Issuu on Google+


2

September 4 - 10, 2013


TRIP BURNS

JACKSONIAN ELISA ACEY

W

hen setting up her shop, Elisa Acey kept the dying business of old-school barbershops in mind. “There’s not a whole lot of those left,” Acey, 53, says. On a rainy day around Memorial Day in 2011, she went to Fondren to look for a location to open a salon. Her first stop was an empty building on Mitchell Avenue where the consignment shop Silly Billy’s is now located. While waiting for her husband, Stan, to arrive, she walked to Bob’s Cut & Curl on State Street to inquire about renting the back of the shop for her salon. Bob Smith offered to sell Acey the entire business and go to work for her. She bought his 42-year-old barbershop and opened Acey Custom Hair Design, complete with a full-service salon in the back and a barbershop in the front. The shop got its name because “Acey’s” couldn’t fit into the existing shop sign. “When ‘The Help’ came through, they put the (sign) up there, and it said Bob’s,” Acey says. “We liked the retro look, so we just left that.” The neighborhood gave Acey and her business a warm welcome. “I like Fondren a lot,” she says. “You kind of feel like you’re in a small town because everything’s convenient, and people walk around.” She likes to keep her shop funky like the neighborhood. Car memorabilia line the walls of the barbershop, partially as an homage to her husband’s love for cars—Stan owns Acey’s High

CONTENTS

Performance Machine Shop (2825 Highway 80, 601-969-9400)—but also because of the nostalgia they evoke. “Most people can associate something in their past (with a car)—their grandma or their first car or whatever,” Acey says. “Cars are a common theme.” Acey’s daughter Kacy Whitty, 30, created the artwork in the salon. At the front of the salon is a long wall for shop patrons to sign their names. Acey wants to cater to the students and the business district in the area. “We want people to think we’re affordable, but not a go-and-getyour-hair-buzzed-off kind of shop. We’ll give you what you want,” she says. She worked at Maurice’s Barber & Style in Maywood Mart and Highland Village Concepts before opening her shop in September 2011. She and Stan have, in addition to Whitty, a son, Adam, 32, and two stepdaughters, Ronda, 29, and Holley, 25. Shelly Burns, a former co-worker of Acey’s from Maurice’s, also works at the salon, and former owner Smith still works in the barbershop. Whitty does coloring at the salon. Some of the services Acey Custom Hair Design offers include men’s hot lather shaves, protein-intensive treatments and blow-outs. Stylists use Paul Mitchell coloring and also offer a semi-permanent clear-shine gloss. For more information, visit Acey Custom Hair Design’s Facebook page, or call 601-937-7754. —Amber Helsel

Cover Photo by Trip Burns

10 Supervisors’ Systems

“Your role (as a supervisor) is not to go into the school and straighten out the superintendent, but you create the environment for that to happen. What are the amenities that a county needs to create a great environment for children to learn, for jobs, so that crime can be low? So when you hear about problems going on with our kids, you have to address systemic stuff that’s going on. The role of the supervisor is to create an atmosphere so we can try to address those problems. …” —Gus McCoy, “ McCoy: Tearing Down ‘Walls’”

25 Breath of Fresh Air

Take Kelly Bryan Smith’s scavenger hunt guides and get exploring. No Wi-Fi required.

31 Dark and Stormy

New Stage Theatre’s latest finds Sherlock Holmes solving puzzles amidst the bleak backdrop of a Suicide Club.

jacksonfreepress.com

4 ........................PUBLISHER’S NOTE 6 ................................................ YOU 8 ............................................ TALKS 14 ................................ EDITORIAL 15 .................................... OPINION 16 ............................ COVER STORY 25 ........................................ FAMILY 27 ................................. WELLNESS 28 ........................................... FOOD 31 .............................. DIVERSIONS 32 .......................................... FILM 33 ............................... EIGHT DAYS 35 ............................... JFP EVENTS 36 ....................................... MUSIC 37 ....................... MUSIC LISTINGS 38 ..................................... SPORTS 39 .................................... PUZZLES 41 ....................................... ASTRO

COURTESY NEW STAGE THEATRE, KELLY BRYAN SMITH, R.L. NAVE

SEPTEMBER 4 - 10, 2013 | VOL. 11 NO. 52

3


PUBLISHER’S note

by Todd Stauffer, Publisher

Jackson Market Hall, Anyone?

A

few years ago I attended one of the Downtown Jackson Partners trips that Tyler Cleveland mentions in his cover story this week (pages 16-24), where some Jackson stakeholders take a look at what other cities have accomplished in their urban revitalization efforts. The trip that I was on was to Little Rock, Ark., where we toured the renovated downtown—including meeting spaces, river overlooks, parks, an outdoor amphitheater and the Clinton Presidential Center. We stayed in the Peabody Little Rock and dined out in the River Market District, where the beer at Boscos brewpub flowed. There was even a run arranged for the morning after down the river trail to get a closer view of the Arkansas River. (I didn’t go on the run.) Some Jacksonians left that trip extremely excited about one particular stop on our visit—the Verizon Arena (then still called the Alltel Arena), an 18,000-seat arena located just a few miles from downtown in North Little Rock (a separate town in the same county). The Verizon Arena excited some on the trip because it was funded by public-private cooperation, overseen by a clever politician (the “judge” of the county; roughly equivalent to a mayor) and run by a man from Mississippi who had moved to Little Rock from Starkville. Everything about a roughly $80 million downtown arena seemed “do-able” when you were standing in one—and to add to the excitement, the folks in North Little Rock could even imagine our two cities booking some of the same acts. (The Verizon Arena has Luke Bryan and Bon Jovi coming in October, which we don’t.) As we walked around on the field in the Verizon Arena (it was configured for an arena football game), I heard a lot of chat-

ter about the possibilities—and more than a few digs at the Mississippi Coliseum. We also got interesting advice from the management: Save money. Most regional arenas like Little Rock’s hover close to break-even or worse, with the occasional profitable year balancing out the losses. A quick look at the Verizon Arena’s calen-

‘I like to be a part of projects that will happen in my lifetime.’ – Andrés Duany dar (jfp.ms/verizonarena) shows one event scheduled for September—professional wrestling toward the end of the month— and just a handful for the rest of the year. In Jackson, enthusiasm for a downtown arena resulted in an initial phase of feasibility studies and an attempt at fundraising spearheaded by Downtown Jackson Partners. After an initial flurry of activity, Mayor Johnson’s administration absorbed that effort and, depending on whom you ask, put it to a slow death—or at least a long nap. I was always surprised that there wasn’t more excitement over something else that we saw in downtown Little Rock—some-

thing I still think about frequently. It’s called Market Hall (jfp.ms/markethall), and it’s a 10,000-square foot, glassed-in space with a 40-foot vaulted ceiling and easy access to parks and the streets of downtown. In this venue—which also has a beer garden and free Wi-Fi, according to its website—15 different food vendors in stalls serve a variety of food ranging from Mexican to fresh vegetarian, Thai, Middle Eastern, “sweet soul” food and, of course, pizza. Outside is another 15,000 square feet of space for a seasonal, two-day-a-week farmers market. When we visited Market Hall, we were told that it’s not just a popular breakfast and lunch spot for locals and tourists—it’s also a business incubator, giving talented local cooks, chefs and bakers an opportunity to ply their wares with relatively little overhead. The ones that do well (and learn to handle their business along with their food) occasionally move on to open their own restaurants or second locations. In a way, it’s an air-conditioned answer to the food-truck startups that have succeeded in hipster cities. Imagine if we’d started work on Jackson’s version of Market Hall five years ago. It’s smart and right-sized, while still a significant attraction, serving as a niche for local folks while attracting the tourists. Imagine a mix of international and Mississippi cuisine in a wide-open market space downtown on Capitol Street—and what that could do for the city. Imagine the weekday nights it stays open into the evening with a live band on the stage and some craft beers on tap. Imagine the Saturday foodie festival it could host in the hot months or the chef demonstrations on Sunday afternoons. And now imagine that it’s a working, breathing incubator. Along with your

booth rental, you get business instruction and mentoring. If you’re not doing well with the business—or the food—you get help and advice. If you do really well, you might get investment—or a tax break, a grant or a loan—to help you expand out into your own restaurant, thus opening a space in the market for the next new thing. It’s not as exciting as an arena football team or a corporate skybox at a Bon Jovi concert—instead, it’s small. It’s local. It’s to scale. It’s do-able. And I wonder if the effort that went into an arena had gone into a public market idea instead, we’d not only have a nice shiny venue downtown for all sorts of gatherings and celebrations, but we might now have some functional businesses ready to move into retail spaces on Capitol Street just as it’s being “two-wayed.” Heck, we might still even have “Downtown at Dusk” going on! As the famed New Urbanism planner Andrés Duany once said about the Two Lakes project on the Pearl River, “I like to be a part of projects that will happen in my lifetime.” A downtown arena, Town Creek riverwalk, South Street marina, Capitol Green—those things would be fantastic, no doubt. But I, personally, have an easier time imagining the Jackson Market Hall—especially on a Thursday evening with a craft beer, a plate of great food, some good music and the stars shining through the glass roof. Lifting a glass and knowing we’re helping another round of local businesses succeed—that’s the sort of progress that I’d love to see our leaders, chambers and “partners” champion. Email Publisher Todd Stauffer at todd@ jacksonfreepress.com.

September 4 - 10, 2013

CONTRIBUTORS

4

Tyler Cleveland

R.L. Nave

Dustin Cardon

Kelly Bryan Smith

Brinda Willis

Briana Robinson

Lindsay Fox

Andrea Thomas

JFP city reporter Tyler Cleveland loves sports, good music and soul food. He can be found around Fondren when he’s not running to and fro across the Jackson Free Press offices. He wrote the main cover story.

Reporter R.L. Nave grew up in St. Louis, graduated from Mizzou (the University of Missouri), and lived a bunch of other places before coming to Jackson. Contact him at 601362-6121 ext. 12. He contributed to the cover package.

Copy Editor Dustin Cardon is a graduate of the University of Southern Mississippi. An English major from Brandon, he enjoys reading fantasy novels and wants to write them himself one day. He wrote the Week in Review.

Kelly Bryan Smith is a Fondren mom, nurse and writer. In her spare time, she practices yoga, builds garage apartments and fights crime with her son Batman. She wrote a family story.

Brinda Willis often plays tricks on people with her identical twin. She’ll go anywhere to hear the blues, and she is a real farmer’s daughter. She wrote the food story.

Music Editor Briana Robinson wants to become an expert on all things music. She also loves dance and photography. Send her the music scoop at briana@jacksonfreepress. com. She contributed to the cover package.

Design Intern Lindsay Fox is a recent graduate of the University of Mississippi. She is an aspiring editorial designer with a passion for magazines. She helped design this issue.

Advertising Designer Andrea Thomas is a native of Ridgeland. Andrea is a lover of music, fashion and good food. She spends her free time exploring everything Jackson has to offer. She designed many of the ads for the issue.


5

jacksonfreepress.com


JESSICA KING

[YOU & JFP] Derica Knox (left, pictured with Josie Smith) Age: 26 How long have you lived in Jackson? 26 years How long have you read the JFP? Two and a half years What’s your favorite part of Jackson? The parks. Quote: “It is what it is, and it’s nothing you can do about it. “ Secret to life: Look in my two kids’ eyes and know that everything will be alright.

Write us: letters@jacksonfreepress.com Tweet us: @JxnFreePress Facebook: Jackson Free Press

WHAT IS THE BEST BUSINESS ADVICE YOU’VE EVER RECEIVED? Keith Davis Don’t hire friends or neighbors. It never ends well. Glenda Barner Have some firm capital for when times are tight. Tanya Francis Write a detailed business plan and don’t expect to make a profit immediately. Pete Castorena Pray and thank God. Depending on what type of business, always greet your customers. When a mistake occurs, take action by making it right. That customer will bring in more business! Your best advertisement is word of mouth! Rob Alexander Saying “yes� when presented with a challenging opportunity will open doors for you, and one of those doors will lead you to the path of success. Kandie Itisme Love and have passion for your business. Taylor Brahman Go to college. Doug Yoakum Never lose sight of God’s presence, because he is always in control! Tyler Edward Ricketts Quit while you’re ahead.

