Issuu on Google+

).3)$%4()3)335%

darlington ĺ?Š's you

"USINESS0ROFESSIONAL " #LASSIFIEDS " #OMMUNITY#ALENDAR!  $INING%NTERTAINMENT" &IND)T)N&ORT7AYNE !  9OUTH ! (EALTHY4IMES" "RIDGINGTHE'AP ! 

3ERVING.ORTHEAST&ORT7AYNE!LLEN#OUNTY

SO JOIN OUR TEXT CLUB! TEXT HOLIDAY TO 46862!

WWW&7$AILY.EWSCOM

.OVEMBER 

!WINDOWTOTHEPAST 1RVWDOJLDEULQJVEDFNORQJWLPH)RUW:D\QHWUDGLWLRQ

"Y6ALERIE'OUGH VGOUGH KPCNEWSNET

The first time Steve Wesner saw a holiday lighting display in downtown Fort Wayne, he was just a boy standing among a crowd of thousands outside the Wolf & Dessauer department store. Each year, a winter wonderland took over the storefront, a magical, moving spectacle depicting everything good about the Christmas season. People traveled from all over the region to see its big reveal. “It was just extremely fascinating and the crowd would be heavy. You had to wait and work your way up to the front of the line to get up to the windows. People would be standing there as deep as the sidewalk was wide,� Wesner recalled. Years later, he would stand waiting in similar lines as his own children marveled at the sight. Wolf & Dessauer’s display was a first-rate means to attract shoppers and lure them through its doors. But nothing lasts forever — eventually the lavish window displays were discontinued after the retailer was purchased by L.S. Ayers. For many, those department store windows are thought of as a beloved childhood memory. But over the past several years, a sort of revival has taken place to

#OURTESYPHOTO

+ATHY*AMES EVENTPLANNERANDDECORATORAT#ORNER(OUSE#REATIONS DRESSESANANIMATED3ANTA#LAUS FIGUREINPREPARATIONFORTHE%MBASSY4HEATRES#HRISTMASWINDOWREVEALATTHEOLD)NDIANA(OTEL restore the tradition so a new generation Festival of Trees, an eight-day festival at can make similar memories in Fort Wayne. the historic Embassy Theatre and old “I really wanted to see something that Indiana Hotel. But in 2008, James said she happened years ago at Wolf & Dessauer,� begged Dana Berkes, marketing director at said Kathy James, event planner and decoEmbassy Theatre, for a chance to pay rator at Corner House Creations. For years, homage to the former department store she has taken part in decorating the tradition.

“We are of that era. We’re old enough to remember Wolf & Dessauer’s windows,â€? James said. Since most Festival of Trees guests used street or garage parking off Harrison, they walked right by the old Indiana Hotel on their way to Embassy Theatre. James saw an opportunity. “There was nothing that would make you want to come to those windows. So I just said, let me do this ‌ What I was thinking, I don’t know,â€? she said, laughing. Since then, she and her husband, David, have brought the windows to life, revealing them to the public each year during the Night of Lights. The event draws thousands to downtown Fort Wayne to watch various lighting displays turn on for the holiday season, including the former Wolf & Dessauer Santa and his reindeer, and Merry Christmas wreath displays. The James’ window designs were first inspired by a storybook Christmas tree at the Embassy’s Festival of Trees. “Our windows are a story line,â€? David said. “When you go to the big cities, each window is a story in itself. But this is like reading a chapter book. Each window tells you a little piece of that story.â€? Kathy and David have worked with local -iiĂŠWINDOW, ÂŤ>}iĂŠĂ“

-ĂŒĂ•vvĂŠ>ĂŠ Ă•ĂƒĂŠiĂ›iÂ˜ĂŒĂŠ Vœ“ˆ˜}ĂŠĂŒÂœĂŠiÂœĂ€}iĂŒÂœĂœÂ˜ "Y.ICHOLE(ACHA 4HOMAS NTHOMAS KPCNEWSNET

#OURTESYPHOTO

!SERVICEMEMBERHUGSHISFAMILYAFTERCOMINGHOMEFORTHEHOLIDAYS4WOLOCALSERVICEMEMBERSWILL GETTOSPENDTHEHOLIDAYSINTHECOMFORTOFHOMEWITHTHEh(OMEFORTHE(OLIDAYSvCONTESTSPONSORED BY&ORT7AYNE)NTERNATIONAL!IRPORT THE'REATER&ORT7AYNE#HAMBEROF#OMMERCEAND7!*)-AGIC 

ÂœÂ˜ĂŒiĂƒĂŒĂŠLĂ€ÂˆÂ˜}ĂƒĂŠÂ“ÂˆÂ?ÂˆĂŒ>ÀÞÊ “i“LiĂ€ĂƒĂŠÂ…ÂœÂ“iĂŠvÂœĂ€ĂŠĂŒÂ…iĂŠÂ…ÂœÂ?ˆ`>ĂžĂƒ winners of “Home for the Holidays,â€? a contest sponsored by Fort Wayne International Airport, the Greater Fort Wayne Chamber of Commerce and WAJI Magic 95.1.

Those with a loved one on active military duty are encouraged to submit their story, in 300 words or less, explaining why -iiĂŠHOME, ÂŤ>}iĂŠx

ĂŽĂŽĂ¤ĂˆĂŠ˜`iÂŤi˜`i˜ViĂŠ À°]ĂŠÂœĂ€ĂŒĂŠ7>ĂžÂ˜i]ĂŠ ĂŠ{Ăˆnän

Times Community Publications

In a matter of weeks, two local members of the U.S. military will board a plane and begin their journey home for the holidays. The free service is provided annually for

For the past 17 years, WLDE has held its Stuff a Bus event each November. But instead of packing the big, yellow bus with children and sending them off to school, the radio station, its partners and the community will fill four buses with food to be delivered to needy families in the area this holiday season. The 2012 drive is set for Nov. 19-21 with the radio station broadcasting live from Georgetown Square Shopping Center. The first Stuff A Bus drove into the shopping center more than a decade ago. Maureen Partee, with Georgetown Leasing, said the pairing has worked well. “It really has been a perfect fit. Georgetown tries to do different community outreach things and this goes right along with that,â€? Partee said. The event, which collected more than 18,000 pounds of food during the 2011 drive, expanded its drop-off locations to four sites two years ago with hopes of collecting even more food this year. The 2012 sites include: • Georgetown Square, • Rustic Hutch and Travel Leaders on Coldwater Road, • Jefferson Pointe, and • Midwest America Federal Credit Union on Bluffton Road. The public is asked to bring non-perishable food items and personal and household products. The food will be donated to Associated Churches, which runs 30 neighborhood food pantries. The household and personal goods will be donated to the Franciscan Center to be used in several of its outreach programs.

#OURTESYPHOTO

!BUSSITSSTUFFEDWITHFOODANDPERSONALITEMS DURING7,$%S3TUFF!"USEVENT4HEEVENT WILLBEHELD.OV  ATFOURAREALOCATIONS Both faith-based organizations will use the items collected to help their clients, Partee said. Partee said Georgetown is happy to play a part in the community service project. The bus sets up near the corner of East State Street and Maplecrest Road and the community does the rest. Partee said the disc jockeys are broadcasting live from inside the bus, which gets more packed as times goes by. “It gets very funny to watch after things start piling up and when they start -iiĂŠBUS, ÂŤ>}iĂŠÂŁĂ“


-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

! UĂŠ WWW&7$AILY.EWSCOM

WINDOW vĂ€ÂœÂ“ĂŠÂŤ>}iĂŠĂŠÂŁ sculptor and illustrator Don Johnson to create “Oscarâ€? the elf, a character who appears each year in the story line. Johnson illustrates the story and meticulously sculpts the characters before animator Dennis Baker works to mechanize their movements. Kathy describes Johnson as a perfectionist, something she thinks stems from his previous

work as a pattern maker. “I always tell him, ‘Don, you’re too picky,’� she said. Creating the display is a year-round effort, beginning just after the new year. Once the team of volunteers has settled on a story line, they then sculpt, animate and dress the characters from a workshop. Elements then are installed in the storefront a little bit

at a time. “What I do is make sure it will fit into the dimensional confines of the space. I have to work on it (in my shop) before it goes into fine assembly in the window,� David said. There are just 14 inches of work space to move around in once the team begins setting up window scenes at the hotel. “We are constantly changing

#OURTESYPHOTO

4HISSPOSTCARDDRAWINGOF7OLF$ESSAUERDEPARTMENTSTOREBRINGSBACKMEMORIESFORMANY&ORT 7AYNERESIDENTSWHOUSEDTOINCLUDEITS#HRISTMASLIGHTINGANDWINDOWDISPLAYSAMONGTHEIRANNUAL HOLIDAYTRADITIONS how we do things. It has been a learning process,� he said. They have come a long way: In their first year, the husband and wife team used mechanisms from toys to animate window figures. At the time, they didn’t realize once the figures were installed in the display, freezing temperatures would cause their movements to slow down. But Baker, the son of a family friend, came to the rescue in 2009 with

pneumatics, or air-powered animatronics, which are unaffected when temperatures plummet. The display also improves each year as Johnson adds more handmade figures to its cast of characters, which will eventually give the windows a more unified look and feel, Kathy said. And with every story line, the community becomes more familiar with Oscar the elf and his haphazard holiday adventures. This year, a misunder-

standing with sleepy Santa Claus will send Oscar the elf on a wild goose chase to find a “whatchamacallit,â€? all the while running into colorful characters along the way. The window’s official reveal is scheduled for 7:15 p.m. Wednesday, Nov. 21, during the Night of Lights. David said he hopes what they’re doing will keep a “threadâ€? of tradition -iiĂŠWINDOW, ÂŤ>}iĂŠĂŽ

We Are Expanding ĂŒÂœĂŠ>``ĂŠVÂ?>ĂƒĂƒiĂƒĂŠ>˜` }Ă€ÂœĂ•ÂŤĂŠÂŤiĂ€ĂƒÂœÂ˜>Â? ĂŒĂ€>ˆ˜ˆ˜}t

Â…>˜}iĂŠvÂœĂ€ĂŠĂŒÂ…iĂŠLiĂŒĂŒiĂ€t

Â…>˜}i vÂœĂ€ ĂŒÂ…i LiĂŒĂŒiĂ€t

3TARTINGAT

$

NOW OFFERING:

Available at all locations! UNLIMITED TANNING

**

**24hr Gym access only. All other ammenities available during staffed hours. Hours subject to change.

9

*

95 2for1 PERMONTH

Month-to-Month * See club for details.

Must present at time of signing. Any plan. See club for details. Expires 12/14/12.

7 DAY FREE ALL ACCESS GROUP CLASS

PASS

iĂœĂŠ*>Ă€ĂŒÂˆVÂˆÂŤ>Â˜ĂŒĂƒĂŠÂœÂ˜Â?Þ° Including Group Personal Training, Zumba, Cycling and Les Mills.

Join our VIP Club! •TTe Text xt “MAXFITâ€? to 90210 for News & Updates 7245 Maplecrest Rd.

NE (260) 969-0575

9914 Illinois Rd.

1415 W. Dupont Rd.

SW (260) 755-6761

NW (260) 755-2216

www.maxfitnessftw.com

Enrollment! Any plan.

Must present at time of signing. See club for details. Expires 12/14/12.

Programming Now Available!


-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

WWW&7$AILY.EWSCOM UĂŠĂŠ!

#OURTESYPHOTO

3CULPTORANDILLUSTRATOR$ON*OHNSONHASMADENUMEROUSFIGURESTO DEMONSTRATETHEADVENTURESOFh/SCARvTHEELFIN%MBASSY 4HEATRES#HRISTMASWINDOWDISPLAYSATTHEOLD)NDIANA(OTEL

WINDOW

vĂ€ÂœÂ“ĂŠÂŤ>}iĂŠĂŠĂ“

going in Âş o/Â…iĂŠÂœÂ?`iĂ€ĂŠĂžÂœĂ•ĂŠ}iĂŒ] one, Fort except ĂŒÂ…iĂŠÂ“ÂœĂ€iĂŠÂ˜ÂœĂƒĂŒ>Â?}ˆ> Wayne, last year and thinks because “i>Â˜ĂƒĂŠĂŒÂœĂŠĂžÂœĂ•Â°ĂŠĂŠ`ÂœÂ˜Â˝ĂŒ they may that with the help of Ăœ>Â˜ĂŒĂŠĂŒÂœĂŠĂƒiiĂŠ>Â˜ĂžĂŠÂœvĂŠĂŒÂ…>ĂŒ have sponsors, been the Â˜ÂœĂƒĂŒ>Â?}ˆ>ĂŠ}iĂŒĂŠÂ?ÂœĂƒĂŒÂ°Âť sick. windows “You could know, the 3TEVE7ESNER become older you more get the spectacmore ular every nostalgia year. means to you. I don’t But for the thousands of want to see any of that children who have gazed nostalgia get lost. I think in awe at those Embassy the kids today — even windows on the Night of though they have the Lights, it already is speciPad, all these game tacular. Just ask Wesner, devices, and everything who has been to them all else — think some of ‌ well, almost. this old stuff is “The window displays intriguing. They still find at the Embassy draw an these window displays incredible number of interesting.â€? people. I think they do an excellent job,â€? he said. For a behind-the-scenes “We’ve taken the grandlook, click on this story at kids to just about every FWDailyNews.com.

YOU’LL BE AMONG FRIENDS. From independent living to nursing care, a retirement-living option to meet every need.

Call us today to set up your tour and free lunch at (260) 447-1591. Find us on:

www.lutheranlifevillages.org

s

LOCAL RESIDENTS ARE NOW PAIN FREE FROM NECK AND BACK PAIN, WITHOUT DRUGS OR SURGERY, AFTER USING A NEW ADVANCED TREATMENT... Spinal shots, pills & operations can be a pain in the neck and back. Now there is a new option for those suffering with neck and back pain. We are revolutionizing the treatment of neck and back problems with a combination of Non-Surgical Spinal Decompression Therapy with Cold Laser/Active Therapeutic Motion ATMŽ2 (over 600 cases) and a new treatment protocol we call Brain Based Therapy. The combination of these therapies can make all the difference in someone’s success from conditions like: chronic neck and back pain, spinal stenosis, herniated discs, radicular neuralgia (arm, hand or leg pain), sciatica, arthritis and even those who have failed back surgery.

This is why you might do something that you would think should not possibly have caused the level of pain it did. It was your BRAIN protecting you. Brain Based Therapy is a non-drug treatment to improve the brain. To help re-wire it, if you will, so it is not as perceptive to the pain. It’s time for you to find out if Non-Surgical Spinal Decompresion with Cold Laser/Active Therapeutic Motion (ATMŽ2) will be your pain solution. For 10 days only, $47 will get you all the services I normally charge new patients $257 for!

Call 260-482-2206 by November 30 anytime between the hours of 9:00 am and 5:00 pm Monday through Thursday to schedule your $47 consultation and exam.

Non-Surgical Spinal Decompression Therapy with Cold Laser/Active Therapeutic Motion ATMŽ2 gets good reviews from the American Journal of Pain Management that reports a positive relief rate when used on patients with herniated discs, some Are YOU next? Our office is called Chalfant Chiropractic Center of the leading causes of neck and back problems. and we are located at 5931 Stoney Creek Drive, across from Batteries Plus and next to But sometimes this amazing treatment isn’t enough Cork ’N Cleaver, Fort Wayne, IN 46825. if you’ve been in pain for a long time. And again, our phone number is 260-482-2206.

WHY??? Once you’ve been in pain for a while your body starts to take defensive measures to protect itself from further injury and pain. The brain starts to learn that an area of your body is weak and injured and takes precautionary measures. An “emergency line� in the nervous system is created so that when there is even an inkling of irritation to this weakened area, your body will start into its protection mode by tightening muscles, telling you that something is wrong by setting off the “PAIN ALARM�.

We have set a high standard in treating spinal related disorders. Our goal is to eliminate pain for our patients and restore quality of life. Our commiment to the treatment of spinal related injuries has lead to the facility combining cutting edge technology with chiropractic care and neurological rehabilitation. Our clinic consists of state-of-the-art equipment, testing and treatment programs for the best patient outcomes.

Visit us online: chalfantchiropractic.com


Bridging the Gap WWW&7$AILY.EWSCOM

!

