Issuu on Google+

JMB

+ INSIDE JMB

2010 / 2011 / Nr. 3

Aktuelle Ausstellungen Neues aus der Sammlung Die Akademie des J端dischen Museums Berlin Current Exhibitions News from our Collection The JMB Academy

J端disches Museum Berlin / Jewish Museum Berlin

JOURNAL Doron Rabinovici Nathan L. Kaplan Corinne Sauer Robert M. Sauer Aubrey Pomerance Benjamin Gidron W. Michael Blumenthal Iris Blochel-Dittrich Leonore Maier Micol Ostow

Business Business


UND WAS IST IHNEN DAS WICHTIGSTE IM LEBEN? Gut, dass man sch端tzen kann, was einem wichtig ist. Gut, dass es Versicherungen gibt.


Editorial Editorial

W. Michael Blumenthal, Direktor des Jüdischen Museums Berlin W. Michael Blumenthal, Director, Jewish Museum Berlin

Just over 70 years ago, a 19-year-old proved that it is possible—with little more than $10 in starting capital and without the mastery of his adopted country’s language—to become extraordinarily prosperous. Eric F. Ross, who died in September of this year, arrived in the United States a destitute immigrant, but possessed the right combination of good ideas, an uncanny sense for business, and the courage to build his own company—and to let others participate in its success. Over the past few years, we have all experienced the extent to which we are dependent on the performance of the economy. Jewish Museum Berlin exhibitions explore the economic side of life again and again: as, for example, with the 17th century businesswoman, Glikl, who managed her late husband’s business; the history of the Scherk cosmetic company; and the discussion of stereotypes involving Jews and money. This last subject provides the starting point for Doron Rabinovici’s essay in this edition of our JMB Journal: the author studies the connections between money, gold, and anti-Semitism from an etymological perspective. Nathan L. Kaplan—who though it requires constant scrutiny, finds ways as a consultant to exercise a Jewish economic ethic—writes about the points of friction and contradiction between religion and the modern world of business. In his contribution on the third sector in Israel, Benjamin Gidron explains how social institutions and non-profit organizations also advance the economy of a country. As for the political dimension of national economies, Corinne and Robert M. Sauer’s commentary explores the voting habits of American Jews: why do “Jews earn like Episcopalians and vote like Puerto Ricans?” Finally, company portraits of Berlin and Bielefeld businesses place the spotlight on Jewish owners, who were forced to sell and flee from the Nazis in the 1930s. As always, we hope that you enjoy reading this edition of the journal!

Vor rund 70 Jahren bewies ein damals 19-Jähriger, dass es – selbst mit einem Startkapital von zehn Dollar und ohne die Landessprache zu beherrschen – möglich ist, wirtschaftlich außerordentlich erfolgreich zu werden: Der im September dieses Jahres verstorbene Mäzen Eric F. Ross, der als mittelloser Emigrant in die USA kam, besaß das richtige Gespür, Ideenreichtum und den Mut, ein eigenes Business aufzubauen – und andere daran teilhaben zu lassen. Dass wir alle vom Funktionieren der Wirtschaft abhängig sind, haben wir in den letzten Jahren zu spüren bekommen. Auch in den Ausstellungen des Jüdischen Museums geht es immer wieder um die wirtschaftliche Seite des Lebens – etwa bei der Kauffrau Glikl, die im 17. Jahrhundert die Geschäfte ihres Mannes fortführte, der Firmengeschichte des Kosmetikbetriebs Scherk oder bei der Auseinandersetzung mit Stereotypen in Verbindung mit den Themen Juden und Geld. Mit Letzterem beschäftigt sich in dieser Ausgabe unseres JMB Journals Doron Rabinovici: Etymologisch untersucht er den Zusammenhang von Geld, Gold und Antisemitismus. Über die Reibungspunkte und Widersprüche zwischen Religion und dem modernen Geschäftsleben schreibt Nathan L. Kaplan, der als Unternehmensberater Möglichkeiten findet, auch heute nach einer jüdischen Wirtschaftsethik zu leben – die zugleich ständig hinterfragt werden muss. Dass auch soziale Einrichtungen und gemeinnützige Organisationen einen großen Beitrag zur Wirtschaft eines Landes leisten, erklärt Benjamin Gidron in seinem Beitrag zum Dritten Sektor in Israel. Die politische Dimension der Nationalökonomie untersuchen Corinne und Robert M. Sauer in ihrem Kommentar zum Wahlverhalten der US-amerikanischen Juden: Weshalb „verdienen Juden wie Episkopale und wählen wie Puerto-Ricaner“? Im Blickpunkt stehen schließlich zwei Firmenporträts von Unternehmen in Berlin und Bielefeld, deren jüdische Eigentümer in den 1930er Jahren gezwungen waren, ihren Betrieb zu verkaufen und vor den Nazis zu fliehen. Wie immer wünschen wir Ihnen beim Lesen des Journals viel Vergnügen!

J M B JOURNAL

3


Credo und Credit Creed and Credit Der Jude erinnerte die Christen an die Rückstände aus den frühesten Schriftrollen und an die Verbindlichkeiten jüngster Abmachungen. Er gemahnte an Schuld und Schulden, an den Ursprung Gottes und des Geldes. Eine Etymologie.

Geldgeschäfte, ca. 1450 Transactions, around 1450

The Jew reminded the Christians of the arrears from the earliest scrolls and of the obligations of recent agreements. He reminded them of the burden of guilt and of debts, of the origin of God and of money. An etymology.

8 > 13


Der Journalist Oved Ben Ami (1905–1988) war Mitbegründer zahlreicher Siedlungen, Gründer der israelischen Tageszeitung Maariv und Urheber der israelischen Diamantenindustrie. Der Fotograf Micha Kirshner (geb. 1947) porträtiert ihn als genialen Geschäftsmann, der mit Heiligenschein und Flügeln den irdischen Sphären enthoben wird. Israeli journalist Oved Ben Ami (1905–1988) not only was one of the founders of numerous settlements, he also established a large number of organizations and associations, launched the Israeli newspaper Maariv, and initiated the Israeli diamond industry. Photographer Micha Kirshner (b. 1947) portrays Ben Ami as an ingenious businessman and raises him above the earthly spheres.

Ethik Ethics Sind Profitstreben, Leistungszwang und Ungleichheit mit Reflexionen über Moral, gutes Leben und richtiges Handeln überhaupt zu vereinbaren? Ergänzt um das Adjektiv „jüdisch“ sieht sich die Wirtschaftsethik von weiteren Gegensätzen geprägt. Can profit maximization, performance pressure, and inequality be reconciled with morality, good life, and proper behavior? Adding the adjective “Jewish,“ the concept of economic ethics becomes even more conflicted.

8 > 17


Politik Politics Ein chassidischer Jude bereitet sich am 7. November 2006 in Brooklyn, New York, auf die Wahlen vor. A Hasidic Jewish man prepares to vote on November 7, 2006 in the Brooklyn borough of New York City.

„Juden verdienen wie Episkopale und wählen wie Puerto-Ricaner.“ Standhaft, so sieht es aus, weigern sich amerikanische Juden, ihren Wohlstand mit eher konservativen oder (im europäischen Sinn des Wortes) wirtschaftsliberalen Haltungen zu verbinden. Ein Kommentar. “Jews earn like Episcopalians and vote like Puerto Ricans.” American Jews, it seems, tenaciously refuse to link their higher income levels with more conservative, or economically liberal (in the European sense), political positions. A commentary.

8 > 22


Kundentreue Customer Loyalty Weltweit führend in der Herstellung von Zunft- und Berufskleidung war bis 1933 ein von jüdischen Unternehmern geführtes Geschäft in Bielefeld – nicht zuletzt dank einer geschickten Werbung, die die Wandergesellen für M. Mosberg durch das Land trugen. Werbetuch der Firma M. Mosberg, ca. 1890–1930. Company cloth by M. Mosberg, around 1890–1930.

In the first third of the twentieth century, one of the world’s leading manufacturers of specific occupational and trade clothing was a Jewish company in Bielefeld: M. Mosberg, whose reputation was carried throughout the country by journeymen.

8 > 41


Non-Profit Non-Profit Ein bedürftiger Israeli erhält in der Stadt Rischon LeZion gegen eine Bescheinigung Tüten mit Lebensmitteln von der privaten Hilfsorganisation Pitchon Lev. A moneyless Israeli hands over his aid ticket to receive bags of food from volunteers from the private Pitchon Lev charity in the Israeli town of Rishon LeZion.

Non-Profit-Organisationen sind eine bedeutende Größe in der israelischen Wirtschaft: Ihr Finanzvolumen betrug im Jahr 2008 insgesamt über 25 Milliarden US-Dollar. Doch die gesellschaftliche Rolle, die sie spielen, geht über die wirtschaftliche hinaus. The third sector in Israel is a large and significant force in the Israeli economy. Its overall expenditures (2008) were over $25 billion. But the role of non-profit organisations for society goes far beyond mere economics.

8 > 48


Um die Welt Around the World „Weniger als eine Woche nachdem wir an Land gegangen waren, hatten wir beide eine Arbeit, sie als Sekretärin und ich als Angestellter in der Rechnungsabteilung von National Biscuit Co.“ Erinnerungen an einen Neubeginn in San Francisco 1948.

San Francisco in den 1940er Jahren.

“Less than a week after stepping ashore we were both employed—she as a secretary, and I as a billing clerk at the National Biscuit Co.” Remembering a new start in San Francisco, in 1948.

San Francisco in the 1940s.

8 > 52


Familienunternehmen Family Business Tiegel für Cold Cream der Firma Scherk, 1924–1938. Schenkung von Irene Alice Scherk. Cold Cream by the Scherk company, 1924–1938. Gift of Irene Alice Scherk.

„Ich möchte nicht Chef sein, ich weiß nicht – ich möchte nicht, dass einer mir gehorchen muss.“ Nur widerwillig übernahm Fritz Scherk das Parfümerie-Unternehmen seines Vaters – und führte es dennoch bis in die 1960er Jahre weiter. Eine Firmengeschichte. “I don’t want to be the boss, I don’t know—I wouldn’t want anyone to have to obey me.“ Only reluctantly did Fritz Scherk take over his father’s cosmetic company—and ran it successfully until the 1960s. A company history.

8 > 55


JMB JOURNAL

Editorial...................................................................................3

Editorial .................................................................................................... 3

Daten und Fakten...................................................................1 2

Facts and Figures .................................................................................. 1 2

Der Gläubige als Gläubiger ....................................................1 3 Doron Rabinovici

Creed and Credit ................................................................................... 1 3 Doron Rabinovici

Dialektik jüdischer Wirtschaftsethik .......................................1 7 Nathan L. Kaplan

Dialectic of Jewish Business Ethics...................................................1 7 Nathan L. Kaplan

Jüdische Theologie und Wirtschaftstheorie. Ein Kommentar ...22 Corinne Sauer / Robert M. Sauer

Jewish Theology and Economic Theory. A Commentary ............22 Corinne Sauer / Robert M. Sauer

„Das Mekka der Zimmerleute“: Die Firma M. Mosberg in Bielefeld ........................................41 Aubrey Pomerance

“The Carpenters’ Mecca”: The M. Mosberg Company in Bielefeld .............................................41 Aubrey Pomerance

Weltfenster.............................................................................4 6

Worldwide.............................................................................................. 4 6

Zur Entwicklung der ökonomischen und soziokulturellen Rolle des Dritten Sektors in Israel ................48 Benjamin Gidron

The Evolution of the Economic and the Socio-Political Roles of the Third Sector in Israel .........................48 Benjamin Gidron

In 80 Jahren um die Welt.......................................................52 W. Michael Blumenthal

Around the World in Eighty Years ....................................................52 W. Michael Blumenthal

„Scherk ist wieder da“ – eine Firmengeschichte in Deutschland....................................55 Iris Blochel-Dittrich, Leonore Maier

“Scherk is back”: The History of a German Company ..................................................55 Iris Blochel-Dittrich, Leonore Maier

Die „Chai-Rollers“: Wofür amerikanisch-jüdische Teenager ihre Schekel ausgeben .............................................6 0 Micol Ostow

Chai Rollers: How Jewish Teens Spend Their Shekels .........................................6 0 Micol Ostow

Ein großer Philanthrop – Nachruf auf Eric F. Ross................62 W. Michael Blumenthal

A Great Philanthropist—In Memoriam: Eric F. Ross .......................62 W. Michael Blumenthal

INSIDE JMB

Aktuelle Ausstellungen ...........................................................26 Neues aus der Sammlung .......................................................30 Preis für Verständigung und Toleranz ....................................32 Die Akademie des Jüdischen Museums Berlin ........................3 4 Bildung & Medien .................................................................36 Interview ................................................................................38 Vorschau ................................................................................4 0

Current Exhibitions .............................................................................. 27 News from our Collection.................................................................... 31 Prize for Understanding and Tolerance ...........................................33 The JMB Academy................................................................................ 35 Education & Media................................................................................ 37 Interview ................................................................................................ 39 Preview................................................................................................... 4 0

IMPRESSUM / CREDITS

Der Artikel von Corinne und Robert Sauer stammt von: / The article by Corinne and Robert Sauer was first published at: www.acton.org. Wir danken Doron Rabinovici für die Bereitstellung seines Textes aus: / Many thanks to Doron Rabinovici for his article from: „Credo und Credit“, © Suhrkamp Verlag, Frankfurt am Main 2001. Dank geht auch an den Propyläen Verlag für die Genehmigung des Abdrucks des Textes von Michael Blumenthal. Further thanks go out to the Propyläen Verlag for granting the rights to reprint the translation of Michael Blumenthal’s Text. Er erschien zuerst in / It was first published in: W. Michael Blumenthal „In achtzig Jahren um die Welt – Mein Leben“. Übersetzung ins Deutsche / German Translation: Klaus-Dieter Schmidt. Falls Rechte (auch) bei Anderen liegen sollten, werden die Inhaber gebeten, sich zu melden. Should rights (also) lie with others, please inform the publisher.

© Stiftung Jüdisches Museum Berlin, 2010 Herausgeber / Publisher: Stiftung Jüdisches Museum Berlin Redaktion / Editor: Marie Naumann, Eva Kaufmann (Assistenz / assistance) Email: publikationen@jmberlin.de Übersetzungen ins Englische / English Translation: Maggie Bell (S./pp.: 17ff., 31-37, 55ff.), Allison Brown (S./pp.: 13ff, 29, 39, 42ff, 62) Übersetzungen ins Deutsche / German Translation: Michael Ebmeyer Englisches Lektorat / English Copy Editing: Liesel Tarquini Englisches Korrektorat / English Proof Reading: Naomi Lubrich Anzeigen / Advertising: Anja Butzek, Assistenz: Daniela Eck, Anne Saure Gestaltung / Design: Eggers + Diaper Druck / Printed by: Medialis, Berlin Abonnements und Bestellungen / Abonnements and Ordering Janine Lehmann, Tel.: +49 (0)30 25993 410, info@jmberlin.de Gefördert durch den Beauftragten der Bundesregierung für Kultur und Medien. Sponsored by the Federal Commissioner for Cultural and Media Affairs. Stiftung Jüdisches Museum Berlin Lindenstraße 9–14 D–10969 Berlin Tel.: +49 (0)30 25993 300 www.jmberlin.de

Bildnachweis / copyright: © bpk / Nationalgalerie, SMB, Foto: Jörg P. Anders, S. 31 rechts/right © Getty Images, Foto: David Silverman, S. 8 © Getty Images, Foto: Mario Tama, S. 6 © istockphoto, S. 60/61 © JMB, S. 41, 43-45 © JMB, Rendering: bromsky, S. 34/35 © JMB, Foto: Svea Pietschmann, S. 37 © JMB, Foto: Sönke Tollkühn, S. 3, 62 © JMB, Foto: Jens Ziehe: S. 4, 7, 10, 26/27, 29 rechts/right, 57, 58 © Micha Kirshner: Cover, S. 5 © Mimi Levy Lipis, S. 28 © Noel Tovia Matoff, S. 32 links/left © Privatsammlung, Foto: Jens Ziehe: S. 29 links/left © Stadtarchiv Nürnberg, S. 25 © The Israel Museum, Foto: Jens Ziehe: S. 31 links/left © Time & Life Pictures/Getty Images, S. 9 © Wall AG, S. 38

J M B JOURNAL

11


Daten und Fakten Facts and Figures

Summe, die sich Antonio in Shakespeares „Kaufmann von Venedig“ vom Juden Shylock leiht, in Dukaten

3.000

Frist, innerhalb der er sie zurückzahlen muss, in Tagen Jahr, in dem das Zinsverbot aus dem christlichen Kirchengesetz gestrichen wird

90 1983

Anzahl jüdischer Feiertage im Jahr 2011, an denen gearbeitet werden darf (außerhalb Israels)

15

Anzahl jüdischer Feiertage im Jahr 2011, an denen Arbeit verboten ist

18

Anzahl jüdischer Feiertage im Jahr 2011, an denen Arbeit vermieden werden sollte oder mit Einschränkungen erlaubt ist

11

Als Präsident Bush 2002 eine Veränderung des Mindestlohngesetzes zu Ungunsten der Arbeitnehmer durchsetzte, baten jüdische Arbeitnehmer um eine rabbinische Stellungnahme. Die Rabbiner argumentierten unter Berufung auf die Mischna, dass Vermeidung von Armut zu den wichtigsten Prinzipien der jüdischen Wohlfahrtspflicht gehört. Anteil der staatlichen Förderung an der Finanzierung des gemeinnützigen Sektors in Israel

59,1%

Anteil der staatlichen Förderung an der Finanzierung des gemeinnützigen Sektors in Deutschland

42,5%

Anteil der staatlichen Förderung an der Finanzierung des gemeinnützigen Sektors in den USA

25,6%

Prozentsatz der erwachsenen Bevölkerung in Deutschland, die ehrenamtlich tätig ist

10%

Prozentsatz der erwachsenen Bevölkerung in den USA, die ehrenamtlich tätig ist

22%

Prozentsatz der erwachsenen Bevölkerung in Israel, die ehrenamtlich tätig ist Mitarbeiter der Firma Scherk im Jahr 1933 Mitarbeiter der zurückgekauften Firma Scherk bei Produktionsbeginn im Jahr 1951 Mitarbeiter der Firma Scherk im Jahr 1966 Gesellen im Jahr 1913, die organisiert auf Wanderschaft gingen (geschätzt) Gesellen im Jahr 2010, die organisiert auf Wanderschaft gehen (geschätzt) Anzahl der Kleiderstücke inklusive Zubehör, die eine vollständige Gesellenkluft ausmachen Amount that Antonio borrows from the Jew, Shylock, in Shakespeare’s Merchant of Venice in ducats Period of time in which he has to repay the loan in days Year in which the prohibition of interest was erased from Christian Canon Law

6% > 400 22 165 1.500 400 10 3,000 90 1983

Number of Jewish holidays in 2011 on which work is permitted (outside Israel)

15

Number of Jewish holidays in 2011 on which work is forbidden

18

Number of Jewish holidays in 2011 on which work should be avoided or is permitted with certain restrictions

11

When President Bush effectuated a change to the Minimum Wage Law in 2002 that negatively affected the situation of the employees, Jewish employees asked for a rabbinical statement. The Rabbis referred to the Mishna and argued that prevention of poverty is one of the most important responsibilities of Jewish welfare. Share of governmental support to the non-profit sector in Israel

42.5%

Share of governmental support to the non-profit sector in the USA

25.6%

Percentage of adult population volunteering in Germany

10%

Percentage of adult population volunteering in the USA

22%

Percentage of adult population volunteering in Israel Number of Scherk cosmetic company employees in 1933 Number of Scherk employees after reacquisition at the start of production in 1951 Number of Scherk employees in 1966

6% > 400 22 165

Number of organized craftsmen who set out on a journey in 1913 (estimated)

1,500

Number of organized craftsmen who set out on a journey in 2010 (estimated)

400

Number of articles of clothing including accessories that constitute a complete craftsman’s traditional dress

12

59.1%

Share of governmental support to the non-profit sector in Germany

J M B JOURNAL

10


Der Gläubige als Gläubiger Einige Überlegungen zum Antisemitismus

Creed and Credit Some Thoughts on Anti-Semitism Dieser Artikel basiert auf dem Essay „Credo und Credit“, erschienen in: Doron Rabinovici: Credo und Credit, Frankfurt am Main (Suhrkamp) 2001. This article is based on the essay „Credo und Credit“ by Doron Rabinovici, in: Credo und Credit, Frankfurt / Main (Suhrkamp) 2001.

Doron Rabinovici

In the beginning was the Jew, and the Jew was with God, and with God he was not willing to believe in the Passion of Christ. And the Jew was deemed the murderer of the God, who was worshipped by those in whose community he was damned to live. He was to provide creed (Credo) and credit (Credit) for the Christians. He was to lend the Occident truth (Wahrheit) and valuta (Währung). He was creditor (Gläubiger) and a person of greater faith (Gläubigere) as under the Old Covenant. Not only did he watch over the money, but also over the commandments of the One Almighty God. The People of the Book had to do the bookkeeping. The Jew was to refer to that which had been originally recorded and say, “As it is written!” He reminded the Christians of the arrears from the earliest scrolls and of the obligations of recent agreements. He reminded them of the burden of guilt (Schuld) and of debt (Schulden), of the origin of God and of money. The Occident needed the Jew. The language to which I am devoted, the German language, suggests a perspective in which the economic and religious roles of Jews merge.* The parallel expressions denote a worldview that is unable to distinguish between economic and spiritual orders, yet at the same time accuses precisely the Jews of this lack of differentiation, claiming that they profit from morality and that profit becomes their sole morality. It is as if we were looking at a drawing by M.C. Escher, in which two images overlap. The Jew is to be seen at the interface. The Occident borrowed God and gold from the Jew. Like Escher’s famous double-edged sketches, there are two aspects, two perspectives that are intertwined. Was the Jew despised because he worked with money, or did he have to work with money because he was despised? From a historical perspective, money might very well be of divine or at least cultic origin.1 The Latin pecunia is derived from pecus or cattle, which were also offered up to the gods and whose image was printed on coins. This was the case in the temple of the god Juno, whose epithet was therefore Moneta. It was the priests who recorded how many gifts were presented. The etymology of the word for money can * Translator’s note: The author draws upon the etymological similarities between these terms in German. This parallelism also exists to some extent in English, if not always in etymological terms then at least semantically. Obviously, creed and credit both come from the Latin credere, “to believe or trust.” “Truth” is related to “validity,” which has the same root, meaning “having strength or value,” as “valuta.” While the root of the English “creditor” is generally no longer directly associated with “trust” or “faith,” in fact the creditor shows good faith toward his debtors, as people of faith show in their God. “Guilt” and “debts” are related semantically in English, both denoting a burden, whether moral or material.

Am Anfang war der Jude und der Jude war bei Gott, war bei Gott nicht bereit, an die Passion Christi zu glauben. Und der Jude war zum Mörder des Gottes gestempelt worden, den diejenigen verehrten, in deren Gemeinde er zu leben verdammt war. Die Christen hatte er mit Credo und Credit zu versorgen. Er sollte dem Abendlande Wahrheit und Währung leihen. Er war der Gläubiger und der Gläubigere im Sinne des alten Bundes. Er hütete nicht bloß das Geld, sondern ebenso die Gebote des einen, allmächtigen Gottes. Das Volk des Buches musste jenes der Buchhaltung sein. Der Jude sollte auf das ursprünglich Verbuchte verweisen und sagen: „Es steht geschrieben!“ Er erinnerte die Christen an die Rückstände aus den frühesten Schriftrollen und an die Verbindlichkeiten jüngster Abmachungen. Er gemahnte an Schuld und Schulden, an den Ursprung Gottes und des Geldes. Der Okzident brauchte den Juden. Die Sprache, die deutsche, der ich verschrieben bin, legt mir eine Perspektive nahe, in der die ökonomischen und religiösen Rollen des Juden zur Deckung kommen. Hinter den Ausdrücken verbirgt sich ein Weltbild, das zwischen wirtschaftlicher und geistiger Ordnung nicht unterscheiden kann, aber zugleich diese mangelnde Differenzierung just dem Juden vorwirft und behauptet, jener schlage aus der Moral bloß Profit und mache den Profit zu seiner einzigen Moral. Es ist, als schauten wir auf eine jener Zeichnungen von M.C. Escher, in denen zwei Ansichten einander überschneiden. In der Mitte ist der Jude zu sehen. Das Abendland lieh sich Gott und Gold von ihm. Wie auf jenen berühmten doppeldeutigen Skizzen des Künstlers sind zwei Aspekte, zwei Sichtweisen ineinander verschränkt. Wurde der Jude verachtet, weil er mit Geld handelte, oder musste er mit Geld handeln, weil er verachtet wurde? Historisch gesehen, ist Geld womöglich göttlichen, zumindest kultischen Ursprungs.1 Das lateinische pecunia leitet sich von pecus, dem Vieh, her, das auch den Göttern dargebracht wurde und dessen Bild auf Münzen geprägt wurde, etwa im Tempel der Göttin Juno, deren Beiname deshalb Moneta war. Die Priester waren es, die festhielten, wie viele Gaben überreicht worden waren. Die Etymologie des Wortes Geld lässt auch in anderen Sprachen an diesen Zusammenhang denken. Die Tempel versahen die Münzen mit ihrem Siegel, horteten sie jedoch nicht bloß, sondern verwerteten sie weiter. So wurden sie zu den „ersten Bankinstituten“.2

J M B JOURNAL

13


be traced to this context in other languages as well. Temples furnished coins with their seal, yet rather than hoarding continued to use them thus becoming the “first banks.” 2 This reveals perhaps not only the origins of money, but also the religious character of capitalism. Or would it even be fitting to speak of “capitalism as religion,” as asserted by Walter Benjamin?3 A religion was needed that was able to distinguish between money and the rest of the economy and to link all believers irrespective of nationality. Christianity offered this option. Jesus had expelled all traders from the temple. Money was no longer to be found within the sphere of that which was holy. He urged giving to Caesar what belonged to Caesar and to God what belonged to God. This belief and its apocalyptic hope for a day of judgment, when debt of every kind would be accounted for and settled, became the uniform, general value system within the massive economic realm. In the old religions, sacrifice was to reconcile the community with God, a society, which was divided through wealth and poverty and through the original emergence of property. In Christianity, salvation came about through Jesus’s sacrifice, but the guilt for this was transferred elsewhere, just as the traders had been banned from the Temple. And just as priests and priest-kings used to execute sacrifices, the act was recalled in Holy Mass, but blamed on the Jews. They were said to be the murderers of the savior, Judas having betrayed him for thirty pieces of silver. In the beginning was the Jew. The Occident needed him. Hatred toward the commandments of the Almighty God, the severity of monotheism, and the laws of the credit economy, the rule of money, and the God of all commodities, could be deflected onto the Jews. Whereas money was once invented to symbolize the sacrifice, now hosts were made to symbolize the flesh of the Son of God, which the congregation received in order to be redeemed through consumption. The guilt for this seemingly cannibalistic ritual was awarded to the Jews however. According to Jochen Hörisch “it is not coincidence that both the host and the coin resemble each other in their design; both must be issued by an authority; both have two sides; both raise the Faustian question of whether the thing is sacred or profane.”4 Christianity emerged in opposition to trade with money, but it did not abolish money and did not replace it, but instead separated “good money” from “bad money.” The good

14

J M B JOURNAL

Vielleicht offenbart sich hier nicht bloß das Herkommen des Geldes, sondern der religiöse Charakter des Kapitalismus. Oder ist gar der „Kapitalismus als Religion“ anzusehen, wie Walter Benjamin meinte?3 Es brauchte eine Religion, die zwischen Geld und dem Rest der Wirtschaft zu trennen und die alle Gläubigen jenseits ihrer Nationalität zu einen wusste. Das Christentum bot diese Möglichkeit. Jesus hatte die Händler aus dem Tempel verjagt. Das Geld sollte nicht mehr im Bannkreis des Heiligen sein. Er hatte erklärt, es möge dem Kaiser gegeben werden, was des Kaisers ist; für Gott solle verbleiben, was Gottes ist. Dieser Glaube und seine apokalyptische Hoffnung auf einen Jüngsten Tag, an dem die Schulden jeglicher Art abgerechnet und beglichen werden müssten, wurde zum einheitlichen, allgemeinen Wertesystem im riesigen Wirtschaftsreich. In den alten Religionen sollte das Opfer die Gemeinschaft mit Gott und die Gesellschaft an sich versöhnen, die durch Reichtum und Armut, durch das erste Entstehen von Eigentum, gespalten war. Im Christentum erwuchs ebenfalls aus der Opferung Jesu ein Heil, aber die Schuld dafür wurde ausgelagert, so wie die Händler aus dem Tempel verwiesen worden waren. Hatten früher Priester und Priesterkönige das Opfer zu vollziehen, so wurde die Tat zwar in der heiligen Messe erinnert, aber den Juden angelastet. Sie, hieß es, wären die Mörder des Erlösers gewesen, nachdem Judas ihn für dreißig Silberlinge verraten hätte. Am Anfang war der Jude. Das Abendland brauchte ihn. Der Hass gegen die Gebote des allmächtigen Vatergottes, gegen die Strenge des Monotheismus und gegen die Gesetzmäßigkeiten der Kreditwirtschaft, der Herrschaft des Geldes, des Gottes aller Waren, konnte auf die Juden abgelenkt werden. War einst das Geld erfunden worden, um das Opfer zu versinnbildlichen, so wurden nun Hostien geprägt, um jenes Fleisch des Gottessohnes zu symbolisieren, das sich die Gemeinde der Gläubigen durch Verzehr einverleibte, um erlöst zu werden. Die Schuld für dieses kannibalisch anmutende Ritual wurde aber den Juden zugesprochen. „... beide, die Hostie wie die Münze, ähneln schon in ihrem Design nicht ohne Grund einander; beide müssen von Autoritäten emittiert werden; beide haben zwei Seiten; angesichts beider stellt sich die faustische Frage, ob das Ding heilig sei oder profan“, meint dazu Jochen Hörisch.4 Das Christentum ist in Opposition zum Geldhandel entstanden, hat aber das Geld nicht abgeschafft und


money came from God and was embodied in the host; the bad money came from the Jews. The Jew, murderer of God, was accused of stabbing the hosts—the body of Christ—until they bled. The Jew was said to nourish himself from the blood of Christian children. The Jew, the debt collector, sucked the Christians dry. Blood and money, sacrifice and interest, are equated in these myths. The Jew tapped into that which circulates throughout the Christian community and keeps it alive. Bar a few historical exceptions the Jews were to fulfill those functions that were forbidden for Christian groups and were forced into, and associated with, the sphere of currency circulation as a result of bans. The ban on collecting interest from fellow believers was also familiar to the Jews. Christians were expressly prohibited from collecting interest since the fourth century. Although the Lombards in northern Italy and the Cahorsians in France did collect interest, monetary transactions were generally transferred to the Jews. 5 Feudal lords profited from money-lending through the Jewish tax. They used the Jews as a financial sponge. The population saw the demands of the moneylenders, but not the profit of the territorial lords. Thus the Jews became an Occidental “caste-nation” and a plaything in the power struggle among social classes. The Third Lateran Council in 1179 condemned and prohibited usury. At the Council of Vienne in 1311 it was declared that “usury” was tantamount to heresy. 6 Jews were imputed with self-segregation and with possessing access to secret knowledge and secret languages. They were also envied and feared because they could speak the holy language, Hebrew, and knew how to communicate with each other in Yiddish. This is why they were accused of “mauscheln,” a German word derived from the Jewish first name for men, Moishe. “Here mauscheln clearly means to extort usurious interest in the manner of a Jew,” wrote Sander L. Gilman. 7 Whether in theology or economics, the Occident always set aside the most negative tasks and imposed them upon the Jews. The Jew was given the job of passing down and administering metaphysical and pecuniary values, creed and credit. He made reference to the laws and to scripture, to the Book of Books and to bookkeeping. This was where records were taken about what moral and monetary debts had to be settled. He was not simply excluded from the holy mass, but also from the farmer and craft markets that were held near the church following religious services on

wurde von ihm nicht ersetzt, sondern trennte das „gute Geld“ vom „schlechten“. Das gute stammt von Gott und wird von der Hostie verkörpert; das schlechte vom Juden. Dem Juden wurde vorgeworfen, er, der Gottesmörder, steche die Hostien, das Fleisch Christi, bis sie bluteten. Er nähre sich vom Blut der Christenkinder. Der Jude, der Geldeintreiber, sauge die Christen aus. Geld und Blut, Opfer und Zins, werden in diesen Mythen gleichgesetzt. Der Jude zapfe ab, was in der christlichen Gemeinde zirkuliert und sie am Leben erhält. Durch Verbote in die Zirkulationssphäre abgedrängt und mit ihr assoziiert, hatten die Juden jene Funktion zu erfüllen, die christlichen Gruppen, bis auf wenige historische Ausnahmen, verboten waren. Das Verbot, Zins von Glaubensbrüdern zu nehmen, kannten auch die Juden. Christen war das Zinsnehmen seit dem 4. Jahrhundert ausdrücklich untersagt. Zwar übten in Norditalien die Lombarden, in Frankreich die Kawerzen den Kreditverleih aus, aber zumeist wurde das Geldgeschäft den Juden übertragen.5 Die Feudalherren profitierten über eine Judensteuer an dem Geldgeschäft. Sie benutzten die Juden als finanziellen Saugschwamm. Die Bevölkerung sah bloß die Forderung des Kreditverleihers und nicht den Gewinn des Landesherren. So wurden die Juden zum abendländischen Kastenvolk und zu einem Spielball im Machtkampf der Klassen. Das dritte Laterankonzil 1179 befand, dass „Wucher“ verboten sei, und auf dem Konzil von Vienne 1311 wurde klargestellt, dass „Wucher“ mit Häresie, mit Ketzerei, gleichzusetzen sei.6 Den Juden wurde unterstellt, sich abzusondern, über geheimes Wissen zu verfügen, und sich heimlicher Sprachen zu bedienen. Sie wurden unter anderem beneidet und gefürchtet, weil sie die heilige Sprache, Hebräisch, konnten und sich untereinander in Jiddisch zu verständigen wussten; deshalb wurde ihnen vorgeworfen zu „mauscheln“. Mauscheln ist eine deutsche Wortbildung, abgeleitet vom Eigennamen Moishe. „Hier bedeutet mauscheln eindeutig: Wucherzinsen kassieren wie ein Jude“, schreibt Sander L. Gilman. 7 Ob in Theologie oder Ökonomie, stets gliederte das Abendland die heikelsten Aufgaben aus. Es bürdete sie dem Juden auf. Den Juden wurde auferlegt, metaphysische und pekuniäre Werte, Credo und Credit, zu überliefern und zu verwalten. Er verwies auf die Gesetze und auf die Schrift, auf das Buch der Bücher und auf die Buchhaltung. Hier war verzeichnet, welche Schuld und welche Schulden zu begleichen waren.

