Page 1


156. AUKTION MÜNZEN DER SCHWEDISCHEN BESITZUNGEN DIE SAMMLUNG DER FREIHERREN BONDE AUF SCHLOSS ERICSBERG TEIL 4 25. Juni 2009 Steigenberger Hotel Remarque Osnabrück Natruper-Tor-Wall 1 Hotel-Telefon +49 (0)5 41-60 96 633 Hotel-Fax +49 (0)5 41-60 96 634 (nur während der Auktion/only during the auction/ uniquement pendant la vente/solamente durante l'asta/solamente durante la subasta/только во время аукциона)

in Zusammenarbeit mit:

Ulf Nordlind Mynthandel AB Karlavägen 46, Box 5132 102 43 Stockholm Schweden Telefon +46 (0)8 662 62 61 Fax +46 (0)8 661 62 13 info@nordlindsmynt.se www.nordlindsmynt.se

ZEITPLAN AUKTION 156 Donnerstag, den 25. Juni 2009 11.30 Uhr - 13.00 Uhr Nr. 5001 bis Nr. 5200

Detaillierter Zeitplan siehe Seite 5 Besichtigungen siehe Seite 7 Horaire détaillé voir page 5 Exposition des monnaies voir page 7

Detailed timetable view page 5 Viewing of auction good view page 7 Calendario dettagliato veda pagina 5 Esposizione veda pagina 7


Sehr geehrte Kundin, sehr geehrter Kunde und Münzfreund, ich freue mich, daß Sie bereits heute, 4 Wochen vor unserer nächsten Auktion, die neuen Kataloge erhalten haben und wünsche Ihnen viel Freude bei der Lektüre unseres Auktionsangebotes. Wir wurden oft gebeten, den Ablauf einer Auktion etwas näher zu beschreiben, diesem Wunsch kommen wir gerne nach. Am Ende dieses Kataloges finden Sie die Rubrik: “Wie biete ich richtig“, die Ihnen als Ratgeber zur erfolgreichen Teilnahme an unseren Auktionen dienen soll. Sollten Sie darüber hinaus Fragen zum Auktionsablauf haben, helfen wir Ihnen auch gerne persönlich weiter. Die Mitarbeiterinnen unserer Kundenbetreuung stellen wir Ihnen auf der nächsten Seite vor. Mit herzlichen Grüßen aus Osnabrück

Ihr Fritz Rudolf Künker UNSERE ADRESSE OUR ADDRESS

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstr. 23 · 49076 Osnabrück Ust.-Id.-Nr.: DE 256 270 181 Telefon/Phone: Fax: Gebührenfrei: E-Mail: Internet:

+49 (0)5 41-96 20 20 +49 (0)5 41-96 20 222 08 00-58 36 537 service@kuenker.de www.kuenker.de

Montag-Donnerstag Freitag Sonnabend

9.00 - 17.00 Uhr 9.00 - 15.30 Uhr nach Vereinbarung

Außerhalb unserer Geschäftszeit steht unseren Kunden ein automatischer Anrufbeantworter zur Verfügung. Monday-Thursday 9.00 a. m. to 5.00 p. m. Friday 9.00 a. m. to 3.30 p. m. Saturday by prior appointment Answering machine available after opening hours. WWW.KUENKER.DE WWW.KUENKER.COM

Auf unserer Internetseite haben Sie die Möglichkeit • die Abbildungen zu vergrößern • Ihre Gebote direkt abzugeben • die Ergebnisse der Auktionen abzurufen On our website you have the possibility • to zoom all images • to place your bids • to view all auction results

AUKTIONSHOTEL AUCTION LOCATION

Steigenberger Hotel Remarque, Natruper-Tor-Wall 1, 49076 Osnabrück Telefon/Phone: Fax:

2

+49 (0)5 41-60 96 633 +49 (0)5 41-60 96 634

Mitglied im Verband der Deutschen Münzenhändler e. V. Associaton Internationale des Numismates Professionnels (AINP)


UNSERE KUNDENBETREUUNG STEHT IHNEN GERNE ZUR VERFÜGUNG Die Maxime unseres Teams lautet: Nur wenn Sie als Kunde zufrieden sind, sind wir es auch! Geben Sie uns Ihre Auktionsgebote zu treuen Händen, wir sorgen dafür, daß sie korrekt ausgeführt werden. Auch wenn Sie sich von Teilen oder Ihrer gesamten Sammlung trennen möchten, sind wir Ihre ersten Ansprechpartner. Beachten Sie dazu bitte auch die Hinweise für Einlieferer auf der folgenden Seite bzw. im hinteren Teil des Kataloges.

WIR FREUEN UNS AUF IHRE AUKTIONSGEBOTE UND EINLIEFERUNGEN!

Ulrich Künker Leitung Kundenbetreuung ulrich.kuenker@kuenker.de

Marion Künker Deutsch, English marion.kuenker@kuenker.de

Alexandra Elflein English, Français, Italiano alexandra.elflein@kuenker.de

Anastasija Koepsell Russian, Deutsch anastasija.koepsell@kuenker.de

Nadine Zuber Deutsch, English nadine.zuber@kuenker.de

Barbara Westmeyer Deutschsprachige Kundenbetreuung barbara.westmeyer@kuenker.de

Cristina Welzel Italiano, Deutsch, English, Français cristina.welzel@kuenker.de

SO ERREICHEN SIE UNS GEBÜHRENFREI (AUS DEUTSCHLAND) TELEFON FAX INTERNET EMAIL

0800 / 5836537 (0800 / KUENKER) +49 (0) 541/ 96 20 20 +49 (0) 541/ 96 20 222 www.kuenker.de service@kuenker.de

WAS IST ZUR ERFOLGREICHEN AUKTIONSTEILNAHME BESONDERS WICHTIG? • • • • •

Ihr schriftlicher Auftrag sollte möglichst frühzeitig eintreffen, spätestens einen Tag vor der Auktion. Wenn Sie telefonisch an der Auktion teilnehmen möchten, bedarf das unserer vorherigen Genehmigung. Bitte teilen Sie uns diesen Wunsch daher mindestens 48 Stunden vor der Versteigerung mit. Nähere Informationen zum telefonischen Bieten finden Sie auf den folgenden Seiten. Beachten Sie bitte auch die Hinweise „Wie biete ich richtig“ im hinteren Teil des Kataloges. Gerne können Sie Ihre Gebote auch online abgeben. Unter www.kuenker.de bieten wir den gesamten Auktionskatalog online an. Bei Fragen rufen Sie uns an, unsere Kundenbetreuung freut sich auf Ihren Anruf! 3


WICHTIGE HINWEISE FÜR UNSERE EINLIEFERER 1.

Unser Expertenteam garantiert Ihnen eine fachgerechte Bearbeitung der von Ihnen eingelieferten Stücke. 2. Die Schätzpreise werden von uns aufgrund unserer hervorragenden Marktkenntnisse sorgfältig festgelegt. Die Stücke werden zu 80% der im Katalog angegebenen Schätzpreise ausgerufen. Durch diese Regelung werden Sie als Einlieferer geschützt. Für nicht verkaufte Objekte werden keine Gebühren erhoben. 3. Der Standard unserer Kataloge ist von hoher Qualität und findet internationale Anerkennung. Wir haben eine der besten Kundendateien, die es weltweit gibt. 4, Von der individuellen Betreuung unserer Kunden profitieren auch Sie als Einlieferer. 5. Als Einlieferer erhalten Sie Ihren Auktionserlös innerhalb von 45 Tagen nach der Auktion. Sonderregelungen sind nach Absprache möglich. 6. Auf Wunsch kann Ihre Einlieferung bei Ihnen zuhause abgeholt werden. Ab € 2.500,-- Einlieferungssumme übernehmen wir die Kosten, ab € 25.000,-können wir Ihre Einlieferungen unter Umständen und nach Absprache auch an einem vereinbarten Ort persönlich entgegennehmen. Selbstverständlich ist Ihr Versteigerungsgut durch uns versichert. 7. Nicht alle Münzen eignen sich, als Einzelstücke aufgenommen zu werden. Vertrauen Sie auf die Erfahrung unserer Experten, die niedrigpreisige Münzen liebevoll zu interessanten Lots zusammenstellen. 8. Der Schätzwert Ihrer Einlieferung sollte mindestens € 1.000,-- betragen. 9. Ihre Einlieferung wird Ihnen sofort bei Übernahme durch ein Protokoll quittiert. Spätestens fünf Wochen vor der Auktion erhalten Sie eine genaue Auflistung Ihrer Objekte mit den dazugehörenden Katalognummern. 10. Innerhalb einer Woche nach der Auktion erhalten Sie bereits die Ergebnisliste und können alle erzielten Preise feststellen. 11. Profitieren Sie von der Anziehungskraft eines führenden Unternehmens. Bitte wenden Sie sich bei Fragen an unseren Kundenservice unter 05 41 – 96 20 20 oder gebührenfrei unter 08 00-58 36 537. 12. Unsere Verträge für Einlieferungen können Sie unverbindlich anfordern. Haben Sie noch Fragen? Wir freuen uns auf Ihren Anruf. Telefon: 05 41 – 96 20 20 oder gebührenfrei unter 08 00-58 36 537.

RENSEIGNEMENTS IMPORTANTS A L'ATTENTION DES VENDEURS 1.

Notre équipe d’experts garantit une prise en charge compétente des pièces que vous nous confiez. 2. Notre excellente connaissance du marché nous permet de fixer soigneusement les prix estimés. Les pièces seront mises aux enchères à un prix représentant 80% du prix estimé indiqué dans le catalogue. Cette réglementation vous protège en tant que vendeur. Aucuns frais ne seront prélevés sur les pièces invendues. 3. Nos catalogues ont un niveau qualitatif élevé, reconnu au plan international. Nous disposons d’un des meilleurs fichiers clients du monde. 4. En tant que vendeur, vous profiterez vous aussi du suivi personnalisé que nous offrons à nos clients. 5. Le vendeur recevra le produit de la vente dans les 45 jours qui suivront les enchères. Des dispositions spéciales pourront être prises sur accord préalable. 6. Nous prendrons en charge les frais d´expédition des pièces dont le montant sera supérieur à € 2.500,--: Si leur montant est supérieur à € 25.000,--, l´un de nos employés pourra se charger de prendre la livraison à un lieu convenu. A votre demande notre assurance couvrira tous les risques. 7. Les pièces de monnaie ne se prêtent pas toutes à une vente individuelle. Faites confiance à l’expérience de nos spécialistes qui se chargeront avec plaisir de rassembler les pièces bon marché de manière à constituer des lots intéressants. 8. La valeur estimée des pièces fournies devra s’élever à un minimum de € 1.000,--. 9. Au moment de la prise en charge, vous recevrez un détail des pièces fournies. Au plus tard cinq semaines avant la vente aux enchères, vous recevrez une liste exacte de vos pièces avec les numéros de catalogue correspondants. 10. Dans la semaine qui suivra la vente aux enchères, vous recevrez déjà la liste de ses résultats et pourrez prendre connaissance des prix obtenus. 11. Profitez de l’attrait du leader du marché. Pour tout renseignement, veuillez-vous adresser à notre service clientèle: +49 (0)5 41-96 20 20. 12. Vous pouvez demander sans engagement de votre part nos contrats de dépôt de pièces? Vous avez d’autres questions? Nous serons heureux de vous répondre au +49 (0)5 41-96 20 20.

4

IMPORTANT INFORMATION FOR OUR CONSIGNERS 1.

Our team of specialists guarantees an expert treatment of the consigned items. 2. The estimates are carefully established by us due to our excellent knowledge of the market. Bidding for the items is then started at 80 % of the estimate price stated in the catalogue. This arrangement protects you as a consigner. Unsold items incur no fees. 3. The standard offered in our catalogue is of the highest quality, and is recognised internationally. We have one of the best clientele lists worldwide. 4. You as a consigner also profit from the individual consultation offered to our customers. 5. As a consigner, you receive the auction proceeds within 45 days of the close of auction. Special arrangements can be made following discussion. 6. For consignments with a value over € 2.500,-- we may bear the transportation costs. For deliveries over € 25.000,-- we may personally collect the items at an arranged place after prior consultation. Upon consultation, the shipping of your goods could be covered by our insurance. 7. Not all coins are suited to be registered as individual items. Trust in our expert´s experience as they carefully combine less-valuable coins into interesting lots. 8. The valuation price of your delivery should be at least € 1.000,--. 9. Your delivery is confirmed in writing immediately on receipt. At least five weeks before the auction, you receive an exact list of your objects with the relevant catalogue numbers. 10. Within a week of the close of auction, you receive a list with the results in order to see what prices were reached for each individual lot. 11. Profit from our position as a leading coin dealer. If you have any questions, please contact our customer service team on +49 (0)5 41-96 20 20. 12. Would you like to receive copies of our contracts for consigner, without making any commitment? Do you have any other questions? Our customer service team will be pleased to help you – please call on +49 (0)5 41-96 20 20.

INFORMAZIONI PER I NOSTRI DEPOSITANTI 1.

Il nostro team di esperti assicura un trattamento accurato dei pezzi che ci avete inviato. 2. Eseguiamo valutazioni finalizzate alla vendita. I prezzi di stima sono frutto della nostra eccezionale conoscenza del mercato e della nostra attenta valutazione. La base d´asta ammonta all´80% del prezzo di stima indicato sul catalogo. Non si addebitano spese per gli oggetti invenduti. 3. I nostri cataloghi sono di alta qualità e sono riconosciuti a livello internazionale. I nostri clienti sono fra i migliori al mondo. 4. Come depositanti potete beneficiare dell’assistenza riservata a ciascuno dei nostri clienti. 5. Come depositanti riceverete gli importi realizzati all’asta entro 45 giorni dal termine della stessa. Si possono concordare condizioni particolari. 6. A partire da un controvalore degli oggetti di € 2.500,--i costi del trasporto sono a nostro carico, mentre a partire da un controvalore di € 25.000 gli oggetti possono essere ritirati personalmente da un nostro incaricato ad un posto concordato. Naturalmente il trasporto dei vostri oggetti puó essere assicurato tramite la nostra assicurazione. 7. Non tutte le monete possono essere negoziate singolarmente. Fidatevi dell´esperienza dei nostri esperti, che raggruppano le monete non molto preziose in lotti di sicuro interesse. 8. Il valore stimato degli oggetti depositati deve ammontare ad almeno € 1.000,--. 9. Nel momento in cui gli oggetti sono presi in consegna, viene rilasciata una ricevuta numerata. Riceverete un elenco preciso degli oggetti che avete depositato con i relativi numeri di catalogo al massimo cinque settimane prima dell’asta. 10. Riceverete l’elenco degli oggetti aggiudicati entro una settimana dalla chiusura dell’asta. Potrete cosi verificare i prezzi realizzati. 11. Approfittate della capacità di un leader di mercato per aumentare il valore dei vostri oggetti. Se avete delle domande, rimaniamo a vostra disposizione per qualsiasi necessità. Rivolgetevi alla nostra consulenza ai clienti diretta al numero +49 (0)5 41-91 20 20. 12. Volete ricevere i nostri contratti senza impegno? Avete altre domande? Potete contattarci al numero +49 (0)5 41-96 20 20.


DETAILLIERTER ZEITPLAN AUKTIONEN 154-157 AUKTION 154 DER MÜNZSCHATZ VON HERBORN MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT

Dienstag, den 23. Juni 2009 9.30 Uhr - 13.00 Uhr Nr. 1 bis Nr. 655 Der Münzschatz von Herborn, Münzen und Medaillen: Aachen - Mühlhausen in Thüringen 14.00 Uhr - 19.00 Uhr Nr. 656 bis Nr. 1681 Münzen und Medaillen: Münster - Würzburg, Medaillen, Orden, Papiergeld, Lots, Habsburg, Europa: Baltikum - Griechenland

Mittwoch, den 24. Juni 2009 9.30 Uhr - 13.00 Uhr Nr. 1682 bis Nr. 2306 Europa: Großbritannien - Zypern, Übersee, Münzwaagen, Münzgefäße AUKTION 155 1000 GOLDPRÄGUNGEN AUS 3 JAHRTAUSENDEN DEUTSCHE MÜNZEN AB 1871

AUKTION 156 DIE SAMMLUNG DER FREIHERREN BONDE AUKTION 157 RUSSISCHE MÜNZEN UND MEDAILLEN

14.00 Uhr - 19.00 Uhr Nr. 3001 bis Nr. 4000

Donnerstag, den 25. Juni 2009 9.30 Uhr - 11.30 Uhr Nr. 4001 bis Nr. 4532 11.30 Uhr - 13.00 Uhr Nr. 5001 bis Nr. 5200 14.00 Uhr - 19.00 Uhr Nr. 6001 bis Nr. 6628 Rußland: Dmitry Iwanowitsch - Nikolaus I. Freitag, den 26. Juni 2009 9.30 Uhr - 13.00 Uhr Nr. 6629 bis Nr. 7012 Rußland: Alexander II. - Republik, Lots Rußland

5


INHALT AUKTION 156 MÜNZEN DER SCHWEDISCHEN BESITZUNGEN DIE SAMMLUNG DER FREIHERREN BONDE AUF SCHLOSS ERICSBERG TEIL 4

Nr. Münzen der schwedischen Besitzungen südlich der Ostsee

Seite

5001

-

5174

15

-

52

5001

-

5045

15

-

23

Die Stadt Reval (Tallinn)

5001

-

5020

15

-

17

Die Stadt Narva

5021

-

5027

Die Stadt Riga

5028

-

5045

19

-

23

5046

-

5134

24

-

41

Die Stadt Elbing

5046

-

5048

Das Herzogtum Pommern

5049

-

5106

25

-

34

Die Stadt Wolgast

5107

-

5110

34

-

35

Die Stadt Stralsund

5111

-

5125

36

-

38

Das Baltikum

Die polnische und deutsche Ostseeküste

Die Herrschaft Wismar Die Stadt Wismar Die schwedischen Besitzungen in Nordwestdeutschland

18

24

5126

38

5127

-

5134

39

-

41

5135

-

5144

42

-

44

-

Das Herzogtum Bremen und Verden

5135

-

Die Stadt Osnabrück Die schwedischen Besitzungen in Mittel- und Süddeutschland

5143

42

-

5144

43 44

5145

-

5174

44

-

52

Die Stadt Erfurt

5145

-

5161

44

-

48

Das Erzbistum Mainz

5162

-

5165

48

-

49

Das Bistum Würzburg

5166

-

5170

49

-

50

Die Stadt Fürth Die Stadt Augsburg

6

-

5171 5172

-

5174

51 51

-

52


Nr.

Seite

Ein schwedisches 2-Mark-Stück mit einem Gegenstempel der Stadt Straßburg

5175

52

Ein halber Dukat des schwedischen Königs Frederik I. als Landgraf von Hessen

5176

52

Münzen und Medaillen zum Thema Luther und Reformation

5177

-

5182

53

-

54

Prägungen mit Bezug zum Dreißigjährigen Krieg

5183

-

5185

54

-

55

Diverse Medaillen aus der Sammlung der Freiherren Bonde, meist mit Bezug zu Schweden

5186

-

5200

56

-

59

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 155

___________________________

BESICHTIGUNG Besichtigung des Auktionsgutes in unseren Geschäftsräumen, Gutenbergstr. 23, 49076 Osnabrück, ab dem 2. Juni 2009, nach vorheriger telefonischer Vereinbarung unter +49 (0)5 41 96 20 20.

EXPOSITION Les monnaies seront visibles à partir du 2 juin 2009, Gutenbergstr. 23, 49076 Osnabrück, sur rendez-vous téléphonique +49 (0)541 96 20 20.

EXPOSICIÓN Con cita previa +49 (0)541 96 20 20 podrá ver todos los lotes a partir del 2 de Junio del 2009 en nuestras oficinas en 49076 Osnabrück, Gutenbergstr. 23.

ON VIEW The coins are on view at our premises in 49076 Osnabrueck, Gutenbergstr. 23, from June 2, 2009 by prior appointment: +49 (0)541 96 20 20.

ESPOSIZIONE Tutti i lotti sono visionabili a partire dal 2 giugno 2009 presso la nostra sede, Gutenbergstr. 23, 49076 Osnabrück previo appuntamento telefonico +49 (0)541 96 20 20.

ПРОСМОТР АУКЦИОННЫХ ЛОТОВ Просмотр аукционных лотов проходит с 2 июня 2009 года года в нашем офисе по телефонной договоренности +49 (0)541 96 20 20 по адресу: Gutenbergstr. 23, 49076 Osnabrück.

7


WICHTIGE HINWEISE FÜR UNSERE TELEFONBIETER

IMPORTANT INFORMATION ON TELEPHONE BIDDING

Wenn Sie telefonisch mitbieten möchten, bitten wir Sie aus organisatorischen Gründen, uns diesen Wunsch bis spätestens 48 Stunden vor der Versteigerung schriftlich mitzuteilen. Voraussetzung für ein telefonisches Mitbieten ist, daß Sie mindestens den Schätzpreis bieten. Telefonisches Bieten ist erst ab einem Schätzpreis von ca. 500 Euro pro Los möglich.

If you wish to participate in the auction as a telephone bidder, please inform us at least 48 hours in advance as we have to approve and schedule all calls. To register for telephone bidding, we require that you submit at least the estimate as written bid in addition to being called. Telephone bidding is accepted on lot numbers with estimates starting at 500 Euro.

Bitte beachten Sie, daß wir keinerlei Haftung übernehmen, falls die telefonische Verbindung während der Auktion nicht zustande kommt.

We do not assume liability should the telephone line be interrupted or not be achieved.

Sollten Sie Fragen zu der telefonischen Teilnahme an unseren Auktionen haben, können Sie uns vor der Auktion unter +49 (0)5 41-96 20 20 oder 08 00-58 36 537 (gebührenfrei) anrufen. Während der Auktion erreichen Sie uns unter der auf der ersten Seite angegebenen Telefonnummer.

INFORMATIONS POUR LA PARTICIPATION PAR TELEPHONE

Please call +49 (0)5 41-96 20 20 for more information or to register for telephone bidding. During the auction you will be able to reach us at the telephone number indicated on page 1.

INFORMAZIONI PER LA PARTECIPAZIONE TELEFONICA

Si vous désirez participer par téléphone à nos ventes aux enchères, veuillez vous mettre en relation avec Alexandra Elflein au moins 48 heures avant la vente au numéro +49 (0)5 41-96 20 233. Pendant la vente aux enchères nous vous prions d'appeler le numéro indiqué sur page no. 1 de ce catalogue.

Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare la Signora Cristina Welzel al numero diretto +49 (0)5 41-96 20 250 come minimo 48 ore prima dell´asta e di inviarci la vostra offerta, la quale deve ammontare come minimo al prezzo di stima anche per iscritto.

Une participation téléphonique à la vente sera possible à la condition que vous nous fassiez parvenir aussi votre ordre par écrit. Cet ordre devra être au moins égal au minimum au prix d’estimation et concerner un lot estimé au moins 500 Euros.

Accettiamo una partecipazione telefonica in diretta durante l´asta per oggetti il cui prezzo di stima ammonta come minimo ai 500 Euro. Non assumeremo nessuna responsabilità se la linea telefonica è occupata o se non siete raggiungibili.

Nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

INFORMACIONES DE COMO PARTICIPAR POR TELÉFONO Si quiere participar por teléfono en la subasta por favor se ponga en contacto anteriormente con la señora Cristina Welzel +49 (0)5 41-96 20 250 y envienos las pujas tambien por escrito por lo menos 48 oras antes de la subasta. Autorizamos una participación por teléfono solamente para lotes cuyos precio de estima es por lo menos 500 Euro. No asumimos la responsabilidad si la conexión telefónica se interumpa sin previsión o si está comunicando.