BOOMing Soon Pick up the September-October issue of BOOM Jackson, on the streets this week! Then, while you read all about fall fashion, art and business, help us plan our next couple issues. The November-December issue is focused on holiday giving and entertaining, local-style. We’re looking for local artists who create handmade goods and art that would make great holiday gifts. You can suggest your favorite artisan or yourself. For the January-February 2014 issue—the first glossy Hitched!—we are seeking nominations for this year’s Power Couples. We want to know about couples (married or not) who are making Jackson a better place, be they doctors, lawyers, coaches, businesspeople, artists, professors, administrators, nonprofit organizers or something else entirely.

Email kathleen@jacksonfreepress. com to suggest local artisans or great couples, and check out boomjackson.com to see last year’s Power Couples issue.

-OST6IRAL%VENTSATJFPEVENTSCOM

-OST6IRAL3TORIESATJFPMS

³5LSSOH(IIHFWVRI¾2QH/DNHœ´E\5/1DYH ³/XFN\7RZQ%UHZHU\([SDQGLQJ´E\7\OHU&OHYHODQG ³800&([SDQGV1HZ2XWOHW7HQDQWVDQG7ZLQ3HDNV´E\'XVWLQ&DUGRQ ³-DFNVRQ5DOO\&DOOVIRU0LOLWDQW3XUVXLWRI(TXDOLW\´E\5/1DYH ³2UGLQDQFH:RXOG%DQ*XQV,Q3XEOLF3ODFHV´E\7\OHU&OHYHODQG -RLQWKHFRQYHUVDWLRQDWMISPVFRPPHQWV

&6SLUH&RQFHUW6HULHV6HSW 0LVVLVVLSSL6WDWH)DLU7DOHQW&RPSHWLWLRQXQWLO6HSW $]LDWLNN%ODNN/DERU'D\)HVWLYDODQG%LUWKGD\&HOHEUDWLRQ6HSW /DERU'D\&RQFHUW6HSW 'D\RI'LJQLW\WK$QQLYHUVDU\RIWKH0DUFKRQ:DVKLQJWRQ'& IRU-REVDQG)UHHGRP$XJ 3RVWHYHQWVDWMISHYHQWVFRPRUHPDLOHYHQWV#MDFNVRQIUHHSUHVVFRP



     

September 4 - 10, 2013

     



6

  I ce  cubes

E sp re s s o

    

CUPSESPRESSOCAFE.COM


2013 FRIENDSHIP GOLF OUTING xxx/cvuufsgmzzphb/ofu

Thursday, September 26 Colonial Country Club 5635 Old Canton Rd. in Jackson

Zphb!Uifsbqz!with JJ Gormley-Etchells, E-RYT-500 September 27 - 28, 2013 Friday - 6:00 - 8:30 pm Yoga for a Healthy Back and Relief from Sacro-iliac Pain $50 Saturday 12:00 - 2:00 pm Yoga for Shoulders, Neck and Upper Back Tension $40 JJ Gormley-Etchells has been a student of yoga since 1979 and a teacher since 1989. She began teaching teachers and using yoga therapeutically in 1994. She has studied from many traditions including Ashtanga, Iyengar, Kundalini, Anusara and Viniyoga. She calls her yoga education well-rounded and draws from each tradition that which she loves.

Saturday 3:00 - 5:00 pm Yoga for Hip and Knee Health & Safety $40 Discount when you sign up for all three: $110

8:30 a.m. - Shotgun Start 1:00 p.m. - Lunch

SPONSORS:

Atmos Energy Sally and Dick Molpus Foundation McDaniel and Register Dr. George Schimmel

Teams and individual players welcome! To sign up or to become a sponsor, call Hibbett Neel at 601-948-3071 or Jonathan Larkin at 601-957-0434

Viking Investments

WWW.JACKSON2000.ORG Bringing the Community Together, Promoting Racial Harmony and Facilitating Understanding

Register Online At www.butterflyyoga.net

jacksonfreepress.com

4136!Opsui!Tubuf!Tusffu!.!Gpoesfo!Ejtusjdu!.!712/6:5/3424

7 JCV7210-55 Event Week Sept 2 JFPress 9.25x5.875.indd 1

8/30/13 2:46 PM


Wednesday, Aug. 28 President Barack Obama speaks from the steps of the Lincoln Memorial at the 50th anniversary of the March on Washington for Jobs and Freedom. ‌ A military jury sentences Maj. Nidal Hasan to death for his 2009 shooting rampage at Fort Hood.

Friday, Aug. 30 Nearly 5,000 firefighters battle a huge forest fire burning in and around California’s Yosemite National Park. ‌ President Barack Obama announces that he is weighing “limited and narrowâ€? action against the Syrian regime. Saturday, Aug. 31 President Obama announces he will seek congressional approval before striking Syria. ‌ Protesters around the world take to the streets to protest for and against a possible U.S.-led attack on Syria. Sunday, Sept. 1 The Obama administration argues that new physical evidence shows the Syrian government used sarin gas in a deadly Damascus attack. ‌ In an emergency meeting, the 22-state Arab League urges the United Nations and the international community to take “deterrentâ€? measures to stop the Syrian regime’s alleged crimes.

²'HEUD*ULI¿QRZQHURIWKH&RIIHH 5RDVWHU\RQSHUVHYHUDQFH

by Tyler Cleveland

T

he city of Jackson is re-issuing a request for proposals for a long-awaited downtown convention-center hotel, just two months after unveiling an agreement with a developer to build one. Jackson Mayor Chokwe Lumumba announced at a city budget hearing Aug. 28 that the city would issue its new RFP. The announcement came at the conclusion of a budget presentation from Willie Mott, interim executive director of the Jackson Redevelopment Authority. In June, JRA approved father-and-son developers Robinson and Andre Callen’s proposal to build a $60-million, 305-room hotel. Then-Mayor Harvey Johnson Jr. and then-Mayor-elect Lumumba joined other city officials at the June 25 announcement at the Jackson Convention Center Complex. The proposal called for the hotel to connect to the convention complex via a skywalk, and developers pledged to work with Hyatt Hotels to build a first-rate establishment complete with additional meeting areas, a full-service restaurant and parking. Under the agreement with the city, Jackson would potentially be on the hook for $9 million in loans once the building is constructed, but that money would only be used to cover budget shortfalls for the first five years of operation. Then, in early August, Texas-based development firm Journeyman Austin proposed a $70-million convention-center hotel. The JRA board, which meets publicly on the fourth Wednesday of every month, was set to review that proposal and choose one of the two to suggest to the mayor. The board had not made any public comments

until Mott appeared before the city council Wednesday. During a presentation designed to analyze JRA’s $1.4 million 2014 budget request from the city, several council members questioned Mott about the progress of the

When the authority was created in 1968, it was designed as a quasi-governmental economic-development agency for the city. According to its web site, JRA is responsible for the resurgence and revitalization of residential, business and investment growth

City Councilwoman Margaret Barrett-Simon, Ward 7, questioned JRA Executive Director Willie Mott about the process to vet the convention-center hotel proposals.

hotel project. He responded that he could not comment on the deal’s status, at least not publicly. Earlier that day, without explaining why, JRA board members went into executive session at their monthly meeting to discuss that project and another long-delayed development: Farish Street.

in the city. It has produced beneficial projects in the past, including renewal projects at Highway 80 and the Jackson Medical Mall, but its recent history of delays is what provoked skepticism in several council members. “Despite its historical successes,

Louis LeFleur: Early Businessman, Mystery

A IP BU S

RN

8

Tuesday, Sept. 3 President Barack Obama announces plans to urge reluctant world leaders to back an American-led strike against Syria. ‌ Israel carries out a joint missile test with the United States in the Mediterranean Sea amid heightened Middle East tensions. Get news updates at jfpdaily.com.

²-DFNVRQ0D\RU&KRNZH /XPXPEDRQHTXDOLW\

*XV0F&R\LV WKH\RXQJHVW FDQGLGDWH UXQQLQJIRU +LQGV&RXQW\ VXSHUYLVRUS

One Step Forward ...

TR

September 4 - 10, 2013

Monday, Sept. 2 Russian President Vladimir Putin proposes sending a delegation of Russian lawmakers to the United States to discuss the situation in Syria with members of Congress. ‌ Microsoft Corp. buys Nokia Corp.’s line-up of smartphones and a portfolio of patents and services for $7.2 billion.

¹)´VELEARNEDWHENSOMETHING DOESN´TWORKOUT )DON´TFOCUSON IT)T´SJUSTYESTERDAY4HEMILKIS SPILLED'ETATOWEL WIPEITUP TRYTOPOURANOTHERGLASSORGET SOMETHINGELSE²

TRIP BURNS

Thursday, Aug. 29 The Mississippi Supreme Court unanimously upholds the state’s opencarry gun law. ‌ The Obama administration announces new gun-control proposals to curb imports of militarysurplus weapons and to close a loophole that allows felons and others circumvent background checks.

¹7EMUSTBEMILITANTINTHE PURSUITOFTHATEQUALITY7E CAN´TBETIMIDINTHEPURSUIT OFTHATEQUALITY3OMETIMES WECAN´TEVENBENICEINTHE PURSUITOFTHATEQUALITY²

lthough French-Canadian explorer Louis LeFleur is credited with establishing a trading post on the Pearl River that eventually grew into Mississippi’s capital city, few facts are known about LeFleur’s life. His trading post, called LeFleur’s Bluff, was an important of commercial center in the region and drew Choctaw, Chickasaw and Biloxi Indians who canoed up and down the Pearl to hunt deer, beaver, mink, turkey and duck with whites and other Indians. LeFleur later opened a tavern on the Natchez Trace before he retired to his property on the Yazoo River, where he owned as many as 100 slaves and continued to hunt into his 80s.


²0\UOLH(YHUV:LOOLDPVIRUPHU1$$&3QDWLRQDOSUHVLGHQWRQOHDGHUVKLS

TRIP BURNS

it’s been my view that if you want to “Are we not accepting bids at this send something off to die a slow death, you point?â€? Barrett-Simon asked. “Or is it still send it to JRA,â€? said Councilman Quen- an open bidding process? Should we have a tin Whitwell, Ward 1. He deadline? We had the big went on to ask for details announcement downof JRA’s attorney expenstown and I thought that es, which Whitwell said was it ‌â€? looked to be extensive. That’s when the mayor Mott’s dizzying respoke up. Saying he had sponse never answered told Mott not to comWhitwell’s questions: ment, Lumumba stood “The first thing that I can up for the JRA executive. say is that one thing we’ve “I just talked to (Mott) looked at and talked to— yesterday about this isand I want to commend sue,â€? Lumumba said. the mayor on this—is in We need to have a briefQuentin Whitwell, Ward 1, one particular meeting ing so the council can be with a developer and so asked JRA’s Willie Mott if brought up to speed on JRA is a place to send ideas forth, the mayor actually “if you want them to die a the convention-center hocame over and sat in on that slow death.â€? tel. ‌ I think the shoe-in meeting to hear first-hand. thing we were thinking was That’s opening doors. That’s getting things going to happen during the last administradone. So that’s one thing that we are doing. tion, as far as the Callen group is concerned, “The second thing,â€? Mott continued, may not be such a sure thing. So I’ve asked “is that the redevelopment authority, right that we put out a request for proposals, and now, is part of trying to clean up some things we are sure that these two groups will put in and get it back running the way it should new proposals. “ run, is we’re looking into making sure we When pressed, Lumumba said he are getting this vetting process done. OK? was “positiveâ€? that at least one of the two If we go through a proper vetting process developers that has submitted a proposal we’ll have an understanding where we have would be rebidding, but did not specify JRA, the mayor and council, etcetera going which one. Neither firm’s representatives through its proper vetting process, so every- attended the Aug. 28 budget hearing or one will know where everything stands.â€? the JRA meeting. Mott went on to say he’s never seen a When Barrett-Simon asked what the project come through an easy vetting pro- timeline would be for the RFPs, Mott said cess, and urged the council to keep that in JRA has not developed them. mind when evaluating how quickly the “Let’s work on some dates,â€? Mott said. board responds to requests for vetting. “There are some things I need to work on A few minutes later, Councilwoman before we get to that point that I don’t need Margaret Barrett-Simon, Ward 7, asked to express publicly.â€? what the status of the two bids for a proposed Comment at www.jfp.ms. Email Tyler convention center hotel was. Mott said he Cleveland at tyler@jacksonfreepress.com, and couldn’t make any public statements. follow him @TylerCleveland.