J M B JOURNAL

15


Christian holidays. He was identified not with productive capital, but with filthy mammon. Not only material values, also non-material ones are subject to continuous change over time. If the existing value system was despised, if people were afraid of changing values, decline, and inflation, and if upheaval and an apocalypse were anticipated, then the Jew was to blame for it. Jews have been made responsible for a decline in values again and again. The existing order collapsed in Western Europe in the late Middle Ages. Crafts and trade flourished, but agriculture faced a crisis. There was an increased demand for credit, but the volume of available capital was limited. Christians pushed their way into the blossoming monetary economy. Complaints of “usurers” were no longer raised against all forms of interest-trading, but solely against that by the Jews. Host and coin, moral and monetary debt, blood and money, truth and valuta, mass and markets were set against each other in Christianity as equivalent antipodes, and simultaneously equated. Creed and credit had to be separated in order to conceal any and all affiliation or analogies. To this end, creditors were needed who could be anathematized as the murderer of God. In the beginning was the Jew, and the Jew was with God, and the Jew became money. That was the sound of the counterpoint of Jewish life in Europe over the centuries. The trail of blood left by anti-Semitism was like a leitmotif carried throughout the history of the Occident, because Christianity could always respond with yet another pogrom. Doron Rabinovici was born in Tel Aviv and has lived in Vienna since 1964. He works as a writer, essayist, and historian. His latest novel, “Andernorts,” was published in 2010 (Suhrkamp Verlag, Berlin).

1 See Bernhard Laum, Heiliges Geld. Eine historische Untersuchung über den sakralen Ursprung des Geldes, cited in: Christoph Deutschmann, Die Verheißung des absoluten Reichtums. Zur religiösen Natur des Kapitalismus (Frankfurt am Main and New York: Campus, 1999), 80–85; Wilhelm Gerloff, Die Entstehung des Geldes und die Anfänge des Geldwesens (Frankfurt am Main: Klostermann, 1940); Horst Kurnitzky, Triebstruktur des Geldes. Ein Beitrag zur Theorie der Weiblichkeit (Berlin: Wagenbach, 1976); Horst Kurnitzky, Der heilige Markt. Kulturhistorische Anmerkungen (Frankfurt am Main: Suhrkamp, 1994). 2 Laum, 139; cited in Deutschmann, Verheißung, 82. 3 Walter Benjamin, “Capitalism as Religion,” [1921] in: Selected Writings, vol. 1 (1913–1926), ed. Michael W. Jennings (Cambridge, MA: Harvard University Press, 2004), 288. 4 Jochen Hörisch, Heads or Tails: The Poetics of Money, translated by Amy Horning Marschall (Detroit, MI: Wayne State University Press, 2000), 27. 5 Anna Drabek, “Judentum und christliche Gesellschaft im hohen und späten Mittelalter,” in: Das österreichische Judentum, ed. Kurt Schubert and Nikolaus Vielmetti (Vienna, Munich, Jugend und Volk), 1988. 6 Ibid. 7 Sander L. Gilman, Jewish Self-Hatred: Anti-Semitism and the Hidden Language of the Jews (Washington, DC: Johns Hopkins University Press).

16

J M B JOURNAL

Er war nicht bloß von der heiligen Messe ausgeschlossen, sondern ebenso von der Marktmesse der Bauern und der Handwerker, die zu christlichen Feiertagen nach dem Gottesdienst und nahe der Kirche abgehalten wurde. Er wurde nicht mit dem schaffenden Kapital identifiziert, sondern mit dem schlechten, dem raffenden. Nicht bloß die materiellen, sondern ebenso die ideellen Werte unterliegen einem fortwährenden Wandel im Zeitenwechsel. Wenn die bestehenden Wertesysteme gehasst, Wertewandel, Niedergang und Inflation gefürchtet, Umbrüche und Apokalypsen erwartet wurden, dann hieß es, an allem wäre der Jude schuld. Der Werteverfall wurde immer wieder den Juden vorgeworfen. Im späten Mittelalter des westlichen Europas brach die bisherige Ordnung auseinander. Handwerk und Handel florierten, die Landwirtschaft geriet in Krise, der Kreditbedarf stieg, das Kapitalvolumen war knapp. Christen drängten in die aufblühende Geldwirtschaft. Das Klagen über das „Wuchern“ richtete sich nun nicht mehr gegen jeden Zinshandel, sondern bloß noch gegen den jüdischen. Hostie und Münze, Schuld und Schulden, Blut und Geld, Wahrheit und Währung, Messe und Handel wurden im Christentum einander als Äquivalent und Antipoden gegenübergestellt und zur selben Zeit gleichgesetzt. Credo und Credit mussten voneinander getrennt werden, um jegliche Verwandtschaft und alle Analogien zu kaschieren. Dazu brauchte es Gläubiger, die als Gottesmörder verflucht werden konnten. Am Anfang war der Jude, und der Jude war bei Gott, und der Jude ist Geld geworden. So klingt über alle Jahrhunderte hinweg der Kontrapunkt jüdischen Lebens in Europa. Wie ein roter Faden zieht sich die Blutspur des Antisemitismus durch die Geschichte des Abendlandes, denn das Pogrom war allemal eine Möglichkeitsform des Christentums. Doron Rabinovici, geboren in Tel Aviv, lebt seit 1964 in Wien. Er arbeitet als Schriftsteller, Essayist und Historiker. Sein letzter Roman „Andernorts“ erschien 2010 (Suhrkamp Verlag, Berlin). 1 Siehe: Bernhard Laum: Heiliges Geld. Eine historische Untersuchung über den sakralen Ursprung des Geldes, Tübingen 1942, zitiert nach: Christoph Deutschmann: Die Verheißung des absoluten Reichtums. Zur religiösen Natur des Kapitalismus, Frankfurt am Main, New York 1999, S. 80–85. – Wilhelm Gerloff: Die Entstehung des Geldes und die Anfänge des Geldwesens, Frankfurt am Main 1940. – Horst Kurnitzky: Triebstruktur des Geldes. Ein Beitrag zur Theorie der Weiblichkeit, Berlin 1976. – Horst Kurnitzky: Der heilige Markt. Kulturhistorische Anmerkungen, Frankfurt am Main 1994. 2 Laum, S. 139, zitiert nach Deutschmann: Verheißung, S. 82. 3 Walter Benjamin: Fragmente. Autobiographische Schriften. Gesammelte Schriften, Band VI, unter Mitwirkung von Theodor W. Adorno und Gershom Scholem, herausgegeben von Rolf Tiedemann und Hermann Schweppenhäuser, Frankfurt am Main 1991, S. 100. 4 Jochen Hörisch: Kopf oder Zahl. Die Poesie des Geldes, Frankfurt am Main 1996, S. 33. 5 Anna Drabek: Judentum und christliche Gesellschaft im hohen und späten Mittelalter, in: Dies., Kurt Schubert, Nikolaus Vielmetti (Hg.): Das österreichische Judentum, Wien, München 1988, S. 25–57. 6 Drabek, S. 47. 7 Sander L. Gilman: Jüdischer Selbsthaß. Der Antisemitismus und die verborgene Sprache der Juden, Frankfurt am Main 1993, S. 95.


Dialektik jüdischer Wirtschaftsethik Dialectic of Jewish Business Ethics

Nathan L. Kaplan

The term “business ethics” might appear to be an oxymoron. Can profit maximization, performance pressure and inequality be reconciled with morality, good life and just behavior? Adding the adjective “Jewish,“ the concept of business ethics becomes potentially even more contradictory. A look at various Jewish businessmen and women shows, on the one hand, Aaron Feuerstein, owner and CEO of a successful US textile factory, who continued to pay his 3,000 employees salaries totalling $25 million after his factory was destroyed in a fire. He had no legal obligation to do so; instead he based his actions on what he publicly called Jewish values. Bernard Madoff, on the other hand, swindled his investors, most of whom were Jewish, out of approximately $50 billion. Simultaneously, he served on the boards of numerous Jewish foundations and congregations. Or let’s compare full-time student David, earning his livelihood with Torah study, to Lisa, a modern-orthodox investment banker. These four people consciously identify themselves as Jews, they are active in the same capitalist free-market economic system, and yet offer very different answers to the fundamental question of ethics: What should I do? Oppositions and contradictions occur in practice, but also appear in the earliest source of Jewish teachings on the economy. The Chumash (the five books of Moses), which is the historical and ideational foundation of Judaism, reveals a dialectical tension regarding productivity and commerce. On the one hand, it contains many work-related imperatives: Six days per week you must take care of business! Every year, for a period of six years, you must engage in agriculture! commands the Bible. But on the seventh day, the annual holidays, and during the Sabbatical year (every seventh year, called shmita in Hebrew), you shall rest from your work. Although in our times the one-day weekend appears like the idea of a workaholic, the Chumash treats rest and holidays as holy. Many believe, today, that holidays offer us time to “recharge” and to return to work with more energy. In the Chumash, the reasoning is the other way around: the meaning and purpose of work is to achieve the hallowed repose. Yet if the transcendence of productivity is so valuable, then why aren’t there three-day weekends? Is the weekly 6-to-1 ratio of work to rest perhaps the perfect balance? Shouldn’t we then protest the two-day weekend’s desecration of a divine workday? Until now, enraged demonstrators from ultra-orthodox

Der Begriff Wirtschaftsethik erscheint vielen bereits als Widerspruch in sich. Sind Profitstreben, Leistungszwang und Ungleichheit mit Reflexionen über Moral, gutes Leben und richtiges Handeln überhaupt zu vereinbaren? Ergänzt um das Adjektiv „jüdisch“ sieht sich die Wirtschaftsethik von weiteren möglichen Gegensätzen geprägt. Das ist leicht anhand des Pluralismus jüdischer Akteure im Wirtschaftsleben zu erkennen: Auf der einen Seite finden wir Aaron Feuerstein, der nach der Zerstörung seiner US-amerikanischen Textilfabrik durch einen Brand Gehälter von insgesamt 25 Millionen US-Dollar an seine 3.000 Angestellten weiterzahlte, obwohl er hierzu gesetzlich nicht verpflichtet war, und diese Tat ausdrücklich mit jüdischen Werten begründete. Auf der anderen Seite gibt es einen Bernard Madoff, der, während er seine (zum größten Teil jüdischen) Investoren um etwa 50 Milliarden US-Dollar betrog, gleichzeitig in diversen jüdischen Gemeinden und Stiftungen aktiv war. Oder vergleichen wir einmal den Vollzeitstudenten David, der seinen Lebensunterhalt mit dem Torastudium verdient, mit der modernorthodoxen Investmentbankerin Lisa: vier Menschen, die alle eine bewusste Identifikation mit der gleichen Religion teilen, im selben marktwirtschaftlich-kapitalistischen Wirtschaftssystem tätig sind, und doch eine sehr unterschiedliche Antwort auf die grundlegende Frage der Ethik leben: „Was soll ich tun?“ Gegensätze und Widersprüche bestehen nicht nur in der Praxis, sondern finden sich bereits in den Quellen jüdischer Wirtschaftsethik. Schon der Chumasch (die fünf Bücher Moses), der die historisch-ideelle Grundlage des Judentums bildet, weist eine dialektische Spannung auf, wenn es um Produktivität und Handel geht. Einerseits enthalten die Bücher zahlreiche zur Arbeit aufrufende Imperative: Sechs Tage sollst Du arbeiten und alle Geschäfte verrichten! Jedes Jahr, sechs Jahre lang, sollst Du Landwirtschaft betreiben!, befiehlt der biblische Gesetzgeber. Andererseits soll am siebten Tage, während der jährlichen Feiertage und im alle sieben Jahre wiederkehrenden Sabbatjahr, die Arbeit ruhen. Auch wenn das Eintageswochenende heutzutage wie der Einfall eines Workaholics wirkt, macht der Chumasch doch deutlich, dass die Ruhe und die Festtage tatsächlich heilig sind. Man ruht sich nicht in erster Linie aus, um wieder arbeiten zu können, Sinn und Zweck der Arbeit ist vielmehr die geheiligte Ruhe selbst. Wenn aber die Transzendenz der Produktivität so

J M B JOURNAL

17


circles have attacked so-called Shabbat desecrators. Why don’t the latter conversely block the Israeli beaches that religious Jews visit on Fridays and admonish them to become more productive, like the Biblical Jacob: “My brothers, we may drive our cars on the day of rest, but you are idling away a day of work at the beach!“ The oppositions and contradictions continue. On the one hand, the Chumash institutionalizes private property, through the obligation to neither steal nor covet the belongings of others. The latter might never have been easy to comply with, and today’s privatelyowned islands, beach villas, and luxury yachts probably don’t make it any easier. The Pentateuch addresses this issue by limiting the institution of private property and granting it only temporarily. In this spirit, one may eat from other people’s fields, and every fifty years, in the Jubilee year, servants must be freed, debts forgiven, and plots of land (apart from a few exceptions) returned to their original owners or their heirs. But if desiring others’ property should be circumvented and the regulation of ownership conditions is understood as attempting to prevent extreme inequality, then why is the right to private property institutionalized in the first place? If the Bible values economic equality, then why aren’t bondmaids and bondsmen, financial debts, and trade in private estates prohibited? Such paradoxes are perhaps intrinsic to monotheism, since its one and only God creates life as well as death, the abundance of creation as well as deprivation. Given that an all-encompassing, omnibenevolent God created these apparently contradictory phenomena, it is at least comforting that divine law establishes norms to deal with them. This also applies to poverty and other forms of social misery. Hence there are many provisions for handling the unequal distribution of wealth; for instance the interest prohibition on emergency loans, the obligation to make charitable donations, and numerous agricultural tithes. God acts both idealistically and pragmatically. Humans may be created in His image but they nonetheless need to be nudged towards good behavior with sticks (curses) and carrots (blessings), also in the economic arena. Beyond legal norms, the Bible can offer lessons in business ethics through its protagonists. Moses, for example, is frequently presented in management science as a prime example of the so-called servantleader model: a humble and empathetic leader who places the interests of his subordinates before his own.

18

J M B JOURNAL

wertvoll ist, warum gibt es dann kein Dreitageswochenende? Ist das wöchentliche Arbeits-Ruhe-Verhältnis von 6 zu 1 bereits die perfekte Mischung? Sollte man dann nicht dagegen protestieren, dass durch das Zweitageswochenende ein Göttlicher Arbeitstag verfaulenzt wird? Bisher wurden sogenannte Entweiher des Schabbat durch wütende Demonstranten aus frommen Kreisen angegriffen. Wie wäre es, wenn diese sich nun revanchierten, indem sie die freitags von Frommen aufgesuchten israelischen Badestrände mit einer Sitzblockade unzugänglich machten und ihre Religionsgenossen nach dem Vorbild des biblischen Jakobs zur Produktivität ermahnten: „Meine Brüder, wir fahren zwar Auto am Ruhetag, aber ihr verbummelt einen Arbeitstag am Strand!“ Die Gegensätze und Widersprüche gehen weiter. Einerseits institutionalisiert der Chumasch Privateigentum, und zwar als Verpflichtung, den Besitz anderer weder zu stehlen noch zu begehren. Zumindest Letzteres war wohl schon immer schwierig, und in Zeiten von Privatinseln, Strandvillen und Luxusyachten fällt es nicht leichter. Damit hat der Pentateuch vielleicht gerechnet, denn Privateigentum wird nur begrenzt und auf Zeit gewährt. In diesem Sinne darf sich ein jeder am Feld des Nächsten satt essen, und in jedem Jubeljahr, das heißt alle 50 Jahre, müssen Diener freigesetzt, jegliche Schulden erlassen und Grundstücke (bis auf wenige Ausnahmen) an ihre ursprünglichen Besitzer bzw. deren Erben zurückgegeben werden. Wenn aber die Gier nach dem Eigentum anderer unterbunden werden und der Ausgleich der Eigentumsverhältnisse extreme Ungleichheit verhindern soll, warum wird dann ein Recht auf Privateigentum überhaupt gewährt? Wenn ökonomische Gleichheit vom biblischen Gesetzgeber geschätzt wird, warum werden dann Leibeigene, Schulden und Handel mit privatem Landbesitz zugelassen? Solche Paradoxien sind dem Monotheismus möglicherweise immanent, denn sein einer und einziger Gott erschafft sowohl das Leben als auch den Tod, sowohl die Fülle der Schöpfung als auch den Mangel. Wenn mit der Konzeption eines allumfassenden, wohlwollenden Gottes scheinbar widersprüchliche Phänomene in die Welt kommen, so ist es doch beruhigend, dass das Göttliche Gesetz durch Verfahrensregeln den Umgang mit ihnen kontrolliert. Dies gilt beispielsweise auch im Falle von Armut und anderen Formen des sozialen Elends. Entsprechend gibt es viele Bestimmungen für den Umgang mit ökonomischer Ungleichverteilung, wie z.B. das


But can, or should managers really identify with a prophet who gives up a well-protected life in one of the world’s most powerful families in order to become the leader of a horde of ungrateful slaves, shlepping through the desert with them for forty years, without himself ever reaching the promised land at the end of this ordeal? Neither are the inner lives of Biblical figures straightforward: Abraham, icon of lovingkindness and justice, hides his wife Sarah in a chest to smuggle her past Egyptian customs, then claims that she is his sister in order to save his own life; he later accepts as her alleged brother gifts and servants from the Egyptians, and finally leaves his wife alone in Pharaoh’s house. An accidental lapse, perhaps? Not at all: Abraham repeats his strategy—most probably a traumatic one for Sarah—with another king. Over the course of its history, Jewish business ethics has constantly been subject to dialectical strains. The oral Law of the Talmud—the core of current-day Judaism next to the Biblical scriptures—can be perceived as a rabbinical attempt to compensate for, and reconcile, the contradictions and conflicts between the moral ideals of Judaism and the empirical constraints of various particular socio-historical environments. For instance, the prohibition on charging interest became an obstacle to Jews in Babylonian exile, making it difficult for them to participate in an economy dependent on capital investment. The rabbis responded by developing the heter iska, which enables capital investing into businesses without the generated dividends being considered an interest payment. And with the prozbul the rabbis constructed a Halachic loophole which made it possible to circumnavigate the cancellation of debts during the Sabbatical year, thus ensuring that the indigent could receive emergency loans even right before the beginning of shmita —and that their creditors could still count on being paid back. Through the rabbinical oral Torah, new convictions and mind-sets developed over the course of history have become integrated into Jewish business ethics. In contrast to the Prophets’ condemnation of foreign rule, the Talmudic sage Samuel bar Abba, for instance, formulated his maxim of Dina de-malkhuta dina (the law of the land is the law), which enabled the integration of the Babylonian legal system into Halachah (Jewish law). Samuel had predicted that the legal isolation of the Jewish community could become dangerous in Babylon as well. Thus he institutionalized

Zinsverbot bei Notdarlehen, die Spendenpflicht sowie zahlreiche Ausgleichsregelungen in der Landwirtschaft. Gott wirkt sowohl idealistisch als auch pragmatisch. Der Mensch ist zwar in Seinem Ebenbild geschaffen, soll aber gleichzeitig mit Zuckerbrot (Segen) und Peitsche (Fluch) zum richtigen Handeln geleitet werden, auch in der Wirtschaft. Über rechtliche Normen hinaus werden wirtschaftsethische Lehren auch in biblischen Protagonisten entdeckt. Moses beispielsweise wird in der Managementlehre gerne als Paradebeispiel des sogenannten Servant-Leader-Modells präsentiert: Ein bescheidener und empathischer Anführer, der die Interessen seiner Untergebenen vor die eigenen stellt. Aber wollen oder sollten Manager sich überhaupt mit einem Propheten identifizieren, der ein gut behütetes Leben in einer der mächtigsten Familien der Welt aufgibt, um eine Horde undankbarer Sklaven anzuführen und sich mit ihnen 40 Jahre lang durch die Wüste zu schleppen, ohne selbst am Ende des Leidenswegs das Gelobte Land zu erreichen? Auch das Innenleben biblischer Protagonisten ist nicht eindeutig: Abraham, Sinnbild für Gutmütigkeit und Gerechtigkeit, versteckt seine Frau Sarah in einer Kiste, um sie an ägyptischen Grenzzöllnern vorbeizuschmuggeln, gibt sie zur Rettung seines eigenen Lebens als seine Schwester aus, empfängt als angeblicher Bruder Sarahs von den Ägyptern eine Vielzahl an Reichtümern und Dienern und lässt seine Frau dann alleine im Hause des Pharaos. Ein Ausrutscher vielleicht? Nein: Den für Sarah sicherlich traumatischen Schwindel wiederholt Abraham später mit einem anderen König. Jüdische Wirtschaftsethik unterliegt auch in ihrem historischen Verlauf ständigen dialektischen Spannungen. Die sogenannte mündliche Tora, neben der verschrifteten Bibel Kern des heutigen Judentums, kann demnach als rabbinischer Versuch gewertet werden, Widersprüche und Konflikte zwischen den moralischen Idealen des Judentums und empirischen Zwängen seines jeweiligen soziohistorischen Umfelds aufzuheben. Beispielsweise wurde das Zinsverbot im babylonischen Exil zunehmend zum Hemmnis einer erfolgreichen Teilhabe der Juden an einer von Investitionskrediten abhängigen Wirtschaft. Als Reaktion darauf entwickelten die Rabbinen das zugleich geniale und spitzfindige Konstrukt der Iska, das Beteiligungen an Unternehmensgewinnen ermöglichte, ohne dass diese formell Zinszahlungen auf investiertem

J M B JOURNAL

19


the religious obligation—still applicable today—for Jews to abide by the public, civil, and criminal law of the countries in which they live. Obviously, this results in a flood of contradictions within Halachah. The Chumash requires, for example, daily remuneration of wageworkers whereas in most countries, monthly payment is the norm. And according to the laws of ona’ah, which prohibit overcharging and underpaying, not only the market determines what a fair price is, but rabbis, too, are to provide their opinion. The Talmud is full of contradictions and paradoxes. In light of these tensions, it is no surprise that its basic methodology is dialectical, continually striving towards a synthesis of conflicting views. This dialectic also arises with every effort to integrate Jewish values, norms, and beliefs into today’s economic system, whether on an individual, corporate, or national level. Take for example the productivity imperative of Western capitalism, partly based on a belief in the notion that “time is money.” In light of this equation, I asked myself on my first project as a management consultant whether I should interrupt my work for Mincha and Ma’ariv, the midday and evening prayers. I decided to make a compromise and prayed unusually fast in the client’s stairwell. In order not to attract attention, I whispered into my Bluetooth headset so as to appear to be talking on my mobile phone (ever since, I’ve called it Jewtooth). Beyond ritual laws, it may be challenging to overcome the obstacles between certain tenets of a freemarket economy and those of Jewish business ethics. Halachah forbids deception. According to the economic concept of price discrimination, however, different market segments should be charged, if possible, varying prices for the same goods and services. But is it ethically justifiable to sell the same cheese under a different brand for a higher price? Is this misleading? A further example is the prohibition of Lifnei iver, which in its Biblical source literally forbids the laying of stones in the path of the blind, but which according to its rabbinical interpretation prohibits the exploitation of information asymmetries as well. The market’s performance pressure can punish adherence to such normative ideals with decreased competitiveness: Aaron Feuerstein’s textile business ultimately went bankrupt. His benevolence was rewarded by politicians and the media, not, however, by the market. Against the background of these dialectical tensions, the aphorism “two Jews, three opinions“ can take on

20

J M B JOURNAL

Kapital gleichkämen. Und mit dem Prozbul erfanden die Rabbinen ein halachisches Schlupfloch, welches die Aufhebung der Schulden im Zusammenhang mit dem Sabbatjahr umging. So wurde gesichert, dass auch kurz vor dem Sabbatjahr noch Notdarlehen an Bedürftige vergeben wurden – und dass ihre Gläubiger auf Rückzahlung hoffen konnten. Neue im Verlauf der Geschichte entwickelte Geisteshaltungen und Überzeugungen werden durch die rabbinische mündliche Tora Bestandteil jüdischer Wirtschaftsethik. So entwickelte der talmudische Schriftgelehrte Samuel bar Abba im Gegensatz zur Auflehnung der Propheten gegen Fremdherrschaft die halachische Maxime Dina de-malchuta dina – „das Gesetz des Landes ist Gesetz“ –, welche einer Integration des babylonischen Rechtssystems in die Halacha (das jüdische Recht) gleichkam. Samuel hatte vorausgesehen, dass eine rechtliche Absonderung der jüdischen Gemeinschaft auch in Babylon gefährlich werden könnte. So institutionalisierte er die bis heute geltende religiöse Verpflichtung aller Juden, die öffentlich-, zivil- und strafrechtlichen Bestimmungen der Länder, die sie bewohnen, zu befolgen. Natürlich entsteht so eine ganze Flut an Widersprüchen innerhalb der Halacha. Beispielsweise verpflichtet der Chumasch zur täglichen Bezahlung von Lohnarbeitern; nach dem Arbeitsrecht der meisten Länder sind jedoch monatliche Lohnzahlungen die Norm. Und laut Ona’ah, Bestimmungen, die Übervorteilung verbieten, sollen faire Warenpreise nicht nur vom Markt, sondern auch von Rabbinern reguliert werden. Der Talmud ist voller Gegensätze, Widersprüche und Paradoxien. Es ist angesichts dieser Spannungen kein Wunder, dass seine Grundmethodologie eine dialektische ist, die kontinuierlich eine Synthese aus widersprüchlichen Ansichten herzustellen versucht. Diese Dialektik begleitet jeden Versuch, jüdische Werte, Normen und Überzeugungen in das heutige Wirtschaftssystem zu integrieren, ob auf individueller, nationaler oder Unternehmensebene. Nehmen wir zum Beispiel den Produktivitätsimperativ des westlichen Kapitalismus, der unter anderem auf dem Glauben an die Idee von time is money basiert. Während meines ersten Projekts als Unternehmensberater fragte ich mich, ob ich trotz dieser Gleichung meine Arbeit für Mincha und Ma’ariv, das Mittags- und Abendgebet, unterbrechen sollte. Ich beschloss eine Kompromisslösung und betete im Treppenhaus des Klienten


new meaning. The conflicts between Jewish economic morals and the socio-economic system in which Jews find themselves demand both ethical reflection and the creation of a synthesis. Between two Jews there should be three opinions, because each of them ought to represent one-and-a-half opinions, consisting partly of Jewish ideals and partly of economic pragmatism. This dialectic may sound like a difficult endeavour. It may also, however, be child’s play for a tradition that on the one hand honors King Solomon’s wisdom—which teaches how the accumulation of gold is nothing but futile vanity—and on the other hand offers the golden carrot dish Tzimmes for Rosh ha-Shanah as a symbol of hope to be blessed in the new year with this exact same vanity. Nathan L. Kaplan studied philosophy and economics in London and attended Talmudical academies in New York and Jerusalem. He works at an international management consulting firm and is currently writing his dissertation in Heidelberg on Jewish corporate ethics.

besonders schnell. Um zudem nicht unnötig aufzufallen, flüsterte ich in den Bluetooth-Kopfhörer meines Handys hinein, als würde ich telefonieren (seitdem heißt er für mich Jewtooth). Auch abgesehen von rituellen Vorschriften können Grundsätze der freien Marktwirtschaft mit denen der jüdischen Wirtschaftsethik schwierig zu vereinbaren sein. Nach der Halacha ist geistige Täuschung verboten. Laut dem ökonomischen Konzept der Preisdifferenzierung aber sollten für eine bestimmte Leistung, wenn möglich, unterschiedliche Preise gefordert werden. Ist es nun ethisch vertretbar, den gleichen Käse unter einer anderen Marke teurer zu verkaufen? Oder ist dies eine Form von Irreführung? Ein anderes Beispiel ist das Verbot von Lifnei iver, welches in seiner biblischen Quelle wörtlich verbietet, den Blinden Steine in den Weg zu legen, laut seiner rabbinischen Interpretation zusätzlich das Ausnutzen eines Informationsvorteils untersagt. Der Leistungsdruck des Marktes kann die Befolgung solcher normativen Ideale mit geringerer Wettbewerbsfähigkeit bestrafen: Aaron Feuerstein musste für sein Textilunternehmen letztendlich Insolvenz anmelden. Seine Wohltätigkeit wurde zwar von der Politik und der Öffentlichkeit, nicht aber vom Markt belohnt. Vor dem Hintergrund dieser dialektischen Spannungen ist auch der Aphorismus „zwei Juden, drei Meinungen“ in neuem Lichte zu verstehen. Die Konflikte zwischen der jüdischen Wirtschaftsmoral und dem jeweiligen sozio-ökonomischen System, in dem sich Juden befinden, sind zugleich ein Aufruf zur ethischen Reflexion, zur Schaffung einer Synthese. Zwischen den zwei Juden bestehen drei Meinungen, weil nach einer solchen Reflexion jeder von ihnen anderthalb Meinungen vertreten sollte, bestehend aus einem Teil jüdischer Ideale und einem Teil ökonomischer Pragmatik. Diese Dialektik klingt wie ein schwieriges Unterfangen. Vielleicht ist sie aber auch ein Kinderspiel für eine Tradition, die einerseits König Salomons Weisheit verehrt, laut der das Anhäufen von Gold nichtige Eitelkeit darstellt, und die sich andererseits an Rosch ha-Schana mit dem goldenen Karottengericht Tzimmes symbolisch wünscht, im neuen Jahr in den Genuss eben dieser Eitelkeit kommen zu dürfen. Nathan L. Kaplan studierte Philosophie und Volkswirtschaftslehre in London und besuchte Talmudhochschulen in New York und Jerusalem. Er arbeitet bei einer internationalen Unternehmensberatung und schreibt derzeit in Heidelberg seine Dissertation zum Thema jüdische Unternehmensethik.