-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

Ă€Âˆ`}iĂŠÂœÂŤi˜ˆ˜}ĂŠViÂ?iLĂ€>ĂŒi` After pulling together for decades to get the Maplecrest Road extension constructed, officials from Allen County and the cities of Fort Wayne and New Haven had to

wait a few more days for the weather to cooperate in order to celebrate the project’s completion. Three days after the new road opened to traffic, elected leaders

and residents gathered with scissors in hand at the intersection of Maplecrest and Nelson Road to cut the ceremonial ribbon. The celebration —

dubbed “Connecting Communities� — was to have preceded the opening of the road. But a mixture of sleet, rain and high winds on Tuesday forced officials

Fort Wayne’s Only

Green Dry Cleaners 'SJFOEMZUP:PV "/%0VS &OWJSPONFOU

to postpone the event until today. “The weather may have forced us to change our celebration plans,� Commissioner Linda Bloom told the audience, “but it wasn’t going to delay the motoring public from using this new road.� The Maplecrest extension represents the largest infrastructure project Allen County government has ever overseen, extending Maplecrest from Lake Avenue to Adams Center Road in New Haven. It features

construction of 1.5 miles of new four-lane roadway with curb, gutter and four new bridges. Also included are new storm sewers and a multi-use trail. The new highway is expected to help spur economic growth in the area. Total economic output from postconstruction private investment is projected to exceed $715 million over a period of 11 years, according to a 2008 analysis. -iiĂŠBRIDGE, ÂŤ>}iĂŠÂŁĂ“

• Biodegradable • Non-toxic • One Day Service EverGreen Dry Cleaning 6401 Georgetown North Blvd.

Same Location, New Green Process, Same Friendly Staff

20% Off

All Dry Cleaning

260-245-0198 Mon.-Fri. 7-7 • Sat. 9-3

#OURTESYPHOTO

Expires 12/9/12

4HREEDAYSAFTERTHENEWROADOPENEDTOTRAFFIC ELECTEDLEADERS ANDRESIDENTSGATHEREDWITHSCISSORSINHANDATTHEINTERSECTIONOF -APLECRESTAND.ELSON2OADTOCUTTHECER EMONIALRIBBON


-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

WWW&7$AILY.EWSCOM UĂŠĂŠ!

HOME vĂ€ÂœÂ“ĂŠÂŤ>}iĂŠĂŠÂŁ their service person should come home for the holidays. Two winners will be selected to receive one free, roundtrip ticket to FWA from any place in the world. Winners must be able to receive leave from duty to travel home between Dec. 1 and Jan. 31, 2013. In 2011, Navy Petty Officer 2nd Class

Matthew Art, who was stationed in Yokosuka, Japan, met his young daughter for the first time and married her mother during his visit home for the holidays. U.S. Army Pvt. Gregory Bolden also won a trip last year. In a letter to the Fort Wayne Airport Authority, his mother wrote, “Thank you for working so hard to bring

my son home for the holidays. You have made this a great holiday and I will always remember your kindness.� The deadline to submit entries is midnight Sunday, Nov. 25. To learn more about the contest, or to enter, go to waji.com. The winners will be announced live on WAJI Magic 95.1 on Friday, Nov. 30, 2012.

Voted Fort Wayne Reader’s Choice

#1 Thrift Store! #OMEINFORALLOFYOURHOLIDAYNEEDS s#HRISTMAS$ECOR s&URNITURE s(OUSEHOLD)TEMS s%LECTRONICS

s4OYS s*EWELRY!CCESSORIES s#LOTHINGFORALLAGES s3/-%4().'&/2%6%29/.%

$ONATIONSOFGENTLYUSEDITEMSACCEPTED

#(%#+/54/527%%+,930%#)!,3 6406 E. State Blvd., Fort Wayne, IN 46815 • 260-748-0672 GEORGETOWN SQUARE • www.renewupscaleresale.org

“Bridging the Gap�

$W*HRUJHWRZQH3ODFH\RX¡OOĂ€QGWKHIUHHGRPDQGVXSSRUWWRFUHDWHWKHOLIHVW\OH \RXGHVHUYH$ZDNHHDFKPRUQLQJWRDFRORUIXOSDOHWWHRISRVVLELOLWLHVIURPZKLFKWR SDLQW\RXUGD\(QMR\WKHPXWHGWRQHVRIVROLWXGHNQRZLQJIULHQGVDQGDQDWWHQWLYH VWDIIDUHFORVHE\-RLQLQRQWKHYLEUDQWWRQHVRIWKHUHFUHDWLRQDYDLODEOHZLWKLQ\RXU FRPPXQLW\'HOLJKWLQDGLQLQJSURJUDPWKDWZRUNVDURXQG\RXUVFKHGXOH'LVFRYHU D ZHDOWK RI IULHQGO\ QHLJKERUV DQG D VWDII ZKR ZLOO OLNHO\ FRPH WR IHHO OLNH \RXU H[WHQGHGIDPLO\ $W*HRUJHWRZQH3ODFH\RX¡OOĂ€QGWKHĂ H[LELOLW\DQGFKRLFHVWKDWPDNHLWSRVVLEOHWR SDLQW\RXUGD\VKRZHYHU\RX¡GOLNH ‡*HRUJHWRZQH3ODFHKDVUHVWDXUDQWVW\OHGLQLQJ IURPDPSPYou choose your own meal times. ‡$:DVKHUDQG'U\HULQHYHU\DSDUWPHQW ‡$FDULQJDQGORYLQJVWDII ‡5HVSLWHDSDUWPHQWVDYDLODEOH ‡%HGURRP%DWKFRWWDJHVDYDLODEOH ‡$QGDIIRUGDEOHDOOLQFOXVLYHUDWHV A Capital Senior Living Community

0DSOHFUHVW5G‡)RUW:D\QH,1  ‡ZZZJHRUJHWRZQHSODFHUHWLUHPHQWFRP


-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

! UĂŠ WWW&7$AILY.EWSCOM

Direct Mailed to 20,000 Homes & Businesses

In Southwest Allen County & Roanoke

Direct Mailed to 19,500 Homes & Businesses

In North & Northeast Fort Wayne & Allen County

the Ha sta pp ff o

A Division of KPC Media Group

m o r a f Hair Color p s S y starting at‌ n a o l d li Sa 00 $ o s n 35 i Adult Haircuts y H ogg $1500 N f Children’s Haircuts ccuts t Hi Lites starting at‌

$10000

$3000

 ĂŠĂ€iĂƒĂ•Â“iĂƒ i˜iĂ€}ÞÊ>ĂƒĂƒÂˆĂƒĂŒ>˜Vi Community Action of Northeast Indiana has begun making appointments for energy assistance for all of its

Good news for your neighborhood. /Â…iĂŠ iĂ?ĂŒĂŠĂƒĂƒĂ•io Nov. 16, 2012 Copy Due Nov. 8

Home of the h Direct Mailed & Rack Distribution to 12,000 Homes & Businesses

$600 Eyebrow

Serving Northwest Fort Wayne & Allen County

Proud to be offering Salon & Spa services at Affordable prices for 7 years!

Arch!

In New Haven & East Allen County

Direct Mailed & Rack Distribution to 21,000 Homes & Businesses

We are an Offical Toys for Tots drop site •N ov 5 - Dec 14

In East Fort Wayne & Allen County

The

Dec. 7, 2012 Copy Due Nov. 29

Serving Southwest Fort Wayne, Allen County & Roanoke

Dec. 14, 2012 Copy Due Dec. 6

Serving Northeast Fort Wayne & Allen County

Dec. 14, 2012 Direct Mailed & Rack Distribution to 80,000

In Allen County & Surrounding Area

www.TheTimesClipper.com

3231 St. Joe Center Rd., Riviera Plaza

(260) 485-8600

!PPOINTMENTS !CCEPTED 7ALK INS7ELCOME 'IFT#ERTIFICATES !VAILABLE

Copy Due Dec. 6

Serving New Haven & East Allen County

Our Staff: A Division of KPC Media Group Inc.

Lynn Sroufe i˜iĂ€>Â?ĂŠ>˜>}iĂ€ Â?ĂƒĂ€ÂœĂ•viJÂŽÂŤV˜iĂœĂƒÂ°Â˜iĂŒ

Lynette Donley

M-F 9AM-8PM • SAT 9AM-5PM

For Advertising Information Call 426-2640 www.TimesPubs.com • info@TimePubs.com

offices in Allen, DeKalb, LaGrange, Noble, Steuben and Whitley counties. The Energy Assistance Program helps pay a portion of a client’s heating bills during the winter months. Last year, CANI helped around 9,000 families with their utility bills. The program runs Nov. 5 through May 15. Applicants must meet specific income levels. At all locations, you must bring with you: • Documentation of all household gross income (payroll check stubs, letter from employer, award letters, unemployment income, veterans benefits; TANF; Social Security; pensions, etc.) for the past 12 months for everyone in the household 18 years of age and older. • Current heating and light bills at current residence. • Social Security numbers for everyone in the household. • Rental Lease or a completed landlord affidavit for all renters. • A wage-history statement is needed for anyone 18 and older who has not had income for the previous 12 months. To make an appointment, call CANI at 423-3546.

->Â?iĂƒĂŠ>˜>}iĂ€ Â?ĂžÂ˜iĂŒĂŒi`JÂŽÂŤV˜iĂœĂƒÂ°Â˜iĂŒ

Sasha Boehme

VVÂœĂ•Â˜ĂŒĂŠ Ă?iVĂ•ĂŒÂˆĂ›i

Mark Davis

VVÂœĂ•Â˜ĂŒĂŠ Ă?iVĂ•ĂŒÂˆĂ›i

Betsy Draper VVÂœĂ•Â˜ĂŒĂŠ Ă?iVĂ•ĂŒÂˆĂ›i

Maryann Ulmer VVÂœĂ•Â˜ĂŒĂŠ Ă?iVĂ•ĂŒÂˆĂ›i

Nichole Hacha-Thomas

`ÂˆĂŒÂœĂ€Ă‰i>ĂŒĂ•Ă€iĂŠ7Ă€ÂˆĂŒiĂ€ Â˜ĂŒÂ…ÂœÂ“>ĂƒJÂŽÂŤV˜iĂœĂƒÂ°Â˜iĂŒ

Valerie Gough "˜Â?ˆ˜iĂŠ `ÂˆĂŒÂœĂ€ Ă›}ÂœĂ•}Â…JÂŽÂŤV˜iĂœĂƒÂ°Â˜iĂŒ

Janeen Pierr Ă€>ÂŤÂ…ÂˆVĂƒ

Mary Schmitz Ă€>ÂŤÂ…ÂˆVĂƒ

Beth Welty

Ă€>ÂŤÂ…ÂˆVĂƒ

George O. Witwer *Ă•LÂ?ÂˆĂƒÂ…iÀÊ “iĂ€ÂˆĂŒĂ•Ăƒ

Terry Housholder *Ă€iĂƒÂˆ`iÂ˜ĂŒ]ĂŠ "ĂŠ

5JNFT$PNNVOJUZ1VCMJDBUJPOTBSF QVCMJDBUJPOTPG,1$.FEJB(SPVQ *OD Â "MMSJHIUTSFTFSWFE

3/UP#4/1SPHSBN '3&&UFYUCPPLSFOUBM VOUJM.BZ

Contact Us At: 3306 Independence Dr. Fort Wayne, In 46808 Phone: (260) 426-2640 Fax: (260) 426-2503 www.FWDailyNews.com

$PNQMFUFZPVSBQQMJDBUJPOBOEBMM FOSPMMNFOUSFRVJSFNFOUTCZOPPOPO %FDFNCFS BOECFFOUFSFE UPXJOBOJ1BE

IVBEVMUEFHSFFTDPN

PS


IN FORT WAYNE

Holiday Gift Center

-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

WWW&7$AILY.EWSCOM UĂŠĂŠ!

Âź ˆ}Â…ĂŒĂŠÂœvĂŠˆ}Â…ĂŒĂƒÂ˝ĂŠ> Ăƒi>ĂƒÂœÂ˜>Â?ĂŠĂƒÂŤiVĂŒ>VÂ?i Downtown Fort Wayne’s annual holiday lighting ceremony is set for Wednesday, Nov. 21, when thousands of people fill the sidewalks and streets to witness one of the city’s greatest Christmas spectacles. The Night of Lights includes five prominent holiday displays as they are lit up for the first time this holiday season. The event wraps up with a fireworks display at Parkview Field. Displays will be illuminated nightly through the New Year.

2012 Night of Lights schedule #OURTESYPHOTO$OWNTOWN)MPROVEMENT$ISTRICT

5:45 p.m. Aunt Millie’s Northern Lights (Pearl Street) 6 p.m. Community Center Santa’s Workshop display (Main Street) and History Center turret lighting (Barr Street) 6:15 p.m. Santa and his Reindeer at PNC with Mayor Tom Henry, Santa and special guests (Main and Berry streets) 6:45 p.m. Wells Fargo holiday display and Indiana Michigan Power Merry Christmas Wreath with a special performance by the Fort Wayne Children’s Choir (One Summit Square) 7:15 p.m. Botanical Conservatory and Embassy Theatre window lighting (Jefferson Street) 7:45 p.m. Parkview Field fireworks (Ewing Street)

3ANTAANDHISREINDEERMADETHEIRDEBUTONTHE7ASHINGTON"OULEVARDSIDEOF7OLF$ESSAUERDEPARTMENTSTOREON.OV

 ANDWASTHESECOND LARGESTDISPLAYOFITSKIND3ANT AANDHISREINDEERAREFEETLONGANDWEIGHTONS4HE DISPLAYUSESATOTALOF ,%$LIGHTBULBS

START A NEW HOLIDAY TRADITION. SATISFY SATISFY EVERYBODY. EVERYBODY. 6739 WEST JEFFERSON BLVD. 260-969-MOES OPEN 11AM - 9PM DAILY

MOES.COM Š2012 MOE’S FRANCHISOR LLC

#OURTESYPHOTO$OWNTOWN)MPROVEMENT$ISTRICT

4HOUSANDSOFPEOPLEGATHERTOWATCHTHE#HRISTMAS TREE DISPLAYLIGHTUPOVERTHEENCLOSEDSKY WALKAT#ALHOUNAND 7AYNESTREETS

WE E

E TO OOM O C LL

GET $5 IN MOE BUCKS

FOR EVERY $25

YOU SPEND ON GIFT CARDS.

#OURTESYPHOTO$OWNTOWN)MPROVEMENT$ISTRICT

4HE-ERRY#HRISTMASWREATHWASFIRSTDISPLAYEDINON THE#ALHOUN3TREETSIDEOFTHE7OLF$ESSAUERBUILDING 4HEWREATHISFEETINDIAMETER

Visit your local Moe’s for holiday catering details. We Deliver!


&IND)T)N&ORT7AYNE

! UĂŠ WWW&7$AILY.EWSCOM

-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

!73&ANTASYOF,IGHTS KICKSOFF.OV "Y.ICHOLE(ACHA 4HOMAS display a piece from “It’s A Wonderful Life,� featuring a bell theme. In addition, two famiThe annual Anthony lies of AWS have Wayne Services Foundasponsored displays, too. A tion’s Fantasy of Lights family, in memory of their will kick off the 2012 son Christopher who died season at 6 p.m. on Nov. nine years ago, will honor 21. In its 18th year, the his sense of humor with a festival will see four new lighted replica of the infadisplays added to the mous leg lamp from the AWS collection. BAE Systems has spon- movie, “A Christmas Story.� A fourth, surprise sored a new lighted Santa display will be lit in honor in flight — only he isn’t of a very special young on his sleigh. BAE’s lady, said Lynne Gilmore, Santa will be in an airplane dropping presents executive director of the AWS Foundation. from the air. Gilmore said the organMidwest America ization feels compelled to Federal Credit Union will

NTHOMAS KPCNEWSNET

SEASONS CLEANINGS Call now to receive your free no-obligation estimate.

260-489-2012

• Our products, equipment and processes www.MAIDS.com provide for an unmatched caliber of clean. • A 100% satisfaction guarantee. • A one-of-a-kind home cleaning plan, customized to your needs. • The Maids 22-Step Healthy TouchŽ Deep Cleaning System helps improve indoor air quality.

Referred for a reason

$25

OFF

the price of your first deep clean service www.MAIDS.com

host the lighted tradition not only for the money raised, but as a service to the community. “Part of our mission is community inclusion,â€? she said. “This event is intended to address that component of our mission.â€? The new displays will be added to current stock, which is chock full of family favorites — from Santa and his elves playing with the water faucet to Santa eating a Penn Station sub and Johnny Tincap playing -iiĂŠLIGHTS ÂŤ>}iĂŠ™

Expires 12/21/12.