Music Writing

Interested in interviewing musicians, reviewing albums and networking within Jackson’s music community?

The Jackson Free Press is looking for freelance writers interested in covering the city’s music scene. Please e-mail inquiries to

briana@jacksonfreepress.com

   

Most classes begin the week of Sept. 23. For more information, call 601-974-1130 or go online at www.millsaps.edu/conted Series

Course Instructor Arts and Crafts Alternative Photography Mary Quin Basic Bracelet Making Laura Tarbutton Basic Enameling Laura Tarbutton Beginning Knitting Donna Peyton Beginning Photography Ron Blaylock Beginning Precious Metal Clay Laura Tarbutton Bob RossŽ Painting: Floral Michael Hughes Ž Bob Ross Painting: Landscape Michael Hughes Ž Bob Ross Painting: Wildlife Michael Hughes Botanical Drawing Dain Hayes Calligraphy Betsy Greener Advanced Calligraphy Betsy Greener Christmas Is Coming Tom & Nancy McIntyre Creating Your Own Art Fabric Rhonda Blasingame Digital Photo Editing Ron Blaylock Floral Design Tom & Nancy McIntyre Introduction to Mosiacs Teresa Haygood Introduction to Watercolor Paul Buford Let Your Inner Painter Sparkle Beverly Keaton Smith Oil Painting Workshop Tom Morrison Pottery/ Sculpture Tom Morrison Right Angle Weave Beaded Bracelet Martha Scarborough Dance Introduction to Ballroom Dancing Mike & Lisa Day Line Dance for Fun & Fitness Sandra Plunkett ZumbaŽ Salsa Mississippi Enrichment for High School Students (Only) Creating Music @ the Computer Tim Coker Genes, Proteins, & Inherited Diseases Sarah Lea Anglin How to Get into Medical School Naila Mamoon Health and Fitness Boxers Rebellion Hybrid Kickboxing Jeremy Gordon Life Enrichment Through the Andean Healing Arts Jackson Fields liveRIGHTnow Tabatas Terry Sullivan Tai Chi Mike Chadwick Yoga for Everyone Sally Holly Heritage and History History of Terrorism: An Overview Michael Reinhard Military Medicine During the Civil War William Hanigan Mississippi’s Antebellum Architecture Todd Sanders Raramuri (Tarahumara Indians) & Cultural Biospheres Larry Baron Reel Mississippi Todd Sanders Home and Garden Container & Raised Bed Kitchen Gardening Felder Rushing Home & Garden Design Rick Griffin Living in Today’s Home with Yesteryear’s Antiques Barry Plunkett Southern Cottage Gardening Felder Rushing Language and Literature Conversational Spanish Robert Kahn How to Sell What You Write James Dickerson Introduction to Practical Spoken Chinese Chia-lun Ho Jane Austen Book Club: The Paradox of Persuasion Carolyn Brown & Susan Ford Self-Publishing Cassandra Hawkins-Wilson To Tell the Truth: Creative Nonfiction Ellen Ann Fentress Writing & Selling Short Stories Part 1 & 2 John Floyd Money and Business An Introduction to Effective Grant Writing Kenneth Wheatley Basics of Investing Mark A. Maxwell Becoming a Better Board Volunteer Joe Donovan Exploring Entrepreneurship Joe Donovan Fundraising Ethics Joe Donovan Serving Your Community: Board Service 101 Joe Donovan Music Beginning Guitar Jimmy Turner Beginning Harmonica Scott Albert Johnson Songwriting David Womack Personal Development Acting for Stage & Film Jim Fraiser Conscious Evolution Luke & Charlotte Lundemo Power Communication for Executives Linda Berry Relationships & Spirituality Bob Nevels Understanding Your Dreams Karen Mori Bonner Special Offerings ACT Test Prep Course Leonard Blanton Backyard Astronomy Jim Waltman Birdwatching Chris King La Dolce Vita: Italian Wines & Movies Patsy Ricks Regional Wines of Europe John Malanchak TIPS for Buying Fine Jewelry Eddie Havens What Does It Mean To Be a Southerner Today Nell Knox

jacksonfreepress.com

¹)WASTOLDINSOMANYWAYSANDBYSOMANYPEOPLE PARTICULARLYMEN YOUCAN´TDOTHISJOB!ND)HADTOREMIND THEM¨)WASTHEWIDOWOF-EDGAR%VERS BUT)WASMYOWN WOMANWITHMYOWNACCOMPLISHMENTS²

9


TALK | city

McCoy: Tearing Down ‘Walls’ by R.L. Nave

R.L. NAVE

At age 47, youth pastor and insurance agent Gus McCoy is one of the youngest candidates vying for the Hinds County District 2 supervisor’s seat.

W

hether it’s troubled young people, insurance agreements, or maintenance and infrastructure issues, Gus McCoy likes to think he’s on the front lines of issues Hinds County supervisors tackle on a daily basis. McCoy, 47, is an insurance agent and youth pastor at New Jerusalem Church. He is also chief executive officer of the nonprofit Metro Youth Initiative. Previously, he was an

electrical-utility contractor with Entergy. An Edwards native and resident of the Presidential Hills—he and his wife, Melissa, recently moved there from Fondren—McCoy is making his first run for elected public office with a bid for Hinds County District 2 supervisor. He recently spoke with the Jackson Free Press about his plans for the district.

How can a supervisor address young people’s problems? When you hear about problems going on with our kids, you have to address systemic stuff that’s going on. The role of the supervisor is to create an atmosphere so we can try to address those problems. … We have 53 parks in the city of Jackson. … I challenge men all the time: How much money does it take to pick up a bat and a ball and take some boys to the park and go play ball with them? They’ll engage just because it’s something to do. I’m a youth pastor; I deal with that all the time. I don’t think there’s one simple cure-all. But when I go to Bolton and I know that the Boys and Girls club is not there anymore—

about four or five years ago the Boys and Girls club was having some funding issues. They had to cut, and where they cut was in the county. Or if I go to Edwards, and they need a park. I think providing those services are within the purview of the board of supervisors.

even though we may have different needs: One part of the community may need a library, another might need sidewalks. I don’t want a county where we feel walled off from one other. Folks in the rural areas provide taxes to the tax base just like everybody else.

How do you balance the needs of urban and rural residents? We’re an entire county; it’s not a territory thing. If crime rises in Clinton, that’s not a Clinton problem. That’s going to affect the perception of the whole entire county. They (dug a ditch) over there because they felt the crime was coming from a certain area of Jackson. Clinton can’t wall itself from the rest of the community because we need each other. When WorldCom was located out there, you had employees coming out of Jackson, Utica and everywhere else. I don’t follow one school of thought or another that says the county needs to do its thing and cities do their thing because that’s just not going to work. Everywhere that is working, whether it’s in regard to law enforcement, whether it’s in regard to economic development, it’s done together. I want to see this thing seamless,

What’s the two-minute pitch for Gus McCoy? I think Hinds County has an opportunity to move forward with a progressive plan for the county that does not mean taxing our citizens. Where we are right now is people feel like services are not being met, that they’re not receiving bang for their buck and that the environment that is being created is not being progressive enough for the problems that we have. My promise is that even though we might not solve every problem that we have immediately, every need will be addressed. People want to be listened to, but at the same time they want services. That’s my commitment—that we meet their needs, but also that we provide the services their tax dollars require. Comment at www.jfp.ms. Email R.L. Nave rlnave@jacksonfreepress.com.

Ripe for a Green Revolution by R.L. Nave

10

To date, the South has not cashed in on used to make floor tiling, countertops, bricks, Rainbow ceased its glass-recycling program this growing industry. Most of the nation’s roofing and landscaping material. in 2012. Another company, Recycling Serlargest recycling centers are located in dense Today, the value of scrap aluminum is vices Inc., on Mill Street in midtown, acurban areas outside of the South. None of about $1,500 per ton, $350 per ton for scrap cepted paper and plastic recycling from the the nation’s 75 largest MRFs are located in PET (e.g. plastic soda bottles) and HDPE (e.g. public but was cited for city and state enthe southeast, and the closest facility to Jack- plastic milk jugs) and $3 per ton for glass. vironmental health violations, and remains son is in the Dallas metro. Lately, Jackson’s recycling culture has closed. Some companies recognize that Still, with curbside recycling pickup Mississippi’s market is wide open. only available to residential trash customTampa, Fla.-based Commercial Plastics ers in Jackson—apartment buildings and Recycling Inc. announced an expansion complexes are commercial businesses into Bay St. Louis with a 30,000-squareand, therefore, do not receive recycling foot facility in late July. Paul Benveneti, services—environmentally minded citia purchasing and sales manager with zens now have few choices but to throw CPR, said the recycler’s existing relarecyclables in with the rest of the trash. tionships with petrochemical comRecyclers in Mississippi are hoping panies combined with what he calls a that the recycling ethic continues to get sea change in attitudes about recycling stronger as people become more eco-conhelped solidify the company’s decision scious. CPR’s Benveneti said consumers to enter Mississippi. increasingly want environmentally sus“The economics of it are changing With few recycling options in the capital city, tainable goods, which is driving the deJackson is primed for growth of its green economy. and companies are looking at recycling as mand for recycled materials. not only the right thing to do thing, but “There’s money to be made,” also a smart business decision,” Benveneti said. taken a hit with the closure or Benveneti said. Some of that change in thinking occurred scaling back of two local recyclers. In August, Jackson residential garbage customers can during the Great Recession, when companies Global Plastics Recyclers on Palmyra Street call the city at 601-960-0000 to request up to were looking for creative ways to cut their bot- closed its doors. Global, which reopened two bins for curbside pickup of paper and plastom lines. Likewise, builders and manufactur- briefly after a warehouse fire this spring, tic. Curbside glass recycling is not available at ers wanted to lower the costs of raw materials became the only place to recycle glass after this time. Comment at www.jfp.ms. FLICKR/MOJAVE DESERT

September 4 - 10, 2013

I

n the two decades since he arrived from California, Luke Lundemo has witnessed, and been part of, a vast improvement in the capital city’s recycling ethic. In that time, the city started offering curbside pickup of recyclable materials such as plastic containers, glass, and newsprint and other paper. Businesses, including Rainbow Natural Grocery Cooperative, where Lundemo is chief executive officer, began facilitating the hauling of Jackson’s recyclables to materialsrecovery facilities, or MRFs, as far away as Texas. That could mean there’s a business opportunity for a local materials-recycling center. “If we have someone local, the market is huge,” Lundemo said. Jackson tops no lists of America’s greenest cities, but given the lack of recycling infrastructure and a stated commitment from government officials including Mayor Chokwe Lumumba—who campaigned on developing a green culture—the capital city could be ripe for a green revolution. U.S. Environmental Protection Agency information from Oct. 2011 shows that recycling materials recovery is a $236 billion industry that directly employs 1.1 million workers. Another 1.4 million jobs are tied to recycling.