J M B JOURNAL

21


Jewish Theology and Economic Theory. A Commentary Jüdische Theologie und Wirtschaftstheorie. Ein Kommentar Corinne Sauer / Robert M. Sauer

Der verstorbene Milton Himmelfarb, Sozialanalytiker und Langzeitbeobachter der jüdisch-amerikanischen Gesellschaftsgruppe, brachte deren politisches Paradox in einem berühmten Aphorismus auf den Punkt: „Juden verdienen wie Episkopale und wählen wie Puerto-Ricaner.“ Standhaft, so sieht es aus, weigern sich amerikanische Juden, ihren Wohlstand mit eher konservativen oder (im europäischen Sinn des Wortes) wirtschaftsliberalen Haltungen zu verbinden. Jüngsten Erhebungen zufolge liegt ihr Pro-Kopf-Einkommen fast doppelt so hoch wie das nichtjüdischer Amerikaner. Dennoch ist unter ihnen der Anteil derer, die sich als Befürworter des freien Marktes bezeichnen, um 33 bis 50 Prozent niedriger als bei amerikanischen Katholiken und Protestanten. Wie erklärt es sich, dass amerikanische Juden an einer besonders hartnäckigen Form von Champagner-Sozialismus leiden (oder sich daran erfreuen)? Die beliebteste Antwort auf diese schwierige Frage zieht den Einfluss der Religion sowie den hohen Stellenwert sozialer Gerechtigkeit im jüdischen Glaubenssystem als Gründe heran. Nach gängiger Auffassung spornt die jüdische Religion ihre Anhänger einerseits zu hoher Bildung und beruflichem Erfolg an, macht sie aber zugleich zu energischen Befürwortern einer eher kollektivistischen Sozialpolitik und anderer Formen aggressiver staatlicher Eingriffe mit dem Ziel einer idealen Gesellschaft. Unserer Meinung nach wirft diese sogenannte Standardantwort jedoch ein wesentliches Problem auf: Es trifft keineswegs zu, dass die jüdische Religion eine Sammlung von Grundsätzen ist, die auf eine Umverteilung des Wohlstands und ähnliche progressive Programme hinauslaufen. Unsere Nachforschungen haben vielmehr das Gegenteil ergeben. Die jüdische Religion ist ein Denksystem, das sich am ehesten mit den Prinzipien des Wirtschaftsliberalismus vereinbaren lässt. Die jüdische Wirtschaftstheorie bietet keine Erklärung für die verbreitete Abneigung von Juden gegen die Ideologie des freien Marktes. Eine simple Analyse der politischen Vorlieben amerikanischer und israelischer Juden kann diese Abneigung belegen und statistisch untermauern. Paradoxerweise ist zugleich wohlbekannt, dass Juden über die Jahrhunderte vom freien Markt und dem kapitalistischen Wettbewerb sehr profitiert haben. In seiner Rede vor der Mont Pelerin Society im Jahr 1972 rief Milton Friedman die Wirtschaftswissenschaften auf, zu erklären, warum der freie Markt den Juden ebenso wie anderen Minderheiten in der Regel sehr zugute kommt. Mit Friedman argumentiert: Wo immer es ein Monopol gibt, sei es ein privates oder ein staatliches, ist Raum für Willkür bei der Auswahl jener, denen das Monopol nutzt – sei das Kriterium die Hautfarbe, die Religion, die

22

J M B JOURNAL

The late Milton Himmelfarb, a social commentator and longtime student of the American Jewish community, definitively summed up the Jewish political paradox with his famous aphorism: “Jews earn like Episcopalians and vote like Puerto Ricans.” American Jews, it seems, tenaciously refuse to link their higher income levels with more conservative, or economically liberal (in the European sense), political positions. Recent data indicate that American Jews earn per capita almost twice as much as non-Jews. Yet, they are between 33 percent and 50 percent less likely than American Catholics and Protestants to identify themselves as supporters of the free market. Why is it that American Jews suffer from (or perhaps enjoy) a particularly acute case of champagne socialism? The most popular answer to this difficult question involves the impact of Judaism on the belief system of American Jews, as well as Judaism’s emphasis on aggressively pursuing social justice. The conventional wisdom is that Judaism motivates Jews to be highly educated and to succeed professionally but to fervently support relatively collectivist social policies and other forms of aggressive government intervention for shaping an ideal society. In our view, however, the fundamental problem with the so-called standard answer is that it is not at all true that Judaism is a set of principles that endorses income redistribution and other progressive social programs. In fact, our research shows the opposite: Judaism is a system of thought that more naturally aligns itself with the basic principles of economic liberalism. Jewish economic theory does not explain the widespread distaste amongst Jews for a free market political agenda. A simple analysis of the political preferences of American and Israeli Jews suggests that there is a statistical basis for claiming that Jews have a strong distaste for economic liberalism. This is quite a paradox because it is also well-known that Jews have benefited a great deal over the centuries from the operation of free markets and competitive capitalism. In his 1972 address to the Mont Pelerin Society, Milton Friedman appealed to basic economic theory to explain why Jews, as well as other minorities, generally derive great benefits from free-market systems. According to Friedman: Wherever there is a monopoly, whether it be private or governmental, there is room for the


nationale Herkunft oder was auch immer. Im freien Wettbewerb hingegen zählt nur die Leistung. Der Markt ist farbenblind. Niemand, der auf den Markt geht, um Brot zu kaufen, weiß oder will wissen, ob der Weizen dafür von einem Juden, einem Katholiken, einem Protestanten, einem Muslim oder einem Atheisten angebaut wurde; oder von einem Weißen oder einem Schwarzen. Friedman stellte zudem fest, dass Juden überproportional häufig in Gewerben und Berufen arbeiten, die frei zugänglich sind, also nicht unter staatlicher Aufsicht oder Genehmigungspflicht stehen. Die Beispiele reichen von der Rolle der Juden im internationalen Bankwesen zu Zeiten, da die christliche Kirche ihren Gläubigen derartige Aktivitäten nur sehr eingeschränkt gestattete, bis zur heutigen jüdischen Präsenz im Einzelhandel, im Rechtswesen, in der Medizin oder im buchhalterischen Bereich. Dort, wo für die Ausübung eines Gewerbes oder Berufs eine behördliche Erlaubnis benötigt wird, sind

application of arbitrary criteria in the selection of the beneficiaries of the monopoly—whether these criteria be the color of skin, religion, national origin or what not. Where there is free competition only performance counts. The market is color blind. No one who goes to the market to buy bread knows or cares whether the wheat was grown by a Jew, Catholic, Protestant, Muslim or atheist; by whites or blacks. Friedman also observed that Jews can be disproportionately found working in industries and professions that are characterized by free entry, as opposed to industries and professions that require government licensing or franchise. Examples range from Jewish representation in international banking during the time that the Christian church restricted these activities amongst Christians,

UNSERE LEIDENSCHAFT KOMMT ZU IHNEN Catering ist Vertrauenssache. Seit Jahrzehnten begleitet unser Team einfallsreich inszenierte und reibungslos realisierte Veranstaltungen –  von fünf bis 1.500 Personen. Damit Sie in glänzender Erinnerung bleiben. Informationen unter (030) 25 02-11 77 oder auf unserer neu gestalteten Website www.palace-catering.de. Budapester Str. 45 · 10787 Berlin · www.palace.de Telefon +49 (30) 25 02-0 · Fax +49 (30) 25 02-11 19

J M B JOURNAL

23


Juden immer wieder Opfer antisemitischer Diskriminierung geworden. Dort, wo der Zugang frei ist, die Märkte arbeiten dürfen und sich Unternehmergeist entfalten kann, profitieren alle gleichermaßen vom farbenblinden Markt. Vielleicht liegt der Schlüssel zum Verständnis der politischen Abneigung von Juden gegen die freie Marktwirtschaft in einer kognitiven Dissonanz, welche die im Judentum traditionelle Unterstützung für den Sozialismus hervorgerufen hat. Über jene Denker, die in der Vergangenheit jüdische Religion und Sozialismus zu verbinden strebten, schreibt Rabbiner Meir Tamari, ein herausragender jüdischer Gelehrter und ehemaliger Ökonom der Bank of Israel: „Die verbreitete Gleichsetzung der jüdischen Soziallehre mit der sozialistischen ist (...) entweder das Produkt einer Unkenntnis des Quellenmaterials oder von bewusster Verdrehung desselben.“ In seinem Buch „The Challenge of Wealth“ formuliert Tamari weiterhin: „Sozialismus, der sich gegen das Privateigentum und die Schaffung von Wohlstand wendet, ist mit jüdischer Theologie unvereinbar.“ Für Tamari sind Privateigentum und die Ansammlung von Wohlstand vielmehr Grundpfeiler einer jüdischenWirtschaftstheorie. Es ist zweifellos an der Zeit, dass sich Juden, egal wo sie leben und wie religiös sie sind, ein paar tiefer greifende Gedanken machen über die unverkennbare Kluft zwischen dem linken Wirtschaftsdenken einerseits, das in weiten Teilen der jüdischen Gemeinschaft vorherrscht, und den Lehren in Sachen persönlicher und ökonomischer Freiheit andererseits, die sich aus der reichen jüdischen Tradition ziehen lassen – sowie über den bemerkenswerten Erfolg, mit dem Juden zu allen Zeiten Wohlstand und Arbeit geschaffen haben, für sich selbst und für andere, auch für unzählige Nichtjuden. Die Welt, wie wir sie heute kennen, wäre, so heißt es, unverständlich ohne die Einsichten und Weisheiten aus den hebräischen Schriften und ohne die besondere Reise des jüdischen Volks durch die Geschichte. Eine Rückbindung ihrer politischen Haltungen zu den Themen Arbeit, Wohlstand und Armut an die Weisheit der jüdischen Überlieferung wäre vermutlich nicht nur für die jüdischen Gemeinschaften ein großer Gewinn, sondern ebenso für die vielen anderen Gruppen, deren Kulturerbe durch die Begegnung mit dem jüdischen Volk tief geprägt und beeinflusst ist. Corinne Sauer und Robert M. Sauer sind Gründer des Jerusalem Institute for Market Studies, einem unabhängigen wirtschaftspolitischen Think-Tank in Israel.

to more recent Jewish representation in retail trade, law, medicine, and accounting. When government permission is required to enter into a particular industry or profession, Jews will be discriminated against and suffer the consequences of anti-Semitism. When there is free entry, well functioning capital markets, and the potential for entrepreneurship, the rules of the color-blind market will benefit all. Perhaps the key to understanding why Jews have a political aversion to free-market policies, despite the great personal benefit derived from free markets, lies in the cognitive dissonance produced by the support for socialism inherent in Judaism. Concerning those thinkers that tried to link Judaism and socialism in the past, Rabbi Meir Tamari, a prominent Jewish scholar and former economist with the Bank of Israel writes, “the widespread identification of Jewish social thinking with that of socialism is ... the product of either ignorance of the source material, or willful distortion.” In his book, The Challenge of Wealth, Tamari further states, “socialism that denies private property and wealth creation is irreconcilable with Jewish theology.” Tamari believes that private property and wealth accumulation are the cornerstones of Jewish economic theory. The time is surely ripe for the Jewish people, wherever they live and regardless of their degree of religiosity, to reflect seriously upon the apparent disjuncture between the left-wing economic thinking that prevails in much of the Jewish community, the lessons about economic freedom and liberty conveyed by the richness of the Jewish tradition, as well as their remarkable success throughout history in creating wealth and employment for themselves and others, including countless Gentiles. The world as we know it today, it has been remarked, would be incomprehensible without the insights and genius contained within the Hebrew Scriptures and the story of the remarkable journey of the Jewish people throughout history. Reconnecting their political ideas about work, wealth, and poverty with the wisdom of Jewish tradition would likely be of benefit not only to the Jewish communities but also to those other communities whose own inheritance has been so profoundly shaped and influenced by their encounter with the Jewish people. Corinne Sauer and Robert M. Sauer are founders of the Jerusalem Institute for Market Studies, an independent and non-profit economic policy think-tank located in Israel.

24

J M B JOURNAL


INSIDE JMB A KT U E L L E AU SST E L LU N G E N N E U ES AU S D E R SA M M LU N G D I E A K A D E M I E D ES JÜDISCHEN MUSEUMS BERLIN CU R R E N T E X H I B I T I O N S NEWS FROM OUR COLLECTION T H E J M B AC A D E M Y


Über 20 Millionen Menschen aus fast allen Ländern Europas wurden als „Fremdarbeiter“, Kriegsgefangene oder KZ-Häftlinge in das nationalsozialistische Deutschland verschleppt oder mussten in den von der Wehrmacht besetzten Gebieten Zwangsarbeit leisten. Deutsche „Herrenmenschen“ gaben sich das Recht, Unterworfene und angebliche „Untermenschen“ rücksichtslos auszubeuten. Spätestens seit 1942 gehörten Zwangsarbeiterlager zum Alltag im nationalsozialistischen Deutschland. Sie wurden überall eingesetzt: in Rüstungsbetrieben ebenso wie auf Baustellen, in der Landwirtschaft, im Handwerk, in öffentlichen Einrichtungen oder in Privathaushalten. Zwangsarbeit war kein Geheimnis. Sie war ein weitgehend öffentliches Verbrechen. Anliegen der Ausstellung ist es, erstmals die gesamte Geschichte dieses NS-Verbrechens und seiner Folgen nach 1945 – zugleich eine europäische Erfahrung ohne Beispiel – in all ihren Voraussetzungen, Entwicklungen und Ausprägungen darzustellen. Sie zeigt, wie die Zwangsarbeit von Beginn an Teil der rassistischen Gesellschaftsordnung des NS-Staates war: Die propagierte „Volksgemeinschaft“ und die Zwangsarbeit der Ausgeschlossenen – beides gehörte zusammen. In der Allgegenwart und

Alltäglichkeit der Zwangsarbeit und in der breiten gesellschaftlichen Partizipation zeigte sich der rassistische Kern des Nationalsozialismus. An keinem anderen NS-Verbrechen waren derart viele Menschen beteiligt – als Opfer, Täter oder Zuschauer. Besonderes Augenmerk legt die Ausstellung auf die Beziehungsgeschichte von Deutschen und Zwangsarbeitern. Jeder Deutsche musste sich entscheiden, wie er ihnen begegnete: mit einem Rest von Mitmenschlichkeit oder der angeblich gebotenen – rassistisch gerechtfertigten – Kälte und Unerbittlichkeit des Angehörigen eines vermeintlich höherwertigen Volkes. Die Geschichte der Zwangsarbeit lässt sich keinesfalls auf ein bloßes Regimeverbrechen reduzieren, sie wird vielmehr als Gesellschaftsverbrechen erkennbar. Über 60 repräsentative Fallgeschichten bilden den sachlichen Kern der Ausstellung. Sie wurden, wie die Mehrzahl der gezeigten Dokumente und Bildüberlieferungen, akribisch in einer Vielzahl von Archiven in ganz Europa eigens für die Ausstellung recherchiert. Thematisch reichen diese Fallgeschichten von der entwürdigenden Arbeit politisch Verfolgter in Chemnitz nach der nationalsozialistischen „Machtergreifung“ bis hin zur mörderischen Sklavenarbeit von Juden im besetzten Polen oder dem Zwangsarbeitsalltag auf einem Bauernhof in Niederösterreich. Zu den Überraschungen der umfangreichen internationalen Archivrecherchen für die Ausstellung gehörte die Entdeckung einer unerwartet breiten und dichten fotografischen Überlieferung signifikanter Ereignisse. Deren quellenkritisch fundierte Präsentation in Verbindung mit den Fallgeschichten bildet – inhaltlich, gestalterisch und ausstellungsdidaktisch – die zweite Säule der Ausstellung. Recherchiert und rekonstruiert werden konnten ganze Fotoserien, die einen gleichsam szenischen Zugang zu Aspekten der Geschichte der Zwangsarbeit ermöglichen. Visualität in Gestalt quasi filmisch angeordneter Foto- oder Fotoausschnittsvergrößerungen bildet den Ausgangs- und Einstiegspunkt für die tiefer-

B EG L E I T P RO G RA M M Z U R AU SST E L LU N G (Auswahl)

SELECTION OF EVENTS ACCOMPANYING THE EXHIBITION

1 0. N OV E M B E R 20 1 0, 1 4: 30 –1 6 : 1 5 U H R A R B E I T E N F Ü R D E N F E I N D. N S-Z WA N GSA R B E I T: FO LG E N U N D E R I N N E R U N G E N N AC H 1 945 Im Rahmen der Konferenz „Zwangsarbeit in Hitlers Europa“ präsentieren internationale Referenten aktuelle Forschungsergebnisse zu den länderspezifischen Erscheinungsformen der Zwangsarbeit im Zweiten Weltkrieg. O RT: Akademie der Wissenschaften, Markgrafenstraße 38, Berlin-Mitte

1 0 N OV E M B E R 20 1 0, 2 : 30 – 4: 1 5 P. M . WO R K I N G FO R T H E E N E M Y. FO RC E D L A B O R U N D E R N AT I O N A L S O C I A L I S M : CO N S EQ U E N C ES A N D R ECO L L EC T I O N S P OST-1 945

A KT U E L L E AU SST E L LU N G E N

28 . S E PT E M B E R 20 1 0 B I S 30. JA N UA R 20 1 1

Zwangsarbeit. Die Deutschen, die Zwangsarbeiter und der Krieg Eine internationale Wanderausstellung der Stiftung Gedenkstätten Buchenwald und Mittelbau-Dora im Jüdischen Museum Berlin, initiiert und gefördert von der Stiftung Erinnerung, Verantwortung und Zukunft. Schirmherrschaft: Bundespräsident Christian Wulff

1 0. JA N UA R 20 1 1 , 1 8 U H R Z E I TZ E U G E N G E S P R Ä C H M I T H E L E N A B O H L E-S ZAC K I Im Gespräch mit Ewa Czerwiakowski berichtet die ehemalige Zwangsarbeiterin von ihren Erfahrungen in einem Außenlager des KZ Flossenbürg. Helena BohleSzacki, 1928 in Bialystock geboren, stammt aus einer deutsch-polnisch-jüdischen Familie. Von der Gestapo verhaftet und deportiert, musste sie ab Herbst 1944 Zwangsarbeit leisten. O RT: Auditorium des Jüdischen Museums Berlin

26

INSIDE JMB

As part of the conference “Forced Labor in Hitler’s Europe,” international experts will present current research on the country-specific manifestations of forced labor during the Second World War. LO C AT I O N : Akademie der Wissenschaften, Markgrafenstraße 38, Berlin-Mitte

1 0 JA N UA RY 20 1 1 , 6 P. M . W I T N ESS TO H I STO RY: D I S CU SS I O N W I T H H E L E N A B O H L E-S ZAC K I In a conversation with Ewa Czerwiakowski, former forced laborer Helena Bohle-Szacki describes her experiences at an external site of the Flossenbürg concentration camp. Ms. Bohle-Szacki comes from Bialystock, where she was born to a German-Polish-Jewish family in 1928. Arrested and deported by the Gestapo, she entered into forced labor in the fall of 1944. LO C AT I O N : Jewish Museum Berlin Auditorium

und weitergehende Auseinandersetzung mit der Geschichte der Zwangsarbeit. Die Ausstellung gliedert sich in vier Abschnitte. Der erste Teil ist den Jahren 1933 bis 1939 bis zum Beginn des Zweiten Weltkrieges gewidmet. Hier werden insbesondere die rassistisch-ideologischen Wurzeln der nationalsozialistischen Zwangsarbeit offen gelegt. Was in diesen Jahren propagiert, teils rechtlich kodifiziert und mit breiter gesellschaftlicher Teilhabe in die Praxis umgesetzt und eingeübt wurde, bildete den Ausgangspunkt für die nachfolgende Radikalisierung der Zwangsarbeit im besetzten Europa bis hin zur Arbeit als Vernichtung. Dieser Ausweitung und Radikalisierung ist der zweite Abschnitt der Ausstellung gewidmet. Der dritte Abschnitt lenkt den Blick wieder auf das Deutsche Reich, in dem Zwangsarbeit ab 1941/42 zum Massenphänomen wurde. Der Abschnitt endet mit den zahlreichen Massakern an Zwangsarbeitern bei Kriegsende. Der vierte Teil der Ausstellung umfasst die Zeit von der Befreiung 1945 bis zur gesellschaftlichen Auseinandersetzung und Anerkennung der Zwangsarbeit als Verbrechen in der Gegenwart. Das letzte Wort in der Ausstellung haben ehemalige Zwangsarbeiterinnen und Zwangsarbeiter. In den Gesprächen mit ihnen wurde immer wieder deutlich, wie wichtig es ist, die transnationale Erfahrung der nationalsozialistischen Zwangsarbeit zu einem lebendigen Kern eines europäischen Gedächtnisses zu machen. Mit Absicht ist die Ausstellung deshalb als internationale Wanderausstellung konzipiert. Volkhard Knigge, Rikola-Gunnar Lüttgenau, Jens-Christian Wagner Weitere Informationen finden Sie unter www.ausstellung-zwangsarbeit.org.


CU R R E N T E X H I B I T I O N S

28 S E PT E M B E R 20 1 0 TO 30 JA N UA RY 20 1 1

Forced Labor. The Germans, the Forced Laborers, and the War An international traveling exhibition curated by the Buchenwald und Mittelbau-Dora Memorials Foundation, initiated and sponsored by the foundation “Remembrance, Responsibility and Future.” Under the auspices of Federal President Christian Wulff.

More than twenty million people—natives of almost every country in Europe—carried out forced labor for Nazi Germany in the German Reich as well as in the countries occupied or controlled by the Germans. The German “master race” granted itself the right to exploit those it had subjugated and members of allegedly “inferior races” with all ruthlessness. By 1942 at the latest, forced labor camps as well as forced laborers of both genders were an integral part of everyday life in Nazi Germany. The workers were recruited from all parts of Europe and deployed throughout the German economy: in armament factories, on construction sites, in agriculture and the trades, in public institutions and private households. The deployment of forced laborers was no secret. For the most part, it was a crime committed in public. The aim of the exhibition is to present the history of forced labor—a crime and an unprecedented

European experience—in all its preconditions, developments and forms. From the very beginning, forced labor was a core element of the Nazi social order; it shaped the “people’s community” propagated by the National Socialists— based, as it was, on inclusion and racist exclusion. From the very beginning, forced labor was thus a core element of the Nazi social order, and accordingly far more than just a side effect of war. No other crime committed by the National Socialists involved as many people—be it victims, aggressors or bystanders. The exhibition directs special attention to the history of the relationship between Germans and forced laborers. Every German was confronted with the decision as to how he or she would encounter forced laborers: with a last vestige of humanity, or with the allegedly imperative, racialistically justified frostiness and inexorability of a member of a supposedly superior people. The history of National Socialist forced labor can by no means be reduced to a crime committed by a regime; on the contrary, it makes forced labor perceivable as a crime committed by an entire society. More than sixty representative cases form the core of the exhibition. Like the majority of the documents and images shown, these case studies were meticulously researched especially for the exhibition in a large number of archives all over Europe and beyond. Thematically the studies cover a wide range of different experiences, for example the demeaning work performed by victims of political persecution in Chemnitz after the National Socialist seizure of power, the grueling slave labor carried out by Jews in occupied Poland, or everyday life as a forced laborer on a farm in Lower Austria. Among the surprises we encountered in conjunction with the extensive international archive research carried out in preparation for the show was the discovery of unexpectedly broad and thorough photographic documentation of significant events. From the point of view of content, design, and educational considerations, their source-critical presentation in connection with the case studies forms the exhibition’s second

mainstay. It proved possible to reconstruct entire photo series which provide virtually scenic access to various aspects of the history of forced labor. Visuality—enlargements of photos or photographic details arranged in virtually cinematic manner—forms the point of departure for the more in-depth and far-reaching critical examination of the history of forced labor. The exhibition is based on four sections. The first is dedicated to the period before the beginning of World War II, i.e. the years 1933 to 1939. It seeks primarily to uncover the racist-ideological roots of National Socialist forced labor. The concepts propagated, legally codified, and put into practice by a large proportion of the society in the pre-war years formed the point of departure for the subsequent radicalization of forced labor in occupied Europe to the point where it served as an instrument of annihilation. That expansion and radicalization is the subject of part two of the exhibition. Part three focuses on forced labor as a mass phenomenon in the German Reich from 1941/42 onward and ends with the massacres of forced laborers in the final phase of the war. Section four is concerned with the period from liberation to the present public discussion and recognition of forced labor as a crime. At the exhibition’s end, former forced laborers themselves have the last word. Again and again, our conversations with them confirmed how important it is to make the transnational experience of National Socialist forced labor a living core of a collective European memory. The conception of the exhibition “Forced Labor. The Germans, the Forced Laborers and the War” as an international traveling exhibition was therefore entirely deliberate. Volkhard Knigge, Rikola-Gunnar Lüttgenau, Jens-Christian Wagner For further information please visit our website at www.ausstellung-zwangsarbeit.org.

K ATA LO G Mit wissenschaftlichen Beiträgen zu den Hintergründen der Ereignisse, Fallgeschichten aus der Ausstellung und ca. 200 Abbildungen. Eine Publikation der Stiftung Gedenkstätten Buchenwald und Mittelbau-Dora, 256 Seiten, € 19,80.

Ansicht der Sonderausstellung »Zwangsarbeit. Die Deutschen, die Zwangsarbeiter und der Krieg« Exhibition view: “Forced Labor. The Germans, the Forced Laborers, and the War”

Bereits 2003 erschienen: „Jüdische Zwangsarbeiter bei Ehrich & Graetz, Berlin-Treptow“ Hrsg.: Aubrey Pomerance, 272 Seiten, mit über 500 Abbildungen, € 5,-. DuMont Verlag

E X H I B I T I O N C ATA LO G Contains scholarly articles offering a historical background for the events and case histories in the exhibition, includes circa 200 illustrations. A Buchenwald and Mittelbau-Dora Memorials Foundation publication, 256 pages, € 19.80. Published in 2003: Jewish Forced Laborers at Ehrich & Graetz, Berlin-Treptow Ed.: Aubrey Pomerance, 272 pages, with over 500 illustrations, € 5,-. DuMont Verlag German version only.

