Issuu on Google+

Serving the Steuben County 101 lakes area since 1857

Top golfer: Dufner wins PGA championship

Weather Cloudy with a 40 percent chance of thunderstorms. High of 83. Page A8

Page B1

MONDAY, AUGUST 12, 2013

Angola, Indiana

Public views taken Written input

GOOD MORNING Plane crash near Waterloo injures man WATERLOO — An Angola man was injured when his small plane crashed near Waterloo Sunday morning, the DeKalb County Sheriff’s Department said. An ultralight plane piloted by Patrick Hale, 66, crashed into a corn field in the 4200 block of DeKalb C.R. 22, just before noon. Hale told investigators he lost rudder control before the crash. He was flying from Waterloo airport at the time. A witness found the plane without a pilot. Meanwhile, Hale walked to a nearby residence for help. He suffered bleeding from his head and a hand injury. He was transported to a hospital by a private vehicle. Assisting at the scene were Waterloo Fire and Rescue, DeKalb EMS and the Indiana State Police.

Rodeo clown in Obama mask draws flak at state fair KANSAS CITY, Mo. (AP) — A clown wearing a President Obama mask appeared at a Missouri State Fair rodeo this weekend and the announcer asked the enthusiastic spectators if they wanted to see “Obama run down by a bull.” The antics led the state’s second highest-ranking official, Lt. Gov. Peter Kinder, to denounce the performance in a tweet Sunday. He said it was “disrespectful” to the president. “We are better than this,” the Republican tweeted. State Fair officials said the show was “inappropriate” and “does not reflect the opinions or standards” of the fair. “We strive to be a family friendly event and regret that Saturday’s rodeo badly missed that mark,” they said in a statement Sunday. Reprints of all KPC photos can be purchased online at kpcnews.com under Marketplace: Photo Reprints.

Contact Us • The Herald Republican 45 S. Public Square Angola, IN 46703 Phone: (260) 665-3117 Fax: (260) 665-2322 Classifieds: (toll free) (877) 791-7877 Circulation: (800) 717-4679

Index • Classified.............................................. B7-B8 Life.................................................................A6 Obituaries.....................................................A4 Opinion ........................................................B4 Sports.................................................... B1-B3 Weather........................................................A8 TV/Comics ..................................................B6 Vol. 156 No. 221

75 cents

kpcnews.com

will be allowed about hog farm BY JENNIFER DECKER jdecker@kpcmedia.com

OCTAVIA LEHMAN

Sally and Gene Kessler of Kessler’s Kountry Line Dancing teach line dancing at their Auburn

home. Some students come from Ohio and Michigan.

They walk the line Auburn couple lead dancing classes at their home BY OCTAVIA LEHMAN olehman@kpcmedia.com

AUBURN — Once September hits, Sally Kessler’s schedule gets busier. Besides working as a manager at McDonald’s and running her Avon business, she’s back at her favorite activity: line dancing. From her Auburn home, Sally leads line dancing classes on weeknights, teaching beginning, intermediate, advanced and partner dances. The garage in her backyard doubles as the studio. The walls, lined with country memorabilia, include photos of her dance students. A life-size cutout of Brooks and Dunn, the popular country duo, beckons from one corner. The studio is Kessler’s Kountry

NEIGHBORS DEKALB

COUNTY

Line Dancing, a place where friends are made and dancers train. Sally and her husband Gene operate the dancing group, but they don’t claim to be professionals. Sally teaches the line dances and Gene plays the music. “We don’t dance for perfection,” Sally said. “It’s a lot of fun and socializing.” Their passion for line dancing began in 1991, after Sally saw an advertisement for Country Connection, a country dance club in Fort Wayne.

Video at kpcnews.com Sally and Gene Kessler show some line dancing moves and Sally shows more of their studio in video at kpcnews.com. Scan the QR code to watch the video on your tablet or smartphone.

Gene liked country music, so the two decided to check it out. “I never danced before,” Sally said. The two wanted to get better at line dancing and started taking lessons at Bev’s Western Wear in Auburn.

ANGOLA — The Indiana Department of Environmental Management has heard plenty of concerns about a proposed 4,800-hog farm that will be addressed at an upcoming public meeting. IDEM is holding the meeting regarding K&D Contract Pork LLC’s proposed swine operation on Thursday, Aug. 22, from 6-8 p.m. at the Steuben Community Center, 317 S. Wayne Street. Keith Werner, K&D’s owner, is proposing the operation that would be located at C.R. 6100W and 200N on a 60-acre parcel. He is a third-generation farmer. Indiana’s permitting process and regulations for confined feeding operations and concentrated animal feeding operations will be discussed at the meeting. IDEM staff will have information about the proposed CAFO on display beginning at 5:30 p.m. and will be available to answer questions before the meeting. The meeting will open up for public discussion and questions. If the public meeting concludes before 8 p.m., IDEM staff will remain to answer questions and discuss the proposed project in an informal, one-on-one setting. Individuals who wish to submit written comments to IDEM regarding the permit application

SEE KESSLER, PAGE A8

SEE HOG FARM, PAGE A8

Donors get creative with foundation gifts BY JENNIFER DECKER jdecker@kpcmedia.com

When it comes to donations to community foundations, cold, hard cash isn’t always involved. Instead, alternative forms of contributions have helped fill endowment coffers, such as grain, silver bars, timber, sheep, property rentals and real estate sales. Here are some of the alternative forms of donations to community foundations in Steuben, DeKalb, Noble and LaGrange counties.

Steuben County Community Foundation In February, SCCF received the largest private monetary gift in its history — $1.1 million —

from the estate of the late Don and Martha Rogers. In addition to that gift, SCCF president and CEO Jennifer Danic said it will include proceeds from the sale of Lake James real estate the Rogerses owned. Danic said state giving, Danic houses, businesses, real estate and sometimes other commodities are all part of gifts to the foundation. “It’s like noncash,” Danic said. “We need to get it appraised, but I won’t sit here and say what it’s worth. We have an extensive gift acceptance policy.” SCCF recently began accepting

grain donations from area farmers. If the commodity is accepted by an elevator and the donor designates SCCF as the recipient, the foundation receives the proceeds for endowments and grants. In addition, SCCF has rental property it receives funding from, she said. Elsewhere in the state, Danic said she heard another community foundation received a gift of sheep. But it’s not known if the flock entered that foundation’s office and bleated its case of worth.

Community Foundation of DeKalb County

tion of DeKalb County, Wendy Oberlin, executive director, said it is common that donors give from abundance. “Sometimes they give cash or appreciated stock, because that’s what they have a lot of. Some donors have an abundance of other assets that they are willing to give — grain, commercial real estate, and in one case, silver bars,” she said. Yes, silver bars. “Our donor had a desire to make a gift in remembrance of his wife. He inherited a collection of silver bars. His own estate plan was already in place with provisions for his children. He discussed using the silver to make a charitable gift with his family,

At the Community Founda-

SEE DONORS, PAGE A8

Deaths of wandering autistic kids prompt action FROM THE ASSOCIATED PRESS

The 3-year-old girl wandered away from her grandmother’s home in Wareham, Mass., in mid-April. A frantic search began almost immediately, and within an hour little Alyvia Navarro was found unresponsive in a nearby pond. She was pronounced dead the next day. A month later, across the continent, a larger search unfolded over three days as hundreds of emergency service personnel and volunteers fanned out around

SAVE THE DATE

Clearlake, Calif., looking for 9-year-old Mikaela Lynch after she vanished from her backyard. The outcome grimly echoed the Wareham search: A dive team found Mikaela’s body in a muddy creek. The two girls were the first of at least 14 children with autism known to have died this year after slipping away from their caregivers. All but one of them drowned, evidence of a fascination that many autistic children have with water. The body of the

latest victim, 11-year-old Anthony Kuznia, was found Thursday in the Red River after a 24-hour search near his home in East Grand Forks, Minn. The tragic phenomenon goes by various names — wandering, elopement, bolting — and about half of autistic children are prone to it, according to research published last year in the journal Pediatrics. That would be a huge number. The Centers for Disease Control and Prevention estimated last year

that 1 in 88 children are affected by autism, and a federal survey this year pegged the prevalence rate at one of every 50 schoolchildren — more than 1 million children in all. Wandering has led to the deaths of more than 60 children in the past four years, and the fear of it can make daily life a harrowing, never-let-your-guard-down challenge for parents. “We take steps at home — locks on every door, gates, SEE WANDERING, PAGE A8

GOLF OUTING

for the Wednesday, August 21, 2013 • Glendarin Hills Golf Club, Angola, Indiana


A2

THE HERALD REPUBLICAN

Police Blotter •

AREA • STATE •

kpcnews.com

MONDAY, AUGUST 12, 2013

Indigo bunting is a colorful, summer singer

Woman receives probation for marijuana charge AUBURN — Judge Kevin Wallace sentenced an Angola woman in DeKalb Superior Court I last week.Brittany Nodine, of the 200 block of Broad Street, Angola, received a conditional discharge for possession of marijuana, a Class A misdemeanor. If she successfully completes one year of probation, the charge will be dismissed.

Demolition derby driver dies of heart attack GASTON (AP) — A coroner says cardiac arrest killed an eastern Indiana man competing in a demolition derby. Delaware County Coroner Scott Hahn says the autopsy Sunday on 43-year-old Todd Delaney of Muncie showed he suffered from “significant coronary artery disease” and emphysema. The Star Press reports Delaney became ill while participating in a demolition derby Saturday night at the Gaston Lions Club Fair, about 50 miles northeast of Indianapolis.

An indigo bunting sang from the top of the tall walnut tree at the edge of our pasture as I stepped out of the barn, its song a series of double notes and short double phrases, cheep cheep, tinkle tinkle, cheer cheer, a pause, then another series. Though it OUTDOOR was early in NOTES the morning, the bunting was the only bird I heard Neil Case at first. Then from the far end of the pasture I heard a catbird. Earlier in the year, that time of day, I would have heard a symphony of bird songs, robins, mourning doves, a brown thrasher, red-winged blackbirds in the nearby marsh. But now, mid-summer, those birds sang sporadically or not at all. Yet the indigo bunting sang as if it was spring, on and on, day after day, not

only early in the morning but on and off throughout the day. I looked for the singer of course, but couldn’t spot it among the leaves. An indigo bunting, male, is blue on its head, back, wings, tail, breast and belly, a brightly colored little bird — when the sun is shining on and not behind it. When the sun isn’t shining or is behind it, however, an indigo bunting is just a dark little bird, the size of a chipping sparrow. Further, it sits still while it sings, makes no movement to give it away like a warbler. I wasn’t surprised I couldn’t spot the singer in the pasture. The male indigo bunting is as brightly colored as any bird. A female is a little brown bird, as dull-colored as the male is bright. Indigo buntings are birds of high and low, of tree tops, like the one I heard when I stepped out of the barn early in the morning a few days ago, and at every other level of the trees and of bushes and tall weeds, even on the ground. Their nesting range is from the middle of the

Two little words can keep you out of so much trouble. Let everyone know you remembered. THE

1-877-791-7877

HERALD

REPUBLICAN

The

S Star

THE NEWS SUN

Please join us for the...

25th Anniversary Celebration Urgent Care of Cameron Hospital

Thursday, August 15, 2013 4:00 - 6:00 p.m. ŠBlood Pressure Screening ŠBlood Sugar Checks ŠRefreshments

1381 N. Wayne St., Angola, IN Š 665-8222

Travel

PHOTO CONTRIBUTED

A male indigo bunting.

Dakotas, Nebraska, Kansas, Oklahoma and Texas east to the Atlantic Coast, from southern Canada south to the Gulf of Mexico. They’re not as common, as numerous as robins but they are far from rare. I see one regularly. I hear one much more often than I see one. Often I hear

but fail to see one it, even though I look for it. I remember the first indigo bunting I ever saw. I was a boy and a birder, and I was walking in a ravine that led to the river near my home. I saw this little bird fly into and land near the top of a tree on the other side of the

ravine. The sun was behind me and with the sun shining on it, as I saw it, the bird was as brightly colored as a male goldfinch in summer, only it was blue, all blue. I knew immediately what it was. I’d looked at pictures of it in my bird books often. I stared at it that day and as I stared I saw it sing, heard and learned its song. In ”Birds of America” the indigo bunting is described as a bird with a distinct personality. The male is one of the most showy of birds. He may be seen “on a fence rail, or tilting on the reeds, or dodging about in a flock of English Sparrows, or up on a bush or short tree within easy view.” Or he may be heard and sometimes seen in the top of a tall walnut or other tree. I see indigo buntings regularly in spring and summer. I hear them even more often, particularly in summer when many other birds don’t sing often if at all. I’ve never found a nest, however, but how would I? Females take care of nesting and they don’t sing.

Ritz ‘dismayed’ at grades ANDERSON (AP) — Glenda Ritz says she’s dismayed by the tasks she faces succeeding Tony Bennett as Indiana’s superintendent of public instruction. Ritz told about 200 supporters that not only must she overhaul some of the changes Bennett made during four years in office and implement her own program, but now she must also deal with the investigation into Bennett’s manipulation of school grades, The Herald Bulletin reported Sunday. The Associated Press has published emails showing Bennett and his staff changed the school grading formula to raise the score of a campaign donor’s charter school from a C to an A. School grades are used to determine how much money schools get and whether “failing” schools are taken over by private operators. Bennett has denied any wrongdoing, but he resigned as Florida’s education commissioner, a post he was appointed to after Ritz defeated his re-election bid in Indiana last year.

t like Royalty s o m l A

Reserve Early - Don’t Be Disappointed

The A-F school grading scale is one of the Bennett reforms Ritz spoke most sharply about changing during an open house Saturday at United Auto Workers Local 663. “I want an assessment model with no ceiling so we can truly understand where our students stand,” the superintendent said. “I want a strong system of equity and high quality for every student, and a big part of that is a strong system of public education.”

Ritz also announced the creation of an outreach program for public schools around the state modeled after her own grassroots-oriented superintendent election campaign. The program will feature 14 outreach education service centers around the state organized by leading educators in each area. “We’ll work with local leaders and superintendents about how this will be implemented and look for solutions,” Ritz said.

THE HERALD REPUBLICAN The Herald Republican (USPS 521-640). 45 S. Public Square, Angola, IN 46703 Established 1857, daily since 2001 ©KPC Media Group Inc. 2013

Recipient of several awards from the Hoosier State Press Association for excellence in reporting in 2012.

HOW TO CONTACT US President/Publisher: Terry Housholder (260) 347-0400 Ext. 176 COO: Terry Ward (260) 347-0400 Ext. 174 CFO: Rick Mitchell (260) 347-0400 Ext. 178 Executive Editor: Dave Kurtz (260) 347-0400 Ext. 129 Editor: Michael Marturello (260) 665-3117 Ext. 140 Circulation Director: Bruce Hakala (260) 347-0400 Ext. 172 Web site: kpcnews.com

thousholder@kpcmedia.com tward@kpcmedia.com rmitchell@kpcmedia.com dkurtz@kpcmedia.com mmarturello@kpcmedia.com bhakala@kpcmedia.com

DELIVERY SERVICE — MISSED/ DAMAGED NEWSPAPERS If your newspaper was damaged or had not been delivered by 6:00 a.m. Monday through Friday or 7 a.m. Saturday and Sunday, call customer service by 10 a.m. and we will ensure a replacement copy is delivered to you.

CIRCULATION CUSTOMER SERVICE TELEPHONE HOURS 1-800-717-4679 Monday through Friday 6 a.m.-5 p.m. Saturday and Sunday 7 a.m.-10 a.m.

SUBSCRIPTION RATES — Motor and Foot Routes 7-DAY DELIVERY Monthly: $15.40 3 Months: $46.20 6 Months: $89.00 1 Year: $169.00

FRI./SAT./SUN. DELIVERY $8.00 $22.50 $44.00 $85.00

MAIL SUBSCRIPTION RATES — Out of Four-County Area 7-DAY DELIVERY Monthly: 3 Months: 6 Months: 1 Year:

$18.00 $54.00 $108.00 $216.00

NEED EXTRA COPIES? If you would like extra copies of a particular issue of The Herald Republican, they are available at the The Herald Republican office for $1.25 per copy daily, and $1.75 per copy Sunday. Published by KPC Media Group Inc. at 102 N. Main St., Kendallville, IN 46755. Published every day except New Year’s Day, Memorial Day, July 4th, Labor Day, day after Thanksgiving and Christmas Day. Periodical postage paid at Kendallville, IN 46755 and at additional mailing offices. POSTMASTER: Send address changes to: The Herald Republican, P.O. Box 39, Kendallville, IN 46755

GRAND CANYON & NATIONAL PARKS BY TRAIN October 6 - 18, 2013

Ride the rails out west and experience the awesome beauty of the Grand Canyon, Zion National Park, Bryce Canyon, Moab, Arches National Park and Grand Junction. This tour promises to provide those “Kodak moments” that will stay with you for a lifetime.

AUSTRALIA & TASMANIA April 2 - 14, 2014

Your choice is clear

Great Barrier Reef, Hobart, Cairns, Melbourne, Sydney

Can’t get enough? Then extend your tour with an option to include 6 days in New Zealand! Auckland, Waitomo Caves, Rotorua, Queenstown, Arrowtown and Milford Sound.

Call Edgerton’s today 260-497-8747 9111 LIMA RD., FT. WAYNE, IN OTHER EXCLUSIVE EDGERTON’S TOURS TRAIN TOURS: AIR & CRUISE:

New Mexico & Albuquerque Balloon Fiesta October 8-15, 2013

MOTORCOACH TOURS: Branson Holiday Show Tour November 12-18, 2013

England & Scotland October 2-15, 2013 China November 4-18, 2013 Hawaii Jan. 15 to 26 or Feb. 26 to March 9, 2014 Panama Canal April 13-29, 2014

www.edgertonstravel.com

The ra p

y

you

It’s all about

Butler, IN • 260-868-2164

www.laurelsofdekalb.com


AREA • STATE •

MONDAY, AUGUST 12, 2013

kpcnews.com

THE HERALD REPUBLICAN

A3

Leftover Henryville funds debated Teachers’ group wants to use money to buy supplies SELLERSBURG (AP) — A union president says a southern Indiana school district should use unspent donations to reimburse teachers for items they lost when tornadoes heavily damaged the Henryville schools last year. David Knies, president of the West Clark Community Schools Teachers’ Association, says some of the $500,000 in unspent donations that poured into the district after the

tornadoes could reimburse teachers for personal items they lost from their classrooms. The union has been talking to the school board since the repaired school reopened last year, he said. “We’ve given them what we think the teachers ought to get and the board gave us a figure, but we’ve not talked about it since,” Knies told the News and Tribune after the school board’s meeting Thursday.

“We need to reimburse (teachers) for what they spent,” Knies said. “The tornado caused them to lose their supplies and they had to go back out and buy them. I’m going to guess anywhere from $500 to $1,500 or more for some teachers. Some of them had stuff where they’d taught for 30 years and lost everything they had.” Superintendent Monty Schneider said while the district hopes it can help

teachers who lost items, there’s been no decision yet on reimbursements. The district has some out-ofpocket expenses not covered by insurance, he said. “We’ve had discussions because teachers’ personally owned items were not covered by insurance, and that’s typical,” Schneider said. “They lost some personal stuff, they’ve been given a lot of donated stuff, but they’re still out a lot of items.”

Murder case continues to be a nightmare for Indiana family INDIANAPOLIS (AP) — Frank and Janice Renn lost a daughter and their grandchildren in a burst of violence on an autumn day in 2000. In the 13 years since, each day has been filled with the same sense of loss as the one before. “It’s like that movie Groundhog Day, where he keeps waking up to the same thing every day,” Frank Renn said. David Camm could say the same thing. The former Indiana state trooper — and the Renns’ son-in-law before the slayings — has spent a majority of the past 13 years behind bars following two convictions in deaths of his wife and children, even though courts threw out both verdicts. A third trial will begin Monday to determine whether Camm is guilty of shooting and killing Kimberly Camm, his 7-year-old son Bradley and 5-year-old daughter Jill at the Camms’ southern Indiana home. There’s a new prosecutor, a different judge and a new trial venue. The 49-year-old Camm insists he was wrongly convicted, and this trial is another chance to clear his name. For the Renns, this is another shot at closure. “What does it take to get this over with?” Frank Renn asked. The Camm slayings are one of Indiana’s longest-running murder cases, following a tangled legal path riddled

AP

Janice, left, and Frank Renn hold a photograph of their daughter Kimberly Camm in their New Albany home on Saturday. Camm, her daughter, Jill, 5, and her son, Bradley, 7, were all shot to death at their Georgetown home in 2000. David Camm, Kimberly’s husband, and the children’s father, is accused of the killings.

with missing murder weapons, allegations of affairs and child abuse, the emergence of a second suspect and a prosecutor’s removal over a book deal. For years, a debate has raged over whether Camm is a villain or a victim, with both sides taking to websites, books and national television to argue their points. A petition on change.org seeking to have him freed

Gary violence sparks calls for new gun laws GARY (AP) — Rising homicides and an increase in gang violence are sparking calls for local gun laws in Gary despite a state law that bars local ordinances regulating firearms. The state is sending technical assistance to Gary and has ordered city leaders to work with the Indiana State Police to identify needs. The U.S. Department of Justice also is consulting city officials. Former Gary Mayor

Richard Hatcher tells The Times in Munster Gary’s problems aren’t new. He says lawmakers need to rethink their stance on local gun rules. Hatcher says cities with low crime rates might not want local gun-control laws, but communities like Gary that are battling violence would benefit from them. Republican state Sen. Carlin Yoder of Middlebury says the idea tramples on the Second Amendment.

CHECK OUT THE LATEST POSTS ON kpcnews.com

• Alternators

Trust the Midas Touch!

Locally Owned & Operated!

Your One Stop Maintenance & Repair Shop

BRAKE SPECIAL UP TO

50

$

5

$ 00

OFF

OIL OFF* CHANGE

4 Wheel Brakes Installed *$25 per axle

Good thru August 2013

Good thru August 2013

2401 N. WAYNE ST., ANGOLA, IN (260)

665-3465

Hours: Mon.-Fri. 7:30 - 5:00 p.m. Sat. 7:30 - Noon Shocks & Struts • Belts & Hoses • And More!

• Starters • Exhaust • Batteries • Radiators • Inspections • Tune-ups • Timing Belts • Bulbs

Brakes • Oil Changes • Tires • Emissions • Engine Diagnostics • Factory Scheduled Maintenance

• Alignments

has collected hundreds of signatures. Prosecutors have moved the trial to Lebanon, Ind. — more than 100 miles from the Louisville, Ky., suburbs where the slayings occurred — in hopes of finding jurors who haven’t already made up their minds about Camm’s guilt or innocence. But in the digital era, that’s a tall order. “They probably will be able to seat a jury, but

whether it’s a fair jury is an open question,” said Shawn Boyne, a law professor at the Indiana University School of Law in Indianapolis. Another challenge for prosecutors is making a legal argument that resonates with jurors after the two previous failures. Camm, who had left the state police four months before his family was killed, was arrested a few days after telling investigators he had discovered his wife and their two children shot to death in the garage of their Georgetown home in September 2000. The weapon was never found. Defense attorneys argued at Camm’s first trial in 2002 that prosecutors ignored evidence that another man had been in the garage where killings occurred. After DNA linked a violent ex-convict to the scene, they thought Camm would be freed. Instead, prosecutors said Camm had conspired with the second man to kill his family, and he was convicted again in 2006. The second man, Charles Boney, is serving a 225-year prison sentence for murder and conspiracy to commit murder. Boney’s palm print was found on Kimberly Camm’s sport-utility vehicle, and a sweatshirt found in the garage had been issued to Boney in prison while he was serving time for armed robbery and criminal confinement.

AP

Rescue workers deal with the aftermath of a fatal wreck on U.S. 33 between Ligonier and Goshen on Sunday morning. An Ohio woman lost her life in the two-vehicle accident.

Ohio woman dies in U.S. 33 crash BENTON — One person has died and three others have been airlifted to a hospital after a car and a minivan collided along a northern Indiana highway. The driver of the van, Cynthia L. Gilleo, 47, of Celina, Ohio, was pronounced dead at the scene of the collision about 11:30 a.m. Sunday at the intersection of U.S. 33 and a rural road about four miles south of Goshen. Gilleo was northbound on U.S. 33 near C.R. 146 at about 11:30 a.m. when a southbound 2002 Pontiac Grand Prix driven by Sarah M. Fields, 31, of Elkhart went left of center and hit the 2002 Pontiac Montana Gilleo drove, the Elkhart County Sheriff’s

Department said in a news release. Gilleo was pronounced dead at the scene. She was wearing a seatbelt at the time of the crash. Fields suffered a fractured pelvis and head and neck lacerations. Two passengers in the van, Andrew Clinger, 41, and Allison Clinger, 16, also were injured. Andrew Clinger complained of leg and foot pain. Allison Clinger suffered a fractured femur and neck and back pain. All three injured persons were airlifted to a Fort Wayne hospital. The Elkhart County Sheriff’s Department Crash Investigation Team is investigating the crash.

Toddler drowns near Leesburg LEESBURG (AP) — A toddler has died a day after being pulled from a northern Indiana lake. Indiana conservation officers say 2-year-old Tucker Farmer of Marion died Sunday afternoon at Fort Wayne’s Lutheran Hospital. They say the boy had been airlifted there Saturday evening from Kuhn Lake, about 40 miles northwest of Fort Wayne. Officers say the child was missing for only a few minutes before family members found him face down in the water and not breathing. They say an autopsy will be performed by the Allen County Coroner’s Office to determine the boy’s cause of death.

LEGAL NOTICES • Legal Copy Deadlines Copy due Publish Wed. 4 p.m. .............................Mon. Thurs. 4 p.m. ..................................... Tues................................................... Fri. 4 p.m............................. Wed. Mon. 4 p.m. .......................... Thurs. Tues. 4 p.m. .............................. Fri. Annual Reports & Budgets due 5 working days before the publish date.

E-mail your legal! legals@kpcnews.net Call Kelly at 877-791-7877x182 for details

LEGAL NOTICE ORDINANCE NO. 1439-2013 AN ORDINANCE AMENDING THE CITY OF ANGOLA, INDIANA CODE OF ORDINANCES BY ESTABLISHING A NEW STOP INTERSECTION AND ELIMINATING A STOP INTERSECTION Be it ordained by the Common Council of the City of Angola, Indiana, that: Section 1. Title VII Traffic Code, Chapter 73 Traffic Schedules, Schedule III, entitled, “Stop Intersections” of the Angola Code of Ordinances is hereby amended by the addition of the following: Through Intersecting or Street Stop Street South Street Euclid Street (aka Euclid Avenue) Section 2. Title VII Traffic Code, Chapter 73 Traffic Schedules, Schedule III, entitled, “Stop Intersections”, is hereby amended by the deletion of the following: Through Intersecting or Street Stop Street Euclid Street Gale Street (aka Euclid Avenue) Euclid Street South Street (aka Euclid Avenue) Section 3. This ordinance shall be in full force and effect from and after its enactment by the Common Council, approval by the Mayor, and publication according to law. Passed and adopted by the Common Council of the City of Angola, Indiana and approved by me this 5th day of August 2013. Richard M. Hickman, Mayor HR,00349254,8/12,hspaxlp NOTICE OF SHERIFF'S SALE TO THE OWNERS OF THE WITHIN DESCRIBED REAL ESTATE AND ALL INTERESTED PARTIES By virtue of a certified copy of a decree to me directed from the Clerk of Circuit Court of Steuben County, Indiana, in Cause No. 76D01-1208 -MF-0471 wherein Beneficial Financial I Inc. successor by merger to

Beneficial Indiana Inc. d/b/a Beneficial Mortgage Co. was Plaintiff, and Eugene C. Braddock , Cynthia A. Braddock, and Asset Acceptance, LLC were Defendants, requiring me to make the sum as provided for in said Decree with interest and cost, I will expose at public sale to the highest bidder, on the 26th day of September, 2013, at the hour of 11:00 a.m. or as soon thereafter as is possible, at 206 E. Gale St, Angola, IN 46703, the fee simple of the whole body of Real Estate in Steuben County, Indiana. Part of the West half of the Northeast Quarter of the Southwest Quarter of Section 29, Township 36 North, Range 12 East, Steuben County, Indiana, Bounded as follows: Commencing at the Northeast corner of said West half; thence South (assumed bearing) 332.40 feet along the East line of said west half to the true point of beginning; thence continuing South 362.00 feet along said East line; thence West 601.66 feet; thence North 362.00 feet; thence East 601.66 feet to the point of beginning. The above described tract contains 5.00 acres. Subject to Legal Highway Rights-of-Way and easements of record.More commonly known as: 6615 S State Rd 327, Hudson, IN 46747 Parcel No.: 76-12-29-000-025.010 -014 Together with rents, issues, income, and profits thereof, said sale will be made without relief from valuation or appraisement laws. Sheriff of Steuben County Salem Township 6615 S State Rd 327 Hudson, IN 46747 The Sheriff's Department does not warrant the accuracy of the street addressed published herein Rayanna Alexander Binder 24776-49 Doyle Legal Corporation, P.C. 41 E Washington Street Suite 400 Indianapolis, IN 46204 SERVICE DIRECTED TO: Eugene C. Braddock, 6615 S. State Rd. 327, Hudson, IN 46747-9200. Type of Service: Sheriff. Cynthia A. Braddock, 1770 Raleigh Ave., Apt. L, Kendallville, IN 46755-2556. Type of Service: Certified. NOTICE DOYLE LEGAL CORPORATION, P.C. IS A DEBT COLLECTOR. THIS IS AN ATTEMPT TO COLLECT A DEBT, AND ANY INFORMATON OBTAINED WILL BE USED FOR THAT PURPOSE. HR,00349391,8/12,19,26,hspaxlp