TALK | city

Jackson Ordinance Seeks to Curb State Gun Law By Tyler Cleveland

munity,” Tillman told the Jackson Free Press. “There’s even concern among the people who serve the public, so we just want to clarify some things and make sure, as a city, that FLICKR/JEFF_GUNN

J

ackson city leaders have watched the “open carry” debate unfold since Gov. Phil Bryant signed House Bill 2 into law, reinforcing existing state law that allows anyone without a criminal record to openly carry a firearm. Now, they’re working on Plan B. Two days before the Mississippi Supreme Court overturned Hinds County Circuit Court Judge Winston Kidd’s injunction to stop the law from taking effect, Jackson City Council President Charles Tillman introduced an ordinance to ban weapons from a laundry list of public places in the capital city. Similar to what many private businsses have done, the proposed ordinance would ban guns and knives (with an exception for law enforcement officers) on all city property, including City Hall. Also on the list of banned areas are public parks, playgrounds, gyms, recreational facilities and fields the city maintains; meeting places for governmental bodies; political rallies, parades and official political meetings; and all non-firearm related college or professional athletic events. “Since the Legislature passed the law, there’s been a lot of concern out in our com-

A proposed Jackson gun ordinance would ban guns in many public places such as parks and gyms.

we are taking our own look at how we handle public safety.” The bill passed during the last legislative session sought to clarify the term “open carry.”. The result was a law that allows for any citizen who never been convicted of a felony

the ability to carry a gun in plain sight. The bill’s sponsor, Rep. Andy Gipson, R-Braxton, told reporters in April he doubts that his bill will result in more gun-toting citizens. “Mississippians have more discretion than that,” Gipson said. State Attorney General Jim Hood agreed in his opinion. “To be clear,” Hood wrote. “The mere fact that a person is openly carrying a weapon, without anything more, does not give the officer grounds to detain that person, or to require him to submit to questioning.” Mississippi has some of the most lax gun laws in the country. The state does not require background checks for transferring guns between private owners or require permits or registration of gun owners. We are also a national leader in gun deaths, ranking No. 2 in a 2010 analysis by Washington, D.C.-based Violence Policy Center. Mississippi suffers 6.9 gun deaths for every 100,000 people, nearly double the U.S. average of 3.6. The ordinance, which the six city council Democrats will likely support, will have at least one member in opposition. Quentin Whitwell, Ward 1, the council’s lone Republi-

25th Anniversary

can, said many reactions to the state law come from a misunderstanding of the language. “In today’s world, a lot of people are worried about weapons,” Whitwell said. “But the real goal should be to get the guns away from the people who want to use them for criminal purposes. “The real problem (with this ordinance) is this part about (reacting to) the ‘open carry’ law. We already have a state law that allows open carry, and I think there’s a lot of misunderstanding about that. I’m not for anything that would destroy the constitutional fabric of the state of Mississippi or the United States.” One of Tillman’s main concerns is the safety of Jackson Police Department officers. “Officers sometimes have to use force to separate people,” Tillman said. “If they pull up to a situation where everyone has a gun strapped to their waist, obviously, that changes things.” JPD Assistant Police Chief Lee Vance said Tillman’s ordinance is similar to other efforts in cities and business across the country. “Anytime you have guns, there’s a greater potential for someone getting hurt. That’s not opinion, that’s just a fact. … If (HB 2) is law,

it’s law; we’ll have to deal with it the best we can until its amended or done away with.” Comment at www.jfp.ms. Email Tyler Cleveland tyler@jacksonfreepress.com, and follow him @TylerCleveland.

7EPIW%GGSYRX1EREKIVW

A SPECIAL limited edition Commemorative Medal will be awarded to ALL race finishers.

ROUTE: The 5-mile race starts at the Old Mississippi River Bridge located at I-20 and Washington Street, crosses the Old Mississippi River Bridge, and ends back at Vicksburg.

RACE TIMES: 8:00 am for 5-Mile Run and 5-Mile Walk & 1-Mile Fun Run will follow (No headphones, rollerblades, strollers, bicycles or animals allowed on the course)! DIRECTED BY: The Mississippi Track Club, Grand Prix Event Proceeds to benefit The Southern Cultural Heritage Foundation

For more information www.southernculture.org Additional Support: Budweiser | City of Vicksburg | Coca-Cola | Coomes Produce | Gulf States Golf Cars Waste Management | Woodmen of the World

3YXWMHI(MKMXEP6ITW

-J]SYPMZIERHFVIEXLXLIWSGMEP;IF%2(]SY«VI[MPPMRKXSKSSYXIZIV]HE]XSXEPO XSTISTPIEFSYXMX[I«ZIKSXEYRMUYITSWMXMSR;I«VIPSSOMRKJSVWSQISRIXSWIPP HMKMXEPEHZIVXMWMRKQSFMPIWSPYXMSRWWQEPPFYWMRIWWETTWERHQSVIMRGPYHMRKXLI 4YWLPSGEPTPEXJSVQLIVIMR.EGOWSR'SRXVEGXSVMRLSYWIHITIRHMRKSRI\TIVMIRGI -J]SYPSZI]SYVWQEVXTLSRIERH]SY«VIVIEH]XSQEOIEGLERKIMR]SYVGEVIIVKIX MRXSYGLERHPIX«WXEPO

7II[[[NJTQWNSFWJSVQSVIHIXEMPWSRXLMWTSWMXMSRERHSXLIVW

7IRHVIWYQIWERHGSZIVPIXXIVXSNSFW$NEGOWSRJVIITVIWWGSQ 8LI.EGOWSR*VII4VIWW-RGMWER)UYEP3TTSVXYRMX])QTPS]IV-XMWXLITSPMG]SJXLIGSQTER]XSTVSZMHIIUYEP STTSVXYRMX]JSVEPPIQTPS]IIWERHETTPMGERXWJSVIQTPS]QIRX[MXLSYXVIKEVHXSVEGIGSPSVGVIIHVIPMKMSRKIRHIV WI\YEPSVMIRXEXMSRREXMSREPSVMKMREKIQEVMXEPWXEXYWQIRXEPSVTL]WMGEPHMWEFMPMX]TVIKRERG]QMPMXEV]SVZIXIVERWXEXYW SVER]SXLIVFEWMWTVSLMFMXIHF]WXEXISVJIHIVEPPE[8LMWTSPMG]EPWSTVSLMFMXWIQTPS]IIWJVSQLEVEWWMRKER]SXLIV IQTPS]IIWJSVER]VIEWSRMRGPYHMRKFYXRSXPMQMXIHXSVEGIVIPMKMSRWI\REXMSREPSVMKMREKISVHMWEFPIHWXEXYW

jacksonfreepress.com

SATURDAY, OCTOBER 12, 2013

;IRIIHGPMIRXHVMZIRGERHMHEXIWVIEH]XSLMXXLIWXVIIXWXSTVSWTIGXRI[EGGSYRXW PMWXIRXSGPMIRXRIIHWERHJSPPS[YTIZIV][IIO[MXL[SVPHGPEWWGYWXSQIVWIVZMGI &VMRK]SYVPSZISJPSGEPFYWMRIWWERH]SYV[MPPMRKRIWWXS[EOIYTIZIV]QSVRMRKXS MQTVSZI]SYVGYWXSQIVW«FSXXSQPMRI1SXMZEXIHWEPIWTISTPIGERQEOIQS SVQSVIMRXLMWGSQQMWWMSRHVMZIRTSWMXMSR[LMGLSJJIVWETEMHHE]XVEMRMRKTIVMSH

11


TALK | business

Are you between the ages of 18-65 years and experiencing withdrawal symptoms? If so, you may be eligible to participate in a research study of an investigational medication for the treatment of opioid dependency. All research-related care and study medication will be provided at NO COST to those who qualify.

September 4 - 10, 2013

For More information, call:

12

3531 Lakeland Drive Brentwood Plaza – Suite 1060 Flowood, MS 39232 (601) 420-5810

Hair Studio, eCities and Nissan Grants by Dustin Cardon Google, said in a statement. “Google is proud to recognize this growing entrepreneurial spirit and the role it plays in creating jobs and sustaining local economies.” Ridgeland Mayor Gene McGee also weighed in: “Given the critical role that technology plays in driving growth and creating jobs, we want to encourage every business in Ridgeland to embrace the web. Technology has been a powerful part of our economy, and we expect that trend to continue. I am so proud of Ridgeland’s small businesses for leadRidgeland Mayor Gene McGee is thrilled that ing the charge in Mississippi.” his city is the 2013 eCity for the state. Visit the eCities website at google.com/economicimpact/ecities ashandra Booker is the owner for more information. of the newly opened JSU Hair Studio, located inside the Jack- Nissan Awards Grants to Teachers son State University Student Nissan and BankPlus awarded Center (1400 Lynch St.). The salon has $65,000 in grants to teachers in the Madan upscale atmosphere and provides cli- ison County and Canton Public School ents with quality hair care and healthy districts last week, enabling these teachhair-care products. The studio also fea- ers to fund creative and groundbreaking tures “Design Essentials” product line. learning projects for their students. JSU Hair Studio offers free consultaThe program awards up to $1,500 tions, natural hair care services, weaving, to teachers and school administrators to treatments, manicures and pedicures, and fund projects that their schools’ budgets custom jewelry. can’t afford. Nissan’s grants will support The studio is open Monday from 9 51 different educational initiatives, ina.m. to 3 p.m., Tuesday from 9 a.m. to 6 cluding a 3D printer for technology stup.m. and Friday from 7 a.m. to 1 p.m. dents learning how to design products, For more information, call Booker at Spanish-language children’s books to give 601-979-7004. students deeper insight into vocabulary and culture, and touch-screen tablet comRidgeland is a 2013 eCity puters to help special-needs students learn Google recently named Ridgeland how to write. the 2013 eCity for Mississippi. The eCThe Community Foundation of ity awards recognize the strongest on- Greater Jackson administers Nissan’s grant line business community in each state, program. Nissan has awarded more than in which businesses make good use of $400,000 to the Canton and Madison the Internet to find new customers, County Public School districts since the connect with existing clients and fuel company started the program in 2007. the local economy. “Over the last seven years, this initiaIndependent research-firm Ipsos tive has had a significant impact on the partners with Google to analyze the on- lives of thousands of Mississippi students, line strength of local, small businesses in and enables teachers to think big about all 50 states to decide winners for eCity bringing learning to life,” Jane Alexander, awards. The companies weigh a variety president and CEO of the Community of factors including the likelihood of Foundation of Greater Jackson, said in small businesses to have a website, use a release. “With Nissan’s continued and a blog, promote themselves on a social generous support of education, the posnetwork, sell goods directly from their sibilities for learning are endless.” web pages and have a mobile-friendly Nissan has awarded more than $8 website. Winning cities exhibit strong million in grants, academic scholarships engagement and potential for growth and other charitable contributions in cenwithin the digital economy. tral Mississippi since 2003. Nissan em“Ridgeland’s growth and innova- ployees also do volunteer work for comtion in e-commerce is an example that munity organizations, including working other cities across the state can strive with students in the classroom and as to replicate,” Scott Levitan, direc- one-on-one mentors. tor of small business engagement at Comment at www.jfp.ms. COURTESY THE CITY OF RIDGELAND

Do You Suffer From Opioid Dependence?

R


1060 E County Line Road Ridgeland, Ms

LET US CATER YOUR PARTY OR EVENT Burger Bars • Blue Plates Pulled Pork Plates • Chick Bite Trays Wrap and Sandwich Trays

Your #1 burger place is also your #1 caterer!

601.213.8705

Dale Carnegie Course

Skills for Success

8 Weekly Sessions starting Oct 14

Step Up to Leadership One Day Course November 12th 888-437-1066 or e-mail paul.phillips@dalecarnegie.com Presented by Paul Phillips and Associates, Inc.