Subscribe to our e-mail newsletter at SweetCars.com

Visit Facebook.com/SweetCars

Follow our blog at blog.SweetCars.com

your dream VEHICLE is SweetCars Signature Guarantees: I

We treat our clients as valued guests

I

Full-disclosure pricing — no hidden fees

2001

I

Amazing products & professional personnel

2011

FERRARI 360

MERCEDES-BENZ

Modena Spider Conv. Rosso Corsa

CLS Class Iridium Silver Metallic

Low Miles, High Speed! 6-speed Manual 3.6 liter V8 3.6-liter

Practically Brand-new! CLS550 4-dr Coupe 5.5-liter 5.5 liter V8 V8

2011 CHEVROLET Camaro Rally Yellow

American Icon! 426HP Automatic 6 2-liter 6.2-liter 6.2 li V8 Engine Eng gine

#OURTESYPHOTO

!VARIETYOFLIGHTSWILLBEONDISPLAYDUR INGTHETH ANNUAL!NTHONY7AYNE3ERVICES&OUNDATION&ANTASYOF ,IGHTS WHICHKICKSOFF.OVANDCONTINUESTHROUGH .EW9EARS%VE Hurry in, inventory subject to change

Our inventory moves fast! See our entire selection online at sweetcars.com.

We are ONE OF THE TOP 20 DETAILERS

NNOW OW AVAILABLE!

in the country

HolidaY

Whether you have a new auto or a rare classic, our customized detailing and maintenance services will make your vehicle show ready!

Gift Certificates CALL OR COME IN

The Perfect Gift for the Car Enthusiast in Your Life!

TOP-20

Hand application of appropriate sealant and wax

Detailers

Comprehensive engine cleaning and engine dressing Headliner vacuuming, hand cleaning, spot removal, and more!

We Have the Best

#OURTESYPHOTO

Come in or call us Today!

2404 West Jefferson Blvd. Fort Wayne, IN 46802  ot4XFFU$BSTDPN

STORE HOURS: Mon, Tues, Thurs: 9:00AM–7:30PM Wed, Fri: 9:00AM–6:00PM Sat: 9:00AM–4:00PM

3ANTAWAVESTOCARSASTHEYDRIVETHROUGHTHE!73&OUN DATION&ANTASYOF,IGHTS4HEANNUALDISPLAYFEATURES ORIGINALDESIGNSBYLOCALFAMILIESANDBUSINESSES&OUR NEWDISPLAYSWILLBEUNVEILEDTHISYEAR


&IND)T)N&ORT7AYNE

-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

WWW&7$AILY.EWSCOM UĂŠĂŠ!

ÂˆĂƒĂŒÂœĂ€ĂžĂŠ iÂ˜ĂŒiĂ€Â˝ĂƒĂŠĂ“Ă‡ĂŒÂ…ĂŠiĂƒĂŒÂˆĂ›>Â? ÂœvĂŠˆ˜}iĂ€LĂ€i>`ĂŠVœ“ˆ˜} 6SHFLDOHYHQWVDQQRXQFHG

-ETRO#REATIVE

The Festival of Gingerbread at the History Center, 302 E. Berry St., kicks off several special events on Nov. 21- with the Night of Lights. During the Night of Lights, visitors can get a sneak peek at the handiwork of creators from 5-9 p.m. Admission is only $2 per person at the door. At 6 p.m. the History Center’s turret will be lit with special holiday colors of red and green. Santa also will be present during the Night of Lights. A variety of special events will occur during the Festival of Gingerbread. Admission to the festival is $5 for adults, $3 for seniors ages 59 and over and students ages 3-18, and free to children age 2 and under. There is no extra charge for special activities or events unless indicated.

Special events include: • Saturday, Nov. 24, 1-3 p.m., Create Your Own Ornament. $1 plus regular museum admission. • Sunday, Nov. 25, 1-3 p.m., Make a Holiday Greeting Card. $1 plus regular museum admission. • Tuesday, Nov. 27, 5-9 p.m., free night sponsored by AEP Indiana-Michigan Power. • Saturday, Dec. 1, 1-3 p.m., visit with Santa Claus. • Sunday, Dec. 2, 1-3 p.m., Holiday Story Telling. • Saturday, Dec. 8, 1-4 p.m., Science of Sugary Structures sponsored by PNC Bank and Science Central. $3 plus regular museum admission. • Sunday, Dec. 9, 1-4 p.m., Cookie Decorating Party. $1 plus regular museum admission. Special holiday exhibits during the Festival include a Wolf and Dessauer display of animatronic characters, an exhibit of “A Christmas Carolâ€? watercolors that once adorned the Patterson Fletcher department store and a display of holiday photos from years past.

Imagine Your Special Someone Taking the Controls and Soaring Above the Clouds!

LIGHTS vĂ€ÂœÂ“ĂŠÂŤ>}iĂŠĂŠn baseball with the elves. The new displays, and those before them, have been commissioned by area families and businesses to reflect the sponsor. Each takes a few months to design and manufacture. This, Gilmore said, makes a trip through the Fantasy of Lights a unique experience every year. “The majority of our displays are original designs,â€? Gilmore said. That, she said, is one of the reasons more than 10,000 cars travel through Franke Park each year. “There’s nothing out there like the Fantasy of Lights.â€? Gilmore said AWS clients often stop out and help, whether collecting money from cars or wearing a Santa hat and waving at the cars as they enter. In addition to clients, several non-profit and service groups come out to assist the foundation with one of its largest fundraisers each year.

“We rely on volunteers to work every night during the display,� Gilmore said. “We are always looking for groups to help this year or people to sponsor displays in 2013.� Any group interested in assisting with the Fantasy of Lights can call Gilmore at 7446145. Long after the lighted displays are packed away — AWS stores and maintains each one in the offseason — the funds earned in the six-week span will help the foundation carry out the mission of Anthony Wayne Services — to assist infants, children and adults with intellectual and physical disabilities. The cost to enjoy the AWS Fantasy of Lights is just $5 per car, a cost Gilmore said has stayed constant in recent years. For more information, visit AWS Fantasy of Lights online at awsfantasyoflights.com

The Aspiring Pilot in Your Life! The Spouse Who Has Everything! That Special Someone Who’s Looking for a New Challenge!

SweetAviation Flight Training & Aircraft Rental — Smith Field Airport

With a personal flying lesson from Sweet Aviation!

Holiday Special INTRODUCTORY FLIGHT LESSON LESS SON Gift Certificates Available — Call Joel Pierce Today!

(260) 267–5505

O

SweetAviation.com

O

59

$

426 W. Ludwig Rd. Fort Wayne, IN


&IND)T)N&ORT7AYNE

! UĂŠ WWW&7$AILY.EWSCOM

-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

Get Focused

Avoid Fort Wayne traffic - your best eye care is closer than you think!

Offering comprehensive eye exams, contact lens fittings, detecting, monitoring and treating diseases of the eye. Grabill Eye Center features full optical services with a wide selection of eyeglass frames and contact lenses. We accept many insurances or take advantage of our affordable cash pay rates and glasses packages. After work/school appointments available.

FALL CONTACT LENS SPECIAL! Save BIG on some of our best lines of high-quality, ultra-breathable soft contacts! Final Price: $40 LESS than 1-800 and the big box stores PLUS receive a FREE full-sized bottle of solution (while supplies last) on all year’s supply orders!

Make sure to use your insurance benefits by year’s end!

¼šŽ>¼>Ž^z†^Ž>¸pw z†

CHUPP’S PIANOS WWW.CHUPPSPIANOS.COM

Pre-owned Steinway Model L Walnut $16,900

Pre-owned Yamaha Baby Grand Polished Ebony $7,900 Just in ~ Pre-owned Yamaha C7

Call Now: 260-484-9053 5328 Coldwater Road

6 ",-ĂŠ7 /

Y ou ’ ll L ove Ou r R at es, Too!

2.

34%

Northbrook Village 1403 W. Dupont Rd 407.0181

APR

Apply today and save!

Lutheran Health Plaza Time Corners 1314 Minnich Rd 6210 West Jefferson Blvd 493.6670 459.1443

1330 Directors Row 471.8336

FOR4HE7INTER7ONDERLAND3HOPPING%VENT AT'EORGETOWNE0LACE2ETIREMENTON

F[bcc\aZ

Auto loans as low as

6116 Trier Rd 486.8043

*Rate as of 10/25/12 and subject to change. Valid for terms up to 60 months on 2009 and newer models. Normal loan underwriting guidelines apply. Partners 1st active checking account, credit score of 720 or greater and minimum NADA value of $12,000 required. Please ask a Partners 1st representative for active checking account details.

Pianos starting as low as $895

%VENT

3ATURDAY $ECEMBER  AM PM "OOTHRENTALISh&REEvUPONAPPROVAL OFPRODUCTWITHADONATIONOFAGIFTOR CRAFTVALUEDATORMOREFORDOORPRIZES !LLTYPESOFCRAFTSSMALLRETAIL BUSINESSESAREINVITED ,IGHTREFRESHMENTSWILLBEPROVIDED

#ALL3HELLEY"ARKERAT  TODAY TO2360YOURSPACETODAY

'EORGETOWNE0LACE Independent & Assisted Living

-APLECREST2OADs   Fort Wayne, IN 46815 • A Capital Senior Living Community


-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

WWW&7$AILY.EWSCOM UĂŠĂŠ!

-iĂŒĂŒÂ?iĂ€ĂƒÂ˝ĂŠ Â…Ă€ÂˆĂƒĂŒÂ“>ĂƒĂŠÂŤÂ?>˜˜i` >ĂŒĂŠ-ĂœÂˆÂ˜Â˜iÞÊœ“iĂƒĂŒi>` The Settlers will decorate the historic Swinney Homestead, 1424 W. Jefferson Blvd., for the Christmas season. Guests are invited to celebrate the spirit of the season from Nov. 29 to Dec. 1 at 2 p.m. each day. Guests will be treated to refreshments

of syllabub, a traditional English dessert, a light buffet including homemade sweets, fruit, nuts, tea and coffee. Linda Huge will present a program on Victorian Christmas traditions and unique items will be available in the upstairs gift

shop. Tables of four are available and prepaid reservations are $15 per person. Reservations can be made at 489-7115. The charity event supports the maintenance and restoration of the city’s Swinney Homestead.

°"°ÊV œ“LĂŠÂœvviĂ€ĂƒĂŠ Â…ÂœÂ?ˆ`>ÞÊ}Ă€ÂˆivĂŠĂƒi“ˆ˜>Ă€ D.O. McComb & Sons Funeral Homes announced it will sponsor a community seminar, “Coping During the Holidays.â€? The memorial service, held at the D.O. McComb & Sons on Lake Avenue, will be presented by speaker Dar Richardson on Saturday, Nov. 17. Participants can choose from two sessions. Session one will

a loved one is extremely difficult. D.O. McComb offers this time to families to remember a lost loved one, participate in the candle-lighting ceremony by lighting a candle in their memory and offering families support in their grief. For further information on the seminar and to register, visit mccombandsons.com or call 426-9494.

be held from 1-2:30 p.m. and session two will be from 4-5:30 p.m. There is no charge for the seminar and reservations will be taken on a first-come, firstserved basis. The deadline is Nov. 7. Richardson, grief and loss counselor, will offer helpful suggestions to not only honor a loved one’s memory, but help us heal. Dealing with the death of

We don’t cut corners,

We clean them. ĂŒĂŠiÀÀÞÊ>ˆ`Ăƒ]ĂŠĂœiĂŠÂŽÂ˜ÂœĂœĂŠÂŤĂ€iVÂˆĂƒiÂ?Ăž]ʓiĂŒÂˆVĂ•Â?ÂœĂ•ĂƒÂ?Ăž]ĂŠÂˆÂ“Â“i`ˆ>ĂŒiÂ?Ăž]ĂŠ >Â?Ăœ>ĂžĂƒĂŠĂŒÂ…iĂŠÂŽÂˆÂ˜`ĂŠÂœvĂŠVÂ?i>Â˜ĂŠĂžÂœĂ•ĂŠÂ“i>Â˜Â°ĂŠ9ÂœĂ•ĂŠĂœÂˆÂ?Â?ĂŠĂ€iViÂˆĂ›iĂŠĂŒÂ…iĂŠÂ…Âˆ}Â…iĂƒĂŒĂŠ Â?iĂ›iÂ?ĂŠÂœvĂŠÂŤĂ€ÂœviĂƒĂƒÂˆÂœÂ˜>Â?ĂŠV>Ă€i°ÊĂ€ÂœÂ“ĂŠĂŒÂ…iĂŠVÂœÂ˜ĂƒĂ•Â?ĂŒ>ĂŒÂˆÂœÂ˜ĂŠĂŒÂœĂŠĂŒÂ…iĂŠiĂ?ÂŤiĂ€ĂŒĂŠ VÂ?i>˜ˆ˜}ĂŠ>˜`ĂŠĂŒÂ…iĂŠvÂœÂ?Â?ÂœĂœÂ‡Ă•ÂŤ]ĂŠLiĂŠVÂœÂ“ÂŤÂ?iĂŒiÂ?ĂžĂŠĂƒ>ĂŒÂˆĂƒwĂŠi`ĂŠiĂ›iĂ€ĂžĂŠĂƒĂŒiÂŤĂŠ ÂœvĂŠĂŒÂ…iĂŠĂœ>Þ°ÊĂ•>Ă€>Â˜ĂŒii`°

Ready for a professional clean? Call us today. merrymaids.com Fort Wayne

260-484-7920 rutter@mm444.com

$100 Off Take $50.00 off your initial cleaning when you pick up a weekly or bi-weekly cleaning service with Merry Maids, then take an additional $10.00 off your next 5 regular cleanings. Offer good through 12/31/12.

SilhouetteÂŽ Window Shadings and LuminetteÂŽ Privacy Sheers

VignetteÂŽ Modern Roman Shades

OR MORE WITH

Comfort and Joy, Now at a Savings.

qualifying purchases

Save September 15 — December 15 on select

window fashions.

way to ďŹ ll your home with the beauty and warmth of the season.

SAVE $100

*

Garden Homes Live the Carefree Lifestyle!



)DLUILHOG$YHQXH)RUW:D\QH,1 WINDOW COVERINGS Mon.-Thurs. 9-5, Fri. 9-12, Sat. 10-2

Ask about our newly reduced Garden Home rates! * Manufacturer’s rebate offer valid for qualifying purchases made 9/15/12 – 12/15/12. Ask a sales representative for information on qualifying purchases. All rebates will be issued in U.S. dollars, in the form of an American Express ŽPrepaid Reward Card. This rebate offer may not be combined with any other Hunter Douglas offer or promotion. Š 2012 Hunter Douglas. All rights reserved. All trademarks used herein are the property of their respective owners.

Garden Homes have been created for the independent resident who wants the freedom to come and go, but desires the amenities that accompany living in a specially designed community. In our Garden Homes, you’ll ďŹ nd maintenance-free living with a variety of oor plan options. Maintenance Free (Interior and Grounds)

MOST NEW WINDSHIELDS

MOST POWER WINDOW REGULATORS starting at

starting at

24 Hour Emergency Response System Transportation Services Utilities Included Full Kitchens and/or Restaurant Style Dining

Auto Glass & Window Tinting

Beauty/Barber Shop Installed

Installed

Must present coupon. One coupon per order. Expires 12/31/12

Must present coupon. One coupon per order. Expires 12/31/12

WINDOW TINT

HOME & OFFICE WINDOW TINTING

SPECIAL

1. Decrease Heat 2. Reduce Fading & Health Risks 3. Cuts Glare 4. Enjoy Energy Savings 5. Increase Safety 6. Enhance Appearance

OFF

7. It’s Fast & Easy! Two Door Cars Only

Any $300 Job

Legal limit 35%. Must present coupon. One coupon per order. Expires 12/31/12

Must present coupon. One coupon per order. Expires 12/31/12

Heritage Park GARDEN HOMES, ASSISTED LIVING APARMENTS, MOVING FORWARD REHABILITATION, AUGUSTE’S COTTAGE MEMORY CARE, SKILLED NURSING SERVICES, LONG TERM CARE, HOSPICE, RESPITE

Wide Variety of Activities Pets Welcome Accepting Veterans BeneďŹ ts and Long Term Care Insurance Full Continuum of Care including Assisted Living Apartments, Short Term Rehabilitation and Memory Care

7" IN-DASH TOUCH SCREEN DVD PLAYER

OFF 5214 Decatur Road

ALL AUDIO

only

Receive a free gift just for visiting!