8

ВАЖНАЯ ИНФОРМАЦИЯ ДЛЯ УЧАСТИЯ ПО ТЕЛЕФОНУ Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.


AUKTION 156 – SAMMLUNG DER FREIHERREN BONDE BITTE BEACHTEN SIE: Alle Objekte der Auktion 156, Sammlung der Freiherren Bonde, unterliegen gem. § 25 a UStG der Differenzbesteuerung. Für deutsche und ausländische Käufer aus Ländern der Europäischen Union wird auf die Zuschlagssumme ein Aufgeld in Höhe von 22 % erhoben. In diesem Aufgeld ist die gesetzliche Mehrwertsteuer bereits enthalten. Die Mehrwertsteuer wird bei der Rechnungsstellung nicht ausgewiesen. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 18 % auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen bankspesenfreie Zahlung des Kaufpreises in € - Währung. Ausländischen Münzhändlern aus Ländern der Europäischen Union dürfen bei Nachweis der Umsatzsteuer-Identifikationsnummer (§ 27 a UStG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b UStG in Verbindung mit § 6 a UStG auch eine Lieferung ohne Umsatzsteuer verlangen.

PLEASE NOTE: All objects in Auction 156, Bonde Collection, are subject to a differential tax in accordance with § 25 a of the German Turnover Tax Act (UStG). Purchasers from Germany and the European Union Countries (EEC) will pay a surcharge of 22% being levied on the hammer-price. This surcharge includes already statutory VAT (value-added tax = Mehrwertsteuer) on the total difference. VAT is not shown separately on the invoice. Purchasers from abroad will be charged a surcharge of 18 % on the hammer-price, provided the export of the coins is undertaken by the auctioneer. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Dealers from EEC countries (other than Germany) may ask for receiving the goods free of tax upon presentation of their VAT I.D. number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the German Turnover Tax Law.

Haben Sie Fragen zur Differenzbesteuerung im For any questions concerning the differential tax Auktionskataog 156, Samlung der Freiherren in auction 156, Bonde Collection, please contact Bonde, so rufen Sie uns gerne an: us:

GEBÜHRENFREI (AUS DEUTSCHLAND) TELEFON FAX INTERNET EMAIL

0800 / 5836537 (0800 / KUENKER) +49 (0) 541/ 96 20 20 +49 (0) 541/ 96 20 222 www.kuenker.de service@kuenker.de

9


DIE SAMMLUNG DER FREIHERREN BONDE AUF SCHLOSS ERICSBERG &CU5EJNQ­'TKEUDGTI\·JNV\WFGPDGFGWVGPFUVGP$CTQEMDCWVGP5EJYGFGPUWPFDGHKPFGVUKEJKP5ÌFGTOCPNCPF EC  MO UÒFYGUVNKEJ XQP 5VQEMJQNO $CWJGTTGP YCTGP FGT (TGKJGTT 'TKE )[NNGPUVKGTPC   WPF FGUUGP )GOCJNKP $GCVC XQP ;ZMWNN IGUVQTDGP   8QNNGPFGV YWTFG FGT $CW XQP KJTGO 5QJP %JTKUVQHGT )[NNGPUVKGTPC  FGTFGO5EJNQ­UGKPJGWVKIGU#WUUGJGPICD  &KG (COKNKG )[NNGPUVKGTPC JCVVG ITCXKGTGPFG HKPCP\KGNNG 5EJYKGTKIMGKVGP WPF XGTRH·PFGVG \W #PHCPI FGU  ,CJTJWPFGTVU ITQ­G 6GKNG KJTGU )TWPFDGUKV\GU CPFKGXGTOÌIGPFG#FGNUHCOKNKG*KNFGDTCPF5GKVDGHCPFUKEJ'TKEUDGTI KO $GUKV\ XQP &CXKF *GPTKE *KNFGDTCPF   FGUUGP 5QJP &CXKF )QVVJCTF *KNFGDTCPF   GKP NGKFGPUEJCHVNKEJGT 5COONGT YCT WPF CWEJFGP)TWPFUVGKPFGTXQTNKGIGPFGPPWOKUOCVKUEJGP5COONWPINGIVG&CXKF )QVVJCTF *KNFGDTCPF MQPPVG OGJTGTG DGFGWVGPFG 5COONWPIGP MQORNGVV GTYGTDGP WPVGT CPFGTGO FKG EC  /ÒP\GP WPF /GFCKNNGP WOHCUUGPFG 5COONWPIXQP,QPCU0QTP  WPFKO,CJTFKG5COONWPIXQP &CPKGN)GQTI0GUEJGTFGTCWU(WTEJVXQTGKPGTTWUUKUEJGP+PXCUKQPRCPKMCTVKI XGTMCWHVG 0QTP JCVVG GVNKEJG UMCPFKPCXKUEJG 4CTKV·VGP  KP FGT #WMVKQP XQP /CFCK KP *CODWTI GTYGTDGP MÌPPGP 9KG CWU FGT GTJCNVGPGP -QTTGURQPFGP\ GTUKEJVNKEJ KUV PWV\VG FGT RCUUKQPKGTVG 0WOKUOCVKMGT *KNFGDTCPF \CJNTGKEJG -QPVCMVG WO YGKVGTG 1DLGMVG HÒT UGKPG 5COONWPI \W &CXKF)QVVJCTF*KNFGDTCPF IGYKPPGP +PUDGUQPFGTG MQPPVG FGT UEJYGFKUEJG $QVUEJCHVUUGMTGV·T WPF *QHLWPMGT KP 5V 2GVGTUDWTI ,QJCP ,GPPKPIU  GKPG UVCVVNKEJG 5GTKG XQP TWUUKUEJGP /GFCKNNGP CWH FKG -TKGIUGTHQNIG<CT2GVGTUFGU)TQ­GPXGTOKVVGNPFKGPWPņOGJTCNU\YGK,CJTJWPFGTVGUR·VGTņYKGFGTKPFGP PWOKUOCVKUEJGP-TGKUNCWH\WTÒEMHNKG­GP  10


 

0CEJ FGO 6QF FGU MKPFGTNQUGP &CXKF )QVVJCTF *KNFGDTCPF GTDVG UGKP 0GHHG (TGKJGTT %CTN %CTNUUQP $QPFG   'TKEUDGTI WPF FKG 5COONWPIGP 5QYQJN %CTN %CTNUUQP $QPFG CNU CWEJ FKG 8GTVTGVGT FGT P·EJUVGP FTGK )GPGTCVKQPGP %CTN ,GFXCTF $QPFG   %CTN %CTNUUQP$QPFGFGT,ÒPIGTG  WPF%CTN)QVVJCTF$QPFG    RHNGIVGP WPF GTYGKVGTVGP FKG PWOKUOCVKUEJG 5COONWPI CWH 5EJNQ­ 'TKEUDGTIDGVT·EJVNKEJFKGCWEJFGO4GKEJUCPVKSWCT$TQT'OKN*KNFGDTCPF

PKEJV OKV FGP DGTGKVU GTY·JPVGP *KNFGDTCPFU XGTYCPFV  HÒT UGKP 5VCPFCTFYGTM ÒDGT FKG MÌPKINKEJ UEJYGFKUEJGP /GFCKNNGP CNU )TWPFNCIG FKGPVG FQTVUKPFFKGOGKUVGP/GFCKNNGPXQP5EJNQ­'TKEUDGTIOKV#PICDG FGU5VCPFQTVGUXGT\GKEJPGV    &GT GPVJWUKCUVKUEJUVG 0WOKUOCVKMGT CWU FGT (COKNKG $QPFG YCT YQJN FGT \WNGV\V IGPCPPVG %CTN )QVVJCTF FGT FGP 7OHCPI FGT 5COONWPI CWH HCUV 1DLGMVGCWUDCWVGWPFFCOKVDGKPCJGXGTFQRRGNVG'TXGTHCUUVGCWEJ %CTN,GFXCTF$QPFG PWOKUOCVKUEJG(CEJCTVKMGNWPFYCT/KVINKGFKPFGT5EJYGFKUEJGP0WOKU OCVKUEJGP)GUGNNUEJCHV 5XGPUMC0WOKUOCVKUMC(ÌTGPKPIGP    

     %CTN%CTNUUQP$QPFGFGT,ÒPIGTG %CTN)QVVJCTF$QPFG     #WEJPCEJUGKPGO6QFJKGNVFKG(COKNKG$QPFGFKG5COONWPI\WI·PINKEJHÒTFKGPWOKUOCVKUEJG(QTUEJWPI 'UKUVFGTCWUFTÒEMNKEJG9WPUEJFGT(COKNKGFCUUUKEJPWPCPFGTG5COONGTCPFGPPWOKUOCVKUEJGP<GWIGP FGTUEJYGFKUEJGPWPFGWTQR·KUEJGP)GUEJKEJVGGTHTGWGPMÌPPGP    5WOOCT[ 'TKEUDGTIRCNCEGQPGQH5YGFGPʼnUHQTGOQUVDCTQSWGDWKNFKPIUKUUKVWCVGFKPVJGRCTKUJQH5VQTC/CNOKPVJG EQWPV[ QH 5ÌFGTOCPNCPF VYQ JQWTU FTKXG HTQO 5VQEMJQNO  (TQO  'TKEUDGTI YCU QYPGF D[ &CXKF *GPTKE*KNFGDTCPF  YJQECOGVQDGXGT[YGCNVJ[CPFCESWKTGFCITGCVPWODGTQHEQWPVT[GUVCVGU *G OCFG 'TKEUDGTI CP GPVCKNGF GUVCVG YJKEJ NCVGT RCUUGF QP VQ JKU UQP &CXKF )QVVJCTF *KNFGDTCPF   *GYCUWPOCTTKGFCPF'TKEUDGTIHWTVJGTRCUUGFQPVQJKUPGRJGYDCTQP%CTN%CTNUUQP$QPFG   +VJCUTGOCKPGFKPVJGRQUUGUUKQPQHVJG$QPFGHCOKN[GXGTUKPEG

11


(ยค414&





(รŒTGNKIICPFG CWMVKQPUMCVCNQI WVIรŒTU CX FG MXCTXCTCPFG UXGPUMC   DGUKVVPKPIUO[PVGP WT GP CX 5XGTKIGU HรŒTPยทOUVC RTKXCVC O[PV QEJ   OGFCNLUCONKPICTล†5CONKPI$QPFGRยน'TKEUDGTIUUNQVV8ยนTHKTOC7NH 0QTFNKPF/[PVJCPFGN#$JCTJKVVKNNUHรŒTUยนNVFGNCTWTFGP$QPFGUMC UCONKPIGP &GN  UQO WVILQTFGU CX GPDCTV OGFCNLGT IGPQOHรŒTFGU   VKNNUCOOCPUOGF(TKV\4WFQNH-ร’PMGT)OD*%Q-)K1UPCDTร’EM  QMVQDGT  &GPPC HรŒTUยทNLPKPI TรŒPVG GP O[EMGV UVQT WRROยทTM    UCOJGV XยทPF UQO FGP XCT OQV GP KPVGTPCVKQPGNN RWDNKM QEJ ICX GVV   O[EMGV KORQPGTCPFG TGUWNVCV &GV ยทT FยทTHรŒT O[EMGV INยทFLCPFG QEJ    PCVWTNKIV HรŒT QUU CVV ยทP GP IยนPI IGPQOHรŒTC GP CWMVKQP TKMVCF VKNN GP    NKMPCPFG RWDNKM K UCOCTDGVG OGF 'WTQRCU NGFCPFG CWMVKQPUJWU Rยน   O[PVQEJOGFCNLGTHKTOC(TKV\4WFQNH-ร’PMGT  $NCPFFGMXCTXCTCPFGUXGPUMCDGUKVVPKPIUO[PVGPKFGPPCUCONKPIHKPPU HNGTCUยทNNU[PVCQDLGMVQEJXยนTHรŒTJQRRPKPIยทTCVVCNNCUCONCTGRยนFGVVC QOTยนFGMQOOGTCVVHKPPCPยนIQVCXKPVTGUUG 

-CVCNQIGPJCTHรŒTHCVVCVUCX#PFTGCU-CKUGTQEJ/CPWGNC9GKยญUQORยน XCPNKIVUยทVVNCIVPGTGVVUVQTVCTDGVGRยนDGUMTKXPKPICTPCOGFUGFXCPNKI PQIITCPPJGVHรŒTXKNMGVJยทTOGFHTCOHรŒTUGVVUVQTVVCEM(รŒTHCMVCITCPUMPKPIQEJJKUVQTKUMCVGZVGTVCEMCU QEMUยน HรŒTTG EJGHGP HรŒT -WPIN /[PVMCDKPGVVGV .CTU 1 .CIGTSXKUV UCOV TรŒTCPFG 9KUOCTU RNยนVO[PV   6QTDLรŒTP5WPFSWKUV*KUVQTKUMCX[GTJCTHQVQITCHGTCVUCX)CDTKGN*KNFGDTCPFQEJIGPGTรŒUVUVยทNNVUVKNNXยนTV HรŒTHQICPFGCX/CVU2GVGTUUQP %GPVTCNCPVKMXCTKCVGVK5VQEMJQNO UCOV,WNKWU*CICPFGT$CUGN   &GUXGPUMCDGUKVVPKPIUO[PVGPUJKUVQTKCยทTKPVTGUUCPVQEJQHVCDQTVINรŒOF&GHรŒTUVCJรŒTJGOOCK4GXCN

6CNNKPP HTยนPQEJOGTCQOHCVVCPFGQEJURTKFFDNKTFGHรŒTUVHTยนPQEJFGHรŒNLCPFGยนTGPWPFGT FGPCX)WUVCX++#FQNHNGFFCGZRCPUKQPGP.CPFGVUUVQTOCMVUVKFVQIUNWVTGFCPOGF-CTN:++UFรŒF QEJFGHยนยนVGTUVยนGPFGQOTยนFGPCRTยทINCFGDCTCVKFXKUGIPCO[PVFGVUKUVC   #XUNWVPKPIUXKU XKNN LCI QEJ OKP MQORCPLQP *CPU *KTUEJ ยทP GP IยนPI VCEMC XยนT MQNNGIC (TKV\ 4WFQNH    -ร’PMGTHรŒTFGVVCยนVGTKIGPUยนXยทPUMCRUHWNNCQEJGHHGMVKXCUCOCTDGVGVKNNINยทFLGQEJP[VVCHรŒTXยนTCMWPFGT  5VQEMJQNOKCRTKN   7NH0QTFNKPF

12


8149146 &GT XQTNKGIGPFG #WMVKQPUMCVCNQI DGKPJCNVGV FKG PQEJ XQTJCPFGPGP /ÒP\GP FGT UEJYGFKUEJGP    $GUKV\WPIGPCWUGKPGTFGTDGFGWVGPFUVGP/ÒP\WPF/GFCKNNGPUCOONWPIGP5EJYGFGPUFGT5COONWPI $QPFG CWH 5EJNQ­ 'TKEUDGTI 7PUGTG (KTOC 7NH 0QTFNKPF /[PVJCPFGN #$ JCV DKUJGT  6GKNG CWU FGT    5COONWPI$QPFGXGT·W­GTV&GT6GKNJCWRVU·EJNKEJ/GFCKNNGPYWTFGIGOGKPUCOOKVFGT(KTOC(TKV\ 4WFQNH-ÒPMGT)OD*%Q-)CO1MVQDGTKP1UPCDTÒEMXGTUVGKIGTV&KGUGT#WMVKQPYWTFG GKPG CW­GTQTFGPVNKEJ ITQ­G #WHOGTMUCOMGKV \WVGKN UKG YCT CWH GKP KPVGTPCVKQPCNGU 2WDNKMWO    \WIGUEJPKVVGP WPF GT\KGNVG GKP UGJT DGGKPFTWEMGPFGU 'TIGDPKU 'U KUV HÒT WPU FCJGT GKPG NQIKUEJG    -QPUGSWGP\GTPGWVGKPGHÒTGKPGPKPVGTPCVKQPCNGP-WPFGPMTGKUKPVGTGUUCPVG#WMVKQPKP<WUCOOGPCTDGKV OKV 'WTQRCU HÒJTGPFGO #WMVKQPUJCWU HÒT /ÒP\GP WPF /GFCKNNGP FGT (KTOC (TKV\ 4WFQNH -ÒPMGT    FWTEJ\WHÒJTGP   7PVGTFGPUEJYGFKUEJGP$GUKV\WPIUOÒP\GPKPFKGUGO-CVCNQIDGHKPFGPUKEJOGJTGTG5GNVGPJGKVGPWPF YKT JQHHGP FC­ CNNG 5COONGT KPVGTGUUCPVG 1DLGMVG HKPFGP YGTFGP &GT -CVCNQI YWTFG XQP #PFTGCU    -CKUGTWPF/CPWGNC9GK­XGTHC­VFGPGPYKGÒDNKEJHÒTKJTG5QTIHCNVDGKFGP$GUEJTGKDWPIGP\WFCPMGP KUV (ÒT JKUVQTKUEJG 6GZVG WPF *KPVGTITWPFKPHQTOCVKQPGP DGFCPMGP YKT WPU CWEJ DGK FGO GJGOCNKIGP    .GKVGTFGU/ÒP\MCDKPGVVUKP5VQEMJQNO.CTU1.CIGTSXKUVUQYKGDGK6QTDLÌTP5WPFSWKUVHÒT#PICDGP \W FGP 9KUOCTGT -WRHGTRNCVVGP &KG JKUVQTKUEJGP 5VCFVCPUKEJVGP YWTFGP XQP )CDTKGN *KNFGDTCPF    HQVQITCHKGTVWPFITQ­\ÒIKI\WT8GTHÒIWPIIGUVGNNVXQP/CVU2GVGTUUQP %GPVTCNCPVKMXCTKCVGV5VQEMJQNO  WPFXQP,WNKWU*CICPFGT$CUGN   &KG)GUEJKEJVGFGTUEJYGFKUEJGP$GUKV\WPIUOÒP\GPKUVKPVGTGUUCPVWPFXKGNHCEJ\WYGPKIDGCEJVGV&KG GTUVGP5VÒEMGYWTFGPKP4GXCNIGRT·IVKPITÌ­GTGO7OHCPIYWTFGP$GUKV\WPIUOÒP\GPLGFQEJGTUV UGKV  WPF FGP HQNIGPFGP ,CJTGP KO <WUCOOGPJCPI OKV FGT XQP )WUVCX ++ #FQNH IGHÒJTVGP    UEJYGFKUEJGP'ZRCPUKQPJGTIGUVGNNV&KGUEJYGFKUEJG)TQ­OCEJVU\GKVGPFGVGDGTGKVUOKVFGO6QF-CTNU :++ XQT FGT PQTYGIKUEJGP (GUVWPI (TGFGTKMUUVGP WPF FKG YGPKIGP ÒDTKIIGDNKGDGPGP $GUKV\WPIGP    RT·IVGPPWTURQTCFKUEJGKIGPG/ÒP\GP\WNGV\V   5EJNKG­NKEJ YQNNGP OGKP 2CTVPGT *CPU *KTUEJ WPF KEJ PQEJ GKPOCN WPUGTGO -QNNGIGP (TKV\ 4WFQNH    -ÒPMGT HÒT FKG YKGFGTWO HTGWPFUEJCHVNKEJG WPF GHHGMVKXG <WUCOOGPCTDGKV KO &KGPUVG WPUGTGT -WPFGP    FCPMGP   5VQEMJQNOKO#RTKN   7NH0QTFNKPF

13


&KG/テ単\UVツキVVGP5EJYGFGPUWPFUGKPGT$GUKV\WPIGP

14


REVAL

/ª0<'0&'45%*9'&+5%*'0$'5+6<70)'0 5ª&.+%*&'41565'' &#5$#.6+-7/

&+'56#&64'8#. 6#..+00  5GKVFGO,CJTJWPFGTVIGJÌTVG'UVNCPF\WO&GWVUEJGP1TFGP9GIGPFGT$GFTQJWPIFWTEJFGPGT QDGTWPIUNWUVKIGP TWUUKUEJGP <CTGP +YCP FGO 5EJTGEMNKEJGP WPVGTYCTH UKEJ 4GXCN  5EJYGFGP WPF   FGUUGP -ÌPKI 'TKM :+8   &KG /ÒP\RT·IWPI HQNIVG KP 4GXCN FGO GKPJGKOKUEJGP /ÒP\HW­  

4GXCN/CTM  CWEJ WPVGT FGO HQNIGPFGP -ÌPKI ,QJCPP+++  9·JTGPFFGT4GIKGTWPIXQP UGKPGO5QJP5KIKUOWPF+++YWTFGFGTUEJYGFKUEJG/ÒP\HW­GKPIGHÒJTV5KIKUOWPFYWTFG'PFG FGU,CJTJWPFGTVUKP5EJYGFGPCDIGUGV\V GTDNKGD-ÌPKIXQP2QNGPDKU\WUGKPGO6QF YCU\W NCPIYKGTKIGPMTKGIGTKUEJGP#WUGKPCPFGTUGV\WPIGPHÒJTVG$KUYCTFKG/ÒP\RT·IWPIKP4GXCN\GKV YGKUG UGJT WOHCPITGKEJ UQYQJNKP)QNFCNUCWEJKP5KNDGT FCPCEJJÌTVGUKGLGFQEJCWH4W­NCPFGT QDGTVG 4GXCN WPF 'UVNCPF  YCU FWTEJ 5EJYGFGP KO (TKGFGP XQP 0[UVCF  CPGTMCPPV YWTFG    5GFCPVCNGVN[FFG'UVNCPFWPFGT6[UMC1TFGP/CPM·PFGUKIJQVCFCXFGPGTÌXTKPIUN[UVPGT[UMG VUCTGP +XCP FGP HÌTUMT·EMNKIG QEJ ICX UKI F·THÌT  WPFGT 5XGTKIG QEJ FGUU MWPI 'TKM :+8     &GPO[PVPKPIUQO·IFGTWOK4GXCNHQTVUCVVGGHVGTKPJGOUMO[PVHQV 4GXCNOCTM QEJU¹·XGP WPFGTGHVGTVT·FCTGPJCNXDTQFGTP,QJCP+++  7PFGTFGPUKUVP·OPFGUUQP5KIKUOWPFKPHÌTFGU UXGPUM O[PVHQV   &GPPG DNGX CXUCVV JCP FQI HÌTUV  UQO MWPI CX 2QNGP  XKNMGV NGFFG VKNN   N¹PIXCTKIC MTKI (TCO VKNN  XCT O[PVPKPIGP VKFXKU QOHCVVCPFG U¹X·N K IWNF UQO UKNXGT OGP FGP   WRRJÌTFGF·TGHVGT4[UUNCPFGTÌXTCFG4GXCNQEJ'UVNCPFQEJFGVVCGTM·PFGUCX5XGTKIGXKFHTGFGPK 0[UVCF

5001

  

5002

5003

'TKM:+8/CTM (GTFKPI #JNUVTÌO0GWOCPPC 5GJTUEJÌP /CTM (GTFKPI #JNUVTÌOC0GWOCPPC 2T·IGUEJY·EJGUGJTUEJÌP /CTM (GTFKPI #JNUVTÌO0GWOCPPD 5GJTUEJÌP

   15


REVAL

5004

1,5:1

5004



2HGPPKI#JNUVTÌO :4 0GWOCPP

4-N4CPFCWUDTWEJGVYCUMQTTQFKGTVUGJTUEJÌP





 /CTM (GTFKPI    8CTKCPVGP    8CTKCPVGP    8CTKCPVGP  5QNKFWU 5EJKNNKPI      8CTKCPVGP  Q ,   8CTKCPVGP    8CTKCPVGP    8CTKCPVGP  #JNUVTÌO  C  