What is an “Old” Catholic? Don’t let the name fool you . . . Learn more about this inclusive and progressive Independent Catholic Church and its origin . . . OId Catholic Church

WEEKLY MASS 1 P.M. Sunday COME JOIN US. ALL ARE WELCOME AT OUR LORD’S TABLE. St. Alexis Episcopal Church’s Building 650 East South St., Jackson, Miss.

www.occms.org

601-871-0601

jacksonfreepress.com

St. Mary Magdalene the Apostle

13


The Other Dr. King

A

s I commemorated the 50th anniversary of the March on Washington, I thought about the Dr. Martin Luther King Jr. we rarely hear about. We have allowed people to define King with one speech: “I Have a Dream.� The speech was important and powerful. When I was a young girl, I copied the whole speech and carried it every day. But Dr. King issued many challenges to Americans that we remain silent about. In a lesser-known speech, “Remaining Awake Through a Great Revolution,� King said it was time to develop a world perspective, stating: “The world in which we live is geographically one. The challenge that we face today is to make it one in terms of brotherhood.� Instead of the warm, fuzzy, let’s-all-hold-hands-and-everything-will-be-fine Dr. King that some have led us to believe existed, he understood that racism is complex and woven into our nation’s fabric. “It is an unhappy truth that racism is a way of life for the vast majority of white Americans, spoken and unspoken, acknowledged and denied, subtle and sometimes not so subtle—the disease of racism permeates and poisons a whole body politic,� King said. “And I can see nothing more urgent than for America to work passionately and unrelentingly—to get rid of the disease of racism.� This is the same speech in which he famously called Sunday mornings “the most segregated hour� in America. That hasn’t changed much. King also spoke about the myths around race and race relations that are hindering our progress. The first myth he called out is still with us, too: “One is the myth of time. It is the notion that only time can solve the problem of racial injustice. And there are those who often sincerely say to the Negro and his allies in the white community, ‘Why don’t you slow up? Stop pushing things so fast. Only time can solve the problem. And if you will just be nice and patient and continue to pray, in 100 or 200 years, the problem will work itself out.’� One moment in time should never define someone. Many prefer Dr. King, the dreamer. People don’t want to know about the Poor People’s Campaign that he was working on when he was assassinated or his anti-war views. The American public doesn’t want to hear any so-called radical or militant words from a black leader they have decided is “safe� on race relations, so Dr. King’s message has to be edited, refined and repackaged for easy mass consumption. It’s OK to have a dream—just make sure you’re awake for the revolution.

‘never seen’ Âł:KHQWKHODZVXLWZDVÂżUVWÂżOHG,VDLG,ÂśGQHYHUVHHQDODZVXLWWKDWFODLPVWKH &RQVWLWXWLRQLVXQFRQVWLWXWLRQDO´

September 4 - 10, 2013

°2EP!NDY'IPSON 2 "RAXTON TOTHE!SSOCIATED0RESSINREACTIONTOTHESTATE 3UPREME#OURTOVERTURNINGALOWER COURTINJUNCTIONAGAINST(OUSE"ILL

14

Why it stinks: Attorney Gipson could use a refresher course on the law, it seems. The judicial process allows citizens to change laws that are unfair or discriminatory, including those that violate the state’s and the nation’s constitutions. The U.S. Supreme Court declared numerous state and federal laws unconstitutional, starting in 1803 with Marbury v. Madison, which established judicial reviews as a way to decide whether laws meet constitutional standards. One of the more famous cases on a state law’s constitutionality is 1973’s Roe v. Wade. The decision said the Texas law impinged on a woman’s right to privacy when it did not allow her to choose abortion. Earlier this year, the court ruled in U.S. v. Windsor that the federal Defense of Marriage Act, aka DOMA, was unconstitutional because it discriminated against same-sex married couples. It also overturned part of the 1965 Voting Rights Act, saying that singling out some states for U.S. Department of Justice review of voting rules was—you guessed it—unconstitutional.

Wagging the Dog on Guns

T

his week, the Mississippi Supreme Court unanimously overturned Hinds County Judge Winston Kidd’s injunction against House Bill 2. That came as no surprise. Despite good intentions, the attempt to stop the legislation seemed more an act of desperation than one based in law. What is surprising to us is that Mississippians—in particular, members of the overly partisan state Legislature—seem unable to move past the rhetoric concerning guns. It looks to us like a case of the tail wagging the dog: Few, if any, of Mississippi’s leaders dare to touch the issue for fear of losing votes. Here’s the problem: Allowing every Mississippian to openly carry guns puts all of us in real danger. So say the state’s top law-enforcement and prosecutors. That danger was the impetus for people like Hinds County District Attorney Robert Smith to seek an injunction against the law. “It’s difficult to determine who is a threat, and (who) isn’t a threat,� Smith said during a press conference in June. Here’s what Smith meant: When just about anyone can openly carry a gun without a permit, how can we tell whether a person has a gun legally? Guns are easy to obtain in Mississippi. Like most states, sales between private individuals are not subject to background checks. That so-called “gun-show loophole� means that felons can just as easily buy guns as perfectly law-abiding citizens.

Just carrying a gun openly does not give police latitude to stop someone whom they don’t know has a felony record. “[T]he mere fact that a person is openly carrying a weapon, without anything more, does not give the officer grounds to detain that person, or to require him to submit to questioning,� wrote Mississippi Attorney General Jim Hood in his opinion about House Bill 2 in June. To be fair, Mississippi’s leadership isn’t alone in this particular race to the bottom. Congress is loath to do battle with powerful industry lobbying groups like the National Rifle Association, even when the majority of Americans cry out for their leaders to do something—anything—to stop the gun violence in our country. Gun lobbyists have defined the parameters of the playing field. Now, Jackson City Council President Charles Tillman has proposed an ordinance banning guns from any public venue in the capital city. If our prognosticators’ hats are on right, the ordinance faces an uphill battle. Nevertheless, we congratulate Mr. Tillman for taking a stand on guns, something few politicians seem willing to do. What seems clear to us is that it is not enough to simply expect our leadership to do the right thing. Ultimately, it is the people who will pay the price. And it’s the people who must make their voices heard. Without our noisy and messy demands for change, chances are nothing different will ever happen.

Email letters to letters@jacksonfreepress.com, fax to 601-510-9019 or mail to P.O. Box 5067, Jackson, MS 39296. Include daytime phone number. Letters may be edited for length and clarity. Or write a 300-600-word “Your Turn� and send it by email, fax or mail above with a daytime phone number. All submissions are subject to fact checks.


BY JOE ATKINS

‘All About the Food’ EDITORIAL News and Opinion Editor Ronni Mott Features Editor Kathleen Morrison Mitchell Reporters Tyler Cleveland, R.L. Nave Music Editor Briana Robinson JFP Daily Editor Dustin Cardon Editorial Assistant Amber Helsel Events Editor Latasha Willis Music Listings Editor Tommy Burton Fashion Stylist Meredith Sullivan Writers Torsheta Bowen, Ross Cabell Marika Cackett, Richard Coupe, Bryan Flynn, Genevieve Legacy, Anita Modak-Truran, Larry Morrisey, Eddie Outlaw, Julie Skipper, Kelly Bryan Smith, Micah Smith Bloggers Dominic DeLeo, Jesse Houston Editorial Intern Justin Hosemann Consulting Editor JoAnne Prichard Morris ART AND PHOTOGRAPHY Art Director Kristin Brenemen Advertising Designer Andrea Thomas Design Intern Lindsay Fox Staff Photographer/Videographer Trip Burns Editorial Cartoonist Mike Day Photographer Tate K. Nations ADVERTISING SALES Advertising Director Kimberly Griffin Account Managers Gina Haug, David Rahaim BUSINESS AND OPERATIONS Director of Operations David Joseph Bookkeeper Aprile Smith Distribution Manager Richard Laswell Distribution Raymond Carmeans, John Cooper Jordan Cooper, Clint Dear, Ruby Parks ONLINE Web Editor Dustin Cardon Web Designer Montroe Headd Multimedia Editor Trip Burns CONTACT US: Letters letters@jacksonfreepress.com Editorial editor@jacksonfreepress.com Queries submissions@jacksonfreepress.com Listings events@jacksonfreepress.com Advertising ads@jacksonfreepress.com Publisher todd@jacksonfreepress.com News tips news@jacksonfreepress.com Fashion style@jacksonfreepress.com Jackson Free Press P.O. Box 5067, Jackson, Miss., 39296 Editorial (601) 362-6121 Sales (601) 362-6121 Fax (601) 510-9019 Daily updates at jacksonfreepress.com The Jackson Free Press is the city’s award-winning, locally owned newsweekly, with 17,000 copies distributed in and around the Jackson metropolitan area every Wednesday. The Jackson Free Press is free for pick-up by readers; one copy per person, please. First-class subscriptions are available for $100 per year for postage and handling. The Jackson Free Press welcomes thoughtful opinions. The views expressed in this newspaper are not necessarily those of the publisher or management of Jackson Free Press Inc. Š Copyright 2013 Jackson Free Press Inc. All Rights Reserved

"TTPDJBUJPOPG "MUFSOBUJWF/FXTXFFLMJFT

O

XFORD—A.J. Liebling, the great journalist, raconteur, and connoisseur of good food loved to venture off the beaten tracks of New York and Paris to find little, overlooked restaurants and bistros. Places where a man with a taste for good dining could enjoy himself. Liebling knew such places—“lost Atlantisesâ€? he called them—often have a precarious existence. “The small restaurant is evanescent,â€? he wrote in “Between Meals,â€? his 1959 classic “Sometimes it has the life span of a man, sometimes of a fruit fly.â€? More recently, food-and-travel TV personality Anthony Bourdain had this to say about the perils of the restaurant business in his book “Kitchen Confidentialâ€?: “To want to open a restaurant can be a strange and terrible affliction. What causes such a destructive urge in so many otherwise sensible people? Why would anyone want to pump their hard-earned cash down a hole that statistically, at least, will almost surely prove dry?â€? Maher Alqasas, 50, a native of the Mount of Olives in Palestine and veteran restaurant owner here in Oxford, acknowledges the risks: “This is a tough business. Imagine working 12 hours a day and having a smile on your face for 12 hours, and to like what you do. The kitchen is a fireball—booming, loud— and I have to be a part of that. What makes it worth it at the end of the day is seeing the smile on their faces.â€? He’s talking about the smile on customers’ faces at his Middle Eastern and Mediterranean restaurant Petra CafĂŠ (no connection to Jackson’s Petra CafĂŠ), open since February in the corner of the town’s famous square. “Food is the moment of celebration,â€? says Alqasas, who grew up in Qatar, “because when you are hungry, you are willing to eat anything, but if you know you are eating something good, it is a joy. You are nourishing your body.â€? The food at Petra isn’t exactly what you’d find in most southern homes. But it’s just as homemade and just as likely to be from old family recipes, says Petra chef and Alqasas’ wife, Angela, also a native of Palestine. “My customers come to my kitchen and tell me it’s the best falafel they’ve ever had—customers from Chicago (and) Michigan,â€? she says. “I love it. I remember when

I was a kid, my mom asked me to do the falafel. We used to help my mom. I learned from my mother and my mother-in-law.â€? The Alqasas—their three children work at Petra, too—like the idea of a homey atmosphere, even though home for them would be exotic to most Oxonians. The walls feature paintings of street scenes and merchants from Old Egypt. The music is Turkish; the carpet at the front door is Persian. “I’m trying to keep the Oxford look, too, the old and new,â€? Maher Alqasas says. Still, running a successful restaurant on Oxford’s Square can require more than good food and atmosphere. Most of the two dozen or more restaurants and bars on or near the Square also serve alcohol. They’re why the town’s nightlife rivals that of much larger cities. Petra allows brown bagging but serves no alcohol. It hurts business, Alqasas admits, “But eventually, it is going to be known: Customers can bring their own. It is worth the wait. It is all about the food.â€? Alqasas is Muslim. His religious faith is one reason he avoids serving alcohol. Another is the bar he once had in an earlier version of Petra a few blocks away. “It made my life miserable as far as inventory, keeping kids working, no stealing. ‌ I don’t want to be a part of it.â€? At least some of his customers don’t mind. “It didn’t stop us,â€? said Ole Miss student Shelby Herring, a 21-year-old hospitality-management major from Texas, during a recent meal there with her friend and fellow Ole Miss student Molly Thrush. “I like Mediterranean food. I’m a vegetarian, so I like the falafel (fried, ground vegetables), the salads, the hummus. Back home, I’d go once a week to a Middle Eastern or Mediterranean restaurant.â€? Petra just suffered through the summer doldrums that tend to hurt the bottom lines of most college-town businesses. Many tables remained empty during the summer evenings. Alqasis is optimistic, however. “I am a patient person,â€? he says. On the other hand, he’s ready for the fall invasion of Ole Miss students. “Can’t wait!â€? Joe Atkins is a veteran journalist, columnist, and professor of journalism at the University of Mississippi. His blog is laborsouth.blogspot. com. Email him at jbatkins@olemiss.edu.

‘To want to open a restaurant can be a strange and terrible affliction.’