INSIDE JMB

27


A KT U E L L E AU SST E L LU N G E N

4. N OV E M B E R 20 1 0 B I S 23. JA N UA R 20 1 1

Die Sukka: Ein flüchtiges Haus für einen jüdischen Feiertag Die Sukka (pl. Sukkot) ist ein flüchtiges, jüdisches Haus, und die Fotos in der Ausstellung im Jüdischen Museum Berlin zeigen diesen zeitgenössischen Brauch. Die mehr als 1500 Jahre alten Baubestimmungen sind einfach: eine Sukka – Laubhütte – muss mindestens zweieinhalb Wände und ein Laubdach (s’chach) haben. Nachts muss man durch das Dach die Sterne sehen können und tagsüber muss das Laub des Daches einen Schatten auf den Boden werfen, sodass es nur bedingt Schutz vor der Witterung gibt. Jeden Herbst wird die Sukka neu errichtet und für eine Woche bewohnt: Man isst, feiert und schläft in ihr. Paradoxerweise erinnert sie einerseits an die Wüstenwanderung der Israeliten, während andererseits mit dem Laubhüttenfest auch Erntedank gefeiert wird und so der Sesshaftigkeit der Feiernden Ausdruck verliehen wird. Durch den Aufbau und die damit verbundene Erfahrung eines Raumes, egal wie gering dieser ist, wird überall eine Heimat konstruiert, die gleichzeitig vergänglich und beständig ist. Mit der Sukka wird eine räumliche Erfahrung – ein sogenanntes immersive environment – im Judentum in den Mittelpunkt gestellt. Abstrakte, jahrtausendealte Texte werden in zeitgenössische räumliche Praktiken in Städte wie Paris, London oder New York transkribiert. Die Fotos zeigen, dass die Sukka ein überliefertes und kontinuierliches Ritual ist, und erweitern unser Verständnis der Beziehungen zwischen Architektur und Judentum. Sukkot feiern die Schön-

heit des Vergänglichen und definieren Architektur neu. Die fotografierten Sukkot stehen im Spannungsfeld von realen, spezifischen Räumen und abstrakten Heimaten, von individueller Architektur und kollektivem Ritual, von sesshaft sein und sich unbeständig fühlen. Ich habe die Architektur der zeitgenössischen Sukka zwischen 1999 und 2009 in Europa, den USA und in Israel dokumentiert. Mehr als 150 Fotos werden in einer raumspezifischen Installation in der Eric F. Ross Galerie gezeigt. Durch die fünf Projektionsleinwände erschließen sich neue Räume, die wiederum in einen Dialog zu den an den Wänden stehenden Textauszügen aus historischen Bauanleitungen treten. Zusammen gewähren die Texte, Räume und Fotos den Besuchern einen Einblick in ein flüchtiges Haus für ein jüdisches Fest. Mimi Levy Lipis

D I E B I L D E R D E R AU SST E L LU N G E R S C H E I N E N AU C H I N

Mimi Levy Lipis: Home is Anywhere: Jewish Culture and the Architecture of the Sukkah. Köln: Verlag Walther König, 2010

2 . S E PT E M B E R 20 1 0 B I S 31 . JA N UA R 20 1 1

„Du bist bei Parfümören angekommen“ ... so wurde Fritz Scherk (1918–1995) bei seiner Geburt von der Familie enthusiastisch begrüßt. Er wuchs zwischen Parfüm und Puderdosen auf. Zur Familie gehörten die Albersheims, seit 1892 Besitzer einer Parfümerie in Frankfurt, und sein Vater Ludwig, der die Berliner Kosmetikfirma Scherk zu hoher Blüte führte. In sieben Kapiteln erzählt die Kabinettausstellung ein Stück Berliner und Frankfurter Unternehmensgeschichte vom Kaiserreich bis in die „Wirtschaftswunderjahre“ der Bundesrepublik. Denn sowohl Scherk als auch Dr. Albersheim wurden nach „Arisierung“, Kriegs-

zeit und Restitution von den emigrierten jüdischen Unternehmerfamilien wieder aufgebaut und bis in die 1950/60er Jahre fortgeführt – eine Seltenheit in der deutschen Nachkriegsgeschichte. Dass diese Facette deutsch-jüdischer Geschichte nun auch in der Sammlung des Jüdischen Museums vertreten ist, verdanken wir einer Schenkung von Irene Scherk, der ältesten Tochter von Fritz Scherk, aus dem letzten Jahr. Basierend auf dem reichhaltigen Material ihres Familienkonvoluts setzen wir unsere Reihe von Kabinettausstellungen zur Wirtschafts- und Unternehmensgeschichte fort. Fritz Scherk entschloss sich auf Bitten ehemaliger Mitarbeiter der Firma seines Vaters zur Rückkehr nach Deutschland – er war ausgebildeter Parfümeur und Haupterbe des 1946 in London verstorbenen Firmengründers. Von Israel aus beantragte er Wiedergutmachung und kaufte die Firma von der Schering AG zurück. Im Zuge der „Arisierung“ hatte der Chemiekonzern Scherk im Jahr 1938 günstig erworben und die nichtjüdischen Mitarbeiter übernommen. „Scherk ist wieder da“, kündigte der Firmenchef die Fortführung des Familienbetriebes 1951 in einem Brief an den Handel an. Auch Walter Carsch, Fritz Scherks Onkel und früherer Besitzer von Dr. Albersheim, erhielt seine Firma in Frankfurt zurück und führte sie ab 1949 von den USA aus weiter. Bei ihren Nachkriegsprodukten knüpften beide Unternehmen an die Vorkriegszeit an: Khasana – Dr. Albersheim kreierte Lippenstifte und dekorative Kosmetik, Scherks Verkaufsschlager waren Gesichtswasser und Kompaktpuder. Produkte beider Firmen sind in der Ausstellung schaufensterartig präsentiert; eine Berliner Privatsammlerin stellte uns dafür über hundert Leihgaben zur Verfügung. Khasana – Dr. Albersheim blieb bis Ende der 1950er Jahre in Familienbesitz und ging später an den Henkel-Konzern über. Scherk-Produkte, zuletzt hergestellt von GlaxoSmithKline, sind manchem bis heute ein Begriff. Das imposante Firmengebäude ist heute Sitz des Pharmazeutischen Instituts der Freien Universität Berlin. Iris Blochel-Dittrich, Leonore Maier

Zu Sukkot umgebaute Balkone, New York 2007 Balconies function as sukkot, New York 2007

28

INSIDE JMB


CU R R E N T E X H I B I T I O N S

4 N OV E M B E R 20 1 0 TO 23 JA N UA RY 20 1 1

The Sukkah: A Fleeting House for a Jewish Festival The sukkah (pl. sukkot) is a temporary Jewish dwelling built each fall for Sukkot, the Feast of Tabernacles. The more than 150 exhibition photographs for “The Sukkah: A Fleeting House for a Jewish Festival” in the Eric F. Ross Gallery show how this custom is implemented today. The architecture is based on simple construction guidelines dating back more than 1500 years: A sukkah must have at least two and a half walls and a thatched roof made of cut plant material (s’chach). Stars must be visible through the roof at night and the roof’s branches must cast a shadow on the ground during the day. Erected anew each year in the fall and inhabited for one week, it is used when dining, celebrating, and even sleeping. The sukkah paradoxically commemorates the Israelites’ time of wandering in the desert while Sukkot, on the other hand, celebrates the harvest—an expression of being settled. The sukkah places a spatial experience—what is referred to as an immersive environment—at center stage. Abstract, ancient texts are transcribed into contemporary spatial practices in cities such as Paris, Jerusalem, and New York. The exhibition photographs demonstrate that the construction of a sukkah is a continuous ritual that is handed down and expand our understanding of the relationship between Judaism and architecture. Sukkot celebrate the beauty of the transient and redefine the boundaries of architecture. The photographed tabernacles are somewhere between real, specific spaces and

abstract homelands, between individual architecture and collective ritual, between personal interpretation and historical influence, between being settled and feeling transient. I have photographically documented the architecture of the contemporary sukkah in Europe, the United States, and Israel between 1999 and 2009. These photos are being shown in a sitespecific installation. Projected onto five large screens, new spaces evolve that in turn enter into dialogue with excerpts of historic construction guidelines, which are displayed on the walls of the gallery space. Together, the texts, the space, and the photographs grant visitors insight into a fleeting house for a Jewish festival. Mimi Levy Lipis

THE PICTURES OF THE EXHIBITION ARE ALSO SHOWN IN

Mimi Levy Lipis: Home is Anywhere: Jewish Culture and the Architecture of the Sukkah. Cologne: Verlag Walther König, 2010

2 S E PT E M B E R 20 1 0 TO 31 JA N UA RY 20 1 1

“Welcome to the perfumers” … is how Fritz Scherk (1918–1995) was enthusiastically greeted by his family at his birth. He grew up amid perfume bottles and powder compacts. The Scherk cosmetic company in Berlin flourished under his father, Ludwig. And the Albersheims, who had owned a perfumery in Frankfurt since 1892, were also part of the family. This showcase exhibition tells a piece of Berlin and Frankfurt business history in seven chapters, from the German Empire to Germany’s “economic miracle” years. Both firms survived “Aryanization”, the war years, restitution, and reconstruction by the emigrated Jewish entrepreneurial families, and continued into the 1960s—a rarity in German postwar history. This facet of German-Jewish history is now part of the collection of the Jewish Museum thanks to the generous bequest last year by Irene Scherk,

eldest daughter of Fritz Scherk. Based on the wealth of material in the family estate, we are able to continue our series of showcase exhibitions on economic and business history. Fritz Scherk decided to return to Germany, responding to requests by former employees in his father’s company, since he was a trained perfumer and principal heir of the company founder, who died in London in 1946. From Israel, he filed for restitution and bought back the company from the Schering AG. Within the scope of Aryanization, the Scherk cosmetic company had been sold substantially under value in 1938 and taken over by non-Jewish staff. “Scherk is back,” the company chief announced in a letter to the trade when the family company resumed business in 1951. Walter Carsch, Fritz Scherk’s uncle and former owner of the Dr. Albersheim company, regained his company in Frankfurt and continued to run it from the United States from 1949 on. With their postwar products, both companies were able to build upon those of the prewar period: Khasana—Dr. Albersheim created lipsticks and decorative cosmetics; Scherk’s product hits were facial toner and the Mystikum powder compact. Products of both companies are presented in showcases in the exhibition. A private collector in Berlin loaned us more than a hundred items. Khasana—Dr. Albersheim remained in family hands until the late 1950s and later became part of the Henkel company. Scherk products, most recently produced by GlaxoSmithKline, remain a familiar name today. The impressive company building is now the site of the pharmaceutical institute of the Free University Berlin. Iris Blochel-Dittrich, Leonore Maier

Werbeanzeige der Firma Scherk, ca. 1951–1969. Schenkung von Irene Alice Scherk. Advertisement by the Scherk Company, around 1951–1969. Gift by Irene Alice Scherk.

Körperpuder vor und nach der „Arisierung“ der Firma Dr. Albersheim, ca. 1930–1945 Bottles of talcum powder from before and after the “Aryanization” of Dr. M. Albersheim, ca. 1930–1945.

INSIDE JMB

29


N E U ES AU S D E R SA M M LU N G

Nicht Bloch, sondern Herz. Die neue Interpretation eines alten Gemäldes In einem gemeinsamen Seminar mit der Universität Potsdam (Institut für jüdische Studien, Prof. Dr. Christoph Schulte) im Sommer 2009 und Winter 2009/10 über Porträts von Juden im 18. Jahrhundert wurde untersucht, wie sich Bild und Selbstbild von Juden in dieser Umbruchszeit veränderten, wie Juden als Auftraggeber mit den Künstlern ihrer Zeit in Kontakt traten und dadurch zu einem Teil des kulturellen Netzwerkes in Berlin wurden. Dabei kam es zu einer neuen Zuschreibung – und auch zu einer neuen Interpretation eines Gemäldes. Für unsere Untersuchungen bestand die wichtigste Gruppe von Gemälden aus Porträts, die 1990 und 2001 als langfristige Leihgaben des Israel Museums an das Jüdische Museum kamen. Sie stammten ursprünglich aus dem ersten Berliner jüdischen Museum, das sich in der Oranienburger Straße befand und eine Einrichtung der Jüdischen Gemeinde war. Am 24. Januar 1933 eröffnet, wurde es nach der Pogromnacht geschlossen und seine Bestände beschlagnahmt. Den größten Teil seiner Gemäldesammlung fand man 1946 in einem Keller in Charlottenburg. In den folgenden Jahren restituierte man sie an die JRSO (Jewish Restitution Successor Organization), die die meisten der Gemälde 1952 an das Bezalel Museum in Jerusalem übergab, das den Grundstock für das heutige Israel Museum bildete. Durch diese verzweigten Wege gingen viele Informationen zu den einzelnen Werken verlo-

30

INSIDE JMB

ren: Flüchtigkeitsfehler entstanden, zufällige Verwechselungen setzten sich fort. Heute muss das Wissen um die Bilder mühsam und aus einzelnen Informationen rekonstruiert werden. Unser Seminar konnte diesem Puzzle einen Mosaikstein hinzufügen: Gegenstand war in diesem Falle ein Porträt, das der preußische Hofmaler Johann Christoph Frisch im Jahr 1779 schuf und das zu einer Reihe von Arzt-Porträts gehörte, die das erste jüdische Museum aus dem Krankenhaus der Gemeinde übernommen hatte. Das Bild galt bislang als eine Darstellung des Arztes und Naturforschers Marcus Elieser Blochs; nicht zuletzt, weil es 1931 in einem Artikel von Max Osborn in der Zeitung des Centralvereins deutscher Staatsbürger jüdischen Glaubens als solche abgebildet und beschrieben worden war. Auch Karl Schwarz folgt dieser Deutung in seinem zur Eröffnung des Museums erschienenen Katalog. Im Rahmen der Recherchen zu den Porträts von Juden des 18. Jahrhunderts wurden zahlreiche Bestände systematisch durchgesehen. Dabei fanden sich zwei Kupferstiche, die nach dem Gemälde von Frisch gestochen waren: zum einen ein ovaler Bildausschnitt als Brustbild von C. W. Bock, zum anderen ein Nachstich des gesamten Gemäldes von J.J.F. Tassaert. Doch beide Kupferstiche identifizierten den Dargestellten nicht als Bloch, sondern eindeutig als den Arzt und Philosophen Marcus Herz. Durch diese neue Identifizierung schloss sich eine Verbindung: Dass der Dargestellte nun als Marcus Herz zu erkennen war, rückte das Porträt in unmittelbaren Zusammenhang zu einem Porträt von Herz’ Braut Henriette de Lemos, das Anna Dorothea Lisiewska-Therbusch im Jahr 1778 malte und das sich heute in der Alten Nationalgalerie befindet. In der Tat bilden nicht nur die Dargestellten, sondern auch die Gemälde ein Paar: In ihren Formaten, 75 x 59 cm und 81 x 65 cm, weisen sie nahezu dieselben Proportionen auf. Die Komposition beider Porträts ist zudem aufeinander bezogen: Der Gatte, traditionell auf der linken Seite, wendet sich nach rechts, während

die Braut eine Bewegung nach links vollzieht. Am 1. Dezember 1779 fand die Hochzeit statt. Das Gemälde von Anna Dorothea Therbusch diente dabei als visueller Bezugspunkt für ein Gedicht, vorgetragen mit musikalischer Begleitung in der Satzbezeichnung „grazioso“, die Schönheit der damals gerade 15-jährigen Braut in höchsten Tönen und holprigen Reimen preisend. Doch auch dem Gatten zollte es Respekt: Dies Mädchen lohnet den Verehrer / Erhabner Philosophie, / Ihn, den Gefühlesquellenlehrer, / In der Empfindungstheorie! / Der Denken noch durch Thun vergrößert, / So weisheitsvoll wie Socrates. / Der Körper heilt, und Seelen bessert, / Der Liebling des Hipocrates. / Wer Welten misst mit einem Blicke; / Der Erdengüter Innres kennt, / Der rechnet sich’s zum ächten Glücke, / Wenn heiße Lieb’ im Herzen brennt! / So bringe denn die Nectarschale, / Du frohe Götterpflegerin! / Dem sehnsuchtsvollen Ehgemale / Als Wonne höchster Wonne hin!“ Marcus Herz erscheint hier in vielerlei Rollen: als liebender und geliebter Gatte, als weiser Philosoph, als Arzt, der Körper heilt, aber auch als Theoretiker der Gefühle und der Seele. Über die „heiße Lieb’“ der Ehegatten hinaus zeigen diese beiden Porträts ein weiter interpretierbares Programm, in dem Antike und Gegenwart, Schönheit und Wissen, klassische Bildung und naturwissenschaftliche Forschung sich wechselseitig bedingen und erst gemeinsam zu einem harmonischen Ganzen verschmelzen. Auch andere Porträts geben noch Rätsel auf und sicher werden sich nicht alle lösen lassen. Was an neuen Erkenntnissen zu vermelden ist, wird im kommenden Jahr auf der Website des Museums im Rahmen der online-Präsentation der Sammlung veröffentlicht werden. Ein Teil der Arbeitsergebnisse des Seminars ist schon jetzt auf der von Christoph Schulte und der Universität Potsdam betriebenen Website haskala.net zu sehen. Inka Bertz


N E WS F RO M O U R CO L L EC T I O N

Not Bloch, but Herz. Reinterpreting a Work of Art For two semesters from 2009 to 2010, the Jewish Museum Berlin co-sponsored a joint seminar with the University of Potsdam (Institute for Jewish Studies, Prof. Dr. Christoph Schulte) about portraits of Jews in the eighteenth century. The topics examined included how likenesses of Jews and Jewish self-perception changed during this period of upheaval, how Berlin Jews came into contact with the artists of their time through the artwork they commissioned— and as such how they thus became part of the cultural network of the city. The project resulted in the reevaluation and even a new interpretation of a work of art. The most important group of paintings we studied was comprised of portraits that the Jewish Museum received via long-term loan in 1990 and 2001 from the Israel Museum. They were originally a part of the first Jewish museum in Berlin, which was located on Oranienburger Strasse as a feature of the religious community there. The museum opened on January 24, 1933, but closed after Kristallnacht in 1938 when its holdings were seized. The lion’s share of the collection was found in a cellar in Charlottenburg in 1946 and was given to the Jewish Restitution Successor Organization. Most of these paintings were then handed over to the Bezalel Museum in Jerusalem in 1952 as a foundation for today’s Israel Museum.

Significant information was lost about each individual work during the course of this circuitous journey: careless clerical mistakes were made and confusion ensued. As a result, knowledge about the paintings must now be painstakingly reconstructed from individual bits of detail. Our seminar was able to add a piece to this mosaic of information: The piece at hand concerned a portrait from 1779 by the Prussian court painter Johann Christoph Frisch. The painting is one in a series of portraits of doctors that the first Jewish museum had received from the congregation’s hospital. Until now, the painting was thought to be the doctor and scientist Marcus Elieser Bloch, not least because it had been reproduced and described as such in an article by Max Osborn in the newspaper for the Central Association for German Citizens of the Jewish Faith (Centralvereins deutscher Staatsbürger jüdischen Glaubens) in 1931. This interpretation was even reiterated by Karl Schwarz in his catalog for the museum’s opening. Numerous art inventories were reviewed within the framework of our research on the eighteenth century portraits. In doing so, two copper engravings emerged, both etched from this painting by Frisch: one was an oval half-portrait by C.W. Bock, the other image by J.J.F. Tassaert was of the entire portrait. Yet both engravings identify the subject not as Bloch, but rather unambiguously as the doctor and philosopher Marcus Herz. This new identification led us to an unexpected connection: now that the subject is recognized as Marcus Herz, the portrait can be viewed in relation to the painting of his bride, Henriette de Lemos. The painting of de Lemos, completed by Anna Dorothea LisiewskaTherbusch in 1778, now hangs in the Alte National Galerie in Berlin. In fact, not only were the subjects a couple, but the paintings themselves are also a pair: at 75 x 59 cm and 81 x 65 cm respectively, they are nearly the same proportions. The composition of both portraits also correspond to each other— with the husband, traditionally on the left side and turning to the right, and the wife complet-

ing the gesture by turning to the left. Their marriage took place on 1 December, 1779. The painting by Therbusch served as a visual reference point for a poem that was recited, with “grazioso” musical accompaniment, praising the beauty of the 15-year-old bride in the highest of terms and somewhat clumsy rhymes. The husband also received a tribute of respect:

This maiden is worthy / of her admirer of noble philosophy, / of him, the teacher of emotions’ origins, / in the theory of sentiment! / He—his thinking heightened through doing— / is as wise as Socrates. / Who bodies heals. / Who souls improves. / Favored by Hippocrates. / He who measures worlds with a glance; / who knows the inner riches of the earth, / who charges himself with true happiness, / when fiery love burns in his heart! / So bring the cup of nectar, / you merry maid to the gods! / You—the delight of highest delight— / go to your husband! Marcus Herz appears here in several roles: as lover and beloved husband, as wise philosopher, as a doctor who heals the body, and also as a theoretician of emotion and of the soul. Beyond the “fiery love” of the spouses, the two portraits offer a program that can be interpreted. One in which antiquity and the present, beauty and knowledge, classical literacy and the study of natural sciences all presuppose and condition one another, fusing together into a harmonious whole. There are other portraits that remain riddles, certainly not all of which will be solved. Any announcements regarding new findings will be published in the coming year on the Jewish Museum’s website as part of the online presentation of the museum’s collection. The seminar’s research result can already be seen in part on the website run by Professor Christoph Schulte and the University of Potsdam at haskala.net. Inka Bertz

Links: Johann Christoph Frisch: Marcus Herz, Öl auf Leinwand, 1779. Left: Johann Christoph Frisch: Marcus Herz, Oil on Canvas, 1779.

Rechts: Anna Dorothea Therbusch: Henriette de Lemos, Öl auf Leinwand, 1778. Right: Anna Dorothea Therbusch: Henriette de Lemos, Öl auf Leinwand, 1778.

INSIDE JMB

31


P R E I S F Ü R V E R ST Ä N D I G U N G U N D TO L E RA N Z

Seit 2002 zeichnet das Jüdische Museum gemeinsam mit dem Freundeskreis im Rahmen des Jubiläums-Dinners Persönlichkeiten aus, die sich für Bildung, Menschenwürde und Völkerverständigung eingesetzt haben. Der „Preis für Verständigung und Toleranz“ wird in diesem Jahr an Prof. Dr. Jan Philipp Reemtsma sowie an Dr.-Ing. Hubertus Erlen verliehen.

Jan Philipp Reemtsma „Dieses Kind ist uns allen geschenkt worden.“ Mit diesen Worten wurde der 1952 in Bonn geborene Jan Philipp Reemtsma vom Prokuristen der Zigarettenbetriebe der Familie Reemtsma begrüßt. Doch entgegen der großen Hoffnungen, die seitens des Hamburger Familienbetriebs in den Nachwuchs gelegt wurden, trat Jan Philipp Reemtsma sein Erbe nicht an. Heute ist er einer der angesehensten Literaturwissenschaftler Deutschlands – und darüber hinaus bedeutender Mäzen für kulturelle, wissenschaftliche und politische Initiativen. Bereits als Jugendlicher hatte Jan Philipp Reemtsma für Literatur, Politik und Philosophie mehr Interesse gezeigt als für die Wirtschaft. Mit diesen persönlichen Interessen verknüpfte er schon früh großes soziales Engagement, und mit der Unterstützung des Schriftstellers Arno Schmidt begann 1977 seine Emanzipation vom Familienerbe. 1981 entstand aus dieser Unterstützung die Arno-Schmidt-Stiftung, die der Förderung und Pflege des Werks des bedeutenden deutschen Schriftstellers gewidmet ist. Nur drei Jahre später folgte eine weitere Stiftungsgründung: Jan Philipp Reemtsma rief das Hamburger Institut für Sozialforschung ins

Leben, mit den Arbeitsschwerpunkten Die Gesellschaft der Bundesrepublik, Nation und Gesellschaft sowie Theorie und Geschichte der Gewalt. Heute gehört das HIS zu den renommiertesten wissenschaftlichen Einrichtungen Deutschlands. Nicht zuletzt erlangte es diesen Ruf durch zwei kontrovers diskutierte Ausstellungen über die Verbrechen der Wehrmacht, die zum ersten Mal öffentlich machten, in welchem Maße auch deutsche Soldaten in den Jahren 1941–1944 am Massenmord in der Sowjetunion beteiligt waren. Die Ausstellungen, die heute als Meilenstein in der Geschichtsaufarbeitung gelten, weisen auf einen der Kernpunkte in Reemtsmas Schaffen hin: Die Opposition gegen das Verschweigen von Gewalt zu Zeiten des Nationalsozialismus. Dass ihm diese Opposition eine persönliche moralische Verpflichtung ist, erweist sich auch durch Reemtsmas Verantwortung gegenüber Fremdund Zwangsarbeitern, die in den Fabriken der Reemtsma-Familie beschäftigt waren: Ihnen zahlt er – unabhängig von Stiftungsinitiativen – direkt und unbürokratisch Entschädigungen.

Hubertus Erlen Gesellschaftlich und kulturell engagiert, erfolgreich als Unternehmer und begeistert von Wissenschaft und Forschung: Hubertus Erlen ist Manager und engagierter Bürger zugleich. Sein ausgeprägtes Bewusstsein für gesellschaftliche Anliegen zeigt sich u.a. durch sein Engagement in verschiedenen Stiftungen oder in ehrenamtlicher Tätigkeit für die Bundesregierung. Der 1943 geborene promovierte Diplom-Ingenieur Hubertus Erlen begann seine Karriere 1972 bei Schering. Schon 1985 wurde Erlen in den Vorstand berufen und Arbeitsdirektor. Bald erlangte er den Ruf als jemand, der den Konsens sucht, zugleich aber harte Entscheidungen nicht scheut. Als Unternehmer galt sein Engagement vor allem dem Aufbau eines leistungsfähigen globalen Produktionsnetzwerkes und dem Ausbau des Geschäftes in den USA. Als Personalvorstand führte er flexible Arbeits-

zeitmodelle ein, engagierte sich für die Vermögensbildung der Mitarbeiter und weltweit für die Entwicklung von Nachwuchskräften. 2001 übernahm Hubertus Erlen die Position des Vorstandsvorsitzenden der Schering AG. Er richtete in den folgenden Jahren die Scheringstrategie neu aus und steigerte die Effizienz und Profitabilität des Unternehmens wesentlich. Dabei verlor er jedoch die traditionell mitarbeiterfreundliche Politik nicht aus den Augen. Er war der erste Vorstandsvorsitzende eines DAX 30 Unternehmens, der sein Gehalt offenlegte und der erste, der eine Frau in den Vorstand der Schering AG holte. Dass sich sein Engagement nicht auf Wirtschaftliches beschränkt, zeigte sich auch, als er die Schering-Stiftung zur Förderung von Wissenschaft, Kultur und sozialen Zwecken ins Leben rief. 2002 entwickelte er das Konzept für die gemeinnützige Stiftung, und es gelang ihm, den Aufsichtsrat der Schering AG davon zu überzeugen, 20 Mio. Euro hierfür zur Verfügung zu stellen. Später wurde das Stiftungskapital auf 35 Mio. Euro aufgestockt. Die Stiftung fördert junge Wissenschaftler und Preise und verleiht jährlich den Ernst Schering Preis für herausragende Beiträge auf dem Gebiet der medizinischen Forschung. Auch privat engagiert sich Hubertus Erlen: Er ist Mitgründer der James Simon Stiftung, die sich im Namen des berühmten jüdischen Philanthropen und Kunstmäzens für die Förderung von Kunst und Kultur einsetzt. Der Musik- und Theaterliebhaber ist auch Gründungsmitglied der Fördervereine der Staatsoper Berlin und des Deutschen Theaters. Als Vorsitzender der Robert Koch Stiftung setzt er sich engagiert für die Förderung von jungen Wissenschaftlern und die Auszeichnung von Spitzenforschern ein. Seit zwei Jahren ist er ehrenamtlich für die Bundesregierung im Lenkungsrat des Deutschlandfonds zur Rettung von Unternehmen, die durch die Finanzkrise in Probleme geraten sind, tätig. Für die Zukunft wünscht sich Hubertus Erlen ein starkes gesellschaftliches Engagement junger Unternehmer und Unternehmerinnen. Marie Naumann

Die diesjährigen Träger des „Preises für Verständigung und Toleranz“, Jan Philipp Reemtsma (links) und Hubertus Erlen (rechts). This year’s laureates of the “Prize for Understanding and Tolerance”, Jan Philipp Reemtsma (left) and Hubertus Erlen (right).

32

INSIDE JMB


P R I Z E FO R U N D E R STA N D I N G A N D TO L E RA N C E

Since 2002 the Prize for Understanding and Tolerance is presented by the Jewish Museum Berlin and the Friends of the Museum during the museum’s anniversary dinner. The prestigious prize is awarded to artists, politicians and entrepreneurs who support human rights, crosscultural understanding, and social issues. This year’s laureates are Prof. Dr. Jan Philipp Reemtsma and Dr.-Ing. Hubertus Erlen.

Jan Philipp Reemtsma “This child was given to us all.” It was with these words that Jan Philipp Reemtsma, born in Bonn in 1952, was welcomed into the world by the manager of his family’s cigarette company. Yet despite the high hopes for the addition to the family on the part of the Hamburg family business, Reemtsma did not accept this inheritance. At the age of twenty-six he sold off his share of the company, and today is one of Germany’s most distinguished literary scholars as well as an important patron of cultural, scientific, and political initiatives. Even as an adolescent Jan Philipp Reemtsma was more interested in literature, politics, and philosophy than he was in business. He combined these personal interests with a resolute commitment to social engagement from an early age and—with encouragement from writer Arno Schmidt—began to emancipate himself from his familial inheritance in 1977. The Arno Schmidt Foundation, dedicated to the nurture and advancement of important German writers, emerged out of this support in 1981. Only three years later Jan Philipp Reemtsma would bring another foundation to life, the Hamburg

Institute for Social Research. This one with the core working emphases of “society in the Federal Republic of Germany”,” nation and society,” and “the theory and history of violence.” Viewed with skepticism during its early years, the HIS has a place today among Germany’s most renowned scholarly institutions. HIS has also acquired its reputation, not least, from two heavily discussed and controversial exhibitions on the crimes perpetuated by the Wehrmacht, which made public for the first time the degree to which German soldiers did in fact participate in mass murder in the Soviet Union between 1941 and 1944. While they have come to be seen as milestones in the effort to come to terms with Germany’s twentieth century history, these exhibitions also point to a central element of Reemtsma’s achievement: his opposition to the concealment of violence from the National Socialist period. That he holds this opposition as a personal moral duty is also demonstrated by his sense of responsibility towards the foreign and forced laborers who were employed in the Reemtsma family factory. He has compensated them directly and without bureaucracy, independent of other reparation initiatives.