Check out the latest posts on kpcnews.com

NOTICE OF SHERIFF'S SALE TO THE OWNERS OF THE WITHIN DESCRIBED REAL ESTATE AND ALL INTERESTED PARTIES By virtue of a certified copy of a decree to me directed from the Clerk of Superior Court of Steuben County, Indiana, in Cause No. 76D01-1302 -MF-000116 wherein JPMorgan Chase Bank, N.A. was Plaintiff, and Trenton C. Smith, Jr., et al., were Defendants, requiring me to make the sum as provided for in said Decree with interest and cost, I will expose at public sale to the highest bidder, on the 26TH day of SEPTEMBER, 2013, at the hour of 11 AM or as soon thereafter as is possible, at 100 E. Gale Street, Angola, IN 46703, the fee simple of the whole body of Real Estate in Steuben County, Indiana. Lot numbered nine (9) in Hendry’s Addition to the town, now city, of Angola, Indiana, according to the recorded plat thereof, excepting therefrom the south 48 feet of said lot numbered nine (9), in Steuben County, Indiana. SUBJECT TO LIENS, ENCUMBRANCES AND EASEMENTS OF RECORD. More commonly known as: 301 South Washington Street, aka 301 South Washington, Angola, IN 46703 Parcel No. 76-06-26-420-506.000 -012 Together with rents, issues, income, and profits thereof, said sale will be made without relief from valuation or appraisement laws. "Subject to all liens, encumbrances and easements of record not otherwise extinguished in the proceedings known as Cause No. 76D01-1302 -MF-000116 in the Superior Court of the County of Steuben, Indiana." TIM TROYER Sheriff of Steuben County 301 South Washington Street aka 301 South Washington Angola, IN 46703 The Sheriff`s Department does not warrant the accuracy of the street addressed published herein Plaintiff Attorney: April N. Pinder (29045-49) Robert E. Altman III (29811-15) Reisenfeld & Associates, LPA LLC 3962 Red Bank Road Cincinnati, OH 45227 Voice: (513) 322-7000 Facsimile: (513) 322-7099 HR,00349396,8/12,19,26,hspaxlp SUMMONS: NOTICE OF ACTION TO QUIET TITLE TO REAL ESTATE Notice to Benjamin H. Weldon, the spouse, widow, heirs, or devisees of Benjamin H. Weldon; Glen R. Jackson, the spouse, widow, heirs, or devisees of Glen R. Jackson; Edward Meyer, the spouse, widow, heirs, or devisees of Edward Meyer; all other persons and entities who claim an interest in the real estate described herein, the names and whereabouts

being unknown. Notice is given that Dennis C. Ryan and Judith A. Ryan have filed Complaint to Quiet Title to Real Estate in Steuben Superior Court, Dennis C. Ryan and Judith A. Ryan v. Benjamin H. Weldon, et al., Cause No. 76D01-1307-PL-0364 by which they ask the Court to enter judgment, quieting in them the title to the following described real estate located in Steuben County, Indiana: Part of the Northwest quarter of Fractional Section 4, Township 37 North, Range 13 East, Steuben County, Indiana, described as follows: Commencing at the Northwest corner of Lot 44 of the Old Ford Plat as shown in Plat Book 2, pages 82 and 83, Recorder’s Office, said corner marked with a 1 inch diameter steel stake; thence South 44 degrees 12 minutes 35 seconds West (assumed bearing), along the westerly line of said Lot 44, a distance of 78.43 feet (79 feet-plat) to a 1 inch diameter steel stake marking the Southwest corner thereof and being the point of beginning; thence South 37 degrees 06 minutes 16 seconds East, along the Southerly line of said Lot 44 and southeasterly prolongation thereof, a distance of 48.22 feet (48 feet-plat) to the Southwest corner of Lot 43 of said Old Ford Plat, said corner marked with a 1 inch diameter pipe stake; thence South 43 degrees 39 minutes 53 seconds West, along the southwesterly prolongation of the westerly line of said Lot 43, a distance of 22.0 feet; thence North 48 degrees 26 minutes 40 seconds West 47.92 feet to an intersection with the southwesterly prolongation of the westerly line of Lot 44 of said plat; thence North 44 degrees 12 minutes 35 seconds East, along said southwesterly prolongation, 31.5 feet to the point of beginning, containing 0.03 acre, more or less. Subject to easements of record. Said real estate has no assigned street address but is located between Lot 44, Village of Old Ford Plat, at Lake James, and Bayview Road (Charles (Ed) Meyer Road). Hearing on said Petition is scheduled in Steuben Superior Court, 55 South Public Square, Angola, Indiana 46703, on the 1st day of October, 2013 at 9:00 a.m. All persons named or described above must respond within thirty (30) days after the last notice of this action is published or judgment by default may be entered against them for the relief demanded in the Complaint. Plaintiffs are represented by Attorney Latriealle Wheat, 107 West Maumee Street, Angola, Indiana 46703. Dated this 23rd day of July, 2013. Michelle Herbert Clerk of Steuben Superior Court HR,00347661,7/29,8/5,12,hspaxlp


A4

AREA • NATION •

kpcnews.com

Deaths & Funerals • Dennis Wymer KENDALLVILLE — Dennis Dale Wymer, 63, lifetime Kendallville resident, died Saturday, Aug. 10, 2013, at Parkview Regional Medical Center, Fort Wayne. Mr. Wymer was born in Kendallville May 2, 1950, to the late Charles Edward Mr. Wymer Wymer and Esther Lucille (Aukerman) Wymer. He graduated from East Noble High School in 1968 and served in the United States Naval reserves. He worked in Kendallville at the Business Service Co. years ago, Uniform Printing for 26 years and Courier Printing for five years. He was a member of Moose Lodge 1301 in Kendallville. He held all offices of the Kendallville Moose Lodge and was given the highest honor, Pilgrim of the Moose degree, in 1988. He also was active at the state and district levels of the Moose Lodge. He was a member of the American Legion Post 86 in Kendallville. He donated many gallons of blood to the American Red Cross over the years. Survivors include three sisters, Ruth Austin of Fort Wayne, Pat and Robert Easterday of Kendallville, and Nancy and Robert Myers of Cortland, Ohio; three brothers, Charles “Chuck” and Gloria Wymer of Churubusco, Richard and Sharon Wymer of Huntington, and Gary and Carol Wymer of Avilla; and many nieces and nephews. He was also preceded in death by his sister, Shirley Lobdell. Calling will be today from 5-8 p.m. and Tuesday from 10-11 a.m. at Hite Funeral Home, Kendallville. Moose Lodge services will be there today at 8 p.m. Services will be Tuesday at 11 a.m. at the funeral home with the Rev. Thomas Clothier officiating. Memorials are to Mooseheart or the American

Diabetes or American Cancer associations. Send a condolence to the family or view a video tribute to Dennis by today at www.hitefuneralhome.com

Harry H. Freeze GARRETT — Harry Hudson “Hud” Freeze, 95, of Garrett, died Sunday, Aug. 11, 2013 at Miller’s Merry Manor Nursing Home in Garrett. He was born June 28, 1918 in Garrett to the late Harry H. and Bertha (Koble) Freeze. He married Frances C. Nowacki on Jan. 15, 1944 and she died Feb. 5, 1994. He was a WWII veteran having served in the U.S. Army. Hud was a conductor on the B&O Railroad for 40 years, retiring in 1975. He was a member of the Garrett First Baptist Church, Garrett American Legion, Eagles and Elks. He is survived by a son and daughter in-law, Hud and Claudia Freeze of San Diego, Calif., and a daughter, Jacqualine Freeze of Fort Wayne. He was also preceded in death by a brother, Charles Freeze. The funeral service will be held on Wednesday, Aug. 14, at 10 a.m. at the First Baptist Church in Garrett. Visitation will be held on Tuesday, Aug. 13, from 5-8 p.m. at Thomas Funeral Home, 1277 C.R. 56 and at the church on Wednesday from 9:30 a.m. until service time. Rev. David Mix will officiate. Burial will follow in Christian Union Cemetery in Garrett. Memorials are to The Rocket Fund for CDG Research, Miller’s Merry Manor Nursing Home or First Baptist Church. To send a condolence or sign the online guestbook visit www.thomasfuneralhome.org

Harold Feasel VAN WERT, Ohio — Harold E. “Gus” Feasel II, 65, of Van Wert, Ohio, died Thursday, Aug. 8, 2013, at

Obituary Policy • KPC Media Group daily newspapers (The News Sun, The Star and The Herald Republican) do not charge for death notices that include notice of calling hours, date and time of funeral and burial, and memorial information. An extended obituary, which includes survivors, biographical information and a photo, is available for

a charge. Deadline for funeral homes placing obituaries is 5 p.m. for next day publication. The email address is obits@kpcmedia.com. Submitted obituaries must contain the name and phone number of the funeral home. For information, contact Jan Richardson at 347-0400, ext. 131.

CHECK OUT THE LATEST POSTS ON kpcnews.com

his residence. Services will be at 11 a.m. today in the Zwick & Jahn Funeral Home, Decatur, Ind. Burial will be at Willshire Cemetery. Calling was noon to 3 p.m. and 4-8 p.m. Sunday at the funeral home. Memorials are to the family.

Esther McClish CROSSVILLE, Tenn. — Esther L. McClish, 94, of Crossville, Tenn., and formerly of Garrett, passed away August 9, 2013, at Cumberland Medical Center in Crossville, Tenn. She was a homemaker. She enjoyed crafts, painting by numbers and loved cooking holiday dinners for her family. She was born Oct. 2, 1918, in Monroe, Mich., to Harry and Viola (Warner) Porter. She is survived by five sons and daughtersin-law, David McClish of Hicksville, Ohio, Harold McClish of Crossville, Tenn., Howard and Wava McClish of Crossville, Tenn., Ronald and Sue McClish of Crossville, Tenn., and Danny McClish of Pahrump, Nevada; two daughters, Bonnie Everage of Crossville, Tenn., and Sharon Caldwell of Crossville, Tenn.; two sisters, Bertha Sprouse of Warsaw, and Audrey King of Stroh; 18 grandchildren; 38 great-grandchildren; 12 great-great-grandchildren; and one great-great-greatgrandchild. In addition to her parents; she was preceded in death by her husband, Vaughn McClish. Services will be 11 a.m. Wednesday at Feller and Clark Funeral Home, 875 S. Wayne St., Waterloo. Burial will be in Cedar Creek Cemetery in rural Garrett. Visitation will be from 2-4 and 6-8 p.m. Tuesday at the funeral home. Memorial may be directed to DeKalb County Humane Shelter. To send condolences, visit www.fellerandclark. com.

Behind the scenes at Jackson shows revealed during trial LOS ANGELES (AP) — Nearly four years ago, audiences got their last look at Michael Jackson in the top-grossing concert film of all time, “This Is It.” Tens of millions worldwide saw a seemingly healthy and confident performer sing and glide across a rehearsal stage as he prepared for his ill-fated comeback tour. Now, those same sessions are being replayed for a new audience: jurors in a case filed by Jackson’s mother, Katherine Jackson, claiming concert promoter AEG Live should be held liable for his untimely death in June 2009. Through testimony and evidence, the panel has seen a very different picture of Jackson — one framed by descriptions such as “skeletal,” ”lost,” absent from rehearsals and unable to perform songs that made him a superstar. In a darkened courtroom, and in stark contrast, the jurors have also seen clips of the concert film — visibly captivated by Jackson’s smooth moves and easy vocals as he prepared for his “This Is It” tour in yet another indicator of the enduring allure of the so-called “King of Pop.” AEG Live’s lawyers have used the film to point to the flashes of brilliance in Jackson’s final rehearsals as proof that its executives could not have known the singer would soon die. But Katherine Jackson’s attorneys have played the footage juxtaposed to video of her son spinning and Moonwalking in younger years in an attempt to show that his skills were diminished and the film was selectively edited. Once again last week, jurors were reminded of many of the dire descriptions of Jackson’s deteriorating health in the final weeks. An attorney for the singer’s mother presented snippets of testimony from five of Jacksons’ collaborators expressing concerns

Hite Funeral Home

Brian DeCamp & Andy David Funeral Directors 403 S. Main Street, Kendallville, IN

LOS ANGELES (AP) — Eydie Gorme, a popular nightclub and television singer as a solo act and as a team with her husband, Steve Lawrence, has died. She was 84. Gorme, who also had a huge solo hit in 1963 with “Blame it on the Bossa Nova,” died Saturday at Sunrise Hospital in Las Vegas following a brief, undisclosed illness, said her publicist, Howard Bragman. Gorme was a successful band singer and nightclub entertainer when she was

invited to join the cast of Steve Allen’s local New York television show in 1953. She sang solos and also did duets and comedy skits with Lawrence, a rising young singer who had joined the show a year earlier. When the program became NBC’s “Tonight Show” in 1954, the young couple went with it. They married in Las Vegas in 1957 and later performed for audiences there. Lawrence, the couple’s son David and other loved ones were by

In Your Hour of Need Miscellaneous Services Florists LAGRANGE MONUMENT WORKS

260-347-1653

260-463-2438 800-998-2511

www.hitefuneralhome.com

Yeager FUNERAL HOME 1589 Lincolnway South • Ligonier • 260-894-4900

www.yeagerfuneralhome.com

260-347-1653

www.northernindianafuneralcare.com

502 N. Main St., Auburn 260-925-3918 www.Pinnington-McComb.com

Beams

Funeral Home 200 W. Toledo St., Fremont

260-495-2915 www.beamsfuneralhome.com

Young Family Funeral Home 222 South State St. Kendallville, IN 260-347-0950 State Road 9 North Wolcottville, IN 260-854-2251 www.youngfamilyfuneralhome.com

FIND DIRECT LINKS TO THESE BUSINESSES ON THE OBITUARY PAGE OF THE ONLINE EDITIONS AT :

kpcnews.com

AP

In this March 5, 2009 file photo, Michael Jackson announces several concerts at the London O2 Arena in July, at a press conference at the London O2 Arena. Jurors hearing a case filed by Katherine Jackson over her son Michael’s death have received a behindthe-scenes look at the superstar’s troubles off-camera as he prepared for his ill-fated comeback shows.

about his health, including one who openly worried that he might die. Some of the statements were also sent in emails to AEG Live executives in 2009. “If we didn’t have these emails, we know what they’d be saying,” Katherine Jackson’s attorney Brian Panish said. “You can’t come in and change those now.” “It is only the fair and accurate representation of what he was actually doing to prepare,” AEG Live defense attorney Marvin S. Putnam said of the film. “What we can’t know and we can’t provide any picture of is what Mr. Jackson was doing when he was not preparing for ‘This Is It’ at rehearsal.” “It wasn’t meant to be a day-by-day chronicle of Mr. Jackson’s life,” Putnam said, adding that “it doesn’t show someone who’s deteriorating.” The footage that became the “This Is It” movie was never intended for the big screen and by its nature is a

bit rough. Jackson’s outfits often change several times in one song because it is compiled from multiple rehearsals. There are few time elements in the movie, so rehearsals shot on the last night the singer was alive are shown alongside earlier rehearsals. For instance, Jackson’s final rehearsed song was his environmental anthem, “Earth Song,” which appears an hour and 20 minutes into the movie. The next song, “Billie Jean” was performed weeks earlier, according to testimony in the trial. “This Is It” was released in October 2009 for a two-week theatrical engagement, earning more than $260 million worldwide — far more than concert films by Justin Bieber, Katy Perry or Madonna. In the film, Jackson shows off many of the crisp dance moves that made him a superstar, but in the courtroom, his collaborators have detailed his missed rehearsals, his difficulty performing some of his signature moves and occasional signs that Jackson was under the influence of medications. Among their observations not reflected in the film: • Choreographer Travis Payne went to Jackson’s home almost daily for rehearsals, but acknowledged that he couldn’t say how many times the singer often skipped the one-on-one sessions. Payne testified that Jackson was struggling to prepare for the show and had asked to use a teleprompter to help him remember lyrics to some of his songs. • Nor did Jackson show up for rehearsals with the band and backup dancers. Director Kenny Ortega told jurors that Jackson missed numerous rehearsals in mid-June. When he arrived for a rehearsal session on June 19, 2009, Jackson was shivering, incoherent and unable to rehearse.

Popular singer Eydie Gorme dies at 84

We Can Help Funeral Homes

MONDAY, AUGUST 12, 2013

4770 East US 20 LaGrange, IN 46761 www.lagrangemonumentworks.com

Fackler Monument Company Since 1924 “Over 400 monuments inside our showroom”

411 W. Main St., Montpelier, OH 43543 800-272-5588 facklermonument.com

Distinctive Granite & Glass Monuments

114 E. 6th St. Auburn

260-925-0777

BAKER’S ACRES FLORAL & GREENHOUSE LLC

We Deliver Flowers For All Occasions

108 N. Cedar • Auburn • 570-8421 www.maddencompany.com

A C E

260-927-5357 Hours: Custom Mon.-Fri. 9-5 Monuments Sat. 9-Noon

1108 W. Auburn Dr., Auburn acemonuments.com Microchip Granite Stones Vases Urns

15% OFF

R&T MONUMENTS 125 S. MAIN ST., KENDALLVILLE, IN

260-349-9188

M-FRI 11 AM-5 PM • SAT 11 AM - 3 PM

Your Hometown Monument Store

www.rtmonumentskendallville.com

FREMONT 495-2015 ANGOLA 665-5505

Cremation Services

UHPDWLRQ /HJDF\&  5HPHPEUDQFH&HQWHU 260-894-3161 TheLegacyRemembered.com

her side when she died, Bragman said. “Eydie has been my partner on stage and in life for more than 55 years,” Lawrence said in a statement. “I fell in love with her the moment I saw her and even more the first time I heard her sing. While my personal loss is unimaginable, the world has lost one of the greatest pop vocalists of all time.” Although usually recognized for her musical partnership with Lawrence, Gorme broke through on her

own with the Grammy-nominated “Blame it on the Bossa Nova.” The bouncy tune about a dance craze of the time was written by the Tin Pan Alley songwriting team of Barry Mann and Cynthia Weil. Her husband had had an equally huge solo hit in 1962 with “Go Away Little Girl,” written by the songwriting team of Gerry Goffin and Carole King. Gorme would score another solo hit in 1964, but this time for a Spanish-language recording.

Lotteries • INDIANAPOLIS — The following numbers were drawn Sunday in area lotteries: Hoosier Lottery: Evening, 0-8-2 and 7-1-5-2; Cash 5, 5-13-15-18-21; Quick Draw, 1-14-18-19-2729-32-36-39-42-46-48-5758-65-66-69-71-76-78. Michigan: Midday, 5-7-8 and 7-9-6-5; Evening, 1-2-7 and 7-5-3-6; Fantasy 5, 04-11-15-23-35; Keno, 03-10-11-17-21-23-25-30-

35-40-41-42-46-50-52-5354-57-66-69-74-75. Ohio: Midday, 6-0-9 and 1-6-2-2; Evening, 8-3-5 and 0-8-3-9; Pick 5, 0-5-5-4-0 (Midday) and 4-7-3-9-2; Rolling Cash 5, 03-10-2028-29. Illinois: Pick Three, 8-8-9 and 0-8-8-5; Evening, 5-7-4 and 6-9-9-2; My 3, 4-1-2 (Midday) and 4-9-3; Lucky Day Lotto, 13-24-26-32-37 (Midday) and 07-08-18-2327.

kpcnews

.com

WELLNESS CENTER Med. Lift Chairs Massage Chairs Power Recliners 2 Person Spas Power Adjustable Beds

Come In And Try Them Out!

For Your Home 1990 W. Maumee, Angola

Obituaries appear online at this newspaper’s Web site. Please visit the Web site to add your memories and messages of condolence at the end of individual obituaries. These messages from friends and family will be attached to the obituaries and accompany them in the online archives.

VOTE FOR YOUR FAVORITE.

KPC Contest


Legal Notices •

MONDAY, AUGUST 12, 2013

ANNUAL FINANCIAL REPORT County Number 76; School Corporation Number: 7605 School Corporation Name: Fremont Community Schools Any questions regarding this report should be directed to: Richard J. Wirtz, Business Manager; Telephone Number: 260-495-5005 RECEIPTS COMPARISONS CALENDAR YEAR 2012 2012 2012 Approved Budget Actual Receipt Accounts Receipts Receipts GENERAL FUND 1000 Local Sources $181,430 $226,961 2000 Intermediate Sources 325 6 3000 State Sources 6,581,412 6,662,416 4000 Federal Sources 5000 Other Financing Sources 500,000 6000 Other Items TOTAL $7,263,167 $7,623,261 REFERENDUM FUND 1000 Local Sources $ $ TOTAL $ $ DEBT SERVICE FUND 1000 Local Sources $1,667,877 $1,877,114 2000 Intermediate Sources 3000 State Sources 4000 Federal Sources 5000 Other Financing Sources 6000 Other Items TOTAL $1,667,877 $1,877,114 RETIREMENT/SEVERANCE BOND FUND DEBT SERVICE FUND 1000 Local Sources $349,841 $351,387 TOTAL $349,841 $351,387 CAPITAL PROJECTS FUND 1000 Local Sources $1,415,851 $1,568,182 2000 Intermediate Sources 3000 State Sources 4000 Federal Sources 5000 Other Financing Sources 161,506 6000 Other Items 3,898 TOTAL $1,415,851 $1,733,586 SCHOOL TRANSPORTATION FUND 1000 Local Sources $1,061,777 $1,196,810 3000 State Sources 4000 Federal Sources 5000 Other Financing Sources 6000 Other Items 128 TOTAL $1,061,777 $1,196,938 SCHOOL BUS REPLACEMENT FUND 1000 Local Sources $224,300 $220,199 5000 Other Financing Sources 6000 Other Items TOTAL $224,300 $220,199 EXEMPT DEBT SERVICE FUND 1000 Local Sources $ $ 2000 Intermediate Sources 3000 State Sources 4000 Federal Sources 5000 Other Financing Sources 6000 Other Items TOTAL $ $ REPAIR AND REPLACEMENT FUND 1000 Local Sources $ $0 3000 State Sources 4000 Federal Sources 5000 Other Financing Sources 6000 Other Items TOTAL $ $ SELF-INSURANCE FUND 1000 Local Sources $ $ 3000 State Sources 4000 Federal Sources 5000 Other Financing Sources 6000 Other Items TOTAL $0 $0 GRAND TOTAL $11,982,813 $13,012,485

Senior Sponsor Junior Sponsor Sophomore Sponsor Freshman Sponsor Yearbook All School Musical-HS All School Musical-HS All School Musical-HS Fall Play Fall Play Band Accompanist Vocal Music (Grades 5-12) Spanish Club Art Club Drama Club FHA BPA Nat’l Honor Society

EXPENDITURES COMPARISONS CALENDAR YEAR 2012 2012 2012 Approved Budget Actual Expenditure Accounts Expenditures Expenditures GENERAL FUND/FISCAL STABILIZATION FUND 11000 Instruction/Regular Programs $5,593,099 $5,296,855 12000 Instruction/Special Programs 358,300 348,822 13000 Instruction/Adult/Continuing Education 14000 Instruction/Summer School 9,000 12,726 15000 Enrichment Programs 16000 Remediation 38,000 49,143 17000 Payments to Governmental Units in State 159,156 146,840 21000 Support Services/Pupils 296,500 285,888 22000 Support Services/Instruction 157,000 141,731 23000 Support Services/General Administration 275,300 255,094 24000 Support Services/School Administration 426,000 405,458 25000 Central Services 51,100 37,907 26000 Operation & Maintenance of Plant Srvcs. 358,800 300,021 27000 Student Transportation 30000 Operation of Non-instructional Srvcs. 123,521 123,027 40000 Facility Acquisition and Construction 50000 Debt Services 60000 Non-programmed Charges 568,195 TOTAL $7,845,787 $7,971,707 REFERENDUM FUND 11000 Instruction/Regular Programs $ $ 12000 Instruction/Special Programs 13000 Instruction/Adult/Continuing Education 14000 Instruction/Summer School 15000 Enrichment Programs 16000 Remediation Programs 17000 Payments to Governmental Units in State 21000 Support Services/Pupils 22000 Support Services/Instruction 23000 Support Services/General Administration 24000 Support Services/School Administration 25000 Central Services 26000 Operation & Maintenance of Plant Srvcs. 27000 Student Transportation 30000 Operation of Non-instructional Srvcs. 40000 Facility Acquisition and Construction 50000 Debt Services 60000 Non-programmed Charges TOTAL $ $ DEBT SERVICE FUND 25000 Central Services $ $682 50000 Debt Services 1,799,602 1,695,314 60000 Non-programmed Charges 0 TOTAL $1,799,602 $1,695,996 CAPITAL PROJECTS FUND 22300 Instruction-Related Technology $367,000 $261,665 25000 Central Services 26000 Operation and Maintenance of Plant Srvcs 555,276 549,963 40000 Facility Acquisition and Construction 704,000 483,668 50000 Debt Services 60000 Non-programmed Charges 200,000 TOTAL $1,626,276 $1,495,296 SCHOOL TRANSPORTATION FUND 23000 Support Services/General Administration $100,000 $35,779 25000 Central Services 15,000 2,981 26000 Operation & Maintenance of Plant Services 27000 Student Transportation 1,087,500 872,632 40000 Facility Acquisition and Construction 205,785 50000 Debt Services 60000 Non-programmed Charges 125,778 913,718 TOTAL $1,534,063 $1,825,110 SCHOOL BUS REPLACEMENT FUND 25000 Central Services $ $ 27000 Student Transportation 275600 130,108 50000 Debt Services 60000 Non-programmed Charges TOTAL $275,600 $130,108 EXEMPT DEBT SERVICE FUND 25000 Central Services 50000 Debt Services EXTRA-CURRICULAR SALARY SCHEDULE in effect June 30, 2013

kpcnews.com

A5

EXPENDITURES COMPARISONS CALENDAR YEAR 2012 (CONTINUED) 60000 Non-programmed Charges TOTAL $ $ REPAIR AND REPLACEMENT FUND 25000 Central Services $ $ 26000 Operation & Maintenance of Plant Srvcs. 40000 Facility Acquisition and Construction 60000 Non-programmed Charges TOTAL $ $ SELF-INSURANCE FUND 11000 Instruction/Regular Programs $ $ 12000 Instruction/Special Programs 13000 Instruction/Adult/Continuing Education 14000 Instruction/Summer School 15000 Enrichment Programs 16000 Remediation 17000 Payments to Governmental Units in State 21000 Support Services/Pupils 22000 Support Services/Instruction 23000 Support Services/General Administration 24000 Support Services/School Administration 25000 Central Services 26000 Operation & Maintenance of Plant Srvcs. 27000 Student Transportation 30000 Operation of Non-instructional Srvcs. 40000 Facility Acquisition and Construction 60000 Non-programmed Charges TOTAL $0 $0 GRAND TOTAL $13,081,317 $13,118,217 NON-CERTIFIED EMPLOYEE CLASSIFICATIONS AND RANGE OF PAY RATES 2012-2013 Classifications Range of Pay Rates I. Instructional and Supplementary Pupil Services A. Library Aides 15,692 B. Kindergarten Aides N/A C. Special Education Aides 11,800-19,224 D. Prime Time Aides N/A E. Pre-kindergarten/Head Start Aides N/A F. Educational Enterprises N/A G. Other N/A II. Cafeteria and Food Services A. Managers/Head Cooks 12,974 - 14,132 B. School Food Service Director 25,925 C. All Other Food Service Employees 7.98-10.49 Hourly III. Health Services A. Nurses 41,532 B. Other N/A IV. Office/Clerical/Secretarial 15,245-18,254 V. Executive/Administrative/Accounting A. Business Manager 75,000 B. Buildings and Grounds Director 60,000 C. Community Relations/Publicity Director N/A D. Other N/A VI. Maintenance/Custodial/Warehouse/Security/Transportation A. Building Custodians 9.01-16.49 Hourly B. Bus Drivers 11,924-17,054 C. Other N/A VII. Computer Services 40,000 VIII. Other N/A Total number of non-certified part-time employees - 11 Total number of non-certified full-time employees - 53 ASSESSED VALUATION AND TAX RATES CALENDAR YEARS 2012 & 2013 2012 2013 Assessed Valuation 1,055,555,665 1,021,748,642 Tax Rate - General Fund N/A* N/A* Tax Rate - Referendum Fund 0 0 Tax Rate - Debt Service Fund 0.1483 0.1382 Tax Rate - Retirement/Severance Bond Debt Service Fund 0.0312 0.0478 Tax Rate - Capital Projects Fund 0.1236 0.1529 Tax Rate - School Transportation Fund 0.0947 0.1019 Tax Rate - School Bus Replacement Fund 0.0189 0.0069 Tax Rate - Exempt Debt Service Fund 0 0 *The school corportion general fund will only have a tax rate if a excess levy appeal has been approved. Per HB 1001 passed in 2008.