Z  4 CD 4  Z  Z  Z  Z C Z  Z   5VÒEMZIGNQEJV 5EJKNNKPIQ, UEJÌPpUGJTUEJÌP





,QJCP+++5QNKFWU 5EJKNNKPI Q,OKV/ÒP\OGKUVGT\GKEJGP“ Z WPFL Z #JNUVTÌO C Z WPFD Z  5VÒEM5EJÌPpUGJTUEJÌP





)WUVCX++#FQNH¤TG#JNUVTÌODCF  5VÒEM'VYCUMQTTQFKGTVUEJÌPpUGJTUEJÌP





%JTKUVKPC¤TG Z  Z  Z #JNUVTÌO Z  Z  Z   5VÒEM5EJÌPpUGJTUEJÌP



1,5:1

5009



-CTN :+  4GKEJUVCNGT   I -TGW\TQUGVVG  /10'6# Û 018# Û #4) Ù   %+8+6#6+5Û4'8#.+'05Ù$GJGNOVGU9CRRGPXQP4GXCN -TGW\TQUGVVG %#41.85Û&Ù)Ù58'Ù )16* Ù 9#0 Ù 3 Ù 4': Û '6 Û 24 Ù *“ Ù )GJCTPKUEJVGU $TWUVDKNF N OKV .QTDGGTMTCP\ WPF   WOIGNGIVGO/CPVGN#JNUVTÌO FKGUGU'ZGORNCTFQTVCNU7PKMWODG\GKEJPGV &CXp*CICPFGT 0GWOCPP FKGUGU'ZGORNCT   8QPCNNGTITÌ­VGT5GNVGPJGKV7PKMWO#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI  'TYQTDGPXQT

16


REVAL

5010



/CTMQ,  I#JNUVTÌO :4 0GWOCPP  8QPITÌ­VGT5GNVGPJGKV5VCTMMQTTQFKGTVGUIGTKPIGTJCNVGPGU(WPFGZGORNCT



'TYQTDGPCOHÒTUEJYGFKUEJG-TQPGP

5011

   

5012

5014

5013

¤TG#JNUVTÌOC0GWOCPP ¤TG#JNUVTÌO 4 0GWOCPP ¤TG#JNUVTÌO0GWOCPP ¤TG#JNUVTÌO0GWOCPP

5GJTUEJÌP 4-TCV\GTUGJTUEJÌP (CUVUGJTUEJÌP -N&QRRGNUEJNCIUGJTUEJÌP

   

5015 5017

5016

  

¤TG#JNUVTÌO 4 0GWOCPP ¤TG#JNUVTÌO0GWOCPP ¤TG#JNUVTÌO0GWOCPP

5018

4-N<CKPGPFGGVYCUMQTTQFKGTVHCUVUGJTUEJÌP 5GJTUEJÌP -N4CPFHGJNGTUGJTUEJÌP

  

5019

 

¤TG#JNUVTÌOC0GWOCPPC ¤TG#JNUVTÌO0GWOCPP

5GJTUEJÌP 5GJTUEJÌP



 ¤TG   ¤TG    8CTKCPVGP    8CTKCPVGP    ¤TG      8CTKCPVGP  8CTKCPVGP #JNUVTÌO Z  Z  DC Z  5VÒEM5EJÌPpUGJTUEJÌP

 

 17


NARVA

&+'56#&60#48# &KG 5VCFV 0CTXC NKGIV KO PQTFÌUVNKEJGP 'UVNCPF CP FGT )TGP\G \W +PIGTOCPNCPF LGV\V 4W­NCPF  'KPG   GKIGPG/ÒP\RT·IWPIPCEJUEJYGFKUEJGO/ÒP\HW­HCPFXQPDKUUVCVVFCDGKJCPFGNVGGUUKEJņ XQPFGPUGNVGPGP&WMCVGPCDIGUGJGPņWOWPF¤TG5VÒEMG0CTXCYQ-CTN:++KO,CJT UGKPGPDGFGWVGPFUVGP5KGIKO0QTFKUEJGP-TKGIGT\KGNGPMQPPVGYWTFGXKGT,CJTGUR·VGTXQPFGP 4WUUGPGTQDGTVWPFKO(TKGFGPXQP0[UVCFņYKGFKGÒDTKIGPDCNVKUEJGP2TQXKP\GPņXQP5EJYG FGPCP4W­NCPFCDIGVTGVGP   5VCFGP 0CTXC NKIIGT K PQTFÌUVTC 'UVNCPF P·TC +PIGTOCPNCPF PWOGTC 4[UUNCPF  'IGP O[PVPKPI GHVGT   UXGPUM O[PVHQV ·IFG TWO  HT¹PUGVV U·NNU[PVC FWMCVGT  GPFCUV   QEJ  TWPFUVÒEM    ÌTG  0CTXC F·T -CTN :++ XWPPKV UKP N[UCPFG UGIGT  GTÌXTCFGU H[TC ¹T UGPCTG CX T[UUCTPC QEJ   CXVT·FFGUņNKMUQOFGÌXTKICDCNVKUMCRTQXKPUGTPCņXKFHTGFGP

5021

5022



-CTN:+¤TG#JNUVTÌOD0GWOCPP



¤TG#JNUVTÌOD0GWOCPP

5023

5024



¤TG#JNUVTÌOD 4 0GWOCPP



(CUVUGJTUEJÌP



9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



5025

5026

-N<CKPGPFGWPF)TCHKVVQHCUVUGJTUEJÌP



¤TG#JNUVTÌOC0GWOCPP

5GJTUEJÌP





¤TG#JNUVTÌOC0GWOCPP

(CUVUGJTUEJÌP





¤TG#JNUVTÌOC0GWOCPP

(CUVUGJTUEJÌP





¤TG 8CTKCPVGP ¤TG 8CTKCPVGP ¤TG#JNUVTÌOEDC Z  DC 5VÒEMZIGNQEJVUEJÌPpUGJTUEJÌP

18




RIGA

&+'56#&64+)# &KG5VCFV4KICWPFKJTG7OIGDWPIIGJÌTVGNCPIG\WO&GWVUEJGP1TFGPWPFYCTHÒTMWT\G<GKVUGNDUV UV·PFKI DKU 2QNGP FKG /CEJV ÒDGTPCJO #NU YKEJVKIGT $CWUVGKP DGK FGT #WUDKNFWPI FGT UEJYGFKUEJGP   )TQ­OCEJVUVGNNWPI KO 1UVUGGTCWO GTQDGTVG )WUVCX ++ #FQNH KO ,CJT  FKG UVTCVGIKUEJ DGFGWVGPFG   5VCFV&KG5VCFVFKGUGKVFGO,CJTJWPFGTVFCU/ÒP\TGEJVDGUC­RT·IVGPWPPCEJFGOGKPJGKOKUEJGP /ÒP\HW­)QNFWPF5KNDGTOÒP\GPOKVFGO6KVGNFGUUEJYGFKUEJGP-ÌPKIU)TQ­GPTIGTTKGHGPFCDGK FKG PKGFTKIUVGP 0QOKPCNG JGTXQT PCOGPVNKEJ FKG UGJT IGTKPIJCNVKIGP WPF OKPFGTYGTVKIGP 5EJKNNKPIG  

5QNKFK &KGUGT7POWVDGKFGP0CEJDCTN·PFGTPDGUQPFGTUKP2QNGPYWTFGPQEJFCFWTEJIGUVGKIGTVFC­ FKGUEJYGFKUEJG4GIKGTWPI\WT*GTUVGNNWPIFGTMNGKPGP/ÒP\UQTVGPHÒT.KXNCPFGKPPGWGU/ÒP\YGTMKP 4KIC GTÌHHPGVG 8QP  DKU  YWTFGP FQTV NGFKINKEJ &TGKRÌNEJGT WPF 5EJKNNKPIG OKV PKGFTKIGO   5KNDGTIGJCNV JGTIGUVGNNV &KG WOHCPITGKEJG (·NUEJWPI FKGUGT 5QTVGP FWTEJ FKG /ÒP\UV·VVG XQP 5WEGCXC  

/QNFCWJGWVG4WO·PKGP \YCPIFKG5EJYGFGP\WT'KPUVGNNWPIFGT5EJKNNKPIRTQFWMVKQPKP4KIC+PFGT 4KICGT/ÒP\UV·VVGYWTFGP)QNFWPF5KNDGTOÒP\GPDKUIGRT·IVFCPCEJYKGFGTWO\W$GIKPPFGU  ,CJTJWPFGTVU HÒT -CTN :++ +O ,CJT  YWTFG 4KIC XQP FGP 4WUUGP GTQDGTV /KV FGT HQTOGNNGP   #DVTGVWPI 4KICU CP 4W­NCPF KO (TKGFGP XQP 0[UVCF  JCVVG <CT 2GVGT + GKPGU UGKPGT YKEJVKIUVGP   -TKGIU\KGNGGTTGKEJV   5VCFGP QEJ QOT¹FGV JÌTFG N·PIG WPFGT 6[UMC 1TFGP QEJ WRRNGXFG UGFCP GP MQTV UL·NXUV·PFKIJGV KPPCP   2QNGPÌXGTVQIFGO&GPUXGPUMCIT[GPFGUVQTOCMVGPGTÌXTCFGWPFGTDGH·NCX)WUVCX++#FQNHFGP XKMVKICUVCFGP/[PVT·VVGPHT¹PVCNGVDKDGJÌNNUNKMUQOFGPKPJGOUMCO[PVT·MPKPIGP5VCFGPRT·I NCFG K UXGPUMC MWPIGPU PCOP O[PV K U¹X·N IWNF UQO UKNXGT (ÌTCTIGNUG X·EMVG FG N·IUVC XCNÌTGTPC K   U[PPGTJGV UEJKNNKPICTPC UQNKFWU  UQO XCT O[EMGV N¹IJCNVKIC (ÌT CVV ÌMC R¹ FGV DGUX·T FGVVC QTUCMCFG   ITCPPN·PFGTPCKU[PPGTJGV2QNGPÌRRPCFGFGPUXGPUMCTGIGTKPIGPGVVGIGVO[PVXGTMK4KICXCTUO[PV U·IUXCTCUNCIPCHÌT.KXNCPF&GVXCTDCTCFTGKRÌNEJGTQEJUEJKNNKPICTCXN¹IUKNXGTJCNV  &G QOHCVVCPFG O[PVHÌTHCNUMPKPIGTPC UQO J·TUMCTGP K 5WEGCXC PWXCTCPFG 4WO·PKGP  DGFTGX VXKPICFG   UXGPUMCTPCCVVWRRJÌTCOGFXGTMUCOJGVGP+UVCFGPUO[PVXGTMRT·INCFGUO[PVKIWNFQEJUKNXGTHÌTCNNC UXGPUMCOQPCTMGTVQOXCTGHVGTGPN·PITGRCWUHÌNLFG+DÌTLCPCXVCNGVUNQIUO[PVHÌT-CTN :++4KICKPVQIUCXT[UUCTPCQEJCXVT·FFGUHQTOGNNV6UCT2GVGTJCFGP¹VVUKVVO¹N

5028



)WUVCX++#FQNH4GKEJUVCNGT&KG4ÒEMUGKVGPWOUEJTKHVGPFGVOKV8#0#JNUVTÌO &CX*CICPFGTXCT0GWOCPP 4-N*GPMGNURWTOKPDGTKGDGPUGJTUEJÌP  19


RIGA

5029



4GKEJUVCNGT  &KG 4ÒEMUGKVGPWOUEJTKHV GPFGV OKV 8# #JNUVTÌO  &CX  *CICPFGT    0GWOCPP 4(CUUWPIUURWTGP4ÒEMUGKVGCNVXGTIQNFGV(GNFGTNGKEJVDGCTDGKVGVUGJTUEJÌP



'TYQTDGPXQT

5030

5030 1,5:1



4GKEJUVCNGTI5VCFVYCRRGPXQP\YGK.ÌYGPIGJCNVGP\WFGP5GKVGPFKGIGVGKNVG,CJTGU \CJN QDGP \YKUEJGP FGP 6ÒTOGP -TGW\ ÒDGT IGMTGW\VGP 5EJNÒUUGNP WPVGP KO 6QTDQIGP .ÌYGPMQRH   \YKUEJGP /  9 /CTVKP 9WNHH /ÒP\OGKUVGT KP 4KIC  )GMTÌPVGU WPF IGJCTPKUEJVGU   $TWUVDKNF T KP FGT .KPMGP 4GKEJUCRHGN OKV FGT 4GEJVGP FCU 5EJYGTV UEJWNVGTPF #JNUVTÌO  :4    0GWOCPP 8QPITQ­GT5GNVGPJGKV.GKEJVG(GKNURWTGPCO4CPFUGJTUEJÌP  'TYQTDGPHÒTUEJYGFKUEJG-TQPGP



6CNGT 8CTKCPVGP  8CTKCPVGP 5EJKNNKPI 4 5QNKFWU 5EJKNNKPI   8CTKCPVGP  8CTKCPVGP #JNUVTÌO Z  Z  4   Z  Z  5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP

5032



5032 1,5:1



%JTKUVKPC&WMCVGPI5VCFVYCRRGPXQP\YGK.ÌYGPIGJCNVGPQDGP$NWOGP UEJOWEMWPVGP-CTVWUEJGOKVFGT,CJTGU\CJN\WFGP5GKVGPFKGIGVGKNVG5KIPCVWT*9 *GKPTKEJ 9WNHH /ÒP\OGKUVGT KP 4KIC  )GMTÌPVGU $TWUVDKNF KP 5RKV\GPMNGKF T #JNUVTÌO  4    (D*CICPFGT0GWOCPP )1.&44 9KP\5EJTÌVNKPIUHGJNGTWPF-TCV\GTFGPPQEJCVVTCMVKXGU'ZGORNCTHCUVXQT\ÒINKEJXQT\ÒINKEJ  'TYQTDGPXQT

20


RIGA

5033

5033

1,5:1



4GKEJUVCNGT  &KG 8QTFGTUGKVGPWOUEJTKHV GPFGV OKV 4+)'05+5 #JNUVTÌO  &CX  #   *CICPFGT0GWOCPP  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPI5EJTÌVNKPIUHGJNGTCWHFGT4ÒEMUGKVGUGJTUEJÌP  'TYQTDGPHÒTUEJYGFKUEJG-TQPGP

5034



4GKEJUVCNGT&KG8QTFGTUGKVGPWOUEJTKHVGPFGVOKV4+)'0#JNUVTÌO&CX*CICPFGTXCT 0GWOCPP 44(CUUWPIUURWTGP(GNFGTDGCTDGKVGVUGJTUEJÌP



5035

5035

1,5:1



4GKEJUVCNGT#JNUVTÌO&CX*CICPFGT0GWOCPP  449KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI





&KXGTUG5QNKFK 5EJKNNKPIG FGT5VCFV4KICWPFFGU*GT\QIVWOU.KXNCPF  %C5VÒEM5EJÌPpUGJTUEJÌPWPFUGJTUEJÌP

 21


RIGA

1,5:1

5037



-CTN : )WUVCX   &WMCVGP    CWH UGKPG -TÌPWPI \WO UEJYGFKUEJGP -ÌPKI   I':#84'1Ù51.+&1Ù%+8+6#6+5Ü4+)'05+5/'(+'4+('%+6b5VCFVCPUKEJVXQP4KIC OKV5EJKHHGPCWHFGT&ÒPCQDGPCWH9QNMGPJCNVGP\YGK.ÌYGPFGP9CRRGPUEJKNFXQP4KICFCTÒDGT \YGK'PIGNOKV-TCP\%#41.85)856#875Û:Û&Ù)Ù58'%Ù)16*Ù8#Ù4':Û)GMTÌPVGU WPF IGJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN CO #TOCDUEJPKVV FKG ,CJTGU\CJN ÛÛ   FCPGDGPFKG5KIPCVWT5& 5VGORGNUEJPGKFGT5GDCUVKCP&CFNGT #JNUVTÌOC(D*CICPFGT /CW¾0GWOCPP5#PO9KGEGM )1.&8QPITÌ­VGT5GNVGPJGKV 9KP\4CPFHGJNGTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT)QNFVÌPWPI  'TYQTDGPCOHÒTUEJYGFKUEJG-TQPGP



-WTKQUGTYGKUG KUV FGO JGTXQTTCIGPFGP $CTQEMUVGORGNUEJPGKFGT 5GDCUVKCP &CFNGT DGK FGT ,CJTGU\CJN FKGUGT RTCEJV   XQNNGP*WNFKIWPIUOÒP\GGKP(GJNGTWPVGTNCWHGP#WHFGO5VÒEMKUVCPUVCVV MQTTGMV \WNGUGP 



&KXGTUG5QNKFK 5EJKNNKPIG FGT5VCFV4KICWPFFGU*GT\QIVWOU.KXNCPF  5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



5039

1,5:1



-CTN :+  &WMCV   I 5VCFVYCRRGP \W FGP 5GKVGP FKG IGVGKNVG ,CJTGU\CJN QDGP   \YKUEJGP FGP 6ÒTOGP -TGW\ ÒDGT IGMTGW\VGP 5EJNÒUUGNP FCTÒDGT -TQPG WPVGP KO 6QTDQIGP   .ÌYGPMQRH KP FGT 7OUEJTKHV FKG 5KIPCVWT + / ,QCEJKO /GKPGEMG /ÒP\OGKUVGT KP 4KIC    $TWUVDKNFTOKVWOIGNGIVGO/CPVGN#JNUVTÌO 4 (D*CICPFGT0GWOCPP  )1.&448QT\ÒINKEJ  'TYQTDGPXQT

22

1,5:1


RIGA

5040



-CTN:++/CTM5VQEMJQNOIGRT·IVWPVGT-ÌPKI-CTN:+OKV)GIGPUVGORGNXQP 4KIC CWU FGO ,CJTG  CWH FGT 8QTFGTUGKVG )GMTÌPVGU /QPQITCOO -CTNU :++ #JNUVTÌO   

)GIGPUVGORGN WPF /ÒP\G  )GNQEJVUGJTUEJÌP



9·JTGPFFGU)TQ­GP0QTFKUEJGP-TKGIGUDGOÒJVGUKEJ<CT2GVGT+WOGKPG#WUYGKVWPIUGKPGU/CEJVDGTGKEJGUKO $CNVKMWO0CEJFGT4ÒEMGTQDGTWPI0CTXCUKO,CJTGDGNCIGTVGGT4KICFCUCNNGTFKPIUGTUVKP TWUUKUEJG *·PFG HKGN 9·JTGPF FGT TWUUKUEJGP $GNCIGTWPIDGUEJNQ­FGTUEJYGFKUEJG)GPGTCNIQWXGTPGWTKP.KXNCPF (TGKJGTT %CTN )WUVCH (TÌNKEJ GKPG )GIGPUVGORGNWPI CNNGT KP 4KIC DGHKPFNKEJGP UEJYGFKUEJGP /ÒP\GP &KG )GIGP   UVGORGNWPI UQNNVG FKG 8GTFQRRGNWPI FGU 0QOKPCNYGTVGU DGYKTMGP -ÌPKI -CTN :++ YCT LGFQEJ OKV FKGUGT #WHYGT   VWPICDUQNWVPKEJVGKPXGTUVCPFGPWPFXGTDQVFKGUG9·JTWPIUOC­PCJOGWOIGJGPF

5042

5041





5041

¤TG5VQEMJQNOIGRT·IVWPVGT-ÌPKI-CTN:+OKV)GIGPUVGORGNXQP4KICCWUFGO,CJTG CWHFGT8QTFGTUGKVG)GMTÌPVGU/QPQITCOO-CTNU:++#JNUVTÌO )GIGPUVGORGN WPF /ÒP\G  5GJTUEJÌP



¤TG5VQEMJQNOIGRT·IVWPVGT-ÌPKI-CTN:+OKV)GIGPUVGORGNXQP4KICCWUFGO,CJTG CWHFGT8QTFGTUGKVG)GMTÌPVGU/QPQITCOO-CTNU:++#JNUVTÌO )GIGPUVGORGN WPF /ÒP\G  (CUVUGJTUEJÌP



5043

5044

5045



¤TG5VQEMJQNOIGRT·IVWPVGT-ÌPKI-CTN:+OKV)GIGPUVGORGNXQP4KICCWUFGO,CJTG CWHFGT8QTFGTUGKVG)GMTÌPVGU/QPQITCOO-CTNU:++#JNUVTÌO )GIGPUVGORGN WPF /ÒP\G  5GJTUEJÌP





¤TG5VQEMJQNOIGRT·IVWPVGT-ÌPKI-CTN:+OKV)GIGPUVGORGNXQP4KICCWUFGO,CJTG CWHFGT8QTFGTUGKVG)GMTÌPVGU/QPQITCOO-CTNU:++#JNUVTÌO )GIGPUVGORGN WPF /ÒP\G  (CUVUGJTUEJÌP



¤TG5VQEMJQNOOKV)GIGPUVGORGNXQP4KICCWUFGO,CJTGCWHFGT8QTFGTUGKVG)GMTÌPVGU /QPQITCOO-CTNU:++#JNUVTÌO )GIGPUVGORGN WPF /ÒP\G  (CUVUGJTUEJÌP





23


ELBING

&+'21.0+5%*'70&&'765%*'1565''-ยช56'

&+'56#&6'.$+0) &KG *CPUGUVCFV 'NDKPI MCO KP FGT /KVVG FGU,CJTJWPFGTVUWPVGTRQNPKUEJG*GTTUEJCHVYWTFG FKG5VCFVXQP)WUVCX++#FQNHGTQDGTVWPFDNKGD\GJP,CJTGNCPIKPUEJYGFKUEJGT*CPFDKUUKGXQPFGT 8QTOWPFUEJCHVUTGIKGTWPIHร’T-รŒPKIKP%JTKUVKPCIGOยทยญFGO9CHHGPUVKNNUVCPFXQP5VWJOUFQTHCP2QNGP \WTร’EMIGIGDGPYWTFG-CTN:)WUVCXDGUGV\VGOKVUGKPGP6TWRRGP'NDKPIXQP'PFGDKU+P FKGUGT <GKV YWTFGP FQTV /ร’P\GP OKV FGO 0COGP FGU 5EJYGFGPMรŒPKIU IGRTยทIV 'KPKIG FGT 'NDKPIGT   /ร’P\GP XQP )WUVCX ++ #FQNH VTCIGP \YCT FGP 6KVGN FKGUGU -รŒPKIU CDGT FCU 2QTVTยทV UGKPGU %QWUKPU   -รŒPKI5KIKUOWPF+++XQP2QNGP#WHFGPGTUVGP$NKEMUQNNVGPFKG/ร’P\GPHร’TRQNPKUEJIGJCNVGPYGTFGP *KPVGTFKGUGT/ร’P\RQNKVKMUVCPFFGTUEJYGFKUEJG4GKEJUMCP\NGT#ZGN1ZGPUVKGTPCFGTDKU'PFGKP 'NDKPITGUKFKGTVG#WU+PUEJTKHVGPIGJVJGTXQTFCยญFKGUEJYGFKUEJG4GIKGTWPI\WFKGUGT<GKVCWEJQHHK \KGNNFKG8GTCPVYQTVWPIHร’TFCU/ร’P\YGUGPร’DGTPCJO7PVGT-CTN:)WUVCXYWTFGP)QNF5KNDGTWPF