#/22%#4)/.,Q³-)3&ROOHJH)RRWEDOO3UHYLHZ´ 9RO,VVXH ZHLQFRUUHFWO\QRWHGWKHUDGLRVWDWLRQIRU -DFNVRQ6WDWH8QLYHUVLW\IRRWEDOOJDPHV$VRI6HSWHPEHUOLVWHQHUVFDQWXQHLQWR)07KH-DFNVRQ)UHH 3UHVVDSRORJL]HVIRUWKHHUURU

Write to Change Your World Hurry: Only 11 seats available! Register now for JFP Editor Donna Ladd’s popular creative non-fiction fall class series. All levels welcome in the 101 class series, the last in 2013. Class runs every other Saturday from 10 a.m. to 12:30 p.m. Sept. 7, 21, Oct. 5, 19, Nov. 2, 16 Meets in the JFP classroom in Fondren $150, includes snacks and materials.

Call 601-362-6121 ext 15 or email class@writingtochange.com for more information.

jacksonfreepress.com

Editor-in-Chief Donna Ladd Publisher Todd Stauffer

15


TRIP BURNS

Corner Store: Where Are You? by Tyler Cleveland

September 4 - 10, 2013

O

16

n a recent trip to the William F. Winter Archives and History Building, a couple of enterprising reporters dug up some old pictures and articles about Capitol Street. A picture dated Jan. 20, 1967, taken from the West Street intersection looking east, shows a bustling business district with independent businesses lining the street. There are people in the picture. There are cars in gridlock (without road construction). There is life. As the caption on the now-tattered newspaper clip said, the picture “reveals a busy downtown artery with all the hustle and bustle of modern city life.” A lot has happened since 1967, the year some of the conspirators who murdered three civil-rights workers in Neshoba County were convicted, and hardly any of it has been kind to Jackson’s retail scene. Looking at the same street from the same view today paints a picture of what was, what is and what could be. Jackson’s downtown retail is either flat, or moderately improving, depending on whom you talk to, but it’s not anywhere near the level of occupancy it once enjoyed. Between 1970 and 1980, the west end of Capitol Street, a microcosm of the entire downtown scene, devolved. An article in The Clarion-Ledger by writer Richard Hart, dated Sept. 24, 1981, describes it best: “The

trains slowed to a halt, the hotel closed up, and the few last diehard merchants hung on for dear life.” That article, titled “Saving What’s Left of Capitol Street,” reads like it could have been written yesterday, with lines like “The Farish Street renovation just blocks away has not spread interest into that part of town.” Those merchants are even fewer in number now. Lott Furniture, The Mayflower Café and a handful of other businesses have hung on long enough to see the King Edward Hotel renovated and reopened. Jackson-based BlackWhite Real Estate Development is working on renovating and reopening some mixed-use space across the street from the hotel, but it’s still in the early stages. Even with great excitement and myriad promises of a revitalized downtown over the last decade, one major question still looms: Where is the corner store? The Flight of Retail Stacy Mitchell, a Portland, Ore.-based senior researcher at the Institute for Local Self-Reliance, said the decline is not exclusive to Jackson or southern cities. “This has been a phenomenon that has been experienced across the country,” Mitchell said. “It began in the 1950s and ’60s as shopping malls started popping up on the outskirts of towns. By the late ’80s and ’90s,

big-box stores started popping up. That really dealt a severe blow to a lot of downtown retail areas. As one business left, it made all the other stores suddenly a little less convenient than they were before, because you couldn’t fill all your needs in one area anymore.” In Jackson and many other cities, the problem was ironically exacerbated by the end of Jim Crow laws: Black business dis-

‘We don’t need one big project here and another there.’ —Roy Decker tricts such as Farish Street and Beale Street lost the bulk of their customers to shopping areas they were previously restricted from, and suburban malls grew to meet the demand of white families fleeing newly integrated public schools and, thus, the city.

“Urban renewal” didn’t help, meaning that rows of previously successful local businesses downtown were razed for office buildings and parking lots. Mitchell says savvy cities started doing something about the shrinking retail problem in the early 1990s, when they realized the migration of business was not healthy for the downtown economy. They reinvested in downtown and stopped putting all their infrastructure dollars into the far-reaching corners, chasing real-estate demand. Meanwhile, Jackson was sluggish to respond to downtown’s needs, and instead, began to expand its borders to keep the people who were moving outward inside the incorporated city limits, but far from downtown. The businesses on Capitol Street continued, and still continue, to scrape by, surviving on the promise that the area will eventually return to its former glory. And so it goes in most pockets of downtown, where the streets turn into a ghost town at 5 p.m. At the eastern end of the strip, Jackson’s landmark restaurant Hal & Mal’s has survived on Commerce Street, a block off State Street, since 1982. Owner Malcolm White confirmed that the downtown described in the 1981 article was very real. “There was no life downtown after the sun went down,” White said. “It was ‘move ’em in, move ’em out’ when it came to people working down here. When


TRIP BURNS

‘Utopian Planning’? Getting independent businesses to open or relocate downtown is a tricky task, and the number of ideas for creating the environment for growth seems to far outnumber entrepreneurs capable of, or interested in, opening and sustaining a retail business there. Jackson State associate professor of Urban and Regional Planning Mukesh Kumar has written about the problems that plague downtown’s retail scene. He believes the city and its civic leaders must market downtown as a means to an alternative lifestyle for people who want to live in an urban setting. More people, he says, will create the demand for retail that the capital city needs.

“The biggest difference between living in a suburb and living in a downtown area is transportation—how you get from point A to point B,” Kumar said. “If I still have to get into my car and drive to the grocery store or to the movie theater, then for what am I living downtown and paying higher rent?” Kumar has a few ideas of his own, like

some big multi-million dollar project. He sees projects like the District at Eastover, the renovations of Farish Street and Capitol Street, the Westin Hotel and the Convention Center Hotel as positives, but doubts they will create the climate for growth that Jackson would like in downtown. “Instead of thinking about project A,

TRIP BURNS

people came to our restaurant, they were coming to downtown with the intention of coming here and nowhere else.” That has changed in recent years. Downtown nightlife lives beyond Hal & Mal’s, with bars like Underground 119, Martin’s, Fenian’s, Ole Tavern on George Street, F. Jones Corner and a few other watering holes dotting the landscape. There are restaurants like Wasabi, Steve’s Uptown, Miller’s Grill, Basil’s, Mayflower Cafe, Adobo, Parlor Market and Elite Restaurant, but the list of businesses long gone is even longer. “If you look at the big picture, the retail and business scene in downtown has gotten a lot better since the 1980s when we were first opening up,” White said. “It’s just a slow, slow process.”

JSU professor Mukesh Kumar wants Jackson to have a real conversation about downtown.

re-striping all the streets to accommodate bike and walking lanes, just to start, but he’d rather see the city have a real conversation that is based on creating desire for commercial and residential space that isn’t tied to

project B and project C, we need to be thinking about how these projects collectively will get us to where we want to be,” Kumar said. “(Renovating Capitol Street) is probably going to create a little more demand for housing

in and around this area, but it doesn’t really fit with what we’re trying to create.” Jackson architect and developer Roy Decker opened his architecture firm Duvall Decker with wife Anne Marie Decker in Fondren in 1998. He has since taken on significant projects in midtown and, more recently, in west Jackson, trying to replace the blight that has brought land value, all across the city, down for years. Looking out the window of his State Street offices in the heart of Fondren, you can see thriving restaurants and retail hot spots, but it wasn’t always like that. Twelve years ago, the Mississippi Department of Wildlife and Fisheries was the only entity on the block. Now, residents and visitors enjoy restaurants like Rooster’s, Basil’s, Sneaky Bean Coffee Shop, and several retail clothing stores. Decker agrees with Kumar that large developments will not turn the fortunes of downtown Jackson around. “We don’t need one big project here and another there,” he said. “What downtown really needs is a coordinated, strategic plan that can build consensus among the city leaders.” The Philadelphia, Pa., transplant said another problem with the prospects of downtown is that there is a lot of talk, but too little action among aspiring developers. “Utopian planning is rampant,” Decker said. “It’s not just in downtown, it’s the entire architecture and development market. We have these new urbanists proposing visions of an endgame, but there’s no connec-

A Passion for Serving by Ronni Mott

Tara Blumenthal’s passion for serving the community informs her business ethics.

T

ara Blumenthal began practicing yoga for exercise. Weight training wasn’t working for her, and she was “tripping off the treadmill,” trying to get a cardio workout. “I was not the graceful girl in the gym,” she says. Yoga wasn’t exactly an overnight hit for Blumenthal, either. “I was particularly tight in certain spots, and my joints were super loose, so that created a lot of instability for me,” she says. “So I didn’t love the actual physical poses, but I loved the way I felt after I left.” Blumenthal struggled, but kept with

it. As her body became stronger and more flexible, she also became calmer and more grounded. Within a year of her first class, Blumenthal began training to become a teacher. Today, she has been teaching for more than a decade. In October 2011, Blumenthal made the leap from teaching in other people’s studios to teaching classes under the Tara Yoga moniker. At first, she split classes between The Commons at Eudora Welty’s birthplace and a dedicated space at Energy in Motion, a private gym just across the Pearl River from Jackson. But it wasn’t long before she consolidated the business in Flowood. Part of what prompted the move was her desire to give back to her community, what Blumenthal calls “practicing yoga off the mat.” She also wanted a place where she could more easily schedule her private clients. Opening her studio didn’t require a big capital investment—yoga doesn’t re-

quire technology or even furniture—and that allows Blumenthal to enjoy the journey as she slowly, mindfully grows her business. “You have to be willing to listen to what direction to go in,” she says. Learning from yoga to respond rather than react keeps Blumenthal and Tara Yoga on an even keel. “Sometimes I’d have really small classes, and the students would say, ‘How are your numbers?’” Blumenthal says about the studio’s beginnings. “I would say, ‘They’re small. Don’t you love it?’” With her energy focused on one location, Blumenthal can teach as many classes as she has energy for, while she also attends to business essentials, such as billing, marketing and scheduling. Tara Yoga now has two other instructors offering yoga at the studio on a contract basis. Teaching, she says, is the easy part. The driving force for Blumenthal is to share yoga—a practice she has found

profoundly beneficial—with as many others as possible. Tara Yoga is also Blumenthal’s “vehicle for service,” allowing her to give back in ways she may not have been able to otherwise. Blumenthal holds frequent community classes to benefit nonprofits such as the Animal Rescue Fund, the Center for Violence Prevention and, most recently, Stewpot Community Services. The last such event celebrated moving Tara Yoga upstairs to a space three times larger than her previous studio, while staying at the same address. “You don’t make a lot (teaching) yoga,” Blumenthal says. Money isn’t the point, and her decision to take the bigger space a tough one. “There’s a risk in that. ... You have to ask yourself what your motivation is.” For Blumenthal, Tara Yoga comes down to three words: “Love, authenticity and integrity.”

jacksonfreepress.com

Tara Yoga 200 Park Circle, Suite 4, Flowood, 601-720-2337 tara-yoga.net or on Facebook

17


CORNER STORE from page 17 tivity among the projects, and they just end up creating buzz, but produce no results.� That said, Decker, who is in the process of contracting on housing developments in downtown that he’s not ready to go public with, is optimistic about the market there. “You’re going to see the same thing that happened in Fondren happen (downtown),� he said. “It’s just a matter of providing housing for a diverse crowd that reflects Jackson. You want people of mixed income living in the area so you don’t create a yuppie paradise that only the well-off can afford to survive.� North Toward Fondren Kumar uses Fondren, the area around Decker’s Jackson office, as an example of what could be in the downtown area, if only there was affordable housing. “It’s a natural progression for the art community to move where you can live relatively cheaply but you aren’t in the suburbs,� Kumar said. “That’s why Fondren and Belhaven are doing so well. The boutiques and niche stores move into the area to cater to that clientele.� One example of what Kumar is referring to is the renaissance that is currently happening in midtown. The once-blighted community is back on its feet, attracting businesses and fostering an artistic sense of community.