$620.00 $2,360.00 $305.00 $305.00 $1,260.00 $1,120.00 $340.00 $225.00 $1,120.00 $340.00 $1,460.00 $225.00 $1,235.00 $340.00 $340.00 $340.00 $340.00 $340.00 $340.00

Vendor Name Fremont Comm Schools Fremont Community Schools Farmers State Bank In State Teachers Retire Fund Nipsco Four Co. Area Voc. Cooperative Kerlin Bus Sales & Leasing, Inc. Dekalb Eastern Schools North Central Cooperative, Inc Industrial Contracting & Eng Croxton & Roe Ins. Public Employees Reitrement Farmers State Bank Brooks Construction Co., Inc. Forte Floors Current Office Solutions Farm Bureau Insurance Quill Corporation Frontier CIM Technologies Madison National Life Stoops Freightliner Town of Fremont Global Gov’t/Ed North American Benefits Co Perry Corporation Kenn-Feld Group LLC Jim Indledue Construction, Inc. Havel Warrick & Boyn Llp MacAllister HP Products IN Dept. of Workforce Dev Koorsen Protection Services Dunworth Auto, Inc Simplexgrinnell LP Kendall Electric, Inc Anthem Insurance Companies ENA Services LLC Advanced Systems Group Educational Services Company Southern Bleacher Co Inc Lee Co., Inc. Academic Licenses The Paper Corporation Kaufmann Software CERTIFIED SALARY SCHEDULE in effect June 30, 2013 BACHELORS EXP. SALARY 10%TRF TOTAL 0 $32,603 $3,260 $35,864 2-Jan $33,103 $3,310 $36,413 3 $34,095 $3,410 $37,505 4 $35,074 $3,507 $38,581 5 $36,056 $3,606 $39,662 6 $37,036 $3,704 $40,740 7 $38,016 $3,802 $41,818 8 $38,996 $3,900 $42,896 9 $39,976 $3,998 $43,974 10 $40,956 $4,096 $45,052 11 $41,952 $4,195 $46,147 12 $43,961 $4,396 $48,357 13 $44,909 $4,491 $49,400 14 $45,857 $4,586 $50,443 15 $46,798 $4,680 $51,478 16 $47,745 $4,775 $52,520 EXP. SALARY 3%TRF TOTAL 17 $48,692 $1,461 $50,153 18 $49,640 $1,489 $51,129 MASTERS OR BA +36 HRS OR BA +540 CRU’S STUDENT ENROLLMENT OCTOBER 1, 2012 Pre-School Ages 0-2 (PW) - 0; Pre-Kindergarten Ages 3 - 5 (PK) - 0; Kindergarten - 84; Grade 1 - 65; Grade 2 - 79; Grade 3 - 65; Grade 4 - 62; Grade 5 - 90; Grade 6 - 78; Grade 7 - 83; Grade 8 - 80; Grade 9 - 88; Grade 10 - 95; Grade 11 - 104; Grade 12 - 89; Grade 12+/ Adult (13) - 0; Total - 1062

Student Council-HS $1,605.00 V Cross Country Coach $2,190.00 MS Spelling Bee $225.00 MS Intramural Soccer $590.00 Auditorium Manager $340.00 V Boys’ Golf Coach $2,140.00 MS Team Leader $340.00 MS Football Coach $1,860.00 HS Choir $340.00 Ass’t. Golf Coach (Grades 6-12) $1,125.00 MS Math Bowl $225.00 MS Football Ass’t. Coach $1,575.00 HS Academic Team $340.00 V Wrestling Coach $3,210.00 MS Academic Team $225.00 MS Volleyball Coach $1,575.00 HS Spell Bowl $340.00 Ass’t. Wrestling Coach $1,575.00 MS Spelling $225.00 MS Yearbook $340.00 HS Quiz Bowl $225.00 HS Canteen $2,000.00 MS Operetta $1,715.00 EL Chair $340.00 JV & V Cheer Coach/Fan Bus $1,905.00 V Girls’ Basketball Coach $6,315.00 MS Set Design $340.00 EL Music $565.00 Fresh Cheer Coach/Fan Bus $1,015.00 JV Girls’ Basketball Coach $2,810.00 MS Cheer Coach $1,015.00 EL Set Design $340.00 Newspaper - Outside Class $350.00 Gr 9 Girls Basketball Coach $2,360.00 MS Boys’/Girls’ Track $1,685.00 EL Learning Fair Co-ordinator $340.00 V Football Coach $6,420.00 Beginning Teacher Mentor $645.00 MS Ass’t. Track Coach $1,125.00 EL Yearbook $340.00 V Football Ass’t Coach $2,835.00 V Volleyball Coach $3,425.00 MS Cross Country Track $1,070.00 MS PL221 $805.00 V Bys Basketball Coach $6,315.00 JV Volleyball Coach $1,800.00 MS Golf Coach $1,015.00 HS PL221 $805.00 JV Bys Basketball Coach $2,810.00 Gr 9 Volleyball Coach $1,125.00 MS Wrestling Coach $1,015.00 EL PL221 $805.00 Gr 9 Bys Basketball Coach $2,360.00 E-Club $340.00 MS Ass’t. Wrestling Coach $675.00 Webmaster $340.00 JV Baseball Coach $2,025.00 V Softball Coach $3,320.00 Gr 8 Boys’/Girls’ Basketball $1,800.00 JV Softball Coach $2,025.00 V Baseball Coach $3,320.00 V Softball Ass’t. Coach $1,715.00 Gr 7 Boys’/Girls’ Basketball $1,800.00 Intramural Tennis $850.00 V Baseball Ass’t Coach $1,715.00 V Girls’ Golf Coach $2,140.00 Gr 6 Boys’/Girls’ Basketball $845.00 V Girls’ Tennis Coach $2,090.00 Head B Track Coach $3,320.00 MS Accompanist $225.00 MS Intramural Volleyball $590.00 V Boys’ Tennis Coach $2,090.00 Ass’t. HS Track Coach $1,645.00 MS Student Council $340.00 MS Canteen $900.00 Ass’t Girls’/Boys; Tennis Coach $1,230.00 PAYMENTS IN EXCESS OF $2500 MADE TO VENDORS CALENDAR YEAR 2012 General Capital School School Bus General Capital School School Bus Fund Project Fund Transportation Replacement Total Fund Project Fund Transportation Replacement Total Vendor Name Amount Amount Fund Amount Fund Amount Amount Amount Amount Fund Amount Fund Amount Amount Eric Armin Inc 8,692 8,692 534,068 200,000 900,000 1,634,068 Angola Office Supply 361 7,967 8,328 1,411,052 44,602 148,013 1,603,667 Follett Library Resources 7,651 7,651 310,908 1,921 312,829 Student Athletic Protection, Inc. 6,665 6,665 266,011 266,011 Visa 2,321 3,979 61 6,361 6,574 197,591 7,422 211,587 Muncie Community Schools 5,921 5,921 89,188 48,065 14,702 151,955 Central Indiana Hardware Co. 5,900 5,900 1,182 130,108 131,290 Steuben Co Remc 418 5,038 408 5,865 49,101 25,230 53,793 128,123 Oce Imagistics Inc 27 5,445 5,472 118,529 118,529 NCS Pearson, Inc 5,400 5,400 91,220 2,193 93,413 Paxton/Patterson LLC 5,320 5,320 44,537 48,518 93,054 Standard For Success LLC 5,034 5,035 47,676 14,282 27,200 89,158 Billings Service Station 5,030 5,030 47,598 12,942 24,433 84,973 Pioneer 5,009 5,009 76,375 76,375 Steven E Hanna 4,950 4,950 44,911 44,911 Steuben Cty Communications 4,800 4,800 31,700 31,700 Robert’s Floors Co. 4,780 4,780 6,549 25,095 31,644 Best-Klean Products 98 4,567 4,665 2,809 28,329 31,139 White Supply Company 4,654 4,654 28,328 28,328 Indiana Physical Therapy 4,600 4,600 26,681 26,681 Region 8 ESC 325 4,109 4,434 22,561 723 588 23,872 Harrell’s 4,355 4,355 20,030 20,030 Arrow Uniform Rental 605 3,690 4,296 7,264 9,734 2,952 19,950 Renaissance Learining, Inc 3,901 3,901 285 19,463 19,748 Helmke Beams LLP 3,815 3,815 17,270 378 1,229 18,877 Kone, Inc. 3,815 3,815 18,134 18,134 Advanced Turf Solutions 3,776 3,776 17,029 17,029 The Disc Golf Company 3,700 3,700 16,949 16,949 Hydrotex 3,691 3,691 14,092 14,092 Farm Bureau Life Insurance Co. 3,556 3,556 13,738 13,738 Worthington Direct 3,472 3,472 13,509 13,509 Sonadoft Corporation 3,219 3,219 923 12,477 13,400 Fremont Hardware, Inc. 2,937 255 3,192 12,433 12,433 Verizon Wireless 3,134 3,134 11,934 279 12,214 Clear Lake Electric 3,119 3,119 12,041 12,041 Morris & Sons 3,083 3,083 11,401 11,401 Brown’s Wood Concepts 255 2,818 3,072 11,379 11,379 The McKean Group Inc 3,065 3,065 11,294 11,294 Decker Equipment 2,844 2,844 10,395 10,395 Us Games 2,773 2,773 9,912 9,912 Adams Remco Inc. 1,776 848 2,625 9,866 9,866 Copier Co. 215 2,401 2,616 9,800 9,800 Culligan of Fremont 2,609 2,609 9,535 9,535 Smith Enterprises 2,576 2,576 9,485 9,485 Auto-Jet Muffler Corp 2,559 2,559 9,021 9,021 9,000 9,000 ings. SUMMONS BY PUBLICATION STATEMENT OF INDEBTEDNESS CALENDAR YEAR 2012 EXP. SALARY 10%TRF TOTAL If you wish to countersue, you must IN THE STEUBEN Indebtedness Principal Outstanding 1 $33,813 $3,381 $37,194 do so by written petition filed herein SUPERIOR/CIRCUIT COURT Temporary Loans $ 2 $34,313 $3,431 $37,744 not more than sixty (60) days from CASE NO.: 76C01-1307-DR-205 School Bonds 2,000,000 3 $35,468 $3,547 $39,015 the date hereof. STATE OF INDIANA Emergency Loans 4 $36,621 $3,662 $40,283 Dated: 7-23-13 COUNTY OF STEUBEN SS: School Bus Loans 5 $37,753 $3,775 $41,528 Clerk, Steuben County IN RE THE MARRIAGE OF: Holding Company - Public and Private 1,530,000 6 $38,930 $3,893 $42,823 HR,00347646,7/29,8/5,12, hspaxlp DANIEL JOHN POWERS, Veterans’ Memorial Loans 7 $40,081 $4,008 $44,089 PETITIONER Common School Loans 8 $41,236 $4,124 $45,360 V. Indiana Bond Bank/Anticipated Notes 9 $42,391 $4,239 $46,630 MARY MARGARET POWERS, Retirement/Severance Bond Debt 1,740,000 10 $43,542 $4,354 $47,896 RESPONDENT Other DLGF Approved Debt 11 $44,697 $4,470 $49,167 The State of Indiana to ResponQualified School Construction Bonds (ARRA) 12 $45,849 $4,585 $50,434 dent: Mary Margaret Powers, 60 Ln Qualified Zone Academy Bonds (ARRA) 13 $47,004 $4,700 $51,704 587AA Lake James, Fremont, IndiTOTAL 5,270,000 14 $48,156 $4,816 $52,972 ana 46737. Outstanding Encumbrances - All Funds (Include purchase 15 $49,333 $4,933 $54,266 You have been sued by your orders, vendor contracts, letters of commitment, leases) $ 16 $50,517 $5,052 $55,569 spouse for dissolution of your mar17 $51,698 $5,170 $56,868 Legal Copy Deadlines riage. The case is pending in the CERTIFICATION EXP. SALARY 3%TRF TOTAL Publish Court named above. I hereby certify that the Copy due 18 $52,881 $1,586 $54,467 In order to participate in the proannual financial report is true and Wed. 4 p.m. .............................Mon. 19 $54,062 $1,622 $55,684 ceedings, you must enter a written accurate in every respect to the best Thurs. 4 p.m. ..................................... Total number of certified part-time appearance in person or by your atof my knowledge and belief. further Tues................................................... employees___________ torney. In the event you do not enter certify that all contracts, vouchers, Fri. 4 p.m............................. Wed. Total number of certified full-time a written appearance within sixty (60) and bills for all payments made by the Mon. 4 p.m. .......................... Thurs. employees__________ days of the date hereof, your marschool corporation are in tis posses- Tues. 4 p.m. .............................. Fri. riage can be dissolved by Decree of sion and open to public inspection. Annual Reports & Budgets due 5 working the Court by default. In the event of a days before the publish date. Date: July 15, 2013 CERTIFIED ADMINISTRATIVE Legal Notices Decree is entered by default, it may Hope Korte STAFF IN EFFECT JUNE 30, 2013 contain a judgment against you and Secretary, Board of School Trustees Worth noticing Administrative Staff: provisions regarding the distribution Fremont Community Schools Lowest Salary - 67,504; Highest of assets and payment of debts. The 1100 W. Toledo St. Salary - 88,073; Average Salary Decree may also require you to take Fremont, IN 46737 75,630; Number of Personnel - 6. actions or refrain from actions in orHR,00349247,8/12,hspaxlp der to carry out the terms of the Court’s Decree. If you do not enter a Call Kelly at written appearance, you will receive 260-665-3117 877-791-7877x182 no further notice of these proceed-

E-mail your legal!

legals@kpcnews.net

@sk

THE EXPERT

for details

THE

HERALD

REPUBLICAN


A6

THE HERALD REPUBLICAN

kpcnews.com

MONDAY, AUGUST 12, 2013

Golf carts not four-wheel drive BY ERNIE WITHAM

“All is fair in love and golf.� — Proverb A husband gives advice on golfing The revelation that golf carts do not have four-wheel drive came to me one morning as I tried to find my ball in the mud, which I found out later was actually not part of the golf course at all but rather the site of a pending condo project, half a block away. I must have missed the out-of-bounds marker when I was crossing the freeway. It was just one more lesson in the complex world of golf. I remember the first time I played. My twosome was paired up with another twosome. After my tee-off on the first hole went somewhat awry, landing on the clubhouse roof, one of the other players asked if I had a handicap. I thought his joke in poor taste and threatened him with my 9-iron. Now, of course, I realize that having a handicap is a good thing, even if it is 52. Learning the rules and language of golf is crucial. It separates the obvious beginner from someone just having another bad day. Therefore, I have from experience compiled a few lessons that may help other novices. If the instructor tells you to address the ball, do not take out a pen and write “to green� on the ball. Try not to stand on asphalt in the summer while wearing golf shoes, unless you are with a very strong friend. The easiest way to find a lost golf ball is to ask the guy limping in the next fairway. Never insist that your spouse golf. It can lead to only one of two results. One, she/he plays really badly, complains for four hours and ruins your whole day. Or, he/she plays really well, offers four hours of suggestions on how you might do better and ruins your whole day. A double bogey is not a strong drink from the movie “Casablanca.� It means two over par. And not a bad score at all. If they have a name for it, it’s a good score. There is no name for a 15. A chip is not something left behind by a foraging

cow. That’s a flap. A chip is a carefully choreographed half-swing that often goes farther than your original drive. A divot is a lump of grass that flies up from where the golf ball used to be. A damnit is a lump of grass that flies up in your face as you hit two feet behind the ball. A slice is a ball that curves to the right. A bad slice is a ball that lands behind you. A tough lie has double meanings. It’s when you have to come up with an excuse — for the umpteenth time — as to why it took six hours to play nine holes and why your breath smells like nacho chips and beer. It also refers to a difficult spot to have to hit your ball from. For instance, the base of a tree, the crook of a tree or the upper branches of a tree. Heavy rough is the area along the edge of the fairway just before your ball is legally out of bounds. A good rule of thumb — if the guy beside you is barbecuing, you’re probably out of bounds. And finally, Club Rules imply that you are not penalized by foreign objects on the fairway. Therefore, if you knock out a tourist with your drive, you are allowed to move your ball one club’s length from the body. Now that you understand some of the basics, you should be able to better appreciate the game. And you can focus on some of the more intriguing idiosyncrasies of golf, like if it’s completely made out of metal, why do they call it a 3-wood? (C)2013 BY CHICKEN SOUP FOR THE SOUL PUBLISHING, LLC

Distributed by King Features Syndicate

)L[HG5DWH0RUWJDJHV86'$*RYHU /RDQV+RXVLQJ'HYHORSPHQW$GMXVW 5DWH/DQG0RUWJDJH%DOORRQ0RUWJ &RQVWUXFWLRQ+RPH,PSURYHPHQW

Everyday Loans. Extraordinary Service.

PHOTO CONTRIBUTED

Sharing with the neighbors The children at the Angola United Methodist Church finished their week of God’s Big Backyard Bible Camp with blessing their neighbors with flower pots they

painted and planted with flowers. They were placed at North Elizabeth, North West, West Broad, North Superior, Jackson and West Gilmore streets.

Community Calendar • Today • Alcoholics Anonymous Meetings: 8 a.m. First Congregational United Church of Christ, 314 W. Maumee St., Angola. • GED Classes: 9 a.m. Steuben County Literacy Coalition, 1208 S Wayne St, Angola. 665-3357 • Weight Watchers: 9 a.m. Angola United Methodist Church, 220 W. Maumee St., Angola. • Move It to Improve It: 10:15 a.m. Steuben County Council on Aging, 317 S Wayne St, Angola. 665-9856 • Happy Knitters and Bubbly Crocheters: 11 a.m. Steuben County Council on Aging, 317 S Wayne St, Angola. 665-9856 • Weight Watchers: 5:30 p.m. Angola United Methodist Church, 220 W. Maumee St., Angola. • Angola Rotary Meeting: 6 p.m. Elks Lodge, 2003 N. Wayne St., Angola. • Steuben 9-12: 6 p.m. Angola Christian Church, 1297 N. C.R. 200W, Angola. • Little River Chorus rehearsal: 6 p.m. Fairview

Missionary Church, 525 E. C.R. 200N, Angola. • Diabetes Support Group: 7 p.m. Hamilton United Methodist Church, 7780 S. Wayne St., Hamilton. • Alcoholics Anonymous Big Book Meeting: 7:30 p.m. First Congregational United Church of Christ, 314 W. Maumee St., Angola.

Tuesday, Aug. 13 • ImagiKnit: 10 a.m. Carnegie Public Library of Steuben County, 322 S. Wayne St., Angola. • Story Time: 10 a.m. Carnegie Public Library of Steuben County, 322 S. Wayne St., Angola. • Tri-State Duplicate Bridge: 12:15 p.m. Presbyterian Chapel of the Lakes, 300 Orland Road, Angola. • Story Time: 1 p.m. Carnegie Public Library of Steuben County, 322 S. Wayne St., Angola. • Grief Support Group: 4:30 p.m. Cameron Woods, 701 W. Harcourt Road, Angola. • Community Soup and Supper: 5 p.m. Faith Harvest Church, 200 Park Ave., Angola. • Alcoholics Anonymous

TURN ON YOUR PASSION FOR DANCE! Fall Registration Aug. 19 & 20 • 4-6 PM Shoe ďŹ tting during registration by Standing Ovation Classes Oered: Ages 2-3: Ballet/Tap Combo Ages 4-6: Ballet, Tap, Jazz, Clogging Ages 7 and up: Ballet, Pre-Pointe, Pointe, Tap, Jazz, Lyrical,

Meeting: 7:30 p.m. First Congregational United Church of Christ, 314 W. Maumee St., Angola.

• Retired Senior Volunteer Project: 9 a.m. St. Anthony of Padua Catholic Church, 700 West Maumee Street, Angola. 665-2259 • Helping Hands Volunteer Project: 9 a.m. Church of Jesus Christ of Latter Day Saints, 768 N. S.R. 827, Angola. • Faith Community Health Clinic: 5 p.m. Holy Family Espicopal Church, 909 S. Darling St., Angola. • Bingo: 6 p.m. Orland American Legion, 211 N. Bronson St., Orland. • Alcoholics Anonymous Meeting: 7 p.m. First Congregational United Church of Christ, 314 W. Maumee St., Angola. • New Beginnings for Narcotics Anonymous: 7:30 p.m. First Congregational United Church of Christ, 314 W. Maumee St., Angola.

665-2141 • Bariatric Support Group: 5 p.m. Coachlight Coffee House, 30 N. Public Square, Angola. • Beginner Quilt Class: 6 p.m. Angola High School, 350 S. John McBride Ave., Angola. • Bingo: 6 p.m. Angola American Legion Post 31, 1760 W. Maumee St., Angola. • Big Book Meeting: 7 p.m. Serenity House, 2438 CR 50, Auburn. 927-8902 • Northeast Indiana Woodworkers Group Meeting: 7 p.m. Carnegie Public Library of Steuben County, 322 S. Wayne St., Angola. • Abate Region O Meeting: 7:30 p.m. Hamilton Fish and Game Club, 110 E. Railroad Street, Hamilton. • Alcoholics Anonymous Men’s Meeting: 7:30 p.m. Holy Family Espicopal Church, 909 S. Darling St., Angola. • Alcoholics Anonymous Meeting: 7:30 p.m. Fremont United Methodist Church, 3165 E. Spring St., Fremont.

Thursday, Aug. 15

Friday, Aug. 16

Wednesday, Aug. 14

• Euchre Community Game: 9:30 a.m. Steuben County Council on Aging, 317 S Wayne St, Angola. 665-9856 • Story Time: 10 a.m. Carnegie Public Library of Steuben County, 322 S. Wayne St., Angola. • Angola Kiwanis Meeting: 12 p.m. Cameron Memorial Community Hospital, 416 East Maumee Street, Angola.

• Bingo: 6 p.m. Orland American Legion, 211 N. Bronson St., Orland. • New Beginnings for Narcotics Anonymous: 7 p.m. Narcotics Anonymous, 412 S. John St., Angola. • Alcoholics Anonymous Open Discussion Meeting: 7:30 p.m. First Congregational United Church of Christ, 314 W. Maumee St., Angola.

Clogging, Technique Classes, Turns, Leaps & Tricks Class

Adult Instructors with extensive dance educations.

Classes begin Tuesday, September 3

Weddings In Color •

Turning Pointe Dance Academy Æ:LWKRYHU\HDUVRI EDQNLQJH[SHULHQFHDQG \HDUVLQPRUWJDJHOHQGLQJ,DP DEOHWRRIIHU\RXDZHDOWKRI NQRZOHGJHWKURXJKRXWWKHORDQ SURFHVVDQGSURPLVHWRWUHDW\RX ZLWKWKHVDPHUHVSHFWDV,ZRXOG ZDQWWREHWUHDWHG*LYHPHDFDOO WRGD\DQGOHWPHDVVLVW\RXLQ PDNLQJ\RXUGUHDPVFRPHWUXHÇ

3375 CR 427, Waterloo • 260-553-2780 E-mail: turningpointedirector@live.com

The Herald Republican prints color wedding photos with wedding

)5((&2,1 $335$,6$/6 DPSPDW

.ULVWLH Kristie Prater 5HWDLO/HQGHU$93 NSUDWHU#VPEWFRP  10/6

Member FDIC

:HGQHVGD\$XJXVW 1:D\QH6W$QJROD,1 :LWKROGFRLQVFXUUHQF\JROGDQGVLOYHUSULFHVDWDQDOOWLPHKLJKZHZDQWWREH VXUHWKDW\RXKDYHDFFHVVWRWKHEHVWDGYLFHSRVVLEOHZKHQVHOOLQJ\RXUFROOHFWLRQ +&&ÂśVDSSUDLVHUZLOOEHWKHUHWRDSSUDLVHDQGRIIHU\RXDIDLUSULFHIRU\RXUROG FRLQVFXUUHQF\JROGDQGVLOYHUFRLQVDQGEDUV<RXFDQWUXVW\RXUFROOHFWLRQWRWKH VHDVRQHGQXPLVPDWLVWVRI+&&5DUH&RLQV6HUYLFLQJEDQNVIRUQLQHWHHQ\HDUV &OHDQLQJ\RXUFRLQVPD\GHFUHDVHWKHLUYDOXH1RDSSRLQWPHQWV 4XHVWLRQV"&DOO+&&DWRUYLVLWZZZKFFFRLQFRP

:($5(%8<,1*

stories free of charge the first Sunday of every month. You can submit your announcement online at kpcnews.com. At the top of the home page, under Share News, there are links to wedding forms. You may also send your information by mail to The Herald Republican c/o Jennifer Decker, 45 S. Public Square, Angola, IN 46703. If sending a photo by mail, please include a self-addressed, stamped envelope to have it returned. Or you can attach a high quality, color photo to your online form. For information, call Jennifer at 665-3117, ext. 146, or email her at jdecker@kpcmedia.com. The deadline for wedding submissions is Monday at noon prior to publication.


AREA • NATION •

MONDAY, AUGUST 12, 2013

kpcnews.com

THE HERALD REPUBLICAN

A7

Egyptian police say they plan to beseige sit-in protests CAIRO (AP) — Supporters of ousted President Mohammed Morsi fortified their two Cairo sit-in sites as Egyptian security officials said their forces will move against the entrenched protest camps within 24 hours — perhaps as early as daybreak today. At the main sit-in, vendors said they have sold hundreds of gas masks, goggles and gloves to protesters readying for police tear gas. Three waist-high barriers of concrete and wood have been built against armored vehicles. The Arab world’s most populous country, where more than 250 people have been killed in clashes since Morsi was toppled July 3, braced for more violence as the four-day Muslim Eid celebrations wrapped up Sunday to end the holy

month of Ramadan. The security officials said they would set up cordons around the protest sites to bar anyone from entering, and one of the officials said that could begin as soon as sunrise. The Interior Ministry has said it would take gradual measures, issuing warnings in recent weeks and saying it would use water cannons and tear gas to minimize casualties. Interior Ministry officials, speaking to The Associated Press on condition of anonymity because they are not authorized to discuss details of the security plans, said they are prepared for clashes that might be set off by the cordons. The officials said police are working with the Health Ministry to ensure ambulances are on hand for the wounded and that armored

police vans are nearby to take away those arrested. A special force within the Interior Ministry’s riot police that are trained for crowd dispersal will deal with protesters. In the past, however, Egypt’s riot police, many of whom lack the training to deal with unarmed civilians, resorted to using lethal force. There was no immediate government confirmation of when forces would move in on the sit-ins. Egypt’s military-backed interim leadership alleges that the sit-ins and protests have frightened residents, sparked deadly violence and disrupted traffic in the capital. Mass rallies two weeks ago called by the military leader, Gen. Abdel-Fattah el-Sissi, showed that a large segment of Egypt’s population backs

the armed forces’ actions against the Morsi supporters. The protesters blame the Interior Ministry and “thugs” for past violence, including a July 8 clash between demonstrators and security forces that left more than 80 dead. Just before the holiday, the government said international efforts failed to reach a diplomatic solution to the standoff with Morsi’s supporters, who include members of his Muslim Brotherhood. The Cabinet said the decision to clear the main sit-in site outside the Rabaah al-Adawiya Mosque and a smaller one in nearby Giza near Cairo University was “irreversible.” A last-ditch effort was launched over the weekend by the Sunni Muslim world’s pre-eminent religious institution,

Al-Azhar, to push for a resolution. The protesters, who demand Morsi’s reinstatement as Egypt’s first freely elected president, are expecting an imminent security push to clear them out and they have been fortifying their positions. Ripped-up pieces of pavement comprise the first barriers that visitors must zigzag around to reach the Rabaah sit-in, where tens of thousands have been camped. Along the way are piles of rocks to throw at police. There are also signs denouncing el-Sissi, who led the coup against Morsi, as well as marks on the ground that purport to show where protesters were shot to death in the recent clashes with security forces. One man bent down to kiss

one of the spots on his way to the sit-in. At the six entrances to the camp, male and female volunteers frisk visitors, inspect bags and check IDs. Speakers on a stage Sunday led chants of “The dogs of el-Sissi killed my children!” and sang the national anthem. There are fears that violence from trying to clear the two sites will spread to other areas of the capital and beyond, where thousands of Morsi supporters also hold near-daily marches. The main protest camp is between middle-class residential buildings and ground floor businesses. Its focal point is the mosque and an adjacent stage where leaders of the Brotherhood charged with inciting violence openly talk to journalists.

BACK TO

SCHOOL SAFETY TIPS WALKING TO SCHOOL

Every day millions of children take to the streets to go to and from school. They walk, ride bicycles, take buses and arrive in automobiles. For many children this experience is a new one and they may not understand safety rules. Young children do not have the same concept of safety as adults. They may not look before they leap, which is why it is so important for parents to supervise young children and practice safety with their older children. The safety tips listed here will help you, as parents, prepare your children for a safe journey.

BUS STOPS

• Parents should walk or bike the route prior to school starting and look for any possible hazards the child may encounter and identify a safe place to go if the child needs help. • Stop, look and listen before crossing the street. Always cross at the crosswalk and obey traffic signals. • Walk or bike with a friend. It is safer and more fun with a buddy. • Go directly to school and directly home afterward. • Do not play in vacant fields or lots. • Stay on the sidewalk or bike path and do not take short cuts. • If someone approaches you or makes you feel uncomfortable, don’t talk to them and keep walking or riding. • If a vehicle is following you, turn around and run the other way. • Don’t put your name on clothing, backpacks, books or lunch boxes that are visible to others. • If approached by a dog, do not run. Do not touch the dog. Stand still and tell the dog to go home. If the dog will not leave, slowly back away from the dog putting distance between him and you; then continue walking.

Angola Collision Services

• Know your bus number. • Stay in a group while waiting for the bus. • Do not play in the street. Stay on the sidewalk or grass. • Wait for the bus to completely stop before approaching it. • Look both ways before crossing the street to get on the bus. • Stay seated while on the bus and keep hands and head inside the windows. • If someone offers you a ride, say NO. • A parent could be at the bus stop before and after school for extra safety.

FOR PARENTS...VEHICLE TRAFFIC

• Christ-centered academic excellence • Preschool through eighth grade • Caring experienced staff • Small class sizes • State accredited Our school participates in the Indiana Choice Scholarship Program. CONTACT US FOR DETAILS!

ST. JOHN LUTHERAN SCHOOL 301 S. Oak Street, Kendallville, IN 260.347.2444 • www.stjohneagles.org

• While driving, be more aware of the speed limits in your neighborhood and around schools. • Observe the sides of the roadway, watching for children walking and biking. • Give children right-of-way in crosswalks and school zones. • Avoid backing your vehicle at schools. • Children should exit to the right side of the vehicle. • Do not leave until your child is completely on school property.

BIKING TO SCHOOL • Bright colored clothing will make you more visible to drivers. • Always wear a bicycle helmet. • Backpacks should be tight on the upper back and not dragging on the rear tire. • Respect traffic lights and stop signs. • Ride on the right with the traffic.

• Preferred by Major Insurance Companies • All Insurance Company Estimates Accepted • All Repairs Completed On Site • Frame Analysis • Unibody Repair • Full Frame Repair • Paint Booth • Guaranteed Paint Match • Airbag Installation • Written Warranties 340 Hoosier Dr., Angola, IN (Located behind Oasis Carwash)

Butler, IN - Headquarters Kendallville, IN - Compounding Facility Added in 2009

www.color-master.com

The Nation’s Largest Recycler The Nations largest Steel Joist and Metal Deck Producer

• Estimating • Parts Ordering • Frame Analysis

Thanks For 41 Great Years!

Phone: 260-665-8604 • Fax: 260-665-8989

Proudly supporting our local schools! A Division of Corporation

Celebrating over 1 million safe miles! )\[SLY0UKPHUH ;LSSTLTVYL!^^^HPYWYVK\J[ZJVT

Kids, look both ways before crossing the street. Butler Police Department 201 N. Broadway • Butler For emergencies, dial 911 Business calls, dial 868-2171

• Collision Repair • Frame Repair • Custom Paint & Body • Restoration • Insurance Work

1001 S. Wayne, Angola

665-0077

autokraftautobody@gmail.com Jamie Hall - Owner

Rob Jowsay - Owner

6610 C.R. 60, P.O. Box 1000 St. Joe, Indiana, 46785

COMPLETE AUTO BODY REPAIR

BODY SHOP

111 E. Railroad St. • Garrett • 357-5565

Ph: 260-337-1800 • FAX: 260-337-1801

VISIT US FOR OUR BOOK SALE THROUGH AUGUST Looking for building project donations (Matched by Olive B. Cole Foundation) Write Checks to Ligonier Public Library Memo Line, Building Fund

LIGONIER PUBLIC LIBRARY 300 S. Main St. • 260-894-4511 www.ligonier.lib.in.us

114 E. 6th St. Be cool, follow the safety ru Auburn when you les return

925-0777

to school!

Butler Fire Department 700 W. Main St., Butler, IN

Proudly serving the community since 1896


A8

THE HERALD REPUBLICAN

AREA â&#x20AC;˘ NATION â&#x20AC;˘

kpcnews.com

MONDAY, AUGUST 12, 2013

KESSLER: Couple lead classes in Garrett, Angola FROM PAGE A1

Skies will be cloudy today with a 40 percent chance of thunderstorms. The daytime high will be 83 and tonightâ&#x20AC;&#x2122;s low will be 63. Partly sunny Tuesday and cooler, with a high of 76. The overnight low will be 56. Wednesday, skies will be sunny with a high of 74 and a low of 53.

Sundayâ&#x20AC;&#x2122;s Statistics Local HI 80 LO 57 PRC. 0 Fort Wayne HI 82 LO 61 PRC. 0

South Bend HI 79 LO 57 PRC. 0 Indianapolis HI 84 LO 67 PRC. 0

Todayâ&#x20AC;&#x2122;s drawing by:

Dalton Millhouse Sunrise Tuesday 6:48 a.m. Sunset Tuesday 8:44 p.m.

Submit your weather drawings to: Weather Drawings, Editorial Dept. P.O. Box 39, Kendallville, IN 46755

silver,â&#x20AC;? Oberlin said.

and they were in favor of the idea,â&#x20AC;? Oberlin said. Oberlin said her foundation knew nothing about the market for silver or how to turn it into cash. She wondered if the donor would bring the silver bars into the foundationâ&#x20AC;&#x2122;s office or if heavy boxes of silver would need to be delivered to a buyer. â&#x20AC;&#x153;Lucky for us, the donor watched the market price for silver and knew where to sell it. The donor drove the silver to the buyer, who knew that it should be gifted to the community foundation with a paperwork transaction before it was sold. The buyer wrote a check for the proceeds of the silver to the community foundation, and that became the gift to create an endowment fund,â&#x20AC;? Oberlin said. In doing so, the donor created a permanent fund in memory of his late wife to support music programs at the coupleâ&#x20AC;&#x2122;s church. â&#x20AC;&#x153;The community foundation was thrilled to help the donor support his church in his wifeâ&#x20AC;&#x2122;s memory. We were even happier that we didnâ&#x20AC;&#x2122;t have to lift heavy boxes of

LaGrange County Community Foundation The LaGrange County Community Foundation doesnâ&#x20AC;&#x2122;t receive other forms of donations beyond cash or real estate, said Loren Heinlen, LCCF program officer. â&#x20AC;&#x153;As a general rule, we donâ&#x20AC;&#x2122;t get items unless we solicit a gift,â&#x20AC;? Heinlen said. â&#x20AC;&#x153;Generally, weâ&#x20AC;&#x2122;re shooting for larger value.â&#x20AC;? Heinlen said the foundation recently received a donation of Elsie Willardâ&#x20AC;&#x2122;s home near Parkview LaGrange Hospital. Willard was the foundationâ&#x20AC;&#x2122;s founding executive director in 1991. â&#x20AC;&#x153;Our board will decideâ&#x20AC;? what the foundation will do with it, he said.. â&#x20AC;&#x153;We received an appraisal, but we have to wait for the Internal Revenue Service.â&#x20AC;?