Hubertus Erlen Socially and culturally engaged, successful as a businessman and enthusiastic about research and scholarship: Hubertus Erlen is both a manager and a committed citizen. His remarkable awareness of societal concerns is manifested through his involvement with a variety of foundations as well as in his honorary work for the German federal government. Born in 1943, Hubertus Erlen received his degree in engineering and began his career in 1972 at Schering. Already in 1985 he joined the board of directors as labor director. He soon gained a reputation as a consensus-builder, and simultaneously as someone not afraid to make tough decisions. As a businessman he is known for his commitment to building an efficient global production network and for the development

of the company in the U.S. He introduced flexible work-hour models as head of the labor board, and promoted continuing education for employees as well as the advancement of younger generations. Hubertus Erlen became chairman of the board at Schering in 2001. His adjustments to the company’s corporate strategy over the following years resulted in considerable increases in efficiency and profits. He did not, however, lose sight of his traditional employee-friendly politics. He was the first board chairman of a DAX 30 business to publish his salary and the first to bring a woman onto Schering’s board of directors. His engagement is not limited to business, a fact demonstrated by his creation of the Schering Foundation, which aims to promote science, culture, and social goals. He developed the concept for the charitable foundation in 2002 and succeeded in convincing Schering’s supervisory board to commit 20 million Euros to its endowment, a sum that was later raised to 35 million. The foundation supports young scientists and scholars through stipends, seminars, and prizes, and awards the annual Ernst Schering Prize for outstanding contributions to the field of medical research. Hubertus Erlen is no less involved as a private citizen: he is a co-founder of the James Simon Foundation, which supports art and culture in the name of the renowned Jewish philanthropist and art patron. A lover of music and theater, he is a founding member of the groups “Friends of the Staatsoper Berlin” and “Friends of the Deutsches Theater.” Since joining the board of the Robert Koch Foundation he has also helped promote young scientists and honor top researchers. And for the last two years he has participated in an honorary capacity on the federal government’s steering committee for the German fund to save businesses threatened by the financial crisis. He continues to hope and work for a strong sense of social engagement in young businessmen and women. Marie Naumann

INSIDE JMB

33


D I E A K A D E M I E D ES JÜDISCHEN MUSEUMS BERLIN

Zwischenräume Der Entwurf von Daniel Libeskind für die Akademie des Jüdischen Museums Berlin In den neun Jahren seines Bestehens hat sich das pädagogische Angebot des Jüdischen Museums Berlin mehr als verdoppelt. Zusätzlich zu den 7.500 Führungen werden zurzeit pro Jahr rund 400 Fortbildungen, Workshops und Projekttage angeboten. Akuter Platzmangel ist die Folge, denn die Nachfrage nach Bildungsprogrammen steigt ebenso wie die Sammlungsund Bibliotheksbestände wachsen. Um dieser Nachfrage gerecht zu werden und auch unsere Bestände weiterhin adäquat unterbringen zu können, wird die frühere Blumengroßmarkthalle gegenüber dem Museum durch den Architekten Daniel Libeskind zur Akademie des Jüdischen Museums umgebaut. Zusammen mit den beiden bereits bestehenden Libeskind-Bauten entsteht so an der Lindenstraße ein faszinierendes Gebäudeensemble, das nicht nur für Architekturfans aus aller Welt interessant ist, sondern das auch das Stadtviertel, die südliche Friedrichstadt, durch entstehende Strukturen und Plätze neu definiert und für Besucher aufwertet. Der Umbau der vom Architekten Bruno Grimmek in den 1960er Jahren errichteten Markthalle basiert auf einem Haus-im-HausKonzept, das zum einen aus drei Kuben besteht – einem Eingangskubus, einem Bibliothekskubus und einem Auditorium – und zum anderen aus funktionalen Einbauten an den Längsseiten der Halle, in denen sich Büros, Seminarräume und Werkstätten befinden. Bis auf den Eingangsbereich wird die Außenhaut der Halle nicht angetastet, und das charakte-

ristische Sheddach bleibt erhalten. Das bisher bestehende Parkdeck rund um das Gebäude wurde bereits abgerissen, und auch die Mauer zur Lindenstraße hin wird zurückgebaut. Dadurch wird die historische Halle künftig wesentlich stärker im Stadtbild wahrnehmbar sein als bisher. Der Entwurf von Daniel Libeskind bindet die Akademie in das bestehende Ensemble aus Kollegienhaus und Museumsneubau ein: Ein die Außenwand der Halle durchdringender, geneigter Kubus schafft ein Pendant zum Haupteingang im Kollegienhaus und zum Kopf des Museumsneubaus auf der gegenüberliegenden Seite der Lindenstraße. Die Figur des Kubus variiert ein den Bauten des Jüdischen Museums gemeinsames Thema, das sich im Exil-Garten und im Glashof wiederfindet. Daniel Libeskind entwickelt die neue Akademie im Kontext zur bisherigen Architektur und in seiner einzigartigen Formensprache unter Berücksichtigung der neuen Funktionen und Anforderungen. Die Oberlichter des Eingangskubus in Form der hebräischen Buchstaben Alef und Bet beziehen sich auf das Lernen und greifen damit die Programmbereiche Bildung, Bibliothek und Archiv auf, die sich in der Halle befinden werden. In diesem Eingangskubus öffnet sich ein Einschnitt, durch den der Besucher das neue Gebäude betritt. Im Inneren der Halle findet er zwei weitere gegeneinander geneigte Kuben vor, die das Auditorium und eine Freihandbibliothek enthalten. Sie sind mit einer Holzverkleidung versehen, die einerseits an Transportkisten, andererseits an die Arche Noah erinnern und einen reizvollen Kontrast zu der größtenteils aus Beton konstruierten Halle darstellen. Diese Kuben stehen für die Vermächtnisse, die dem Jüdischen Museum aus aller Welt zugehen und die in der neuen Akademie einer breiteren Öffentlichkeit zugänglich gemacht werden sollen. Zwischen den drei Kuben entstehen spannungsvolle Raumperspektiven, die vielfältige Blicke auf den Innenraum der Halle und ihr Sheddach sowie auf den zukünftigen Stadtplatz im

Blick von der Lindenstraße auf das neue Areal. View from Lindenstrasse of the new buildings.

34

INSIDE JMB

Außenbereich erlauben. Diese „Zwischenräume“ bilden die Schnittstelle zwischen den öffentlichen Funktionen der Akademie, der ehemaligen Blumenhalle und ihrer visuellen Verknüpfung mit dem Kollegienhaus und dem Museumsneubau. Zu verdanken ist der Entwurf Daniel Libeskinds der tatkräftigen Hilfe des US-amerikanischen Fördervereins, den „American Friends of the Jewish Museum Berlin“, die den Entwurf finanzierten – und auch der Umbau des Gebäudes selbst wird zu einem großen Teil durch Spenden ermöglicht.


T H E J M B AC A D E M Y

In-Between Spaces Daniel Libeskind’s Design for the Academy of the Jewish Museum Berlin The Jewish Museum has more than doubled its pedagogical offerings in the nine years of its existence. In addition to the 7,500 guided tours per year, visitors participate in close to 400 continuing education programs, workshops, and “project days.” As the demand for educational events has increased—and the collections and library have also grown—the result has been an acute lack of space. In order to meet this educational demand, and to be able adequately to accommodate our holdings, architect Daniel Libeskind will transform the former flower market hall across the street from the museum into the Academy of

the Jewish Museum. Together with the baroque and Libeskind structures across Lindenstrasse, this new Academy will complete a fascinating ensemble of buildings. Architecture fans from around the world will not be the only ones impressed; indeed the museum’s new building— as well as its open spaces—will redefine and enhance the southern “Friedrichstadt” city district for all visitors to the area. The modification of the market hall, which was erected in the 1960s by architect Bruno Grimmek, is based on the concept of a buildinginside-a-building. This will consist on the one hand of three cubes: an entrance cube, a library cube, and an auditorium. On the other hand, along the long side of the building, will be functional components for offices, seminar rooms, and workshops. Aside from the entrance area, the external shell of the market hall will remain untouched, with even the characteristic shed roof intact. The parking lot that previously surrounded the building has already been removed and the wall to the street will be torn down. The historic market hall will thus be considerably more discernible in the future than before. Daniel Libeskind’s design ties the Academy to the already-existing ensemble of the Kollegien-

haus and the new museum building: a tilted cube that penetrates the outer wall of the market hall creates a counterpart to the main entrance in the Kollegienhaus and for the head of the Libeskind Building on the other side of Lindenstrasse. A variation of a theme shared among the Jewish Museum buildings, the cube figure is also found in the Garden of Exile and the Glass Courtyard. While in consideration of the new space’s functions and requirements, Daniel Libeskind is developing the new Academy within the architectural context of the existing buildings and his unique expression of form. The overhead lights of the entrance cube—in the form of the Hebrew letters alef and bet—refer to learning, thus reflecting the purpose of the spaces and programs in the hall: education, library, and archive. A recess in the entrance cube opens to allow visitors into the rest of the building. Inside the market hall stand two further cubes, which lean in towards one another and contain the auditorium and the open access library. They are furnished with wooden paneling that recalls both transport crates and the story of Noah’s ark. They provide an appealing contrast to the rest of the largely concrete hall. These cubes represent the bequests that come to the Jewish Museum from around the world, whose contents the new Academy will make accessible to an even broader public. Three exciting spatial perspectives—with views of the building’s interior, its shed roof, and the plaza to be laid outside—emerge between the three cubes. These “In-Between Spaces” establish a gateway for the different public functions of the Academy, the former flower market, and their visual links to the Kollegienhaus and the new museum building. We owe a great debt of thanks for Daniel Libeskind’s design to the dynamic efforts of the American support organization, “American Friends of the Jewish Museum Berlin,” which financed not only the design but also, in large part, the modification work on the market building itself through donations.

Blick in die JMB Akademie. View inside the JMB Academy.

INSIDE JMB

35


BILDUNG & MEDIEN

Fladenbrot, Hostie und Mazze Interkulturelle Bildungsarbeit im Jüdischen Museum Sie heißen Benan, Asli, Murat, Ufuk und Dervis und unterstützen das Team der freien Mitarbeiter des Museums bei Workshops, Weiterbildungen und Führungen. Sie sind Historiker, Kulturwissenschaftler oder Lehrer und wollen nicht nur deutsch-jüdische Geschichte vermitteln, sondern stehen mit ihren individuellen Lebensläufen für den gesellschaftlichen Dialog um Anerkennung und Teilhabe. Seit 2005 gibt es im Jüdischen Museum die Möglichkeit, eine Führung mit dem Titel „Ist das im Islam nicht auch so?“ zu buchen – nach Wunsch auch auf Türkisch. Integrationsgipfel und -debatten prägen die aktuelle gesellschaftliche Auseinandersetzung. Doch welche Rolle spielt die interkulturelle Bildungsarbeit in der alltäglichen Arbeit des Jüdischen Museums? Drei Beispiele sollen Chancen und Herausforderungen näher beleuchten. Zum Thema „Kochen und Essen“ kann jeder etwas sagen. So jedenfalls lautete die Idee, die hinter dem Begleitprogramm zur Sonderausstellung „Koscher & Co. Über Essen und Religion“ stand. Mithilfe einer Lehrerin für Deutsch als Zweitsprache initiierten wir eine Kooperation und lotsten Sprachschüler und Integrationskurse ins Museum, Erstbesucher, die vielleicht gar nicht damit gerechnet hatten, ausgerechnet hier etwas über das Verbot von Alkohol im Islam oder die Herstellung von Fladenbrot, Hostie und Mazze zu erfahren. Essen bestimmt nationale und kulturelle Identität. Dies konnten wir vor der Darstellung von Falafel mit israelischem Fähnchen mit den arabischstämmigen

36

INSIDE JMB

Teilnehmern besonders lebhaft diskutieren. Lernen ist auch für Ali wichtig. Er ist die Hauptperson in einem zweisprachigen Kinderbuch, das sich mit der Suche nach Gott beschäftigt und den Ausgangspunkt für ein neues Programm der Bildungsabteilung darstellt. „Alis wunderbarer Weg“ können Kinder in Lesungen auf Deutsch und Türkisch hören. Im Anschluss daran setzen sie die „Suche nach Gott“ in unserer Ausstellung fort: Erinnern sie sich daran, in welches Gotteshaus Ali ging? Und ist das dreidimensionale Modell des Gotteshauses eine Moschee oder eine Synagoge? Ein ganz anderes Beispiel für besondere Möglichkeiten der Vermittlungsarbeit im Jüdischen Museum stellen unsere Archivworkshops dar: Hier forschen Schüler oder Studierende unter fachkundiger Anleitung zu Themen wie Emigration, Jüdische Schule im NS oder zum Novemberpogrom. Solange die Möglichkeit einer unmittelbaren Zeitzeugenschaft durch Stifter besteht, ist zudem das persönliche Kennenlernen im moderierten Gespräch ein intensives und nachhaltiges Erlebnis. Im September diesen Jahres bot sich dazu eine besondere Gelegenheit: Die Geschwister Dorothea Brander und Eugen Merzbacher waren als Stifter eingeladen. Sie hatten in der Zeit von 1935 bis 1945 in Ankara gelebt, und die Tatsache, dass auch von den Schülern einige „Deutsches“ und „Türkisches“ mitbrachten, führte zu neugierigen Fragen und einem lebhaften Austausch. Tanja Petersen

Ein neuer Museumsguide Nahezu zwei Drittel der Besucher des Jüdischen Museums Berlin stammen aus dem Ausland – angeführt wird die Liste von Besuchern aus Italien, Frankreich, Großbritannien und Spanien. Für diese Besuchergruppen gab es bislang kaum Lesestoff zum Museum – die englische Ausgabe des Museumsbuches „Geschichten einer Ausstellung“, das zur Eröffnung des Museums erschien, ist inzwischen veraltet.

Im letzten Jahr brachten wir daher unsere „Museumsbox“ auf den Markt: Raffiniert verpackt enthält sie sieben Hefte, in denen einzelne Objekte aus der Sammlung vorgestellt werden, sowie ein Poster und ein kleines Buch. In diesem Jahr folgten die Übersetzungen dieses Pakets ins Englische, Französische, Italienische und Spanische. Diese ungewöhnlichen Museumsguides sehen zwar etwas anders aus als die deutsche Ausgabe, sind inhaltlich aber gleich – und in jedem Falle stellen sie für alle unsere Gäste ein ebenso schönes wie lesenswertes Souvenirbuch dar. Wie aber packt man das Jüdische Museum Berlin in ein Buch? Wie schildert man 2000 Jahre deutsch-jüdische Geschichte auf 176 Seiten? Unser Guide ist zweigeteilt: Im ersten Teil präsentieren wir die Highlights unserer Sammlung. In einem jüdischen Museum sind alle Exponate „irgendwie jüdisch“. Sie haben diese Eigenschaft, weil es sich um Dinge handelt, die von Juden hergestellt oder benutzt wurden, wie Kleidung und Besteck, Briefe und Reisepässe, Orden und Spielzeug; oder weil es sich um rituell-religiöse Gegenstände handelt wie ein Chanukka-Leuchter oder ein Tora-Vorhang. Mit der Wahl der Ordnungskriterien für die Präsentation unserer Artefakte – „blau-weiß“, „bezeichnet“, „getrennt“, „heimisch“, „konvertiert“, „unterwegs“ und „versteckt“ – geben wir dem spezifischen Charakter dieser Dingwelt eines jüdischen Museums besonderen Ausdruck – und jedem Objekt seine eigene, spannende Geschichte. Der zweite Teil beginnt mit der Frage des PessachLiedes „Echad mi jodea?“ – „Eins, wer weiß es?“. Nicht nur die Antwort darauf, sondern auch viele weitere Zahlen und wissenswerte Fakten zur jüdischen Kultur und Religion kann man hier nachlesen. Ereignisse und Begriffe, die in unserem Hause von besonderer Bedeutung sind, werden erläutert; anhand einer Zeitleiste lassen sich die wichtigsten Daten der deutsch-jüdischen Geschichte verfolgen. Und es finden sich weitere interessante und unterhaltsame Informationen rund um das Jüdische Museum Berlin. Sonja Altmeppen, Henriette Kolb


E D U C AT I O N & M E D I A

Flatbread, Altar Bread, and Matzo Intercultural Education at the Jewish Museum Their names are Benan, Asli, Murat, Ufuk, and Dervis and they support the museum’s team of employees running workshops, continuing education programs, and guided tours. They’re historians, cultural scholars, teachers—and they’re not only here to impart their professional knowledge of German-Jewish history. Their individual life courses also represent the societal dialogue on recognition and participation. They provide our visitors an authentic opportunity to participate in open interaction and social exchange. The Jewish Museum Berlin has offered a guided tour—also available in Turkish—with the title “What do Judaism and Islam have in common?” since 2005. Current societal discussions and debates are shaped by questions about integration. What role, then, does intercultural education play in the everyday work of the museum? Three examples may illuminate the challenges and opportunities of intercultural education: Everyone has something to say about cooking and eating. That, in any case, is the idea behind the accompanying program for the special exhibition “Kosher & Co.: On Food and Religion.” With the help of a teacher for German as a second language, we initiated a cooperation with language programs and integration courses, drawing students into the museum, first-time visitors who do not expect—in the Jewish Museum of all places—to learn about the prohibition of alcohol in Islam or about the production methods for flatbread, hosts, and matzo. Eating can be a decisive element of national and cultural identity, as often demonstrated through the

liveliest of discussions with participants of Arab descent in front of the display on Israeli falafel! Education is important for Ali as well. He is the main character in a bilingual children’s book on the search for God, a book that we use as a point of departure for a new educational program. Children can listen to “Ali’s Amazing Journey” read aloud in German and Turkish. They then continue the “Search for God” in our permanent exhibition. Will they remember which house of worship Ali attended? And is the 3-D model in the exhibit a mosque or a synagogue? A very different example of the Jewish Museum’s opportunity for mediation and exchange can be found in our archive workshops: here, with expert guidance, school and university students research themes such as emigration, Jewish schools under National Socialism, and the November pogrom. So long as there are still living witnesses to the events of that period, we can provide young people with the chance to have extraordinary encounters in moderated discussions, encounters that prove poignant and that leave powerful, lasting impressions. In September of this year we had a special opportunity to issue a benefactor invitation to siblings Dorothea Brander and Eugen Merzbacher. They lived in Ankara from 1935 to 1945, and the both German and Turkish school children at this event initiated an eager question session and an animated exchange. Tanja Petersen

The New Museum Guide Nearly two-thirds of the visitors to the Jewish Museum Berlin come from abroad—most frequently from Italy, France, Great Britain, and Spain. Until now, these groups of visitors have had very little reading material about the museum, and the English edition of the museum’s book, “Stories from an Exhibition,” which was published when the museum first opened, has meanwhile become obsolete.

Our new “Museum Box” was thus introduced last year: artfully packaged, it contains a short book, a poster, and seven booklets in which the reader is made familiar with individual objects from the collection. Translations of this informational packet in English, French, Italian, and Spanish have followed. Although these unusual museum guides look somewhat different from the German edition, they offer the same content in an attractive, worthwhile souvenir book that invites each guest to delve into the museum. How is it possible to fit the Jewish Museum Berlin into one book? How should 2000 years of German-Jewish history be depicted in only 176 pages? Our guide is comprised of two parts: In the first part we present highlights from our collection. All exhibits in a Jewish museum are, of course, “somehow Jewish.” They have this quality because they are items that were produced or used by Jews, such as clothing and utensils, letters and passports, medals and toys; or because they are ritual or religious objects, such as Hanukkah menorahs or Torah curtains. By selecting a set of criteria to classify all these artifacts—”marked,” “blue-white,” “separated,” “at home,” “converted,” “travels,” and “hidden”— we aim to give special expression to the specific character of this Jewish world of objects, and to reveal each object’s own, fascinating story. The second part begins with the question from the Pesach song “Echad mi jodea”—“Who Knows One?” Here not only can the answer to this question be discovered, but also many other facts and figures worth knowing about Jewish culture and religion. We explain the events and ideas that hold particular significance in Jewish homes. And a timeline helps to illustrate the most important dates in German-Jewish history. The visitor can find interesting and entertaining information about the Jewish Museum Berlin itself in this section as well. Sonja Altmeppen, Henriette Kolb

Während der Führung „Was ich glaube, was ich esse“ in der Ausstellung „Koscher & Co.“. During the tour “What I Believe in, What I Eat” in the special exhibition “Kosher & Co. On Food and Religion.”

INSIDE JMB

37


I N T E RV I E W

Daniel Wall Die Wall AG gehört seit vielen Jahren zu den wichtigsten Unterstützern des Jüdischen Museums. 2007 übernahm Daniel Wall den Posten des Vorstandsvorsitzenden der Wall AG.

Sie sagten einmal über die Wall AG: „Es war selbstverständlich, dass die ganze Familie mit angepackt hat.“ War es für Sie ebenso selbstverständlich, in das Unternehmen des Vaters einzusteigen oder hätten Sie damals lieber einen anderen Weg gewählt? Dass man in der Familie mit angepackt hat, war selbstverständlich. Dass ich Karriere innerhalb unseres Unternehmen gemacht habe, nicht. Ich hatte auch andere Ideen, aber die Entwicklung unseres Unternehmens war so spannend, dass es mich dort förmlich hineingezogen hat. Ich hatte die Möglichkeit, mir ein umfangreiches Know-how zu erarbeiten, da ich praktisch alle Bereiche in unserem Unternehmen kennenlernen durfte und viele Bereiche auch neu aufgebaut habe. Einfach war es aber nicht, sich zu behaupten. Es gibt in Deutschland immer weniger große Familienunternehmen, auch die Wall AG gehört nicht mehr dazu. Gleichzeitig wird diese Unternehmensform idealisiert. Sehen Sie dafür einen Grund? Passen Familienunternehmen überhaupt noch in die aktuelle Unternehmenslandschaft? Sie sprechen hier die Übernahme unseres Unternehmens 2009 durch JCDecaux an. JCDecaux ist ebenso wie Wall ein Unternehmen, das als Familienunternehmen gegründet

und geführt wurde. Daher verbinden uns innerhalb unserer neuen Eigentümerstruktur gleiche Werte, Ideale und Handlungsvisionen. Aufgrund dessen empfinde ich unser Haus auch in seiner neuen Konstellation immer noch als ein Familienunternehmen, nur, dass die Familie jetzt größer geworden ist. Es ist natürlich interessant, dass wir jetzt zu einem Weltmarktführer gehören, der an der Börse gelistet ist. Damit kommen neue Herausforderungen und Chancen auf uns zu. Die Institution ‚Familienunternehmen‘ an sich hat eine wichtige Bedeutung für den Mittelstand in Deutschland. Der Mittelstand ist das Rückgrat des Erfolgs unseres Landes. Das heißt, dass Familienunternehmen nach wie vor hervorragend in die aktuelle Unternehmenslandschaft passen. Allerdings wird die Lage für den Mittelstand durch die Globalisierung und Bürokratisierung immer schwieriger. Ihr Unternehmen ist international in verschiedenen Kulturräumen tätig. Worauf muss man achten, wenn man an so unterschiedlichen Orten wie Berlin und Istanbul Stadtmöbel installiert? Es geht für uns immer darum, unsere Stadtmöbel harmonisch in das jeweilige Stadtbild einzupassen. Folglich muss man sich an den architektonischen Besonderheiten einer Stadt orientieren und diese im Design und in der Konstruktion entsprechend aufgreifen. Baustile und die Architektur im Allgemeinen sind natürlich von den kulturellen Einflüssen eines Landes stark geprägt, und diesen müssen unsere Stadtmöbel gerecht werden. Gibt es kommerzielle Plakate, die Sie ablehnen würden? Es gibt auch für Werbung Richtlinien. Um deren Einhaltung sicherzustellen, gibt es in der Werbebranche als Gremium zur freiwilligen Selbstkontrolle den Deutschen Werberat, der etwaigen Verstößen gegen rechtliche Bestimmungen nachgeht und sie gegebenenfalls auch ahndet.

Daniel Wall, Vorstandsvorsitzender der Wall AG. Daniel Wall, president of Wall AG.

38

INSIDE JMB

Unsere Erfahrung ist jedoch, dass Werbekunden sehr verantwortungsvoll mit diesen Richtlinien umgehen und sie einhalten. Selbstverständlich würden wir Plakatmotive, die gegen Gesetze oder die guten Sitten verstoßen, ablehnen. Die Wall AG unterstützt seit Jahren verschiedene Sozialprojekte und Kultureinrichtungen, darunter auch das Jüdische Museum Berlin. Sicherlich erhalten Sie viele Anfragen zu Förderungen. Nach welchen Kriterien wird entschieden, wofür Wall sich engagiert? Wir haben beschlossen, uns als Sponsor bzw. Förderer in den folgenden drei Bereichen zu engagieren: der Kulturförderung, der Förderung von Kindern und Jugendlichen vor allem im Bildungsbereich sowie der Stadtbildpflege. Wir wollen unseren Beitrag zum Erhalt der unglaublich vielfältigen Kulturlandschaft Berlins leisten. Diese stellt ein sehr hohes Gut für die Stadt dar und ist einer der Gründe, warum so viele Besucher aus aller Welt nach Berlin kommen. Die Pflege des Stadtbildes, zum Beispiel durch unser Sponsoring von rund 80 Brunnenanlagen in Berlin, ist für uns als Stadtmöblierer selbstverständlich. Besonders am Herzen liegt uns aber die Förderung von Kindern und Jugendlichen. Wir finanzieren zum Beispiel in Berlin-Kreuzberg das Projekt „rechenfix & wortgewandt“ an der Jens-Nydahl-Grundschule. Schüler der Klassenstufen 3 bis 6 erhalten hier Förderunterricht in den Kernfächern Deutsch und Mathematik. Ziel ist es, mehr Schülern den Zugang zur gymnasialen Oberschule und letztendlich das Erreichen des Abiturs zu ermöglichen. Wir unterstützen auch die Internetplattform betterplace.org. Die haben eine völlig neue Form von Spendenportal geschaffen, das wir versuchen, mit unseren Plakatflächen noch bekannter zu machen. Die Fragen stellten Marie Naumann und Sascha Perkins


I N T E RV I E W

The Wall AG, a company which makes street furniture and outdoor advertising is one of the museum’s greatest supporters. Daniel Wall, son of the founder Hans Wall, runs the company.

be a family business in its new configuration—it is just that the family has gotten bigger. Of course, we are now a world market leader listed on the stock exchange—and with our new size come new challenges and opportunities for us. The “family business” institution plays an important role in small and medium-sized business in Germany in and of itself. These companies are the backbone of our country’s success. That means that family businesses still fit quite well into the current corporate landscape. However, globalization and bureaucratization are making survival for small- and mediumsized companies increasingly difficult.

You once said that “it was a matter of course that the entire family pitched in and helped sustain the family enterprise Wall AG.” Was it obvious for you to get involved in the company your father started or would you have preferred to take a different path?

Your company is active in various international cultural spheres. What needs to be taken into account when installing street furniture in places as different as Berlin and Istanbul?

Daniel Wall

It was a matter of course in the family that everyone pitched in, but not necessarily that I would make a career for myself within our company. I had some other ideas as well, but our company’s development was so exciting that it simply pulled me in. I could acquire comprehensive expertise, because I was able to get an extensive “know-how” of all the divisions within our company and I was also trusted with my ideas on how to restructure various areas. But it was not easy to assert myself.

There are only few large family businesses in Germany left. Not even Wall AG is still among them. Yet at the same time this form of business is idealized. Can you see an explanation for this? Do family-owned companies make sense in today’s corporate landscape? You’re referring to our company’s take-over by JCDecaux in 2009. Like Wall, JCDecaux is a company that was founded and run as a family business. We share the same values, ideals, and operational ideas in our new ownership structure. As a result, I still consider our company to

We always try to make an effort to ensure that our street furniture blends in with the surrounding cityscape. It’s important for us to be oriented towards the special architectural features of a city and to pick up on these in the design and construction of street furniture. Cultural influences generally leave their marks on the construction styles and architecture of any given city or country. Our street furniture tries to do justice to this.

Would you reject any sort of outdoor advertising? There are guidelines within the advertising field. The German Advertising Standards Authority (Werberat), is a committee for voluntary selfregulation, established to ensure compliance with these standards. The Werberat investigates suspected regulatory violations and, if necessary, imposes penalties. Our experience however is that advertising clients are responsible, generally recognizing and complying with these guidelines. We would— of course—decline advertising poster motifs that violate laws or public morals.

Wall AG has supported social projects and cultural institutions for many years now, including the Jewish Museum Berlin. Surely you receive a lot of requests for assistance. What are the criteria for deciding which of these to commit to? We have decided to sponsor and support projects and institutions in the following three areas: cultural patronage, promotion of children and young adults—especially within the educational field, and urban preservation. We want to make a contribution to the preservation of Berlin’s incredibly diversified cultural landscape. It is an extremely valuable commodity for the city and one of the reasons why so many visitors from around the world come to Berlin. Urban preservation, for example through sponsoring more than eighty fountains in Berlin, is a priority for us as providers of street furniture. But we are particularly dedicated to supporting children and young adults. We fund the “rechenfix & wortgewandt” [quick witted with words and numbers] project at the Jens Nydahl Elementary School in Kreuzberg, one of Berlin’s districts, for example. Students in grades 3 through 6 receive extra help in German and mathematics. The goal is to give more schoolchildren the opportunity to attend higher-level secondary schools (Gymnasium) and to eventually be able to take the university qualification exam (Abitur). We also support the Internet platform betterplace.org. They have created a new donation system that we are trying to publicize through our billboards and other outdoor advertising campaigns. Interview: Marie Naumann and Sascha Perkins

INSIDE JMB

39


VO R S C H AU

PREVIEW

> KO M M E N D E AU SST E L LU N G

> CO M I N G E X H I B I T I O N

8 . A P R I L B I S 24. J U L I 20 1 1

8 A P R I L TO 24 J U LY 20 1 1

Radical Jewish Culture

Radical Jewish Culture

Eine Ausstellung des Musée d’art et d’histoire du Judaïsme, Paris

An exhibition of the Musée d’art et d’histoire du Judaïsme, Paris

„Festival for Radical New Jewish Music“ – so lautete 1992 der Titel einer Veranstaltung in München, die von dem New Yorker Komponisten und Saxophonisten John Zorn ins Leben gerufen wurde. Vorgestellt wurde eine Musik, die Blues, Rock, Punk, Jazz und Neue Musik mit Klängen jiddischer Volksweisen aus Osteuropa verbindet. Der musikalische Aufbruch in eine Renaissance jüdischer Kultur war nicht zuletzt durch die Beschäftigung mit der nationalsozialistischen Massenvernichtung der europäischen Juden motiviert, die bislang von der Generation der Überlebenden und Immigranten erfolgreich verdrängt worden war. Ein selbstbewusster jüdischer Ausdruck in der Kunst und speziell in der Musik emanzipierte sich von einer Gemeinschaft, für die Assimilation an US-amerikanische Konventionen auf der Tagesordnung stand. Die Ausstellung „Radical Jewish Culture“ stellt dieses fruchtbare MusikJahrzehnt mit aufschlussreichen audio-visuellen Dokumenten, vielen Musikbeispielen und zum großen Teil unveröffentlichtem Material vor.