Single Din unit (TView Brand) Detachable, widescreen, motorized. USB, SD & BlueTooth Ready

Boss • Planet Audio • Kicker Pioneer JVC • AutoTek MTX • Audio Pipe • Lanzar

Double Din unit (Legacy Brand)

Must present coupon. One coupon per order. Expires 12/31/12

Must present coupon. One coupon per order. Expires 12/31/12

Includes Back-up camera and video outputs.

ASCSeniorCare.com

2001 Hobson Rd. Fort Wayne, IN 46805

260-484-9557


-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

! UĂŠ WWW&7$AILY.EWSCOM

Are You Ready For Another Brutal Winter?

Snow is Just Around the Corner Is that your house below? The middle of winter ...snow covered, icy and slippery. Woodcrest has the remedy for the winter blues! Spacious Villas and Garden Apartments where snow shovels and salt are a thing of the past. We take care of all the maintenance and you get to enjoy the beautiful winter scenes and friendly atmosphere at Woodcrest of Decatur. Surrounded by lakes and woods, Woodcrest has a view perfect for you. Call 260-728-3989 and plan on stopping by for a quick tour. We know you’ll love Woodcrest and all your new friends!

ÂˆĂŒĂžĂŠĂƒiĂŒĂƒĂŠÂ?i>vĂŠÂŤÂˆVÂŽÂ‡Ă•ÂŤĂŠĂƒVÂ…i`Ă•Â?i &UHZVZLOOEHRXWGXULQJWKHPRQWKRI1RYHPEHU Leaf pick-up in all of Fort Wayne’s 355 neighborhoods began Oct. 22. The city’s street department collects leaves in two separate sweeps through each neighborhood through Dec. 7. Leaf collection can occur on any day of the designated collection week (see sidebar). The city asks that residents have leaves ready for pick-up by 7 a.m. on Monday of their neighborhood’s designated week. Crews cannot backtrack through neighborhoods. Leaf collection is provided at the street only. Leaves are to be raked to the curb or park strip in front of the residence or placed in biodegradable bags for collection.

#OURTESYPHOTO

4HECITYHASSETTHELEAFPICK UPSCHEDULE

BRIDGE vĂ€ÂœÂ“ĂŠÂŤ>}iĂŠĂŠ{

www .woodcrestofdecatur.com

The Maplecrest extension also is expected to provide a safer, more efficient route for motorists. The connection of area streets and roads to the new highway will alleviate

obstructions caused by two sets of high-volume rail lines and the Maumee River. Also, traffic congestion in the area is expected to be reduced. Approximately $31.4

million has been spent on the project — well under the engineer’s projected cost of close to $50 million. A final figure is not expected for several weeks.

BUS vĂ€ÂœÂ“ĂŠÂŤ>}iĂŠĂŠÂŁ pushing stuff on top of one another,â€? she said. The live broadcast brings a bit more excitement to the shopping center’s holiday hubbub. Patrons are interviewed on air, merchants are having contests to see whose patrons can rack up the most items and there’s a bus decorated with Christmas lights broadcasting at all hours of the day and night. “It is right before Thanksgiving when people are shopping and in the giving spirit,â€? Partee said. “Georgetown is buzzing and there is really a lot of energy. We feel fortunate to be a part of something like this.â€?

Stuff a what? 2,511 cubic ft. Average volume of a school bus

48 feet Average length of school bus

6 feet Average height of a school bus (inside)

35 feet Average width of a school bus seating 50 people

Since 1928

“Insurance that Insures� 260-468-2953 877-464-1044 Call today for a FREE quote. www.thorneinsuranceagency.com

Kevin Killen (NLU[

We Build

WEB SITES

Luke Rumple (NLU[

Matt Roberts (NLU[

426.2640

fwdailynews.DPN

Learn more about KPC Web Design & Hosting


Youth WWW&7$AILY.EWSCOM

-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

!

>ÂŽiĂŠ>ĂŠÂ?ÂœĂžvĂ•Â?ĂŠÂ˜ÂœÂˆĂƒi "Y'RACE(OUSHOLDER GRACEH KPCNEWSNET

Music is one of the most beautiful aspects of Christmas. The holidays’ musical bounty creates opportunities to broaden musical horizons — either as an appreciative audience member or as a musicmaker. For children who love to sing, the Fort Wayne Children’s Choir very possibly could become like a second family. Now in its 40th season, the FWCC is an afterschool arts program for 251 children ages 8-18 from diverse backgrounds. Allen, Adams, DeKalb, Huntington, Steuben, Wells and Whitley counties are represented. Artistic director Jonathan Busarow joined the FWCC because of his passion for music and his desire to find new ways of sharing music education with all children. Denice Beights, who has been with the choir three years, said she loves working with the choir because “it is making a difference in the lives of our children, as well as the arts scene.�

work and discipline. “The results include excellent educational opportunities, wonderful performances and wellrounded people,� Beights said. “If your child loves to

Sometimes children who don’t “fit in� at school find a family with the choir. Beights said a young man, who has been with the choir six years now, said that at school he was an outcast. “He couldn’t behave, and often was treated poorly by students and teachers because of his behavior,� Beights said. “He didn’t know how to act, how to fit in. However, at choir, he feels like he belongs. “He learned how to express himself, and ultimately, be part of something bigger than himself. He plans to continue through graduation. He doesn’t dream of being a professional musician or music educator, but he can see how the choir has given him the opportunity to create something special, and to be a part of the final fabric.�

sing, he or she should be singing with us. We encourage any child who has passion and enthusiasm for singing to be a part of the choir.� The choirs are: Prepara-

tory (they do not perform), Apprentice, Lyric, Whitley Regional, Treble, Concert (touring choir), Youth Chorale and Chamber Singers. Twenty-two percent of

the members receives financial assistance, so financial barriers should not stop a child from being involved, Beights said. More information is at fwcchoir.org.

Cornerstone Daycare Learning Center 1400 W. Washington Center Rd. www.cornerstonedaycare.com • Ages 1-12 • 6 a.m. - 6 p.m. • Full Day Kindergarten • Before and After School Programs • Summer Fun Program for All Ages • Participates in Paths to Quality • Christian Daycare • State Licensed • Secured Facility

FWCC goals include:

!-INISTRYOF &IRST!SSEMBLY OF'OD ^3INCE^

NOW ENROLLING! 0LEASE#ALLFOR A4OUR 

Cornerstone Daycare Learning Center

• fostering the life-long skill of music literacy, • building an understanding of a wide variety of types of music, • learning how to work as a group towards the same goal and • an appreciation for hard

Present this coupon for

$75 off

your enrollment Valid thru January 31, 2013

Letter From Santa Want to see your child’s face light up?

It was taken at the Johnny Appleseed Festival. Specifically, at Little Johns Sarsaparilla Root Beer booth.

Michele Miller of Ft. Wayne was the KPC staff choice winner for KPC’s September Photo Contest.

;MVLPQUWZPMZIXMZ[WVITQbML TM\\MZNZWU;IV\INWZWVTa  +PQTLÂź[.QZ[\4I[\6IUM





*Wa/QZT

5IQTQVO)LLZM[[











MICHELE MILLER OF FT. WAYNE

;XMKQIT)L]T\[6IUM ;XMKQIT8;\W+PQTLNZWU;IV\I

+WV\IK\6IUM Mail to: NIE c/o KPC Media Group 102 N. Main St. P.O. Box 39 Kendallville, IN 46755





Our son, Luca, 9 months, trying to fit into his Daddy’s Men of Steel cycling race team gear and dreaming of the day he can ride his own bike, in his nursery at our home in Auburn.

8PWVM Check / M.O. Enclosed Make payment to KPC Media Group Inc.

Tina Leavell of Auburn is the people’s choice winner for KPC’s September Photo Contest.

Credit Card # Exp. Date

Must be received in ofďŹ ce by Wed., December 12, 2012 * All proceeds beneďŹ t the KPC Media Group Newspaper In Education Program

TINA LEAVELL OF AUBURN

nie Newspaper in Education

Their photos also will appear online at www.kpcnews.com/photocontest. PHOTO SUBMISSION REQUIREMENTS: • Go to www.kpcnews.net/photocontest

Winners need to contact James Tew at jamest@kpcnews.net or 260-347-0400 x190


!

Community Calendar WWW&7$AILY.EWSCOM

&2)$!9 ./6%-"%2

@!#HRISTMAS3TORY Arts United Center, 303 E. Main St., Fort Wayne. Fort Wayne Civic Theatre presents “A Christmas Story.� Online: fwcivic.org.

(OLIDAY%XTRAVAGANZA3HOPPING0REVIEW0ARTY Allen County War Memorial Coliseum, 4000 Parnell Ave., Fort Wayne. 5-9 p.m. Enjoy a festive evening of food - with beer and wine available at cash bar - entertainment, shopping and exclusive offers all while helping the Community Harvest Food Bank. $45 in advance or $50 at the door. Tickets available online. Phone: (866) 625-6161 or visit womensexpo.org/fortwaynehe/index.shtml.

#HOCOLATE %XTRAVAGANZA TO "ENEFIT &AMILY  #HILDRENS 3ERVICES )NC Masonic Temple, 216 E. Washington Blvd., Fort Wayne. 6:30-9 p.m. The event includes DeBrand chocolate tastings, and hors d’oeuvres furnished by some of Fort Wayne’s finest restaurants and caterers. The evening will also include a chocolate fountain, cash bar, coffee bar, and a silent auction. All proceeds from the silent auction and 50 percent of the ticket sales go directly to Family & Children’s Services, Inc. for their programs. (ARVEST #ONCERT First Presbyterian Church, 300 W Wayne St., Fort Wayne. 7:30 p.m. Fort Wayne Children’s Choir Treble, Concert, Youth Chorale and Chamber Singers. Adult, $8; Seniors and students, $5. Tickets available through the IPFW Larson Ticket Office, 481-6555.

3!452$!9 ./6%-"%2

0ANCAKESFOR0ANCREATIC#ANCER VFW Post 857, 2202 W. Main St., Fort Wayne. 8-11 a.m. 7th annual Pancakes for Pancreatic Cancer Fundraiser. Adult, $5; child, $3; all-you-can-eat, $10. Family friendly event including silent auction, bake sale, door prizes, pancake and sausage breakfast, more. Contact: Angie Gutmann, 417-4117. -ISS&ORT7AYNE#HRISTMASIN!RLINGTON#RAFT3HOW Arlington Park Clubhouse, 4630 W. Arlington Park Blvd., Fort Wayne. 9 a.m. to 3 p.m. Stop by to meet the Miss Fort Wayne titleholders and shop a great selection of handmade crafts, vendors, and baked goods. There will also be a raffle, lunch available, and free crafts for the kids while you’re shopping. 3ECOND3TEPS#RAFT'IFT"AZAAR Second Steps Autism Resource Community Center, 4118 N. Clinton St., Fort Wayne. 10 a.m. to 2 p.m. Free of charge and open to the public. Offers supervision and activities for children with special needs so parents can shop. :4!(OLIDAY-ARKETPLACE Sweetwater, 5501 U.S. 30, Fort Wayne. 10 a.m. to 2 p.m. Mark your calendars. Join Zeta Tau Alpha Fort Wayne Alumnae Chapter for our inaugural Holiday Marketplace. Shop from a wide variety of vendors, including Thirty-One Gifts, Avon, Discovery Toys, Lia Sophia, Longaberger, Mary Kay, Pampered Chef, Premier Jewelry, Scentsy, Silpada, Stampin’ Up, Stella & Dot Uppercase Living, Usborne Books and Tastefully Simple. Visit with Santa from 10:30 a.m. to noon. Admission is free. Vendors will be donating a portion of their proceeds to the Zeta Tau Alpha Foundation. 3AUSAGE3AUERKRAUT $INNER AND #RAFTS Zion Lutheran Church, 2313 S. Hanna St., Fort Wayne. 5-7 p.m. Cost for dinner is $7.50 for 11 years or older. Kids 5-10 years old eat for $3; children 5 years or younger eat free. Carryout available. Handicap accessible. Strolling Minstrel, George Berger, will play old familiar tunes on his accordion. For more info or questions, contact Ed Grim at 485-9879 or ejgrim@juno.com.

-/.$!9 ./6%-"%2

/PERATION#HRISTMAS#HILD.ATIONAL#OLLECTION7EEK Sonrise Church, 10125 Illinois Road, Fort Wayne. 8 a.m. to 8 p.m. Impact a child’s life with a simple shoe box gift. Fill a shoe box with school supplies, toys, necessity

items and a note of encouragement for a child overseas suffering due to disaster, disease, war, terrorism, famine or poverty. This year, Operation Christmas Child expects to reach a milestone with more than 100 million children receiving shoe box gifts since the project began in 1993. National Collection Week for Operation Christmas Child is November 12-19. There are collection sites around the area. To find a location near you, visit samaritanspurse.org/occ.

45%3$!9 ./6%-"%2

&ORT7AYNE7OMENS-IDDAY#ONNECTION,UNCHEON Orchard Ridge Country Club, 4531 Lower Huntington Road, Fort Wayne. 11:20 a.m. to 1 p.m. The November luncheon will feature the Fort Wayne Police Department, which will provide information on preventing identity theft. Cost: $13.50 inclusive. Free child care provided. RSVP by Nov. 6 to Peggy at (260) 432-0335. Sponsored by Stonecroft Ministries.

7%$.%3$!9 ./6%-"%2

(OMEBUYER %DUCATION #LASS American Red Cross, 1212 E. California Road, Fort Wayne. 8 a.m. to 5 p.m. Hosted by the Office of Housing and Neighborhood Services. Anyone interested in taking the class should call 427-1127 or 311. (OLIDAY 3HOPPING "AZAAR Leo United Methodist Preschool, 13527 Leo Road, Fort Wayne. 8:30 a.m. to 8:30 p.m. $ROP IN9OGAINTHE'ARDENS Botanical Conservatory, 1100 S. Calhoun St., Fort Wayne. 5:30 p.m. The practice of yoga is a wonderful way to build strength and flexibility, reduce stress, and enhance general well-being. Taught by certified yoga instructor and world traveler Lanah K. Hake. A few blankets, mats, and straps are available but bring your own supplies if you have them. Drop-in fee $7 (Conservatory members $5). (EATHERS#LOSET3ALE%VENT Bishop Luers High School, 333 E. Paulding Road, Fort Wayne. 6 p.m. New and gently used dresses for sale. With each gown, we are providing information regarding safety tips, phone numbers and Heather Ancelet Norris’ story, who was killed at the hands of an abusive boyfriend in 2007. All gowns sold for $25. Proceeds from the events will enable Heather’s closet to host future guest speakers and purchase additional information about domestic violence. )NTERNATIONAL 'ENEALOGY 2ESEARCH Allen County Public Library, 900 Library Plaza, Fort Wayne. 7-8:30 p.m. The Nov. 14 meeting of the Allen County Genealogical Society will feature a program on International Research by Steven Myers, Assistant Manager of the Genealogy Center. The program is open to visitors as well as members and begins at 7pm in Meeting Room A of the Allen County Public Library. Gathering time is 6:30pm.

4(523$!9 ./6%-"%2

4HE%CONOMICSOF2ECYCLING4URNING4RASHINTO#ASH Greater Fort Wayne Chamber of Commerce, 826 Ewing St., Fort Wayne. 8 a.m. to 1 p.m. Northeast Indiana Sustainable Business Council members certified through the Bright Green Business Program will be presenting information along with a featured speaker from the Indiana Recycling Coalition. Attendees can expect to hear presentations from Fort Wayne Metals, Lincoln Financial Group, Summit Brands and Martin Riley Architects Engineers. Cost: $30, includes continental breakfast and lunch. RSVP by Nov. 12 by phone 452-4396 or kerri@nisbc.org. 'O2ED&OR7OMEN,UNCHEONAND3YMPOSIUM Allen County War Memorial Coliseum, Fort Wayne. 10 a.m. to 2 p.m. Dr. Angela LaSalle of Parkview Women’s Center will be the keynote speaker. LaSalle is board certified in

Baseball for Ages 2 to 6

-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

family medicine with a fellowship in integrative medicine. Tickets are $100 for the event. Tables are still available for corporate women’s groups. This is the American Heart Association’s major fundraiser for Women’s cardiovascular health. Funds raised are restricted to women’s research and programs. !NTHONY7AYNE4OASTMASTERS-EETING Ivy Tech Community College, Fort Wayne. 6:30 p.m. Toastmasters meetings are open to everyone; for better public speaking and a lot of fun. $EPRESSION"IPOLAR  First Presbyterian Church, 300 W Wayne St., Fort Wayne. 7 p.m. 12-step program for those living with depression or bipolar disorder. For more info contact Marilee Stroud at 312-6069 or mtstroud@frontier.com.