Noble County Community Foundation Linda Speakman-Yerick, executive director of the

in a given night and dancers pay a fee of $4 per class. Every year, the Kesslers rent space in Auburn and host three line dancing parties, so the students can all get together and socialize. While most line dances are to country music, Sally incorporates pop songs. Her favorite dance is to â&#x20AC;&#x153;Moves Like Jagger,â&#x20AC;? while her students like â&#x20AC;&#x153;Poker Face.â&#x20AC;? â&#x20AC;&#x153;We bring in variety,â&#x20AC;? Sally said. â&#x20AC;&#x153;I get on iTunes and see whatâ&#x20AC;&#x2122;s popular.â&#x20AC;?

HOG FARM: Information about permit is online FROM PAGE A1

DONORS: Donations are an individual choice FROM PAGE A1

It was a struggle at first, Sally admits. â&#x20AC;&#x153;I decided that youâ&#x20AC;&#x2122;ve got to give it a chance,â&#x20AC;? she said. The first line dance Sally taught was the â&#x20AC;&#x153;Achy Breaky Heartâ&#x20AC;? at the Silver Spur, a now-defunct country bar in Auburn. Sally said she never planned to expand into a dancing operation; it just happened naturally. â&#x20AC;&#x153;I like it,â&#x20AC;? Sally said. â&#x20AC;&#x153;I

love the fellowship.â&#x20AC;? Since 1994, the couple have led classes at the Garrett American Legion and also teach at the Angola American Legion. The Angola class has nearly 40 students. The dance operation at their home is come-and-go, with no reservations required. Anyone can show up at any time, Sally said. â&#x20AC;&#x153;I never know how many students I will have,â&#x20AC;? Sally said. The number of students can range from three to 20

Noble County Community Foundation, said one of the most unusual gifts ever received there was timber. â&#x20AC;&#x153;One of our most interesting gifts was actual walnut tree trunks, which were donated and we sold,â&#x20AC;? she said. Speakman-Yerick said volunteer hours her organization receives are the most valuable gifts of all. â&#x20AC;&#x153;The most wonderful gift is volunteer hours. We are blessed by all the board members, committee members, and the many individuals that are friends of the community foundation,â&#x20AC;? she said. â&#x20AC;&#x153;Countless hours are provided to the foundation, whether through meetings, fundraising, administrative duties or office maintenance.â&#x20AC;? When it comes to donations, SpeakmanYerick said itâ&#x20AC;&#x2122;s a matter of individual choice. â&#x20AC;&#x153;More and more individuals and families are using gift plans to not only take care of themselves, their familiesâ&#x20AC;? SpeakmanYerick said, â&#x20AC;&#x153;but also their charities that are so dear to their hearts.â&#x20AC;?

may do so at the meeting. Barry Sneed, IDEM public information officer, said the state received Wernerâ&#x20AC;&#x2122;s permit application May 30. One request for additional information was made on June 19 and a second request of new manure application plans was requested to be submitted by Wernerâ&#x20AC;&#x2122;s consultant. Because of those requests, the 90-day time frame is adjusted. Sneed said Werner is proposing two barns that would each contain a maximum of 2,400 grow-tofinish hogs. That means the pigs would arrive at 55-60 pounds and leave weighing between 250-270 pounds,

Sneed said. For manure storage, Sneed said Werner has indicated he wants to have manure pits under each barn approximately 8-feet deep that needs to stay 6 inches from the top. Initial storage would be 180 days annually. Beyond that, manure is applied to fields in spring and at fall harvest time. It cannot be applied to frozen or snow-covered ground. Assuming full capacity, Wernerâ&#x20AC;&#x2122;s swine manure output would be about 30,000 gallons and 55 gallons of wash water per barn daily. Wernerâ&#x20AC;&#x2122;s parcel is in the vicinity of several lakes, including Pine Canyon,

Crooked and Lime and Lake Gage. Members of those lake associations have spoken out against possible pollution problems and impact it could have on air quality, water contamination from manure runoff, Steuben Countyâ&#x20AC;&#x2122;s tourism industry, decreased property values and damage to road conditions due to excess truck weights. Citizens can find information about the IDEM permit review process on the agencyâ&#x20AC;&#x2122;s website at idem.IN.gov/4994.htm. To view the permit application from K & D, visit http://108.59.49.89/ Pages/Public/SearchResults. aspx?RegId=106550&DBSource=TEMPO.

WANDERING: Advocates are increasing awareness FROM PAGE A1

alarms,â&#x20AC;? said writer Jo Ashline of Orange, Calif., whose 11-year-old son has autism. â&#x20AC;&#x153;But thereâ&#x20AC;&#x2122;s always, in the forefront of our minds, the thought that one tiny mistake could prove fatal.â&#x20AC;? Groups that advocate for autism-affected families, including the National Autism Association and Autism Speaks, are now making it a priority to increase awareness of wandering â&#x20AC;&#x201D; among

parents, professionals who deal with autistic children, and first-responder agencies that handle missing-children cases. The study in Pediatrics found that half of parents with autistic children had never received advice or guidance from a professional on how to cope with wandering. Among those trying to change that is Sheila Medlam of Colwich, Kan., whose 5-year old son, Mason, drowned in

a pond in July 2010 after squirming out of the family home through a window that had been raised about 8 inches because the air conditioner went out. Medlam was at work; her adult daughter was at home but didnâ&#x20AC;&#x2122;t see Masonâ&#x20AC;&#x2122;s getaway. â&#x20AC;&#x153;It only takes a second of inattention and theyâ&#x20AC;&#x2122;re gone,â&#x20AC;? Medlam said in a telephone interview. â&#x20AC;&#x153;Theyâ&#x20AC;&#x2122;re fast, theyâ&#x20AC;&#x2122;re quiet. They can disappear in an instant.â&#x20AC;?

V tHe HV ZHBHC tHe <HpÄŞÄŞÄŞ

%VeZ`V` šêĹ&#x2019;ä +V.C& <HZZIJ .Ä&#x2030;Ĺ&#x2019;ÄźÄ&#x2019;ÂŽĹ&#x;Â&#x203A;ÂźĹ&#x201E;ÄŞÄŞÄŞ V:`+VHe&+ +V.C& ZtZ`B <.: CH H`+VĂ? <`HCŠ `+ &<H < <V .C +V.C& +<`+ V .Z eVVC`<t H%%V.C& C .C H%%. `V.<Ĺ&#x2039; H% C qV q.CC.C& Cq .&.`< +V.C& .CZ`VeBC`ÄŞ `+.Z H%%V .Z %V H% +V& C tHe V eCV CH H <.&`.HC `H etÄŞ

%V BHCZ`V`.HCZĂ?

`ğź ÂźĂ?Ä&#x2019;ğŸ tÄ&#x2019;Ĺ&#x; Ĺ&#x;ĹşĂ? `ğź ŸÚĹ&#x2019;Ä&#x2019;Ä&#x2030;Âź TÄźÄ&#x2019;Ä&#x192;ĂŞĹ&#x201E;Âź Â&#x2021; êğŸÂ&#x203A;Ĺ&#x2019; <ĂŞÄ&#x2030;Âź Â&#x203A;Â&#x203A;ÂźĹ&#x201E;Ĺ&#x201E;Ä&#x2019;ğêŸĹ&#x201E; ÂźĂ?Ä&#x2019;ğŸ tÄ&#x2019;Ĺ&#x; Ĺ&#x;ĹşĂ? +eVVt H%%V ŚĤêğŸĹ&#x201E; %V.tĂ?

Äś<Ä&#x2019;Ä&#x2019;á ZäŸĚĹ&#x201E; qÂź|ğêÄ&#x2030;Ă&#x2013; .Ĺ&#x2019;Ă?ġ

ZÄ&#x2019;Ĺ&#x;Ä&#x2030;ÂŽ Ă&#x2019;Ä&#x2019;šĹ&#x201E; Ĺ&#x;Ä&#x2030;ĂŞÄ&#x2030;Ĺ&#x2019;ŸğğĹ&#x;ĤĹ&#x2019;ŸŽ Ĺ&#x2019;Ä&#x2019; Â?Ä&#x2019;Ĺ&#x2019;ä Âź|ÄźĹ&#x201E; Ă?Ä&#x2019;Äź Zt eCVZ`C.C&Ă? `äŸ CŸš ŸÚĹ&#x2019;Ä&#x2019;Ä&#x2030;Âź TÄźÄ&#x2019;Ä&#x192;ĂŞĹ&#x201E;Âź ĂŞĹ&#x201E; `p Â&#x2021; ŸÚÚ TäÄ&#x2019;Ä&#x2030;Âź Ä&#x2019;Ä&#x192;Ĥ|Ĺ&#x2019;ĂŞÂ?ڟĂ? HÄ&#x2030; | Ĺ&#x;ÂŽĂ&#x2013;ÂźĹ&#x2019;IJ qÂź Ĺ&#x;Ä&#x2030;ŽŸğĹ&#x201E;Ĺ&#x2019;|Ä&#x2030;ÂŽ Â&#x2021; Ĺ&#x2019;ä|Ĺ&#x2019;ÄšĹ&#x201E; šäź šŸ Ä&#x2019;Ă?Ă?Ÿğ äŸ|ğêÄ&#x2030;Ă&#x2013; Ĺ&#x201E;Ä&#x2019;ĂšĹ&#x;Ĺ&#x2019;ĂŞÄ&#x2019;Ä&#x2030;Ĺ&#x201E; Ă?ÄźÄ&#x2019;Ä&#x192; ¡Ă&#x201E;Ä&#x17D;Ă&#x2018; Ä&#x2019;Äź ¡Ĺ&#x2014;Ć&#x192; ĤŸğ Ä&#x192;Ä&#x2019;Ä&#x2030;Ĺ&#x2019;ä šêĹ&#x2019;ä |ĤĤğÄ&#x2019;ŜŸŽ Â&#x203A;ğŸŽêĹ&#x2019;Ă?

`p ŸÚÚ

ŸÚĹ&#x2019;Ä&#x2019;Ä&#x2030;Âź êğŸÂ&#x203A;Ĺ&#x2019; VÂźÄ&#x192;Ä&#x2019;Ĺ&#x2019;Âź Ä&#x2019;Ä&#x2030;Ĺ&#x2019;ÄźÄ&#x2019;Ăš

Ä&#x2019;Ä&#x2030;Ĺ&#x2019;ÄźÄ&#x2019;Ăš ĹśÄ&#x2019;ĂšĹ&#x;Ä&#x192;Âź šäŸğŸŜŸğ ĹşÄ&#x2019;Ĺ&#x; Ă&#x2013;Ä&#x2019;Š šêĹ&#x2019;ä Ä&#x2030;Ä&#x2019; Ä&#x2019;Ä&#x2030;Âź Ĺ&#x2019;äŸ šêĹ&#x201E;ŸğĪ

qÂź ÂŽÄ&#x2019;Ä&#x2030;ÄšĹ&#x2019; Ĺ&#x201E;ŸÚÚ äŸ|ğêÄ&#x2030;Ă&#x2013; |ĂŞÂŽĹ&#x201E;Ă&#x2026; qÂź ĤğÄ&#x2019;Ŝꎟ äŸ|ğêÄ&#x2030;Ă&#x2013; Ĺ&#x201E;Ä&#x2019;ĂšĹ&#x;Ĺ&#x2019;ĂŞÄ&#x2019;Ä&#x2030;Ĺ&#x201E;Ă? &êŜŸ Ĺ&#x;Ĺ&#x201E; |Ä&#x2030; äÄ&#x2019;Ĺ&#x;Äź |Ä&#x2030;ÂŽ šŸ šêÚÚ Â&#x203A;ä|Ä&#x2030;Ă&#x2013;Âź ĹşÄ&#x2019;Ĺ&#x;Äź ÚêĂ?ŸĪ ŸÚĹ&#x2019;Ä&#x2019;Ä&#x2030;Âź ä|Ĺ&#x201E; Ĺ&#x201E;ĤŸÂ&#x203A;ĂŞ|Ăš ÂŽĂŞĹ&#x201E;Â&#x203A;Ä&#x2019;Ĺ&#x;Ä&#x2030;Ĺ&#x2019;Ĺ&#x201E; Ă?Ä&#x2019;ğ¨ +Ĺ&#x;Ä&#x192;|Ä&#x2030;|Š Ä&#x2030;Ĺ&#x2019;äŸÄ&#x192;Š VT Â&#x2021; .Ä&#x2030;ÂŽĂŞ|Ä&#x2030;| `Âź|Â&#x203A;äŸğĹ&#x201E; Ĺ&#x201E;Ĺ&#x201E;Ä&#x2019;Â&#x203A;ĂŞ|Ĺ&#x2019;ĂŞÄ&#x2019;Ä&#x2030; BÂźÄ&#x192;Â?ŸğĹ&#x201E;Ă? B|Ä&#x2030;Ĺş +Âź|ĂšĹ&#x2019;ä .Ä&#x2030;Ĺ&#x201E;Ĺ&#x;Äź|Ä&#x2030;Â&#x203A;ÂźĹ&#x201E; Â&#x203A;Â&#x203A;ŸĤĹ&#x2019;ŸŽĂ? |ÚÚ `Ä&#x2019;ÂŽ|Ĺş %Ä&#x2019;Äź Ä&#x2030; ĤĤÄ&#x2019;ĂŞÄ&#x2030;Ĺ&#x2019;Ä&#x192;ÂźÄ&#x2030;Ĺ&#x2019;Ă? .Ä&#x2030;ÂŽĹş CÄ&#x2019;ÄźĹ&#x2019;也Ĺ&#x201E;Ĺ&#x2019; .Ä&#x2030;ÂŽĹş qÂźĹ&#x201E;Ĺ&#x2019; ANGOLA

,6

Ĺ?Ĺ?Ă&#x2018;Ć&#x192; q Ă&#x201E;Ĺ?Ĺ&#x2019;ä ZĹ&#x2019;ÄŞ Ä&#x153;Ă&#x201D;Ă&#x2018;Ä&#x153; ZÄŞ &ğŸŸÄ&#x2030; ZĹ&#x2019;ÄŞ Â&#x161; ÄźÄ&#x2019;šÄ&#x2030;Ĺ&#x201E;Â?Ĺ&#x;ÄźĂ&#x2013; ÄŚ|Â&#x203A;ÄźÄ&#x2019;Ĺ&#x201E;Ĺ&#x201E;St. Ă?ÄźÄ&#x2019;Ä&#x192; ZĹ&#x2019;ÄŞ pĂŞÄ&#x2030;Â&#x203A;ÂźÄ&#x2030;Ĺ&#x2019; +Ä&#x2019;Ĺ&#x201E;ĤêĹ&#x2019;|Úħ ÄŚZĹ&#x2019;ÄŞ VÂŽÄŞ Ĺ?Ĺ?Ĺ&#x152; ZÄŞ Ä&#x2019;Ă? ÄźÄ&#x2019;šÄ&#x2030; Ĺ&#x2019;ğħMaumee 411BŸŽ W. 215

.Ä&#x2030;ÂŽĹşAUBURN CÄ&#x2019;ÄźĹ&#x2019;äŸ|Ĺ&#x201E;Ĺ&#x2019;

Duesenberg Dr.

.Ä&#x2030;ÂŽĹş ZÄ&#x2019;Ĺ&#x;Ĺ&#x2019;ä

ÄŚĹ&#x2014;Ä&#x153;Ĺ&#x152;ħ Ĺ&#x2014;Ă&#x2018;Ä&#x17D;ĂŠĂ&#x201D;Ă&#x201D;Ă&#x201D;Ă&#x201D;

CÄ&#x2019;Â?ڟĹ&#x201E;ŜêÚڟ

FORT WAYNE NORTH

Ĺ&#x152;Ć&#x192;Ć&#x192;Ĺ&#x152; ZÄŞ +šźĪ Ĺ&#x2014;Ä&#x153; ÄŚÂ&#x203A;Ä&#x2019;ÄźÄ&#x2030;Ÿğ Ä&#x2019;Ă? ZÄ&#x2019;Ĺ&#x;Ĺ&#x2019;äĤÄ&#x2019;ÄźĹ&#x2019; Â&#x2021; +šź Ĺ&#x2014;Ä&#x153;ħ (Plaza East Across from Hospital)

Ĺ?Ä&#x153;Ä&#x153;Ă&#x2018; ÚÚêĹ&#x201E;Ä&#x2019;Ä&#x2030;ŜêÚڟ VÂŽÄŞ

Ĺ?Ă&#x201D;Ĺ&#x152; ZäŸğêŽ|Ä&#x2030; VÂŽÄŞ 260-489-2222 ÄŚqÂźĹ&#x201E;Ĺ&#x2019;ŸğÄ&#x2030; TĂš|Ĺż|ħ

WARSAW

&ğŸŸÄ&#x2030;Ă?ŸÚŽ

FORT WAYNE S. WEST Ä&#x153;Ĺ&#x152;Ă&#x201E;Ä&#x17D; CÄŞ ZĹ&#x2019;|Ĺ&#x2019;Âź ZĹ&#x2019;ÄŞ 260-436-2800

&ğŸŸÄ&#x2030;Ă?ŸÚŽ .CÄŞ Ă&#x201D;Ĺ?Ä&#x153;Ă&#x201D;Ć&#x192;

HUNTINGTON

ÄŚĹ&#x2014;Ä&#x153;Ĺ&#x152;ħ Ĺ&#x2014;Ĺ&#x2014;Ă&#x201D;ĂŠĂ&#x201D;Ă&#x201D;Ă&#x201D;Ă&#x201D; ÄŚĹ&#x2014;Ä&#x153;Ĺ&#x152;ħ Ă&#x201E;Ă&#x201E;Ă&#x2018;ĂŠĂ&#x201D;Ă&#x201D;Ă&#x201D;Ă&#x201D; 574-269-6555 ÄŚĹ&#x2014;Ä&#x153;Ĺ&#x152;ħ Ă&#x201D;Ĺ?Ĺ?ĂŠÄ&#x17D;Ä&#x17D;Ä&#x17D;Ä&#x17D; ÄŚĹ&#x2014;Ä&#x153;Ĺ&#x152;ħ Ă&#x201E;Ă&#x2018;Ă&#x201E;ĂŠĂ&#x201E;Ă&#x201D;Ă&#x201D;Ă&#x201D; ÄŚĹ&#x2014;Ä&#x153;Ĺ&#x152;ħ Ĺ&#x152;Ĺ&#x152;Ć&#x192;ĂŠÄ&#x17D;Ä&#x17D;Ä&#x17D;Ä&#x17D; 260-356-2220 260-624-2600 260-920-2222 !BĂ&#x152;Ĺ&#x17D; ^Ă&#x2014;Ă&#x152;Ĺ&#x2039;|Ă&#x152;Âľ|Ă&#x152;Ĩ ÂżĂ&#x2014;^BĨ¾Ă&#x2014;Ă&#x152;Ä&#x2019; Ĩ¯Ä?Ă&#x2014;ĽŒ¯Ă&#x2014;ĽĨ Ă&#x152;oÂľBĂ&#x152;B Â?Ă&#x2014;Ä? Boo¾Ĩ¾Ă&#x2014;Ă&#x152;BÂż ÂżĂ&#x2014;^BĨ¾Ă&#x2014;Ă&#x152;Ä&#x2019; Ă&#x152;|BÄ? Ĺ&#x17D;Ă&#x2014;Ä˝ ^B¿¿ Ă&#x;²Â&#x201A;Ĺ&#x201D;Ĺ&#x201D;²čÄ&#x2014;Ă&#x;²/

ÂźÄ&#x2030;ÂźĂ?ĂŞĹ&#x2019;Ĺ&#x201E; Ä&#x2019;Ă? äŸ|ğêÄ&#x2030;Ă&#x2013; |ĂŞÂŽĹ&#x201E; Ĺś|ğź Â?Ĺş Ĺ&#x2019;źĤŸ |Ä&#x2030;ÂŽ ÂŽÂźĂ&#x2013;🟠Ä&#x2019;Ă? äŸ|ğêÄ&#x2030;Ă&#x2013; ĂšÄ&#x2019;Ĺ&#x201E;Ĺ&#x201E;Š Ä&#x2030;Ä&#x2019;ĂŞĹ&#x201E;Âź ÂźÄ&#x2030;ŜêğÄ&#x2019;Ä&#x2030;Ä&#x192;ÂźÄ&#x2030;Ĺ&#x2019;Š |Â&#x203A;Â&#x203A;Ĺ&#x;Äź|Â&#x203A;Ĺş Ä&#x2019;Ă? äŸ|ğêÄ&#x2030;Ă&#x2013; ŸŜ|ĂšĹ&#x;|Ĺ&#x2019;ĂŞÄ&#x2019;Ä&#x2030; |Ä&#x2030;ÂŽ ĤğÄ&#x2019;ĤŸğ Ă?ĂŞĹ&#x2019;ÄŞ VT

COLUMBIA CITY <ÂźÂ?|Ä&#x2030;Ä&#x2019;Ä&#x2030;Š

260-244-4111 CÄ&#x2019;ÄźĹ&#x2019;äĂ?ŸÚŽ ÂźÄ&#x2030;Ĺ&#x2019;Ÿğ Ĺ?Ĺ?Ä&#x153;Ă&#x201D; CÄŞ <ÂźÂ?|Ä&#x2030;Ä&#x2019;Ä&#x2030; ZĹ&#x2019;ÄŞ

WABASH

260-563-6333 ÄŚĹ&#x152;Ĺ?Ă&#x2018;ħ Ă&#x201D;Ă&#x201E;Ĺ?ĂŠĹ&#x152;Ĺ&#x152;Ĺ&#x152;Ĺ&#x152; Ĺ&#x152;Ĺ&#x152;


MONDAY, AUGUST 12, 2013

Scores •

AMERICAN LEAGUE N.Y. YANKEES ..........................5 DETROIT.......................................4 MINNESOTA..............................5 CHICAGO WHITE SOX.......2 CLEVELAND...............................6 L.A. ANGELS ..............................5 OAKLAND....................................6 TORONTO....................................4 KANSAS CITY...........................4 BOSTON.......................................3 TEXAS............................................6 HOUSTON...................................1 INTERLEAGUE BALTIMORE ............................10 SAN FRANCISCO ..................2 SEATTLE.......................................2 MILWAUKEE ..............................0 NATIONAL LEAGUE CINCINNATI ...............................3 SAN DIEGO................................2 ST. LOUIS ....................................8 CHICAGO CUBS ....................4 ATLANTA .......................................9 MIAMI .............................................4 N.Y. METS ....................................9 ARIZONA......................................5

THE NEWS SUN

The

Star

THE HERALD REPUBLICAN

PITTSFORD, N.Y. (AP) — Jason Dufner finally cracked a smile, and gave a slight pump of the fist, saving all that emotion for a big occasion. He won the PGA Championship. Dufner played the kind of golf that wins majors Sunday with a steady diet of fairways and greens that made it too tough for Jim Furyk or anyone else to catch him. Making bogeys on the last two holes at Oak Hill, Dufner closed with a 2-under 68 to capture his first major and atone for a meltdown two years ago in Atlanta. “It’s been a tough day. It was a long day. Tough golf course,” Dufner said. “It probably hasn’t hit me yet. I can’t believe this is happening to me. … I just decided that I was going to be confident and really put my best foot forward and play aggressive and try to win this thing. I wasn’t going to just kind of play scared or soft. “I’m happy to get the job done. It’s a big step in my career.” Dufner wasn’t sure he would get another chance after the 2011 PGA Championship, when he blew a four-shot lead with four holes to play and lost in a playoff to Keegan Bradley. He wasn’t about to let this one get away. Dufner won by playing a brand of golf that matches the expression

on his face. It wasn’t exciting, and it didn’t need to be. The turning point at Oak Hill was the final two holes — on the front nine. Dufner made a short birdie on the eighth hole to take a one-shot lead, and Furyk made bogey on the ninth hole to fall two shots behind. Furyk, a 54-hole leader for the second time in as many years in a major, couldn’t make up any ground with a procession of pars along the back nine. He finally made a 12-foot birdie putt on the 16th, but only after Dufner spun back a wedge to 18 inches for a sure birdie. Furyk also made bogey on the last two holes, taking two chips to reach the 17th green and coming up short into mangled rough short of the 18th green, where all he could do was hack it onto the green. Furyk closed with a 71 to finish three shots behind. Dufner finished at 10-under 270, four shots better than the lowest score at Oak Hill in five previous majors. Jack Nicklaus won the 1980 PGA Championship at 274. Henrik Stenson, trying to become the first Swede to win a men’s major title, pulled within two shots on the 13th hole and was poised to make a run until his tee shot settled on a divot hole in the 14th fairway. SEE PGA CHAMPIONSHIP, PAGE B2

AP

Jason Dufner holds up the Wanamaker Trophy after winning the PGA Championship golf tournament at Oak Hill Country Club on Sunday.

Reds beat Padres in 13 innings

WASHINGTON .........................6 PHILADELPHIA .......................0

Area Events • G I R LS GOLF Angola at West Noble, 1 0 a.m. Fremon t at Elkhart Memorial Invit ational, 2 p.m.

Briefly •

Liberty upend Dream ATLANTA (AP) — Cappie Pondexter scored 33 points and the New York Liberty earned an 88-82 victory over the Atlanta Dream on Sunday. Angel McCoughtry scored 30 points and Erika de Souza had a season-high 23 points and 10 rebounds, but the Dream lost for the seventh time in eight games after a 10-1 start to the season.

On The Air •

BAS E BALL L.A. Angels vs. N.Y. Yankees, E S P N, 7 p.m.

CINCINNATI (AP) — Xavier Paul and Jack Hannahan were looking for opportunities to redeem themselves after making mistakes that helped cost the Reds a game on Saturday. They didn’t have to wait long. Paul came off the bench to hit a game-tying home run in the eighth inning and Hannahan scored the winning run on Joey Votto’s sacrifice fly in the bottom of the 13th to give Cincinnati a 3-2 victory over the San Diego Padres AP on Sunday. Paul committed one error Indianapolis Colts head coach Chuck Pagano, preseason football game against the Buffalo and made a terrible baserunning right, congratulates T.Y. Hilton (13) following a Bills. blunder on Saturday. Hannahan touchdown catch during the first half of an NFL was charged with a career-high three errors and grounded into a double play in that loss. “Live to fight another day,” Hannahan said. “One of the best things about baseball is you can put a bad day behind you and show INDIANAPOLIS (AP) — EJ us and get all the other guys in by quickly getting the Bills to up the next day ready to win.” Manuel’s teammates and coaches position,” Manuel said. “The the line. On the few occasions he Hannahan drew a one-out were pretty darn impressed with veterans have done a great job ran, Manuel was effective. And walk from Tim Stauffer (1-1) and their rookie quarterback. of bringing me along and things when pressed to make plays in the Buffalo’s first-round draft pick like that. The main thing is just 2-minute offense, he drove the Bills Shin-Soo Choo snapped a 0-for-16 thought he could have done even continuing to go out there and into scoring position and then fired slump with a one-out double to right field. Ryan Hanigan, more. Give him time. execute.” a rocket to Dorin Dickerson for a After completing 16 of 21 Sure, it was only preseason and 17-yard score that broke a 13-13 tie pinch-hitting against a drawn-in, five-man infield and shallow passes for 107 yards with one he posted most of the big numbers with 14 seconds left in the half. touchdown and a quarterback against Indianapolis’ backup It may not have been as impres- two-man outfield, was hit by a pitch to load the bases. rating of 102.7, Manuel gave defense, and, of course, there were sive as Andrew Luck’s debut last The Padres went back to three himself a “B” in his debut — a a few mistakes. season. He threw a TD pass to solid mark after leading the Bills But overall, Manuel executed Donald Brown on his first attempt outfielders with everybody drawn in, and Votto hit a fly to left field to a 44-20 victory at Indianapolis. the safe, simple game plan the way at Lucas Oil Stadium, and led the to drive in Hannahan from third “My main thing was I wanted the Bills intended. Colts to a 38-3 victory over St. base. to operate the offense like coach His short passes were accurate Louis. (Nathaniel) Hackett has taught and on time. He sped up the game SEE COLTS, PAGE B2 SEE REDS, PAGE B2

Bills rookies handle Colts

On This Day •

Aug. 12, 2007 — Tiger Woods c aptures t he P GA Championship to win at least one major for the t hird straight season and run h is c areer t ot al to 13. Woods closes with a 1-under 6 9 for a two-shot victory over Woody Austin. Aug. 12, 200 8 — Michael P helps wins t he 200-meter freestyle for his third gold medal at the Beijing Games. It’s his ninth c areer gold, t ying Mark Spitz, Carl Lewis, Soviet gymnast Larysa Latynina and Finnish runner Paavo Nurmi f or the most ever.

B

Dufner lands 1st major title

COLORADO ...............................3 PITTSBURGH...........................2

PRESEASON BUFFALO ..................................44 INDIANAPOLIS .....................20

kpcnews.com

Busch finally wins again at Watkins Glen

AP

Kyle Busch celebrates in Victory Lane after winning a NASCAR Sprint Cup Series race at The Glen on Sunday.

WATKINS GLEN, N.Y. (AP) — There was no slipup on the final lap this time, so Kyle Busch’s victory celebration at Watkins Glen International was as sweet as it gets. Bumped aside a year ago by Brad Keselowski on the final lap as they sped around an oil-covered track, Busch held the reigning Sprint Cup champion at bay on a two-lap dash to the checkered flag Sunday. Busch kept his foot on the accelerator a tad longer than usual during his postrace burnout, even sticking half his body out the window while smoke swirled all around and the tires kept churning. “A big sigh of relief, just a deep breath. Whew!” said Busch, who also was victimized two

years ago while leading on a green-white-checkered finish and finished third. “I was just trying to take it all in and figure it all out. The last couple of years here have been tough, and today it could have been tough again.” Keselowski finished second in this race for the third straight time, and challenged Busch on the final lap, pulling to his rear bumper at one point. There was no bump this time. “We had a shot at it,” Keselowski said. “I was going to have to wreck him to really get it, and I didn’t want to do that. There’s racing and there’s wrecking. Those are two different things. “Everybody defines them a little differently, and I guess that’s

the code you live your life by. If I was going to take out Kyle, it would have been wrecking in my mind, and there’s a distinct difference.” Racing can be all about luck sometimes, and Busch couldn’t get much luckier than he was on this day. Polesitter Marcos Ambrose dominated the race, leading 51 laps, but his good fortune — he was seeking his third straight Cup win at The Glen — finally ran out just past the halfway point of the 90-lap race. Crew chief Dave Rogers was planning to have Busch pit on lap 60, but his crew noticed fluid on the track and brought the No. 18 Toyota in a lap early. SEE NASCAR, PAGE B2


B2

SPORTS •

kpcnews.com

MONDAY, AUGUST 12, 2013

Gardner saves Yankees with 9th inning homer NEW YORK (AP) — Mariano Rivera stood on the mound, looking down at his cleats. Somehow, he’d let yet another lead slip away. Never before had baseball’s all-time saves leader blown three straight chances. Silenced by a pair of Detroit home runs, the fans at Yankee Stadium soon perked up. Brett Gardner homered with two outs in the bottom of the ninth inning, lifting the New York Yankees over the Tigers 5-4 Sunday for their first series win in more than a month. Rivera has a record 643 saves, but had never failed three in a row in 1,087 previous relief appearances. His troubles began in Chicago, where he gave

back a lead to the White Sox. “At least it’s the first time, you know what I mean?” Rivera said. “I just try to go out there and do my job. The last three opportunities, I haven’t done it. So we have to continue battling and get better. Have to keep working and eventually it will happen.” Rivera blew both save chances in this series. Gardner provided the winning hit in both games. “Mo’s bailed us out a few times,” Gardner said. “It didn’t matter if it was me or somebody else, we just needed to get a win today and I’m glad we made it happen.” Rivera (3-2) gave up another homer to a limping

Miguel Cabrera, plus a drive to Victor Martinez in the top of the ninth. The solo shots made it 4-all and turned Alex Rodriguez’s first homer of the season into a footnote. But Gardner connected off Jose Veras (0-5). The feisty center fielder flipped his batting helmet to A-Rod just before reaching the plate, then jumped into a cluster of teammates at home. Alfonso Soriano homered for his 2,000th hit in the fourth inning. He connected off Justin Verlander, as did Rodriguez. “All great pitchers have one thing in common: they attack you and throw strikes,” Rodriguez on why he’s had success against

Verlander — four homers in 28 at-bats. Rodriguez, who has missed most of the year while coming back from hip surgery, hit a leadoff homer in the second. His 648th career home run pushed him past Stan Musial for fifth on the RBIs list with 1,951. “It was a tremendous homer by A-Rod,” Pena said. “Justin Verlander threw a great inside pitch and he used his hands and sometimes you just have to credit the hitter.” Taking two of three from the AL Central leaders gave New York its first series win July 5-7 after an 0-5-3 stretch. Verlander gave up seven hits and four runs in seven innings. He struck out nine.