Decker provided the first bit of affordable housing by building a series of innovative affordable houses. Then Midtown Partners and the Business Association of Mid-

Whitney Grant, the creative economies coordinator for Midtown Partners, said another driving force behind the area’s resurgence has been the strategic plan the

!VERAGE#HANGEIN2EVENUEIN   







 

,QGHSHQGHQWEXVLQHVVHVLQFRPPXQLWLHV  ZLWKD³%X\/RFDO)LUVW´LQLWLDWLYH  ZLWKRXWD³%X\/RFDO)LUVW´LQLWLDWLYH SOURCE: INSTITUTE FOR LOCAL SELF-RELIANCE, 2013 INDEPENDENT BUSINESS SURVEY

town, known as BAM, have partnered with Millsaps College Else School of Business to provide support—from taking out the trash to providing financial instruction—to businesses that want to relocate to the area.

various groups developed together, including BAM, Midtown Partners and the neighborhood association. “I don’t know where we’d be without our strategic plan,� Grant said. “When we go

into a meeting with a potential entrepreneur, we can point to a building on a map and show them how their investment in that building will affect all the buildings around it.� Malcolm White, now the state’s director of tourism, says residential demand is there for downtown, but there just aren’t enough affordable places for people to live. He points to waiting lists for apartments at the Standard Life Building on Pearl Street and the King Edward as a sign that more people will come if there is affordable housing. Flats at the Standard Life, which has rentals ranging from $975 for a one-bedroom apartment to $2,025 for a two-bedroom, two-bath apartment, are anything but affordable for the average Jacksonian. Data from the 2010 census show Jackson’s median household income to be $34,567. “It costs so much to go in and renovate these residential areas that it’s a slow process,� White said. “But there are some mixed-use projects that are soon to get off the ground, and we’ll see more affordable housing in the future.� Catering to the Day Crowd The message from downtown’s business improvement district is rosier, however. Downtown Jackson Partners spokesman John Gomez maintains that local stores

Habitat Young Professionals

PICNIC AT THE CEDARS

September 4 - 10, 2013

THURSDAY | SEPTEMBER 12TH | 6 - 8:30PM | FREE

18

Music by The Red Hots BYO: Drinks, Food and Chairs

Hilco takes styling to a new level! Available in Team Colors, Team Initials or Jersey Numbers! The finest of sports eyewear.

facebook.com/HYPMJ | @JXNHYP Trish Hammons, ABOC 661 Duling Ave. 601.362.6675 www.customoptical.net


PAID ADVERTISING

OPEN FOR BUSINESS

‘Think Local’ for Groceries, Spirits and Service

Mart in Northeast Jackson. The renovation was a tough one—30-year-old cases were replaced, new front-end equipment installed and every department had to be updated. It wasn’t until 1998 that the name change was official—it was now McDade’s Market—and the McDades felt like they’d realized their original vision. “We wanted to find a store we could call a true ‘neighborhood store’,” said Kathy McDade. “After looking in Arkansas, Louisiana and Mississippi, we found the old Sunflower store here in Jackson. We felt it had the greatest potential to become what we wanted.” Greg and Kathy McDade had already spent years in the grocery business when they started McDade’s Market. They met while they were both working for a large grocery store chain in Arkansas; Greg was district manager in the Little Rock division, and Kathy was the corporate deli director. Both had worked their way up from bagging and checking, with continued success leading to the “corner office.” But working for a big chain wasn’t quite for them; once together, they decided to make a change. “We had to work long hours to make the store the true neighborhood store it is today,” Mrs. McDade said. “It’s worth it, though, when a customer walks up to you and says, ‘We appreciate you and we are so glad you’re here.’” With one store under their belt, the McDades found that success—and new challenges—continued to present themselves. In 2000, when space came open next to McDade’s Market, the couple opened McDade’s Wine and Spirits, offering convenience and great prices in Maywood Mart. “We wanted to have some say in what

competition!—but even when she’s in “customer mode” she can’t help but stop any confused-looking fellow customers and point them in the right direction. In November 2010, the McDades acquired the Sunflower in Yazoo City, making it the fifth McDade’s Market. With support from their customers, the McDades are thrilled to be able to continue investing in Mississippi, creating jobs and supporting local growers and products.

Maywood Mart 1220 E. Northside Drive 601-366-8486 Woodland Hills Shopping Center Fondren 601-366-5273 Belhaven English Village 904 E. Fortification St. 601-355-9668

an opportunity to expand their selection to include some of the state’s most esoteric and interesting brands. Mrs. McDade says that their customers are their lifeblood, making it all possible with support and encouragement. The McDades have maintained their commitment to each of their neighborhoods, offering only quality USDA Choice and Select meats, fresh produce with many locally grown options, and services that vary from in-store bakeries and popular lunch counters to expansive beer coolers (with the widest selection they can fit in the store!) and full-service delis. Most important, though, is personal service. Mrs. McDade tells how she shops her own store like anyone else would—after all, she’s not going to the

Westland Plaza 2526 Robinson Road 601-366-8486 Yazoo City 734 E.15th St. 662-746-1144 McDade’s Wine and Spirits 1220 E. Northside Drive 601-366-5676 jacksonfreepress.com

1996, Greg and Kathy McDade purIthatnchased the former Sunflower grocery served as an anchor of Maywood

went next to the grocery store we’d worked so hard to build,” Kathy said. “We wanted something that would be a natural tie in.” In 2004, the McDades were again faced with a challenge and an opportunity. The Winn-Dixie chain of grocery stores was restructuring and looking to sell stores to avoid bankruptcy. The McDades purchased the Woodland Hills/Fondren Winn-Dixie and began a renovation that would lead to their second McDade’s Market location. (The Fondren location was later improved again in 2010, offering an improved layout to better serve that growing neighborhood.) The experience gained in that acquisition came in handy the next year, 2005, when Winn-Dixie filed bankruptcy and the McDades acquired their third store, the historic “Jitney 14” location on Fortification Street. Less than a year later, in 2006, the McDades opened their fourth store in historic Westland Plaza, an area that was underserved by grocery stores after the Winn-Dixie exodus. In 2007, the McDades realized an upgrade to their original vision in Maywood; the McDade’s Market “Extra” was born, featuring gourmet items, organic produce and extra specialty offerings. In 2010, they doubled the size of their McDade’s Wine and Spirits showroom, giving them

19


PAID ADVERTISING

OPEN FOR BUSINESS

The Art of Bread

G

il Turchin has been baking bread for a decade. After a career in investment banking, Turchin received training in bread baking at the French Culinary Institute in New York, as well as at The San Francisco Baking Institute. After his training he worked for several years in a bakery in Fort Worth, Texas. His wife, Sally, is a native Mississippian; they recently moved from Texas to the Jackson area where he realized his dream by opening Gil’s Bread. “I want to bake great bread for the great folks here in Mississippi,” Turchin said. “We offer sweet morning breads, midday sandwiches on our signature baguettes and an assortment of handmade breads.” Gil’s breakfast breads include a rich, buttery mini brioche, sweet

Crazy Ninja, Exciting Food

cinnamon bread, scones and his signature “little-bit-of-everything” morning bread. And what goes better with bread than fine coffee? “We are the only place in the Jackson area serving Mississippi Mud Coffee. We selected it because it’s delicious,” Turchin said. You can find Turchin mixing dough, hand shaping and baking an assortment of beautiful artisan bread. Patrons are welcome to stop by for a delicious bread sample, ask questions about bread baking, or just talk about bread while enjoying a mid-day treat before taking their fresh-baked treasures home. Gil’s Bread also provides free sourdough starter to home bakers and offers bread classes the first and third Sunday afternoons of each month, from 1:00 to 6:00 p.m. Call 601-856-0885 or visit Gilsbread.com for more information.

655 Lake Harbour Drive, Suite 500 Ridgeland, MS 39157 601.856.0885

Photo Credit: Paul Wolfe

Fondren’s Newest Nail Salon

September 4 - 10, 2013

V

20

ictoria Walker, owner of Cuticle’s Nail Studio in Fondren, is passionate about healthy nails. “Your hands are one of the first things that people see and touch. It’s important that women and men take care of their hands, feet and nails,” Walker said. Walker, a licensed esthetician, has been a nail technician for nearly 15 years. She fulfilled her lifelong dream of opening her own salon in June. “If my clients have acrylic nails, I limit the use of a drill. Drills are designed for very special circumstances. Nails can’t take that from week to week. I apply and remove shellac (a two-week manicure process) gently to keep the

nails strong and healthy. I use the the best products for manicures and pedicures.” She’s particularly proud of her pedicures: “I think I’m one of the best in town. My pedicures last, and I take time to explain how clients should take care of their feet between visits. ” Walker nurtures nails that have been damaged. “No nail problem it too big or small,” she said with her trademark smile, “I love a tough case.” Cuticle’s is located at 2947 Old Canton Road, in Fondren Village between Quiznos and Cosmopolitan Catering. Walker offers manicures and pedicures, including gel acrylic nails and shellac. She likes walk-ins but encourages appointments. “I want my clients to know that that their time is their time, and they don’t have to wait,” Walker said. Call 601-366-6999 today for an appointment—your nails deserve it!

2947 Old Canton Road Jackson MS 39216 601-366-699

E

nter Crazy Ninja, and you immediately know this is not your average Asian-fusion restaurant. Hints include: a drum set behind the greeter’s stand, pictures of classic rockers lining the walls and classic rock blasting from the sound system. But the real difference is the bright smile and warm welcome you often get at the front door from Crazy Ninja’s owner, Ashley Bouttavong. She and her husband, Executive Chef Emrick Immanuel, met in Chattanooga, Tenn., where they worked for rival restaurants. An introduction by a friend—and a shared love of classic rock and roll—was all it took to get them on the same team.

Then the opportunity arose to purchase a building in Flowood. The couple saw this as their chance to realize a concept unlike anything else around, marrying a rock-and-roll aesthetic with hibachi, sushi and Asian-fusion dishes—all seasoned with great customer service. It only takes one look through your “record sleeve” menu to realize the food is unique. Emrick’s dishes pull from Chinese, Thai, and Japanese with a hint of southern cuisine and emphasize bold flavors, huge variety and a heavy dose of fun. As the restaurant approaches its one-year anniversary on Sept 20, the couple is preparing a new and improved menu heavily influenced by customer feedback. For Ashley, it is all about giving an awesome experience—and rocking out with her customers while she’s at it.

Rock-N-Roll Hibachi & Sushi

2560 Lakeland Drive Flowood, MS 601.420.4058

A Better Wedding Video

T

he typical wedding video isn’t something you’d see at Sundance or Cannes. But Revival House wants to change that. If you’re looking for a wedding videographer, these guys want you to imagine your wedding video as a short film. “We approach each wedding as if we were preparing for a full-on film shoot,” said Cameron Wood, a partner in the business with his brother Chandler Wood and friend, Kody Gautier. “We carefully craft each film based on the couples and really set out to give the couple a short film not just a video. We create it in such a way that the final product is something to cherish—something you could add to your already extensive DVD collection and enjoy just like you would a major picture. After all, this

is the most important day of your life for many, so why should the quality of the film portray less of that?” Wood said. Cameron has been active in filmmaking since he was 12 years old, while Chandler’s core talent is as a layout artist and designer. Both are musicians—as is Kody, who handles business and sales. And the fact that they’re musicians opens them up to another market they’re looking to tackle in 2014—music production and music videos, while right now they offer logos, design, and creative services for musicians, churches and small businesses. “Our vision is to be a reputable, influential, and ethical multimedia source for the Jackson, Mississippi area and beyond,” Wood said. “We want to be an inspiration to everyone who values creativity and pursue their passions.” Contact Revival House for a free quote (wedding films, creative design or other services) by going to www.revivethishouse.com or call 601-573-5916.