3!452$!9 ./6%-"%2

&INDING /UR 6OICE 3HARING /UR 3PIRIT 7ITHIN AND !CROSS #ULTURES Allen County Public Library, 900 Library Plaza, Fort Wayne. 9 a.m. to 4 p.m. Register for a free four-part community workshop which provides participants the opportunity to explore historical and current racial and cultural inequities; race as a social construction, cultural identities, life histories, and racial autobiographies of self and workshop participants; ancestral research and presentation; social justice, social action, and community mobilization. To register contact Dr. Ruby Cain at rcain@bsu.edu. (OLIDAY 0ICTURES WITHA0 URPOSE H.O.P.E. for Animals, 1333 Maycrest Drive, Fort Wayne. 11 a.m. to 3 p.m. Saturday, 11-3 and Sunday 12-3 HOPE for Animals will be hosting “Holiday Pictures with a Purpose.� Bring your dog or cat and have your family photo taken with the whole family. Don’t have a furry friend? Come get a great family photo. There will be two different backdrops with the option of having Santa in the photo! The Saint Francis photo club will be taking the pictures. Only $7.99 for a 5x7 print and a digital copy. #HORAL&ESTIVAL IPFW Auer Performance Hall, Fort Wayne. 4 p.m. Three Rivers Choral Festival with Fort Wayne Children’s Choir Youth Chorale and area high school choirs. Auer Performance Hall, IPFW Rhinehart Music Center. Free. &AWN,IEBOWITZATANNUAL4 URKEY4ROT Bishop Luers High School, 333 E. Paulding Road, Fort Wayne. 6:30 p.m. Bishop Luers Athletic Booster Club and the performing arts aepartment will host Fawn Liebowitz as the main event at the annual Turkey Trot. Come and enjoy great music, food and support Luers Athletic and Performing Arts Departments. Must be 21 to attend. Tickets: $20 per person. Table reservations available for $300. Tickets can be purchased by calling 456-1261, ext. 3020.

35.$!9 ./6%-"%2

/UTDOORICESKATINGR INKOPEN Headwaters Park, 333 S. Clinton St., Fort Wayne. Noon to 8 p.m. Prices are still $3 for children 13 and under and $5 for children 14 and over and adults. There is a $2 charge to rent skates, or patrons can bring their own skates. Every Wednesday, between Nov. 28 and Feb. 27, will be a free skate day for children 13 and under. !#HILDRENS#ONCERT Plymouth Congregational Church, 501 W. Berry St., Fort Wayne. 2 p.m. Children of all ages will delight in meeting Mr. Puppet and hearing great music from Indiana’s professional vocal ensemble, Heartland. Come early for the best seats. Free. 4HANKSGIVINGFEASTFORTHEBIRDS Wildwood, 409 E S.R. 14, Silver Lake. 25 p.m. Help prepare a winter feast for the birds at Wildwood by making bird feeders and bird treats. Rain or shine. Stay for a hike into the woods to look for animal signs and tracks.

Mid-Morning with Lynne Ford weekdays 10-11 a.m. EDT

-JM4MVHHFSTJTBDIJMEEFWFMPQNFOUQSPHSBN EFTJHOFEUPJOUSPEVDFDIJMESFOUPUIFHBNFPG CBTFCBMM-JM4MVHHFSTUFBDIFTUIFQSPQFSXBZ UPUISPX DBUDI IJUBOESVOCBTFTJOBGVOBOE FYDJUJOHFOWJSPONFOU$MBTTFTNFFUXFFLMZ BOEBSFIFMEJOEPPSTBUBMPDBUJPOOFBSZPV

TALK Worth Talking About

Relationships

Health & Wellness

Around the House

'PSNPSFJOGPSNBUJPO WJTJUPVSXFCTJUFPS DBMMVTBU



www.lilsluggersfw.com

_JKTWZO

Spiritual Growth

F & R Builders, LLC Ready for that home you’ve always dreamed of, or planning an addition to handle a growing family? Expanding your business or farming operation and need it under roof? Perhaps you’ve decided those repairs can’t be put off any longer.

CALL US TO TALK IT OVER! • House Additions • New Homes • Custom-Made Cabinets • Masonry Work - Brick & Block • Post Frame Buildings • Barn Siding & Roofing • Livestock Barns • Garages

Garage & Barns, Houses, Storage Facilities and more!

260-273-9868 • frbuilders.com

Building whatever your heart desires!


#OMMUNITY#ALENDAR

-ĂŒÂ°ĂŠÂœiĂŠ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

WWW3T*OE4IMESCOM UĂŠĂŠ!

-/.$!9 ./6%-"%2

45%3$!9 ./6%-"%2

4919 Projects Drive, Fort Wayne. 7-8:30 p.m. Parents, grandparents, teachers, professionals and others wanting to learn more about autism are welcome. Topics vary monthly. For more information contact Susan Crowell at eeeautismspectrum@yahoo.com or call 637-4409.

Coldwater Road, Fort Wayne. 9:30-11:30 a.m. This month we will be learning how to design a smocking plate. Please bring a pencil, eraser, and colored pencils.

7%$.%3$!9 ./6%-"%2

TH!NNUAL97#!#IRCLEOF7OMEN,UNCHEON Fort Wayne Marriott, 305 E. Washington Center Road, Fort Wayne. 11:30 a.m. to 1 p.m. Keynote speaker, Johanna Orozco is a Teen Educator for the Domestic Violence and Child Advocacy Center of Greater Cleveland. Johanna shares her compelling story with schools, community organizations, parents, and concerned citizens, to educate them about dating violence. She focuses on self-respect, confidence and what signs to look for in an unhealthy relationship. )TSA7ONDERFUL,IFE First Presbyterian Theater, 300 W. Wayne St., Fort Wayne. 7:30 p.m. First Presbyterian Theater. Continues through Dec. 16. Visit firstpres-fw.org for show times and dates. All students $10 Advance sale tickets are $20/$18 for seniors (65+) Tickets purchased at the door are $24/$22 (65+)/$10 full-time students. Discounts for season memberships. Groups of 20 or more are $15 per ticket. Box Office Phone - (260) 422-6329.

,ITTLE 2IVER 2AMBLERS Eagle Marsh Preserve, 6801 Engle Road, Fort Wayne. 9-11 a.m. Hike and explore the preserve’s interesting plants and wildlife. Sponsored by Little River Wetlands Project. Free. Contact info@lrwp.org or 260-478-2515 for information. $OWNSIZING YOUR &INANCIAL -AZE Allen County Extension Office on the IPFW Campus, 4001 Crescent Ave, Fort Wayne. 1 p.m. purposes, as proof of a transaction or payment, or for other financial reasons. But, how long should you keep them? Do you have boxes and bags of old papers and receipts? This program will help you decide what, how long, where and how to keep your records and Downsize Your Financial Maze. For questions, contact Vickie Hadley at the Allen County Extension Office at 481-6826.

&2)$!9 ./6%-"%2

7INTER"IRDSOFTHE-ARSH 0RAIRIEAND7OODS Aboite Branch Library, 5630

Center, 303 E. Main St., Fort Wayne. 8 p.m. The Nutcracker with the Fort Wayne Ballet, Fort Wayne Philharmonic and Fort Wayne Children’s Treble Choir. Tickets available through the Fort Wayne Ballet: fortwayneballet.org (Please note that these are the dates the FWCC Treble Choir performs. The Nutcracker is also performed Dec. 2, 4, 7 and 8.).

4(523$!9 $%#%-"%2

%NCOURAGE %MPOWER AND %NJOY THE !UTISM 3PECTRUM Easter Seals Arc,

&ESTIVALOF'INGERBREAD,IGHTING.IGHT Fort Wayne History Center, 302 E. Berry Street, Fort Wayne. 5-9 p.m. 27th Festival of Gingerbread kicks off its special events with Lighting Night. Visitors can get a sneak peek at the handiwork of creators from 5 to 9 p.m. Admission $2 a person at the door. At 6 p.m. the History Center’s turret will be lit with holiday colors of red and green. Santa will also be present. Online: fwhistorycenter.com. .IGHTOF,IGHTS Downtown Fort Wayne. 5:45 p.m. Join the annual holiday lighting ceremony, beginning at 5:45 p.m. with the Northern Lights display at Aunt Millie’s on Pearl Street. The night ends with fireworks at Parkview Field at 7:45 p.m.

&2)$!9 ./6%-"%2

!#HRISTMAS3URVIVAL'UIDE Arena Dinner Theatre, 719 Rockhill St, Fort Wayne. Conceived and written by James Hindman and Ray Roderick. Musical arrangements by John Glaudin. Directed by Carol HowellWasson. Tickets are $35 each and includes meals prepared by The Bagel Station. &ESTIVALOF'INGERBREAD The History Center, 302 E Berry St, Fort Wayne. Entry forms are now available on our website. There is no charge to enter the competition.

3!452$!9 ./6%-"%2

#REATE 9OUR /WN /RNAMENT Fort Wayne History Center, 302 E. Berry Street, Fort Wayne. 1-3 p.m. Create an ornament to take home, $1 plus regular museum admission. Admission is $5 adults ages 19-58, $3 for seniors ages 59+ and students ages 3-18, and free to children age 2 and under. Online: fwhistorycenter.com.

35.$!9 ./6%-"%2 -AKEA(OLIDAY'R EETING#ARD Fort Wayne History Center, 302 E. Berry Street, Fort Wayne. 1-3 p.m. Make a special card to take home, $1 plus regular museum admission. Online: fwhistorycenter.com.

,ITTLE4URTLE3MOCKERS United Methodist Church of the Covenant, 10001

4(523$!9 ./6%-"%2

4HE .UTCRACKER WITH &ORT 7AYNE "ALLET AND 0HILHARMONIC Arts United

3!452$!9 $%#%-"%2

(OMEBUYER %DUCATION #LASS American Red Cross, 1212 E. California Road, Fort Wayne. 8 a.m. to 5 p.m. Hosted by the Office of Housing and Neighborhood Services. Anyone interested in taking the class should call 427-1127 or 311. 3IGNSAND4RACKS,EARNING!NIMAL!WARENESS Eagle Marsh Preserve, 6801 Engle Road, Fort Wayne. 9-10:30 a.m. Join Dane Nagy, Indiana Master Naturalist, to become aware of the many animals wintering at Eagle Marsh by learning how to decipher the signs and tracks they leave behind. Dress warmly. Sponsored by Little River Wetlands Project. Free. Contact

info@lrwp.org or 260-478-2515 for information.

35.$!9 $%#%-"%2

3UMMIT #ITY 3INGERS CONCERT Allen County Public Library, 900 Library Plaza, Fort Wayne. 3 p.m. The program features music related to Indiana and then evolves to songs of the Christmas season. All concerts are free and family friendly.

45%3$!9 $%#%-"%2

7%$.%3$!9 $%#%-"%2

Coventry Lane, Fort Wayne. 7-8 p.m. Join expert birder Jim Haw of Stockbridge Audubon to learn about winter birds in our area. Sponsored by Little River Wetlands Project. Free. Contact info@lrwp.org or 260478-2515 for information.

 .IGHT AT "OTANICAL #ONSERVATORY Foellinger-Freimann Botanical Conservatory, 1100 S. Calhoun St., Fort Wayne. 5-8 p.m. On the first Thursday of the month, the Botanical Conservatory offers $1 admissions from 5-8 p.m. for adults and children. 4ASTE OF THE #HAMBER Greater Fort Wayne Chamber of Commerce, 826 Ewing St. 5-8 p.m. Spend the evening networking with hundreds of area business professionals while enjoying complimentary hors d’oeuvres from dozens of local restaurants and caterers and various cash bars. All three floors of the Greater Fort Wayne Chamber of Commerce will be filled with vendors at the annual event. Tickets are $10 in advance and $15 at the door. Purchase tickets online at fwchamber.org or at the front desk.

Pet Pictures with Santa Paws! Please join the Pooch Parlor staff for our

OPEN HOUSE & SANTA PICTURE EVENT on Saturday, November 17 • 2-4pm

Pooch Parlor PET GROOMING

3704 N. Clinton St. (just south of Glenbrook Square)

260-471-4440 www.pooch-parlor.com www.facebook.com/PoochParlorPetGrooming

Bridal Exchange NOW OPEN

New Students First Yoga Class

,

Coupon cannot be combined with any other offer. Expires April 1, 2013

Consignment & Sales: Bridal Gowns, Mothers’ Dresses Prom/Special occasion • Tuxedo Rental Shoes/Shoe Dying on Site • Alterations

%CNNQT%JGEM1WV QWTYGDUKVGHQTEWTTGPV %NCUU5EJGFWNGU

NOW OPEN 9175 Lima Rd www.simplyyogafortwayne.com i l f t

260-446-1663

260-470-9860

433 E. Dupont Road, Fort Wayne, IN 46825

10%off Any Purchase Expires 11/15/12

Monday through Friday 11-7 • Saturday 10-5 •Sunday 12-4

4616 Speedway Dr., Fort Wayne

Your Holiday

4"-&4 Need a #PPTU

Vietnamese Cuisine

IN FORT WAYNE

Dine In or Carry Out 220-1188 Mon.-Sat.- 11 am-9 pm • Sun. 11 am-8 pm KIMVUFWCOM

10% Off

Your total meal purchase

Dine in or Carry Out

Let5JNFT$PNNVOJUZ 1VCMJDBUJPOT#VTJOFTT 8FFLMZhelp you reach 78,000 households and businesses this Holiday Season Call /PX for details 260.426.2640 Ext. 305


! UÊ WWW&7$AILY.EWSCOM

-Ì°ÊœiÊ/ˆ“iÃÊUÊ .OVEMBER 


Section

B

3ERVING.ORTHWEST&ORT7AYNE!LLEN#OUNTY

WWW&7$AILY.EWSCOM

.OVEMBER 

œ˜VÂœĂ€`ˆ>ĂŠL>˜`ĂŠ}iĂŒĂƒĂŠ LiĂƒĂŒÂ‡iĂ›iÀÊvÂˆÂ˜ÂˆĂƒÂ… 0DUFKLQJ&DGHWVEULQJKRPHVHFRQGSODFH

&AMILY&EATURES

-AKEYOURTHANKSGIVINGMOUTHWATERINGWITHTHESERECIPES

ÂœÂ˜Â˝ĂŒĂŠLĂ€i>ÂŽĂŠĂŒÂ…iĂŠL>Â˜ÂŽĂŠÂœÂ˜ /Â…>Â˜ÂŽĂƒ}ÂˆĂ›ÂˆÂ˜}ĂŠĂŒÂ…ÂˆĂƒĂŠĂži>Ă€ $VKRZVWRSSLQJPHDORQDEXGJHW

Roast Turkey with Mushroom Stuffing Ingredients: 3 1/2 cups Swanson Chicken Stock 3 tablespoons lemon juice 1 teaspoon dried basil leaves, crushed 1 teaspoon dried thyme leaves, crushed 1/4 teaspoon ground black pepper 1 stalk celery, coarsely chopped (about 1/2 cup) 1 small onion, coarsely chopped (about 1/4 cup) 1/2 cup sliced mushrooms (about 1 1/2 ounces) 4 cups Pepperidge Farm Herb Seasoned Stuffing 1 turkey (12 to 14 pounds) Vegetable cooking spray Directions: 1. Stir 1 3/4 cups stock, lemon juice, basil, thyme and 1/8 teaspoon black pepper in a medium bowl. 2. Heat remaining stock, remaining black pepper, celery, onion and mushrooms in a 4-quart saucepan over mediumhigh heat to a boil. Reduce

"Y.ICHOLE(ACHA 4HOMAS NTHOMAS KPCNEWSNET

"Y&AMILY&EATURES All hosts want to delight guests with delicious meals, especially during the holidays. The pressure often leads them to spend a fortune on ingredients or cater their gatherings. The experts at Campbell’s Kitchen have created this traditional holiday menu, proving that it’s possible to prepare a memorable, gourmet feast by combining affordable, quality ingredients.