AP

New York Yankee Alex Rodriguez, right, gestures after hitting a second-inning solo home run during Sunday’s game against the Detroit Tigers.

COLTS: Vinatieri kicks 2 FG FROM PAGE B1

Luck played only two series Sunday, finishing 4 of 6 for 51 yards and was the only Indy quarterback not to lead the Colts on a scoring drive. He was sacked once. Backup Matt Hasselbeck played three series for the Colts, throwing a 45-yard TD pass to T.Y. Hilton, and departed after a tipped pass was picked off by Crezdon Butler. “Obviously, everybody, top to bottom, is disappointed. We never envisioned going out and playing a football game and having the outcome that we had,” Colts coach Chuck Pagano said. “We’ve obviously got to play better, and we will play better.” Manuel, on the other

hand, played the entire first half and improved as the game went along — just as he did in last weekend’s scrimmage. Indy got two field goals from Adam Vinatieri, the diving catch from Hilton, who bounced into the end zone, and a 72-yard fumble return from Daxton Swanson. Thought the Colts didn’t show much with their revamped offensive line, the new defensive players or the rebuilt special teams, Buffalo saw exactly what it wanted. “I think I showed that I can matriculate the ball down the field,” Manuel said. “I was glad we were able to go out there and get six points before the end of the half.”

Paul hits 7th homer Paul tied the score with a two-run, pinch-hit homer off Ian Kennedy in the eighth and the Reds overcame two more errors for their fourth win in five games. They finished their eight-game homestand with five wins after starting 1-2 against St. Louis. “After last night and making a few mistakes that some people say cost us the game, to be able to come back today late in the game and help put the team in position to win makes me feel good,” Paul said. The Padres, who’ve lost four of their last five games, were 1 for 17 with runners

in scoring position and left 15 men on base. “We’re just having a bad stretch,” second baseman Logan Forsythe said. “We’re still playing good, fundamental baseball. There’s just a couple of things we need to get better at, and one of them is good situational hitting.” Sam LeCure (2-1), Cincinnati’s seventh pitcher, pitched 1 1-3 innings for the win. Kennedy was positioned to improve his career record against the Reds to 4-0 in four starts. Kennedy, in his second start for San Diego after being acquired from Arizona, allowed one hit.

AR: Truex places third

1

Busch was in the pits when a caution flew and Ambrose had to pit under yellow, losing his spot to Busch at the front. “That was a game-changer right there,” said Busch, who won from the pole in 2008 at The Glen. Busch held on through a series of cautions over the final 28 laps. Ambrose, who restarted 12th, crashed late trying to make a run with an ill-handling car and finished 23rd. He entered the race with an average finish of second in five previous starts at Watkins Glen and also had won all three Nationwide races he’d entered at the storied road course in upstate New York. “That’s just the way it goes,” Ambrose said. “We put on a strong showing. It wasn’t our day, but we’ve had plenty of good days here.” The field didn’t have to worry about five-time Watkins Glen winner Tony Stewart. The man known as Smoke is out indefinitely after breaking two bones in his right leg last Monday

night in a sprint car race in Iowa. Stewart, who has undergone two surgeries, saw his streak of 521 consecutive Cup starts come to an end. Max Papis drove Stewart’s No. 14 Chevrolet on Sunday and finished 15th. Martin Truex Jr. was third, followed by Carl Edwards and Juan Pablo Montoya. Clint Bowyer, Joey Logano, Jimmie Johnson, Kurt Busch and AJ Allmendinger rounded out the top 10. Jeff Gordon entered the race with momentum in ninth place in the points standings after a second last week at Pocono, but his day was ruined early with a wreck on lap 15. The four-time Watkins Glen winner finished 36th and dropped to 13th in the standings with four races to go until the Chase for the Sprint Cup title starts. The top 10 drivers in points and the drivers from 11th to 20th with the most wins earn wild-card berths for the 10-race postseason. Kurt Busch moved into 11th place, just two points behind Truex and only four behind ninth-place Greg Biffle.

AP

The Chicago White Sox’s Alexei Ramirez, right, steals second base under Minnesota Twins shortstop Doug

Bernier on Sunday. The Twins scored a 5-2 victory in the contest.

Twins take 3 of 4 against White Sox CHICAGO (AP) — Kevin Correia pitched seven shutout innings, Brian Dozier and Joe Mauer backed him with home runs and the Minnesota Twins beat the Chicago White Sox 5-2 on Sunday. The Twins took three of four games in the series and have won nine of 12 against the White Sox this season. Adam Dunn and Conor Gillaspie hit solo home runs off Casey Fien in the White Sox ninth. Dozier’s three-run homer off Jose Quintana (6-4) gave the Twins a 3-0 lead in the fifth. After Jamey Carroll singled, Mauer hit his ninth homer. Correia (8-8) struck out seven, tying a season high. He allowed five hits and one walk. Cardinals 8, Cubs 4 Pete Kozma singled home the tiebreaking run

in the sixth inning and St. Louis ended a four-game losing streak, beating Chicago and avoiding a sweep. Matt Carpenter and Allen Craig each had three hits and drove in a run. Jon Jay and David Freese both drove in two runs, though they only had one hit between them. The Cardinals dropped five of six to begin a 10-game homestand. Randy Choate (2-1) faced one batter, getting leadoff man David DeJesus to pop out with two men on to end the sixth. Edward Mujica worked the last two innings for his 31st save in 33 chances. Tony Cruz doubled with two outs in the sixth off Blake Parker (1-2) and scored easily on Kozma’s single. Parker was the winner Saturday with an

inning of relief. Angels 7, Indians 2 C.J. Wilson won his fourth consecutive decision and Los Angeles sent Cleveland to its sixth straight loss. Wilson (12-6) allowed two runs in 5 1-3 innings for his eighth win in his last 11 decisions. The left-hander hasn’t lost since July 5. Ubaldo Jimenez (8-7) allowed three runs in 6 1-3 innings for the reeling Indians, who committed a season-high four errors and trail Detroit by eight games in the American League Central. Cleveland began its seven-game homestand three games out of first, but was swept in four games by the Tigers and has dropped the first two to the Angels, who came into town with a four-game losing streak. Mike Trout reached base for a 40th consecutive game.

Nationals 6, Phillies 0 Stephen Strasburg pitched a four-hitter and struck out 10 in the first complete game of his career, Jayson Werth had his second straight three-hit game and the Washington Nationals completed a three-game sweep with a 6-0 victory over the Phillies. Strasburg (6-9) dominated the reeling Phillies for his first win since July 7 against San Diego. The Nationals had lost five straight games started by the right-hander. The Phillies never had a runner in scoring position during their 11th straight road loss. Philadelphia has lost nine of 11 overall. Washington scored two runs in the fourth and three in the fifth against Kyle Kendrick (9-9), who surrendered 11 hits over 5 1-3 innings.

PGA CHAMPIONSHIP: Dufner is third 1st-time major winner in 2013 FROM PAGE B1

He chunked that flip wedge into a bunker and made bogey and closed with a 70 to finish alone in third. In his last three tournaments — two majors and a World Golf Championship — Stenson has two runner-ups and a third. Jonas Blixt, another Swede, also had a 70 and finished fourth. Masters champion Adam Scott never made a serious of move and shot 70 to tie for fifth. Defending champion Rory McIlroy made triple bogey on the fifth hole to lose hope, those he still closed with a 70 and tied for eighth, his first top 10 in a major this year. Dufner two-putted for bogey on the 18th from about 10 feet and shook hands with Furyk as if he had just completed a business deal. He hugged his wife, Amanda, and gave her love tap on the tush with the cameras rolling. Asked if he had ever been nervous, she replied, “If he has been, he’s never told me.” Among the first to greet Dufner was Bradley, who

AP

Jim Furyk watches his tee shot on the third hole during the final round of the PGA Championship golf tournament at Oak Hill Country Club on Sunday.

beat him in the PGA playoff at Atlanta and was behind the “Dufnering” craze from earlier this year. Dufner went to an elementary school in Dallas as part

of a charity day for the Byron Nelson Classic. A photo was taken of Dufner slumped against the wall in the classroom next to the children, his eyes glazed

over, as the teacher taught them about relaxation and concentration techniques. The pose was mimicked all over the country, giving Dufner some celebrity. Now he’s known for something far more important — major champion. Dufner became the sixth player to win a major with a round of 63, joining Tiger Woods, Greg Norman, Raymond Floyd, Nicklaus and Johnny Miller. He is the third first-time major champion of the year, and the 15th champion in the last 19 majors who had never won the big one. Woods is responsible for the latest trend, mainly because he’s not winning them at the rate he once was. Woods extended his drought to 18 majors without winning, and this time he wasn’t even in the hunt. For the second straight round, Woods finished before the leaders even teed off. He closed with a 70 to tie for 40th, 14 shots out of the lead. “I didn’t give myself many looks and certainly didn’t hit the ball good enough to be in it,” Woods said.


SCOREBOARD •

MONDAY, AUGUST 12, 2013

National League Standings East Division Atlanta Washington New York Philadelphia Miami Central Division Pittsburgh St. Louis Cincinnati Chicago Milwaukee West Division

W 72 56 54 52 44

L 46 60 61 64 72

Pct GB .610 — .483 15 .470 16½ .448 19 .379 27

W 70 67 65 52 51

L 47 50 52 65 67

Pct GB .598 — .573 3 .556 5 .444 18 .432 19½

W L Pct GB Los Angeles 66 50 .569 — Arizona 59 57 .509 7 Colorado 55 64 .462 12½ San Diego 53 64 .453 13½ San Francisco 52 65 .444 14½ Saturday’s Games San Francisco 3, Baltimore 2 L.A. Dodgers 5, Tampa Bay 0 Washington 8, Philadelphia 5 Miami 1, Atlanta 0 San Diego 3, Cincinnati 1 Chicago Cubs 6, St. Louis 5 N.Y. Mets 4, Arizona 1 Colorado 6, Pittsburgh 4 Milwaukee 10, Seattle 0 Sunday’s Games Cincinnati 3, San Diego 2, 13 innings Atlanta 9, Miami 4 St. Louis 8, Chicago Cubs 4 Baltimore 10, San Francisco 2 Seattle 2, Milwaukee 0 N.Y. Mets 9, Arizona 5 Colorado 3, Pittsburgh 2 Washington 6, Philadelphia 0 Tampa Bay at L.A. Dodgers, late Monday’s Games Philadelphia (Hamels 4-13) at Atlanta (Teheran 9-5), 7:10 p.m. Cincinnati (Latos 11-3) at Chicago Cubs (T.Wood 7-8), 8:05 p.m. Miami (Koehler 3-7) at Kansas City (W.Davis 5-9), 8:10 p.m. San Diego (Volquez 8-9) at Colorado (Chacin 10-6), 8:40 p.m. Baltimore (Feldman 2-3) at Arizona (Miley 9-8), 9:40 p.m. N.Y. Mets (Mejia 1-1) at L.A. Dodgers (Nolasco 8-9), 10:10 p.m. Tuesday’s Games San Francisco at Washington, 7:05 p.m. Philadelphia at Atlanta, 7:10 p.m. Cincinnati at Chicago Cubs, 8:05 p.m. Milwaukee at Texas, 8:05 p.m. Miami at Kansas City, 8:10 p.m. Pittsburgh at St. Louis, 8:15 p.m. San Diego at Colorado, 8:40 p.m. Baltimore at Arizona, 9:40 p.m. N.Y. Mets at L.A. Dodgers, 10:10 p.m.

American League Standings East Division W L Pct GB Boston 71 49 .592 — Tampa Bay 66 49 .574 2½ Baltimore 65 52 .556 4½ New York 59 57 .509 10 Toronto 54 63 .462 15½ Central Division W L Pct GB Detroit 69 47 .595 — Cleveland 63 55 .534 7 Kansas City 61 54 .530 7½ Minnesota 52 63 .452 16½ Chicago 44 72 .379 25 West Division W L Pct GB Texas 68 50 .576 — Oakland 66 50 .569 1 Seattle 54 63 .462 13½ Los Angeles 53 63 .457 14 Houston 37 79 .319 30 Saturday’s Games Detroit 9, N.Y. Yankees 3 Toronto 5, Oakland 4 San Francisco 3, Baltimore 2 Chicago White Sox 5, Minnesota 4 L.A. Dodgers 5, Tampa Bay 0 L.A. Angels 7, Cleveland 2 Boston 5, Kansas City 3 Texas 5, Houston 4 Milwaukee 10, Seattle 0 Sunday’s Games N.Y. Yankees 5, Detroit 4 Cleveland 6, L.A. Angels 5 Oakland 6, Toronto 4 Kansas City 4, Boston 3 Minnesota 5, Chicago White Sox 2 Texas 6, Houston 1 Baltimore 10, San Francisco 2 Seattle 2, Milwaukee 0 Tampa Bay at L.A. Dodgers, late Monday’s Games Oakland (Straily 6-6) at Toronto (Happ 2-2), 12:37 p.m. Texas (Darvish 11-5) at Houston (Oberholtzer 2-0), 2:10 p.m. L.A. Angels (Richards 3-4) at N.Y. Yankees (Kuroda 10-7), 7:05 p.m. Cleveland (Salazar 1-0) at Minnesota (A.Albers 1-0), 8:10 p.m. Detroit (Fister 10-5) at Chicago White Sox (Sale 7-11), 8:10 p.m. Miami (Koehler 3-7) at Kansas City (W.Davis 5-9), 8:10 p.m. Baltimore (Feldman 2-3) at Arizona (Miley 9-8), 9:40 p.m. Tuesday’s Games L.A. Angels at N.Y. Yankees, 7:05 p.m. Boston at Toronto, 7:07 p.m. Seattle at Tampa Bay, 7:10 p.m. Milwaukee at Texas, 8:05 p.m. Cleveland at Minnesota, 8:10 p.m. Detroit at Chicago White Sox, 8:10 p.m. Miami at Kansas City, 8:10 p.m. Baltimore at Arizona, 9:40 p.m. Houston at Oakland, 10:05 p.m.

Major League Summaries Yankees 5, Tigers 4 Tigers ab r hbi Yankees ab rhbi AJcksn cf 4 0 1 0 Gardnr cf 5 1 1 1 TrHntr rf 5 1 1 0 ISuzuki rf 4 0 0 0 MiCarr 3b 3 1 2 1 Cano 2b 4 1 1 0 Fielder 1b 5 0 1 1 ARdrgz 3b 4 1 2 2 VMrtnz dh 5 1 3 1 Overay 1b 4 1 1 0 Tuiassp lf 3 0 0 0 ASorin lf 4 1 1 1 D.Kelly ph-lf 1 0 0 0 Grndrs dh 3 0 1 0 HPerez 2b 5 0 0 0 Nunez ss 3 0 1 1 B.Pena c 4 1 3 1 CStwrt c 2 0 0 0 Iglesias ss 4 0 2 0 V.Wells ph 1 0 0 0 Totals 39 4134 Totals 34 5 8 5 Detroit 100 000 012—4 New York 021 100 001—5 Two outs when winning run scored. E — H.Perez (2), A.Rodriguez (1). DP — New York 2. LOB — Detroit 12, New York 6. 2B — Mi.Cabrera (22), B.Pena (7), Cano (22). HR — Mi.Cabrera (36), V.Martinez (10), B.Pena (4), Gardner (8), A.Rodriguez (1), A.Soriano (3). SB — Tor.Hunter (3). SF — Nunez. Detroit IP H R ERBBSO Verlander 7 7 4 4 1 9 Coke 1 0 0 0 0 1 Veras L,0-5 2-3 1 1 1 0 1 New York IP H R ERBBSO Pettitte 4 1-3 8 1 1 3 3 Kelley 1 1-3 1 0 0 1 2 Logan H,6 1 1-3 0 0 0 0 1 D.Robertson H,28 1 2 1 1 0 0 M.Rivera W,3-2 1 2 2 2 0 0 HBP — by Verlander (C.Stewart). Umpires — Home, Paul Emmel; First, Chris Conroy; Second, Will Little; Third, Jerry Meals. T — 3:20. A — 42,439 (50,291).

Calhon rf Trout cf Hamltn dh Trumo 1b Aybar ss Nelson 3b Conger c GGreen 2b

2111 4122 4011 5001 4000 4010 4010 3220

Swisher 1b4 11 2 Kipnis 2b 2 1 0 0 ACarer ss 1 0 0 0 Aviles ss 3 1 1 2 Brantly lf 4 0 1 0 CSantn c 4 1 1 1 Giambi dh 4 0 0 0 Chsnhll 3b 3 1 1 0 Stubbs rf 3 01 0 Totals 35 5 8 5 Totals 32 6 8 6 Los Angeles 220 100 000—5 Cleveland 000 004 20x—6 E — Aviles (8). LOB — Los Angeles 11, Cleveland 5. 2B — Brantley (20). HR — Swisher (12), Aviles (7), C.Santana (13). SB — Trumbo (3), Aybar (10), Nelson (2). Los Angeles IP H R ERBBSO Williams 5 2-3 4 4 4 1 7 Boshers H,2 1-3 0 0 0 0 0 J.Gutierrez L,0-3 3 2 2 2 1 0 Maronde 0 1 0 0 0 0 Jepsen 2-3 0 0 0 1 0 Kohn 1 1 0 0 0 1 Cleveland IP H R ERBBSO Masterson 4 1-3 7 5 4 4 5 R.Hill 1 0 0 0 3 2 M.Albers W,3-1 1 2-3 0 0 0 0 0 J.Smith H,16 1 1 0 0 0 2 C.Perez S,18-21 1 0 0 0 0 1 Maronde pitched to 1 batter in the 7th. HBP — by Masterson (Nelson). WP — R.Hill. Umpires — Home, Vic Carapazza; First, Gary Cederstrom; Second, Kerwin Danley; Third, Lance Barksdale. T — 3:13. A — 23,433 (42,241). Athletics 6, Blue Jays 4 A’s ab r hbi Blue Jaysab rhbi Crisp cf 3 0 0 0 Reyes ss 5 0 2 1 CYoung ph-cf1011 MIzturs 2b 3 00 1 Sogard ss 5 0 0 0 Bautist rf 4 0 0 0 Lowrie dh 5 0 0 0 Encrnc 1b 4 1 0 0 Cespds lf 5 1 1 0 Lind dh 4 10 0 Reddck rf 3 1 1 0 ClRsms cf 4 0 0 0 Dnldsn 3b 3 2 2 1 Lawrie 3b 5 0 3 1 Moss 1b 5 1 1 2 Thole c 3 11 0 Callasp 2b 4 1 2 2 Arencii ph 0 0 0 0 Vogt c 4 0 2 0 Bonifac lf 2 1 1 0 RDavis ph-lf000 0 Totals 38 6106 Totals 34 4 7 3 Oakland 000 003 030—6 Toronto 010 002 001—4 E — Moss (7), Sogard (5), Lawrie (8). LOB — Oakland 10, Toronto 15. 2B — Cespedes (15), Callaspo (16), Lawrie (10). HR — Moss (18). SB — Reyes (12), Lind (2), Lawrie 2 (5). SF — M.Izturis. Oakland IP H R ERBBSO Griffin 5 2-3 5 3 2 6 2 Cook W,4-2 1 1-3 1 0 0 1 1 Doolittle H,17 1 0 0 0 1 2 Balfour S,30-31 1 1 1 1 3 1 Toronto IP H R ERBBSO Dickey 7 6 3 3 2 6 Oliver L,3-3 2-3 4 3 3 1 1 Lincoln 1 1-3 0 0 0 1 0 HBP — by Dickey (Donaldson). WP — Balfour, Dickey. Umpires — Home, Jordan Baker; First, Marty Foster; Second, Tim McClelland; Third, Wally Bell. T — 3:16. A — 45,312 (49,282). Royals 4, Red Sox 3 Red Sox ab r hbi Royals ab rhbi Ellsury cf 5 0 0 0 Lough rf 3 1 1 1 Victorn rf 3 1 1 0 Hosmer 1b3 00 0 Pedroia 2b 3 0 0 0 BButler dh 4 0 1 0 D.Ortiz dh 4 0 0 0 Maxwll pr- 0 0 0 0 Nava lf 3 1 1 0 AGordn lf 4 1 3 2 JGoms ph-lf 0 0 0 0 S.Perez c 3 0 1 0 Napoli 1b 3 0 0 0 Mostks 3b 3 1 1 0 Drew ss 4 1 2 0 AEscor ss 3 0 1 0 Lvrnwy c 4 0 2 2 Dyson cf 4 1 1 1 Mdlrks 3b 3 0 1 0 EJhnsn 2b 3 0 0 0 Totals 32 3 7 2 Totals 30 4 9 4 Boston 100 002 000—3 Kansas City 121 000 00x—4 E — S.Perez (7). DP — Boston 1, Kansas City 2. LOB — Boston 7, Kansas City 7. 2B — Victorino (18), Drew (18), A.Gordon (19), Moustakas (18). HR — A.Gordon (13). SB — Victorino (16), Lough (4), A.Gordon (8), Dyson (17). S — A.Escobar. Boston IP H R ERBBSO Lackey L,7-10 7 7 4 4 2 5 D.Britton 1 2 0 0 2 1 Kansas City IP H R ERBBSO Shields W,7-8 7 7 3 2 3 5 Collins H,19 1-3 0 0 0 0 0 Crow H,18 2-3 0 0 0 1 2 G.Holland S,32-34 1 0 0 0 0 2 HBP — by Shields (Victorino). Umpires — Home, Greg Gibson; First, Jerry Layne; Second, Hunter Wendelstedt; Third, Alan Porter. T — 2:56. A — 24,935 (37,903). Mariners 2, Brewers 0 Brewers ab r hbi Mariners ab rhbi LSchfr rf 4 0 0 0 BMiller 2b 3 0 0 0 Segura ss 4 0 1 0 EnChvz rf 3 0 0 0 Lucroy dh 4 0 1 0 Seager 3b 3 0 0 0 CGomz cf 4 0 0 0 KMorls dh 3 0 0 0 Gindl lf 2 0 0 0 Ibanez lf 3 0 0 0 JFrncs 1b 3 0 1 0 MSndrs lf 0 0 0 0 Bianchi 3b 3 0 0 0 Smoak 1b 3 1 1 1 Gennett 2b 3 0 1 0 Ackley cf 3 1 1 0 Maldnd c 3 0 1 0 Ryan ss 3 0 1 0 HBlanc c 3 01 0 Totals 30 0 5 0 Totals 27 2 4 1 Milwaukee 000 000 000—0 Seattle 001 010 00x—2 DP — Seattle 1. LOB — Milwaukee 4, Seattle 1. 2B — J.Francisco (10), Ackley (12). HR — Smoak (13). CS — Segura (8). Milwaukee IP H R ERBBSO W.Peralta L,8-12 8 4 2 2 0 4 Seattle IP H R ERBBSO F.Hernandez W,12-58 4 0 0 1 9 Farquhar S,4-6 1 1 0 0 0 1 WP — W.Peralta. Umpires — Home, Cory Blaser; First, Tim Welke; Second, Dan Bellino; Third, Bruce Dreckman. T — 2:11. A — 25,390 (47,476). Rangers 6, Astros 1 Rangers ab r hbi Astros ab rhbi LMartn cf 5 0 1 1 Grssmn lf 4 0 0 0 Andrus dh 5 1 0 0 Hoes rf 4 00 0 Kinsler 2b 4 0 0 0 Altuve 2b 4 0 1 0 ABeltre 3b 4 0 2 0 Carter dh 4 1 1 1 Rios rf 4 2 2 1 MDmn 3b 4 0 0 0 JeBakr 1b 3 1 1 0 Wallac 1b 2 0 0 0 Morlnd 1b 0 0 0 0 Corprn c 3 0 1 0 G.Soto c 4 0 1 1 BBarns cf 2 0 0 0 Gentry lf 3 1 0 0 Elmore ss 2 0 1 0 Profar ss 4112 Totals 36 6 8 5 Totals 29 1 4 1 Texas 000 011 004—6 Houston 000 000 001—1 E — Hoes (2), Elmore (7). DP — Texas 1. LOB — Texas 5, Houston 4. 2B — A.Beltre (24), Rios (23), G.Soto (6), Altuve (19). HR — Carter (21). Texas IP H R ERBBSO M.Perez W,5-3 9 4 1 1 2 8 Houston IP H R ERBBSO Keuchel L,5-7 8 2-3 8 6 5 1 8 De Leon 1-3 0 0 0 0 0 HBP — by M.Perez (Wallace), by Keuchel (Gentry). WP — M.Perez. Umpires — Home, Chris Guccione; First, Ron Kulpa; Second, Tom Hallion; Third, Phil Cuzzi. T — 2:24. A — 22,922 (42,060).

Twins 5, White Sox 2 Twins ab r hbi White Soxab rhbi Dozier 2b 5 1 2 3 De Aza lf 4 0 1 0 Carroll 3b 4 1 1 0 Bckhm 2b 4 0 0 0 Mauer c 3 1 2 2 AlRmrz ss 4 0 1 0 Mornea 1b 4 0 1 0 A.Dunn 1b 4 1 1 1 Wlngh dh 4 0 0 0 Konerk dh 4 0 0 0 Arcia lf 4 0 2 0 AGarci rf 4 0 1 0 Colaell rf 4 1 1 0 Gillaspi 3b 3 1 1 1 CHrmn rf 0 0 0 0 Flowrs c 3 0 1 0 Thoms cf 4 0 0 0 JrDnks ph 1 0 0 0 Bernier ss 3 1 0 0 Tekotte cf 3 0 1 0 Totals 35 5 9 5 Totals 34 2 7 2 Minnesota 000 050 000—5 Chicago 000 000 002—2 E — Correia (2). DP — Chicago 1. LOB — Minnesota 5, Chicago 6. 2B — Morneau (28), Arcia (13), De Aza (24). HR — Dozier (11), Mauer (9), A.Dunn (27), Gillaspie (10). SB — Al.Ramirez (25), A.Garcia (1). Minnesota IP H R ERBBSO Correia W,8-8 7 5 0 0 1 7 Burton 1 0 0 0 0 2 Fien 1 2 2 2 0 3 Chicago IP H R ERBBSO Quintana L,6-4 5 6 5 5 2 6 Axelrod 4 3 0 0 0 3 Umpires — Home, Dan Iassogna; First, Brian Knight; Second, Mark Carlson; Third, Lance Barrett. T — 2:52. A — 26,344 (40,615).

Braves 9, Marlins 4 Marlins ab r hbi Braves ab rhbi Yelich lf 4 0 0 0 Heywrd rf 5 2 4 1 Hchvrr ss 4 0 0 0 J.Upton lf 3 0 0 0 Stanton rf 3 1 0 0 BUpton cf 1 1 0 1 Polanc 3b 4 0 1 0 FFrmn 1b 3 2 2 3 Lucas 1b 3 1 2 1 Gattis c 5 2 3 1 DSolan 2b 4 0 0 0 CJhnsn 3b 4 0 1 2 Mrsnck cf 4 1 1 1 Varvar p 0 0 0 0 K.Hill c 3 1 1 0 Uggla 2b 2 0 0 1 HAlvrz p 2 0 1 2 Smmns ss 4 0 0 0 Ruggin ph 1 0 0 0 JSchafr cf-lf411 0 DJnngs p 0 0 0 0 Minor p 2 0 1 0 ARams p 0 0 0 0 Trdslvc ph 0 1 0 0 Ames p 0 0 0 0 Avilan p 0 0 0 0 Janish 3b 1 00 0 Totals 32 4 6 4 Totals 34 9129 Miami 030 001 000—4 Atlanta 010 030 41x—9 E — Uggla (12). DP — Atlanta 1. LOB — Miami 3, Atlanta 7. 2B — Lucas (6), H.Alvarez (2), F.Freeman (21), Gattis 2 (14), C.Johnson (25). HR — F.Freeman (14). SB — J.Schafer (10). SF — Lucas, B.Upton, Uggla. Miami IP H R ERBBSO H.Alvarez 6 7 4 4 1 4 Da.Jennings L,1-3 0 1 2 2 1 0 A.Ramos 1 2 2 2 1 0 Ames 1 2 1 1 1 2 Atlanta IP H R ERBBSO Minor W,12-5 7 6 4 4 1 6 Avilan 1 0 0 0 0 1 Varvaro 1 0 0 0 0 0 Da.Jennings pitched to 2 batters in the 7th. Umpires — Home, Jeff Nelson; First, Jim Wolf; Second, Mike Estabrook; Third, Jim Joyce. T — 3:06. A — 32,881 (49,586).