“Festival for Radical New Jewish Music”—this was the title of an event held in Munich in 1992 that was conceived by New York composer and saxophonist John Zorn. It presented a combination of blues, rock, punk, jazz, and new music with sounds of Yiddish folk tunes from eastern Europe. Among the forces that motivated a musical Renaissance of Jewish culture were efforts to deal with the mass extermination of European Jewry by the Nazis, long repressed to a large degree by the generation of camp survivors and immigrants. A self-confident Jewish expression in art and particularly in music emancipated itself from a community for whom assimilation into American customs had been the order of the day. The “Radical Jewish Culture” exhibition presents this seminal musical decade with insightful audio-visual documents, numerous music samples, and largely unpublished material.

> L ES U N G U N D D I S KU SS I O N

> R E A D I N G A N D D I S CU SS I O N

25. JA N UA R 20 1 1

25 JA N UA RY 20 1 1

Unsere Geschichten – eure Geschichte – Neuköllner Stadtteilmütter auf den Spuren der Geschichte des Nationalsozialismus

Our stories—your history—Neukölln district mothers learning about Nazi history

Mit Cem Özdemir (Vorsitzender, Bündnis 90/DIE GRÜNEN) und Elke Gryglewski (Haus der Wannsee-Konferenz)

With Cem Özdemir (Co-chair, Alliance 90/The Greens) and Elke Gryglewski (House of the Wannsee Conference)

Die Publikation „Unsere Geschichten – eure Geschichte – Neuköllner Stadtteilmütter auf den Spuren der Geschichte des Nationalsozialismus“ ist das Ergebnis eines langjährigen Projekts von Aktion Sühnezeichen Friedensdienste und der Diakonie Neukölln-Oberspree: Sogenannte Stadtteilmütter, Frauen mit Migrationshintergrund, die als Familienhelferinnen in innerstädtischen Problembezirken ausgebildet werden, setzten sich im Rahmen ihrer Ausbildung mit der NS-Geschichte auseinander. Das Buch zeigt die Ergebnisse dieser Auseinandersetzung, die persönlichen Zugänge der Frauen zur Geschichte des Nationalsozialismus, zum Holocaust und der NS-Vernichtungspolitik. Es wird deutlich, dass diese Frauen die Auseinandersetzung mit dem Nationalsozialismus als ein zentrales Element im Zugang zum Diskurs der Mehrheitsgesellschaft empfinden.

The publication “Unsere Geschichten—eure Geschichte—Neuköllner Stadtteilmütter auf den Spuren der Geschichte des Nationalsozialismus” (Our stories—your history—Neukölln district mothers learning about Nazi history) is the outcome of a long-term project of the Action Reconciliation Service for Peace (ARSP) and the Diakonie Neukölln-Oberspree Protestant charity. Mothers from non-German cultural spheres in Berlin’s Neukölln district, who were trained to assist families in inner-city trouble spots, dealt with Nazi history in the course of their training. The book presents the results of this involvement and the individual approaches of these women to the history of the Nazi period, the Holocaust, and the extermination policies of the Nazis. These women clearly felt that dealing with Nazi history is the key for participation in the discourse of the majority society.

> P U P P E N T H E AT E R

> P U P P E T T H E AT E R

28. NOVEMBER, 14.30 UND 16 UHR SOWIE JEDEN SONNTAG IM DEZEMBER UM 16.15 UHR

28 N OV E M B E R, 2 . 30 A N D 4 P M , AS W E L L AS E V E RY S U N DAY I N D EC E M B E R, 4.1 5 P M

Chanukka-Knatsch bei den Cohens

Hanukkah Spat at the Cohens

Das Puppentheater hat Tradition auf dem Chanukka-Markt des Jüdischen Museums. Wie das Chanukka-Fest in der Familie Cohen abläuft und welche Wunder im biblischen Jerusalem geschahen, zeigt das Jüdische Museum dieses Jahr in einem besonderen Theaterstück: Große Schaumstoffpuppen, darunter die äußerst beredte Ziege Golda oder der eher schweigsame Juda Makkabi, werden von jüdischen Berliner Künstlern in Bewegung gesetzt. Die Erlebnisse zweier ungleicher Schwestern rund um das Chanukka-Fest verzaubern kleine und große Zuschauer.

Puppet theater has a tradition at the Jewish Museum’s Hanukkah Market. Events at the Cohen family’s Hanukkah party and the miracles that happened in Biblical Jerusalem will be part of a special play this year at the Jewish museum: Large foam puppets, including the extremely eloquent goat Golda and the rather taciturn Judah Maccabee, come to life through Jewish artists from Berlin. The experiences surrounding the Hanukkah celebration of two very different sisters will enchant spectators both young and old.

40

INSIDE JMB


Auf der Walz. Journeyman.


„Das Mekka der Zimmerleute“: Die Firma M. Mosberg in Bielefeld “The Carpenters’ Mecca”: The M. Mosberg Company in Bielefeld Aubrey Pomerance

You don’t see them as often in recent years. Journeymen traveling in their traditional dress: Black floppy hat with a wide brim, black vest and jacket with mother-ofpearl buttons, white collarless shirt, and black corduroy bell-bottom trousers. Their tools and all their belongings tied up in a bundle slung over their shoulder. Young men and women who travel the countryside for at least three years after completing their apprenticeship in order to gain experience in their trade and in life on their way to permanent employment and possibly to becoming master craftsmen. In the first third of the twentieth century, one of the world’s leading manufacturers of specific occupational and trade clothing was a Jewish company in Bielefeld: M. Mosberg. Founded in 1850 by Moses Mosberg on Breite Strasse, where initially textiles, women’s coats and children’s clothing were sold, and since 1890 run by the brothers Max and Julius Mosberg, the company grew into one of the largest specialty factories in Germany. M. Mosberg clothed not only carpenters from head to toe, but also workers in dozens of other trades, including bricklayers and roofers, chimney sweeps and masons, bakers and cooks, waiters and hotel personnel. Durable corduroy slacks, teamsters’ vests, loden jackets, heavy fustian shirts, work coats, barbers’ smocks, butchers’ aprons, blue work overalls, and coachmen’s caps were just a few of the garments produced. Pocket-watch chains, earrings, tie pins, and rings were also part of the inventory as were pipes and lidded beer mugs with the trade insignia. A further important branch of the business was the manufacture, sale, and shipping of tools. The most visible sign of the firm, however, was the large advertisement cloth that the journeymen used to bundle up their clothing and tools to carry with them when they were on the road. This bundle was generally called a “Charlottenburger” (or “Charlie” for short), a name referring to the ban introduced in Charlottenburg in the nineteenth century that prohibited journeymen from entering the city with the then-common fur-covered rucksacks, for fear of lice and vermin. The cloth produced by M. Mosberg became known as “Maxe Mosberger” or “Bielefelder.” In the course of the company’s history, at least three different motifs were produced, all of which included its trademark: two craftsmen in traditional dress, in the last version encircled with the old journeyman’s adage: “The world is round, so let us travel, Brothers.”

42

J M B JOURNAL

Ihr Anblick ist in den letzten Jahren seltener geworden. Gesellen auf Wanderschaft in traditioneller Kluft: Schwarzer Schlapphut mit einer breiten Krempe, schwarze Weste und Jacke mit Perlmuttknöpfen, weißes kragenloses Hemd und schwarze Cordhose mit Schlag, über der Schulter ein Bündel, in dem Werkzeuge, Hab und Gut festgeschnürt sind. Junge Männer und Frauen, die nach ihrer Lehrzeit für mindestens drei Jahre durchs Land ziehen, um Arbeitsund Lebenserfahrungen zu sammeln auf dem Weg zu einer festen Anstellung und womöglich zu einer späteren Meisterprüfung. Weltweit führend in der Herstellung der spezifischen Zunftund Berufskleidung war im ersten Drittel des 20. Jahrhunderts unter anderem ein von jüdischen Unternehmern in Bielefeld geführtes Geschäft: M. Mosberg. Hervorgegangen aus einer 1850 durch Moses Mosberg gegründeten Stoffhandlung in der Breite Straße, in der auch Damenmäntel und Kinderkleidung verkauft wurden, wuchs der Betrieb unter der Führung der Brüder Max und Julius Mosberg ab 1890 zu einem der größten Spezialgeschäfte in Deutschland heran. Nicht nur Zimmermänner kleidete M. Mosberg von Kopf bis Fuß ein, sondern auch Dutzende weiterer Handwerksgruppen, darunter Maurer und Dachdecker, Schornsteinfeger und Steinmetze, Bäcker und Köche, Kellner und Hoteldiener. Manchesterhosen, Fuhrmannswesten, Lodenjoppen, Barchenthemden, Schutzkittel, Friseurjacketts, Schlachterschürzen, Kesselanzüge und Kutschermützen waren nur einige der angefertigten Gewänder. Uhrketten, Ohrringe, Krawattennadeln und Fingerringe gehörten ebenso zum Angebot wie Pfeifen und Stammseidel. Einen zweiten wichtigen Zweig der Firma bildeten Fertigstellung, Verkauf und Versand von Werkzeugen. Das nach außen hin sichtbarste Zeichen der Firma war jedoch das große Werbetuch, in dem die Gesellen Kleider und Werkzeuge einwickelten und als Bündel mit auf die Walz nahmen. Im Allgemeinen wurde dieses Bündel „Charlottenburger“ (oder „Charlie“) genannt: Der Name verweist auf das dort im 19. Jahrhundert eingeführte Verbot, Gesellen mit den damals üblichen fellbezogenen Rucksäcken den Zugang zur Stadt zu gewähren, aus Furcht vor Läusen und Ungeziefer. Doch die von M. Mosberg fabrizierten Tücher erhielten ihre eigene Bezeichnung und wurden als „Maxe Mosberger“ oder „Bielefelder“ bekannt. Im Verlauf der Firmengeschichte sind mindestens drei verschiedene Motive produziert worden. Alle Tücher trugen das Markenzeichen der Firma, zwei


Zimmermänner mit ihren „Maxe Mosbergern“. Journeymen with their “Maxe Mosbergers.”

In 1907, the company set up a large new factory on Jöllenbecker Strasse in the direct vicinity of the train station; in 1921 more than 200 workers were employed there. The measurements of all the customers were recorded and stored, so the craftsmen could make orders from wherever they were sojourning and their new clothing was custom-made and delivered in no time at all. This service prompted many customers to remain loyal to the company; their faithfulness was evidenced through the numerous photographs that Max Mosberg received from journeymen from all over the world and that he displayed in a large showcase in his shop in Bielefeld. On many of them, the company cloth was prominently visible, whether in its main function as a bundle, hanging at a construction site, or sewn together with others to make a carnival costume. An extant letter from the First World War even reported of raising a “Bielefelder” after the storming of a fort in Kaunas. The quality of Mosberg products was extolled in a poem sent to the company in 1930, which reported on the life-threatening situation of a mason who was left hanging by his pants on a nail 65 feet above the ground after a piece of scaffolding had broken off: Here is truly a story to tell, how his trousers saved him when he fell. Down below everyone shouted their praise, and to the pants they threw a gaze. The mason shouted, full of joy: Have a look at my pants of corduroy. For little money I ordered them: M. Mosberg of Bielefeld is quite a gem. I have been wearing them, I must say; for an entire year, every day.

in Kluft gekleidete Handwerker, zuletzt umkreist von dem alten Gesellenspruch „Die Welt ist rund, drum Brüder lasst uns reisen“. Bereits 1907 errichtete das Unternehmen eine neue große Fabrik in der Jöllenbecker Straße in unmittelbarer Nähe zum Bahnhof; 1921 waren dort mehr als 200 Mitarbeiter beschäftigt. Die Maße aller Kunden wurden verzeichnet und aufbewahrt. So konnten die Handwerker von ihrem jeweiligen Aufenthaltsort aus neue Kleidungsstücke nachbestellen, die man ihnen in kürzester Zeit maßgeschneidert zulieferte, ein Service, der sicherlich viele Kunden an die Firma gebunden hat. Ihre Treue zeigte sich dadurch, dass Max Mosberg aus aller Welt zahlreiche Fotografien von Gesellen auf der Walz zugeschickt bekam, die er in einem großen Glaskasten in seinem Bielefelder Laden aushängen ließ. Auf vielen war das Firmentuch prominent zu sehen, sei es in seiner Hauptfunktion als Bündel, aufgehängt auf Baustellen oder in Szene gesetzt als Karnevalsbekleidung. Ein überlieferter Brief aus den Zeiten des Ersten Weltkrieges berichtet sogar vom Hissen eines „Bielefelders“ nach der Erstürmung eines Forts in Kowno. Die Qualität der Mosberg-Erzeugnisse besang ein der Firma 1930 zugesandtes Gedicht, das über die lebensbedrohliche Lage eines Maurers berichtet, der in 20 Metern Höhe mit seiner Hose am Nagel eines abgebrochenen Gerüsts hängen blieb. „Und es sei hier zugegeben, / die Hose rettete sein Leben. / Unten alles schrie Hurra und die Hose sich besah. / Voll Freuden rief der Maurermann, / Ja, seht euch diese Hose an, / die schickte für sehr wenig Geld, M. Mosberg mir aus Bielefeld. / Ich trage sie, das ist sicher wahr, / schon Tag für Tag ein ganzes Jahr.“

J M B JOURNAL

43


Links: Der Firmensitz in der Breite Straße 45, ca. 1907. Left: The company on Breite Strasse 45, around 1907.

Rechts: Das Ladengeschäft in der Jöllenbecker Straße, ca. 1930. Right: The company store on Jöllenbecker Strasse, around 1930.

Local competition came—of all places—from within the family. The Louis Mosberg company, founded in 1868 by an uncle of Max and Julius, also manufactured occupational clothing. In the 1920s, it advertized that “there is no such thing as a brand simply called ‘Mosberg.’” M. Mosberg countered on a page in its catalog under the title “What everyone should know!” in which it was specifically pointed out that “Original M. Mosberg is the first, oldest, and largest special factory of its kind in the city,” which “introduced and established the manufacture of craftsmen’s clothing in Bielefeld.” It was, to be sure, not a competition between equals, but M. Mosberg obviously fretted losing customers if people confused the two names. When the Nazis came to power, Jewish textile companies in the entire country were targeted by the new regime. As early as 1933, the Association of GermanAryan Manufacturers in the Clothing Industry was formed in order to eliminate Jewish competition. Most Mosberg customers apparently remained loyal to the company, as is documented not only by the continued letters, cards, and photographs that were sent by journeymen, but also by two pictures that appeared in newspapers, which are not lacking in irony. In April 1936, the Bochumer Nationalzeitung published a photograph of one “Reichsleiter Stein” examining a “carpenter’s bundle,” which was none other than a “Maxe Mosberger.” At the send off of hundreds of journeymen in Berlin’s Lustgarten in May 1937, Nazi Party Reich Organization Leader Robert Ley, an embittered antiSemite and head of the German Labor Front (Deutsche Arbeitsfront), was photographed with carpenters in the front row carrying Mosberg bundles, as could be seen in both the Berlin weekly Die Woche, and Bielefeld’s local paper, Westfälische Zeitung. The days of the company were, however, numbered. In late September 1938, Bielefeld newspapers reported on the “Aryanization” of M. Mosberg. The new owner was Hermann Vick, a businessman from Braunschweig, who profited from the forced sale of Jewish property there as well. The “de-Jewed” company kept on “all the Aryan personnel from the old firm.” The prestige and success of the former business are apparent not only from the newspaper accounts of the Aryanization that referred it as “a diversified company known around the world,” but also from the fact that the new owner sought special authorization to be able to continue using the trademark and the old name for export purposes. Some six weeks after M. Mosberg changed hands,

44

J M B JOURNAL

Lokale Konkurrenz hatte das Unternehmen ausgerechnet aus der eigenen Familie. Die Firma Louis Mosberg, gegründet 1868 von einem Onkel von Max und Julius, stellte ebenfalls Berufskleidung her. In ihrer Werbung aus den 1920er Jahren wurde betont, „ein echtes Fabrikat schlichtweg ‚Mosberg‘ genannt gibt es nicht.“ M. Mosberg konterte mit einer Seite in seinem Katalog unter dem Titel „Was ein jeder wissen muss!“, auf der buchstäblich hervorgehoben wird, dass „Original M. Mosberg die erste, älteste und größte Spezialfabrik dieser Art in der Stadt“ sei, welche „die Fabrikation der Zunftkleidung in Bielefeld eingeführt und begründet“ hat. Es war jedoch ein Wettbewerb zwischen Ungleichen, bei dem der große M. Mosberg offenbar Kundenverlust durch Namensverwechslung zu befürchten hatte. Mit der Machtübernahme der Nationalsozialisten gerieten die jüdischen Textilunternehmen im ganzen Land ins Visier des neuen Regimes. Schon 1933 entstand die Arbeitsgemeinschaft Deutsch-Arischer Fabrikanten der Bekleidungsindustrie, um die jüdische Konkurrenz auszuschalten. Allem Anschein nach hielten jedoch die meisten Mosberg-Kunden der Firma die Treue, was nicht nur durch weitere postalische Mitteilungen und zugesandte Fotografien der Gesellen belegt wird, sondern auch durch zwei in der Presse veröffentlichte Abbildungen, die einer gewissen Ironie nicht entbehren: Im April 1936 erschien in der „Bochumer Nationalzeitung“ ein Foto eines gewissen Reichsleiters Stein beim Ansehen eines „zünftigen Bündels eines Zimmermannes“, das nichts anderes war als ein „Maxe Mosberger“. Bei der Verabschiedung hunderter Wandergesellen im Berliner Lustgarten im Mai 1937 durch den Reichsorganisationsleiter Robert Ley, erbitterter Antisemit und Leiter der Deutschen Arbeitsfront, standen ebenfalls Zimmermänner mit Mosbergschen Bündeln in der ersten Reihe, wie sowohl in der Berliner Zeitung „Die Woche“ als auch in der heimatlichen „Westfälischen Zeitung“ in Bielefeld zu sehen war. Die Tage der Firma waren dennoch gezählt. Ende September 1938 meldeten Bielefelder Tageszeitungen die „Arisierung“ von M. Mosberg. Neuer Inhaber war der Kaufmann Hermann Vick aus Braunschweig, der auch dort schon vom Zwangsverkauf eines jüdischen Grundstücks profitiert hatte. Der nunmehr „entjudete Betrieb“ übernahm „das gesamte arische Personal der alten Firma“. Ansehen und Erfolg des Unternehmens verdeutlichen


Reichsorganisationsleiter Robert Ley beim Verabschieden von Gesellen, Berlin, Mai 1937. Robert Ley, head of the NS party organisation (Reichsorganisationsleiter), during a farewell ceremony for journeymen in Berlin, May 1937.

many Jewish businesses in Bielefeld were destroyed during the pogroms in November 1938. Among them was the Louis Mosberg company. Max and Julius Mosberg and their sons Hans and Paul, who held leading positions in the company, avoided the wave of arrests. The latter succeeded in fleeing Germany. Hans Mosberg emigrated in August 1939 to England, where he was interned in June 1940 as an enemy alien and later deported to Canada. There he spent almost two and a half years in several internment camps, settling in Montreal after being released. Paul Mosberg was not able to flee until August 1940. He traveled via Russia, Japan, and Shanghai to Vancouver, Canada. Max Mosberg and his wife Johanna Mosberg née Vorreuter were deported in late July 1942 to Theresienstadt together with Max’s brother Julius and his wife Änne Mosberg née Rosenberg. The former were taken to Treblinka in September and murdered there. Julius and Änne Mosberg perished in Theresienstadt. In the mid-1950s Hans and Paul Mosberg filed for restitution. After more than ten years, they finally received compensation. For years Hans Mosberg eked out a living as a businessman and died in 1986. His cousin Paul ran a photo laboratory in Seattle, Washington, until his death in 1972. M. Mosberg has fortunately not been completely forgotten. The Historical Museum of the city of Bielefeld has dedicated a showcase to the company, and its history and fate have been depicted in a few publications on the history of Jews in the city. Recently, the Jewish Museum Berlin received a wonderful album from the estate of Hans Mosberg with photographs, product catalogs, newspaper clippings, and other memorabilia as a donation from his long-time friend, Leo Klag. And so at least some materials have been preserved from and about the company whose name and goods were for decades carried to all ends of the world by countless craftsmen. Aubrey Pomerance is Head of Archives at the Jewish Museum Berlin.

nicht nur die Bezeichnung in den Pressemeldungen zu seiner Arisierung als „weltbekanntes und weitverzweigtes Geschäft“, sondern auch die Tatsache, dass der neue Inhaber sich um eine Sondergenehmigung bemühte, um das Markenzeichen und den alten Namen für den Export weiterführen zu können. Knapp sechs Wochen nach dem Besitzerwechsel von M. Mosberg wurden bei den Novemberpogromen zahlreiche jüdische Geschäfte in Bielefeld zerstört, darunter das der Firma Louis Mosberg. Max und Julius Mosberg sowie ihre Söhne Hans und Paul, die leitende Stellen in der Firma innehatten, entgingen der Verhaftungswelle. Letztere schafften es, aus Deutschland zu entkommen: Hans Mosberg emigrierte im August 1939 nach England, wo er im Juni 1940 als feindlicher Ausländer interniert und anschließend nach Kanada deportiert wurde. Hier verbrachte er fast zweieinhalb Jahre in mehreren Internierungslagern und ließ sich nach seiner Entlassung in Montreal nieder. Paul Mosberg konnte erst im August 1940 fliehen und fuhr über Russland, Japan und Shanghai nach Vancouver. Max Mosberg und seine Frau Johanna geb. Vorreuter wurden zusammen mit seinem Bruder Julius und dessen Gattin Änne Mosberg geb. Rosenberg Ende Juli 1942 nach Theresienstadt deportiert. Erstere wurden im September des Jahres nach Treblinka transportiert und dort ermordet, Julius und Änne Mosberg kamen in Theresienstadt um. Mitte der 1950er Jahre strebten Hans und Paul Mosberg ein Wiedergutmachungsverfahren an, das erst mehr als zehn Jahre später mit einer Entschädigung zu Ende ging. Hans Mosberg hat sich jahrelang eher schlecht als recht als Geschäftsmann durchgeschlagen und starb 1986. Sein Cousin Paul betrieb bis zu seinem Tod 1972 ein Fotolabor in Seattle. Ganz in Vergessenheit ist das Unternehmen M. Mosberg nicht geraten. Das Historische Museum der Stadt Bielefeld widmet der Firma eine Vitrine, und ihr Schicksal wird in einigen Veröffentlichungen zur Geschichte der Juden in der Stadt geschildert. Vor Kurzem erhielt das Jüdische Museum Berlin ein eindrucksvolles Album aus dem Besitz von Hans Mosberg mit Fotografien, Warenkatalogen, Zeitungsausschnitten und sonstigen Memorabilien als Stiftung von seinem langjährigen Freund Leo Klag. Somit sind zumindest einzelne Zeugnisse der Firma aufbewahrt, deren Name und Waren zahllose Handwerker jahrzehntelang in die Welt hinaustrugen. Aubrey Pomerance ist Leiter des Archivs des Jüdischen Museums Berlin.

J M B JOURNAL

45


Weltfenster Worldwide

USA

25% USA

46

Kibbuz und Ökonomie

Kibbutz and Economy

Die israelische Wirtschaftskrise Mitte der 1980er Jahre und ihre harten Auswirkungen auf die finanzielle Situation der Kibbuzim führte zu weitreichenden strukturellen Veränderungen. Zahlreiche Kibbuzim privatisierten Wohnungen ihrer Mitglieder und führten individuelle Gehälter ein. Die Folgen waren ein verändertes Selbstverständnis vieler Kibbuzim und zweistellige wirtschaftliche Wachstumsraten seit dem Jahr 2000. Produzierten die Kibbuzim 1990 noch vorrangig für den israelischen Markt, vervierfachte sich die Anzahl der exportierten Güter bis 2006.

The economic crisis in Israel in the mid-1980s and its tough impact on the financial situation of the kibbutzim led to fundamental structural changes. Many kibbutzim privatized their members’ flats and introduced individual salaries. As a result, the kibbutzim experienced double-digit economic growth from the year 2000, and the self-image of many of them changed. While in 1990 the kibbutzim still mainly produced goods for the Israeli market, the volume of exports quadrupled by 2006.

J M B JOURNAL

Quelle/Source: Kibbutz Industries Association


Hauptexportländer aller Kibbuzim (2006) Kibbutz Industries’ main exporting destinations (2006) Bevölkerung Israels 7,1 Mio

Einwohner Kibbutzim 119.800

Israeli Population

Europäische Union

46%

Kibbutzim Residents

Osteuropa

6%

Eastern Europe

European Union

Asien

11% Asia Israel

1,3% Druckereiwesen, Papier und Karton 1,9% Stein und Baumaterial Printing, paper and cardboard

Afrika

Quarries and building materials

3% Africa

2,8% Medizin und Chemie

Medical and chemicals

3,3% Optik und Glas Optics and glass

4,8% Strom und Elektrik

Electricity and electronics

Exporte aller Kibbuzim nach Wirtschaftssektor Kibbutz Industries’ exports according to sector

56% Plastik und Kunststoffe

6,4% Textilien und Leder Textiles and leather

11% Metall und Maschinen

Plastics and rubber

Metals and machinery

11,4% Lebensmittel Food

J M B JOURNAL

47


The Evolution of the Economic and the Socio-Political Roles of the Third Sector in Israel Zur Entwicklung der ökonomischen und soziokulturellen Rolle des Dritten Sektors in Israel

Benjamin Gidron

Der Dritte Sektor ist eine bedeutende Größe in der israelischen Wirtschaft: Im Jahr 2005 hielt er mehr als 330.000 Menschen in Beschäftigung, hinzu kamen etwa 250.000 Ehrenamtliche. Sein Finanzvolumen betrug (im Jahr 2008) insgesamt über 94 Milliarden Schekel – etwa 25 Milliarden US-Dollar. „Dritter Sektor“ ist ein Sammelbegriff und umfasst all jene gesellschaftlichen Organisationen, die weder kommerziell (also auf Profit ausgerichtet) arbeiten noch Teil des Öffentlichen Dienstes sind – also laut einem Gesetz, einer Verfügung oder formellen Vorschrift vonseiten einer staatlichen oder lokalen Behörde existieren. In den 1990er Jahren zog er die Aufmerksamkeit von Parteiideologen und Wissenschaftlern auf sich, da die Zahl derartiger Organisationen und die Bandbreite ihrer Aktivitäten in fast allen Ländern beträchtlich anwuchs. Zu dieser Zeit bildete sich auch das Konzept eines „Dritten Sektors“ aus, dem all diese unterschiedlichen Organisationen angehören – analog zu den großen Sektoren Öffentlicher Dienst und Privatwirtschaft. Doch wenn man von „Sektoren“ in einer Gesellschaft spricht, muss man deren Rollen spezifizieren. Die Rolle der Privatwirtschaft und die des Öffentlichen Dienstes sind für die öffentliche Wahrnehmung seit Jahrhunderten klar und wohlbekannt. Doch welche Funktionen erfüllt der Dritte Sektor? In Israel sind es vor allem zwei: Erstens stellt er quasi-öffentliche Dienste zur Verfügung, die der eigentliche Öffentliche Dienst nicht anbietet. Und zweitens ist er bedeutsam für die Entwicklung der Zivilgesellschaft. Die erste Funktion tritt da zutage, wo eine Regierung sich die Arbeit gemeinnütziger Körperschaften zunutze macht, oft auch finanziell unterstützt. Die entsprechenden Dienstleistungen können sich zum Beispiel auf kontroverse Themen beziehen, bei denen die Konsensbasis fehlt, um sie dem Öffentlichen Dienst einzugliedern, oder politische Gründe dafür sprechen, sie in privater Hand zu lassen. Dies ist in vielen Ländern etwa im Bereich der Religionserziehung der Fall. Die zweite Funktion – also die für die Entwicklung der Zivilgesellschaft – ist weniger klar gefasst und Gegenstand unterschiedlicher Auffassungen. Einfach ausgedrückt besteht sie darin, Möglichkeiten zum Bürgerengagement zu schaffen, in Form freiwilliger, philanthropischer oder gemeinnütziger Arbeit. Der Dritte Sektor fördert sozialen Wandel und Verbesserungen, indem er neue Themen aufbringt und Bevölkerungsgruppen eine Stimme verleiht, die in anderen Institutionen nicht hinreichend repräsentiert sind. Bei der Analyse der Statistiken zum Dritten Sektor in Israel werden beide Funktionen evident. Dass er wichtige Dienste zur Verfügung stellt, lässt sich vor allem anhand seiner Dominanz auf den Feldern Bildung und Gesundheit, aber auch bei Wohlfahrt und Kultur bele-