#OURTESYPHOTO

4HE#ONCORDIAMARCHINGBANDPERFORMSEARLIERTHISSEASON4HEBANDTOOKITSSHOWONTHER OADTO,UCAS /IL3TADIUMON.OVTOCOMPETEFORTHE)NDIANA3T ATE3CHOOL-USIC!SSOCIATION#LASS#CHAMPIONSHIP

The Concordia Lutheran High School Marching Cadets claimed second place in Indiana State School Music Association Class C championship competition on Nov. 3 at Lucas Oil Stadium. The finish marks the first time the band has been named one of the top three in the state. Its previous highest finish was fourth place in 2011. Under the direction of Dianne Moellering and drum majors Jonathan Na Thalang, Bradley Murphy and Michaela Holloway, the Marching Cadets performed its show, “The Promise.� Musical selections included “3:16,� “Beautiful Savior� and “Variation on Theme from Promise of Living.� &AMILY&EATURES

$ONTFORGETTOMAKEEVERYONESFAVORITESIDEDISHˆGREENBEAN CASSEROLE heat to low. Cover and cook for 5 minutes or until vegetables are tender. Remove saucepan from heat. Add stuffing to saucepan and mix lightly. 3. Remove package of giblets and neck from turkey cavity. Rinse turkey with cold water and pat dry with paper towel. Spoon stuffing lightly into neck and body cavities. Fold any loose skin over stuffing. Tie ends of drumsticks together. 4. Place turkey, breast side up, on a rack in shallow roasting pan. Spray turkey with cooking spray. Brush with stock mixture. Insert meat thermometer into thickest part of meat, not touching bone. 5. Roast at 325°F for 3 1/2 to 4 hours or until thermometer reads 180°F. Baste occasionally with stock mixture. Begin checking for doneness after 3 hours of roasting time. Let turkey stand for 10 minutes before slicing. Notes:

• Bake any remaining stuffing in a covered casserole with the turkey for 30 minutes or until the stuffing is hot. • Stuffing in the turkey should reach 165°F.

Moist and Savory Stuffing Ingredients: 2 1/2 cups Swanson Natural Goodness Chicken Broth Generous dash ground black pepper 2 stalks celery, coarsely chopped (about 1 cup) 1 large onion, coarsely chopped (about 1 cup) 1 package (14 ounces) Pepperidge Farm Herb Seasoned Stuffing Directions: 1. Heat broth, black pepper, celery and onion in a 3quart saucepan over medium-high heat to a boil. Reduce heat to low. Cover and cook for 5 minutes or until vegetables are tender, stirring often. Remove -iiĂŠMEAL, ÂŤ>}iĂŠ Ă“

The performance was the band’s ninth in ISSMA championship competition since 2001. Concordia finished second to the Western High School Marching Panthers of Russiaville. The Panthers performed its show, “At Water’s Edge.â€? Other state finalists included Edgewood, third place; Norwell, fourth place; Beech Grove, fifth place; NorthWood, sixth place; Fairfield, seventh place; Angola, eighth place; North Harrison, ninth place; and Vincennes-Lincoln, 10th place. In Class A competition, the Homestead High School Spartan Alliance marching band also captured a second place finish at -iiĂŠBAND, ÂŤ>}iĂŠ Ç

ĂƒĂƒÂœVˆ>ĂŒi`ĂŠ Â…Ă•Ă€VÂ…iĂƒĂŠĂŒÂœĂŠÂŤĂ€ÂœĂ›Âˆ`i ĂŒĂ•Ă€ÂŽiÞÊ>˜`ĂŠĂŒĂ€ÂˆÂ“Â“ÂˆÂ˜}ĂƒĂŠĂŒÂœĂŠĂŒĂ€ÂœÂœÂŤĂƒ By working with family support personnel at local military bases, Associated Churches of Fort Wayne and Allen County will identify military families in need during the holidays. In preparation for Thanksgiving, 100 meals will be assembled on Saturday, Nov. 10, at 9 a.m. in the Associated Churches warehouse, 602 E. Wayne St. The boxes will be delivered to the 122nd Fighter Wing of the Indiana Air National Guard, located at 3005 W. Ferguson Road on Tuesday, Nov. 13, at 1:30 p.m. Each meal will serve eight people and costs approximately $36. In the weeks leading up to Christmas, families also will be adopted by businesses and church congregations. Each family will receive meals and gifts to help ease the financial burden often associated with the holi-

#OURTESYPHOTO

6OLUNTEERSFROM!SSOCIATED#HURCHESPACKBOXESFILLEDWITHFOODTO SENDTOMILITARYFAMILIES days. Churches, businesses, and individuals are welcome to help in these projects. Contact Associated Churches at 422-3528 or Charlie Hatten by email at chatten@briljent.com. “At Thanksgiving we

are able to give some of them gas cards to get to a family gathering, and the meal that is provided by Associated Churches gives them a way to contribute -iiĂŠTROOPS, ÂŤ>}iĂŠ Ăˆ


Healthy Times WWW&7$AILY.EWSCOM

"

Ă•ÂŤÂœÂ˜ĂŒĂŠ6>Â?Â?iÞÊ/ˆ“iĂƒĂŠUĂŠ.OVEMBER 

7AYSTOAVOIDPACKING ONHOLIDAYPOUNDS "Y-ETRO#REATIVE Eggnog, turkey and stuffing, assorted pastries — the holidays are as much about the food and drink as they are about sharing good times together. So is it any wonder that many gain weight during the holiday season? Researchers at the National Institute of Child Health and Human Development and the National Institute of Diabetes and Digestive and Kidney Diseases have found the average person gains a pound a year from holiday eating, which accumulates and can lead to health problems later in life. But there are some lucky few who seem impervious to the goodies, staying thin despite the extra holiday food. How do some seem to stay so thin all of the time? According to Men’s Health expert and editor-in-chief David Zinczenko, who has spent more than 20 years interviewing all sorts of leading weight loss experts and

reviewing various studies, “What separates the fit from the fat is a series of rules.â€? These rules are easy to follow and they don’t require any special exercise equipment, crash dieting or subsisting solely on wood chips to keep fit. Here are some things to consider during the holidays and as you make healthy eating resolutions for the new year. • Stop dieting. Some studies indicate that individuals who are currently on a diet are more likely to gain weight in subsequent months or years. That’s because restriction of fat and caloric intake can affect muscle growth and bone density. Muscle burns calories very well, so you want to hold onto strong muscles. Also, carefully monitoring what you eat can lead to stress hormones flowing through the body. Hormones like cortisol have been linked to weight gain. So ease up on watching every bite of food you eat and you just may be happier — and thinner — for it.

#OURTESYPHOTO

$ONTLETYOURWAISTEXPANDDURINGTHEHOLIDAYS • Choose high-protein foods. Protein fills the stomach and takes a longer time to digest in the body, which in turn helps you to burn calories. Selecting lean proteins, like turkey, chicken, lean beef, and pork, can help you to feel fuller longer and reduces the chance you’ll nibble on fluff snacks during the day. When faced with holiday fare, choose protein sources to fill you up before indulging on other items. • Fill up on fiber, too. Studies indicate that getting 25 grams of fiber, which is easily achieved by having three servings of fruits and vegetables, can boost fat-fighting efforts of the body by at least 30 percent. Many processed foods are increasing fiber content, but be sure to read labels. That fiber may also be accompanied by a lot of sugar and extra carbohydrates. Fresh fruit and vegetables and whole grain breads are easy ways to get a fiber boost. • Engage in fun exercise. Many people equate staying thin to spending hours at the gym every day. But all it takes is about 20 to 30 minutes of any type of daily activity, whether that be chasing around the kids or playing fetch with a dog. The concept of losing weight just by doing enjoyable activities is known as non-exercise activity thermogenesis, or NEAT. So go for a bike ride and burn 200 calories in the process. • Skip fat-free foods. It would seem foods that have no or low fat would be better for you, but fat is actually a necessity for the body — helping you to feel satiated. Eating a fat-free item could have you feeling hungry soon after and ready to snack later on. In addition, some fatfree items have extra sugar or preservatives for flavor, which can undermine weight-loss plans.

Home for the Holidays Include American Senior Communities on your holiday list! Let us help you with your holiday plans. Come see our Garden Homes and Assisted Living Apartments and learn about the lifestyle our residents enjoy. Tour one of our communities any day beginning Dec. 10th through Dec. 14th between 10a.m. to 4p.m. to receive a certiďŹ *55 or older, and one ham per household. cate for a FREE Holiday Ham!

Happy Holidays from American Senior Communities!

• Don’t be a couch potato. Get up from that computer chair and cut down on television watching. A sedentary lifestyle can easily pack on the pounds. A study by researchers at the University of Vermont found overweight participants who cut their daily TV time in half (from an average of 5 hours to 2.5 hours) burned an extra 119 calories a day. Remember when you were a kid playing with your friends outside from sunrise to sunset? You probably weren’t overweight then. But adults now spend more time indoors, and all that time spent in front of the tube could be hindering your weight-loss efforts. If you follow a few easy rules, there finally may be a way to stay thin without dieting, even during the holiday season.

MEAL vĂ€ÂœÂ“ĂŠÂŤ>}iĂŠĂŠ ÂŁ saucepan from heat. Add stuffing and mix lightly. 2. Spoon stuffing mixture into greased 3quart shallow baking dish. Cover baking dish. 3. Bake at 350°F for 30 minutes or until stuffing mixture is hot.

Green Bean Casserole

260-435-2100

CMG 120959

ASCSeniorCare.com

Ingredients: 2 cans (10 3/4 ounces each) Campbell’s Condensed Cream of Mushroom Soup 1 cup milk 2 teaspoons soy sauce 1/4 teaspoon ground black pepper

8 cups cooked cut green beans 2 2/3 cups French’s French Fried Onions, divided Directions: 1. Stir soup, milk, soy sauce, black pepper, beans and 1 1/3 cups onions in 3quart casserole. 2. Bake at 350°F for 25 minutes or until bean mixture is hot and bubbling. Stir bean mixture. Sprinkle with remaining onions. 3. Bake for 5 minutes or until onions are golden brown.


Ă•ÂŤÂœÂ˜ĂŒĂŠ6>Â?Â?iÞÊ/ˆ“iĂƒĂŠUĂŠ.OVEMBER 

WWW&7$AILY.EWSCOM s"

iÂ?ÂŤĂŠĂƒÂœĂ•}Â…ĂŒĂŠvÂœĂ€ VœœŽˆi‡VÂ…>Â?Â?i˜}i`ĂŠVœœŽ

#VTJOFTTt$MVCTt$IVSDIt'BNJMZt0VUEPPSTt4QPSUT

Go to IZGDLO\QHZVFRP Click on “6KDUH1HZVÂľ

A Division of KPC Media Group

#OMMUNITY 2EPORTER

9OUR.EWS%VERYDAY

Prettiest cookie takes home ĘťPinterestingĘź prize "Y6ALERIE'OUGH VGOUGH KPCNEWSNET

(%!,).' '//$ (%!,4(

7%,,.%33

#OURTESYPHOTO

-ÂŤÂˆÂ˜>Â?ĂŠ Ă?>“ÊEĂŠ8‡,>ĂžĂƒ

f£™°™™ ­fÓääÊ6>�ÕiŽ

u

Includes complete consultation; chiropractic, orthopedic and neurological exam; report of findings; and x-rays. Expires 12/31/12

#OURTESYPHOTO

6ALERIE'OUGH

• Recurring headaches • Pain between shoulders • Painful joints • Low back or leg pain • Numbness in arms & hands • Stress • Neck, shoulder & arm pain • Sport injuries • Scoliosis

Stellhorn Rd

485-9300 4337 Flagstaff Cove

Dr. Lisa Lombardo, D.C.

Stellhorn Professional Village

Medicare and most insurance accepted

This Veterans Day, take a moment to remember those who have served.

are living in your neighborhood, our veterans have helped to make this great country what it is. Today and every day, thank them for their service.

LAKESIDE PARK

1140 Lake Ave • Fort Wayne, IN 46805

(260) 426-9494 www.mccombandsons.com

37

for the winner in our December issue. And for even more recipes, check out “Seven Days of Christmas Cookies� in next month’s newspaper where editor Nichole Hacha-Thomas and her daughter, Camry, will present their favorite cookies for your baking pleasure.

Call now if you have these warning signs of Spinal Misalignment:

HWY

mail your photo and recipe to news@fwdailynews.com with “Holiday Cookie Challenge� in the subject line. Entries must include a full name, address and phone number to ensure that a winner can be notified. Entries will be accepted through Friday, Nov. 23. (Note: Photos must be original. The quality of your photo likely will effect its chance of being repinned by Pinterest users. Entries without photo attachments will not be considered.) To follow the contest on Pinterest, visit pinterest .com/fwdailynews/holiday -cookie-challenge. Whose recipe will cause cookie envy? Look

Wheelock Rd

Cooking is one of those things that makes me feel at home again. Growing up, it was what we did as a family back when family dinners weren’t altogether uncommon. My mother could effortlessly drum up a delicious dinner for four, all while singing and dancing to a good song on the radio. When my husband isn’t there to catch me in the act, I find myself doing the same thing in my own kitchen. (Thanks, Mom.) While I didn’t inherit her fine skill for song and dance, I did become a pretty good cook. But I just can’t seem to bake a good cookie. There I said it. I’m not proud of it, but it’s true — I am no stranger to the botched batch. I just can’t understand it — why can I bake cakes, pies and pastries with ease, but struggle to execute a good cookie? Allow me to explain cookie envy: it’s what I feel at cookie exchange parties when the group describes what they baked to send home with guests

and I have little bags of scary-looking, dry hockey pucks to offer them ‌ they just don’t know it yet. Sure, I could throw them away and try to pass off store-bought cookies as my own, but everyone else worked so hard, and on top of that, I’m incapable of lying. But maybe this year, I could be the one causing cookie envy ‌ with your help. Times Community Publications now is accepting entries in its first ever Holiday Cookie Challenge. Here’s how it works: Choose a delicious recipe you think makes the prettiest Christmas cookie. Then, whip up a batch at home and take a photo of the finished product. Send us your photo and recipe and be entered to win a $50 gift card to Country Kitchen Sweetart. Submitted recipes will be pinned to our “Holiday Cookie Challengeâ€? Pinterest board on Monday, Nov. 26. The recipe with the most repins by Friday, Nov. 30, will take home the prize. To enter the contest, e-


Ă•ÂŤÂœÂ˜ĂŒĂŠ6>Â?Â?iÞÊ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

" sWWW&7$AILY.EWSCOM

SPECIAL NOVEMBER PRICING ON YOUR FAVORITE HONDA MODELS

HONDA CR-V $

259/MO. LEASE

*

HONDA CIVIC $

4740 Lima Rd. | 1.866.384.4499 | DonAyres.com Monday , Tuesday, Thursday | 8:30am to 8:00pm Wednesday, Friday, Saturday #1 INTERNET DEALER

|

8:30 am to 6:00 pm

149/MO. LEASE

*

facebook.com/DonAyresHonda twitter.com/DonAyresHonda DonAyresHondablog.com RANKED ONE OF THE TOP AUTO DEALER BLOGS IN THE NATION

* CR-V advertised is a 2013 2-wheel drive LX. Civic advertised is a 2012 LX. $1999 down. Includes down payments with no security deposit. Excludes taxes, titles, and dealer fees. For well-qualified lessees. See dealer for complete details.


Ă•ÂŤÂœÂ˜ĂŒĂŠ6>Â?Â?iÞÊ/ˆ“iĂƒĂŠUĂŠ.OVEMBER 

WWW&7$AILY.EWSCOM s"

6ÂˆĂƒÂˆĂŒÂˆÂ˜}ĂŠ Ă•Ă€ĂƒiĂŠEĂŠÂœĂƒÂŤÂˆVi œ“iĂŠÂ˜ii`ĂƒĂŠĂ›ÂœÂ?Ă•Â˜ĂŒiiĂ€Ăƒ Visiting Nurse & Hospice Home, a locallybased, non-profit hospice and palliative care provider is looking for volunteers to assist in a variety of roles. Volunteers are needed to visit patients in area nursing facilities to visit with, read or sing to patients and also to visit with patients in the home

setting. Volunteers are a vital part of the agency’s team bringing broad end-oflife support to patients and families. Visiting Nurse & Hospice Home has a well-established volunteer program that provides ongoing support and guidance for volunteers. A thorough training will be held

soon. Visiting Nurse & Hospice Home serves patients in Adams, Allen, DeKalb, Huntington, Noble, Wabash, Wells and Whitley counties. For additional information, please call Ann Blue, Volunteer Coordinator at 435-3222 or via email at annblue@ vnhh.org.