YKGKP4KIC OKPFGTYGTVKIG/ร’P\GPIGRTยทIVUQYKG)TรŒUEJGT 1TVG Hร’TFKG4GEJPWPIFGT#TOGG *CPUCUVCFGP'NDKPIMQOKOKVVGPCXVCNGVWPFGTRQNUMVXยทNFGGTรŒXTCFGUUVCFGPCX)WUVCX++ #FQNH QEJ DGJรŒNNU CX UXGPUMCTPC VKNN  Fยน FGP ยนVGTNยทOPCFGU CX -TKUVKPCU HรŒTO[PFCTTGIGTKPI GHVGT   UVKNNGUVยนPFGVK5VWJOUFQTHH-CTN:)WUVCXQEJJCPUVTWRRGTQEMWRGTCFG'NDKPIHTยนPUNWVGVCX VKNNUNWVGVCX7PFGTFGUUCRGTKQFGTUNQIUO[PVKFGPUXGPUMGOQPCTMGPUPCOP'VVCPVCNCX)WUVCX ++#FQNHUO[PVDยทTFGPPGUPCOPOGPCXDKNFCTMWUKPGP5KIKUOWPFUQORQTVTยทVVล†OGPKPIGPXCTCVVO[P VGP XKF GP JCUVKI CPDNKEM UMWNNG VCU HรŒT RQNUMC $CMQO FGPPC O[PVPKPIURQNKVKM UVQF TKMUMCPUNGTP #ZGN   1ZGPUVKGTPCUQOTGUKFGTCFGK'NDKPIVKNNUNWVGVCX5XGPUMCTGIGTKPIGPรŒXGTVQIXKFFGPPCVKFQEMUยน CPUXCTGV HรŒT O[PVPKPIGP XKNMGV HTCOIยนT CX KPUMTKHVGTPC .KMUQO K 4KIC UNQIU OยนPIC OKPFGTXยทTFKIC   NยนIXCNรŒTGTOGFCPFWMCVGTQEJTKMUFCNGTJรŒNNIQFJCNV7PFGT-CTN:)WUVCXUNQIUQEMUยนIWNFQEJUKN XGTO[PVITQUEJGP QTV WVCPยนTVCNHรŒTCTOยพPUTยทMPKPI 



)WUVCX++#FQNH6CNGT 8CTKCPVGP  8CTKCPVGP  8CTKCPVGP  )TQUEJGP   UQYKG )TรŒUEJGT  -TQPOร’P\G  WPF  6CNGT  -TQPOร’P\G  &C\W   %JTKUVKPC5QNKFWU 5EJKNNKPI  8CTKCPVGP #JNUVTรŒODC

Z  5Vร’EM(CUVUGJTUEJรŒPWPFUGJTUEJรŒP



5047



-CTN : )WUVCX   &WMCVGP   I ร› /10'6# ร™ 018# ร™ # รš %+8+6#6+5 g   '.$+0)'05+5gรœรœรœgg8QPGKPGO'PIGNIGJCNVGPGU5VCFVYCRRGPWPVGPFKGIGVGKNVG5KIPCVWT 0* 0KEQNCWU*GPPKPI/ร’P\OGKUVGTKP'NDKPI %#41.85รœ)856#875รœ:รœ&รœ)รœ 4':)GMTรŒPVGUWPFIGJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN#JNUVTรŒO :4 &WVMQYUMK 5WEJCPGM 4 (Dp*%\ 4 *CICPFGT )1.&8QPCNNGTITรŒยญVGT5GNVGPJGKV /KPIGYGNNVUEJรŒPpUGJTUEJรŒP  'TYQTDGP



0CEJ WPUGTGP 4GEJGTEJGP UKPF XQP FKGUGT ยทWยญGTUV UGNVGPGP RQNPKUEJGP )TQยญIQNFRTยทIWPI NGFKINKEJ  'ZGORNCTG   DGMCPPV  -รŒPKINKEJUEJYGFKUEJGU/ร’P\MCDKPGVVKP5VQEMJQNO  5COONWPI*WVVGP%\CRUMK -TCMCW GTYQTDGPKP5VQEMJQNOCWHFGT#WMVKQPFGT&WDNGVVGPFGU  MรŒPKINKEJUEJYGFKUEJGP/ร’P\MCDKPGVVU  5COONWPI#PVGNNKP*GNUKPMK  &CUXQTNKGIGPFG'ZGORNCTCNUGKP\KIGUKP2TKXCVDGUKV\ 

 24

)TรŒUEJGT 1TV )TรŒUEJGT#JNUVTรŒOC 4  4 &WVMQYUMK5WEJCPGM  4  4  4  5Vร’EM5EJรŒP




POMMERN

&#5*'4<1)67/21//'40 &KG)GUEJKEJVGFGU*GT\QIVWOU2QOOGTPKUV·JPNKEJXKGNUEJKEJVKIYKGUGKP9CRRGP9·JTGPFFGU&TGK ­KIL·JTKIGP -TKGIGU OW­VG UKEJ FGT CNVG *GT\QI $QIKUNCY :+8 FGT UEJYGFKUEJGP 2QNKVKM CPUEJNKG­GP   +O,CJTUVCTDGTMKPFGTNQUWPFFCU*GT\QIVWOYWTFGXQPFGP5EJYGFGPXGTYCNVGVÒDGTPCJO 5EJYGFGPCWEJHQTOGNNGKPGPITQ­GP6GKNFGURQOOGTUEJGP6GTTKVQTKWOUOKV5VGVVKP JGWVG5\E\GEKPKP 2QNGP  WPF 5VTCNUWPF CNU YKEJVKIUVGP 5V·FVGP &KG 8GTYCNVWPI WPF CWEJ FCU /ÒP\YGUGP YWTFG YKG   HTÒJGTCWUIGÒDVWPFPKEJVFGPUEJYGFKUEJGP8GTJ·NVPKUUGPCPIGRC­V&KG/ÒP\GPFKGFGP0COGPFGT UEJYGFKUEJGP-ÌPKIGVTWIGPYWTFGPXQPDKUWPFXQPDKUKP5VGVVKPIGRT·IVDKU FKG 5VCFV OKV FGO 0KGFGTICPI FGT UEJYGFKUEJGP )TQ­OCEJVUUVGNNWPI KO 1UVUGGTCWO XGTNQTGP IKPI   5VGVVKPWPFWPIGH·JTFKG*·NHVGXQP2QOOGTPOW­VGCP2TGW­GPCDIGVTGVGPYGTFGP&GTMNGKPGDGK 5EJYGFGPXGTDNKGDGPG6GKNYWTFGPWPXQP5VTCNUWPFTGIKGTVFCUUEJQPOKVGKIGPGO/ÒP\TGEJVCWUIG UVCVVGV YCT WPF XQP  DKU  /ÒP\GP RT·IVG <WU·V\NKEJ YWTFGP PWP  KP ITQ­GO 7OHCPI   /ÒP\GPXQPDKUUQYKGUEJNKG­NKEJ-WRHGTOÒP\GPDKUIGRT·IV  &CU*GT\QIVWOYWTFGY·JTGPFFGT0CRQNGQPKUEJGP-TKGIGGKPKIG/CNGXQPFGP(TCP\QUGPGTQDGTV+O ,CJTYWTFG&·PGOCTMGKP8GTVTCICWHIG\YWPIGPFWTEJFGPGU2QOOGTPCNUVGKNYGKUGP'TUCV\HÒT 0QTYGIGP GTJCNVGP UQNNVG &C 0QTYGIGP XQP FGP 5EJYGFGP LGFQEJ OKV 9CHHGPIGYCNV GTQDGTV YGTFGP   OW­VG YWTFG FGT 8GTVTCI HÒT WPIÒNVKI GTMN·TV +O ,CJT  YWTFG 2QOOGTP UEJNKG­NKEJ CP 2TGW­GP   CDIGVTGVGPYQHÒT5EJYGFGPCWEJGKPG5WOOGKPDCTGTJKGNV   *GTVKIFÌOGV2QOOGTPJCTGPJKUVQTKCP·UVCPNKMCMQORNKEGTCFUQOFGUUXCRGP7PFGTVTGVVKQ¹TKICMTKIGV O¹UVGFGPICONGJGTVKI$QIKUNCWU:+8CPUNWVCUKIVKNNFGPUXGPUMCRQNKVKMGP*CPCXNGFDCTPNÌUQEJ UXGPUMCTPCCFOKPKUVTGTCFGJGTVKIFÌOGV(T¹PÌXGTVQI5XGTKIG·XGPHQTOGNNVGPUVQTFGNCXVGTTKVQ TKGVOGF5VGVVKP PWOGTC5\E\GEKPK2QNGP QEJ5VTCNUWPFUQOFGXKMVKICUVGUV·FGTPC#FOKPKUVTCVKQPQEJ O[PVT·VVWVÌXCFGUWPIGTH·TUQOVKFKICTGQEJP¹IQPCPUNWVPKPIVKNNUXGPUMO[PVT·VVUMGFFGCNFTKI/[PV UQO WVICXU K FGP UXGPUMG OQPCTMGPU PCOP UNQIU K 5VGVVKP  QEJ  HTCO VKNN FGUU CVV   UVCFGPHÌTNQTCFGUKQEJOGFFGVUXGPUMCUVQTOCMVUX·NFGVUHCNNFGPQEJWPIGH·TJCNXC2QOOGTPCXVT·F FGUVKNN2TGWUUGP&GPMXCTXCTCPFGFGNGPCFOKPKUVTGTCFGUPWHT¹P5VTCNUWPFUQOTGFCPJCFGGIGP O[PVT·VV QEJ UNQI O[PV OGF MGLUGTNKIV RTKXKNGIKWO  OGP F·T HCPPU PW ·XGP JGTVKIFÌOGVU   O[PVXGTM 5¹FCPC O[PV WVICXU  K UVQT QOHCVVPKPI  UCOV VKNN UKUV H¹VCNKIC MQRRCTO[PV   UGPCUV  *GTVKIFÌOGV GTÌXTCFGU GVV RCT I¹PIGT CX HTCPUO·PPGP WPFGT 0CRQNGQPMTKIGP + FGP WRRIÌTGNUG UQO   R¹VXKPICFGU&CPOCTMUMWNNG2QOOGTPÌXGTN·OPCUUQOGPXKUUGTU·VVPKPIHÌT0QTIGOGPGHVGTUQO FGVVCKPVGUMGFFGHTKXKNNKIVQEJ0QTIGO¹UVGVCUOGFXCRGPOCMVCPU¹IUHÌTFTCIGVQIKNVKIVÌXGTIKEM 2QOOGTPKUV·NNGVVKNN2TGWUUGPUQOGPFGNKGVVCXVCNUQOQEMU¹KPPGDCTMQPVCPVGTU·VVPKPIVKNN5XGTKIG

5049



%JTKUVKPC&WMCV5VGVVKPI#JNUVTÌO(D*CICPFGT  )1.&9KP\5VGORGNHGJNGTCO4CPFCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 25


POMMERN

5050

5050

1,5:1



&QRRGNVGT4GKEJUVCNGT5VGVVKPIc%*4+56+0#Û&Ù)Û58'Û)16Û8#0&Û3Û&'5 Û4')+0)GMTÌPVGU$TWUVDKNFJCNDNc/10'6#Û018#Ú#4)Û&8%#685Ú21/'4#0Û $GJGNOVGU9CRRGPXQP\YGKDGJGNOVGPYKNFGP/·PPGTPIGJCNVGP#JNUVTÌO :4 &CX  8QPCNNGTITÌ­VGT5GNVGPJGKV9KP\4CPFHGJNGTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  'TYQTDGPXQT



0CEJWPUGTGP4GEJGTEJGPKUVXQPFKGUGT8CTKCPVGFGUGZVTGOUGNVGPGP&QRRGNVCNGTUPWTPQEJGKPYGKVGTGU'ZGORNCT DGMCPPVFCUKPFGT#WMVKQPXQP(GNKZ5EJNGUUKPIGTCO/CKKP$GTNKPWPVGT0TXGTUVGKIGTVYWTFG#WH FGO 'ZGORNCT FGT DGTÒJOVGP 2QOOGTPUCOONWPI FGU )TGKHUYCNFGT -QOOGT\KGPTCVU 2QIIG #WMVKQP . *CODWT   IGT(TCPMHWTV0T GPFGVFKG8QTFGTUGKVGPNGIGPFGOKV4')+0# 

5051



5052

4GKEJUVCNGT5VGVVKP#JNUVTÌOC&CX*CICPFGT

5053

49KP\4CPFHGJNGTUGJTUEJÌP



4GKEJUVCNGT5VGVVKP#JNUVTÌO&CX*CICPFGT  45EJÌPG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌP



'TYQTDGPXQT



'ZGORNCTFGT#WMVKQP#RRGNITGP +$GTIJOCPUFWDDNGVVGT 5VQEMJQNO0T <WUEJNCIUEJYGFK UEJG-TQPGP 



4GKEJUVCNGT5VGVVKP#JNUVTÌO&CX*CICPFGTXCT

4-N*GPMGNURWTUGJTUEJÌP

'ZGORNCTFGT5COONWPI%,5XGPUUQP#WMVKQP*QNODGTI5VQEMJQNO0T <WUEJNCIUEJYG FKUEJG-TQPGP 

26




POMMERN

5054

5054

1,5:1



-CTN:)WUVCX&QRRGNVGT4GKEJUVCNGT5VGVVKPIf%#41.)856#875Û& Û ) Û 4': Û 57' Û &8: Û 56' Û 21/' )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN   Ú/10'6Ü017#Û#4)Û&8%#6Û21/'4Û$GJGNOVGU9CRRGPXQP\YGKDGJGNOVGP YKNFGP/·PPGTPIGJCNVGP#JNUVTÌO :4 &CX  8QPCNNGTITÌ­VGT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI  'TYQTDGPXQT



+PFGTYQJNDGFGWVGPFUVGP5COONWPIRQOOGTUEJGT/ÒP\GPFGU-QOOGT\KGPTCVU2QIIGFKGCO0QXGODGT XQP . *CODWTIGT KP (TCPMHWTV C / XGTUVGKIGTV YWTFG DGHCPF UKEJ MGKP RQOOGTUEJGT &QRRGNVCNGT FGU -ÌPKIU   -CTN:)WUVCX 

ex 5055



&QRRGNUEJKNNKPI 6CNGT  8CTKCPVGP  8CTKCPVGPZOKV)GIGPUVGORGNCWHFGT 4ÒEMUGKVG #NNG/ÒP\UV·VVG5VGVVKP#JNUVTÌO Z  Z  5VÒEM5GJTUEJÌP



5056



-CTN:+&WMCVGP5VGVVKPI#JNUVTÌOp XIN:4 (D*CICPFGT 5NI2QIIG )1.&8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP 'TYQTDGPHÒTUEJYGFKUEJG-TQPGP





&KG 4ÒEMUGKVGPWOUEJTKHV FKGUGP GZVTGO UGNVGPGP &QRRGNFWMCVGP FGT CWEJ KP FGT 5COONWPI 2QIIG HGJNVG DGIKPPV   WPVGP NKPMU 5Q KUV FCU 5VÒEM CWEJ XQP $TQT 'OKN *KNFGDTCPF KP UGKPGO 5VCPFCTFYGTM ÒDGT FKG UEJYGFKUEJGP /G   FCKNNGP WPF 2TCEJVOÒP\GP $CPF + 5  0T  #PO  XGT\GKEJPGV YQTFGP 7PUGTGU 'TCEJVGPU KUV FGP   8GTHCUUGTPFGU-CVCNQIUFGTUEJYGFKUEJGP$GUKV\WPIUOÒP\GPDGK0TGKP(GJNGTWPVGTNCWHGPFCFQTVCPIGIGDGP YKTFFC­FKG4ÒEMUGKVGPWOUEJTKHVQDGPTGEJVUDGIKPPV  &GT XQTNKGIGPFG &QRRGNFWMCV \GKIV FGP 5EJYGFGPMÌPKI CNU 'TYCEJUGPGP &GT /ÒP\OGKUVGT ,QJCPP .GQPJCTF   #JTGPUDWTI FGT CWH FGT 2T·IWPI CNU 8GTCPVYQTVNKEJGT DG\GKEJPGV KUV MCO  CWU FGP 5C[P9KVVIGPUVGKPKUEJGP   .CPFGP PCEJ 5EJYGTKP 'T YCT WTURTÒPINKEJ FGT *CWRVIGJKNHG FGU DGTÒJOVGP 8CVGTU FGT *GEMOÒP\GP )TCH   )WUVCXXQP5C[P9KVVIGPUVGKP*QJGPUVGKP  &KGUGTNKG­CW­GTJCNDFGT-TGKUOÒP\UV·VVGPKPUQIGPCPPVGP *GEMGPOÒP\GP WPVGTYGTVKIG /ÒP\GP CWURT·IGP WO GKPGP JÌJGTGP 5EJNCIUEJCV\ \W GT\KGNGP 8QP  DKU    NKG­)WUVCXUGKPG/ÒP\OCPKRWNCVKQPGPFWTEJ#JTGPUDWTIKP5VGVVKPCWUHÒJTGPWPFDGVGKNKIVGFGPUEJYGFKUEJGP-ÌPKI CO )GYKPP UKGJG WPUGTG #WMVKQP  0T   #JTGPUDWTI CTDGKVGVG Y·JTGPF FKGUGT <GKV WPF PCEJ )WUVCXU   4ÒEM\WI CWU FGO 5VGVVKPGT /ÒP\IGUEJ·HV CWEJ HÒT 2QOOGTP WPF DTCEJVG IWVJCNVKIG /ÒP\GP YKG FCU XQTNKGIGPFG   5VÒEMJGTCWU&GT/ÒP\OGKUVGTUVCPFDKUKPRQOOGTUEJGP&KGPUVGPYWTFGFCPPCDGTYGIGPFGT*GEMGPOÒP \GTGKKPJCHVKGTV 

27


POMMERN

5057



&WMCVGP5VGVVKPI#JNUVTÌO 4 (D*CICPFGT  )1.&44/KPIGYGNNVUGJTUEJÌP 'TYQTDGPXQT

5058



5058 1,5:1



4GKEJUVCNGT5VGVVKPI$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGNFCTWPVGTFKG 5KIPCVWT Û & 5 Û &CPKGN 5[XGTV\ /ÒP\OGKUVGT KP 5VGVVKP  $GJGNOVGU 9CRRGP XQP \YGK   DGJGNOVGPYKNFGP/·PPGTPIGJCNVGP#JNUVTÌOD :4 &CX*CICPFGT  44.GKEJVG2T·IGUEJY·EJGHCUVXQT\ÒINKEJ  'TYQTDGPXQT

5059

5060

5061



6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT%5#JNUVTÌO&CXXCT  /KPMQTTQFKGTVUGJTUEJÌP





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT$##JNUVTÌO&CX  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT$##JNUVTÌO&CX  /KPMQTTQFKGTVUGJTUEJÌPpXQT\ÒINKEJ



28


POMMERN

5062

5063

5064



 6CNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  5VGVVKP /KV /ÒP\OGKUVGTUKIPCVWT $#   #JNUVTÌOXCT&CX 5GJTUEJÌP





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT$##JNUVTÌOXCT&CX  -N(NGEMHCUVXQT\ÒINKEJ





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT&*/#JNUVTÌO 4 &CX  49KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



5065

5066

5067



6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT&*/#JNUVTÌO&CX

5GJTUEJÌP





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT&*/#JNUVTÌO 4 &CX  4(CUVUGJTUEJÌP





6CNGT5VGVVKP1JPG/ÒP\OGKUVGTUKIPCVWT#JNUVTÌOC 4 &CX



4(CUVUGJTUEJÌP

29


POMMERN

5068

5069

5070



6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+.#WPF\YGKIGMTGW\VG<CKPJCMGP#JNUVTÌOE &CX -N2T·IGUEJY·EJGUGJTUEJÌP





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+.##JNUVTÌOC&CX





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+.#WPF\YGKIGMTGW\VG<CKPJCMGP#JNUVTÌOD &CX -N-TCV\GTMN2T·IGUEJY·EJGUGJTUEJÌP

5071

5072

5GJTUEJÌP



5073



6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+.#WPF\YGKIGMTGW\VG<CKPJCMGP#JNUVTÌOD &CX 5GJTUEJÌP





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+.##JNUVTÌO&CX

(CUVUGJTUEJÌP





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+.##JNUVTÌOXCT&CXXCT  (CUVUGJTUEJÌP



30


POMMERN

5074

5075

5076



6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+%##JNUVTÌOD&CX

(CUVUGJTUEJÌP





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+%#KO#TOCDUEJPKVV#JNUVTÌOC&CX  -N2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ





6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+%#KO#TOCDUEJPKVV#JNUVTÌOC&CX  5GJTUEJÌP



5079

5077

5077



6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+%#PGDGPFGO#TOCDUEJPKVV#JNUVTÌOD&CX -N5VGORGNHGJNGTUGJTUEJÌP





6CNGT$#+.# 8CTKCPVGPZOKVFWTEJIGJGPFGO5EJTÌVNKPIUHGJNGT +.# +%##JNUVTÌOD Z DD&CX Z   5VÒEM/KV/·PIGNPHCUVUGJTUEJÌP 6CNGT5VGVVKP#JNUVTÌOE -N<CKPGPFGUGJTUEJÌP

 



5080

 

6CNGT5VGVVKP#JNUVTÌO 6CNGT5VGVVKP#JNUVTÌO

5081

5GJTUEJÌP -N4CPFHGJNGTUGJTUEJÌP

  31


POMMERN

5083

5082

 

6CNGT5VGVVKP#JNUVTÌO 6CNGT5VGVVKP#JNUVTÌO 4 

5GJTUEJÌP 4(CUVUGJTUEJÌP

5085

5084

 

6CNGT5VGVVKP#JNUVTÌO 6CNGT5VGVVKP#JNUVTÌO

5GJTUEJÌPpXQT\ÒINKEJ 4/KPLWUVKGTVHCUVUGJTUEJÌP

6CNGT5VGVVKP#JNUVTÌO 4  6CNGT )TQUEJGP 5VGVVKP#JNUVTÌO 4 

5088

 

5087

5086

 

 

5089

45GJTUEJÌP 45GJTUEJÌP

5090

 

5091



6CNGT5VGVVKPOKV)GIGPUVGORGNFGT5VCFV5VTCNUWPFCWHFGT8QTFGTUGKVG-TQPGÒDGT5VGTP #JNUVTÌO5' 5GJTUEJÌP





 6CNGT  5VGVVKP OKV )GIGPUVGORGN FGT 5VCFV )TGKHUYCNF CWH FGT 8QTFGTUGKVG -TQPG ÒDGT )   #JNUVTÌO5$ 5GJTUEJÌP





 6CNGT  5VGVVKP OKV )GIGPUVGORGN FGT 5VCFV 5VGVVKP CWH FGT 8QTFGTUGKVG -TQPG #JNUVTÌO 5   & 5GJTUEJÌP





6CNGT5VGVVKPOKV)GIGPUVGORGNFGT5VCFV5VGVVKPCWHFGT4ÒEMUGKVG-TQPG#JNUVTÌO5& 5GJTUEJÌP



5092

   32

6CNGT5VGVVKP#JNUVTÌOD 4  9KVVGP5VGVVKP#JNUVTÌO :4  9KVVGP5VGVVKP#JNUVTÌO 4 

5093

5094

(CUVUGJTUEJÌP 8QPITQ­GT5GNVGPJGKV5EJÌPpUGJTUEJÌP 44(CUVUGJTUEJÌP

  


POMMERN

5095

5096



9KVVGP5VGVVKP#JNUVTÌO 4 

445EJÌPpUGJTUEJÌP





9KVVGP5VGVVKP#JNUVTÌO 4 

444CPFCWUDTWEJHCUVUGJTUEJÌP



ex 5097



 6CNGT   8CTKCPVGP    8CTKCPVGP    6CNGT      8CTK   CPVGP    8CTKCPVGP   6CNGT    8CTKCPVGP    8CTKCPVGP    8CTK   CPVGP  4  8CTKCPVGP 6CNGT OKV)GIGPUVGORGNXQP 5VGVVKP #NNG/ÒP\UV·VVG5VGVVKP 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