Indians 6, Angels 5 Angels ab r hbi Indians ab rhbi Shuck lf 5 1 0 0 Bourn cf 4 1 2 1

Reds 3, Padres 2, 13 innings Padres ab r hbi Reds ab rhbi Venale rf-cf 7 0 1 0 Choo cf 6 0 1 0

Amarst cf 6 0 0 0 Stauffr p 0000 Headly 3b 6 0 2 0 Alonso 1b 5 1 2 0 Forsyth 2b-lf 4 1 1 0 Decker lf 3000 Denorfi rf 2 0 1 0 RCeden ss 6 0 3 0 RRiver c 3001 Gyorko 2b 1 0 1 0 Kenndy p 2 0 0 0 Guzmn ph 1 0 0 0 Hynes p 0000 Grgrsn p 0000 Thayer p 0000 Kotsay ph 1 0 0 0 Vincent p 0 0 0 0 Hundly ph-c 1 0 0 0

Frazier 3b 5 0 0 0 LeCure p 0 0 0 0 Hanign ph 0 0 0 0 Votto 1b 4 0 0 1 Phillips 2b 5 0 0 0 Bruce rf 4 0 1 0 Heisey lf 5 0 0 0 Mesorc c 4 0 0 0 CIzturs ss 2 0 0 0 Cozart ss 3 1 1 0 Leake p 2 0 1 0 MParr p 0 0 0 0 Hoover p 0 0 0 0 Paul ph 1 11 2 AChpm p 0 0 0 0 Broxtn p 0 0 0 0 DRonsn ph1 00 0 Ondrsk p 0 0 0 0 Hannhn 3b0 10 0 Totals 48 2111 Totals 42 3 5 3 San Diego 020 000 000 0000—2 Cincinnati 000 000 020 0001—3 Two outs when winning run scored. E — C.Izturis (1), Leake (1). LOB — San Diego 15, Cincinnati 7. 2B — Venable (14), Gyorko (18), Choo (27). 3B — R.Cedeno (1). HR — Paul (7). SB — Amarista (1), Forsythe (4). S — Forsythe. SF — R.Rivera, Votto. San Diego IP H R ERBBSO Kennedy 8 3 2 2 2 3 Hynes 1-3 0 0 0 0 0 Gregerson 2-3 0 0 0 1 1 Thayer 1 0 0 0 0 2 Vincent 2 1 0 0 0 2 Stauffer L,1-1 2-3 1 1 1 1 0 Cincinnati IP H R ERBBSO Leake 7 6 2 1 3 4 M.Parra 1-3 1 0 0 0 0 Hoover 2-3 0 0 0 0 1 A.Chapman 1 0 0 0 0 3 Broxton 1 1 0 0 0 1 Ondrusek 1 2-3 2 0 0 3 2 LeCure W,2-1 1 1-3 1 0 0 0 1 HBP — by Stauffer (Hanigan). WP — Kennedy. Balk — Ondrusek. Umpires — Home, Joe West; First, Sam Holbrook; Second, Adam Hamari; Third, Rob Drake. T — 4:18. A — 38,567 (42,319). Cardinals 8, Cubs 4 Cubs ab r hbi Cards ab rhbi DeJess cf 4 1 0 0 MCrpnt 2b 5 2 3 1 Lake lf 5 0 0 0 Beltran rf 3 1 1 0 Rizzo 1b 4 0 0 0 MAdms 1b 1 0 0 0 Castillo c 4 2 1 0 Craig 1b-rf 3 2 3 1 Schrhlt rf 3 0 1 0 Hollidy lf 3 1 2 1 DMcDn ph-rf000 0 Freese 3b 2 0 0 2 DMrph 3b 4 1 1 0 Mujica p 1 0 0 0 StCastr ss 4 0 3 1 Jay cf 3 01 2 Barney 2b 4 0 2 2 T.Cruz c 4 1 1 0 EJcksn p 2 0 0 0 Kozma ss 4 0 1 1 Watkns ph 1 0 0 0 J.Kelly p 2 0 0 0 BParkr p 0 0 0 0 Maness p 0 0 0 0 Russell p 0 0 0 0 Choate p 0 0 0 0 HRndn p 0 0 0 0 Chamrs ph 1 0 0 0 DNavrr ph 1 0 0 0 Siegrist p 0 0 0 0 Bowden p 0 0 0 0 Descals 3b1 11 0 Totals 36 4 8 3 Totals 33 8138 Chicago 001 102 000—4 St. Louis 301 001 12x—8 E — Do.Murphy (1), Holliday (2), T.Cruz (1). DP — Chicago 1. LOB — Chicago 9, St. Louis 9. 2B — St.Castro (26), M.Carpenter 2 (37), Craig (26), T.Cruz (4). SB — Schierholtz (6), Holliday (6). CS — Ma.Adams (1). SF — Freese, Jay. Chicago IP H R ERBBSO E.Jackson 5 6 4 4 3 2 B.Parker L,1-2 2-3 2 1 1 0 0 Russell 2-3 0 0 0 0 0 H.Rondon 2-3 2 1 1 1 0 Bowden 1 3 2 2 2 1 St. Louis IP H R ERBBSO J.Kelly 5 1-3 5 4 3 2 3 Maness BS,2-2 1-3 2 0 0 0 0 Choate W,2-1 1-3 0 0 0 0 0 Siegrist H,5 1 0 0 0 2 2 Mujica S,31-33 2 1 0 0 0 0 WP — H.Rondon. PB — Castillo. Umpires — Home, Tony Randazzo; First, Brian Gorman; Second, David Rackley; Third, Larry Vanover. T — 3:44. A — 43,240 (43,975). Orioles 10, Giants 2 Orioles ab r hbi Giants ab rhbi McLoth lf 4 1 1 1 Scutaro 2b4 12 0 Machd 3b 5 2 2 0 BCrwfr ss 3 0 0 0 Markks rf 4 2 2 1 Belt 1b 4 11 1 A.Jones cf 5 2 2 4 Posey c 4 0 0 0 C.Davis 1b 4 1 1 0 Pence rf 4 0 2 1 Wieters c 5 0 1 1 Sandovl 3b2 01 0 Hardy ss 4 1 1 2 Kschnc lf 2 0 0 0 BRorts 2b 3 1 1 1 Francr ph-lf2 00 0 BNorrs p 1 0 1 0 GBlanc cf 4 0 1 0 Urrutia ph 1 0 0 0 M.Cain p 2 0 0 0 Patton p 1 0 0 0 Pill ph 1 00 0 TmHnt p 0 0 0 0 Mijares p 0 0 0 0 ACasill ph 1 0 0 0 SRosari p 0 0 0 0 O’Day p 0 0 0 0 Zito p 0 00 0 FrRdrg p 0 0 0 0 HSnchz ph1 0 0 0 Totals 38101210 Totals 33 2 7 2 Baltimore 000 001 243—10 San Francisco 200 000 000— 2 E — Mijares (1). DP — Baltimore 1. LOB — Baltimore 5, San Francisco 7. 2B — A.Jones (29), C.Davis (33), Scutaro (20), Belt (25), Pence (29). 3B — B.Roberts (1). HR — A.Jones (24), Hardy (21). SB — McLouth (28), G.Blanco (11). SF — B.Roberts. Baltimore IP H R ERBBSO B.Norris 5 6 2 2 2 2 Patton W,2-0 1 1 0 0 0 2 Tom.Hunter H,14 1 0 0 0 0 1 O’Day 1 0 0 0 0 0 Fr.Rodriguez 1 0 0 0 1 2 San Francisco IP H R ERBBSO M.Cain L,7-8 7 5 3 3 1 5 Mijares 0 2 3 3 1 0 S.Rosario 1 2 1 1 1 0 Zito 1 3 3 3 0 2 Mijares pitched to 3 batters in the 8th. Umpires — Home, Quinn Wolcott; First, Todd Tichenor; Second, Mike Everitt; Third, CB Bucknor. T — 3:06. A — 41,622 (41,915). Mets 9, Diamondbacks 5 Mets ab r hbi D’backs ab rhbi EYong lf 4 0 0 0 Pollock cf 5 2 3 0 Lagars cf 5 0 2 0 Prado 3b-lf 5 0 0 0 DnMrp 2b 5 1 1 0 Gldsch 1b 3 1 0 0 I.Davis 1b 2 3 1 0 A.Hill 2b 5 1 2 4 Flores 3b 4 3 2 1 C.Ross lf 1 0 0 0 Baxter rf 3 1 1 0 Davdsn 3b 3 0 1 0 ABrwn ph-rf 2 1 1 3 GParra rf 4 1 2 0 Hwkns p 0 0 0 0 Gswsch c 4 0 1 0 Recker c 5 0 1 1 Pnngtn ss 4 0 1 1 Quntnll ss 4 0 1 1 Spruill p 1 0 0 0 Niese p 3 0 1 0 Cllmntr p 1 0 0 0 Ardsm p 0 0 0 0 Kubel ph 1 0 0 0 Satin ph 0 0 0 0 Thtchr p 0 0 0 0 Atchisn p 0 0 0 0 WHarrs p 0 0 0 0 Byrd rf 0 0 0 0 EDLRs p 0 0 0 0 Nieves ph 1 01 0 Bell p 0 00 0 Totals 37 9116 Totals 38 5115 New York 401 000 301—9 Arizona 103 000 010—5 E — Niese (1), Goldschmidt (5). DP — New York 1. LOB — New York 7, Arizona 8. 2B — Recker (5), A.Hill (17), G.Parra (28). HR — Flores (1), A.Brown (4), A.Hill (7). S — E.Young. New York IP H R ERBBSO Niese W,4-6 6 7 4 4 1 5 Aardsma 1 1 0 0 1 0 Atchison 1 3 1 1 0 0 Hawkins 1 0 0 0 0 0 Arizona IP H R ERBBSO Spruill L,0-2 3 6 5 1 2 1 Collmenter 3 2 0 0 1 2 Thatcher 1-3 1 2 2 1 0 W.Harris 1 1-3 1 1 1 1 0 E.De La Rosa 1-3 0 0 0 0 1 Bell 1 1 1 1 0 2 WP — W.Harris. Umpires — Home, Laz Diaz; First, Tim Timmons; Second, Mark Wegner; Third, Mike Winters. T — 3:08. A — 28,260 (48,633). Rockies 3, Pirates 2 Pirates ab r hbi Rockies ab rhbi Presley lf 5 0 0 0 Fowler cf 3 0 0 0 Tabata rf 3 0 0 0 LeMahi 2b 3 0 0 1 McCtch cf 4 0 2 1 Tlwtzk ss 2 0 0 0 PAlvrz 3b 4 1 1 1 WRosr 1b 4 1 1 0 Walker 2b 4 0 1 0 Belisle p 0 0 0 0 GJones 1b 2 0 0 0 Brothrs p 0 0 0 0 RMartn ph 1 0 0 0 Arenad 3b 3 0 1 1 TSnchz c 3 0 1 0 Culersn lf 4 0 1 0 SMarte pr 0 0 0 0 Torreal c 4 1 1 0 Barmes ss 2 1 1 0 Blckmn rf 3 1 2 0 Mercer ph 1 0 0 0 Bettis p 2 0 0 0 Locke p 1 0 0 0 CDckrs ph 1 0 0 0 Watson p 0 0 0 0 Corpas p 0 0 0 0 JHrrsn ph 1 0 0 0 Helton 1b 1 0 0 0 Morris p 0000 GSnchz ph 0 0 0 0 Totals 31 2 6 2 Totals 30 3 6 2 Pittsburgh 011 000 000—2 Colorado 001 001 10x—3 E — Barmes (9), P.Alvarez (24), Tulowitzki (4). DP — Pittsburgh 1, Colorado 1. LOB — Pittsburgh 8, Colorado 9. 2B — T.Sanchez (2), Barmes (13), Arenado (20), Culberson (1). HR — P.Alvarez (28). SB — Blackmon (4). S — Barmes, Locke. SF — LeMahieu. Pittsburgh IP H R ERBBSO Locke 5 2-3 3 2 1 4 3

kpcnews.com

Watson BS,2-4 1-3 0 0 0 0 0 Morris L,5-5 2 3 1 1 0 0 Colorado IP H R ERBBSO Bettis 6 4 2 2 2 3 Corpas W,1-2 1 0 0 0 0 0 Belisle H,17 1 0 0 0 0 2 Brothers S,10-11 1 2 0 0 1 1 HBP — by Locke (Blackmon), by Corpas (T.Sanchez). PB — T.Sanchez. Balk — Locke. Umpires — Home, Bill Welke; First, Adrian Johnson; Second, Brian O’Nora; Third, Fieldin Culbreth. T — 2:41. A — 44,657 (50,398).

NFL Preseason Thursday’s Games Baltimore 44, Tampa Bay 16 Washington 22, Tennessee 21 Cincinnati 34, Atlanta 10 Cleveland 27, St. Louis 19 Denver 10, San Francisco 6 Seattle 31, San Diego 10 Friday’s Games Detroit 26, N.Y. Jets 17 Miami 27, Jacksonville 3 New England 31, Philadelphia 22 Houston 27, Minnesota 13 New Orleans 17, Kansas City 13 Arizona 17, Green Bay 0 Carolina 24, Chicago 17 Oakland 19, Dallas 17 Saturday’s Game N.Y. Giants 18, Pittsburgh 13 Sunday’s Game Buffalo 44, Indianapolis 20 Thursday, Aug. 15 Detroit at Cleveland, 7:30 p.m. Atlanta at Baltimore, 7:30 p.m. Carolina at Philadelphia, 7:30 p.m. San Diego at Chicago, 8 p.m. Friday, Aug. 16 Minnesota at Buffalo, 7 p.m. Oakland at New Orleans, 8 p.m. San Francisco at Kansas City, 8 p.m. Tampa Bay at New England, 8 p.m. Saturday, Aug. 17 Dallas at Arizona, 4:30 p.m. Tennessee at Cincinnati, 7 p.m. Jacksonville at N.Y. Jets, 7:30 p.m. Green Bay at St. Louis, 8 p.m. Miami at Houston, 8 p.m. Denver at Seattle, 10 p.m. Sunday, Aug. 18 Indianapolis at N.Y. Giants, 7 p.m. Monday, Aug. 19 Pittsburgh at Washington, 8 p.m.

PGA Championship Scores Sunday — At Oak Hill Country Club, East Course Pittsford, N.Y. Purse: $8 million Yardage: 7,177; Par: 70 Final Jason Dufner 68-63-71-68—270 Jim Furyk 65-68-68-71—272 Henrik Stenson 68-66-69-70—273 Jonas Blixt 68-70-66-70—274 Scott Piercy 67-71-72-65—275 Adam Scott 65-68-72-70—275 David Toms 71-69-69-67—276 Jason Day 67-71-72-67—277 Zach Johnson 69-70-70-68—277 Dustin Johnson 72-71-65-69—277 Rory McIlroy 69-71-67-70—277 Graeme McDowell 70-69-73-66—278 Boo Weekley 72-69-70-67—278 Marc Leishman 70-70-70-68—278 Marc Warren 74-67-68-69—278 Roberto Castro 68-69-71-70—278 Kevin Streelman 70-72-66-70—278 Steve Stricker 68-67-70-73—278 Keegan Bradley 69-72-72-66—279 Hideki Matsuyama 72-68-73-66—279 Rickie Fowler 70-68-72-69—279 Michael Thompson 72-67-72-69—280 Matt Kuchar 67-66-76-71—280 David Lynn 69-69-71-71—280 Kiradech Aphibarnrat 68-71-71-71—281 Robert Garrigus 67-68-74-72—281 Webb Simpson 72-64-73-72—281 Bill Haas 68-70-71-72—281 Miguel Jimenez 68-72-75-67—282 Rafael C-Bello 68-75-69-70—282 Scott Jamieson 69-72-70-71—282 Ryo Ishikawa 69-71-70-72—282 Peter Hanson 72-69-74-68—283 Martin Kaymer 68-68-78-69—283 Paul Casey 67-72-74-70—283 Brendon de Jonge 71-71-71-70—283 Justin Rose 68-66-77-72—283 Francesco Molinari 72-68-70-73—283 Lee Westwood 66-73-68-76—283 Matt Jones 72-71-73-68—284 Thorbjorn Olesen 71-70-74-69—284 J.J. Henry 71-71-73-69—284 Danny Willett 73-70-72-69—284 D.A. Points 73-70-72-69—284 Tiger Woods 71-70-73-70—284 Charley Hoffman 69-67-73-75—284 Thongchai Jaidee 70-71-75-69—285 John Merrick 75-68-73-69—285 Ryan Palmer 73-70-71-71—285 Josh Teater 71-71-71-72—285 David Hearn 66-76-71-72—285 K.J. Choi 76-65-71-73—285 Marcus Fraser 67-69-75-74—285 Luke Guthrie 71-71-69-74—285 Scott Stallings 73-70-73-70—286 Ryan Moore 69-71-73-73—286 Hunter Mahan 70-68-78-71—287 Shane Lowry 71-70-75-71—287 Chris Kirk 71-69-73-74—287 Ken Duke 75-68-70-74—287 Stephen Gallacher 75-68-76-69—288 Ian Poulter 70-71-77-70—288 Tommy Gainey 69-74-73-72—288 Harris English 74-69-72-73—288 Sergio Garcia 69-68-75-76—288 Ben Curtis 73-70-74-72—289 Brandt Snedeker 70-73-70-76—289 Tim Clark 69-71-75-75—290 Vijay Singh 70-72-73-75—290 John Senden 72-70-73-76—291 Brooks Koepka 71-72-71-77—291 Phil Mickelson 71-71-78-72—292 Matteo Manassero 72-69-74-77—292 Gary Woodland 73-70-80-70—293 Darren Clarke 69-73-74-80—296

NASCAR Sprint Cup-Cheez-It 355 at The Glen Results Sunday At Watkins Glen International Watkins Glen, N.Y. Lap length: 2.45 miles (Start position in parentheses) 1. (5) Kyle Busch, Toyota, 90 laps, 138.2 rating, 47 points. 2. (8) Brad Keselowski, Ford, 90, 105.9, 42. 3. (3) Martin Truex Jr., Toyota, 90, 117.6, 41. 4. (16) Carl Edwards, Ford, 90, 99.2, 40. 5. (11) Juan Pablo Montoya, Chevrolet, 90, 110.6, 40. 6. (2) Clint Bowyer, Toyota, 90, 109.5, 38. 7. (9) Joey Logano, Ford, 90, 94.8, 37. 8. (18) Jimmie Johnson, Chevrolet, 90, 89.6, 36. 9. (13) Kurt Busch, Chevrolet, 90, 100.3, 35. 10. (4) A J Allmendinger, Toyota, 90, 103.8, 34. 11. (6) Jamie McMurray, Chevrolet, 90, 96, 34. 12. (30) Casey Mears, Ford, 90, 68.5, 32. 13. (26) Kevin Harvick, Chevrolet, 90, 85.1, 32. 14. (14) Ryan Newman, Chevrolet, 90, 77.2, 30. 15. (29) Max Papis, Chevrolet, 90, 68.9, 0. 16. (17) Greg Biffle, Ford, 90, 74.5, 28. 17. (7) Paul Menard, Chevrolet, 90, 79.6, 27. 18. (33) Ricky Stenhouse Jr., Ford, 90, 52.3, 26. 19. (20) Denny Hamlin, Toyota, 90, 68.7, 25. 20. (35) Danica Patrick, Chevrolet, 90, 54.1, 24. 21. (31) David Ragan, Ford, 90, 49.2, 23. 22. (27) Boris Said, Ford, 90, 55.9, 22. 23. (10) Matt Kenseth, Toyota, 90, 82.4, 21. 24. (23) Owen Kelly, Chevrolet, 90, 62, 0. 25. (21) David Gilliland, Ford, 90, 53, 19. 26. (22) Jeff Burton, Chevrolet, 90, 64.8, 18. 27. (40) Dave Blaney, Chevrolet, 90, 42.5, 17. 28. (41) Landon Cassill, Chevrolet, 90, 36.2, 0. 29. (37) Alex Kennedy, Toyota, 90, 38.4, 15. 30. (25) Dale Earnhardt Jr., Chevrolet, 85, 71.6, 14. 31. (1) Marcos Ambrose, Ford, accident, 84, 120, 15. 32. (15) Brian Vickers, Toyota, accident, 84, 60.3, 0. 33. (39) David Stremme, Toyota, 83, 35.7, 11. 34. (19) Kasey Kahne, Chevrolet, 82,

69.4, 10. 35. (24) Ron Fellows, Chevrolet, 74, 53, 9. 36. (28) Jeff Gordon, Chevrolet, 65, 31.5, 8. 37. (32) Aric Almirola, Ford, accident, 58, 49.9, 7. 38. (12) Michael McDowell, Ford, suspension, 58, 68.1, 6. 39. (43) Brian Keselowski, Toyota, brakes, 47, 26.8, 5. 40. (38) Travis Kvapil, Toyota, accident, 41, 40.2, 4. 41. (34) Victor Gonzalez Jr., Chevrolet, accident, 39, 39, 3. 42. (42) Tomy Drissi, Toyota, accident, 39, 28.4, 2. 43. (36) David Reutimann, Toyota, engine, 4, 30, 1.

B3

SPORTS BRIEFS •

Angola Motorsport Speedway Results — August 10, 2013 ICAR Top Speed Fabrication Modified Tour Fast Qualifier: Jason Timmerman, New Bremen, OH; 14.991 Feature: 1. Jason Timmerman, New Bremen, OH; 2. Brian Nester, Edon, OH; 3. Brad Springer, Hudson, IN; 4. Justin Oberlin, Corunna, IN; 5. Zach Henderson, Waterloo, IN; 6. Greg Fullerton; 7. Josh Nester, Edon, OH; 8. Erik Schaeffer, Angola, IN; 9. Bill Burba; 10. Scott Moyer, West Unity, OH; 11. Travis Stepp; 12. Tim Burkett; 13. Ralph Baxter, Fort Wayne, IN; 14. Damon Breedlove; 15. Mark Bott; 16. Jeff Amsdell; 17. Mike Murphy, Pleasant Lake, IN; 18. Tony Van Allen, Garrett, IN; 19. Jacob Mann, Pioneer, OH. Shepherd’s Chevy, Buick, GMC Late Model Sportsman Fast Qualifier: Kale Asztalos, 15.396 Australian Pursuit Winner: Kale Asztalos Heat Race Winners: Kevin Gunkel, Joe Ellert Feature: 1. Larry Henderson, Hamilton, IN; 2. Cassten Everidge, Stroh, IN; 3. Steve Christman, Fort Wayne, IN; 4. Fred Elkins, Helmer, IN; 5. Mike Kugler, Stroh, IN; 6. Kale Asztalos, Angola, IN; 7. Joe Ellert, Waterloo, IN; 8. Ken Wilson, Angola, IN; 9. Nic Weimer, Auburn, IN; 10. Scott Frost, Claypool, IN; 11. Mitch DeWitt, Elkhart, IN; 12. Brandon Barcus, Kendallville, IN; 13. Troy Turk, Concord, MI; 14. Kevin Gunkel, North Webster, IN; 15. Kaleb Presley, Hamilton, IN; 16. Rick Everidge, Stroh, IN. Randy’s Trannys Plus Street Stocks Fast Qualifier: Cam Schoeck, 16.414 Australian Pursuit Winner: Brandon Pulver Heat Race Winners: Tanner Tallarico, Jamie Garrett Feature: 1. Troy Moyer, Edon, OH; 2. Chad Minnix, Garrett, IN; 3. Tanner Tallarico, Charlotte, MI; 4. Cam Schoeck, Kendallville, IN; 5. Brandon Pulver, Albion, IN; 6. Terry King, Waterloo, IN; 7. Ben DeLong, Garrett, IN; 8. Jamie Garrett, Antwerp, OH. Smith Enterprises Mini Stocks Fast Qualifier: Kyle Moonen, Angola, IN; 17.636 Australian Pursuit Race Winner: Kyle Moonen Glenbrook Hyundia Heat Race Winners: Hunter Jack, Dan Foulk Feature: 1. Clif Bennett, Pleasant Lake, IN; 2. Kyle Moonen, Angola, IN; 3. Chris Bennett, Angola, IN; 4. Dennis Pierson, Garrett, IN; 5. Matt Morton, Angola, IN; 6. Tim Bertoia Jr, Angola, IN; 7. Hunter Jack, Butler, IN; 8. Dan Foulk, Angola, IN; 9. Donald Scheiber, Angola, IN; 10. Allen Tink, Fremont, IN; 11. Lloyd Depew, Butler, IN.

Baer Field Speedway Results — August 10, 2013 HOSS Sprint Series Feature: Jason Blonde 2. Cody Gallogly 3. Tim Cox 4. Geoff Kaiser 5. Joe Swanson Heat Winners: Joe Swanson, Cody Gallogly Fast Qualifier: Kaiser 12:865 NTR Late Models Feature: 1 John Gatton, Jr. 2. Alex Vonderau 3. Al Cook, Jr. 4. Chad Richardson 5. Andrew Royer Heat Winners: Mark Mason, Brock Anderson Fast Qualifier: Royer 16:736 Modifieds Feature: 1. Mike Mayes 2. Terry Fisher, Jr. 3. Scott Coe 4. Steve Minich, Jr. 5. Herb Johnson, Jr. Heat Winners: Jack Moore, Herb Johnson, Sr. Fast Qualifier: Coe 16:442 Street Stocks 20 Lap Feature: 1. Jared Neal 2. Shawn Bonar 3. Josh Perkins 4. Ryan McIntyre 5. Steve Bacon Heat Winners: Justin Peak, Ryan McIntyre Fast Qualifier: Jared Neal, 17:648 Mini Stocks 20 Lap Feature: 1. Keith Barker, Jr. 2. Kevin Dibble 3. Kevin Howard 4. Tim Howard 5. Lee Gillingham Heat Winner: Brad McBride Fast Qualifier: Keith Barker Jr., 18:951 Front Wheel Drive 20 Lap Feature: 1. Brian Janes 2. Matt Janes 3. R.J Weick 4. Bob Masters 5. Jacob Bradley Heat Winners: R.J. Weick, Brian Janes Fast Qualifier: Brian Janes, 18:959

ATP World Tour Coupe Rogers Results Sunday — At Uniprix Stadium Montreal Surface: Hard-Outdoor Singles Championship Rafael Nadal (4), Spain, def. Milos Raonic (11), Canada, 6-2, 6-2. Doubles Championship Alexander Peya, Austria, and Bruno Soares (3), Brazil, def. Colin Fleming, Britain, and Andy Murray, Britain, 6-4, 7-6 (4).

WTA Rogers Cup Results Sunday — At Rexall Centre Toronto Surface: Hard-Outdoor Singles Championship Serena Williams (1), United States, def. Sorana Cirstea, Romania, 6-2, 6-0. Doubles Championship Jelena Jankovic, Serbia, and Katarina Srebotnik, Slovenia, def. Anna-Lena Groenefeld, Germany, and Kveta Peschke (3), Czech Republic, 5-7, 6-2, 10-6.

Transactions BASEBALL American League KANSAS CITY ROYALS — Placed INF Miguel Tejada on the 15-day DL. Activated C Salvador Perez from the concussion list. Recalled INF Irving Falu from Omaha (PCL). Optioned LHP Donnie Joseph to Omaha. Designated C Brett Hayes for assignment. Activated RHP Wade Davis from the family emergency leave list. NEW YORK YANKEES — Recalled RHP Dellin Betances from Scranton/ Wilkes-Barre (IL). Optioned 3B David Adams to Scranton/WilkesBarre. National League ATLANTA BRAVES — Activated C Gerald Laird from the 15-day DL. Optioned OF Todd Cunningham to Gwinnett (IL). American Association AMARILLO SOX — Released OF Moises Martinez. EL PASO DIABLOS — Released RHP Austin Carden. GARY SOUTHSHORE RAILCATS — Signed LHP Matt Jernstad. LAREDO LEMURS — Signed RHP Sean Tracey. FOOTBALL National Football League BALTIMORE RAVENS — Signed WR Brandon Stokley to a one-year contract. CHICAGO BEARS — Signed LS Brandon Hartson to a three-year contract. Placed CB Kelvin Hayden on the injured reserve list. DALLAS COWBOYS — Released LS Jackson Anderson. Signed P-K Brett Maher and LS P.J. Mangieri.

AP

Serena Williams celebrates a point over Sorana Cirstea during the women’s singles championship at the Rogers Cup tennis tournament in Toronto on Sunday. Williams won 6-2, 6-0.

Serena Williams wins Rogers Cup in romp TORONTO (AP) — Serena Williams won the Rogers Cup for the third time, routing unseeded Romanian Sorana Cirstea 6-2, 6-0 in Sunday’s final. The top-ranked woman captured her eighth WTA title of the year and 54th of her career. All three of her Rogers Cup crowns have come in Toronto, the others in 2001 and 2011. Williams has lost only one match since March, a stunning early exit at Wimbledon. Cirstea was appearing in her third WTA final and looking to build on her only title — in 2008 at Tashkent. Williams earned $426,000 for the victory. Cirstea takes home $213,000, almost half her prize money so far this year.

Moreno beats Urina to retain WBA bantamweight belt PANAMA CITY (AP) — Anselmo Moreno scored a unanimous decision over William Urina on Saturday night to successfully defend his WBA bantamweight title for the eleventh time. The three judges scored the match 116-112, 118-110 and 118-110 for the Panamanian fighter. Moreno received a cut on the right cheek that caused him to bleed after the seventh round, but the 28-year-old landed better shots and avoided most of Urina’s punches. Moreno improved 34-2-1. Urina fell to 24-3. Urina launched one of his few successful attacks in the ninth round, connecting with a left hook to the face, but the 27-year-old Colombian couldn’t follow up with significant additional punches.

Nadal beats Raonic in Montreal final MONTREAL (AP) — Rafael Nadal beat Milos Raonic 6-2, 6-2 on Sunday in the Rogers Cup final, spoiling Raonic’s bid to become the first Canadian winner in the event in 55 years. Robert Bedard, the last Canadian to win what was then called the Canadian Open in 1955, was in attendance to see Nadal claim his third Rogers Cup title. The Spanish star also won in 2005 and 2008. Raonic was the first Canadian since the now 81-year-old Bedard even to reach the final. Nadal, playing his first tournament since a first-round loss at Wimbledon in June, posted his eighth tournament win this year and the 58th of his career. On Saturday night in the semifinals, Nadal beat two-time defending champion Novak Djokovic 6-4, 3-6, 7-6 (2). By reaching the final, the 22-year-old Raonic will move up to 10th in world rankings, a record for a Canadian. He will be the youngest player in the top 10. Nadal will move from fourth to third. Nadal is 4-0 against Raonic in his career. Nadal stretched his record for wins in Masters series tournaments to 25 with his fourth this year. He is 48-3 and has reached the final of 10 out of 11 tournaments in 2013. Raonic’s victory over Vasek Pospisil of Vernon, B.C., on Saturday marked the first time two Canadians were in the semifinals of an ATP Tour event since Andrew Sznajder and Martin Wosterholme in 1990 at Rio de Janeiro. The last Canadian to get that far in the Rogers Cup, then called the Canadian Open, was Mike Belkin of Montreal in 1969.

Emma Talley wins U.S. Women’s Amateur CHARLESTON, S.C. (AP) — Emma Talley won the U.S. Women’s Amateur on Sunday, beating Yueer Cindy Feng 2 and 1 at the Country Club of Charleston. Feng was vying to become the first Chinese-born player to win a USGA title.

Sachia Vickery wins USTA Girls’ 18s SAN DIEGO (AP) — Top-seeded Sachia Vickery beat second-seeded Alexandra Kiick 4-6, 6-2, 6-0 to win the USTA Girls’ 18s National Championship at Barnes Tennis Center. Vickery overcame a slow start and finished strong to close out Kiick.