Experts in Rehabilitation Moving Forward is designed for those striving to restore abilities lost due to stroke, cardiovascular difďŹ culties, orthopedic surgery and other debilitating conditions. Programs vary in frequency and intensity and include physical, occupational and speech/language therapies. Our goal is to return our participants home safely with the skills they need to continue life on their own terms. Experts in Medicare and assisting families with supplemental and replacement insurance policies.

Glenbrook REHABILITATION & SKILLED NURSING CENTER

MOVING FORWARD REHABILITATION, SKILLED NURSING SERVICES, LONG TERM CARE, HOSPICE, RESPITE

“Where caring people make the difference!�

3811 Parnell Ave. Fort Wayne, IN 46805

260-482-4651

ASCSeniorCare.com


Ă•ÂŤÂœÂ˜ĂŒĂŠ6>Â?Â?iÞÊ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

" sWWW&7$AILY.EWSCOM

*- "ĂŠiĂ?ÂŤiVĂŒĂƒĂŠÂ˜Âœ …ˆŽiĂŠĂŒÂ…ÂˆĂƒĂŠĂœÂˆÂ˜ĂŒiĂ€ The average residential customer can expect to pay slightly less than last winter for natural gas during this winter’s heating season, NIPSCO predicts. NIPSCO supplies natural gas to customers in most of northeast Indiana. Over the course of the five-month winter heating season — Nov. 1 to March 31 — NIPSCO said its average residential customer would use a total of 624 therms and could expect to pay approximately

$438. That compares to $440 for a customer using the same amount of gas last winter. “Market prices for natural gas continue to hold at historically low levels, thanks in large part to plentiful domestic resources,� said NIPSCO’s CEO Jim Stanley. “This is great for our customers, especially as we head into the winter heating season, when utility bills typically reach their highest point of the year.�

Ă•ÂˆÂ?`ĂŠÂœvviĂ€ĂƒĂŠÂ“ĂžĂƒĂŒiĂ€ĂžĂŠĂŒĂ€ÂˆÂŤ The Fort Wayne Civic Theatre Guild is sponsoring a holiday mystery trip on Saturday, Dec. 8. The event’s destination, while a secret, will be fun for all, said organizers. There will be a special

stop for gentlemen, a stop at a museum and a home. The highlight of the trip, though, will be a cabaret dinner and Christmas show. The cost is $99 per person and includes transportation, museum

admission, dinner show and all appropriate tips. Cocktails and shopping are not included and guests are encouraged to enjoy those on their own. For reservations or questions, contact Sharon at 437-7497.

TROOPS vĂ€ÂœÂ“ĂŠÂŤ>}iĂŠĂŠ ÂŁ to the larger meal when they arrive at the celebration,â€? said Connie S. Douthat, 122nd Fighter Wing airmen and family readiness program manager, when asked about the impact of the donation. Douthat continued as she remembered a story from last year, “We had a

What hurts worse than getting a hip replacement?

soldier suffering from PTSD, and he couldn’t get a job. His wife was laid off too. Assistance only goes so far. The fact is if it wasn’t for Associated Churches they wouldn’t have had a Christmas,� she said. “Our military families ministry continues to be so important as so many

soldiers re-deploy, struggle to find work at home, and simply make sense of life. We are grateful to the community for so strongly supporting this ministry,� said Roger Reece, executive pastor of Associated Churches. For more information on ways to help, visit associatedchurches.org.

Not getting an anterior hip replacement at FWO.

Fort Wayne Orthopedics performs hip procedures using the “Anterior Hip Approach� 90% of the time. What does that mean to you? It means that you will be up and around the same day with less post-operative pain. Most of our patients say that they have less pain going home than they did when they came in. If therapy is needed, it can be done at home. And best of all, you can go back to your normal daily routine – and the things you love to do – without restrictions.


Ă•ÂŤÂœÂ˜ĂŒĂŠ6>Â?Â?iÞÊ/ˆ“iĂƒĂŠUĂŠ.OVEMBER 

WWW&7$AILY.EWSCOM s"

Ă•ĂŒÂ…iĂ€>Â˜ĂŠÂ…iÂ?ÂŤĂƒĂŠĂ€i“i“LiÀÊÂ?ÂœĂ›i`ĂŠÂœÂ˜iĂƒ Memorial ornaments once again will adorn a Remembrance Tree at Lutheran Hospital this upcoming holiday season. The annual Remembrance Tree display provides the entire community with a touching way to commemorate loved ones who are gone but not forgotten. The public is invited to place a personalized ornament on the tree on Saturday, Nov. 17, from 9 a.m. to 1 p.m. A special dedication will take place in the hospital’s main lobby at 12:45 p.m. The names of loved ones will be read at that time. Volunteers will paint a family member or friend’s name on the ornament which is provided free of charge. People can opt to write a note to or about the loved one that will be placed inside their orna-

ment. Special ornaments will also be available in memory of fallen heroes from the armed forces, fire department or police department. Each ornament will remain on the tree until shortly after the New Year, at which time they may be picked up at Lutheran and taken home as a memento. K105 FM on-air personality Dude Walker is excited to return again to help decorate ornaments and greet guests. Area choirs and musicians will share songs of the season throughout the morning. Nurses from Lutheran Hospital help plan this special activity. This is the fourth year for the Remembrance Tree event at Lutheran. The public may call 435-7704 for more information.

#OURTESYPHOTO

4HEPUBLICISINVITEDTOPLACEAPER SONALIZEDORNAMENTON,UTHERAN (OSPITALS2EMEMBRANCE4REEON3ATURDAY .OV FROMAMTO PM!SPECIALDEDICATIONWILLT AKEPLACEINTHEHOSPITALSMAIN LOBBYATPM4HENAMESOFLOVEDONESWILLBER EADATTHAT TIME

BAND vĂ€ÂœÂ“ĂŠÂŤ>}iĂŠ ÂŁ Lucas Oil Stadium. The band, which is the 2011 state champion, was beaten by the Carmel Marching Greyhounds. Other finishers included Avon, third place; Center Grove, fourth place; Lawrence Central, fifth place; Lake Central, sixth place; Ben Davis, seventh place; Columbus North, eighth place; Penn, ninth place; and Lawrence North, 10th place. The North Side High School

Marching Redskins performed in Class B championship competition on Nov. 3 as well. The band placed 10th. The Jasper High School Marching Wildcats won the class. Other Class B state finalists included Goshen, second place; Greenwood, third place; Northview, fourth place; Concord, fifth place; Northridge, sixth place; Floyd Central, seventh place; Munster, eighth place; and Plainfield, ninth place.

FWO’s Anterior Hip Approach means less pain now – and later.

No area bands competed in Class D championship competition. The Forest Park High School Marching Rangers of Ferdinand took home the ISSMA Class D championship. Other finishers were Spring Valley, second place; Lewis Cass, third place; Paoli, fourth place; Monrovia, fifth place; Southridge, sixth place; Adams Central, seventh place; Mater Dei, eighth place; South Spencer, ninth place; and Eastside, 10th place.

You. Renewed.

If you suffer from arthritis, or any chronic hip issues, don’t let anyone tell you that the Anterior Hip approach isn’t right for you until you call The Anterior Hip Center at Fort Wayne Orthopedics. We’ll be glad to show you why we’ve helped more than 1,000 patients using the Anterior Hip Approach procedure. It’s a painless decision.

For more information, contact us at (267) 225.5396 | AnteriorHipIndiana.com


Ă•ÂŤÂœÂ˜ĂŒĂŠ6>Â?Â?iÞÊ/ˆ“iĂƒĂŠUĂŠ .OVEMBER 

" sWWW&7$AILY.EWSCOM

EMBASSY

FESTIVAL OF TREES NOVEMBER 21-28

Beautifully decorated trees and youth performances wrapped in the splendor of the Embassy Theatre

EVENTS AND TIMES Nov. 21, 6-9pm, Night of Lights Nov. 22, 4-8pm, Thanksgiving Day featuring the Grande Page Pipe Organ Nov. 23-25, 12-8pm Nov. 26, 9am-1pm, Kingston Senior Day Nov. 27, 9am-1pm Nov. 28, 9am-1pm, Kids Day

Dining & Entertainment Ă€iĂžÂ…ÂœĂ•Â˜`ĂƒĂŠvĂ•Â˜`Ă€>ÂˆĂƒiĂ€ ĂƒiĂŒĂŠvÂœĂ€ĂŠ ÂœĂ›Â°ĂŠÂŁÂŁ They’re fast. They’re sleek, and when they’re not running, they are total couch potatoes. All-Star Greyhounds, a nonprofit that helps provide adoption services for greyhounds, will hold a Nov. 11 fundraiser that also will give people an opportunity to meet some of the gentle dogs and learn about the breed known for speed. Volunteers will have some retired racers and other homeless greyhounds available for adoption and also will answer any questions people may have about the dogs. Live music will be provided by Distractions, food will be available and a raffle of items donated by local businesses and artists will help raise funds for the nonprofit’s work. The event will be from 1 to 5 p.m. at Green Dog Goods, 3421 N. Anthony

-ETRO#REATIVE

!GREYHOUNDISPERCHEDUPONARUG!LL 3TAR'REYHOUNDS A NONPROFITTHATHELPSPROVIDEADOPTIONSERVICESFORGREYHOUNDS WILL HOLDA.OVFUNDRAISER Blvd. A pre-event fundraiser, Flash Your Pet, will be held the day before, Nov. 10, beginning at 1 p.m., at the same location. All breeds

Panda Grill Buffet $IJOFTF +BQBOFTFBOE"NFSJDBO

ADDITIONAL EVENTS

-VODI%JOOFS #VGGFUT

Nov. 23 & 24, 9:30-11am, Breakfast with Santa Nov. 21-Dec. 31, Animated Holiday Windows on Harrison Street

TICKETS

OPXPOMZ

Festival of Trees: $7 for adults, $3 for children 12 and under

$

4.99 &WFSZ%BZ

Available at the Embassy box office, Ticketmaster and Midwest America FCU

Breakfast with Santa: $12.50 per person Reservations available at the Embassy box office, 260.424.5665

EMBASSY THEATRE 125 W. Jefferson Blvd., Fort Wayne, IN 46802 260.424.5665 | fwembassytheatre.org

3929 E. State Blvd. (Corner of Coliseum and State)

Great Variety of Fish, Sushi, Beef and Seafood Made possible by support from

A Goodwill Community Event A fundraiser for the Embassy Theatre Foundation, Inc.

are welcome. Get a great portrait of your pet and raise funds for All-Star at the same time. Appointments are required for photos. Call 483-1267 to schedule.

482-2838

Hours: Mon.-Sun 11 am - 9:30 pm

7UDYHOOLNH5R\DOW\ Almost 5HVHUYH(DUO\'RQŇ‹W%H'LVDSSRLQWHG

1HZ2UOHDQV 7KH2OG6RXWK

$ODVND%\/DQG 6HD

0DUFK 9LVLWWKHELUWKSODFHRIWKH´%OXHV¾7RXU*UDFHODQG ZKHUH(OLYVOLYHGWKH:DUHKRXVH'LVWULFWZKHUH DOOWKH0DUGL*UDVà RDWVDUHPDGHWDNHDFRRNLQJ FODVVDWWKH1HZ2UOHDQV6FKRRORI&RRNLQJVHH ÀUVWKDQGWKHUHFRQVWUXFWLRQRI1HZ2UOHDQVҋà RRG UDYDJHGDUHDVSOXVPXFKPRUH

-XO\ &RPELQHWKHVLJKWVRIWKH5LYHUERDW'LVFRYHU\ 6WHUQZKHHOHUFUXLVHSDQIRUJROGLQDJROGPLQH WDNHDWXQGUDZLOGHUQHVVWRXUZDONRQDJODFLHU DQGFUXLVHLQ´0RGHUQ/X[XU\¾RQWKH&HOHEULW\ ´0LOOHQQLXP¾²ZKDWGR\RXKDYH"2XU$ODVND%\ /DQG 6HD7RXU

&DOO(GJHUWRQŇ&#x2039;VWRGD\ /,0$5')7:$<1(,1 ZZZHGJHUWRQVWUDYHOFRP

2WKHU([FOXVLYH(GJHUWRQŇ&#x2039;V7RXUV :HVWHUQ&DULEEHDQ&UXLVH )HE0DU

&KHUU\%ORVVRP)HVWLYDOLQ'& $SULO

%HVWRI,WDO\ 0DUFK

<HOORZVWRQH7HWRQV 0W5XVKPRUH -XQH

$XVWUDOLD 1HZ=HDODQG &UXLVH7RXU 0DUFK 7KH&DUROLQDV 0RUH 0DUFK

6HHZZZHGJHUWRQVWUDYHOFRP


Ă&#x2022;ÂŤÂ&#x153;Â&#x2DC;Ă&#x152;Ă&#x160;6>Â?Â?iĂ&#x17E;Ă&#x160;/Â&#x2C6;Â&#x201C;iĂ&#x192;Ă&#x160;UĂ&#x160;.OVEMBER 

WWW&7$AILY.EWSCOM s"

Â&#x153;Â&#x2DC;Â&#x2021;ÂŤĂ&#x20AC;Â&#x153;vÂ&#x2C6;Ă&#x152;Ă&#x192;Ă&#x160;Ă&#x20AC;>Â&#x2C6;Ă&#x192;iĂ&#x160;Â&#x201C;Â&#x153;Â&#x2DC;iĂ&#x17E;Ă&#x160;Ă&#x153;Â&#x2C6;Ă&#x152;Â&#x2026;Ă&#x160;>}Â&#x2C6;V>Â?Ă&#x160; >Ă&#x17E;Ă&#x160;Â&#x153;vĂ&#x160;Â&#x2C6;Ă&#x203A;Â&#x2C6;Â&#x2DC;} Jefferson Pointe Shopping Center will host its Magical Day of Giving on Nov. 17 from 10 a.m. to 9 p.m. The event is a fundraiser for several non-profit organizations and includes exclusive discounts at the shopping center, a visit from Santa, holiday entertainment, a tree-lighting ceremony and door prizes. Tickets are $5 and available from several non-profit groups. Katrina Newman, marketing manager for the shopping center, said the event was designed to raise money for groups during the holidays. â&#x20AC;&#x153;We donâ&#x20AC;&#x2122;t touch any of the money,â&#x20AC;? Newman said. â&#x20AC;&#x153;Every year we have so many charities asking for donations, and this is our Jefferson Pointe Shopping Center will host its Magical Day of Giving on Nov. 17 from 10 a.m. to 9 p.m. The event is a fundraiser for several non-profit organizations and includes exclusive discounts at the shopping center, a visit from Santa, holiday entertainment, a tree-lighting ceremony and door prizes. Tickets are $5 and available from several non-profit groups. Katrina Newman, marketing manager for the shopping center, said the event was designed to raise money for groups during the holidays.

â&#x20AC;&#x153;We donâ&#x20AC;&#x2122;t touch any of the money,â&#x20AC;? Newman said. â&#x20AC;&#x153;Every year we have so many charities asking for donations, and this is our solution.â&#x20AC;? Non-profit groups pick up and sell tickets to the Magical Day of Giving event for $5. The groups keep all of the money for themselves. It is a way for each nonprofit to raise funds while funneling shoppers to

Jefferson Pointe. Newman said more than 20 businesses are signed on to participate. Some offer a percentage discount while others â&#x20AC;&#x201D; like Chick-fil-A â&#x20AC;&#x201D; are offering something free. Newman said some groups, like the Columbia City Swim and Dive team, sold approximately 750 tickets to last yearâ&#x20AC;&#x2122;s event, which netted the team more than $3,500 to

purchase new towels, a scoreboard and other equipment. â&#x20AC;&#x153;This is open to any non-profit looking for a fundraiser. Itâ&#x20AC;&#x2122;s proven to be a great idea,â&#x20AC;? Newman said. Tickets are available for non-profit groups to pick up and sell. Organizers need only to call the mall office at 459-1160 to reserve their lot of tickets. Individuals can pick up tickets on the day of the event at the mall office and will be able to choose which charity will receive the proceeds.