5099

5098



-CTN:++6CNGT5VGVVKP#JNUVTÌO&CX  -N4CPFHGJNGTWPF(GKNURWTGPCO4CPFUGJTUEJÌP





6CNGT5VGVVKP#JNUVTÌO&CX



-N<CKPGPFGDGTKGDGPUGJTUEJÌP

5100

5101

5102



6CNGT5VGVVKP#JNUVTÌO 4 

445EJÌPpUGJTUEJÌP





#FQNH(TKGFTKEJ6CNGT5VTCNUWPF#JNUVTÌO 4   49KP\,WUVKGTURWTGPUGJTUEJÌP





)WVG)TQUEJGP5VTCNUWPF#JNUVTÌO

5GJTUEJÌP

 33


WOLGAST

5104

5103



6CNGT5VTCNUWPF#JNUVTÌOC



6CNGT )TQUEJGP 5VTCNUWPF'KPUGKVKIG(GJNRT·IWPIXQO8QTFGTUGKVGPUVGORGN#JNUVTÌO 4(CUVXQT\ÒINKEJ





 )WVG )TQUEJGP   6CNGT    8CTKCPVGP   6CNGT  \GKVIGPÌUUKUEJG (·N   UEJWPI 6CNGT6CNGT 8CTKCPVGP &C\W)WUVCX+++ -W2HGPPKI Z #NNG/ÒP\UV·VVG5VTCNUWPF#JNUVTÌOC 4 DGXIN E 4 CDC Z  Z   5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



)WUVCX +8 #FQNH  -W 2HGPPKI  Z  Z  4HCUVUGJTUEJÌP #NNG /ÒP\UV·VVG5VTCNUWPF#JNUVTÌO Z  Z  4  5VÒEM/GKUVUGJTUEJÌP





5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



&CUUGNVGPG-W2HGPPKI5VÒEMXQPKUVFKGNGV\VGUEJYGFKUEJG$GUKV\WPIUOÒP\G

&+'56#&691.)#56 +PFGT5VCFV9QNICUV CPFGT2GGPGKP8QTRQOOGTP YWTFGKO(TÒJLCJTGKPKIG/QPCVGNCPIFGT DCNUCOKGTVG .GKEJPCO FGU 5EJYGFGPMÌPKIU )WUVCX ++ #FQNH CWHDGYCJTV +O ,WPK YWTFG GT XQP FGT   UEJYGFKUEJGP (NQVVG CDIGJQNV (ÒT FKG HGKGTNKEJG 2TQ\GUUKQP \WO *CHGP YWTFGP KP FGT MWT\HTKUVKI KP   9QNICUV GKPIGTKEJVGVGP /ÒP\UV·VVG 2TCEJVOÒP\GP CWU )QNF WPF 5KNDGT IGRT·IV &KG 5VÒEMG YWTFGP CP   XQTPGJOGWPFJQEJUVGJGPFG)·UVGFGUHGKGTNKEJGP.GKEJGP\WIGUCWUIGIGDGP   +UVCFGP9QNICUV XKF2GGPGK8QTRQOOGTP HÌTXCTCFGUWPFGTP¹ITCO¹PCFGTR¹X¹TGP)WUVCX++ #FQNHUDCNUCOGTCFGNKM&GVJ·OVCFGUKLWPKCXFGPUXGPUMCHNQVVCP6KNNFGPJÌIVKFNKICRTQEGUUKQPGPPGF VKNN JCOPGP UNQIU RTCMVO[PV CX IWNF QEJ UKNXGT K FGV VKNNH·NNKIV ÌRRPCFG O[PVXGTMGV K UVCFGP 5QONKIC   CPX·PFGUUQOMCUVO[PVCPFTCUM·PMVGUVKNNHÌTP·OCI·UVGT

5107



)WUVCX ++ #FQNH  8KGTHCEJGT 4GKEJUVCNGT  CWH FKG ªDGTHÒJTWPI UGKPGT )GDGKPG PCEJ   5EJYGFGP  I &GT -ÌPKI KP XQNNGO 1TPCV NKGIV CWHIGDCJTV UGKPG 5GGNG YKTF XQP \YGK 'PIGNP   \WO UVTCJNGPFGP 0COGP ,GJQXCU IGVTCIGP KO *KPVGTITWPF 5EJNCEJVHGNF)WUVCX #FQNH UKV\V KP 6TKWO   RJYCIGPFGTXQPFTGK2GICUKIG\QIGPYKTFWPFYKTFDGMT·P\VXQPFGT4GNKIKQPWPFFGT)GTGEJVKIMGKV QDGP'68+6#'6/146'64+7/2*1Û +O.GDGPYKGKO6QFGVTKWORJKGTGKEJ #JNUVTÌO

4 &CX FQTVWPVGT'THWTV *KNFGDTCPF+5  444CPFHGJNGT(GNFGTIGIN·VVGVUGJTUEJÌP  'TYQTDGPXQT



&GTNCVGKPKUEJG5RTWEJCWHFGT4ÒEMUGKVGFKGUGU5VÒEMGUDG\KGJVUKEJFCTCWHFC­)WUVCX#FQNHKPFGT5EJNCEJVXQP .ÒV\GP CO  HKGN FKG 5EJYGFGP CDGT VTQV\FGO QFGT IGTCFG FGUYGIGP UKGIVGP 0CEJ UGKPGO 6QFG YWTFG   FGT -ÌPKI PCEJ 9QNICUV IGDTCEJV YQ FGT .GKEJPCO GKP JCNDGU ,CJT DNKGD 'TUV #PHCPI ,WNK  YWTFG GT PCEJ   GKPGT HGKGTNKEJGP 2TQ\GUUKQP CWH GKP 5EJKHH IGDTCEJV WPF PCEJ 0[MÌRKPI ÒDGTHÒJTV <W FKGUGT )GNGIGPJGKV UKPF   5EJCWUVÒEMGYKGFGTJKGTXQTNKGIGPFGXKGTHCEJG4GKEJUVCNGTIGRT·IVYQTFGP 

34


WOLGAST

5108



&TGKHCEJGT4GKEJUVCNGTCWHFKGªDGTHÒJTWPIUGKPGT)GDGKPGPCEJ5EJYGFGPI&GT-ÌPKI KP XQNNGO 1TPCV NKGIV CWHIGDCJTV UGKPG 5GGNG YKTF XQP \YGK 'PIGNP \WO UVTCJNGPFGP 0COGP ,GJQXCU   IGVTCIGP KO *KPVGTITWPF 5EJNCEJVHGNF)WUVCX #FQNH UKV\V KP 6TKWORJYCIGP FGT XQP FTGK 2GICUK   IG\QIGPYKTFWPFYKTFDGMT·P\VXQPFGT4GNKIKQPWPFFGT)GTGEJVKIMGKVQDGP'68+6#'6/146' 64+7/2*1 Û  +O .GDGP YKG KO 6QFG VTKWORJKGTG KEJ  #JNUVTÌO  4  &CX  FQTV WPVGT   'THWTV *KNFGDTCPF+5 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  'TYQTDGPXQT

5109



&QRRGNVGT4GKEJUVCNGTCWHFKGªDGTHÒJTWPIUGKPGT)GDGKPGPCEJ5EJYGFGPI&GT-ÌPKIKP XQNNGO1TPCVNKGIVCWHIGDCJTVUGKPG5GGNGYKTFXQP\YGK'PIGNP\WOUVTCJNGPFGP0COGP,GJQXCUIGVTC IGP KO *KPVGTITWPF 5EJNCEJVHGNF)WUVCX #FQNH UKV\V KP 6TKWORJYCIGP FGT XQP FTGK 2GICUK IG\QIGP   YKTF WPF YKTF DGMT·P\V XQP FGT 4GNKIKQP WPF FGT )GTGEJVKIMGKV QDGP '6 8+6# '6 /146'    64+7/2*1Û +O.GDGPYKGKO6QFGVTKWORJKGTGKEJ #JNUVTÌO&CX FQTVWPVGT'THWTV  *KNFGDTCPF+5 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  'TYQTDGPXQT

5110



4GKEJUVCNGTCWHFKGªDGTHÒJTWPIUGKPGT)GDGKPGPCEJ5EJYGFGP#JNUVTÌO*KNFGDTCPF+ 5 #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'TYQTDGPXQT

35


STRALSUND

&+'56#&6564#.570&

5111

5112

5113



%JTKUVKPC  4GKEJUVCNGT  5EJKNNKPI   OKV 6KVGN (GTFKPCPFU +++ #JNUVTÌO  4    $TCVTKPIC&CX*CICPFGT 4*ÒDUEJG2CVKPCUGJTUEJÌP 



4GKEJUVCNGT  5EJKNNKPI   OKV 6KVGN (GTFKPCPFU +++ #JNUVTÌO  4  $TCVTKPI  C &CX    *CICPFGT 45GJTUEJÌPHCUVXQT\ÒINKEJ 



4GKEJUVCNGT  5EJKNNKPI   OKV 6KVGN (GTFKPCPFU +++ #JNUVTÌO  4  $TCVTKPI  D &CX    *CICPFGT 45GJTUEJÌP

36




STRALSUND

5114

5115



5115

-CTN:+&WMCVOKV6KVGN.GQRQNFU+I#JNUVTÌO$TCVTKPI(D *CICPFGT )1.&44(CUUWPIUURWTGP(GNFGTIGIN·VVGVUGJTUEJÌP



'ZGORNCT FGT #WMVKQP #RRGNITGP QJPG 0WOOGT  + $GTIJOCPU FWDDNGVVGT  5VQEMJQNO  0T    <WUEJNCIUEJYGFKUEJG-TQPGP 



4GKEJUVCNGT  5EJKNNKPI   OKV 6KVGN .GQRQNFU + #JNUVTÌO  4  $TCVTKPI  C &CX    *CICPFGT 44+PCNVGT(CUUWPI(GNFGTIGIN·VVGVHCUVUGJTUEJÌP



'ZGORNCTFGT#WMVKQP#RRGNITGP5VQEMJQNO0T <WUEJNCIUEJYGFKUEJG-TQPGP 

5116

5117

5118



6CNGT#JNUVTÌO$TCVTKPIC&CX  -N5EJTÌVNKPIUHGJNGTYKP\(GKNURWTGPCO4CPFUGJTUEJÌP





6CNGT#JNUVTÌOD$TCVTKPI&CX

5GJTUEJÌP





6CNGT#JNUVTÌOFNGKEJVXCT$TCVTKPI&CX#  -N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



5119



6CNGT#JNUVTÌOD$TCVTKPID&CX

5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 37


WISMAR

5121

5120

5120



6CNGT#JNUVTÌO$TCVTKPI&CX



6CNGT )TQUEJGP #JNUVTÌO :4 $TCVTKPI

5GJTUEJÌP



44/KPIGYGNNVUGJTUEJÌP



2CWN $TCVTKPI DGOGTMVG KP UGKPGO  GTUEJKGPGP 5VCPFCTFYGTM \WT 5VTCNUWPFGT /ÒP\IGUEJKEJVG KP $G\WI CWH   FKGUGP ·W­GTUV UGNVGPGP )TQUEJGP &KGUGT )TQUEJGP YCT PWT KP GKPGO O·­KI GTJCNVGPGP 'ZGORNCT DGK 2QIIG    XQTJCPFGP5VKGTPUVGFVHÒJTVKJPPKEJVCP

5122

5124

5123



6CNGT#JNUVTÌO$TCVTKPI

5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





6CNGT#JNUVTÌO$TCVTKPI

5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





9KVVGP#JNUVTÌO$TCVTKPI

5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





6CNGT DGCTDGKVGV 6CNGT )TQUEJGP  8CTKCPVGP  6CNGT6CNGT9KVVGP&C\W-CTN:++ 6CNGT9KVVGP 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



&+'*'445%*#(69+5/#4

5126



1,5:1

5126

-CTN:+6CNGTOÌINKEJGTYGKUG4QUVQEM2TQDGI#JNUVTÌO 4 &CXp -WP\GN 8QPCNNGTITÌ­VGT5GNVGPJGKV(CUVUGJTUEJÌP 'TYQTDGPXQT



/KEJCGN -WP\GNDGOGTMVG\WFKGUGTCW­GTIGYÌJPNKEJGPWPFGZVTGOUGNVGPGP2TQDGRT·IWPI#WHITWPFGKPGTMÌPKI NKEJGP -QP\GUUKQP XQO ,CPWCT  DGCDUKEJVKIVG FGT UEJYGFKUEJG 6TKDWPCNCUUGUUQT (TKGFTKEJ -NKPEMQY XQP (TKG   FGPUEJKNF KP 9KUOCT CWH GKIGPG -QUVGP GKPG /ÒP\UV·VVG HÒT FKG *GTTUEJCHV9KUOCTGKP\WTKEJVGP&CU2TQLGMVMCO ÒDGTFKG=JKGTCPIGDQVGPG?KP4QUVQEMXQP,QJCPP/GOOKGUCWUIGHÒJTVG2TQDGOÒP\GPKEJVJKPCWUWPFHCPFOKVFGO 6QF-NKPEMQYUKO,CJTGKP'PFG=?  /KVFGT5VCFV9KUOCTJCVVGFKG/ÒP\GGKIGPVNKEJPKEJVU\WVWPFGPPUKGYWTFGHÒTFKG*GTTUEJCHVWPFPKEJVHÒTFKG 5VCFV 9KUOCT IGRT·IV &KG 9CJN FGU 5VCFVYCRRGPU KP 'TOCPIGNWPI GKPGU CPFGTGP $KNFGU HÒT FKG *GTTUEJCHV 9KU   OCTOCIFKG7TUCEJGHÒTFGPTIGTOKVFGO/CIKUVTCVIGYGUGPUGKP'UJCPFGNVUKEJWOGKPG2TQDGRT·IWPIQJPG 0QOKPCNCPICDG 

38




WISMAR

&+'56#&69+5/#4 &KGYKEJVKIG*CPUGUVCFVCPFGT1UVUGGYWTFGKO9GUVHยทNKUEJGP(TKGFGP5EJYGFGP\WIGURTQEJGP 9KUOCT JCVVG /KVVG FGU  ,CJTJWPFGTVU FCU /ร’P\TGEJV GTJCNVGP &KG PCEJ  IGRTยทIVGP /ร’P\GP   GTJCNVGPMGKPGP*KPYGKUCWHFKGUEJYGFKUEJG1DGTJQJGKVUQPFGTPVTCIGPOGKUVFGP6KVGNFGU-CKUGTU CNU 8GTNGKJGTFGU/ร’P\TGEJVU 'UYWTFGKPIGTKPIGO7OHCPI)QNFWPFKPITQยญGT/GPIG5KNDGTDKUJGTWP VGT\WO9KVVGPIGRTยทIV9ยทJTGPFFGT$GNCIGTWPIYWTFGP2NCVVGPOร’P\GPCWU-CPQPGPOGVCNNCWU IGIGDGPUQYKGGKPGKP\GNPGU2HGPPKI5Vร’EMCWยญGTFGOYWTFGPGKPKIG/ร’P\GPOKV)GIGPUVGORGNXGT UGJGP 'KPG ยทWยญGTUV UGNVGPG XGTOWVNKEJ KP 4QUVQEM IGRTยทIVG 2TQDGOร’P\G XQP  OKV FGO 2QTVTยทV   -CTNU:+ 0T IGJรŒTV\WT*GTTUEJCHV9KUOCTPKEJV\WT5VCFV  7O FKG UEJYGFKUEJG 5VCCVUUEJWNF \W XGTOKPFGTP XGTRHยทPFGVG -รŒPKI )WUVCX +8 #FQNH KO ,CJT    9KUOCTHร’T,CJTGCP/GEMNGPDWTI5EJYGTKP+O,CJTXGT\KEJVGVG5EJYGFGPCWHFKG9KGFGT GKPNรŒUWPIFKGUGU2HCPFGU   &GPXKMVKICJCPFGNUUVCFGPXKFยคUVGTULรŒPCXVTยทFFGUKYGUVHCNKUMCHTGFGPVKNN5XGTKIG5VCFGPUO[P VTยทVVJCFGDGXKNLCVUXKFOKVVGPCXVCNGVQEJUVCFUUV[TGNUGPJรŒNNRยนUKPTยทVV/[PVGPJCTKPIGPCPV[FCP QOFGPUXGPUMCรŒXGTJรŒIJGVGPOGPFGUVQOGT RยนFGHNGUVC QOMGLUCTGPUQOIKXCTGCXO[PVTยทVVGP*ยทT UNQIU IWNF QDGV[FNKIV  QEJ UKNXGT ICPUMC QOHCVVCPFG  PGF VKNN YKVVGP 7PFGT DGNยทITKPIGP  WVICXU   RNยนVO[PVCXMCPQPOGVCNNGPGPUVCMCRHGPPKIQEJFยทTVKNNMQPVTCOCTMGTCFGUGPFGNO[PV5GFCPUVCFGP ยนVGTNยทOPCVUUNQIUOGUVNยนICXCNรŒTGTCXMQRRCTUGPCUV'PRTQXO[PVPKPIOGF-CTN:+URQT VTยทVVJรŒTVKNN*GTTUMCRGV9KUOCTKPVGUVCFGPFGPยทT[VVGTUVUยทNNU[PVQEJMCPJCITCXGTCVUK4QUVQEM 0T    (รŒT CVV TGINGTC FGP UXGPUMC UVCVUUMWNFGP RCPVUCVVG )WUVCX +8 #FQNH 9KUOCT VKNN /GEMGPDWTI5EJYGTKP   RยนยนT5XGTKIGCXUVQFHTยนPยนVGTKPNรŒUGP

5127



%JTKUVKPC6CNGT &QRRGNUEJKNNKPI #JNUVTรŒOC :4 -WP\GN#C  8QPITQยญGT5GNVGPJGKV(CUVUGJTUEJรŒP





-CTN : )WUVCX   6CNGT &QRRGNUEJKNNKPI    FWTEJIGJGPFGT 5EJTรŒVNKPIUHGJ   NGT #JNUVTรŒO 4  4 -WP\GN#C#C 5Vร’EM5GJTUEJรŒP

 39


WISMAR

ex 5129



-CTN:+5EJKNNKPI 6CNGT  IGNQEJV 6CNGT &QRRGNUEJKNNKPI  6CNGT 9KVVGP Q, 8CTKCPVGP   5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



5130



-CTN :++  0QV2NCVVGPOÒP\G \W  5EJKNNKPI  IGRT·IV Y·JTGPF FGT$GNCIGTWPIFWTEJ FKG &·PGP 2TGW­GP WPF *CPPQXGTCPGT   I #JNUVTÌO  4  $TCWUG   /CPUHGNF6H-WP\GN 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP  'TYQTDGPXQT



9·JTGPF FGT $GNCIGTWPI 9KUOCTU FWTEJ &·PGP 2TGW­GP WPF *CPPQXGTCPGT UVGNNVG UKEJ KO *GTDUV  CMWVGT   )GNFOCPIGN GKP KPUDGUQPFGTG \WT $G\CJNWPI FGT UEJYGFKUEJGP )CTPKUQP +O 5GRVGODGT YWTFG UQYQJN FKG )GIGP   UVGORGNWPI FGU WONCWHGPFGP 5KNDGTIGNFGU \WT 'TJÌJWPI CWH FGP FQRRGNVGP 9GTV CNU CWEJ FKG 2T·IWPI XQP -WRHGT   FTGKGTP CPIGQTFPGV <WT )GNFUEJÌRHWPI NKG­ FGT 8K\GIQWXGTPGWT KO &G\GODGT  CWU WPDTCWEJDCTGP -CPQPGP   PCEJ FGO 8QTDKNF UEJYGFKUEJGT 2NCVVGPOÒP\GP 0QVMNKRRGP IKG­GP WPF UKG FGP \CJNWPIUXGTRHNKEJVGVGP $ÒTIGTP   CWUTGKEJGP0CEJFGTªDGTICDGFGT(GUVWPICPFKG&·PGPYWTFGFCUIGIGPIGUVGORGNVG)GNFKO#RTKNYKGFGT GKPIG\QIGP /KEJCGN-WP\GN   &GTUEJYGFKUEJG0WOKUOCVKMGT6QTDLÌTP5WPFSWKUVVGKNVG\WFGPJKGT\WT8GTUVGKIGTWPIIGNCPIGPFGP-WRHGTMNKRRGP HTGWPFNKEJGTYGKUG HQNIGPFGU OKV 0WT GKP GKP\KIGU /CN YWTFGP KP GKPGT UEJYGFKUEJGP $GUKV\WPI 2NCVVGPOÒP\GP   JGTIGUVGNNV &CU /GVCNN YWTFG CWU GTQDGTVGP HGKPFNKEJGP -CPQPGP IGYQPPGP &KGU YCT UGJT WOUVTKVVGP YGKN FKGUG   -CPQPGPCNU-TKGIUDGWVGGKPGPITQ­GPU[ODQNKUEJGP9GTVCNU<GKEJGPFGTOKNKV·TKUEJGP)TQ­OCEJVUUVGNNWPI5EJYG FGPU KPPG JCVVGP -ÌPKI -CTN :++ FGT UKEJ Y·JTGPF FGT 'PVUVGJWPIU\GKV KP 5VTCNUWPF DGHCPF JCV XGTOWVNKEJ UGKPG   'KPYKNNKIWPIHÒTGKPG#WUPCJOGUGKPGUCWUFTÒEMNKEJGP8GTDQVGUXQO,WPKGTVGKNV6TQRJ·GPMCPQPGPGKP\W UEJOGN\GP 0CEJ FGT QHHK\KGNNGP /ÒP\XGTQTFPWPI XQO  &G\GODGT  UQNNVGP UGEJU 0QOKPCNG  WPF /CTM    WPF  5EJKNNKPI  PCEJ FGO NÒDKUEJGP )GYKEJVUU[UVGO IGIQUUGP YGTFGP &KG )GYKEJVG FGT -WRHGTRNCVVGP   DGVTWIGPWPFMI  

40


WISMAR #NNG2NCVVGPVTCIGPFKG,CJTGU\CJNOKVGKPGT<KHHGTKPLGFGT'EMG&CU0QOKPCNKUVKPFKG/KVVGKPGKPGPIGTKH HGNVGP 4KPI GKPIGUVGORGNV +P GKPGO IGVGKNVGP 1XCN DGHKPFGV UKEJ NKPMU FCU 9CRRGP XQP 9KUOCT WPF TGEJVU FKG   $WEJUVCDGP09 0GEGUUKVCU9KUOCTKGPUKU 'KPKIGYGPKIG'ZGORNCTGFGT5EJKNNKPI5VÒEMGUKPFUQMNGKPFCUFGT IGTKHHGNVG 4KPI PKEJV OGJT CWH FGP MNGKPGP 5EJTÌVNKPI RC­VG 'KPGU FGT JKGT CPIGDQVGPGP 2NCVVGP FGU 5EJNQUUGU   'TKEUDGTIKUVGKPGFKGUGTUGNVGPCPIGDQVGPGP8CTKCPVGP  +PUIGUCOV YWTFGP  2NCVVGP CWU HCUV  6QPPGP $TQP\G IGIQUUGP 9KG UKEJ FKGUG #P\CJN CWH FKG GKP\GNPGP   0QOKPCN XGTVGKNVG YKUUGP YKT PKEJV &C­ PWT UQ YGPKIG2NCVVGPJGTIGUVGNNVYWTFGPDGTWJVGXGTOWVNKEJCWH/CPIGN CP-QJNGFKG\WO5EJOGN\GPFGT-CPQPGPDGPÌVKIVYWTFG8QPFGP2NCVVGPGZKUVKGTGPJGWVGXGTOWVNKEJPQEJ  5VÒEM KP ÌHHGPVNKEJGP WPF RTKXCVGP 5COONWPIGP 8QP FGT  /CTM2NCVVG IKDV GU PWT GKP\KI DGMCPPVGU 'ZGORNCT  