48

J M B JOURNAL

The third sector is a large and significant force in the Israeli economy—in 2005 it employed over 330,000 workers and involved about 250,000 volunteers in its activities. Its overall expenditures (2008) were over 94 billion NIS (roughly $25 billion). The third sector is an aggregate term denoting the sum-total of organizations in society that are neither commercial (for-profit), nor public—existing by a law, decree or formal regulation by a national or municipal authority. In the 1990s it became a focus of attention for policy-makers and researchers as the number of such organizations and the scope of their activities grew substantially in practically all countries. This coincided with the notion that all those diverse organizations belong to a “third sector,” following the larger public and the business sectors. But when one talks about “sectors” in society one needs to specify their roles. The roles of the business and public sectors are very clear and have been well known in the public’s awareness for centuries. What are the functions of the third sector? In Israel it fills two important roles: (1) to offer quasi-public services not provided by the public sector, and (2) to develop civil society. In the first case, the government uses non-profit organizations to support services, it itself has neglected, often with government funding. Such services can revolve around controversial issues, where there is no consensus, turning them into bona fide public services, or where political reasons to leave the service in the private rather than in the public domain are compelling; religious education is an example of such a case in many countries. The second role—that of developing civil society—is not as clear-cut and is subject to different interpretations. In its simple form it means creating opportunities for non-coerced citizens’ participation through volunteering, philanthropy and association; promotion of social innovation and change by introducing issues and empowering populations not appropriately represented in other institutions. In analyzing data on the Israeli third sector, these two roles are very evident. The service provision role can be identified in the economic data by the dominance of programs of education and health, but also in welfare and culture, provided by the existence of large, specialized NPOs with major service systems


gen. In diesen Bereichen existieren große gemeinnützige Organisationen, die mit staatlicher Unterstützung ein breites Angebot an Dienstleistungen bieten: In der orthodoxen und ultra-orthodoxen Religionserziehung, in der medizinischen Grundversorgung, in der Kinderfürsorge und Altenpflege, aber auch im künstlerischen Bereich. Die wirtschaftliche Bedeutung des Sektors erklärt sich dadurch, dass auf diesen Feldern eine lange Tradition des nicht-profitorientierten Engagements besteht und die Budgets der dort tätigen Organisationen in hohem Maß aus öffentlichen Mitteln unterstützt werden. Die Funktion des Dritten Sektors für die Entwicklung der Zivilgesellschaft lässt sich aus einem anderen Datensatz ablesen, nämlich dem Register der Neugründungen von Amutot (Vereinen). Seit das Amutot-Gesetz 1980 in Kraft trat und das alte osmanische Vereinsrecht von 1909 ersetzte, wurden fast 50.000 Neugründungen verzeichnet, welche die vielfältigen Anliegen der israelischen Bevölkerung widerspiegeln. Das gegenwärtige Erscheinungsbild des Dritten Sektors lässt sich, ebenso wie seine doppelte Ausrichtung, aus der historischen Entwicklung der israelischen Gesellschaft erklären. In der vorstaatlichen Zeit (1920–1948) fußte das gesamte Bildungs- und Gesundheitssystem auf Organisationen, die wir heute dem Dritten Sektor zurechnen würden. In Ermangelung gesetzlicher Regelungen während des britischen Mandats übernahmen die verschiedenen ideologischen Bewegungen oder „Camps“, die die Einwanderung nach Palästina organisierten, auch diese Grundversorgung für die Neuankömmlinge und allgemein für die jüdische Bevölkerung. Die größte derartige Körperschaft war das „Workers’ Camp“, aus dem später die Histadrut, der Dachverband der israelischen Gewerkschaften, hervorging. Daneben gab es das marktwirtschaftlich orientierte „Civil Camp“, dessen Aktivisten in der Mehrzahl Händler und Freiberufler waren. Und als dritte wichtige Bewegung das religiöse „Mizrachi-Camp“, verwurzelt in orthodoxen Kreisen. Jedes dieser „Camps“ sorgte für „seine“ Leute und stellte ihnen ein umfassendes (sektorielles) System von Dienstleistungen zur Verfügung – von Kindergärten und Schulen über Krankenversicherungen bis zur Altenpflege. Finanziert wurden diese Systeme überwiegend durch Spenden aus dem Ausland, welche die Jewish Agency nach einem komplizierten Schlüssel gemäß ihrer Größe und politischen Bedeutung unter den „Camps“ aufteilte. Die Hauptfunktion des Dritten Sektors bestand somit darin, eine Grundversorgung zu gewährleisten, weil es eine solche sonst schlichtweg nicht gab. Sektoriell waren diese Dienste insofern, als nur bestimmte Bevölkerungsteile auf sie Anspruch hatten. Die Gründung des Staates Israel im Jahr 1948 zog einen tiefgreifenden Wandel in der vorherrschenden Ideologie nach sich, der das Wesen und die Funktionen

supported by the government: in higher- and ultra-orthodox education, in primary health care, in welfare for children and the elderly as well as in the arts. The large economic size of the sector can be explained by the fact that in those key fields, nonprofit organizations traditionally provide these services, and their budgets are significantly supported by public funds. The role of developing civil society can be found in a different set of data, namely records of registration of new Amutot (associations). Since the Law of Amutot went into effect in 1980, replacing an old Ottoman Law of Associations (1909), almost 50,000 new associations have been registered, reflecting the variegated interests of the Israeli population. These current characteristics of the third sector can be traced and its dual orientation explained in and by the historical development of Israeli society. In the pre-State era (1920–1948) the system of social, educational and health services was based on what we would call today Third Sector organizations. In the absence of statutory services during the British Mandate, those basic services were provided to the Jewish population by different ideological movements or “camps” that organized the immigration to Palestine and took care of those arriving. The largest one was the “workers’ camp,” which later developed into the Histadrut (Labor Union). Two other movements were the “civil camp,” with a free market ideology, to which mostly of merchants and self-employed persons belonged; and finally there was the Mizrahi/national religious camp, for the orthodox population. Each of these “camps” cared for “its” population and provided it with a comprehensive (sectorial) service system, consisting of schools, health insurance, day care, elderly care and more. These systems were funded primarily through donations from abroad, which were funneled through the Jewish Agency to the “camps” according to a complicated formula based on their relative size and political strength. Thus, in the absence of other actors to provide services, the major function of the third sector during that era was to provide basic services. These services were sectorial in the sense that they targeted specific populations only and were not universal in any form. After the Israeli state was established in 1948, a dramatic

J M B JOURNAL

49


des Dritten Sektors betraf. An die Stelle des fragmentierten, sektoriellen Systems der „Camps“ trat die Ideologie des fürsorglichen Staates, verkörpert in der Figur des ersten Premierministers David Ben Gurion. Die „Camps“ als Dienstleister wurden praktisch abgeschafft (aus ihnen gingen nun politische Parteien hervor) und durch ein System gesetzlich garantierter Dienste ersetzt. Dieses System kam der gesamten Bevölkerung zugute, und seine Ausgestaltung oblag den Regierungsministerien – für Bildung, Wohlfahrt, Gesundheit etc. Körperschaften des Dritten Sektors wurden vielfach in das staatliche System eingegliedert. In den Fällen jedoch, in denen – zuförderst aus politischen Erwägungen – sektorielle Strukturen erhalten blieben und die entsprechenden Organisationen ihre Arbeit fortführten, wurden sie nun in hohem Maß aus staatlichen Mitteln finanziert – und unter behördliche Aufsicht gestellt. Beispiele dafür sind die Krankenkassen und das ultra-orthodoxe Bildungswesen. Neue Organisationen des Dritten Sektors entstanden, etwa im Bereich der Behindertenförderung. Doch auch hier war die behördliche Anbindung eng, und die Finanzierung kam zu wesentlichen Teilen aus der öffentlichen Hand. In dieser Zeit (1950–1975/80) etablierte sich die Funktion des Dritten Sektors als Anbieter von Dienstleistungen, der, ins Konzept des Wohlfahrtsstaats eingebunden, vor allem das behördliche Angebot vervollständigt. Charakteristisch war seine finanzielle Abhängigkeit vom Staat – und in der Folge ein Mangel an „eigener Stimme“, mit der die Organisationen des Dritten Sektors ihre Anliegen hätten vertreten können. Die gesellschaftliche und politische Krisenzeit, die für Israel nach dem Yom-Kippur-Krieg anbrach, hatte wiederum nachhaltige Auswirkungen auf den Dritten Sektor. In diese Phase fällt der Beginn seiner zweiten Orientierung – auf die Entwicklung der Zivilgesellschaft. Die Ideologie des starken Staats, die darauf hinauslief, dass in sozialen Belangen die Regierung als Hauptakteur und wichtigster Entscheidungsträger auftrat, wich allmählich einer anderen, die auf ein Nebeneinander mehrerer Akteure abzielte. Unabhängige, nicht parteigebundene Initiativen aus der Bevölkerung waren zuvor eher zurückgedrängt worden, nun fanden sie neue Ausdrucksformen. Zunächst in Gestalt von Protesten, später von organisiertem Bürgersinn und nachhaltiger gesellschaftlicher Arbeit, kamen Hunderte neuer Themen auf und Tausende engagierter Individuen traten damit an die Öffentlichkeit. Die Bandbreite reicht vom Umweltschutz über die Rechte ausländischer Arbeitnehmer bis zur Frage nach dem jüdischen Status äthiopischer Einwanderer. Die israelischen Regierungen bevorzugen bei der Förderung gemeinnütziger Engagements eindeutig solche Organisationen, die ihre politische Linie unterstützen oder ihr zumindest nicht entgegenarbeiten. Deshalb

50

J M B JOURNAL

change occurred in the prevailing ideology, which impacted the nature and the functions of the third sector. From a fragmented sectorial system based on different “camps,” the new Israeli state adopted a statist ideology, personified by the first prime minister David Ben Gurion, which practically abolished the “camps” as service providers (and turned them into political parties) and created a statutory system of services instead. That system served the entire population and was organized by government ministries (education, welfare, health, etc.). Existing third sector organizations were merged into the statutory system. Yet in some cases, where statutory services could not replace sectorial services, mostly for political reasons, the sectorial systems remained and continued to provide their services, but were funded to a large extent by the state budget and were supervised by state authorities. Two such cases are the health insurance system and the ultra-orthodox educational system, which is not a part of the statutory educational system, but is, to a large extent, financially supported by the state. New third sector organizations developed during that era as well—for children with mental and physical disabilities, for example. Many of these developed close connections to the state, were funded to a large extent by the public sector, and coordinated their activities with the state authorities. From 1950–1975/80 the service-providing nature of the third sector was shaped, specifically complementing services to the statutory ones within the welfare state concept. Furthermore the financial dependence of the third sector led it to suppress its independent “voice” for those organizations in issues they dealt with. The major social and political crises that the Israeli society underwent in the aftermath of the Yom Kippur War (1973) had a marked effect on the third sector as well, which started to develop an additional orientation—that of developing civil society. The statist ideology, suggesting in effect that the government should be the leading actor and make the major decisions on the social arena, was being gradually replaced by an alternative one, recognizing a plurality of voices on given issues. Independent citizen action and involvement (outside political parties), which was discouraged in the Statist era found new means of expression,


bestand ein wichtiger Faktor für die Neuausrichtung des Dritten Sektors in der Erschließung neuer, hauptsächlich ausländischer Geldquellen, die an die Stelle der traditionellen Finanzierungskanäle in Israel traten und eine direkte Verbindung zwischen den Exponenten zivilgesellschaftlicher Gruppierungen und den meist in Nordamerika oder Europa ansässigen privaten Geldgebern gewährleisteten. Die Regierungen, die sich von der dirigistischen Wirtschaftspolitik der 1950er bis 1970er Jahre hin zu einem offen kapitalistischen Gesellschaftsmodell bewegten, mussten diese Öffnung auch auf den Dritten Sektor ausdehnen. Und wenngleich sie Organisationen, die nicht auf ihrer politischen Linie liegen, weiterhin aktive Unterstützung verweigern, haben sie zumindest gelernt, mit ihnen zu leben. Im Israel des Jahres 2010 kann die Bedeutung des Dritten Sektors gar nicht überschätzt werden. Zum einen bietet er eine Vielfalt von Diensten an, ohne die der Lebensstandard und die Lebensqualität der Israelis erheblich niedriger wären. Zum anderen bringt er fortwährend neue gesellschaftliche Fragen in den Blickpunkt der Öffentlichkeit und stößt damit Debatten und politische Korrekturen an. Darüber hinaus werden in einer Zeit des Niedergangs der politischen Parteien die zivilgesellschaftlichen Organisationen zum wichtigsten Forum für öffentliches Engagement und politische Teilhabe – und zur besten Schule für künftige Führungskräfte. Benjamin Gidron ist Professor Emiritus der Ben Gurion University of the Negev. Er ist Gründer und Direktor des Israeli Center for Third Sector Research (ICTR) und forscht seit 25 Jahren zu Themen rund um den Dritten Sektor.

first in the form of protest and later in the form of civil efforts, and brought to the fore hundreds of new issues and thousands of individuals who were ready to take action around them. These vary from environmental protection to the rights of foreign workers or the Jewish status of Ethiopian immigrants. The Israeli government, in its policy supporting non-profit organizations, clearly favors institutions that follow its policies or at least do not challenge them. Enabling the development of such an orientation were, most importantly, new funding sources, mostly from abroad, that bypassed the traditional channels of fund-raising for Israel and created a direct link between leaders of civil society groups and organizations and private funders, mostly in North America, but also in Europe. The government, which moved from a controlled economy in the 1950s–1970s to an open capitalist one, had to adjust this openness to the third sector as well. And although it still does not actively support organizations that oppose its policies, it has learned to live with them. In Israel of 2010 the importance of the third sector cannot be overstated. On the one hand it provides a whole variety of services, without which the standard of living and the quality of life would be significantly lower. On the other hand it constantly brings to the public’s attention new social issues around which to define new policies or new public intervention. Furthermore, as political parties have lost influence, civil society organizations have become the vehicle of public involvement and participation as well as “leadership schools” for future leaders. Benjamin Gidron is Professor Emeritus and the founder and director of the Israeli Center for Third Sector Research (ICTR) at Ben Gurion University of the Negev in Beer-Sheva, Israel. He has been researching issues pertaining to the Third Sector and related topics for the past 25 years.

J M B JOURNAL

51


W. Michael Blumenthal

Around the World in Eighty Years In 80 Jahren um die Welt

Nachdem ich mehrere Tage die Atmosphäre einer der zweifellos schönsten Städte der Vereinigten Staaten in mich aufgesogen hatte, warteten meine Schwester Stefanie und ich am ersten Samstagabend ungeduldig auf die Sonntagszeitungen und durchforsteten den ganzen nächsten Tag die Stellenanzeigen. Der Montag sollte der D-Day unseres Eintritts in die amerikanische Arbeitswelt werden. Mein überschäumender Enthusiasmus ließ keinen Platz für Zweifel daran, dass wir Erfolg haben würden, und darin wurde ich auch nicht enttäuscht. Gleich am ersten Tag fand meine Schwester eine Anstellung mit einem Wochenlohn von fünfzig Dollar, und auch ich konnte mit einer guten Nachricht aufwarten. Weniger als eine Woche nachdem wir an Land gegangen waren, hatten

52

J M B JOURNAL

For several days I soaked up the atmosphere of what is surely one of America’s most beautiful cities. On our first Saturday night we anxiously awaited the Sunday papers, and all through the next day my sister Stefanie and I pored over the job ads and planned for Monday that would be D-Day in our quest to join the American labor force. My buoyant enthusiasm left no room for doubt about an early success and in this I was not to be disappointed. On the very first day, she had landed a secretarial job at fifty dollars a week and I could triumphantly report similar good fortune. Less than a week after stepping ashore we were both employed—she


wir beide eine Arbeit, sie als Sekretärin und ich als Angestellter in der Rechnungsabteilung von National Biscuit Co., kurz Nabisco, einem der Unternehmensgiganten des Landes, dessen Name in Amerika jedes Kind kennt. Obwohl ich nur eine vage Vorstellung von meinen Pflichten hatte und mein bescheidenes Wochensalär von vierzig Dollar nur knapp über dem gesetzlichen Mindestlohn lag, war ich stolz, in ein derart angesehenes Unternehmen einzutreten. In meinen Augen hatte ich die erste Stufe meiner persönlichen Erfolgsleiter genommen. Vielleicht war es zu erwarten, dass ich als dankbarer Einwanderer meine neue Umgebung anfangs völlig unkritisch durch eine rosarote Brille sah. Aber nachdem ich begonnen hatte, jeden Morgen bei Nabisco die Stechuhr zu bedienen, um acht Stunden lang eine stupide, geisttötende Arbeit zu verrichten, dauerte es nicht lange, bis ich eine weniger glänzende Realität entdeckte. Dabei verlor ich nicht nur meine anfängliche Euphorie, sondern bald auch die kritiklose Bewunderung der Effizienz der amerikanischen Wirtschaft. Als Angestellter in der Rechnungsabteilung hatte ich nämlich auf einem äußerst geschäftigen Schiff angeheuert, auf dem es weder besonders rationell noch besonders heiter zuging. Ich fand mich, schlicht gesagt, in einem Büro, das an einen Ausbeuterbetrieb des 19. Jahrhunderts erinnerte und aus einem Roman von Dickens zu stammen schien, unter einem bunten Haufen von gelangweilten, mürrischen Angestellten wieder, die an langen Holztischen saßen und sich ständig wiederholende Berechnungen anstellten, indem sie endlose Zahlenkolonnen im Kopf addierten und die Summen mit der Hand in Rechnungen für Lorna Doones, Animal Crackers, Oreo Cookies und andere beliebte Nabisco-Produkte eintrugen, die am nächsten Tag ausgeliefert werden sollten. Der Stapel von Rechnungen, der uns jeden Morgen erwartete, schien ständig höher zu werden, und häufig wurden Freiwillige gesucht, die bereit waren, Überstunden zu machen. So führten wir Tag für Tag, nur unterbrochen von einer dreißigminütigen Mittagspause, unsere Galeerenarbeit aus, immer unter den strengen Blicken von Mr. Duff, unserem Chef, einem griesgrämigen, humorlosen älteren Herrn, der uns von seinem Schreibtisch in der Mitte des Raumes aus über eine altmodische randlose Brille hinweg im Auge behielt. Soweit ich feststellen konnte, hatte er zwei Aufgaben, nämlich, erstens, auf eiserne Disziplin zu achten, die er vor allem mit lautem Räuspern und vorwurfsvollen Blicken durchsetzte, die er jenen zuwarf, deren Arbeitseifer nachließ oder die, schlimmer noch, die Sünde begingen, ihrem Nachbarn etwas zuzuflüstern. Seine zweite Aufgabe, die ihn praktisch ununterbrochen in Atem hielt, bestand darin, neue Angestellte zu suchen, um diejenigen zu ersetzen, die das Handtuch geworfen und sich auf grünere Weiden begeben hatten, was angesichts der Umstände häufig geschah. Eine Anstellung auf diesem dysfunktionalen Karussell zu bekommen, war einfach; bedeutend schwerer war es, das Stehvermögen aufzubringen, um längere Zeit auf ihm auszuharren. Die Fluktuation war groß, und so mangelte es Mr. Duff nie an Arbeit. Wie weite Teile von Nachkriegsamerika boomte auch Nabisco, womit jedoch niemand gerechnet zu haben schien. Die Folge war ein heilloses Durcheinander. Für die Millionen heimgekehrter Soldaten, die eine Familie gegründet hatten und nun den Frieden in vollen Zügen genießen wollten, schloss das gute

as a secretary, and I as a billing clerk at the National Biscuit Co., or Nabisco, an American household name and one of the country’s corporate giants. No matter that I had only a hazy notion about my duties and that the modest forty dollars weekly pay was barely above the legal minimum. I was proud to be joining the ranks of so prestigious an enterprise and, as far as I was concerned, I was on my way upward on the first rung of the ladder of success. Perhaps it was natural that I would at first view my new surroundings through the rose-colored glasses of a grateful, uncritical immigrant. Yet it did not take long to discover a less glamorous reality when punching the Nabisco timeclock each morning for eight hours of utterly stupid and mind-numbing work, thereby greatly accelerating a more sobering coming down to earth. Along the way, not only my initial euphoria, but also my uncritical admiration for American business efficiency were among the early victims. As a Nabisco billing clerk, I had in fact enlisted for duty on an exceedingly busy ship, but neither a particularly functional nor happy one. In a Dickensian setting reminiscent of a nineteenth century sweatshop, I had become part of a motley assortment of bored and sullen clerks arrayed around several long wooden tables and tasked to perform repetitive arithmetic calculations on endless columns of figures—in our heads—and then to enter the results manually on invoices for the next day’s deliveries of Lorna Doones, Animal Crackers, Oreo Cookies and assorted other Nabisco bestsellers. The stack of invoices awaiting us each morning seemed to grow ever higher, and often there would be anxious pleas for overtime volunteers. Thus we labored on in a tedious routine with thirty minutes off for lunch, day after day, watched over by Mr. Duff, our boss, a dour and humorless elderly gentleman seated at a desk in the center of the room and sternly peering at us over old-fashioned rimless glasses. His principal duties, as far as I could tell, were two-fold. One was to enforce strict discipline, which he did mostly by noisily clearing his throat and directing reproachful glances toward anyone whose diligence flagged or—worse yet—committed the sin of whispering to his neighbor. The other entailed engaging in what amounted to a non-stop recruiting effort to replace those who had thrown in the towel and left for greener pastures—under the circumstances a frequent occurrence. Getting hired into this dysfunctional merry-go-round was easy; marshalling the stamina to stay the course for any length of time was a considerably greater challenge. With staff turnover high, Mr. Duff was a busy man. As in much of postwar America, Nabisco’s business was booming, but no one seemed to have expected it, and the result was a mess. For the millions of returned war veterans, starting families and eager to enjoy the peace, the good life apparently included the consumption of enough Nabisco cookies, crackers and cup-

J M B JOURNAL

53


Leben offenbar den Verzehr von großen Mengen von Nabisco-Keksen, -Crackers und -Kuchen ein, die zu liefern dem Unternehmen schwerfiel. Dabei hätten schon ein paar einfache Veränderungen des Büroalltags Wunder gewirkt, aber offenbar waren sie noch niemandem eingefallen. Heutzutage hätte wahrscheinlich ein einziger PC uns alle über Nacht überflüssig gemacht, aber selbst in der damaligen vorelektronischen Zeit hätte die Anschaffung einer genügend großen Zahl von elektromechanischen Rechenmaschinen, wie sie mein späterer Arbeitgeber Burroughs damals herstellte, viele von uns den Arbeitsplatz gekostet und Nabisco beträchtliche Einsparungen gebracht. Wenn ich mich recht erinnere, standen uns ganze zwei überalterte Klapperkisten zur Verfügung, aber man musste sich anstellen, um sie zu benutzen, und die ganze Prozedur war ebenso zeitraubend wie hoffnungslos. Ich hielt es zwei Monate bei Nabisco aus, was ungefähr dem Durchschnitt entsprach, und kündigte, kurz bevor die Papierlawine der Weihnachtsbestellungen den armen Mr. Duff und seine unglücklichen Untergebenen unter sich zu begraben drohte. Rechnungen für NabiscoKekse auszustellen, war zwar einer der drögeren Jobs, die ich hatte, aber er ist mir unvergesslich geblieben, und zwar nicht nur, weil ich hier mein erstes Geld in Amerika verdiente, sondern auch, weil er mich auf den Boden der Tatsachen zurückholte und mich zwang, mir Gedanken über meine Zukunft zu machen. Angesichts des Galgens, heißt es, bekommt man einen klaren Kopf. Für mich war Nabisco der Galgen. Nach der Eintönigkeit des Addierens, Subtrahierens und Multiplizierens sagte ich mir, dass es aussichtsreichere Wege zur Verwirklichung meines amerikanischen Traums geben musste. Mir wurde bewusst, dass ich mit meinen 22 Jahren, zehn Jahren Schule und acht Jahren in China zwar reich war an ungewöhnlichen Erfahrungen, aber arm an substantiellem Wissen. Es hieß, in Amerika könne man jederzeit wieder zur Schule gehen, und fehlte es an Geld, lautete das Motto: „Kämpfe dich durch!“ Unter dem Eindruck der geisttötenden Rechenübungen bei Nabisco kam ich zu dem Schluss, dass es an der Zeit war, die Latte höher zu hängen und andere Wege zum Glück auszuprobieren.

cakes to strain the company’s capacity to cope. Even a few simple changes in the office’s routine would have worked wonders, but apparently no one had gotten around to thinking about them. In today’s world, a single desktop computer would surely have obsoleted all of us overnight, but even in those pre-electronic days, enough electro-mechanical adding machines of the kind my future employer, Burroughs, was producing in those days would have eliminated many of our jobs and saved Nabisco lots of money. If memory serves me right, we had a grand total of two overaged, rickety clunkers at our disposal but one had to line up for them, and the whole procedure was time-consuming and hopeless. I lasted two months at Nabisco, which was about the average, and departed just before the onslaught of Christmas orders threatened to drown poor Duff and his unhappy charges in a sea of paper. Still, though billing cookies at Nabisco was one of the less inspiring jobs I have held, it has remained an unforgettable one, not only because it was my first gainful employment in America, but because it was instrumental in putting me back in touch with reality and in forcing me to do some hard thinking about my future. It is said that “the sight of the gallows clarifies one’s mind” and that is what my stint at Nabisco did for me. The monotony of adding, subtracting and multiplying convinced me that there had to be more hopeful avenues for realizing my American dream and that at age 22 with a tenth grade education and eight years in China, I was long on unusual experiences but woefully short on substantive knowledge. It was said that in America it was always possible to go back to school, and if there was no money, the answer was to “work one’s way through.” Spurred on by the mind-numbing Nabisco arithmetic exercises, it was a mere matter of weeks before I reached the conclusion that it was not too soon to set my sights higher and to give alternative roads to fame and fortune a try.

54

Der Direktor des Jüdischen Museums Berlin, W. Michael Blumenthal, legte Ende September seine Memoiren vor. Geboren in der Weimarer Republik, aufgewachsen im Dritten Reich in Berlin-Mitte, floh er mit seiner Familie vor den Nazis ans andere Ende der Welt, nach Shanghai. Von dort emigrierte er in die USA und machte Karriere in Wirtschaft und Politik, unter anderem als Berater Präsident Kennedys und als Finanzminister unter Präsident Carter. 1997 folgte er dem Ruf seiner Heimatstadt und kehrte nach Berlin zurück.

The director of the Jewish Museum Berlin, W. Michael Blumenthal, recently presented his memoir, a personal record of the first rank. Born in the Weimar Republic, he grew up in Berlin during the Third Reich and fled the Nazis with his family to the other end of the world, to Shanghai. He emigrated from there to the USA and pursued a career in business and politics, as advisor to President Kennedy and Minister of Finance under President Carter amongst others. In 1997 he followed the call of his hometown and returned to Berlin.

Das Buch „In achtzig Jahren um die Welt. Mein Leben“ erschien im Propyläen Verlag, Berlin. 576 Seiten, €24,95 [D]

The book “In achtzig Jahren um die Welt“ (“Around the World in Eighty Years“) was recently published by Propyläen Verlag, Berlin. 576 pages, € 24,95. German version only.

J M B JOURNAL


„Scherk ist wieder da“ – eine Firmengeschichte in Deutschland “Scherk is back”: The History of a German Company Iris Blochel-Dittrich, Leonore Maier

By candlelight at the grand piano—this is how Fritz Scherk came into the world on May 26, 1918. The piano belonged to his mother Alice, a singer and the niece of one Dr. M. Albersheim, founder of the Frankfurt perfumery of the same name. The candlelight was due to the circumstances: it was wartime. Meanwhile the boy’s father, Ludwig Scherk, was waiting at his own perfumery in Joachimsthaler Straße to be able to restart the production of creams, powders, and bath salts, which had been interrupted by the war. A skilled druggist with a number of years experience working for Dr. Albersheim in Frankfurt, Ludwig Scherk opened his business in Berlin in 1906. He initially continued to sell Albersheim products, but in 1912 he began to manufacture his own cosmetics. The company grew quickly and products including brilliantly colored bath salts, Scherk’s Cold Cream, and above all the “Mystikum” line, brought the new firm renown across Europe. Trips to the U.S.A., where he was developing both a branch of the company and production capabilities in New York, not only provided Ludwig Scherk with the idea to import Germany’s first shaving tonic, “Tarr,” but also the facial tonic that became the firm’s bestseller for decades. The Scherk store was prominently located at the head of Kurfürstendamm, directly next door to the establishments of Grünfeld and Kranzlereck, formerly Café des Westens. The luxurious perfumery was one of the first places where customers, seated at single tables, would receive individualized service. Among this clientele were the elegant society families of Berlin’s West, women “from the most respectable Jewish circles,” numerous prominent artists, as well as English and French ambassadors. These two customers would later be instrumental for Ludwig Scherk as he tried to emigrate. Both Scherk parents kept diaries in which they closely documented their two sons’ upbringing and development. Fritz and his brother Walter, five years older, were destined from the earliest age to take over their father’s business. Company and family were one and the same, and the sons were purposefully prepared for their future responsibilities as business owners. Yet the parents did not dispute the evidence that Fritz’s talents pointed in another direction, and when the boy declared his uneasiness at barely thirteen, his mother recorded his statement: “I don’t want to be the boss, I don’t know—I wouldn’t like someone to have to

Bei Kerzenlicht an einem Bechsteinflügel – so wurde Fritz Scherk am 26. Mai 1918 geboren. Der Flügel gehörte seiner Mutter Alice, Sängerin und Nichte des Gründers der Frankfurter ParfümerieFirma Dr. M. Albersheim, das Kerzenlicht war den bewegten Zeitumständen im Krieg geschuldet. Der Vater des Knaben, Ludwig Scherk, wartete derweil darauf, in seinem Parfümeriegeschäft in der Joachimsthaler Straße die unterbrochene Produktion von Cremes, Puder und Badesalzen wieder aufnehmen zu können. Das Berliner Geschäft gründete der gelernte Drogist Ludwig Scherk 1906 nach einigen Jahren der Tätigkeit bei Dr. M. Albersheim in Frankfurt. Zunächst verkaufte er auch in Berlin Albersheim-Produkte; 1912 begann er, eigene Kosmetika herzustellen. Seine Firma wuchs rasch, die Produkte – Badesalze in strahlenden Farben, die Scherk’sche Cold Cream, vor allem aber die Mystikum-Reihe – erwarben der Parfümerie Scherk europaweiten Ruhm. Von USA-Reisen, die dem Aufbau einer Filiale und Produktionsstätte in New York dienten, brachte Ludwig Scherk nicht nur die Idee zu Deutschlands erstem Rasierwasser, Tarr, mit, sondern auch das Gesichtswasser, das über Jahrzehnte zum Verkaufsschlager der Firma werden sollte. Die Scherk’schen Geschäfte befanden sich in prominenter Lage am Kurfürstendamm, in unmittelbarer Nachbarschaft zu Grünfeld- und Kranzlereck, vormals Café des Westens. Die luxuriöse Parfümerie Scherk gehörte zu den ersten Geschäften, in denen die Kundschaft an kleinen Tischen individuell beraten wurde. Darunter befand sich das elegante Publikum des Berliner Westens, Damen „aus den achtbarsten jüdischen Kreisen“, zahlreiche prominente Künstler ebenso wie der englische und französische Botschafter. Beide sollten dem Firmenchef später bei der Emigration behilflich sein. Gemeinsam führten die Eltern Scherk Tagebücher, in denen sie Aufwachsen und Erziehung ihrer beiden Söhne dokumentierten. Fritz und sein fünf Jahre älterer Bruder Walter waren von klein auf dazu ausersehen, den väterlichen Betrieb zu übernehmen. Unternehmen und Familie waren eins, und die Söhne wurden zielgerichtet auf die künftigen Aufgaben als Firmeninhaber vorbereitet. Dass seine Talente eigentlich in eine andere Richtung wiesen, focht die Eltern nicht an, obwohl Fritz schon als knapp 13-Jähriger sein Unbehagen zum Ausdruck brachte: „Ich möchte nicht Chef sein,

J M B JOURNAL

55


obey me.” By this point in time his father had built the impressive Scherk factory with 400 employees in a southern part of the city. The plot of land it was built on would even allow the Scherk sons to expand when the business required it. Fritz was in the midst of his training—for the family business of course—when his mother Alice took her life in 1934. Beginning the previous year, Ludwig Scherk had received lucrative offers to sell the company but had refused them all in the hope that he could retain his firm despite political repression. Fritz witnessed company developments first hand: after his apprenticeship, he joined the company as an employee in 1936 and worked in each department. The following year Scherk was even recognized as a “model National Socialist business.” Fritz recalled later: “I was at the ceremony with upper-level Nazis, they didn’t suspect that we were Jews.” But pressure on Jewish business owners only grew. Their competitiveness declined after the ban on advertising in German newspapers, as intimidation of customers and suppliers intensified, and as their allocation of raw materials was restricted. Ludwig Scherk thus saw himself compelled to sell, entering into negotiations through the Warburg Bank with the manufacturing firm Schering. At last he agreed on a deal—far below the company’s value—and sold his life’s work to Schering AG. Because of the high tax on goods leaving the country with their fleeing owners, however, he was only able to transfer a fraction of the proceeds abroad. A few days after signing the contract of sale on June 28, 1938, he emigrated to London—but not before saying goodbye to his staff, the “Scherkianers.” Fritz also left Berlin for France shortly thereafter with 10 Reichsmark in his pocket. His father had organized his emigration, which was intended to serve as a continuing education in the cosmetics field. Fritz did in fact spend a brief interlude at Robertet in Grasse, which was the center of the perfume industry, but so far away from paternal authority, he devoted most of his time to developing his musical skills. Paradoxically, the outbreak of war provided new prospects for Fritz Scherk, as he wrote decades later in an elaborate rhymed memoir: “Then the war came and let me strive, / Independence changed my life.” After several years in the Foreign Legion, Fritz made his way—a persuaded pacifist—to Palestine, where he reluctantly tried to work as a perfumer, but soon, after a period of training, found satisfying employment as a hospital nurse.