B4

THE NEWS SUN

kpcnews.com

The

Star

THE HERALD REPUBLICAN

MONDAY, AUGUST 12, 2013

Guest Column •

Letter Policy •

Ag-gag falls flat but support remains

We welcome letters to the editor. All letters must be submitted with the author’s signature, address and daytime telephone number. We reserve the right to reject or edit letters on the basis of libel, poor taste or repetition. Mail letters to: The News Sun 102 N. Main St. P.O. Box 39 Kendallville, IN 46755 Email: dkurtz@ kpcmedia.com The Star 118 W. Ninth St. Auburn, IN 46706 Email: dkurtz@ kpcmedia.com The Herald Republican 45 S. Public Square Angola, IN 46703 Email: mmarturello@ kpcmedia.com

BY STEVE KEY

With the demise of S.B. 648 in North Carolina on July 26, all ag-gag/anti-whistleblower laws introduced in 11 state legislatures failed to become law in 2013. Included among those bills was S.B. 373 in Indiana, authored by state Sen. Travis Holdman, R-Markle. Other states with bills defeated this year were Arkansas, California, Nebraska, New Hampshire, New Mexico, Pennsylvania, Tennessee, Vermont and Wyoming. With that many states Steve Key considering the issue, you might think the legislation originated with a groundswell of support of farmers, like my grandfather who had acreage in Tennessee. You would be wrong. The bills were inspired by the American Legislative Exchange Council, an entity overwhelmingly The public gains not supported by just from seeing video corporations and their of illegal activity. It also foundations. benefits from reports They create model bills that show currently that are then legal operations that filed in state legislatures by arguably should be the 2,000 state representatives considered for regulaand senators tion or updates in law. who are members of this entity. The goal of ag-gag legislation is to stop the videotaping of poultry, hog and cattle operations. Filming can raise questions of potential animal cruelty or food safety issues. Organizers expanded the proposal to include mining and manufacturing entities in an attempt to garner greater support. As it wound through the legislature, Indiana’s bill at times made it a crime to disseminate farming video without the permission of agribusiness owners and added criminal defamation to the list of laws county prosecutors needed to enforce. HSPA testified against these infringements on the First Amendment. Lawmakers modified the version passed by the Indiana House of Representatives to address only the issue of trespassing and gaining employment through false representations. HSPA didn’t oppose that version since the association neither recommends reporters illegally enter private property nor that they get hired by companies they are investigating. That version didn’t satisfy the author, who changed the bill in conference committee, broadening its scope to the point that Speaker of House Brian Bosma, R-Indianapolis, pulled the bill during its House debate. While the bill died on the final night of the legislature, the issue may be resurrected for the next legislative session. The subject was appointed to this summer’s Interim Study Committee on Economic Development, chaired by state Sen. Jim Buck, R-Kokomo. Apparently it’s not enough that businesses can file a civil lawsuit for defamation if a video falsely portrays its operations. It’s not enough that criminal trespass can be pursued if someone sneaks onto agribusiness property. It’s not enough that there already is a law making it illegal for someone to gain employment under false pretenses. Fortunately, there is a coalition of concerned parties that oppose the ag-gag concept and will be prepared to testify at the summer committee meeting. Along with HSPA, other media entities, environmental groups, labor organizations and animal-rights organizations all oppose the chilling impact of ag-gag legislation. The public gains not just from seeing video of illegal activity. It also benefits from reports that show currently legal operations that arguably should be considered for regulation or updates in law. Laws changed on formerly legal activities concerning child labor, race discrimination, treatment of women in mental institutions, and food safety after journalists shone a light on what was happening.

STEVE KEY is executive director and general

counsel for HSPA. Contact him at skey@hspa.com.

Letters to The Editor • Universe provides different ways of viewing God, mankind To the editor: Did you see the published photo of our Earth and Moon taken from the Cassini spacecraft near Saturn on July 19? From that distance Earth was the size of a thumbtack, and the Moon the size of a pin head. But to those of us living here Earth seems to be a huge, rotating dynamic ball watched closely by God, taking note of who is naughty and who is nice. In 2003 an article in the Scientific American reported most astronomers and physicists are convinced there are endless parallel universes beyond our universe (not galaxies out past our Milky Way galaxy, but UNIVERSES out beyond our UNIVERSE). They reported our universe (the one God reportedly created around 4004 B.C. — a few days before creating Adam and Eve) has 3,3 sextillion stars in about 200 billion galaxies. (A billion has only nine zeros, a sextillion has 21.) They estimated our Milky Way Galaxy has about 40,000 “Earth Planets” — planets similar to Earth in size and in distance relative to their Sun. This means there could be life similar to life here on Earth on 40,000 other

planets in our galaxy. What if our universe’s other 200 billion galaxies each average 40,000 Earth Planets — eight quadrillion more Earths? With humans living on them? We humans are naturally selfish. Yet this innate drive has kept us alive for millennia. Those of us living today are the offspring of the survival of the fittest. Mankind has learned to dominate and control most of Earth’s flora and fauna, and adapt to many changes; thus we have survived. Now if we could just get over our religious and tribal self-righteousness we could live in peace and harmony until the next meteor slams into Mother Earth — like the one 65 million years ago which wiped out 75 percent of all creatures including the dinosaurs. But if we don’t rein in our feelings of superiority toward others, we could easily end mankind’s tenure on this Earth with just one atomic war — wiping out most all life on Earth today and poisoning all lands, lakes, oceans, seas and the atmosphere for dozens and maybe hundreds of years to come. In the Living Bible, in Paul’s letter to the Romans in Chapter 12 he writes “…

Be a new and different person, with fresh newness in all you do and think…” and, “Be honest in your estimate of yourselves.” And, “Just as there are many parts to our bodies, so it is with Christ’s body. We are all parts of it, and it takes every one of us to make it complete.” What if God IS the Universe? And each “small” universe is an organ in God’s body; and galaxies are God’s cells? After all, humans have organs containing billions of cells — cells having millions of atoms and molecules. Too we are home to billions of bacteria that live on and inside us. Maybe WE are “bacteria” IN God, either causing God pain by destroying others, or bringing God pleasure by helping one another? If we are kind, loving and helpful toward all others, might we then live on as “good bacteria” elsewhere in God’s enormous heavenly body? This is certainly a different way to view God and ourselves — by using a sober perspective rather than haughtily thinking too highly of ourselves and dreaming of our anticipated “rewards.” E. Gene Gorrell Jimmerson Lake Fremont

A family matter is to become a private enterprise WASHINGTON — When The Washington Post Writers Group came courting several years ago, inviting me to join the company’s syndicate, I remember well the pitch: We’re a family. By then I had been syndicated for more than a decade by the Tribune Co. and was struck yet again by the layers of irony implicit in the words such media organizations use to describe themselves. Syndicate. Family. Thank God no one kissed me. In The Post’s case, the term was more than metaphor. The paper, which has been in the Graham family for 80 years, was literally a family. The idea appealed to me. Only familyheld papers seemed to sustain the degree of loyalty to the journalistic ideals that attracted my generation of reporters to the field. Back in the day, we really did want to save the world. And, of course, drink. There were other attractions to the Post group. My previous syndicate, to which I am forever grateful, was an enormous enterprise where I was but one of scores of “products” that a handful of salesmen had to sell. Most significant, the top executives were primarily businessmen rather than journalists. At the Writers Group,

in contrast, the top guys — editorial director Alan Shearer and senior editor James Hill — are veteran journalists with close to 100 combined years of institutional memory. The stable of writers is relatively small and, if I do say so, KATHLEEN the best in the business. PARKER Editing is top-notch, owing in no small part to one fellow whose name will not be familiar to many — Richard Aldacushion, editor/fact-checker extraordinaire. We writers worship Richard. One columnist made his name a verb. “To be Richarded” means to be subjected to his gimlet eye and, on occasions too numerous to count, saved from humiliation. We are, indeed, a family and each column is our baby. It doesn’t take a village to write a column, but it’s helpful to have a few affectionate aunts and uncles reading over one’s shoulder. We may not be perfect, but what family is? Although the syndicate is separate from the newspaper, we all live under The Post banner, dwell in the same building,

occupy the same pages and pixels — and all have enjoyed the aura of the literal family, the Grahams. Their announcement Monday that the paper is being sold to Amazon creator Jeff Bezos wasn’t just a news shock. It was a gut-punch of familial disruption. Children of divorce are familiar with the feeling. Nothing will change in the immediate future, we’ve been told. And truly, for me, nothing will. Even though I’ve enjoyed being part of a family I admire, I have been an independent operator for most of the 25 years I have written my column. Only my muse — the fire-breathing deadline monster — has kept me company. Still. When you walk in the door of The Post, you gulp the air of history and feel the presence of journalism’s greats. Bob Woodward of Watergate fame is still around knocking on doors and writing books. Ben Bradlee — Ben Bradlee! — walked these very hallways. Katharine Graham, the matriarch-publisher who shepherded this institution through some of the nation’s most significant political moments, held court a few floors up. And now her son Don Graham and granddaughter/ publisher/namesake Katharine Weymouth have made the

decision no one thought they’d ever see. The family paper is to become the private enterprise of an online retail entrepreneur. Then again, who better to adapt an old form to a new shape? On Monday, when they called the staff together to deliver the news, Weymouth and Graham explained what has long been known: The publicly held company simply doesn’t have the necessary resources for innovation and survival in the Internet age. It is a familiar story these days, but the sting is nonetheless fresh when it is one’s own. Divorce is also commonplace, but this fact is of little consolation when one’s own family falls apart. Bezos has been lauded from all quarters as a good guy whose values are in line with “the family’s.” There’s no questioning his entrepreneurial vitality. When one’s personal fortune hovers around $25 billion, one can afford to dabble in such things as space travel, 10,000-year clocks and even newspapers. All things change. Children grow up, parents die, families adapt and evolve. With therapy — and perhaps a little cash infusion — this one will, too. KATHLEEN PARKER is a syndicated columnist with Tribune Media Services. She can be reached at kathleenparker@washpost.com.

What Others Say • Pressing forward on Middle East peace talks A new round of Middle East peace talks begin this week with hope for success in short supply. And no wonder. The modern state of Israel is nearing age 70, and in all that time there has been no settlement of the vexing question of how Israel and a Palestinian neighbor state can coexist in peace. Nor has there even been an agreement on how to create that Palestinian state and what the

capitals of it and Israel should be. Both want Jerusalem. Yet Secretary of State John F. Kerry deserves praise for ending a five-year freeze in talks even if almost no one imagines a final settlement can be reached in the nine months he has set as the goal. Israeli and Palestinian leaders also deserve praise for finding the courage to renew peace talks when so few hold out hope for success. Perhaps this lack of hope signals what financial markets often call capitulation, meaning

that against all odds the markets begin to rebound just when most investors give up. A weary world is near capitulation on the Middle East and could hardly have lower expectations for success in these negotiations. Israelis and Palestinians need to work hard now to create a two-state solution so all people in the region can live out their dreams in peace and in a relationship built on mutual respect. … Chief negotiators Saeb Erekat for the Palestinians and Tzipi Livni

for the Israelis will need to focus on the future of Jerusalem and the current Israeli settlements in the occupied West Bank and the annexed East Jerusalem. A settlement may well hinge on whether both sides will be willing to share Jerusalem as a capital. Continued tension in the Middle East because of the stateless Palestinians gives extremists around the world a rallying cry. A successful resolution to the conflict would be a gift to the world. Kansas City Star


NATION • WORLD •

MONDAY, AUGUST 12, 2013

Briefs • Jail officer charged with Indiana murder CHICAGO (AP) — Authorities say a correctional officer from Illinois’ Cook County faces is being fired after he was charged with murder in connection with a roadside shooting in Indiana. Edgar Singleton Jr. was charged with one count of murder on Saturday. The 61-year-old allegedly shot 23-year-old Montrell Moss of East Chicago last week in Hammond, Ind., after the men became involved in a dispute. Moss was later pronounced dead at an area hospital. Singleton is a longtime correctional officer in Cook County.

Killer may have abducted young boy JOHNSTON, R.I. (AP) — Police continued to search Sunday for a small boy they believe was abducted from a Rhode Island home where two bodies were found earlier in the morning. Massachusetts State Police arrested a man as a suspect in the boy’s kidnapping, but later said the man apparently wasn’t linked to the child’s disappearance. Police wouldn’t say if they released him. The Johnston police did not immediately return calls for an update on the search, a suspect and their investigation. The search for 2-year-old Isaiah Perez began after the two bodies were discovered about 5:20 a.m. at the home in Johnston, a town of 30,000 residents less than 10 miles from Providence. Investigators believe the two were killed between 4:30 and 5 a.m. and someone then fled the home with the child.

Man kills his son in YWCA office MANCHESTER, N.H. (AP) — A New Hampshire man used a handgun to shoot his 9-year-old son to death before taking his own life during supervised visitation at a YWCA office in the state’s largest city, officials said Sunday. An adult supervisor was present when Muni Savyon, 54, of Manchester, produced a handgun and shot 9-year-old Joshua Savyon of Amherst before shooting himself, the attorney general’s office said. Reports of gunfire shortly after 10 a.m. brought a heavy response from police officers who set up a perimeter.

B5

Some in GOP still trying to deal with immigration BEL AIR, Md. (AP) — Immigration advocates are swarming the country this month, trying to persuade House Republicans to pass a comprehensive overhaul. It was hard to tell at the town-hall meeting that second-term Republican Rep. Andy Harris held recently in this town northeast of Baltimore. The overflow crowd in the board of commissioners meeting room was overwhelmingly white and older, and booed loudly when one audience member asked Harris to support a path to citizenship for immigrants who are in the U.S. illegally. Loud applause followed as Harris shot the idea down, calling it “a nonstarter” that’s “not going anywhere fast” in the House. “The bottom line is there are plenty of immigration laws on the books,” Harris said. “The House is in no rush to take up immigration.” Harris, a 56-year-old physician and the son of Eastern European immigrants, is in a safe GOP district with few Latino voters, and he’s not on target lists drawn up by immigration proponents. So it’s no surprise that

advocates wouldn’t be out in force at his events. Yet his position is far from unique. For all the effort that business and labor groups, activists and others who support action on immigration say they’re pouring into making themselves heard during Congress’ five-week summer recess, there are scores of House Republicans who are hearing very little of the clamor. These lawmakers are insulated in safe districts where immigration activists don’t bother to venture, or so hardened in their positions that no one’s even trying to change their minds. “Most of the energy is being spent on the folks who are gettable,” said Frank Sharry, executive director of America’s Voice, a pro-immigrant group. “We’re not spending a lot of time on Republicans who are clearly going to vote ‘no.’” With immigration legislation stuck in limbo in the GOP-led House, that reality raises the question of how successful advocates can be in reaching their goal for this month: generating enough momentum to propel Congress to act when lawmakers return to Washington in September.

Israel approves many new settlements JERUSALEM (AP) — Israel approved building nearly 1,200 more settlement homes Sunday and agreed to release 26 long-held Palestinian security prisoners — highlighting an apparent settlements-for-prisoners trade-off that got both sides back to peace talks after a five-year freeze. Yet concerns were mounting, especially among Palestinians, that the price is too steep. Sunday’s announcement was Israel’s third in a week on promoting Jewish settlements on war-won lands the Palestinians want for a state. It fueled Palestinian fears of a new Israeli construction spurt under the cover of U.S.-sponsored negotiations.

In Israel, the most vocal protests came from relatives of those killed in attacks carried out by Palestinians slated for release. Bereaved relatives held up large photos of their loved ones during a Supreme Court hearing on an appeal against the upcoming release. “Why are we releasing butchers now? What for?” asked Gila Molcho, whose brother, lawyer Ian Feinberg, was stabbed to death by Palestinians who broke into a European aid office in Gaza City in 1993. Israelis and Palestinians are to launch talks on Wednesday in Jerusalem, following a preparatory round two weeks ago in Washington.

AUBURN TOWN TAVERN

People •

THANK

YOU!

Usher to keep custody of sons ATLANTA (AP) — R&B singer Usher will hold on to primary custody of his two young sons. A judge in Atlanta on Friday dismissed an emergency request by Usher’s ex-wife seeking temporary custody of their two Usher children. Tameka Foster Raymond requested the hearing a day after the former couple’s 5-year-old son got caught in a pool drain while in the care of the multi-Grammy winner’s aunt at Usher’s Atlanta home. Fulton County Superior Judge John Goger dismissed her request for decision-making authority after hearing from both sides in court. After the judge issued his ruling, Usher approached his ex-wife, who broke down while testifying, and gave her a long hug. Based on the evidence presented at the hearing, Goger said he wasn’t certain anyone really could have done anything to prevent the accident. But he also advised the 34-year-old Usher to keep his ex-wife well advised of his whereabouts and who’s taking care of the children.

kpcnews.com

Thank you for your continued patronage!

Customer Appreciation

Celebration! Tuesday, August 13 Wednesday, August 14 CITY BOY BREAKFAST 2 Eggs, Choice of Meat, Potatoes and Toast

ONLY

$3.99

FISH BASKET LUNCH 3 Pieces of Fish, Side and Choice of Potato

$5.99

FAMOUS FISH DINNER Fish, Choice of Potato, Side and Roll

$7.99

1343 S. Main St., Auburn

925-0555 Full Catering Available

AP

Priscilla Robinson and her father, Major Robinson, pose outside Guggenheim Elementary School that she attended and where Major Robinson worked security, in Chicago. In the year since Guggenheim School closed, vandals have descended on the vacant building,

stripping satellite classrooms of their air conditioning units and causing other damage. It wasn’t long before the playground, so popular with neighborhood kids, including Robinson’s niece, was a place to be avoided.

Closed schools impact Chicago CHICAGO (AP) — To Carolyn Lang, West Pullman Elementary is more than the school across the street her children attended a quarter-century ago. It’s where she turned for help when the lock on her front door froze and where school workers watch from their windows to make sure she doesn’t fall victim to crime in an impoverished corner of the city wracked by violence, including two men found shot to death in a car just days ago. But no more. West Pullman is one of nearly 50 Chicago schools the city closed last spring as part of aggressive cost cutting that calls for the single largest closing of schools in any American city in years. Critics of the closures have protested that children will be forced to cross gang boundaries to get to new schools. Largely overlooked are the worries of thousands of people like Lang who have relied on the schools to help

safeguard poor neighborhoods. Soon, many of those buildings will go as dark and quiet as the boarded-up houses that dot their struggling communities. “I used to come home late from prayer meetings at my church, and just seeing the light on and knowing the engineers and the janitors were working, I felt safe because they were there,” said Lang, 58. “Now it won’t be a safe haven anymore.” What will happen to Pullman and other schools is unclear. In recent years, most of the relatively few schools that have closed have reopened as charter, magnet, military, alternative or other kinds of schools. Chicago schools spokeswoman Becky Carroll said the district is “serious about making sure these buildings have a useful purpose, whether they are sold to a private entity (or used as) some kind of community center.” But the district has never

had to find new uses for so many vacant schools at once. Carroll seemed to acknowledge the challenge in an email, saying no one should expect the buildings to be repurposed “in time for the school year or over the next year.” For Terry Donaldson, that means a year or two without the security of the school. “I got to know the janitor over there, and he would be cutting the grass and we’d talk, and then he’d watch my back and I’d watch his back,” said Donaldson, 65. “Nobody bothered him or me because they know we watched each other.” Richard Ingram, who manages rental properties on the South Side, says some tenants call schools rather than police to report crimes to prevent criminals from discovering who they are. “They’re afraid for their lives, but they know the schools can call and there won’t be any repercussions,” he said.


B6

COMICS • TV LISTINGS •

kpcnews.com

DUSTIN BY STEVE KELLEY & JEFF PARKER

MONDAY, AUGUST 12, 2013

Mom looking for witty reply to adoption questions DEAR ABBY: My husband and I have two wonderful sons who joined our family through adoption. While we don’t broadcast that they are adopted, it sometimes comes up in conversation. When it does, people inevitably ask, “What happened to their ‘real’ parents?” or, “Why were they given up?” I know folks are curious, but these comments are hurtful. The details of my sons’ lives are private, to be shared as they grow in age-appropriate ways. They know they are adopted, but are too young to know the details surrounding their lives prior to joining our family. I do not want to have an in-depth conversation with every person who asks a nosy question. These questions always seem to come up when the kids are around and I feel

FOR BETTER OR FOR WORSE BY LYNN JOHNSTON

GARFIELD BY JIM DAVIS

BLONDIE BY YOUNG AND MARSHALL

the questioner, I can think of one that would be effective. Look the person in the eye, smile and say, “Oh, that’s a long story, but look at what beautiful sons I have. I feel truly blessed.” DEAR ABBY: This idea may appeal to the parents of young children: Celebrate “half-birthdays.” (The concept is derived from the “Half-Birthday Song” in “Alice in Wonderland.”) A year to a young child is a long time. In addition to recognizing the joy that he/ she was born, it’s a start to learning the structure of our calendar. It doesn’t have to involve a big party or gifts, just a special activity day with a parent. Our family has observed half-birthdays for 45 years and have found it to be a worthwhile tradition. — FUN MOM

MONDAY EVENING 5:00 (15) WANE (16) WNDU (21) WPTA (21.2) CW (33) WISE (33.2) MNT (39) WFWA (39.2) KIDS (39.3) CRE (39.4) YOU (55) WFFT (22) WSBT (25) WCWW (28) WSJV (34) WNIT (46) WHME (57) WBND (63) WINM

BEETLE BAILEY BY MORT WALKER

AMC A&E CNBC CNN COM DISC DISN E! ENC ESPN ESPN2 FAM FNC FSMW HALL HBO HBO2 HBOS HGTV HIST LIFE MAX MTV NICK SYFY SHOW SPEED SPIKE STARZ TBS TLC TMC TNT TVLND USA VH1 WGN

ALLEY OOP BY JACK AND CAROLE BENDER

FRANK & ERNEST BY BOB THAVES

5:30

AUGUST 12, 2013 6:00

On this date: • In 1846, the American flag was raised for the first time in Los Angeles. • In 1934, the satirical comic strip “Li’l Abner,” created by Al Capp, made its debut. • In 2008, Michael Phelps swam into history as the winningest Olympic athlete ever with his 10th and 11th gold medals. Phelps won the 200-meter butterfly, then swam the leadoff in the 800 freestyle relay team.

THE BORN LOSER BY ART & CHIP SANSOM

Over-the-counter products help dry eyes become difficult to wear contact lenses. You may experience a buildup of sticky mucus in your eye, or find it difficult to cry. Your eyes may become more sensitive to light. Surprisingly, dry eyes can cause excessive ASK tearing. DOCTOR K. These tears are “irritant tears,” made reaction Dr. Anthony in to your dry They Komaroff eyes. contain more water and less fat and mucus than regular tears. As a result, they just run off the eyes without lubricating them as healthy tears do. There are many causes of

dry eyes: allergic reactions, irritation from wearing contact lenses, an eyelid inflammation (a condition called blepharitis), and a disease called Sjogren’s syndrome. Dry eyes become more common when you get older, as tear production normally drops off. Women are more likely than men to get dry eyes. So are people with diabetes and people who live in places with low humidity. Certain commonly used medicines reduce the production of tears, including antihistamines, birth control pills and selective serotonin receptor antagonists (SSRIs), often used to treat depression. Over-the-counter artificial tears mimic the makeup of natural tears, and their regular use effectively treats most cases of dry eye. Lubricating ointments can treat more serious cases, but

6:30

7:00

7:30

8:00

8:30

9:00

9:30 10:00 10:30

News InsEd. News News Wheel Jeopardy Mother M&M Girls M&M Under Dome (N) News 16 News 16 News News InsEd. Access Ninja War (N) Get Out Alive (N) Siberia (N) 21 Alive News News News ET Sound CMA Music Festival: Country's Night to Rock (N) Wendy Williams Queens '70s Seinfeld Rules Hart of Dixie Breaking Pointe (N) Cops Seinfeld Dr. Phil News News Ray Ray Ninja War (N) Get Out Alive (N) Siberia (N) Alex Last Shot Home Videos Frasier Christine SVU "Runaway" SVU "Folly" FamilyG FamilyG Wild K. Company PBS NewsHour Business Matters Antiques Rd. Antique Woody Guthrie Live DinoT WordGirl Fetch! Raggs Sid Barney W.World George Arthur Zula Speaks Clifford Garden Wine O.House Martha Ming J. Pépin Lidia's Cook's J. Weir Martha O.House Steves' Gener. News Robert Florida PBS NewsHour Jimmy Dean Show Protect Your Memory Mother Mother 2½Men 2½Men BigBang BigBang Raising Raising New Girl Mindy WFFT Local News News News News News Wheel Jeopardy Mother M&M Girls M&M Under Dome (N) Rules Rules Mother Mother BigBang BigBang Hart of Dixie Breaking Pointe (N) News Seinf. 1/2 2½Men 30 Rock FamilyG AmerD Simps. FamilyG Raising Raising New Girl Mindy FOX 28 News Wild K. News Steves' Michiana PBS NewsHour Magic Moments Burt Bacharach PartFam FamilyT Star Trek: NG Hogan News Sumrall Bible The Harvest Show Hart Life News News News News OMG! ET CMA Music Festival: Country's Night to Rock (N) Fellow. Ask the Pastor Faith H. Talk News Today Manna Julie Life J. Hagee Bible Movie 

Next of Kin (‘89) Patrick Swayze. 

The Godfather (‘72) Al Pacino, Marlon Brando. The First 48 The First 48 Duck Dy Duck Dy Duck Dy Duck Dy Glades "Civil War" Longmire (N) Fast Money Mad Money The Kudlow Report BMW #TwitterRevolution The Profit The Situation Room With Wolf Blitzer OutFront A. Cooper 360 Piers Morgan Live A. Cooper 360 :20 Sunny :50 Sunny Tosh.O (:55) Colbert Report (:25) Daily KeyPeele :25 Futura SouthPk SouthPk SouthPk SouthPk Moonshiners Moonshiners Moonshiners Amish "Holy War" Amish Mafia (N) MythBusters (N) Dog Blog Dog Blog Phineas Phineas GoodLk Jessie 

A Bug's Life (:45) Ferb Dog Blog Austin Total Divas Total Divas E! News The Kardashians 

Made of Honor 4:40  Jack and Jill (:15) 

Striking Distance 

The Butterfly Effect  Dances With ... Horn (N) Interrupt SportsCenter Baseball MLB L.A. Angels vs N.Y. Yankees (L) Baseball T. (L) Football Press (N) Horn (N) Interrupt SportsCenter (N) N FL (N) N FL (N) Pardon Pardon This Is Sportscenter '70s '70s Home Videos Switched at Birth Switched Birth (N) The Vineyard Switched at Birth The Five Special Report FOX Report The O'Reilly Factor Hannity On the Record Triathlon Insider Football Wilcats UFC 146 Poker WPT Little House Prairie Little House Prairie Little House Prairie  Your Love Never Fails Elisa Donovan. Frasier Frasier (4:45) 

Spanglish Adam Sandler. 

Crazy, Stupid, Love. Americans in Bed (N) H.Knocks 4:  Grosse Poin... Hard Knocks 

Cowboys and Aliens True Blood The Newsroom Movie Weight (:05) 

The Descendants The Sopranos  Beasts of the Southern ... Making FleaFlip FleaFlip FleaFlip FleaFlip Love It or List It Love It or List It Love It or List It H.Hunter House American Pickers American Pickers American Pickers American Pickers American Pickers God, Gun God, Gun Wife Swap Wife Swap Wife Swap  A Sister's Revenge (‘13) Brooke Burns.  Look Again 4:40  Moonrise... (:15) 

Entrapment Sean Connery. (:10) 

Assault on Precinct 13 

Snake Eyes Ridicu. Ridicu. Ridicu. Ridicu. Catfish Catfish Teen Wolf Teen Wolf Sponge Sponge Sponge Sponge Sponge Sponge Guppies PAW (N) F .House F.House Nanny Nanny Movie (:35)  Indiana Jones and the Temple of Doom (:10) 

Indiana Jones and the Last Crusade (4:35)  New York, I Love You (:25)  Every Day Dexter Ray Donovan Dexter Chop GearZ NASCAR Race Hub Pass Pass Pinks! "Atlanta" West Customs (N) Dumbest FOX Spt1 Cops Cops Cops Cops Cops Cops Cops Cops Cops Cops Cops Cops 4:30White (:35)  The Benchwarmers (:05) Starz /(:20)  Hotel Transylvania 

Men In Black 3 Movie Friends Queens Queens Seinfeld Seinfeld Seinfeld FamilyG FamilyG FamilyG BigBang BigBang BigBang CakeB. CakeB. CakeB. CakeB. CakeB. CakeB. CakeB. CakeB. Cake Boss (N) B. Underdogs (N) (4:10)  Mean Girls 

The Man Who Wasn't There 

The Big Lebowski  Intolerable Cru... Castle Castle "The Limey" Castle Major Crimes Major Crimes (N) King & Maxwell (N) MASH MASH MASH MASH MASH MASH MASH MASH Ray Ray Ray Ray NCIS "Boxed In" NCIS "Head Case" NCIS: LA "Plan B" WWE Monday Night Raw Atlanta "Boriqua" Love and Hip-Hop Love and Hip-Hop Atlanta (N) TI Tiny Marrying Love and Hip-Hop Law:CI "Gemini" Home Videos Home Videos Home Videos Home Videos WGN News at Nine

Almanac •

DEAR DOCTOR K: I have dry eyes. What are my treatment options? DEAR READER: Tears are not just for crying. Your eyes are constantly making small amounts of tears to keep the surface of the eye and the underside of the eyelids moist. Tears also contain fat and mucus, substances that cleanse the eyes. Except when you cry, tears are made in such small amounts that the liquid doesn’t spill out of the eyes. You don’t notice that you’re making the right amount of tears, but you do notice when you’re not making enough. Tears are made by tiny glands in the eye called lacrimal glands. Dry eyes occur when your eyes don’t produce enough tears. As your tear production drops off, your eyes can burn or feel itchy, scratchy or irritated. It may suddenly

unprepared to answer them. Do you have any suggestions for a witty and confident response that can shut down these questions? I don’t my DEAR want boys to be ABBY ashamed that they were Jeanne Phillips adopted, but I also don’t want the details out there for public consumption. — MOM IN INDY DEAR MOM: That someone would be so insensitive as to pose those questions in front of the children is disconcerting. While I can’t think of a “witty” response that would deter

they tend to blur vision, so apply them at bedtime. In severe cases, your ophthalmologist may need to insert tiny plugs made of collagen or silicone into your tear drainage ducts. The plugs help both natural and artificial tears stay on your eye longer by preventing them from draining out of the opening in the inner corner of the eyelid. Another approach is to increase tear production. Topical cyclosporine (Restasis) decreases inflammation in the tear-producing glands, which can lead to better tear production. If a medication you’re taking is contributing to your dry eye, changing it may help. DR. KOMAROFF is a physician and professor at Harvard Medical School. His website is AskDoctorK.com.

Crossword Puzzle •


kpcnews.com

MONDAY, AUGUST 12, 2013

B7

Futuristic ‘Elysium’ tops at box office at $30.5 million NEW YORK (AP) — The dystopian science fiction thriller “Elysium” topped the weekend box office with $30.5 million, according to studio estimates Sunday, enough to beat three newcomers, including the Jennifer Damon Aniston comedy “We’re the Millers.” Sony’s “Elysium,” directed by Neill Blomkamp and starring Matt Damon, opened in line with expectations, but still debuted somewhat modestly for a $115 million action film. It couldn’t match Blomkamp’s previous film, the $30 million “District 9,” which opened with $37.4 million

in August 2009. But “Elysium” was able to come out on top in a crowded weekend, with three other new wide releases: the R-rated Warner Bros. comedy “We’re the Millers,” starring Jason Sudeikis and Aniston ($26.6 million over the weekend, a strong $38 million since opening Tuesday night); Disney’s “Cars” spinoff “Planes” ($22.5 million) and Fox’s fantasy sequel “Percy Jackson: Sea of Monsters” ($14.6 million over the weekend, $23.5 million since Wednesday). “District 9” was something of a phenomenon: a relatively low-budget science-fiction film from a first-time, South African director that made over $210 million worldwide and landed four Academy Awards nomina-

tions, including best picture. Like “District 9,” ”Elysium” is rife with allegory, a futuristic tale heavy with contemporary themes of wealth discrepancy, health care and immigration. But it was also made with more than three times the budget of “District 9” and added stars Damon and Jodie Foster. Rory Bruer, head of distribution for Sony said the studio was proud to release an ambitious film like “Elysium” and said that it would be “very profitable” for Sony. The film launched internationally in a handful of markets, including Russia, taking in $10.9 million overseas. With the added star power of Damon and Foster, “Elysium” should be a bigger draw than “District 9” was abroad.