5VQEMJQNO WPFFCU/CTM5VÒEMKUVPWTKP\YGK'ZGORNCTGPDGMCPPV 5VQEMJQNOWPF7RRUCNC &GT0WOKUOCVK MGT%CTN.WPFUVTÌOXGT\GKEJPGVGKPUGKPGO#WHUCV\9KUOCTUPÌFO[PVRN¹VCTHT¹P 0WOKUOCVKUMC/GFFGNCP FGP:: 'ZGORNCTGFCTWPVGTFKGFTGKJKGTCPIGDQVGPGP5VÒEMG

5131



0QV2NCVVGPOÒP\G\W5EJKNNKPIIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJFKG&·PGP2TGW­GPWPF *CPPQXGTCPGTI#JNUVTÌO :4 $TCWUG/CPUHGNF6H-WP\GN # 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP



'TYQTDGPXQT

5132



0QV2NCVVGPOÒP\G\W5EJKNNKPIIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJFKG&·PGP2TGW­GPWPF *CPPQXGTCPGTI#JNUVTÌO :4 $TCWUG/CPUHGNF6H-WP\GN $ 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP



'TYQTDGPXQT





(TKGFTKEJ+-W2HGPPKI 5VÒEM  Z Z IGNQEJV  &C\W-CTN:++-W2HGPPKIWPF#FQNH(TKGFTKEJ-W 2HGPPKI Z  5VÒEM/GKUVUGJTUEJÌP



)WUVCX+8#FQNH-W2HGPPKI#JNUVTÌOC



5VÒEM5GJTUEJÌP

41


BREMEN UND VERDEN

&+'5%*9'&+5%*'0$'5+6<70)'0+0014&9'56&'765%*.#0&

&#5*'4<1)67/$4'/'070&8'4&'0 +O 9GUVH·NKUEJGP (TKGFGP GTJKGNV 5EJYGFGP CWEJ FCU 'T\DKUVWO $TGOGP WPF FCU $KUVWO 8GTFGP &CU   PGW IGDKNFGVG 6GTTKVQTKWO GTJKGNV CNU 6GKN FGU &GWVUEJGP 4GKEJGU FKG $G\GKEJPWPI *GT\QIVWO $TGOGP   WPF8GTFGP'UIGNCPI5EJYGFGPLGFQEJPKEJVCWEJFKG*CPUGUVCFV$TGOGPGKP\WXGTNGKDGP&KG/ÒP\ RT·IWPIWPF8GTYCNVWPIYWTFGPCEJ5VCFG UÒFYGUVNKEJXQP*CODWTI XGTNGIV&KGUG5VCFVJCVVGUGNDUV CWEJFCU/ÒP\TGEJVÒDVGGUCDGTPWTUGNVGPCWU&CU*GT\QIVWORT·IVG/ÒP\GPOKVFGO0COGPFGT UEJYGFKUEJGP -ÌPKIG KP )QNF WPF 5KNDGT KP \CJNTGKEJGP 0QOKPCNGP &KG NGV\VG /ÒP\RT·IWPI GTHQNIVG   HÒT-CTN:++&KG&·PGPGTQDGTVGPKO,CJT$TGOGP8GTFGPCDGTFCU*GT\QIVWOYWTFGKO (TKGFGPXQP5VQEMJQNOFGO-WTHÒTUVGPVWO*CPPQXGT UGKVKP2GTUQPCNWPKQPOKV)TQ­DTKVCP PKGP \WIGURTQEJGP   + YGUVHCNKUMC HTGFGP GTJÌNN 5XGTKIG QEMU¹ ·TMGDKUMQRUFÌOGV $TGOGP QEJ DKUMQRUFÌOGV 8GTFGP XKNMC   KPQO 6[UMC TKMGV DKNFCFG JGTVKIFÌOGV $TGOGP8GTFGP 5L·NXC JCPUCUVCFGP $TGOGP N[EMCFGU 5XGTKIG   FQEMKPVGKPHÌTNKXC/[PVPKPIQEJCFOKPKUVTCVKQPHÌTNCFGUVKNN5VCFGUÌFGTQO*CODWTI&GPPCUVCFJCFG QEMU¹ O[PVT·VV OGP HKEM KPVG O[EMGV VKNNH·NNG CVV WVÌXC FGP *GTVKIFÌOGV UNQI F·TGOQV O[PV HÌT FGP   UXGPUMG OQPCTMGP K IWNF QDGV[FNKIV  QEJ UKNXGT HT¹P JÌIC VKNN N¹IC PQOKPCNGT &GP UKUVC O[PVPKPIGP   UMGFFG  HÌT -CTN :++ &CPUMCTPC GTÌXTCFG  $TGOGP8GTFGP OGP FGV DNGX *CPPQXGT UGFCP   KRGTUQPCNWPKQPOGF5VQTDTKVCPPKGP UQOVKNNGTM·PFGUJGTVKIFÌOGVXKFGPHTGFK5VQEMJQNO

5135



-CTN:+4GKEJUVCNGT5VCFG#JNUVTÌO 4 &CX*CICPFGT  4-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ 'TYQTDGPXQT

42




BREMEN UND VERDEN

5136



5138

5137

/CTM5VCFG#JNUVTÌO 4 &CX

45GJTUEJÌP





/CTM5VCFG/KV%#41.85KPFGT8QTFGTUGKVGPWOUEJTKHV#JNUVTÌO&CX  (GNFGTWPF4CPFDGCTDGKVGVHCUVUGJTUEJÌP





/CTM5VCFG/KV%#41.75KPFGT8QTFGTUGKVGPWOUEJTKHV#JNUVTÌO&CX  (GNFGTWPF4CPFDGCTDGKVGVHCUVUGJTUEJÌP



'TYQTDGPXQT

5140

5139



6CNGT5VCFG#JNUVTÌO&CX



/CTM5VCFG#JNUVTÌOC 4 

#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



449KP\*GPMGNURWTHCUVUGJTUEJÌP



'TYQTDGPHÒTUEJYGFKUEJG-TQPGP

5141

5143

5143



6CNGT5VCFG#JNUVTÌO :4 



 6CNGT    6CNGT     6CNGT  IGNQEJV          8CTKCPVGP   IGNQEJV   6CNGT  4     6CNGT 5GEJUNKPI    &C\W%JTKUVKPC6CNGTUQYKG5VCFV5VCFG6CNGT  5VÒEM5EJÌPpUGJTUEJÌP



-CTN:++6CNGT5VCFG#JNUVTÌOC

8QPITQ­GT5GNVGPJGKV5EJÌPpUGJTUEJÌP

5EJÌPpUGJTUEJÌP



  43


ERFURT

5144

&+'56#&6150#$4ª%- 

)WUVCX++#FQNH4GKEJUVCNGT1UPCDTÒEMCWHUGKPGP6QF#JNUVTÌOD&CX *CICPFGTXCT-GPPGRQJN 5EJTÌVNKPIUTK­MN(GKNURWTGPCO4CPFUGJTUEJÌP

&+'5%*9'&+5%*'0$'5+6<70)'0+0 /+66'.70&5ª&&'765%*.#0&

&+'56#&6'4(746 &KGUEJYGFKUEJG6GKNPCJOGCODNWVKIGP&TGK­KIL·JTKIGP-TKGIPCJOKJTGP#PHCPICNU)WUVCX++#FQNH OKV UGKPGO UEJYGFKUEJGP *GGT ÒDGT FKG 1UVUGG UGIGNVG CWH FGT +PUGN 7UGFQO CP .CPF IKPI WPF KO   'KNVGORQ FWTEJ &GWVUEJNCPF \QI &GT 5KGI DGK $TGKVGPHGNF  DGYKGU FC­FGT)QNFMÌPKICWUFGO 0QTFGPCNU(GNFJGTTGTPUV\WPGJOGPYCT'UGPVUVCPFGKPGPQTOGT)GNFDGFCTHWPFYCUOCPPKEJVCNU 5WDUKFKGP W C XQP (TCPMTGKEJ  GTJKGNV OW­VG OCP UGNDGT CWURT·IGP .GKFGT UKPF FKG /ÒP\UV·VVGP   GKPKIGT6[RGPPQEJPKEJVXQNNUV·PFKIIGMN·TV  #WHLGFGP(CNNVTCIGPFKGGTUVGP$GUKV\WPIUOÒP\GPCWU/KVVGNWPF5ÒFFGWVUEJNCPFFKG,CJTGU\CJN +P /CKP\ YWTFG GKPG DGVT·EJVNKEJG #P\CJN )QNF WPF 5KNDGTOÒP\GP IGRT·IV CWEJ OKV FGT ,CJTGU\CJN   WPFQJPG,CJTGU\CJNHÒT-ÌPKIKP%JTKUVKPC'KPG5GTKG)QNFWPF5KNDGTRT·IWPIGPQJPG#PICDGFGT /ÒP\UV·VVG KUV  WPF  KP 9ÒT\DWTI GPVUVCPFGP WPF CWU GKPIGUEJOQN\GPGP *GKNKIGPDKNFGTP IG   RT·IVYQTFGP/KVITQ­GT9CJTUEJGKPNKEJMGKVKUVFQTVCWEJFGTUGNVGPG6CNGTFGUUEJYGFKUEJGP4GKEJU MCP\NGTU#ZGN1ZGPUVKGTPCQJPG,CJTGU\CJNIGRT·IVYQTFGP  +O,CJTDGICPPFKGUEJYGFKUEJG/ÒP\RT·IWPIKP#WIUDWTI FQRRGNVGWPFGKPHCEJG&WMCVGPUQYKG 6CNGT (ÒTVJ'THWTVWPF0ÒTPDGTI  44




ERFURT &GVUXGPUMCFGNVCICPFGVKFGVDNQFKICVTGVVKQยนTKICMTKIGVVQIUKPDรŒTLCPPยทT)WUVCX++#FQNHNCPFUVGIXKF รŒUVGTULรŒMWUVGPOGFGPUXGPUMJยทTQEJUPCDDVVยนICFGPGTKNCPFGV5GIGTPXKF$TGKVGPHGNFXKUCFGCVV ลŒIWNFMQPWPIGPHTยนP0QTFGPลŒXCTGPHยทNVJGTTGCVVTยทMPCOGF/GPFGVDGJรŒXFGUO[EMGVRGPICTQEJFGV UQO KPVG GTJรŒNNU UQO UWDUKFKGT DN C HTยนP (TCPMTKMG  OยนUVG OCP ULยทNX NยนVC O[PVC 6[XยทTT ยทT FGV KPVG   CNNFGNGUUยทMGTVXCTXKUUCCXFGUUCO[PVUNQIU  +CNNCJยทPFGNUGTDยทTFGHรŒTUVCO[PVGPยนTVCNGV/CKP\UNQIDGV[FNKICOยทPIFGTIWNFQEJUKNXGTO[PV *ยทTUNQIUO[PVยทXGPQEJWVCPยนTVCN  HรŒT-TKUVKPC'PUGTKGKIWNFQEJUKNXGTWVCPCPIKXCPFG CXO[PVQTVHรŒTNยทIIUVKNN9ร’T\DWTIQEJVKNNXGTMCFGUCXPGFUOยทNVCJGNIQPDKNFGTย’TVCNGPยทTQEJ /ยนJยทPFC UNQIU JยทT QEMUยน TKMUMCPUNGT #ZGN 1ZGPUVKGTPCU UยทNNU[PVC VCNGT WVCP ยนTVCN ย’TVCNGV  DยทTU   QEMUยนCXGP)WUVCX++#FQNHUVCNGTUQOMCPXCTCUNCIGPK9GKOCT  /GFDรŒTLCPUMCNNXKPยทOPCO[PVQTVGTUQO#WIUDWTIOGFFWDDNCQEJGPMNCFWMCVGTQEJVCNGT(ร’TVJ 'THWTVUQOUXCTCTRยนHQTVUยทVVPKPIGPCX$TGKVGPHGNFUGTKGPKIWNFQEJUKNXGTQEJOยนPICCPFTCO[PV /[PVPKPICT ยทIFG TWO ยทXGP K 0ร’TPDGTI QEJ 1UPCDTร’EM K )WUVCX ++ #FQNHU PCOP FG UKUVPยทOPFC FQEM   RQUVJWOC  ;VVGTNKICTGPยนITCO[PVDNCGPFWMCVJCTQUยทMTCVKNNMQOUVQTVGT

5145

1,5:1



1,5:1

)WUVCX++#FQNH&WMCVCWHUGKPGP6QF2QUVJWOG2TยทIWPII#JNUVTรŒOC (D*CICPFGTXCT )1.&-N4CPFHGJNGTXQT\ร’INKEJGU'ZGORNCT

5146

5147



5148



&WMCVCWHUGKPGP6QF2QUVJWOG2TยทIWPII#JNUVTรŒOC(D*CICPFGTXCT  )1.&5GJTUEJรŒP





&WMCVCWHUGKPGP6QF2QUVJWOG2TยทIWPII#JNUVTรŒOC(D*CICPFGT  )1.&/KPIGYGNNVUGJTUEJรŒP





&WMCVCWHUGKPGP6QF2QUVJWOG2TยทIWPII#JNUVTรŒOC(D*CICPFGT  )1.&)GUVQRHVGU.QEJHCUVUGJTUEJรŒP



5149

5150



&WMCVCWHUGKPGP6QF2QUVJWOG2TยทIWPII#JNUVTรŒOF(D*CICPFGTXCT  )1.&.GKEJVG(CUUWPIUURWTGPUGJTUEJรŒP





&WMCVCWHUGKPGP6QF2QUVJWOG2TยทIWPII#JNUVTรŒOF(D*CICPFGT  )1.&'VYCUIGYGNNVOKP(CUUWPIUURWTGPUGJTUEJรŒP

 45


ERFURT

5152

5151



&WMCVCWHUGKPGP6QF2QUVJWOG2T·IWPII#JNUVTÌOF(D*CICPFGTXCT  )1.&*GPMGNURWTUGJTUEJÌP





&WMCVCWHUGKPGP6QF2QUVJWOG2T·IWPII#JNUVTÌOG(D*CICPFGT  )1.&.GKEJVG(CUUWPIUURWTGPWPF5EJTÌVNKPIUHGJNGTUGJTUEJÌP



5153



&QRRGNVGT4GKEJUVCNGTCWHUGKPGP6QF2QUVJWOG2T·IWPIIY)856Ü#&1.2*&Ü) 58'%Û)16Ü8#0&Ü4Û/Û24+%Û(+0&8:'56*10'6%#4'.Û&05+0)4+“&GT-ÌPKI OKVGTJQDGPGO5EJYGTVKPFGT4GEJVGPYKTFXQP\YGKIGHNÒIGNVGP2HGTFGPKPGKPGO6TKWORJYCIGPPCEJ NIG\QIGPQDGPJ·NVGKPGCWU9QNMGPMQOOGPFG*CPFGKPGP.QTDGGTMTCP\ÒDGTFCU*CWRVFGU-ÌPKIU KO #DUEJPKVV FKG <GKEJGP HÒT 5EJYGHGN WPF 3WGEMUKNDGT /ÒP\OGKUVGT\GKEJGP XQP *CPU 5EJPGKFGT   IGPCPPV 9GK­OCPVGN  \W FGP 5GKVGP FKG IGVGKNVG ,CJTGU\CJN Û    Û8+6#  /+*+  %*4+56    /145/'#&8.%'.8%48/2*+.2+8::+&GT-ÌPKINKGIVCWHGKPGO2CTCFGDGVVFCTÒDGT JCNVGP\YGK'PIGNGKPMNGKPGU/GPUEJGPDKNF FKG5GGNGFGU-ÌPKIU XQPQDGPVÌPVGUXQPFGO0COGP ,GJQXCU'7)'5'48'5(+&'.+5WOJGTCEJVXQP$CNFCEJKPGPDGFGEMVGQXCNG6CHGNPOKV8GTFKGPUVGP FGU-ÌPKIU#JNUVTÌO :4 &CX*KNFGDTCPF+5  8QPCNNGTITÌ­VGT5GNVGPJGKV8QT\ÒINKEJGU2TCEJVGZGORNCTOKVJGTTNKEJGT6ÌPWPI  'TYQTDGPXQT

46


ERFURT

5155

5154

5156



4GKEJUVCNGT2WTKOVCNGT#JNUVTÌOC&CX*CICPFGT

-N6WUEJG\KHHGTUGJTUEJÌP





4GKEJUVCNGT2WTKOVCNGT#JNUVTÌOC&CX*CICPFGT

 2T·IGUEJY·EJGHCUVUGJTUEJÌP





4GKEJUVCNGT2WTKOVCNGT#JNUVTÌOD&CX*CICPFGT

5GJTUEJÌP



%JTKUVKPC&WMCVI#JNUVTÌO(D*CICPFGTXCT  )1.&/KPIGYGNNVUGJTUEJÌPpXQT\ÒINKEJ



5157



5158

&KG <WYGKUWPI FKGUGT WPF FGT HQNIGPFGP XKGT /ÒP\GP PCEJ 'THWTV KUV WOUVTKVVGP GU YKTF CWEJ 5VGVVKP QFGT GKP   PQTFYGUVFGWVUEJGT/ÒP\QTVKP'TY·IWPIIG\QIGP



&WMCVI#JNUVTÌO(D*CICPFGT  )1.&-N*GPMGNURWTOKPIGYGNNVUGJTUEJÌP

5159



5160

1,5:1



&WMCVI#JNUVTÌOC(D*CICPFGT  )1.&/KPIGYGNNVHCUVXQT\ÒINKEJGU'ZGORNCT





&WMCVI#JNUVTÌOC(D*CICPFGT  )1.&/KP*GPMGNURWTGVYCUWPTGIGNO·­KIGT5EJTÌVNKPIUGJTUEJÌP

 47


MAINZ

5161



4GKEJUVCNGT#JNUVTรŒO&CX*CICPFGTXCT  #VVTCMVKXGU'ZGORNCTOKVHGKPGT6รŒPWPIUGJTUEJรŒPpXQT\ร’INKEJ



&#5'4<$+567//#+0<

5162

1,5:1



1,5:1

)WUVCX++#FQNH&WMCV/CKP\I/KV5KIPCVWT*' /ร’P\OGKUVGT*CPU,CMQD #[TGT  CO 'PFG FGT 4ร’EMUGKVGPWOUEJTKHV #JNUVTรŒO  (D  D *CICPFGT  5NI 9CNVJGT    NGKEJVXCT )1.&47PTGIGNOยทยญKIGT5EJTรŒVNKPIHCUVXQT\ร’INKEJ 

5163



48

&WMCV/CKP\I/KV5KIPCVWT*# /ร’P\OGKUVGT*CPU,CMQD#[TGT CO'PFGFGT4ร’EMUGK VGPWOUEJTKHV#JNUVTรŒO(DD*CICPFGT5NI9CNVJGTp  )1.&44-N*GPMGNURWTMN&TWEMUVGNNGPUGJTUEJรŒP




WÜRZBURG

5165

5164 1,5:1



&WMCV/CKP\I#JNUVTÌOC(D FQTVWPVGT0ÒTPDGTI *CICPFGT5NI9CNVJGTp )1.&44(CUUWPIUURWTGP(GNFGTIGIN·VVGVUGJTUEJÌP





'KPUGKVKIGT*GNNGTQ,/CKP\I#JNUVTÌO 4 5NI9CNVJGTp  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



'TYQTDGPXQT

&#5$+567/9ª4<$74)

5166



)WUVCX++#FQNH&WMCV9ÒT\DWTII#JNUVTÌO(D*CICPFGT *GNOUEJTQVV )1.&-N*GPMGNURWTOKPIGYGNNVUGJTUEJÌP



'ZGORNCTFGT.CIGTNKUVG*QNODGTI5VQEMJQNO0T UEJYGFKUEJG-TQPGP 

5167



4GKEJUVCNGT  9ÒT\DWTI /KV MNGKPGT ,CJTGU\CJN ÒDGT FGO 9CRRGP #JNUVTÌO  E &CX  $   *CICPFGT*GNOUEJTQVV -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 49


WÜRZBURG

5168

5169



4GKEJUVCNGT  9ÒT\DWTI /KV MNGKPGT ,CJTGU\CJN ÒDGT FGO 9CRRGP #JNUVTÌO  E &CX  $   *CICPFGTXCT*GNOUEJTQVV -N2T·IGUEJY·EJGUGJTUEJÌP





4GKEJUVCNGT9ÒT\DWTI/KVITQ­GT,CJTGU\CJNÒDGTFGO9CRRGP#JNUVTÌOEXCT&CX# *CICPFGT*GNOUEJTQVVp *GPMGNURWTUGJTUEJÌP



5170

5170 1,5:1



4GKEJUMCP\NGT#ZGN1ZGPUVKGTPC4GKEJUVCNGTQ,  9ÒT\DWTII+Û&Ü &Ü#:'.Û1:'056+'40#Û.Û$Û+-Û&Û+Û(Û6Û'Û4Û58Û%Û.')Ü+Ü)Ü5Ù(ę&Ü '8 Ü &+4 Û $TWUVDKNF HCUV X X OKV WOIGNGIVGO /CPVGN 5RKV\GPMTCIGP WPF 1TFGP FCTWPVGT UGKP   9CRRGPUEJKNF DGFGEMV XQP GKPGT (TGKJGTTGPMTQPG41$14' Û &+8+01 Ü %1410#685 8+0%+6 Û   .'1 &GT IGMTÌPVG UEJYGFKUEJG .ÌYG UEJTGKVGV PCEJ N OKV -TQPG WPF 5EJYGTV QDGP FGT UVTCJNGPFG   0COG,GJQXCU#JNUVTÌO 4 &CX*CICPFGT*GNOUEJTQVVp  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIMN6WUEJG\KHHGTXQT\ÒINKEJ  'TYQTDGPXQT



#ZGN )WUVCHUUQP 1ZGPUVKGTPC YWTFG CO  ,WPK  CWH FGT +PUGN (¹PÌ DGK 7RRUCNC IGDQTGP 0CEJ UGKPGO 5VW   FKWO KP &GWVUEJNCPF 4QUVQEM 9KVVGPDGTI ,GPC  OCEJVG GT GKPG UVGKNG RQNKVKUEJG -CTTKGTG WPF YWTFG DGTGKVU CNU   5VWFGPVKO,CJTKPFGPUEJYGFKUEJGP4GKEJUTCVDGTWHGP5EJQPCO,CPWCTYWTFGGTXQP-ÌPKI)WUVCX ++#FQNHKO#NVGTXQPPWT,CJTGP\WOUEJYGFKUEJGP4GKEJUMCP\NGTGTPCPPVWPFPCJOWOHCUUGPFG\WMWPHVUYGK UGPFG8GTYCNVWPIUTGHQTOGPKP#PITKHH0GDGPFKGUGPCFOKPKUVTCVKXGP.GKUVWPIGPGT\KGNVG#ZGN1ZGPUVKGTPCCWEJCNU &KRNQOCV CW­GTQTFGPVNKEJG 'THQNIG 5Q YCT GT OC­IGDNKEJ CP FGP (TKGFGPUUEJNÒUUGP XQP -P·TGF OKV &·PGOCTM  