56

J M B JOURNAL

ich weiß nicht – ich möchte nicht, dass einer mir gehorchen muss“. Zu diesem Zeitpunkt hatte der Vater bereits das beeindruckende Scherk’sche Fabrikgebäude für 400 Mitarbeiter im Berliner Südende errichtet – auf einem Grundstück, das genügend Raum für eine Erweiterung des Betriebs durch die Söhne bot. Als seine Mutter Alice sich 1934 das Leben nahm, befand sich Fritz bereits in der Ausbildung; selbstverständlich im familieneigenen Betrieb. Ludwig Scherk hatte seit 1933 lukrative Angebote erhalten, sein Unternehmen zu verkaufen. In der Hoffnung, die Firma trotz der politischen Repressionen erhalten zu können, lehnte er sie alle ab. Sohn Fritz bekam die Entwicklungen in der Firma aus nächster Nähe mit: Nach Beendigung seiner Lehrzeit trat er 1936 in den Betrieb ein und arbeitete dort in sämtlichen Abteilungen. Im Jahr darauf wurde Scherk sogar als „nationalsozialistischer Musterbetrieb“ ausgezeichnet. „Ich war bei der Zeremonie mit hohen Nazis dabei, sie vermuteten nicht, dass wir Juden waren“, so Fritz Scherk im Rückblick. Doch der Druck auf die jüdischen Firmeninhaber wuchs. Die Einschüchterung von Kunden und Lieferanten, das Verbot, in deutschen Zeitungen zu werben sowie Beschränkungen bei Rohstoffzuteilungen minderten die Konkurrenzfähigkeit des Unternehmens. So sah sich Ludwig Scherk zum Verkauf genötigt und trat über das Bankhaus Warburg mit dem Schering-Konzern in Verhandlungen. Weit unter Wert veräußerte er schließlich sein Lebenswerk an die Schering AG; wegen der Reichsfluchtsteuer konnte er nur einen Bruchteil des Erlöses ins Ausland transferieren. Wenige Tage nach Unterzeichnung des Kaufvertrags am 28. Juni 1938 emigrierte er nach London – nicht ohne sich zuvor von seiner Belegschaft, den „Scherkianern“, zu verabschieden. Kurz darauf verließ auch Fritz mit zehn Reichsmark in der Tasche Berlin Richtung Frankreich. Seine Emigration war noch vom Vater organisiert worden und sollte der weiteren Ausbildung in der Parfümbranche dienen. Fritz gab ein kurzes Zwischenspiel bei Robertet in Grasse, dem Zentrum der Parfümindustrie, betrieb aber – fernab der väterlichen Autorität – vor allem den Ausbau seiner musikalischen Fähigkeiten. Paradoxerweise war es der Kriegsausbruch, der Fritz Scherk neue Perspektiven eröffnete: „Dann kam der Krieg und eignes Streben / Veränderte des Fritze’s Leben“, dichtete er Jahrzehnte später in einem umfangreichen gereimten Lebensrückblick. Nach


Links: Ludwig Scherk mit Sohn Fritz, Berlin, 23. Mai 1920. Schenkung von Irene Alice Scherk. Left: Ludwig Scherk with his son Fritz, Berlin, 23 May 1920. Gift of Irene Alice Scherk.

Rechts: Wiederaufbau der Fabrik, 1951. Schenkung von Irene Alice Scherk. Right: The reconstruction of the Scherk company building in 1951. Gift of Irene Alice Scherk.

This freedom from the paternal legacy would not last long, however. Ludwig Scherk died in 1946, still in exile in London but with an already detailed plan for the reconstruction of his Berlin company. He had designated Fritz as his principal heir. Hesitant at first, Fritz Scherk eventually responded to the requests of former “Scherkianers,” who had remained with the firm through the Schering takeover, the war, and the 1942 re-naming (the new name was “Tarsia”), to pursue restitution. After a year of litigation against and negotiations with Schering AG, both parties agreed in 1950 to a settlement: Fritz Scherk would buy back the company—the half-destroyed building and a large part of the product trademark rights—for roughly the current value of the sale price. The rights for the Germanywide distribution of the shaving tonic “Tarr” stayed with Schering, however. Thus, entirely without capital, Fritz Scherk began anew with his wife. “Scherk is back,” was how he put it in a letter to the trade. It started small. Rebuilding the factory alone cost 2 million Deutschmark. But Fritz was able to build upon the company’s good reputation too, to re-activate old customer and supplier contacts, and to rely on a core group of 22 former employees. He soon engaged a new, younger, staff as well. They began by producing the familiar facial tonic and not long after that added the “Mystikum” powder compact. These first Scherk products made after the rebuilding could not be differentiated from the pre-war stock. Before the war Scherk as a brand met upscale needs; even in the 1960s, after the packaging had been long ago updated to suit the taste of the economic miracle years and after new product lines developed, Scherk’s powder compact was still manufactured through a complex 53-part production process. “Profitable”—Fritz Scherk would say in later years—“it was not; but we wanted to stay true to the firm’s reputation.”

einigen Jahren in der Fremdenlegion kam Fritz als überzeugter Pazifist nach Palästina, wo er sich – widerwillig – zunächst als Parfümeur versuchte, dann aber nach einer Ausbildung zum Krankenpfleger mehr Befriedigung im Krankenhausbetrieb erlangte. Doch die Freiheit vom väterlichen Erbe sollte nicht lange währen. Ludwig Scherk war 1946, noch im Londoner Exil, wo er den Wiederaufbau des Berliner Unternehmens bereits bis in die Einzelheiten geplant hatte, gestorben und hatte Sohn Fritz zum Haupterben eingesetzt. Zögernd und erst auf Bitten ehemaliger „Scherkianer“, die von Schering übernommen worden und den ganzen Krieg über in der – 1942 in „Tarsia“ umbenannten – Firma geblieben waren, betrieb Fritz die Restitution. Nach über einjährigem Prozess, in dem der Rückerstattungsanspruch gegen die Schering AG verhandelt wurde, kam es Ende 1950 zum Vergleich der beiden Parteien: Fritz Scherk kaufte die Firma – also das halbzerstörte Gebäude und einen Großteil der Markenrechte – für annähernd den Gegenwert des Kaufpreises zurück. Die Rechte für den deutschlandweiten Vertrieb des Rasierwassers „Tarr“ blieben allerdings bei Schering. Völlig ohne Kapital begann Fritz Scherk mit seiner Frau den Neuanfang. „Scherk ist wieder da“ – so hieß es in einem Brief an den Handel. Man musste klein anfangen. Allein der Wiederaufbau des Fabrikgebäudes kostete 2 Mio. DM; doch Fritz Scherk konnte auf dem guten Ruf der Firma aufbauen, alte Kunden- und Lieferantenkontakte aktivieren und sich auf die Stammbelegschaft von 22 ehemaligen Mitarbeitern verlassen. Schnell wurden weitere, jüngere Mitarbeiter eingestellt. Zu Beginn produzierten sie das bekannte Gesichtswasser, bald darauf auch wieder das Mystikum Kompaktpuder. Die ersten Produkte nach dem Wiederaufbau waren von denen der Vorkriegszeit nicht zu unterscheiden.

J M B JOURNAL

57


Gesichtswasser der Vor- und Nachkriegszeit. Schenkung von Irene Alice Scherk. Facial tonics from before and after the war. Gift of Irene Alice Scherk.

Despite financial success, it remained nonetheless difficult for Fritz Scherk to take on his father’s place. The role of executive, as bequeathed him in his father’s will, did not fit him and he never had the sense that he truly filled his father’s shoes. Instead, he slipped easily and joyfully into the role of pater familias—and not only in his private life. “We were all sort of like his children and his wives,” recounted a former employee. In his memoir, he glances back jovially at the toil of the new beginning: However now I must report, Though he was meant to be the boss, Fritz longed for nothing of the sort And felt, with loud complaints, his loss. The heaps of things he had to know And conduct—manners finely graded— That bosses always ought to show Made him feel a bit degraded. In this regard Fritz Scherk attended, even more than his very engaged father had, to the well being of his employees. At each company anniversary his staff would receive generous gifts. On the feast of St. Nicholas, Christmas bonuses would await them, accompanied by a special feast-day poem, written by the boss and presented in a new form every year. By the end of the 1960s, the company’s permanent workforce had reached 165 people. The 1966 annual sales figure was over 13 million Deutschmark. Until 1969, the year that Scherk was bought by the American company Alberto Culver, all Scherk products were manufactured at the Berlin factory. In 1980, after long drawn-out litigation between Fritz Scherk and Alberto Culver, the trademark rights for Scherk went at last to the Baden company Lingner+Fischer. In his later years Fritz Scherk turned his attention to his own interests again, studying psychology and working as a consultant. Scherk products were still on the market at this time—the brand having outlived the company by more than two decades. Iris Blochel-Dittrich is an art historian and scientific officer at the Jewish Museum Berlin. Leonore Maier is curator at the Jewish Museum Berlin and responsible for the collection of quotidian culture. The two authors curated the exhibition “Welcome to the perfumer’s.”

58

J M B JOURNAL

Vor dem Krieg war Scherk eine Marke des gehobenen Bedarfs gewesen; noch in den 1960er Jahren, als die Verpackungen längst dem Geschmack der Wirtschaftswunderjahre angepasst waren und neue Produktlinien entworfen wurden, wurde der Kompaktpuder in Handarbeit hergestellt. Rentabel, so erinnerte sich Fritz Scherk in späteren Jahren, sei dies nicht gewesen, aber man habe dem Ruf der Firma treu bleiben wollen. Die Stelle seines Vaters einzunehmen, fiel Fritz Scherk trotz des wirtschaftlichen Erfolgs schwer. Die Rolle des Chefs lag ihm nicht und er hatte wohl nie das Gefühl, die Position, für die ihn das väterliche Testament vorgesehen hatte, so recht auszufüllen. Stattdessen schlüpfte er mit Freuden in die Rolle des Familienvaters – und das nicht nur im Privatleben. „Wir waren ja alle so seine Kinder und seine Frauen“, berichtet eine ehemalige Mitarbeiterin. In seiner Lebensrückschau wirft Fritz Scherk einen heiteren Blick auf die Mühen des Neubeginns: „Jedoch muß ich auch nun berichten, / Daß Fritz, zu dieser Zeit, mit Nichten / Dran dachte, einmal Chef zu werden. / So hatte er auch viel Beschwerden, / Sich all das Wissen zu erraffen, / Sich das Verhalten anzuschaffen, / Das man von einem Chef erwartet, – / Er war und fühlte sich entartet.“ Um das Wohlergehen seiner Mitarbeiter kümmerte sich Fritz noch stärker als sein in dieser Hinsicht schon sehr engagierter Vater. Zu den Betriebsjubiläen erhielten die Angestellten großzügige Geschenke; am Nikolaustag erwartete sie eine Weihnachtsgratifikation, die von einem – vom Chef verfassten – Gedicht des Nikolauses begleitet und jedes Jahr in neuer Form präsentiert wurde. Ende der 1960er Jahre war der Mitarbeiterstamm wieder auf 165 angestiegen; der Jahresumsatz der Firma betrug 1966 13 Mio. DM. Bis zum Verkauf der Firma im Jahr 1969 an den amerikanischen Konzern Alberto Culver, wurden die Scherk-Produkte in der Berliner Fabrik hergestellt. Nach langwierigen Gerichtsprozessen zwischen Fritz Scherk und Alberto Culver gingen die Markenrechte 1980 schließlich an die badische Firma Lingner+Fischer über. Fritz Scherk wandte sich in fortgeschrittenem Alter wieder den eigenen Interessen zu, studierte Psychologie und arbeitete als Berater. Scherk-Produkte waren zu dieser Zeit noch immer auf dem Markt – die Marke überlebte die Firma um mehr als zwei Jahrzehnte. Iris Blochel-Dittrich ist Kunsthistorikerin und wissenschaftliche Mitarbeiterin am Jüdischen Museum Berlin. Leonore Maier ist Kuratorin am Jüdischen Museum Berlin und verantwortlich für den Sammlungsbereich Alltagskultur. Gemeinsam kuratierten die Autorinnen die Ausstellung „Du bist bei den Parfümören angekommen“.


ökologie liebt ökonomie Autos sind leichter und dadurch sparsamer im Verbrauch, wenn Bauteile aus BASF-Kunststoffen statt aus Metall gefertigt werden. Das bedeutet weniger Abgase, weniger Kraftstoffbedarf und so mehr Geld im Portemonnaie. Die Umwelt schützen und zugleich Geld sparen – das ist Chemie, die verbindet. Von BASF. www.basf.com/chemistry


Spielwiese By the Bye

Chai Rollers: How Jewish Teens Spend Their Shekels Die „Chai-Rollers“: Wofür amerikanisch-jüdische Teenager ihre Schekel ausgeben

Micol Ostow

Als man mich fragte, ob ich einen Text über das Kaufverhalten jüdischer Teenager schreiben würde, schreckte ich im ersten Moment zurück. Zwar lebe ich davon, für Teenager zu schreiben, aber wenn es um echte, lebende, sprechende Teenager geht, habe ich, ehrlich gesagt, nicht viel privaten Kontakt. Ich bin Schriftstellerin. Ich habe mit keiner Altersgruppe viel privaten Kontakt. Aber mit Teens erst recht nicht. Denn sie machen mir Angst. Ich schreibe für Jugendliche, weil die Gefühle dieser Entwicklungsphase in mir am tiefsten nachwirken – ein Stadium, in dem jedes Erleben bis zum Äußersten gesteigert ist. Das bietet eine Fülle an reichhaltigem, vielschichtigem Schreibstoff. Aber es führt eben auch immer wieder dazu, dass dieselbe Intensität sich in der Kommunikation niederschlägt. Wie gesagt: Teenager sind zum Fürchten. Ich brauche zwar nicht groß zu forschen, um in meinen Geschichten die Gefühle und Sichtweisen Heranwachsender wahrhaftig wiederzugeben, doch wenn es um die ins und outs im Leben von Teenagern geht, bin ich doch ab und zu auf ein wenig Recherche angewiesen. Die Zeiten haben sich geändert. Jugendliche von heute sind Medienprofis und Technikexperten. Als ich zur High School ging, hatte ich das Glück, einen Telefonanschluss mein Eigen nennen zu können. Heute laufen Teenager mit Handys, Smartphones, iPods oder anderen Geräten herum, durch die sie in einem Ausmaß vernetzt sind, das ich mir, als ich so jung war, gar nicht hätte vorstellen können. Als ich meinen Roman gerade „So Punk Rock (and Other Ways to Disappoint Your Mother)“ schrieb, musste ich entscheiden, welchen Lebensstil ich meinen Figuren mitgab. Mein Protagonist, eine Art Jedermann, bezahlt seine gebrauchte E-Gitarre mit Geld, das er als Betreuer in einem jüdischen Sommer-Camp verdient hat. Hier griff ich auf meine eigenen Erfahrungen zurück, aufgewachsen in einer jüdischen Vorstadtsiedlung, und nahm technologische Neuerungen wie Online-Shopping, soziale Netzwerke oder MP3-Player hinzu. Doch reichte das aus? Ich entschloss mich zu ein paar informellen Nachforschungen. Die meisten Teenager, mit denen ich sprach, haben weder feste Jobs noch bekommen sie ein festes Taschengeld. Wenn sie überhaupt regelmäßig eine bestimmte, kleine Summe erhalten, dann für Schulbedarf oder öffentliche Verkehrsmittel. Die Kehrseite ist: Fast alle diese Teenager aus eher wohlhabenden Verhältnissen brauchen, wenn sie sich etwas kaufen wollen, bloß ihre Eltern zu fragen, und meistens kriegen sie dann das Geld. Bei den Mädchen geht der Großteil für Kleidung, Schuhe und manchmal auch (dem Himmel sei Dank) Bücher drauf. Bei Jungen haben Klamotten keinen hohen Stellenwert, dafür aber Sportartikel oder Computer-

60

J M B JOURNAL

When asked to write a piece about the spending habits of Jewish teens, I must confess that my first instinct was to balk. You see, despite the fact that I make my living writing for teens, when it comes to actual, real-life, walking, talking teenagers, I don’t have very much one-on-one contact. Let’s be honest—I’m a writer. I don’t have very much one-onone contact with any age group. But particularly not teens. Quite frankly, they terrify me. I write for adolescents because that’s the emotional stage that resonates most profoundly with me, a time in one’s development when every experience is heightened to its utmost degree. It makes for a wealth of rich, multilayered writing material. But it also makes for interactions fraught with the same crackling levels of intensity. I’ll say it again: teens are scary. Though I don’t have to dig very deep to access the truth of adolescent emotion or point of view in my fiction, when it comes to the ins and outs of teen life, I am occasionally called on to do a bit of research. Times have changed, indeed, and today’s youth is media-savvy, tech-minded. Whereas I, back in my high school days, was lucky enough to have my own private telephone line in my bedroom, many of today’s teens have cell phones, PDAs, iPods, or other devices that keep them plugged in to a degree my young self could never have imagined. When writing my novel, So Punk Rock (and Other Ways to Disappoint Your Mother), I had choices to make about my characters’ lifestyles. My protagonist, more of an “everyman,” paid for his secondhand electric guitar with money he’d earned working as counselor at a Jewish summer camp. My world-building reflected my own experiences growing up in Jewish suburbia, while taking into account technological advancements like online shopping, social networking, or MP3s. But was it accurate? I decided to make some informal inquiries. Most of the teens I spoke with don’t work at regular jobs, nor do they receive an allowance from their parents. If they do receive any regular spending money, it’s usually small amounts meant to cover school supplies, or public transportation. The flip side of this equation is that most of these teens, coming as they


spiele. Bücher kommen auf ihrer Einkaufsliste immerhin auch noch vor, aber bei weitem nicht so weit oben, wie es einer Autorin gefallen würde. Dass die meisten Teenager, mit denen ich sprach, keine festen Jobs hatten, überraschte mich nicht. In der Gegend, wo ich aufwuchs, konnte man frühestens mit 15 oder 16 Jahren an „Arbeitspapiere“ kommen, zudem legten meine Eltern Wert darauf, dass meine höchste Priorität die Schule war. Mit 15 begann ich mir als Babysitter ein bisschen dazuzuverdienen, doch in ein halbwegs formelles Beschäftigungsverhältnis trat ich erst mit 17 ein – als Hilfsverkäuferin, und da gab es großartige Mitarbeiterrabatte auf Klamotten. Zu der Zeit hatte ich schon meine College-Zulassung und fuhr im eigenen Auto zur Arbeit. In der Frage nach dem Luxus Nr. 1 scheinen alle Teens sich heute einig zu sein: ein iPhone, ein Blackberry, ein Laptop, ein iPod oder „irgendein Handy mit guten Texting-Fähigkeiten“. Teenager wollen kommunizieren. Vor allem miteinander und vor allem in Netzwerken wie Facebook, Twitter oder in ihren eigenen Blogs. Wer eins der erwähnten Geräte besitzt, hütet es wie seinen Augapfel. Und wer noch keins hat, bei dem steht es ganz oben auf der Wunschliste. Es ist eine erleichternde Feststellung, dass meine Annahmen über das Leben und Kaufverhalten eines typischen jüdisch-amerikanischen Teenagers heutzutage ziemlich zutreffend waren. Ich bin zwar besorgt wegen all der jungen Technophilen, die um mich herum sprießen – es macht mich nervös, dass sie mit einer Sprache aufwachsen, die mir völlig fremd ist; vom Verständnis von Privatheit und allem, was damit einhergeht, ganz zu schweigen. Aber auch ich liebe mein iPhone und das Kindle-App, das ich mir heruntergeladen habe. Teenager mögen heute ein anderes Verhältnis zu Medien haben als das, mit dem ich aufwuchs, aber solange sie noch lesen (in welchem Format auch immer und am besten meine Bücher), komme ich damit klar.

do from financially comfortable environments, need only to ask

Micol Ostow ist Autorin, Redakteurin und Erzieherin. Ihr erster eigener Roman, „Emily Goldberg Learns to Salsa“, wurde von den New Yorker Bibliotheken ausgezeichnet.

about all of the young technophiles springing up at my heels

for money to make a purchase, and usually, it is provided. For teen girls, the bulk of this money goes toward clothes, shoes, and sometimes (thank heavens), books. For boys, clothes are less of a priority, replaced by sports equipment or electronic games. Books still fall somewhere on their shopping list, but significantly lower down than this author would like. It didn’t surprise me to learn that most of the teens I spoke with hadn’t held regular jobs; where I grew up, teens weren’t allowed “working papers” until age fifteen or sixteen, moreover, my parents felt strongly that academics should be my top priority. Around age fifteen, I began babysitting to earn some extra spending money, but I didn’t take on more formal employment—retail sales, as it happened, which made for some great employee discounts on clothing—until I was seventeen, already accepted into college, and driving my own car to and from the store where I worked. The number one luxury/can’t-live-without item for teens seems to be unanimous: an iPhone, a Blackberry, a laptop, an iPod, or “any cell phone with good texting capabilities.” Teens want to communicate. Mostly with each other, mostly on networks like Facebook, Twitter, or their own person blogs. For those who have one of the aforementioned, it is, hands down, their prized possession. For those without, it’s most likely the last thing they begged their parents to buy for them, and number one on their wish list. It’s a relief to know that, when all is said and done, my own interpretations of what a typical Jewish teen’s life—and spending— would look like today was actually quite accurate. I do worry (it makes me nervous that they’re being raised on a language so utterly foreign to me, not to mention, issues of privacy, and all that entails, are a concern). But, I, too, love my iPhone—and the Kindle app I’ve downloaded for it. Teens may have a different relationship to media than the one I was raised with, but as long as they’re reading (preferably my books) in any format, I’ll take it. Micol Ostow, based in New York, works as an author, editor and educator. Her first original hardcover novel, Emily Goldberg Learns to Salsa, was named a New York Public Library Book for the Teen Age.

J M B JOURNAL

61


Ein großer Philanthrop – Nachruf auf Eric F. Ross A Great Philanthropist—In Memoriam: Eric F. Ross

Eric F. Ross died in Zurich at the age of 91 on Wednesday, 8 September 2010.

Eric F. Ross, born Erich Rosenberg in Dortmund, lived a remarkable life in the United States. Able to flee Germany at age nineteen shortly before the November Pogrom in 1938, he arrived in the United States with ten dollars in his pocket and not a word of English, and soon became a pioneer in the plastics industry. Ross and his wife, who died in 2009, were among the most significant patrons and philanthropists in the United States. Proud that he had succeeded in building a life in the United States on his own, he wanted to share the wealth he had achieved. He was one of the largest donors to the Holocaust Museum in Washington, D.C. Among the other institutions he supported were Ben Gurion University, the Newark Museum, and the New Jersey Performing Arts Center. But his philanthropic involvement not only served large institutions—dozens of smaller projects and organizations benefited from his assistance. Although Eric F. Ross vividly remembered the end of his youth in Germany—“Hitler Youth threw rocks and knives at me: that was the end of my schooling”— the country of his birth benefited in particular from his philanthropy. A distinction that greatly pleased him after having had to flee Germany 71 years earlier, was being awarded the Officer’s Cross by the Order of Merit of the Federal Republic of Germany for his support, in particular of educational initiatives that serve German-Jewish history. Beginning in 2003, Eric F. Ross maintained close ties to the Jewish Museum Berlin. A large part of the museum’s educational program exists thanks to his energetic support and generous donations, including the “on.tour—the JMB Tours Schools” outreach program. Within the framework of this unusual project, the museum travels with its mobile exhibition and workshops to schools throughout Germany in order to reach students who would not otherwise be able to visit the museum. The museum will continue to honor Eric F. Ross in the future—a generous donation from him was vital for the upcoming expansion of the museum. We commemorate this great philanthropist for his extraordinary efforts in doing all he could to help keep memory alive. W. Michael Blumenthal

Am Mittwoch, den 8. September 2010, starb Eric F. Ross im Alter von 91 Jahren in Zürich.

Eric F. Ross, als Erich Rosenberg in Dortmund geboren, bestritt in den USA einen bemerkenswerten Lebensweg: Der Junge, der 19-jährig kurz vor der Reichspogromnacht aus Deutschland fliehen konnte und mit zehn Dollar in der Tasche und ohne Englischkenntnisse in den USA angekommen war, wurde bald zu einem Pionier der Plastikindustrie – und, zusammen mit seiner 2009 verstorbenen Frau, zu einem der bedeutenden Mäzene und Philanthropen der USA. Stolz darauf, dass er es allein geschafft hatte, in den USA ein Leben aufzubauen, wollte er das, was er verdient hatte, weitergeben. Er war einer der bedeutendsten Spender des Holocaust Museums in Washington, D.C., und unterstützte unter anderem die Ben Gurion University, das Newark Museum, und das New Jersey Performing Arts Center. Doch galt sein Engagement nicht allein den großen Institutionen: Dutzende kleinere Initiativen und Organisationen konnten mit seiner Unterstützung rechnen. Obwohl Eric F. Ross sich lebhaft an das Ende seiner Jugend in Deutschland erinnerte – „Hitlerjungen bewarfen mich mit Steinen und Messern. Das war das Ende meiner Ausbildung“ – galt sein Engagement besonders seinem Herkunftsland. Für seine Unterstützung vor allem von Bildungsinitiativen, die der Vermittlung deutsch-jüdischer Geschichte dienen, wurde ihm im letzten Jahr das Verdienstkreuz 1. Klasse des Verdienstordens der Bundesrepublik verliehen, eine Auszeichnung, über die er, der 71 Jahre zuvor aus Deutschland geflohen war, sich besonders freute. Eric F. Ross war dem Jüdischen Museum seit 2003 eng verbunden – seiner tatkräftigen Unterstützung und großzügigen Spenden ist ein Großteil des Bildungsprogramms des Museums zu verdanken, darunter vor allem das Outreach-Programm „on.tour – Das JMB macht Schule“: Im Rahmen dieses ungewöhnlichen Projekts fährt das Museum Schulen im gesamten Bundesgebiet an, um mit einer mobilen Ausstellung und Workshops auch jene Schüler zu erreichen, denen ein Besuch im Museum ansonsten nicht möglich ist. Das Museum wird Eric F. Ross auch in Zukunft ehren – seine großzügige Spende war für die anstehende Erweiterung des Museums entscheidend. Wir gedenken des großen Philanthropen, der sich mit außerordentlichem Engagement für das Bewahren der Erinnerung eingesetzt hat. W. Michael Blumenthal

62

J M B JOURNAL


Können Vertriebsleute flexiblere Fabriken entwickeln?

Können Ingenieure den Krebs besiegen?

Können Kaufleute CO₂Emissionen senken?

Bei Siemens leistet jeder Mitarbeiter einen entscheidenden Beitrag zur Beantwortung der wichtigen Fragen unserer Zeit. Mit innovativen Technologien helfen wir, die Entwicklung auf den Feldern Industrie, Umwelt und Energie sowie Gesundheit entscheidend voranzubringen. Dahinter stehen die Ideen der Menschen, die bei Siemens arbeiten. Weltweit. In den unterschiedlichsten Berufen. Und Ideen entstehen durch Freiraum: den Freiraum zu gestalten, zu erfinden und immer wieder Neues zu lernen. Sehen Sie selbst, welchen Beitrag wir alle auf der ganzen Welt dazu leisten.

siemens.com/answers


Unser Bekenntnis zur Kultur

Seit Jahrzehnten fördert Bosch Kunst und Kultur. Wie zum Beispiel das Jüdische Museum Berlin. Denn unser Leitmotiv „Technik fürs Leben“ steht nicht nur für unsere Produkte und Lösungen, sondern auch für unseren Anspruch, sich zur gesellschaftlichen Verantwortung zu bekennen. www.bosch.de


Jewish Museum Berlin: JMB Journal Nr 3