“International is going to be the big, big win on this film for us,” said Bruer. The weekend was enough to push the box office just past the pace of last year, which means that despite several spectacular flops this summer, Hollywood’s 2013 is currently equal to its 2012. The year-to-date gross of $7 billion is even with last year, although attendance is down 2.9 percent. “Yes, there’s been some high-profile failures,” said Chris Aronson, head of distribution for Fox. “But the summer’s been fantastic despite the gloom and doom some in the media have portrayed.” The market was crowded with family films, including new releases “Percy Jackson” and “Planes,” as well as holdovers like

Sony’s “Smurfs 2” ($9.5 million in its second week) and Fox’s “Turbo” ($2.3 million in its fourth week). With the box office led by two R-rated films, it made for a diverse weekend of movie-going. “It used to be called the dog days of August — and you still get some junk thrown in to August,” said Paul Dergarabedian, analyst for box-office tracker Hollywood.com. “But it can also be the land of opportunity for films that aren’t cookie-cutter for audiences that are burned out by blockbusters.” Estimated ticket sales for Friday through Sunday at U.S. and Canadian theaters, according to Hollywood. com. Where available, latest international numbers are also included. Final domestic figures will be

released later today.. 1. “Elysium,” $30.5 million ($10.9 million international). 2. “We’re the Millers,” $26.6 million. 3. “Planes,” $22.5 million. 4. “Percy Jackson: Sea of Monsters,” $14.6 million ($9.8 million international). 5. “2 Guns,” $11.1 million. 6. “Smurfs 2,” $9.5 million ($34.6 million international). 7. “The Wolverine,” $8 million ($18 million international). 8. “The Conjuring,” $6.7 million ($9.9 million international). 9. “Despicable Me 2,” $5.7 million ($12.2 million international). 10. “Grown Ups 2,” $3.7 million ($6.6 million international).

KPC Classifieds To place an ad call 260-347-0400

Toll Free 1-877-791-7877

Open Monday - Friday 8 a.m. - 5 p.m. Place your ad 24/7 online or by e-mail

Fax 260-347-7282

E-mail classifieds@kpcmedia.com AGE GAR LE SA

kpcnews.com

S e r v i n g D e K a l b , L a G r a n g e , N o b l e a n d S t e u b e n Co u n t i e s To ensure the best response to your ad, take the time to make sure your ad is correct the first time it runs. Call us promptly to report any errors. We reserve the right to edit, cancel or deny any ad deemed objectionable or against KPC ad policies. Liability for error limited to actual ad charge for day of publication and one additional incorrect day. See complete limitations of liability statement at the end of classifieds.

ADOPTIONS

EMPLOYMENT

ADOPTION - MEANT TO BE A MOM: Loving, financially secure TV producer promises your child a bright future with laughter, education, wonderful extended family and lakefront home. Expenses Paid (917) 804-0568 greatfamily59 @gmail.com

■ ✔ ■ ✔■ ✔ ■ Custodial

Garrett Keyser Butler is looking for a

JOBS

custodian

NOTICES AIRLINE CAREERS begin here - Get FAA approved Aviation Tech training. Financial aid if qualified. Job placement assistance. CALL Aviation Institute of Maintenance 877-523-5807 www.FixJets.com AC0190

FOUND FOUND! Dachshund Brownish/red, found on CR 19 past CR 36. Collar with no tags. 260-333-2406

EMPLOYMENT ■ ❏ ■ ❏ ■

Apply in person St. James Restaurant Avilla

■ ❏ ■ ❏ ■ Cleaning

Part Time Janitorial

Brown/Black Striped tabby cut, 4 yr old male. No collar, has microchip. Lost Wed., Aug. 7, Lake James, Spring Point (CR 200 W approx 1/2 mile N of Whisper Bay condos). Kit is greatly missed, reward. Call 765-414-6698

TUTORS Reading Individual diagnosis and teaching. Licensed and experienced. Call Kathy 260-833-1697

position available, must be flexible, in the Ashley area, 15-20 hours a week, $8.50 per hour.

Driver

Regional Drivers Wanted for Local Company REQUIREMENTS INCLUDE:

Garrett, IN 46738 EOE

Call 800-272-8726

No phone calls please

900 E Warfield St.

Restaurant

Part Time Servers & Bartender

•CLASS A CDL •2 YEARS DRIVING EXPERIENCE •ABILITY TO WORK IN A RELAXED ATMOSPHERE •HOME MOST WEEK NIGHTS & EVERY WEEKEND

Apply at:

LOST 11 yr old black lab & chow mix. All black. Short & wirey hair. Short tail like chow. White muzzle, no tags or collar. Her name is Molly. Lost Tuesday, July 9 in afternoon. Lost on CR 54 & 39 260-925-1950

2nd shift Includes all areas of custodial duties & floor maintenance (stripping and waxing of tiled floors).

CLASSIFIED

EMPLOYMENT

■ ✔ ■ ✔■ ✔ ■ Drivers Class A CDL Minimum Two years Experience Good pay and benefits Home every night No touch freight Days & Nights Available. For our Ft. Wayne, & Butler, Indiana locations -

Or email resume to:

mary@cmwtrans port.com ■

Cleaning

Call Jim 800-621-1478 Ext. 131 or apply on line at: fabexpress.com Drivers

position available, must be flexible, in the Topeka area, 15-20 hours a week, $9.00 per hour.

is looking for Class A CDL drivers. Home every weekend and most nights. We are a local company.

Call 260 466-3773

Call

260 307-1254

@sk

THE EXPERT

AGRIBUSINESS • Every Saturday read up on the latest trends, technology and predictions for the future of farming.

The

1-877-791-7877 THE NEWS SUN

The

HERALD Star REPUBLICAN THE

OPPORTUNITIES

INDEPENDENT

CONTRACTORS INDEPENDENT Circulation Department Adult Motor Routes Contact: Christy Day in DeKalb County

kpcnews.com Email: classifieds@kpcnews.net

• Valid Driver’s License • Responsible Adult • Reliable Transportation • Available 7 days a week

Fax: 260-347-7282 Toll Free: 1-877-791-7877

Route available in Kendallville.

Circulation Department

Contact: Misty Easterday

• VALID DRIVER’S LICENSE • Responsible Adult • Reliable Transportation • Available 7 days a week.

102 N. Main St., Kendallville Phone: 800-717-4679 ext. 105 E-mail: newssundm@kpcmedia.com Carriers are independent contractors and not employees.

118 W 9th St., Auburn, IN Phone: 260-925-2611 ext. 17 E-mail: cday@kpcmedia.com

Due to increased workload, we are in need of a fabricator for our Prototype Shop. This is a hands-on position requiring daily interaction with Engineering, Tool room and Production activities. This position requires basic knowledge of blue print reading, math, measurement techniques such as calipers/micrometers and basic machining skills on a lathe, mill and drill press. A potential candidate may possess skills such as home workshop craftsmanship, fabrication hobbies, tool room experience or mechanical abilities in related fields. Previous experience with manual and CNC tube bending is a plus. The ability to work under time constraints and customer demands is a must. Candidates must be able to work alone, unsupervised and maintain self-managed work ethics while producing quality results as dictated by customer specifications. All other necessary skills required for this position will be gained through on-the-job training and experience. This is a 1st shift position with periodic overtime. Mandatory overtime may be required under certain workload conditions. *Pay is based on experience Benefits Include: medical, dental, vision insurance, 401K and paid vacation.

Please send resume to: hrmgr96@gmail.com ATM c/o HR Mgr 1501 Wohlert St., Angola, IN 46703

Star

HERALD REPUBLICAN THE

Call 1-800-717-4679 today to begin home delivery!

CONTRACTORS

Carriers are independent contractors and not employees.

THE NEWS SUN

Place an ad showing your love

OPPORTUNITIES

PROTOTYPE SHOP POSITION

NLS HAULING

Part Time Janitorial

CARRIER

CARRIER

Call

260 307-1254

Don’t want the “treasure” you found while cleaning the attic? Make a clean sweep ... advertise your treasures in the Classifieds.

Leading provider of paperboard packaging is currently accepting applications for:

MAINTENANCE TECHNICIAN Duties

• Installs, maintains and repairs printing presses and folder/gluers

Skills • Technical Certificate in Industrial Maintenance or equivalent preferred

Description of Benefits • Medical, Dental, Vision, 401K Match, Vacation, Tuition Reimbursement...just to name a few

Apply at: www.graphicpkg.com Click on the “Career Center” link. EEO • M/F/D/V

aaaA

Sudoku Puzzle

NOW HIRING IN Kendallville (Location) Schwan’s Home Service, Inc.

Complete the grid so that every row, column and 3x3 box contains every digit from 1 to 9 inclusively.

CARRIER

OPPORTUNITIES

CONTRACTORS INDEPENDENT Circulation Department Albion/Brimfield motor route. Contact: Misty Easterday Earn over $1,000 per month in 2+ hr/day. • VALID DRIVER’S LICENSE • Responsible Adult • Reliable Transportation • Available 7 days a week.

BUNDLE HAULER WANTED

1 6 8

102 N. Main St., Kendallville Phone: 800-717-4679 ext. 105 E-mail: newssundm@kpcmedia.com

102 N. Main St., Kendallville Phone: 800-717-4679 ext. 105 E-mail: newssundm@kpcmedia.com

Carriers are independent contractors and not employees.

Carriers are independent contractors and not employees.

7 2

6

9

5

2 8

3

8

8 8 7 5

3

9

2 9

Route Sales Representative

1

5

Night delivery of bundles from Kendallville to Angola 60 miles/2 hrs. round-trip 3/4 ton van or larger preferred. • VALID DRIVER’S LICENSE • Responsible Adult • Available 7 nights a week.

2

4

6 3 8

1 2

6

s#OMPETITIvE#OMPENSATION Package with Base Wage, #OMMISSIONAND)NCENTIves s0RE ESTAblished and Growing #USTOMER"ASE /PTIONS s3ALESAND-ANAGEMENT Training sPaid Vacation s2ETIREMENT3avings Program s%MPLoyEE$ISCOUNTON #OMPAnY0RODUCTS

For immediate For immediate consideration, consideration apply online at apply online at www.schwansjobs.com 507- 537-8990 www.schwansjobs.com EOE EOE

Difficult rating: EASY 8-12

2011Schwan’s Schwan’s Home Inc. ©©2011 HomeService, Ser vice, Inc. AllRights Rights Reser Reserved. All ved.


B8

kpcnews.com

• Metal Technologies is a well maintained, modern green sand foundry • Finishing Department positions available on all shifts starting at $13.95/hour with direct hire opportunities available within 90 days of placement. All applicants must meet the following requirements: • High School Diploma or GED • Ability to work in a heavy industrial environment •Must submit to criminal background check and drug screen • Willing to work overtime Job fair process will include application, assessment activities, and finishing department tour (Dress accordingly: closed toe shoes/boots and long pants). The job fair will be held at Metal Technologies, 1537 West Auburn Drive, Auburn, Indiana 46706. If you have any questions please contact the Forge Industrial Staffing Office at 260-471-5900 and refer to Metal Technologies when you call.

Hickory Creek at Kendallville

PRESENCE SACRED HEART HOME

a non-profit skilled nursing home is in need of a

We are accepting applications for the following positions:

MDS Coordinator & Certified Dietary Manager

•RN Nursing Team Leader FT Day shift

IMPACT Institute has an opening to work with approx 10-12 second year students. Candidates should have baking and pastry background (degree preferable). This Instructional Asst/Deli Mgr hours are from 7:30am to 2:30pm Mon-Fri through the school year. Pay depends on exp. Please complete the general application on our website: impactinstitute.net Click on the resources tab, employment opportunities. EOE

& CNAs F/T evenings, P/T days Interested candidates may submit resume in person to:

General

EQUIPMENT OPERATOR/ LABORER

Attention: Annette Weber, Administrator 260-347-3612

Apply in person: Eshelman Excavating 5999 E. US 6 Kendallville M-F • 8:30 am-3:30 pm

Lennard Ag Company in Howe, IN is NOW HIRING: CDL-A and POTATO TRUCK DRIVERS Seasonal semi-truck and straight-truck drivers needed to drive along-side our harvesters in the fields and deliver to our Howe, IN location. All local fields – no overnights. Looking for safe, reliable, and professional drivers. Call Lennard Ag @ (260) 562-3900 for more information or apply at: 0450 W. 750 N. Howe, IN 46746 Located south of IN for an immediate interview. (Turn West at the Valero Gas Station and Holiday Inn Express on SR 9)

CHANDLER HOUSE

General FULL TIME Business Technician Drs. Roush & Will Kendallville Bring resume to Kendallville office.

*Assisted living with six levels of care*

Due to increasing census, We are Hiring -

General Part time Nightly Cleaning People Needed in Kendallville

Part-Time CNAs or HHAs

Is accepting applications for a Street Department Assistant. Applications and a job description are available at the Hamilton Town Hall, 900 S. Wayne Street, or can be accessed on the Town website, www.hamiltonindiana .org. Deadline for applications is Thursday, August 29, 2013, at 4:00 p.m.

Pay D.O.E. Send Resume to: kleitch@ bjspecialty.com or apply in person B & J SPECIALTY, INC. 7919 N 100 E WAWAKA, IN 46794

■ ❏ ■ ❏ ■

BREAKING NEWS

kpcnews .com

Restrictions apply. www.mrdapartments.com E-mail to: crosswaitestates@ mrdapartments.com

Angola ONE BR APTS. $425/mo., Free Heat. 260-316-5659 Avilla 1 & 2 BR APTS $450-$550/ per month. Call 260-897-3188

Contact Tricia Parks for an interview.

CONDOS/DUPLEXES

Or Apply on line at:

Angola 2 BR duplex w/attached 1 car gar. Natural gas heat, has central air conditioning. $500/mo. 668-9081

www.presencehealth .org/lifeconnections

✦ ✧ ✦ ✧ ✦ ✧

Restaurant

Now hiring for Big Turkey Lake 1 BR, $600/mo. all util. Included carport 260 249-8302

ALL POSITIONS Apply in person at:

■ ✦ ■ ✦ ■

PART TIME HOUSEKEEPER needed at Deerfield Apartments. Motivated, dependable persons may apply in person 1998 Deerfield Lane Kendallville or by fax: 260-347-5654 EOE Janitorial

■ ◆ ■ ◆ ■

Full and Part Time Cleaners

■■■■■■■■■■■■■ General

Needed in the Butler area. Must have clean background.

JOURNAL GAZETTE

Send Resume via e-mail to:

Routes Available In:

pharrison@emsinc .com

Auburn & LaGrange

UP TO $1000/ MO.

Call 800-444-3303 Ext. 8234

Or Call Job Line 1-888-395-2020 ext 3336 State your name, number & city with your message.

Health Auto Mechanic

RESPIRATORY THERAPIST The Cardio Respiratory Department of Sturgis Hospital has a 72 hour full time night position for a Certified eligible and/or registered Respiratory Therapist. MI licensure required or willing to obtain. Position offers: • 12 hour shifts • Every third weekend • Excellent benefits and wages Email resume to: resume@sturgis hospital.com Or send to: Sturgis Hospital Attn: Human Resources 916 Myrtle Ave. Sturgis, MI 49091 (269) 659-4440 Fax (269) 659-6713

Best Deal Auto Sales Hiring ASE Certified auto mechanics. Seasoned or right out of school. If you are looking for a great place to work where you will be appreciated for the work you do, call Best Deal Auto Sales. We offer great pay, up to (4) weeks paid vacation. Monthly bonuses. Call: 260-357-0099 ext. 107 Ask for Dave

Bored?

Crooked Lake House rental, $900/mo. Occupancy Sept. 15 June 15. 4 BR, 3.5 BA, (260) 573-9512

AT YOUR SERVICE CLOCK REPAIR

HOME IMPROVEMENT

Clock Repairs all types mantle & wall clocks Free Estimates 260 242-5266

All Phase Remodeling and Handyman Service - No Job too Big or Small !!! Free Estimates

BUSINESS & PROFESSIONAL BANKRUPTCY FREE CONSULTATION

$25.00 TO START Payment Plans, Chapter 13 No Money down. Filing fee not included. Sat. & Eve. Appts. Avail. Call

Call Jeff 260-854-9071 Qualified & Insured Serving You Since 1990

ROOFING/SIDING

Collect: 260-424-0954

County Line Roofing

act as a debt relief agency under the BK code

FREE ESTIMATES Tear offs, wind damage & reroofs. Call (260)627-0017

QUICK CASH Peddle your wheels in a flash - invest in an Auto Ad that reaches 112,000 potential buyers!

THE NEWS SUN The

S Star

HERALD REPUBLICAN THE

1-877-791-7877 kpcnews.com

Garrett Land contract, 4 BR Handyman special, $500/mo. 615-2709

Restaurants

Shady Nook 10170 E 600 S Big Long Lake

MOBILE HOMES FOR RENT

is hiring for the following positions -

Servers, Cook, Dishwashers & Bartender.

Wolcottville 2 & 3 BR from $100/wk also LaOtto location. 574-202-2181

Please apply in person after 3 PM.

MERCHANDISE BLACK HAIR STYLING CHAIR & DRYING CHAIR. LIKE NEW. 260 636-7550

HS Diploma or GED Required Apply GKB Head Start

504 South Second St., Garrett ❖❖❖❖❖❖❖❖❖

Drivers CLASS A-CDL -Minimum 2 years experience. Clean MVR. Good Pay/Benefits. Home nightly. No touch freight. FT Days & Nights. For Fort Wayne/Butler locations, call Jim @ 800-621-1478, ext. 131 or apply online at: fabexpress.com. (A)

SETSER TRANSPORT AND TOWING USED TIRES Cash for Junk Cars! 701 Krueger St., K’ville. 260-318-5555 ATTENTION: Paying up to $530 for scrap cars. Call me 318-2571

(260) 238-4787

FURNITURE

2007 Cadillac DTS pearl white 48,000 miles, luxury 2 package, new Michelin tires, tinted windows and pin strips. $16,500 260-705-9971

HOMES FOR SALE All real estate advertising in this newspaper is subject to the Fair Housing Act which makes it illegal to advertise "any preference limitation or discrimination based on race, color, religion, sex, handicap, familial status, or national origin, or an intention, to make any such preference, limitation or discrimination." Familial status includes children under the age of 18 living with parents or legal custodians; pregnant women and people securing custody of children under 18. This newspaper will not knowingly accept any advertising for real estate which is in violation of the law. Our readers are hereby informed that all dwellings advertised in this newspaper are available on an equal opportunity basis. To complain of discrimination call HUD Toll-free at 1-800-669-9777. The toll-free telephone number for the hearing impaired is 1-800-927-9275.

Drivers DRIVER TRAINEES NEEDED NOW at Stevens Transport! New drivers earn $750 per week. No CDL? No Problem! CDL & Job Ready in 15 days. 1-877-649-9611 Drivers GORDON TRUCKING CDL-A Drivers Needed! Up to $4,000 Sign On Bonus! Starting Pay Up to .46 cpm. Full Benefits, Excellent Hometime, No East Coast. Call 7 days/wk! TeamGTI.com 888-757-2003

USDA 100% Government Loans!--Not just for 1st time buyers! All credit considered! Low rates! Buy any home anywhere for sale by owner or realtor. Academy Mortgage Corporation, 11119 Lima Road, Fort Wayne, IN 46818. Call Nick at 260-494-1111. NLMS146802. Some restrictions may apply. Equal Housing Lender. Se Habla Espanol. (A)

APARTMENT RENTAL

MOBILE HOMES FOR SALE

Sunny Summer Savings

Mobile Homes for Sale in Waterloo, Rome City & Butler. Small parks. No big dogs. Ref req’d. (260) 925-1716

• FREE Heat & Hot Softened Water • Low Security Deposits* • Pet-Friendly Community* • On-site Management & Maintenance Staff

Steuben County 1988 14x70 Mobile home. 3 BR, 2 BA on a one acre lot. Small shed & beautiful pine tree landscaping. Near Prairie Heights School. $45,000 firm. 260-829-6697

*Restrictions apply

CALL TARA TODAY! NELSON ESTATES 260-349-0996 1815 Raleigh Ave., Kendallville 46755 nelsonestates@mrdapartments.com mrdapartments.com

Sudoku Answers 8-12 4

9

1

5

7

8

2

3

6

5

6

7

2

3

1

4

9

8

8

3

2

4

6

9

5

1

7

9

5

6

1

2

4

7

8

3

7

1

8

6

5

3

9

4

2

3

2

4

9

8

7

1

6

5

2

7

9

8

4

6

3

5

1

6

4

3

7

1

5

8

2

9

1

8

5

3

9

2

6

7

4

FRUIT & PRODUCE Wysong Blueberries GREAT picking! M, W, Th, & Sat. -7:00 AM-noon & M, W, Th 4:30 - 7:30 PM Already picked berries 1 mi. E of Wawaka on US 6. 260-760-6982

SPORTING GOODS

Junk Auto Buyer

up to $1000.00

CARS

2005 G6 V-6 (3500) 130,000 miles 2 owners power windows, locks, mirrors, cruise, tilt, cold air, am/fm/cd player, sunroof and alum. wheels. Deep Red Asking $5900 call: 260-460-7729 1965 Mustang luxury pony interior, 200-6 cyl. auto, possible 46,000 mi. $10,500. 260 920-4362 1 & Only Place To Call--to get rid of that junk car, truck or van!! Cash on the spot! Free towing. Call 260-745-8888. (A) Guaranteed Top Dollar For Junk Cars, Trucks & Vans. Call Jack 260-466-8689

8-ft oak, slate Steepleton pool table-balls, cues, cover. $1200 Buyer moves! 260-463-5267 GUN SHOW!! Greenfield, IN – August 17th & 18th, Hancock County Fairgrounds, 620 North Apple Street, Sat. 9-5, Sun. 9-3 For information call 765-993-8942 Buy! Sell! Trade!

WANTED TO BUY TIMBER WANTED All species of hard wood. Pay before starting. Walnut needed.

SUV’S 1999 Jeep Grand Cherokee Larado 4x4. Fully serviced, new brakes on front & rear, 4.0 Litre inline 6 cyl., good tires, battery tested good, no rust, Burgundy in color, factory Alloy wheels, CD/cassette player, factory power moon roof, Navigation system, cold A/C, Keyless entry, luggage rack, gauge package, tilt/cruise, P.W., P.D.L., 118K miles, has been well maintained, very good cond. $4,900/OBO (260) 349-1324 May see at 720 1/2 Arcadia Court, Friendly Village, Kendallville.

260 349-2685

VANS PETS/ANIMALS AKC Yorkie Puppies born June 14, will top out at 10 lbs. 2 Females- $500/each 419-212-4466 FREE: Barn kittens 260-570-5797 FREE: Kittens Small & med. all colors & varieties. 260 242-1992 FREE: To good homePom/Spitz white female 7 years old, current on shots. 260 350-1113 FREE: To good home8 yr. old male cat; neutered & declawed. Moving and can’t take with. 260 350-8084

Music Maker Instrument, stand, case & music. New, $35.00. (260) 488-6225

20” Bicycle $20.00 (260) 235-2036 20+ Collectable Dolls plus 2 display cases. Bisque head. $50.00. (260) 833-4114

4 Drawer Metal File Cabinet. Perfect cond. except little rust on top. $20.00. (260) 570-8994

Sacrifice!! vinyl picket fence, approx. 168 ft. 3ft. tall, $550.00 260 920-4362

PIONEER POLE BUILDINGS Free Estimates Licensed and Insured 2x6 Trusses 45 year Warranted Galvalume Steel 19 Colors Since 1976 #1 in Michigan Call Today 1-800-292-0679

2 Table Lamps Brass w/Ecru shades. Weighted bases. $50.00 for both. (260) 925-3403

$ WANTED $ Junk Cars! Highest prices pd. Free pickup. 260-705-7610 705-7630

IVAN’S TOWING

QUEEN PILLOWTOP MATTRESS SET Can deliver, $125. (260) 493-0805

MERCHANDISE UNDER $50

26” 3 speed Pro American mens bicycle. Asking $30.00 obo. Purchased in 1974. (260) 925-0268

Electric Pallet Lift $125.00 260 242-6631

Brand NEW in plastic!

MERCHANDISE UNDER $50

AUTOMOTIVE/ SERVICES

BUILDING MATERIALS

❖❖❖❖❖❖❖❖❖ Teacher Aid

Check out Happenings in Friday’s newspaper!

Avilla 2567 N 750 E Thurs. - Sat. • 7 - 6 Largest Ever Antiques, toys, action figures, jewelry, (lots) tools, hardware, pictures, paintings, lots of $1.00 items. *Setting up Tues. & Wed.* Lookers Welcome

Avilla 1 BR, W/D, AC, very nice cond. $450/mo. + dep. 260 349-5169

■ ❏ ■ ❏ ■

■ ❏ ■ ❏ ■

GARAGE SALES

HOMES FOR RENT

EOE

The Bull Pen Cafe in Fremont, IN Must be able to work nights and weekends. No phone calls, please.

Housekeeper

CNC LATHE & MILL OPERATORS

Excellent working conditions.

Call today to schedule a Tour! 260-668-4415 199 Northcrest Road Angola, IN 46703 PETS WELCOME!

Town of Hamilton

General

Must be able to set up and operate. Check parts & maintain quality.

FREE HEAT, WATER, SEWER & TRASH RESIDENTS PAY ELECTRIC ONLY LOW RENTAL RATES

•BSW Part Time

2879 S. Lima Rd. Kendallville, IN 46755

Apply at:

Call or Text Bob (260) 403-7676

■■■■■■■■■■■■■

■ ❏ ■ ❏ ■

CROSSWAIT ESTATES

■ ✦ ■ ✦ ■ Healthcare

General

CDL-A & Potato Truck Drivers

A New Apartment Home Awaits You at

Contact Angie Smith Dir. of Nursing 260-897-2841 for an interview.

1433 S. Main Street Kendallville, IN

■ ◆ ■ ◆ ■

General

✦ ✧ ✦ ✧ ✦ ✧ Health

CULINARY ARTS INSTRUCTIONAL ASST/DELI MGR

STUFF

Forge Industrial Staffing will hold a job fair at Metal Technologies, Auburn, Indiana on Saturday, August 17th from 2 PM to 6 PM.

APARTMENT RENTAL

WHEELS

Health Care

General

EMPLOYMENT

HOMES

General

EMPLOYMENT

GARAGE SALES

EMPLOYMENT

RENTALS

EMPLOYMENT

MONDAY, AUGUST 12, 2013

1999 Mercury Villager Sport, 155,500 mi.. $1,800/obo 260 927-8775

MOTORCYCLES 2006 Yamaha Roadstar Silverado. 1,700 cc, 102 cu. in., windshield, bags 16,500/mi. $6,200/OBO 574-849-6195

2007 Road King Classic Harley Davidson FLHRC, 96 cu. in. 1584 cc, 6 speed trans, extra chrome, custom exhaust, custom seat, loaded. Only 15,109 miles. Over $26,000 invested. For Sale $16,500/obo

5x8 gray & black Oval Braided Rug. Indoor/outdoor. Heavy duty. $50.00. (260) 243-8070 70 yr. old heavy wood desk, small adult size. $25.00. (260) 570-8994 Approx. 45’ 3 legged TV antenna with yard light. $50.00 obo. Leave message, (517) 369-1014 Bed Frame $20.00 (260) 235-2036 California Ivy hand painted Poppytrail China pieces (6). $50.00. (260) 347-5840 Coffee Table 23”x66”x16” high. Marble inlays at both ends. Sliding door in center. $50.00. (260) 925-3403

Occasional Table 19” octagonal w/marble inlay top. 21” tall. Opens to 16” high storage. $35.00. (260) 925-3403 Occasional Table 26"sq.x20” tall. Marble inlay top. 6” deep drawer. $30.00. (260) 925-3403 Occasional Table 36”x13” w/marble inlay top. Opens for storage, 2 shelves. $35.00. (260) 925-3403 Patio Table 30”x60”, 6 chairs with cushions, weathered gray. $50.00. (260) 488-6225 Pfaltzgraff China 16 pc. service for 4 blue flowers, green stems & yellow trim on white. Like new, $10.00. (260) 833-4114 Queen Size Bed with metal frame. $50.00. (260) 243-8300 Recumbent Exercise Bike, monitors heart rate. Was $299 new, Asking $25.00. (260) 570-8994 Texas Instrument T1-82 graphing calculator for graphing out mathe matical & scientific problems. $35.00. (260) 281-2889 Two Drawer Metal File Cabinet. $20.00. (260) 235-2036

Coffee Table 24”x48” with 5 glass inserts. Pecan wood, new cond. $50.00. (260) 488-6225

Vintage 5’ galvanized chicken feeder. Full of blooming annuals. Must see. $50.00. (260) 243-8070

Computer Work Center by Sauder. Mission style, 43” desk top, attached 42” tower/file drawer, $35.00. (260) 925-3403

Wine Bottles. Cork style. Size 750 ml. Clear & colored. Case of 12 for $5.00. (260) 281-2889

Conn Organ, works. $30.00 260 920-4362 Dell Dimension Computer with disk & monitor, mouse, keyboard. Stuck in safe mode. $50.00. (260) 347-0851 Fisher Price Kick & Play Takes 1 D battery & 3 AA batteries. Batteries included. Unit vibrates & has flashing lights w/music. Everything cleaned. $25.00 obo. (260) 582-9458 Full Size Bed with metal frame. $10.00. (260) 243-8300 Full Size Bicycle $30.00 (260) 927-1780 Full Size Bicycle $35.00 (260) 235-2036 Galvanized Bucket with huge Boston Fern. On old pulley hook. Al for $25.00. (260) 243-8070 Galvanized tub with ornamental grasses. $25.00. (260) 243-8070 Girls 24” Bike $20.00 (260) 544-4196

KPC LIMITATIONS LIMITATIONS OF LIABILITY: KPC assumes no liability or financial responsibility for typographical errors or for omission of copy, failure to publish or failure to deliver ad vertising. Our liability for copy errors is limited to your actual charge for the first day & one incorrect day after the ad runs. You must promptly notify KPC of any error on first publication. Claims for adjustment must be made within 30 days of publication and, in the case of multiple runs, claims are allowed for first publication only. KPC is not responsible for and you agree to make no claim for specific or consequential damages resulting from or related in any manner to any error, omission, or failure to publish or deliver.

AGRIBUSINESS • Every Saturday find out the latest news of the farming industry in your local daily newspaper.

Golf Clubs, Wilson bag & cart, $25. (260) 570-8994 Hand Winch $30.00 (260) 235-2036

SWINE

Household Dishes 44 pc. Service for 8 Dishwasher Safe, micro safe oven to table stoneware. Country Garden pattern. $20.00. (260) 833-4114 Kids Football Cleats by Adidas, size 1 1/2. $10.00. (260) 347-1953

GRAIN

Kids Football Cleats by Nike, size 2. $15.00. (260) 347-1953 Knee Roller $50.00 (260) 665-6673 Lamp Set 28” high, black/gold oriental glass. $30.00. (260) 488-6225

DAIRY

Longaberger American Holly large serving bowl, $35.00. Call/text, (260) 515-3468

260 449-9277

Longaberger Pottery 2 qt. & 1 qt. pitchers. Heritage green. $50.00 total. Call/text, (260) 515-3468

MERCHANDISE UNDER $50

Longaberger Pottery Oval divided serving dish, heritage green, $30.00. Call or text, (260) 515-3468

1 pr. Mens Reebok Football Shoes. Very good cond. Worn 1 season. Size 10 1/2. $20.00. (260) 349-9282

Longaberger Pottery Pillar candle holder, heritage green, $15.00. Call/text (260) 515-3468

FARM The

Star

THE NEWS SUN

HERALD REPUBLICAN THE

Call

1-800-717-4679 today to begin home delivery!


The Herald Republican – August 12, 2013