 5VQNDQYQOKV4W­NCPF  #NVOCTMOKV2QNGP  $TÌOUGDTQOKV&·PGOCTM  UQYKGCO9GUV H·NKUEJGP(TKGFGPXQPDGVGKNKIV  0CEJFGO6QF)WUVCXU++#FQNHCWHFGO5EJNCEJVHGNFDGK.ÒV\GPCO0QXGODGTÒDGTPCJO4GKEJUMCP\NGT #ZGN1ZGPUVKGTPCUQHQTVFKG4GIKGTWPIHÒTFKGGTUVUGEJUL·JTKIG6JTQPHQNIGTKP%JTKUVKPC+O,CJTUEJNQ­1ZGP UVKGTPC \YKUEJGP 5EJYGFGP WPF FGP 'XCPIGNKUEJGP5V·PFGP&GWVUEJNCPFUFGP*GKNDTQPPGT$WPFCNUFGUUGP#PHÒJ TGT GT CWH FGO XQTNKGIGPFGP 6CNGT CWUFTÒEMNKEJ IGPCPPV YKTF #WEJ PCEJ FGT 8QNNL·JTKIMGKV FGT -ÌPKIKP DNKGD   1ZGPUVKGTPCDKU\WUGKPGO6QFCO#WIWUVKP5VQEMJQNOKP#OVWPF9ÒTFGP  'KPGP DGUQPFGTU GKPFTWEMUXQNNGP $GNGI HÒT FKG -QORGVGP\ WPF FCU #PUGJGP FCU FGT 4GKEJUMCP\NGT DGUC­ KUV FGT   JKGT \WT 8GTUVGKIGTWPI IGNCPIGPFG UGJT UGNVGPG 6CNGT FGT MGKPGP TGIKGTGPFGP /QPCTEJGP UQPFGTP GKPGP 2QNKVKMGT   \GKIV &KGU KUV GKPOCNKI KP FGT /ÒP\IGUEJKEJVG FGT HTÒJGP GWTQR·KUEJGP 0GW\GKV &KG 6KVWNCVWT #ZGN 1ZGPUVKGTPCU   NCWVGV + NNWUVTKUUKOWU  & QOKPWU  & QOKPWU  #:'. KWU  1:'056+'40# . KDGT  $ CTQ  + P  - KOKVQ  & QOKPWU    + P  ( KJQNO  6 KFÌ  ' SWGU  4 GIPK  58 GEKCG  % CPEGNNCTKWU  .') CVWU  + P  ) GTOCPKC  5 WRTGOWU  (1'& GTKU    '8 CPIGNKEK &+4 GEVQT  &GTJÌEJUVDGTÒJOVG*GTT*GTT#ZGN1ZGPUVKGTPC(TGKJGTT\W-KOKVQ*GTT\W(KJQNO

WPF 6KFÌ4KVVGT-CP\NGTFGU-ÌPKITGKEJGU5EJYGFGPJÌEJUVGT)GUCPFVGTKP&GWVUEJNCPF#PHÒJTGTFGU'XCPIGNK UEJGP $WPFGU  &KG 4ÒEMUGKVGPNGIGPFG DGOGTMV \WO FCTIGUVGNNVGP UEJYGFKUEJGP .ÌYGP 41$14' &+8+01   %1410#6858+0%+6.'1 /KVIÌVVNKEJGT-TCHVIGMTÌPVUKGIVFGT.ÌYG  

50


AUGSBURG &+'56#&6(ª46*

5171



)WUVCX++#FQNH-TGW\GT#JNUVTÌO 4   445EJTÌVNKPIUHGJNGTCO4CPFHCUVUGJTUEJÌP



&+'56#&6#7)5$74)

5172

5173

1,5:1



)WUVCX++#FQNH&WMCVRQUVJWOG2T·IWPII#JNUVTÌO(D(QTUVGT *CICPFGT )1.&44.GKEJVG(CUUWPIUURWTGPUGJTUEJÌP





&WMCV  RQUVJWOG 2T·IWPI  I #JNUVTÌO  (D  FQTV HCNUEJG 8QTFGTUGKVGPCDDKNFWPI    (QTUVGT*CICPFGT )1.&4.GKEJVG(CUUWPIUURWTGP)TCHKVVKUGJTUEJÌP

 51


HESSEN

5174



&QRRGNVGT4GKEJUVCNGTRQUVJWOG2T·IWPII&GTIGJCTPKUEJVG-ÌPKITGKVGVNKPFGT4GEJ VGP -QOOCPFQUVCD KO *KPVGTITWPF FKG 5VCFVCPUKEJV XQP #WIUDWTI)GMTÌPVGU XGT\KGTVGU XKGTHGNFKIGU   9CRRGP OKV /KVVGNUEJKNF \YKUEJGP    WOJGT  IGMTÌPVG 9CRRGP FGT UEJYGFKUEJGP 2TQXKP\GP   #JNUVTÌO FQTV/ÒP\UV·VVG5VQEMJQNO &CX(QTUVGTp*KNFGDTCPF+5  44.GKEJVG(CUUWPIUURWTGPUGJTUEJÌP  'TYQTDGPXQT



9KG UEJQP KO -CVCNQI FGT DGFGWVGPFGP 5COONWPI UEJYGFKUEJGT /ÒP\GP XQP -CTN'TKM 5EJOKV\ #WMVKQP 5EJYGK   \GTKUEJGT $CPMXGTGKP WPF 5RKPM  5QP <ÒTKEJ  0T  DGOGTMVYWTFGJCPFGNVGUUKEJDGKFGTJKPVGTFGO TGKVGPFGP 5EJYGFGPMÌPKI FCTIGUVGNNVGP 5VCFV WO #WIUDWTI 1DYQJN $LCTPG #JNUVTÌO FKG /ÒP\G FGP UEJYGFKUEJGP   4GKEJURT·IWPIGP WPF FGT /ÒP\UV·VVG 5VQEMJQNO \WIGQTFPGV JCV KUV GU YCJTUEJGKPNKEJ FC­ GU UKEJ WO GKPG #WIU   DWTIGT2T·IWPIJCPFGNV 

'+05%*9'&+5%*'5/#4-56ª%- /+6'+0'/)')'056'/2'.&'456#&6564#55$74)

5175



3:1

5175

5EJYGFGP -ÌPKITGKEJ -CTN :+   /CTM  5VQEMJQNO OKV )GIGPUVGORGN FGT5VCFV 5VTC­DWTICWHFGT4ÒEMUGKVG.KNKGÒDGTFGWVUEJGO5VCFVUEJKNF#JNUVTÌO /ÒP\G (TKGFGTKEJ XIN HH)GIGPUVGORGN  5GJTUEJÌP



'TYQTDGPXQT

'+0*#.$'4&7-#6&'55%*9'&+5%*'0-¤0+)5 (4'&'4+-+#.5.#0&)4#(810*'55'0

1,5:1

 52

5176

1,5:1

*GUUGP-CUUGN(TKGFTKEJ+&WMCV-CUUGNI'FGTIQNF(D5EJÒV\ )1.&8QT\ÒINKEJ




LUTHER UND REFORMATION

/ª0<'070&/'&#+..'0<7/6*'/# .76*'470&4'(14/#6+10

5177



5VCFV /CIFGDWTI  4GKEJUVCNGT  CWH FKG ,CJTHGKGT FGT 4GHQTOCVKQP 5NI 9JKVKPI p   X5EJT 8QPITQ­GT5GNVGPJGKV/KVCNVGO*GPMGNUGJTUEJÌP



'ZGORNCTFGT5NI'TDUVGKP

5178



-ÌPKITGKEJ 5EJYGFGP -CTN :+  5KNDGTOGFCKNNG Q ,   XQP # -CTNUVGGP CWH FGP   4GHQTOCVQT /CTVKP .WVJGT $TWUVDKNF /CTVKP .WVJGTU T OKV WOIGNGIVGO /CPVGN'KPG CWU 9QNMGP   MQOOGPFG*CPFJ·NVGKP*GT\QDGPUVTCJNGPFG5QPPGOOI5NI9JKVKPI5VGPUVTÌO

00’  48QT\ÒINKEJ



5180

5179





5179

5VCFV*CODWTI5KNDGTOGFCKNNGXQP&)XQP*CEJVGPCWHFKG,CJTHGKGTFGT4GHQTOCVKQP 'KPG )CPU CO $TCVURKG­ ÒDGT QHHGPGO (GWGT5EJYKOOGPFGT 5EJYCP /KV 4CPFUEJTKHV  OO   I)CGF5NI9JKVKPI 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



*GT\QIVWO5CEJUGP5CCNHGNF,QJCPP'TPUV8+++4GKEJUVCNGT5CCNHGNFCWHFKG ,CJTHGKGTFGT4GHQTOCVKQP-Q\KPQYUMK1VVQ4W­5NI9JKVKPI  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 53


DREISSIGJÄHRIGER KRIEG

5181

5181 1,5:1



)TCHUEJCHV 5VQNDGTI %JTKUVQH (TKGFTKEJ WPF ,QUV %JTKUVKCP  5KNDGTOGFCKNNG    5VQNDGTI CWH FKG ,CJTHGKGT FGT 4GHQTOCVKQP #WUDGWVG FGT 5VTC­DGTIGT )TWDGP $TWUVDKNF /CTVKP   .WVJGTU T OKV WOIGNGIVGO /CPVGN#WH FGO JÌEJUVGP $GTI UVGJV GKP *KTUEJ PCEJ N OKV GTJQDGPGO   NKPMGP8QTFGTNCWHXQTIGMTÌPVGT5·WNGFCTWPVGT)GDKTIUNCPFUEJCHVWPFXGTUEJKGFGPG$GTIYGTMUFCTUVGN NWPIGPWPVGPDQIKI51%Ù564#5$'4)'0ÛOOI(TKGFGTKEJ/ÒUGNGT 5NI9JKVKPI 44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 



.QV -NGKPG 5GTKG XQP /GFCKNNGP FGU  ,CJTJWPFGTVU CWH ,QJCPPGU *WU /CTVKP .WVJGT WPF FKG   4GHQTOCVKQPFCTWPVGTGKP0ÒTPDGTIGT&WMCVCWHFKG,CJTHGKGTFGT4GHQTOCVKQP 5NI9JKVKPI IGNQEJV  5VÒEM(CUVUGJTUEJÌPpXQT\ÒINKEJ



24)70)'0/+6$'<7)<7/&4'+55+),*4+)'0-4+')

5183



#NDTGEJV 9CNNGPUVGKP  *GT\QI XQP (TKGFNCPF 4GKEJUVCNGT  ,KVUEJKP &CX    /G[GT0QJGLNQX±2T±VQX± 445GJTUEJÌP  #NDTGEJV XQP 9CNNGPUVGKP IGDQTGP CO  KO DÌJOKUEJGP *GTOCPKV\ GPVUVCOOVG FGT TGKEJGP RTQVGUVCPVK   UEJGP DÌJOKUEJGP #FGNUHCOKNKG XQP 9CNFUVGKP 7O  VTCV #NDTGEJV PCEJ GTUVGP -TKGIUGTHCJTWPIGP IGIGP FKG   6ÒTMGP \WO -CVJQNK\KUOWU ÒDGT 'T WPVGTUVÒV\VG -CKUGT (GTFKPCPF ++ Y·JTGPF FGU $ÌJOKUEJGP #WHUVCPFGU WPF   XGTOGJTVG FWTEJ FGP 'TYGTD XQP \CJNTGKEJGP )ÒVGTP FGT IG·EJVGVGP #WHUV·PFKUEJGP UGKPGP 4GKEJVWO DGVT·EJVNKEJ   0CEJ FGT 'TJGDWPI KP FGP (ÒTUVGPUVCPF  YWTFG 9CNNGPUVGKP  *GT\QI XQP (TKGFNCPF WPF TKEJVGVG UGKPG   4GUKFGP\KP,KVUEJKPGKP+OINGKEJGP,CJTUVGNNVGGTCWHGKIGPG-QUVGPGKP*GGTXQP/CPP\WT7PVGTUVÒV\WPI FGT MCVJQNKUEJGP .KIC IGIGP &·PGOCTM CWH  MCWHVG GT FCU *GT\QIVWO 5CICP WPF \QI OKV 6KNN[ PCEJ 0QTF   FGWVUEJNCPF'TDGUGV\VG/GEMNGPDWTIWPF2QOOGTP OKV#WUPCJOGFGUXGTIGDNKEJDGNCIGTVGP5VTCNUWPF WPFYWTFG  \WO )GPGTCN FGU Q\CPKUEJGP WPF $CNVKUEJGP /GGTGU GTPCPPV +O (TKGFGP XQP .ÒDGEM OKV &·PGOCTM    GTJKGNV#NDTGEJVFKGOGEMNGPDWTIKUEJGP*GT\QIVÒOGTCNUMCKUGTNKEJGU.GJGP  &KG /CEJVHÒNNG 9CNNGPUVGKPU WPF UGKPG WPFWTEJUKEJVKIGP 8GTJCPFNWPIGP OKV 5CEJUGP WPF 5EJYGFGP DGNCUVGVGP   LGFQEJ FCU 8GTJ·NVPKU -CKUGT (GTFKPCPFU ++ \W UGKPGO DGFGWVGPFUVGP (GNFJGTTP \WPGJOGPF #O  ,CPWCT    YWTFG KP 9KGP FKG #DUGV\WPI 9CNNGPUVGKPU DGUEJNQUUGP WPF OKV GKPGT 8GTUEJYÌTWPI IGIGP FGP -CKUGT DGITÒPFGV   &GT IGPKCNG *GGTHÒJTGT FGT DGTGKVU  FCU /ÒP\TGEJV GTJCNVGP WPF WOHCUUGPF CWUIGÒDV JCVVG YWTFG CO    (GDTWCT  KO DÌJOKUEJGP 'IGT GTOQTFGV WPF FGT ITÌ­VG 6GKN UGKPGT 2T·IWPIGP YWTFG MQPHKU\KGTV WPF   GKPIGUEJOQN\GP

54


DREISSIGJÄHRIGER KRIEG

5184



5VCFV0ÒTPDGTI5KNDGTCDUEJNCIXQPFGP5VGORGNPFGTFTGKHCEJGP&WMCVGPMNKRRGCWHFGP(TKGFGPU GZGMWVKQPUJCWRVTG\G­I-GNNPGT#PO5NI'TNCPIGT  -N*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ



1,5:1

5185



*GT\QIVWO 5CEJUGP9GKOCT 9KNJGNO  4GKEJUVCNGT  9GKOCT CWH FKG HGKGTNKEJG   ªDGTHÒJTWPI FGT )GDGKPG UGKPGU $TWFGTU FGU  KP 0GWGPDWTI IGUVQTDGPGP *GT\QIU $GTPJCTF CWU   FGTRTQXKUQTKUEJGP4WJGUV·VVGKO$TGKUCEJGT/ÒPUVGTPCEJ9GKOCT&CX5EJPGG  44-N<CKPGPFGXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  $GTPJCTF *GT\QI XQP 5CEJUGP9GKOCT IKNV CNU FGT YQJN DGFGWVGPFUVG FGWVUEJG RTQVGUVCPVKUEJG (GNFJGTT FGU &TGK   ­KIL·JTKIGP-TKGIGU&GTCO#WIWUVKP9GKOCTIGDQTGPG*GT\QIUEJNQ­UKEJPCEJGKPKIGP5VWFKGPOQPCVGP KP,GPCFGPRTQVGUVCPVKUEJGP6TWRRGPCPWPFHQEJVDGK9KGUNQEJWPF9KORHGP#NU)GPGTCN)WUVCX#FQNHUXQP 5EJYGFGP JKGNV $GTPJCTF  FKG GTQDGTVGP 4JGKPNCPFG PCJO CO 5VWTO CWH 9CNNGPUVGKPU .CIGT VGKN WPF DGJCWR   VGVG PCEJ FGO 6QF )WUVCX #FQNHU FCU 5EJNCEJVHGNF DGK .ÒV\GP 0CEJ FGO 8GTNWUV XQP 4GIGPUDWTI  YWTFG   $GTPJCTF DGK 0ÌTFNKPIGP XGTPKEJVGPF IGUEJNCIGP WPF XGTNQT UGKP *GT\QIVWO +P FGP DGKFGP HQNIGPFGP ,CJTGP   M·ORHVG GT OKV HTCP\ÌUKUEJGP 8GTDÒPFGVGP OKV YGEJUGNPFGP 'THQNIGP XQT CNNGO KP .QVJTKPIGP UEJNWI  FKG   MCKUGTNKEJGP 6TWRRGP DGK 4JGKPHGNFGP WPF PCJO PCEJ OGJTOQPCVKIGT $GNCIGTWPI CO  &G\GODGT  $TGKUCEJ   GKP YQTCWH FKG XQTNKGIGPFG /GFCKNNG $G\WI PKOOV 0CEJ FGP #PUVTGPIWPIGP FGT (GNF\ÒIG GTNCI $GTPJCTF CO    ,WNK  DGK 0GWGPDWTI CO 4JGKP GKPGT MWT\GP -TCPMJGKV 'TUV KO ,CJT  YWTFGP UGKPG )GDGKPG CWU FGO   DCFKUEJGP 0GWGPDWTI PCEJ 9GKOCT ÒDGTHÒJTV &GT CWH FGT 4ÒEMUGKVG NGUDCTG 6GZV GPVJ·NV FGP *KPYGKU FC­ FKG   $GKUGV\WPIKO,WDKN·WOULCJTFGU#WIUDWTIGT4GNKIKQPUHTKGFGPUUVCVVHCPF

55


MEDAILLEN

&+8'45'/'&#+..'0#75&'4 5#//.70)&'4(4'+*'44'0$10&' /'+56/+6$'<7)<75%*9'&'0

5187

5186

5186



4GNKIKQP 5KNDGTOGFCKNNG Q , WO   XQP ' *CPPKDCN ,GUWU OKV &QTPGPMTQPG CNU )GHCPIGPGT   FCTIGUVGNNV UVGJV OKV IGUGPMVGO -QRH WPF WOIGNGIVGP /CPVGN JCNDT&CU .COO )QVVGU UVGJV PCEJ T   XQTDTGPPGPFGO#NVCTOOI(QTTGTp5NI)QRRGNp 45GJTUEJÌPGU'ZGORNCT



.CPFITCHUEJCHV*GUUGP-CUUGN-CTN 5KNDGTOGFCKNNGXQP+.G%NGTECWHFGP6QF UGKPGT)GOCJNKP/CTKC#OCNKC

/KVCWÓ9GKNOÒPUVGT6QEJVGTFGU$KUEJQHU,CMQD-GVVNGT  $TWUVDKNF /CTKC #OCNKCU T OKV WOIGNGIVGO /CPVGN <GKNGP 5EJTKHV QDGP 4QUGVVG \YKUEJGP &TGK   DN·VVGTPOOI*QHHOGKUVGTp5EJÒV\p5NI/KPWU2TGKUUp  8QPITÌ­VGT5GNVGPJGKV8GTOWVNKEJWPGFKGTV/KP4CPFHGJNGTUGJTUEJÌP



&GT/GFCKNNGWT'JTGPTGKEJ*CPPKDCNYWTFGCO#RTKNKP5VQEMJQNOIGDQTGPWPFYWTFG5EJÒNGTFGUCW­GT QTFGPVNKEJCMVKXGP5VGORGNUEJPGKFGTU#TXKF-CTNUVGGP+O,CJTVTCV*CPPKDCNKPFKG&KGPUVGFGU-WTHÒTUVGPXQP *CPPQXGTKO,CJTYWTFGGT\WO/ÒP\OGKUVGTKP%NCWUVJCNGTPCPPV



.CPFITCH-CTNWPFUGKPG)GOCJNKP/CTKC#OCNKCDTCEJVGPCO#RTKNCNUGTUVGU-KPFKJTGP5QJP(TKGFTKEJ \WT 9GNV FGT CO  /CK  FKG 2TKP\GUUKP .WKUG XQP $TCPFGPDWTI JGKTCVGVG 0CEJ FGTGP HTÒJ\GKVKIGP 6QF KO   #NVGT XQP PWT  ,CJTGP   FCWGTVG GU HCUV \GJP ,CJTG DKU (TKGFTKEJ \WO \YGKVGP /CN JGKTCVGVG WPF \YCT CO   #RTKNFKGUEJYGFKUEJG2TKP\GUUKP7NTKMC'NGQPQTC5EJYGUVGTFGUMKPFGTNQUGP-ÌPKIU-CTN:++0CEJFGO6QF FGUUEJYGFKUEJGP-ÌPKIU-CTN:++CO0QXGODGTDGKFGTPQTYGIKUEJGP(GUVWPI(TGFGTKMUVGPHQNIVG7NTKMC 'NGQPQTC CNU UEJYGFKUEJG -ÌPKIKP PCEJ $GTGKVU  FCPMVG UKG \WIWPUVGP KJTGU 'JGOCPPGU CD FGT 5EJYGFGP DKU   \WUGKPGO6QFCO/·T\TGIKGTGPUQNNVG

5188



56

5VCFV #OUVGTFCO 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 5KNDGTJQEJ\GKV FGU -CWHOCPPU WPF /ÒP\   RTQDKGTGTU KP FGT #OUVGTFCOGT $CPM #PVQP )TKNN WPF UGKPGT )GOCJNKP 'NKUCDGVJ )TKNN &TGK )GPKGP   GKPGTKPUVTCJNGPFGP9QNMGPUEJYGDGPFJCNVGPFKGTÌOKUEJG<CJN::8ÒDGTGKPGP#NVCTOKV\YGKDTGP PGPFGP*GT\GP\WFGP5GKVGPLGGKP(ÒNNJQTPOKV/ÒP\GPWPF$NWOGP<GJP<GKNGP5EJTKHVQDGPFCU 9CRRGPFGU-CWHOCPPU)TKNNOOI*[EMGTV:8++5-2-pX.QQPp  48QT\ÒINKEJ #PVQP)TKNNYCTIGDÒTVKIGT5VQEMJQNOGTWPFGOKITKGTVGPCEJ*QNNCPF




MEDAILLEN

5189

5190





-ÌPKITGKEJ &·PGOCTM (TGFGTKM 8  5KNDGTOGFCKNNG  XQP / ) #TDKGP CWH FGP   UEJYGFKUEJGP )GUCPFVGP CO F·PKUEJGP *QH (TGKJGTT 1VVQ (NGOKPI )GJCTPKUEJVGU $TWUVDKNF T OKV   WOIGNGIVGO /CPVGN&CU 9CRRGP (NGOKPIU XQO -QOOCPFGWTUDCPF FGU 5EJYGTVQTFGPU OKV 1TFGPU   \GKEJGP WOIGDGP CWH .ÌYGPHGNNOKV(TGKJGTTGPMTQPGOOI)CNUVGT5#PO *[EMGTV:8++5 (GKPG6ÌPWPIXQT\ÒINKEJ



-CKUGTTGKEJ4W­NCPF#NGZCPFGT+$TQP\GOGFCKNNGQ,  XQP.2.WPFITGPCWHFGP TWUUKUEJGP)GUCPFVGPCOUEJYGFKUEJGP*QH,QJCPP2GVGTXQP5WEJVGNGP  $ÒUVGXQP5WEJ VGNGPUT6'55'4##/+%+6+#'OO$QUVTÌO+5&KCMQXp*[EMGTVp9WT\DCEJp (GKPG6ÌPWPIXQT\ÒINKEJ



5191







5190

5192

5193

)TQ­JGT\QIVWO1NFGPDWTI0KEQNCWU(TKGFTKEJ2GVGT5KNDGTOGFCKNNGXQP#.KPF DGTICWHFGP)GDWTVUVCIUGKPGULÒPIGTGP$TWFGTU'NKOCTCO,CPWCT)GMTÌPVGU/QPQITCOOKP 5VTCJNGP5GEJU<GKNGP5EJTKHVÒDGT.QTDGGT\YGKIGPOOI  8QPITQ­GT5GNVGPJGKV5VGORGNINCP\



-ÌPKITGKEJ5CEJUGP#NDGTV5KNDGTOGFCKNNGXQP#.KPFDGTICWHFGP)GDWTVUVCI UGKPGT )GOCJNKP -ÌPKIKP %CTQNC 7PKHQTOKGTVGU $TWUVDKNF KJTGU 8CVGTU 2TKP\ )WUVCH XQP 9CUC T  #EJV <GKNGP 5EJTKHV KP .QTDGGT\YGKI QDGP -TQPG  OO  I *[EMGTV :+++ 5     5NI/GTUGDp 5VGORGNINCP\