Some deals available on the Magical Day of Giving include: â&#x20AC;˘ A free original or spicy chicken sandwich from Chick-fil-A, â&#x20AC;˘ Twenty percent off your entire purchase at Clairâ&#x20AC;&#x2122;s Accessories, â&#x20AC;˘ Free â&#x20AC;&#x153;Secret Cardâ&#x20AC;? with a $10 purchase at Victoriaâ&#x20AC;&#x2122;s Secret, â&#x20AC;˘ Forty percent off an entire purchase at Justice, â&#x20AC;˘ Ten percent off at The Buckle on all accessories, â&#x20AC;˘ Door prize for free Debrand Fine Chocolates, â&#x20AC;˘ Fifteen percent off all purchases at Cold Stone

Where to get tickets â&#x20AC;˘ AIDS Task Force â&#x20AC;˘ Allen County SPCA â&#x20AC;˘ Shawnee show choir â&#x20AC;˘ Northwood show choir â&#x20AC;˘ Columbia City Swim and Dive â&#x20AC;˘ Lindley Elementary School Creamery, â&#x20AC;˘ A free small soft drink or coffee with a meal purchase at Panera Bread and â&#x20AC;˘ $3.50 off any $10 purchase at Ulta.

4HEGIANT#HRISTMASTREEAT*EFFERSON0OINTE3HOPPING#ENTERWILL BELITDURINGTHEMALLS-AGICAL$AYOF'IVING WHIC HWILLTAKEPLACE .OV4HETREE LIGHTINGWILLBEGINATPM

A Division of KPC Media Group

#OMMUNITY2EPORTER Go to IZGDLO\QHZVFRP Click on â&#x20AC;&#x153;6KDUH1HZVÂľ

9OUR.EWS%VERYDAY #VTJOFTT 'BNJMZ $MVCT 0VUEPPST $IVSDI 4QPSUT

â&#x20AC;&#x153;Fort Wayneâ&#x20AC;&#x2122;s Premier Tanning Experienceâ&#x20AC;?

6OTED&ORT7AYNES4ANNING3ALON Studio Tan offers the most advanced tanning equipment available today.

What are you waiting for?

5BO5PEBZ

&ALL3PECIALS

First Tan FREE New Customers Only

Expires 12/7/12

&ALL0REVIEW0ACKAGE~ $5000 3ESSION3PECIAL Level 1 ~ $2750 Level 2 ~ $4300 Level 3 ~ $5000 Level 4 ~ $6300 Level 5 ~ $7600 Level 6 ~ $10000

Early Bird Single Session (Mon-Fri 8am-11am Only)

~ $300

Unlimited Specials 1 Week Unlimited - Level 1 ~ $1000 1 Month Unlimited - Level 1 ~ $3499

Ă&#x201C;ä£Ă&#x17D;Ă&#x160;Â&#x153;Ă&#x152;Â&#x2C6;Â&#x153;Â&#x2DC;Ă&#x160; Â&#x153;Â&#x201C;Â&#x2C6;Â&#x2DC;}Ă&#x160;Â&#x2C6;Â&#x2DC;Ă&#x160; Â&#x153;Ă&#x203A;iÂ&#x201C;LiĂ&#x20AC;t

&ACEBOOK&RIDAYSs"LACK&RIDAY3PECIALS

7ATCHOUTFOR7ACKY7EDNESDAY Mon. -Thurs. 8 a.m. - 9 p.m. â&#x20AC;˘ Fri. 8 a.m. - 8 p.m. â&#x20AC;˘ Sat. 9 a.m. - 5 p.m. â&#x20AC;˘ Sun. 11 a.m. - 5 p.m.

Northwest 918 Woodland Plaza (Dupont/Coldwater Road)

969.2292

Georgetown 6209 E. State Blvd. (State/Maplecrest Road)

485.2100

Southwest 10218 Chestnut Plaza Dr. (Illinois/Scott Road)

625.5215


"

Business & Professional WWW&7$AILY.EWSCOM

Ă&#x2022;ÂŤÂ&#x153;Â&#x2DC;Ă&#x152;Ă&#x160;6>Â?Â?iĂ&#x17E;Ă&#x160;/Â&#x2C6;Â&#x201C;iĂ&#x192;Ă&#x160;UĂ&#x160;.OVEMBER 

"REWERSHOCKED PLEASEDWITHNATIONALAWARD "Y-IKE-ARTURELLO MIKEM KPCNEWSNET

Thereâ&#x20AC;&#x2122;s a certain amount of satisfaction in winning a national award for a product you and your staff put your heart and soul into. Just ask Blaine Stuckey, co-owner of Mad Anthony Brewing Co., which recently won a gold medal in the Great American Beer Festival national beer competition, the largest commercial beer competition in the world. Stuckey, who lives on Jimmerson Lake, said the more than 500 brewers that put out top-quality

products have a shot at winning top honors in national and international competition such as the Great American Beer Festival. You just never know if your beer is going to be honored. â&#x20AC;&#x153;It was a shocker. I was pleasantly surprised,â&#x20AC;? said Stuckey, whose company is headquartered in Fort Wayne and has a restaurant in Auburn. A store at Lake James is in the works. â&#x20AC;&#x153;If youâ&#x20AC;&#x2122;re putting out good beer youâ&#x20AC;&#x2122;ve got a shot.â&#x20AC;? There were more than 2,700 beers entered in the competition. The Great American Beer Festival

Pursuant to IC 4-32.2-4-5 the Army Navy Union #57 is publishing notice that an application for an annual bingo license has been filed by: Army Navy Union #57 2025 Olladale Drive Fort Wayne, IN 46808 Location of Bingo Event: 2025 Olladale Drive Fort Wayne, IN 46808 /PERATORS -ARK3CHERER *ENNIFER/(ARA $AMION/(ARA /FFICERSOF/RGANIZATION 3TEVE -ERTENS #OMMANDER *OHN,OTHAMER 3R6ICE#OMMANDER 2OGER0IERSON *R6ICE#OMMANDER 3UE"ALSAMO !DJUTANT ,ARRY+OONTZ 0AY-ASTER 'EORGE$OCKERY YR%XECUTIVE/FFICER $ENNIS(ARMEYER YR%XECUTIVE/FFICER -ARK3CHERER YR%XECUTIVE/FFICER (AROLD0ECONGE YR%XECUTIVE/FFICER &RANCIS&REDRICK *UDGE!DVOCATE

Any person may protest the proposed issuance of the annual bingo license. Protest letters must be received within fifteen (15) days from the date the last posting appears. The Commission shall hold a public hearing if ten (10) written and signed protest letters are received. Address Where Protest Letters Should be Sent: INDIANA GAMING COMMISSION Attention: Diane Freeman Charity Gaming Division East Tower Suite 1600 101 W. Washington St. Indianapolis, Indiana 46204

Furnace on Its Last Leg? Have Your Furnace Repaired or Replaced! REBATES AVAILABLE

FINANCING

on New Installations*

FREE Quotes

on New Installations*

Made Right Here In Indiana

$74

Furnace Service & Clea Cleaning

Offers cannot be combined. Expires Expir 12/15/12.

$30OFF

Any Service Repair Not valid on trip charge. Offers cannot be combined. Expires 12/15/12.

*With approved credit. Call for details.

FAMILY OWNED AND OPERATED

260-496-8400 www.customassured.com 2630 Independence Drive, Fort Wayne, IN 46808 24 Hour Service- Every Day of the Year!

also available for carryout in half-gallon growlers at the three stores, including seven days a week in Fort Wayne, home of the brewery. This is the second time Mad Anthony has won an award at the Great American Beer Festival competition. The other time was in 1999 for its Auburn Lager, which received a silver medal. Stuckey said he was pleased to see so many small, independent brewers from the Midwest, particularly Indiana and Michigan, do so well at the competition. He said a lot of good beer is being crafted in the Midwest. â&#x20AC;&#x153;A lot of that is happening,â&#x20AC;? he said. Co-owners with Stuckey are Todd Grantham, brewmaster, and Jeff Neels, director of restaurant operations. The restaurant planned for Lake James is going to be at the former site of Branch McCrackenâ&#x20AC;&#x2122;s Hoosier Basketball Camp at Bledsoeâ&#x20AC;&#x2122;s Beach. Seven Indiana breweries won three gold medals, three silver medals and one bronze in the competition.

#OURTESYPHOTO

3TUCKEY awards gold, silver and bronze medals for excellence in 75 beer-style categories but does not necessarily award medals to the top three finishers in a particular category, the festivalâ&#x20AC;&#x2122;s website said. Mad Anthony was honored for its Ruby Raspberry Wheat beer in the Fruit Wheat Beer category. There were 38 beers entered in the category. Silver was awarded to Leinenkugelâ&#x20AC;&#x2122;s Summer Shandy, Jacob Leinenkugel Brewing Co., Chippewa Falls, Wis.; and bronze went to 5 Lizard Latin-Style Witbier, 5 Rabbit Cerveceria, Bedford Park, Ill. Ruby Raspberry Wheat is available on tap at Mad Anthony brew pubs in northeast Indiana. It is

To place an ad call toll free 1-877-791-7877 or Fax 260-347-7282 â&#x20AC;˘ E-mail times@kpcnews.net

Times ClassiďŹ eds A DIVISION OF KPC MEDIA GROUP INC.

Open Monday - Friday 8 a.m. - 5 p.m. Place your ad 24/7 online or by e-mail

Serving Allen County â&#x20AC;˘ FWDAILYNEWS.COM To ensure the best response to your ad, take the time to make sure your ad is correct the ďŹ rst time it runs. Call us promptly to report any errors. We reserve the right to edit, cancel or deny any ad deemed objectionable or against KPC ad policies. Liability for error limited to actual ad charge for day of publication and one additional incorrect day. See complete limitations of liability statement at the end of classiďŹ eds.

CLEANING SERVICES Local woman cleaning homes & businesses, 14 years experience, references. 749-5204 or 402-4700

ADOPTIONS ADOPT: Hopeful 1st time parents promise your baby a secure, loving home. Expenses paid. Jill & Owen, 1-866-440-4220 hAdoption is Loveh Absolute Devotion, Close-Knit Family, Lots of LOVE, Security awaits 1st baby. Expenses paid. hhhAnna hhh h1-800-989-8921h

START SAVING

NOW!

thetimesclipper.com

HOMES FOR SALE Crooked Lake 3 BR, 2 BA, 2 car detached garage, open floor plan w/master bedroom on main floor. Fenced backyard, new furnace & air conditioning. Lake view w/sandy beach & dock for boat. $175,000. 4475 W. Orland Rd. Angola, IN

260-750-1420 New Haven 3 BR, 2 BA Villa in Landon Meadows. 1851 sq. ft., lake lot, very low maintenance dues. New model & building lots available. Located SW corner of Landon & Maysville Rds. OPEN HOUSE: Sundays, 2 - 4 Wednesdays, 5 - 7 Bob Griebel 760-5815 Ann Marquardt 466-6741

Coldwell Banker RWG

WANTED TO BUY Van converted for wheelchair use in good condition. 260-761-4109

KPC LIMITATIONS LIMITATIONS OF LIABILITY: KPC assumes no liability or financial responsibility for typographical errors or for omission of copy, failure to publish or failure to deliver advertising. Our liability for copy errors is limited to your actual charge for the first day & one incorrect day after the ad runs. You must promptly notify KPC of any error on first publication. Claims for adjustment must be made within 30 days of publication and, in the case of multiple runs, claims are allowed for first publication only. KPC is not responsible for and you agree to make no claim for specific or consequential damages resulting from or related in any manner to any error, omission, or failure to publish or deliver.

#AMERON-C+ENNA

0ICTUREDISAPINTOF2UBY2ASPBERRY7 HEATBEERBY-AD!NTHONY "REWING#OANDTHEGOLDMEDALWONBYTHECOMPANYINLASTWEEKS 'REAT!MERICAN"EER&ESTIVALCOMPETITION

5(*,21$/$'9(57,6,1*

Sales Manager

.3&0HGLD*URXS,QFVHHNVDQH[SHULHQFHG LQGLYLGXDOIRUUHJLRQDODGYHUWLVLQJVDOHVPDQDJHU DNH\SRVLWLRQLQRXUJURZLQJFRPSDQ\7KH VXFFHVVIXOFDQGLGDWHZLOOGULYHJRDODFKLHYHPHQW JHQHUDWHLGHDVIRUQHZUHYHQXHDQGGHYHORS QHZEXVLQHVV&ROODERUDWLQJZLWKWKHDGYHUWLVLQJ GLUHFWRUWKHUHJLRQDOVDOHVPDQDJHUZLOOOHDGORFDO VDOHVWHDPVIRURXUZHOOUHJDUGHGGDLO\DQGZHHNO\ QHZVSDSHUVRQOLQHDQGQLFKHSURGXFWV+HRU VKHZLOOEH³RQWKHVWUHHW´ZLWKWKHVWDIIPRWLYDWLQJ DQGWUDLQLQJWKHPDQGZLOOPHHWZLWKFXVWRPHUV ([FHOOHQWFRPPXQLFDWLRQDQGSUHVHQWDWLRQVNLOOV DUHLPSRUWDQW([SHULHQFHLQGLJLWDOPHGLDVDOHV LVUHTXLUHG.3&LVDIDPLO\RZQHGDQGRSHUDWHG FRPSDQ\WKDWVHUYHVVWURQJFRPPXQLWLHVLQWKH ODNHVUHJLRQRIQRUWKHDVW,QGLDQD7REHFRQVLGHUHG IRUDQRSSRUWXQLW\WRJURZZLWKXVVHQGFRYHUOHWWHU DQGUHVXPHLQFRQ¿GHQFHWR

1DQF\6LEOH QDQF\V#NSFQHZVQHW

.3&0HGLD*URXS,QF 10DLQ6W.HQGDOOYLOOH,1

EOE

Since

Over 100 Years

1911


Ă&#x2022;ÂŤÂ&#x153;Â&#x2DC;Ă&#x152;Ă&#x160;6>Â?Â?iĂ&#x17E;Ă&#x160;/Â&#x2C6;Â&#x201C;iĂ&#x192;Ă&#x160;UĂ&#x160;.OVEMBER 

WWW&7$AILY.EWSCOM s"

Worship Briefs Get ready for Advent

End-of-life care seminar planned

The ladies of St. Michael Church, 2131 Getz Road, will host an evening of relaxation without the holiday hassle on Dec. 3 from 6-8 p.m. to prepare hearts and minds for the season of Advent. The evening will begin with a Nativity Walk followed by Christmas music, singing and desserts (diabetic desserts also will be available). The guest speaker for the evening will be Michigan resident Rose Fremer, who supports the need for a nativity set in every home as a way of teaching about the birth of the Lord. Fremer will share the story of how she began the Nativity Set Ministry. Nativity sets will be available for purchase from Fremer, to help support her ministry. Admission is free but a free-will offering will be received to offset the expenses. Any remaining funds will be donated to St. Michaelâ&#x20AC;&#x2122;s nativity ministry to purchase nativity sets for future community outreach clients in 2013. Register for the evening by emailing connies home@hotmail.com.

Emmanuel Lutheran Church (Soest) will host a seminar on the ethics of endof-life care on Nov. 1 from 6-8 p.m. at the church, located at 9909 Wayne Trace. The church will examine how Christians are to respond to physician-assisted suicide becoming a legal option in some states and increased acceptance of arguments that the quality of life should determine the length of life. The session will look at end-of-life issues from the perspective of Godâ&#x20AC;&#x2122;s word while attempting to provide some practical guidance for those times when difficult decisions must be made for loved ones or ourselves. The guest speaker for the event will be Rev. John T. Pless, an assistant professor of pastoral ministry and missions at Concordia Theological Seminary. The event will examine the Christian ethics in the realm of end-of-life care and decision-making. There is no cost to attend and refreshments and childcare will be provided.

Donâ&#x20AC;&#x2122;t miss the final Taste!

TASTE OF THE CHAMBER

Three floors of networking, delicious food and beverages Thursday, December 6th ¡ 5-8 p.m. The Chamber, 826 Ewing St. ¡ Advance registration: $10 at fwchamber.org/taste ¡ Admission at the door: $15


" sWWW&7$AILY.EWSCOM

Õ«œ˜ÌÊ6>iÞÊ/ˆ“iÃÊUÊ .OVEMBER 


St. Joe Times - Nov. 2012