-ÌPKITGKEJ 5CEJUGP #NDGTV  5KNDGTOGFCKNNG  XQP # .KPFDGTI CWH FGP $GUWEJ FGU   -ÌPKIRCCTGU KO UEJYGFKUEJGP 4¹FC )GMTÌPVGU /QPQITCOO KP 5VTCJNGP5KGDGP <GKNGP 5EJTKHV WPVGT   5VGTPOOI*[EMGTV:+++55NI/GTUGDp 45VGORGNINCP\

 57


MEDAILLEN

5194



-ÌPKITGKEJ 5CEJUGP #NDGTV  5KNDGTOGFCKNNG  XQP # .KPFDGTI CWH FGP $GUWEJ FGU   -ÌPKIURCCTGUKP5EJYGFGPKO5QOOGTWPFFGP$GUWEJXQP8KUD[CO,WNK<GJP<GKNGP 5EJTKHV+PPGPCPUKEJV XQP 5V .CWTGPVKK KP 8KUD[  OO  I *[EMGTV :+++ 5     5NI/GTUGDp 8QT\ÒINKEJ



5195



-ÌPKITGKEJ)TQ­DTKVCPPKGP'FYCTF8++5KNDGTOGFCKNNGXQP#9[QPCWHFKG-QP HGTGP\FGT+PVGTRCTNCOGPVCTKUEJGP7PKQPKO9GUVOKPUVGTRCNCUV$ÒUVGN9GKDNKEJG)GUVCNVUVGJVPCEJT KPFGTCWUIGUVTGEMVGP.KPMGPJ·NVUKGGKPGP.QTDGGTMTCP\ÒDGTUGEJU<GKNGP5EJTKHVFKG4GEJVGCWHGKPGP #NVCTIGNGJPVOOI'KOGT 8QT\ÒINKEJ



5196



58

-ÌPKITGKEJ5EJYGFGP)WUVCX85KNDGTRNCMGVVGXQP50KNUUQPCWHFGP$GUWEJFGU UEJYGFKUEJGP-ÌPKIURCCTGUKP2CTKU&KG$TWUVDKNFGTFGU-ÌPKIURCCTGUPGDGPGKPCPFGTNKO#DUEJPKVV -TQPGP WPF 5EJTKHVDCPF OKV /'& (1.-'6  (¤4  (156'4.#0&'6)GMTÌPVGU \YGKHGNFKIGU   9CRRGP CWH .QTDGGT\YGKIGP ÒDGT UKGDGP <GKNGP 5EJTKHV QDGP FKG 5VCFVCPUKEJV XQP 2CTKU  OO   I 8QT\ÒINKEJ




MEDAILLEN

5197



-ÌPKITGKEJ5EJYGFGP)WUVCX85KNDGTOGFCKNNGXQP50KNUUQPCWHFKG'TDCWWPI FGT UEJYGFKUEJGP -KTEJG KP 2CTKU #PUKEJV FGT -KTEJG5GEJU <GKNGP 5EJTKHV /KV 4CPFRWP\G 2WP\G    #4)'06 2WP\G OOI 8QT\ÒINKEJ



5198



-ÌPKITGKEJ5EJYGFGP)WUVCX8$TQP\GOGFCKNNGXQP50KNUUQPCWHFKG8QNNGP FWPIFGTUEJYGFKUEJGP-KTEJGKP2CTKU$ÒUVGN#PUKEJVFGT-KTEJGQDGP&'151.+).14+#/KV 4CPFRWP\G 2WP\G $410<'OO 8QT\ÒINKEJ



5199





-ÌPKITGKEJ0KGFGTNCPFG9KNJGNOKPC$TQP\GRNCMGVVGXQP$GIGGTCWHFKG-QP HGTGP\FGT+PVGTRCTNCOGPVCTKUEJGP7PKQPKP&GP*CCI/GFCKNNQPOKVFGO2QTVT·VFGT-ÌPKIKPWOJGT $NWOGPIGDKPFG \W FGP 5GKVGP FKG 9CRRGP FGT 0KGFGTNCPFG WPF &GP *CCIU#PUKEJV FGU (TKGFGPU   RCNCUVGUZOO9WT\DCEJ 8QT\ÒINKEJ



.QV5GTKGXQPFTGK/ÒP\GPWPFUKGDGP/GFCKNNGP5EJYGK\$KUVWO%JWT$NW\IGT'KFIGPQUUGP UEJCHV(TCPMGP6QUECPC2CQNQ(TCPMTGKEJ$TQP\GOGFCKNNG2TGW­GP6TCIDCTG /GUUKPIOGFCKNNG  /CPÌXGT  (TCPMTGKEJ $TQP\GOGFCKNNG   +PVGTPCVKQPCNGT -QPITG­ FGU   2CTKUGT6KGTUEJWV\XGTGKPU $GNIKGP$TQP\GOGFCKNNG +PVGTRCTNCOGPVCTKUEJGT-QPITG­KP$TÒU UGN  2TGW­GP $TQP\GRNCMGVVG   +PVGTRCTNCOGPVCTKUEJGT -QPITG­ KO $GTNKPGT 4GKEJUVCI  UQYKG   \YGKGKPUGKVKIG-NKUEJGGUXQP2GTUQPGPOGFCKNNGPFGU,CJTJWPFGTVU 5VÒEM/GKUVXQT\ÒINKEJ

 59


16 Figuren aus der Affenkapelle. Meißen, die Modelle von J.J. Kaendler und P. Reinicke, um 1753, Ausformungen ab 1753 - ca. 1780. Auktion am 15. Mai 2009

Einladung zu Einlieferungen Herbstauktionen 2009 in Köln Antiquarische Bücher, Alte Kunst und Kunstgewerbe Moderne und Zeitgenössische Kunst, Photographie sowie Asiatische Kunst

LEMPERTZ gegründet 1845

Neumarkt 3 50667 Köln Poststraße 22 10178 Berlin www.Lempertz.com

Tel. 02 21 ⁄ 92 57 29 - 0 Fax - 6 Tel. 030 ⁄ 27 87 60 8 -0 Fax - 6 info@Lempertz.com


HINWEISE FÜR UNSERE BIETENDEN AUKTIONSKUNDEN 1. Die Auktionsbedingungen finden Sie am Ende dieses Katalogs. 2. Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. 3. Das beiliegende Formular macht es Ihnen leicht, ein schriftliches Gebot abzugeben. Falls Sie Ihre Gebote faxen möchten: unser Telefax 05 41-96 20 222 steht Ihnen Tag und Nacht zur Verfügung. 4. Die von Ihnen ersteigerten Objekte werden Ihnen innerhalb von acht Tagen nach Beendigung der Auktion zugeschickt. Die Aufträge werden in der Reihenfolge des Eingangs bearbeitet, d. h. die zuerst eingegangenen Aufträge werden auch zuerst bearbeitet. Auch alle Bieter, die keinen Zuschlag erhalten haben, werden von uns nach der Auktion benachrichtigt. 5. Wenn Sie telefonisch bieten möchten, teilen Sie uns diesen Wunsch bitte mindestens 48 Stunden vor der Auktion mit. Unseren Kundenservice erreichen Sie unter 05 41-96 20 20 oder gebührenfrei unter 08 00-58 36 537. 6. Wenn Sie als neuer Kunde noch nicht bei uns gekauft haben, ist es empfehlenswert, wenn Sie uns Referenzen angeben. Nennen Sie uns eine Münzhandlung, mit der Sie bereits in Geschäftsverbindung stehen. Oder rufen Sie unseren Kundenservice an. 7. Die Echtheit aller verkauften Objekte wird auch über die gesetzliche Frist hinaus gewährleistet. 8. Alle Kunden, die als Bieter an einer unserer Auktionen teilnehmen, erhalten innerhalb von zwei Wochen nach der Auktion unsere Ergebnisliste gratis. 9. Sie haben Fragen zu einer bestimmten Münze? Sie möchten persönlich an unserer Auktion teilnehmen? Sie haben andere Fragen? Unser Kundenservice freut sich auf Ihren Anruf, entweder direkt unter 05 41-96 20 20 oder gebührenfrei unter 08 00-58 36 537.

IMPORTANT INFORMATION FOR PLACING BIDS 1. The terms and conditions of the auction can be found at the end of this catalogue. 2. Please send us your instructions as early as possible. The likelihood of errors occurring increases if we do not receive your instructions until shortly before the auction. 3. The enclosed form makes it simple for you to submit a written bid. Our fax machine +49 (0)541 – 96 20 222 is on standby day and night in case you wish to fax your bids. 4. The objects which you purchase will be delivered to you within eight days of the close of auction. Instructions are processed in the same order as they were received – in other words, the first instructions to be received are the first to be processed. All unsuccessful bidders will be also informed after the auction. 5. If you would like to bid by telephone, please ring our customer service beforehand on +49 (0)541 - 96 20 20. 6. If you are a new customer who has not yet bought anything through us, we recommend that you give us references. Name a coin dealer with whom you have already done business. Or call our customer service. 7. The genuineness of all sold objects is also warranted beyond the statutory length of time. 8. All customers who participate as bidders in our auction receive our list of results free of charge within two weeks of the close of auction. 9. Do you have questions about a particular coin? Would you like to participate personally in our auction? Do you have any other questions? Our customer service team will be pleased to help you – call on +49 (0)541 - 96 20 20.

RENSEIGNEMENTS À L'ATTENTION DE NOS CLIENTS DES VENTES AUX ENCHÈRES 1. Vous trouverez les conditions générales de vente aux enchères à la fin de ce catalogue. 2. Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. 3. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Si vous souhaitez faxer votre offre, vous pourrez le faire 24 heures sur 24 au +49 (0)541 – 96 20 222. 4. Les objets dont vous serez adjudicataire vous seront envoyés dans les huit jours suivant la fin de la vente aux enchères. Les commandes seront prises en compte dans l’ordre de leur arrivée, c’est-à-dire que les commandes nous parvenant les premières seront d’abord traitées. Après la vente aux enchères, nous préviendrons tous les enchérisseurs n’ayant pas obtenu l’adjudication. 5. Si vous souhaitez faire des enchères par téléphone, veuillez appeler aupravant notre service clientèle au +49 (0)541 – 96 20 20. 6. Si vous êtes un nouveau client et n’avez encore fait aucune acquisition chez nous, il serait conseillé de nous fournir quelques références. Indiquez nous si vous traitez déjà avec un professionnel du commerce des monnaies. Ou contactez notre service clientèle au +49 (0)541 – 96 20 20. 7. L’authenticité des pièces vendues sera garantie même au-delà des délais légaux. 8. Tous les clients participant à l’une de nos ventes aux enchères en tant qu’enchérisseurs recevront gratuitement une liste de résultats dans les deux semaines suivant la vente aux enchères. 9. Vous avez des questions concernant une pièce particulière? Vous désirez prendre part personnellement à notre vente aux enchères? Vous avez d’autres questions? Notre service clientèle se fera un plaisir de vous répondre au +49 (0)541 – 96 20 20.

INFORMAZIONI PER GLI OFFERENTI DELLE NOSTRE ASTE 1. Le condizioni d’asta si trovano alla fine di questo catalogo. 2. Siete pregati di inviarci i vostri ordini il più presto possibile. Se il vostro ordine ci perviene poco tempo prima dell’apertura dell’asta, si possono verificare errori nell’elaborazione dello stesso. 3. Per le vostre offerte scritte potete utilizzare il modulo allegato al catalogo. Nel caso voleste trasmettere le vostre offerte per fax, siete pregati di inviarle al seguente numero: +49 (0)541-96 20 222. 4. Gli oggetti che avete acquistato all’asta vi saranno spediti entro otto giorni dal termine della stessa. Gli ordini vengono evasi in base alla data di ricevimento, quindi hanno precedenza quelli pervenuti prima. Anche gli offerenti che non hanno avuta alcuna aggiudicazione riceveranno una nostra comunicazione al termine dell’asta. 5. Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare prima la consulenza ai clienti al numero diretto +49 (0)541-96 20 20. 6. Se siete clienti nuovi e non avete mai acquistato da noi, vi proponiamo di inviarci delle referenze. Dateci il nome di un negozio di monete presso il quale avete già fatto degli acquisti, oppure chiamate la nostra consulenza ai clienti al numero +49 (0)541 96 20 20. 7. Il certificato d’autenticità di tutti gli oggetti venduti viene rilasciato anche oltre i termini privisti per legge. 8. Tutti i clienti che hanno partecipato ad una nostra asta riceveranno gratuitamente l´elenco delle aggiudicazioni entro quindici giorni dal termine della stessa. 9. Avete delle domande su una moneta in particolare ? Desiderate partecipare personalmente ad una nostra asta? Avete altre domande? Rivolgetevi al nostro Servizio Clienti al numero +49 (0)541 – 96 20 20.


MEINE TEILNAHME ALS SCHRIFTLICHER BIETER 1. 2. 3. 4. 5. 6. 7.

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe rechte Seite) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,-- gefunden, möchten jedoch nur € 2.000,-- ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,-- an. Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da. Tel. 0800 – 583 65 37 (gebührenfrei). Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,- pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

MEINE PERSÖNLICHE TEILNAHME IN OSNABRÜCK 1.

3.

Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. 2. Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 – 5 83 65 37. Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

WIE ENTSTEHT DER PREIS EINER AUKTION? 1. 2.

Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80% dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich:

Beispiel 1 (Schätzpreis: € 1.000,--) Es liegt kein schriftlicher Auftrag vor: der Auktionator ruft das Los in der Auktion mit € 800,-- aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,--.

Beispiel 3 (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,-- vor: das Los wird in der Auktion mit € 800,-ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,--.

Beispiel 2 (Schätzpreis: € 1.000,--) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4: (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,-- vor: der Auktionator ruft das Los mit € 800,-- aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,--. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,-- und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,-- den Zuschlag.

Bieter 1: Limit € 2.900,-Bieter 2: Limit € 1.800,-Bieter 3: Limit: € 800,-Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10%). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1, € 1.900,-- (obwohl die Schätzung € 1.000,-- beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,--. Das Höchstangebot von € 2.900,-- musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,--) Es liegen drei Gebote von je € 975,-- vor: um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,--.


MUSTERAUKTIONSAUFTRAG FÜR SCHRIFTLICHE BIETER 1. Name, Adresse, Telefon: Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

5. Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

2. Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind für jedes einzelne Los zu bieten.

6. Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

3. „Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „oder“ verbinden. Wichtig: bei den „oder“-Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z.B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist.

4. Unterschreiben Sie Ihren Auktionsauftrag . . .nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

7. Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, daß oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten. 8. Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

ANTWORTEN AUF FRAGEN, DIE UNS OFT GESTELLT WERDEN 1.

Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15% auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer.

Beispiel 2: Zuschlagpreis: € 1.000,-€ 100,-Aufgeld 15% € 150,-€ 15,00 Versandkosten, z. B.* € 5,90 € 5,90 MwSt. 7% € 80,91 € 8,46 ______ ________ Rg.-Betrag € 1.236,81 Rg.-Betrag € 129,36 Mehrwertsteuer: üblicherweise in Deutschland 7%, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MWSt-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 / 5836537. Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80% des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. Beispiel 1:

2. 3.

4.

Zuschlagpreis Aufgeld 15%: Versandkosten, z.. B.* MwSt. 7%

* Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.


VERSTEIGERUNGSBEDINGUNGEN Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in € - Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschlang gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in € - Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifikationsnummer (§ 27 a UStG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b UStG in Verbindung mit § 6 a UStG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen.

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlaß der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluß ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständiger seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden.

Die Mindeststeigerungsstufen für das Bietungsverfahren betragen:

Mindestangebote

Mindeststeigerungsstufe

Wenn Sie in unserer Auktion erworbene Münzen an einen Grading Service in den USA verschicken möchten, übernehmen wir keine Garantie, daß die Münzen dort angenommen oder entsprechend unserer Bewertung eingestuft werden.

bis zu

€ 100,--

€ 5,--

bis zu

€ 200,--

€ 10,--

bis zu

€ 500,--

€ 20,--

bis zu

€ 1.000,--

€ 50,--

bis zu

€ 2.000,--

€ 100,--

bis zu

€ 5.000,--

€ 200,--

bis zu

€ 10.000,--

€ 500,--

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 20.000,--

€ 1.000,--

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 50.000,--

€ 2.000,--

DIE VERSTEIGERER:

ab

€ 50.000,--

€ 5.000,--

Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden. Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


TERMS AND CONDITIONS OF AUCTION The auction is conducted on behalf and for the account of the appropiate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law GazetteVol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Cicil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT – legislation and represents the basis for calculating the surcharge of 15 percent payable by the puchaser. The total price so calculated (hammerprice plus surcharge) is subject to the VAT (value added tax=Mehrwertsteuer), which is payabel additionally. Purchasers from abroad will be charged a surcharge of 15 per cent net on the hammer-price, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged Value Added Tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT I.D. number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the GermanTurnover Tax Law Buyers from other countries are not charged Value Added Tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchaser who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed overt to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to seperate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

same price or prices for a given lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or receipient, resp. The auctioned goods remain the sole and exclusiv property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicil in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicil outside the jurisdiction of the Federal Republik of Germany or if the legal domicil of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith do, however, not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or moutings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of indivdual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaintes or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a gernerally sworn expert of the trade, which the auctioneer may choose at his sole discretin, for assessment an the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receipt the lots, respectively.

The minimum rates of increase for the bidding procedure are: for minimum offers

minimum increase rate

up to

€ 100,--

€ 5,--

up to

€ 200,--

€ 10,--

up to

€ 500,--

€ 20,--

up to

€ 1.000,--

€ 50,--

up to

€ 2.000,--

€ 100,--

up to

€ 5.000,--

€ 200,--

up to

€ 10.000,--

€ 500,--

up to

€ 20.000,--

€ 1.000,--

up to

€ 50.000,--

€ 2.000,--

above

€ 50.000,--

€ 5.000,--

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3-5%. Should several bids be obtained in writing bidding the

If a coin that is sold by us is sent to a grading service ("slabbing"), we do not guarantee that the coin will be slabbed (nor that it will be slapped at any particular grade or with any particular comments ); however, we always warranty that each coin or numismatic item we sell will be genuine. The authenticity of the coins is warranted. Warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may bei exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers form abroad. Only the German text has legal forde. The prices realized will be published in the form of a list immediately after the auction.

THE AUCTIONEERS:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


NUMISMATISCHE AUSDRÜCKE EXPRESSIONS NUMISMATIQUES NUMISMATIC TERMS TERMINI DI NUMISMATICA DEUTSCH

ENGLISCH

FRANÇAIS

ITALIANO

RUSSISCH

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert. Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece

champ exemplaire de trouvaille monnaie commémorative retouché troué frappé ondulé patine dorée Trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro Tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazzione esemplare magnifico

Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite Schriftspuren

weakly struck edge nick edge faults lettered edge to right reverse traces of inscription

de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers traces de légende

conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

annata rara conio errore di conio conservazione estraordinaria

ОТТИСК НА ГУРТЕ ПОТЕРТАЯ СВИНЕЦ АССИМЕТРИЧНЫЙ ДВОЙНОЙ ЧЕКАН КАЙМА ОДНОСТОРОННЯЯ ЭМАЛИРОВАННАЯ СОХРАННОСТЬ СЛЕГКА ЭКЗЕМПЛЯР СЛЕДЫ ОБРАБОТКИ ОШИБКА В ПРОЦЕССЕ ЧЕКАНКИ ПОЛЕ ЭКЗЕМПЛЯР ПАМЯТНАЯ МОНЕТА ОТГЛАЖЕННАЯ ПРОКОЛАТАЯ ОТЧЕКАНЕННАЯ ВОЛНИСТАЯ ЗОЛОТАЯ ПАТИНА СЛЕДЫ ОТ УШКА КРАСИВАЯ СТОЛЕТИЕ МАЛЕНЬКИЙ СЛЕДЫ КОРРОЗИИ ЦАРАПИНА МЕДЬ СПЛАВ ЛЕГКИЙ СЛЕВА МИНИМАЛЬНЫЙ ИМИТАЦИЯ ПРЕВОСХОДНЫЙ ЭКЗЕМПЛЯР ИЗДЕРЖКН ПРИ ЧЕКАНКН ВМЯТИНА НА ГУРТЕ ОШИБКА НА ГУРТЕ ГУРТОВАЯ НАДПИСЬ СПРАВА РЕВЕРС СЛЕДЫ ПРЕДЫДУЩЕЙ НАДПИСИ ЗАГОТОВКА БРАК ЗАГОТОВКИ СЛАБО ОТЧЕКАНИНА РЕДКАЯ В ТАКОЙ СОХРАННОСТИ РЕДКИЙ ГОД ШТАМП ОШИБКА ШТАМПА СОХРАННОСТЬ ВЫШЕ СРЕДНЕГО

overstruck unpublished

surfrappé inédit

ribattuto inedito

Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn

unique specimen gilt extremely rare head tiny flan ornamental border tin

unique doré de toute rareté en face petit flan tranche ornée étain

pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno

Ziseliert

chased

ciselé

cesellato

ПЕРЕЧЕКАН НЕОПУБЛИКОВАННАЯ МОНЕТА УНИКАЛЬНАЯ ПОЗОЛОЧЕННАЯ НАИРЕДЧАЙШАЯ АВЕРС НЕЗНАЧИТЕЛЬНЫЙ ЗАГОТОВКА ЦИНК ЦАРАПИНЫ НА ПОЛЕ МОНЕТЫ МУЗЕЙНЫЙ ЭКЗЕМПЛЯР ПРЕВОСХОДНАЯ ПАТИНА


Künker eAuctions

Künker eAuctions

Unsere eAuctions umfassen circa 250 Losnummern. In einem festgelegten Zeitraum von 14 Tagen haben Sie die Möglichkeit, online auf die für Sie interessanten Münzen und Medaillen zu bieten. Die einzelnen Losnummern laufen zeitlich versetzt aus. Selbstverständlich werden Sie über Ihren aktuellen Gebotsstatus laufend per Email informiert und können Ihre Gebote bei Bedarf bis zur letzten Sekunde erhöhen.

Our eAuctions contain 250 lots. During a fixed period of 14 days you have the opportunity to submit your bids online on your favourite coins and medals.

Weitere Informationen und die nächsten Termine zu den Künker eAuctions finden Sie unter:

You may find further information and the next dates of the Künker eAuctions here:

www.kuenker.de

www.kuenker.com

Each lot will expire at different times. Certainly you will be informed constantly by email about the current status of your bids so that you permanent have the possibility – if necessary – to raise your bids till the end of the eAuction.

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Eva Marowsky, Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Dresdner Bank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND - FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse-5288 Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH88 0483 5013 5494 4200 1 Swift-Code: CRESCHZZ81Z We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ERHALTUNGS- UND SELTENHEITSGRADE ERHALTUNGSGRADE/ GRADING TERMS DEGRÉS DE CONSERVATION GRADI DI CONSERVAZIONE

SELTENHEITSGRADE

Polierte Platte Proof

Flan bruni Fondo specchio

Stempelglanz Uncirculated

Fleur de coin Fior di conio

Vorzüglich Extremely fine

Superbe Splendido

Sehr schön Very fine

Très beau Bellissimo

Schön Fine

Beau Molto Bello

Gering erhalten Very good

Très bien conservé Bello

R = Selten Von großer Seltenheit

RR = Sehr selten Von größter Seltenheit

Profile for Fritz Rudolf Kuenker GmbH & Co. KG

Auktion 156 Künker  

Münzen der schwedischen Besitzungen, Die Sammlung der Freiherren Bonde auf Schloss Ericsberg, Treil 4

Auktion 156 Künker  

Münzen der schwedischen Besitzungen, Die Sammlung der Freiherren Bonde auf Schloss Ericsberg, Treil 4