PAID ADVERTISING

OPEN FOR BUSINESS

Look Good in Your Scrubs

S

abrina Sutherland, RN, found shopping for medical uniforms, or “scrubs,” a chore. The types available lacked style and comfort. Taking the matter into her own hands, Sabrina opened Elite Scrubs in 2010, designing a friendly shop for high-quality, stylish scrubs. In early 2013, she relocated to Lakeland Drive and was joined by her daughter, Leslie Sutherland, who acts as store manager. Now the pair greets customers with bright smiles and a commitment to style and comfort. Leslie’s knack for fashion brought her on board. She loves to pull and tug the fabrics, putting different brands through their paces. She also has an understanding of what younger

nurses desire. Nurses who’ve been on the job for years may prefer older styles, but there is a new generation wanting something tailored for them. Every person through the door has a different body type that dictates what looks and feels most comfortable. Guys are welcome, too, and have their own option-filled section. “You’d be surprised how many men will let us dress them. We pick items out for them and make a fuss. They love it,” Sabrina said. Elite Scrubs also has in-house digital monogramming capabilities that allow custom logos and names. This cuts down the wait for customized scrubs or uniforms. For Sabrina, the business comes down to a hands-on and caring approach. “Just because someone wears scrubs every day doesn’t mean they can’t look nice. Not everyone believes they look good in scrubs. But they can,” she said.

3500 Lakeland Drive Flowood, MS 601.790.9003

Where Food and Fate Collide

W

hen Kismet’s of Brandon was first conceived, Jackie Barnes and Jason Sheppard were working for a small restaurant with Lee and Kathy Kennedy. Lee and Kathy left and opened Kismet’s. Jackie and Jason followed immediately looking for a better opportunity. A successful Brandon restaurant was born. This was 1991. Fast forward two decades and you will find Jackie and Jason right where they began with Kismet’s with one exception: They are now at the helm of this cozy Brandon gem. Voted as Brandon’s Best Lunch by Jackson Free Press readers, Kismet’s

(another word for “Fate”) is no longer one of Brandon’s best-kept secrets. Kismet’s features authentic Greek cuisine with an authentic southern flair, made with fresh ingredients by their staff. Their signature gyros and fried shrimp poboys are among the best in town. They also offer a wide variety of wraps, sandwiches and open-face delights ranging from chicken salad to BBQ to allveggie options. Jackie and Jason contribute their success on the loyalty of their patrons and staff, many who have been there since the very beginning. According to Kismet’s lore, if you ever have a question, just ask one of the original employeees because “they have seen it all.” Kismets is at 315 Crossgates Blvd. next to Kroger. Call 601-825-8380 to learn more or to order one of their signature catering trays for events, tailgating, church activities or other occasions.

315 Crossgates Boulevard Brandon, MS 39042 601.825.8380

Lunch Mon-Fri 11:00-1:30 Dinner Mon-Fri 5:00-9:00

Dine-In • Carry-Out • Catering

ALL NEW MENU!

Welcome To The Ride of Your Life We Make It Happen!

Weddings Birthday Parties Vacations www.executivelimoms.com

601.987.9426

1316 N. STATE STREET • JACKSON 601.987.3937

With The Most Reliable Luxury Transportation Service

1100 J.R. LYNCH STREET, SUITE 5 JACKSON, MS • 601.487.6812

Service Excellence with Southern Hospitality

1625 SIMPSON HWY 49 • MAGEE 601.849.2822

- ()

..

LUNCH BLUE PLATE SPECIAL $10 includes tax and drink

BUILD YOUR OWN BURGER

STARTING AT $10

DINNER SPECIALS

HOME STYLE ORIGINAL

FRESH VEGETABLES RIBEYE STEAK BITES

PLATTERS WITH 2 SIDES

STARTING AT $12

HAMBURGERS $9

HAPPY HOUR

HOMEMADE DESSERTS

MON - FRI 1 - 3:30

214 South State Street Downtown Jackson, Mississippi www.martinslounge.net • (601) 354-9712

jacksonfreepress.com

VIP- Executive- Private

21


CORNER STORE from page 18 "UILDING7HAT7E+NOW

C

ivic Economics conducted a study of 15 independent retailers and seven independent restaurants in Salt Lake City to compare local economic impact with four big-box retail chains (Target, Barnes & Noble, Home Depot and Office Max, and Target) and three national restaurant chains (Darden, McDonald’s, and P.F. Chang’s). Unsurprisingly, the study showed that the locally owned retailers return 52 percent of their revenue to the local economy, while national retailers contributed just 14 percent. The local restaurants returned an average of 79 percent of revenue locally, while chain restaurants only kept to 30 percent in town. Bottom line: Locally owned, independent businesses spend more locally on goods, labor and business-to-business services. SOURCE: HTTP://WWW.LOCALFIRST.ORG/IMAGES/STORIES/SLC-FINAL-IMPACT-STUDY-SERIES.PDF

.ATIONAL#HAINSVS)NDEPENDENT2ETAILERS .ATIONAL#HAINS

)NDEPENDENTS

0RO½TAND ,ABOR 0ROCUREMENT FOR)NTERNAL 5SE  0ROCUREMENT FOR2ESALE 

/RFDO5HFLUFXODWLRQRI5HYHQXH

September 4 - 10, 2013



22

and boutiques that cater to the business community are doing well there. “Any retail we get right now is going to be niche retail,â€? Gomez said. “We’ve had some success with a few jewelry stores and office supply stores‌ stores that cater to that 8-to-5 business crowd.â€? Gomez points to Carter Jewelers, which has been in the same location on High Street, on the edge of downtown, for 160 years. Unlike a startup, Carter has a clientele that travel from all over the state to purchase a product. “What I think has hurt the business downtown is the city has shackled us with some really high taxes,â€? Carter’s owner Jerry Lake said. “Taxes have to be passed on in the form of rent, and I don’t know how some of these business are paying it. The city has been great to us over the years. We’ve worked with different mayors and the police protection we’ve been provided has been wonderful; our only complaint is the taxes.â€? Lake paid $14,928 in taxes in 2012 at 711 High St., which has an appraised value of $486,120 and an assessed value of $72,918, according to public tax records. Gomez said DJP is banking on downtown’s eateries and entertainment spots to help bring people back downtown after dark.

#HARITABLE'IVING 

/RFDO5HFLUFXODWLRQRI5HYHQXH



Retail, he said, is more about daylight hours. “Our numbers just don’t mesh with what we’re looking at,� Gomez said. “We’re trying to grow our culture and restaurants and bars to give people a reason to come back after 5 p.m. That’s where we are focused right now. We are also trying to convince someone to open up a small corner grocery, so we can support that residential growth.� Some residents downtown say that, despite high residential occupancy rates, downtown can feel like a ghost town at night— perhaps due to many apartments owned or rented by absent or corporate tenants. Few residents, few customers for local drugstores, restaurants and gift shops at night. Gomez said the belief that downtown has a good deal of taken-but-unused housing isn’t “necessarily true.� He says entrepreneurs don’t want to take the risk. DJP, he said, is focused on one-on-one contact, looking for a local entrepreneur willing to take a chance and work out a deal with local government to get some tax relief for the first few years of operation. That way, he said, they will have time to figure out what they need to carry to get support from the local community before they hit a financial crunch and have to close.

One business that went that route was the Standard Life Bodega, which opened in November 2010, and closed in April 2012. “It’s tough when you are a local retailer, and you don’t have the buying power of a national company,� Gomez said. “We are just going to have to keep trying until we get a business that the local residents can support.� That is, don’t hope to wander into local quirky shops after happy hour soon like you can in Austin, Texas, or Athens, Ga. That’s not the focus, at least of Gomez’ group. ‘None of This Is Easy’ Other cities have successfully turned their downtown areas around, and Jackson could be the next one to follow suit—with the right focus, organization and local will. Mitchell said Jackson would probably benefit from a group she has worked closely with, the National Main Street Center, a non-profit based out of Washington, D.C., that has helped more than 2,000 communities reclaim their downtown area, creating $54 billion in investments and 450,000 jobs, according to the group. “It’s a subsidiary of the National Trust for Historic Preservation,� Mitchell said. “It’s worked in thousands of communities and has quite a successful track record. The way it works is a local organization gets created as a chapter of the Main Street Center, then organizers come in and work with the citizens in the community and civic leaders to come up with a decent formula for what to work on.� Mitchell said another step cities can take, and Jackson apparently is in the process of doing, is to improve the quality of the streets and the infrastructure underneath them. On top of the $10 million makeover to Capitol Street, Mayor Chokwe Lumumba proposed a budget last week that will pump an extra $22 million into public works, bringing the city’s total expenses on public works to a whopping $398 million for the coming year. “None of this is easy,� Mitchell said. “There is a lot of evidence now, through consumer surveys and things like that, that show there is a growing interest in independent business and in walking and riding bikes for transportation. When I got in this business, those things were in a downward spiral. Cities can capitalize on these larger trends, they just have to have community and civic leaders who are dedicated to making it work.� Jackson thought it had that in 1981. The potential was there, and still is. White puts it best: “I used to tell my brother Hal all the time that we would see the revitalization of downtown in our lifetimes,� he said. “It’s happening, it’s just extremely slow. I still believe it will get there. I just begin to question whether I will be alive to see it.� Comment at www.jfp.ms.

4OP2EASONSTO 3UPPORT,OCALLY /WNED"USINESSES ,OCAL#HARACTERAND0ROSPERITY ,QDQLQFUHDVLQJO\KRPRJHQL]HG ZRUOGFRPPXQLWLHVWKDWSUHVHUYH WKHLURQHRIDNLQGEXVLQHVVHV DQGGLVWLQFWLYHFKDUDFWHUKDYHDQ HFRQRPLFDGYDQWDJH #OMMUNITY7ELL "EING /RFDOO\RZQHGEXVLQHVVHVEXLOG VWURQJFRPPXQLWLHVE\VXVWDLQ LQJYLEUDQWWRZQFHQWHUVOLQNLQJ QHLJKERUVLQDZHERIHFRQRPLF DQGVRFLDOUHODWLRQVKLSVDQGFRQ WULEXWLQJWRORFDOFDXVHV ,OCAL$ECISION -AKING /RFDORZQHUVKLSHQVXUHVWKDWLP SRUWDQWGHFLVLRQVDUHPDGHORFDOO\ E\SHRSOHZKROLYHLQWKHFRPPX QLW\DQGZKRZLOOIHHOWKHLPSDFWV RIWKRVHGHFLVLRQV +EEPING$OLLARSINTHE,OCAL %CONOMY &RPSDUHGWRFKDLQVWRUHVORFDOO\ RZQHGEXVLQHVVHVUHF\FOHDPXFK ODUJHUVKDUHRIWKHLUUHYHQXHEDFN LQWRWKHORFDOHFRQRP\HQULFKLQJ WKHZKROHFRPPXQLW\ *OBAND7AGES /RFDOO\RZQHGEXVLQHVVHVFUHDWH PRUHMREVORFDOO\DQGLQVRPH VHFWRUVSURYLGHEHWWHUZDJHVDQG EHQH¿WVWKDQFKDLQVGR %NTREPRENEURSHIP (QWUHSUHQHXUVKLSIXHOV$PHULFDœV HFRQRPLFLQQRYDWLRQDQGSURVSHU LW\DQGVHUYHVDVDNH\PHDQVIRU IDPLOLHVWRPRYHRXWRIORZZDJH MREVDQGLQWRWKHPLGGOHFODVV 0UBLIC"ENE½TSAND#OSTS /RFDOVWRUHVLQWRZQFHQWHUV UHTXLUHFRPSDUDWLYHO\OLWWOHLQIUD VWUXFWXUHDQGPDNHPRUHHI¿FLHQW XVHRISXEOLFVHUYLFHVUHODWLYHWR ELJER[VWRUHVDQGVWULS VKRSSLQJPDOOV %NVIRONMENTAL3USTAINABILITY /RFDOVWRUHVKHOSWRVXVWDLQYL EUDQWFRPSDFWZDONDEOHWRZQ FHQWHUVZKLFKLQWXUQDUHHVVHQ WLDOWRUHGXFLQJVSUDZODXWRPR ELOHXVHKDELWDWORVVDQGDLUDQG ZDWHUSROOXWLRQ #OMPETITION $PDUNHWSODFHRIWHQVRIWKRX VDQGVRIVPDOOEXVLQHVVHVLVWKH EHVWZD\WRHQVXUHLQQRYDWLRQDQG ORZSULFHVRYHUWKHORQJWHUP 0RODUCT$IVERSITY $PXOWLWXGHRIVPDOOEXVLQHVVHV HDFKVHOHFWLQJSURGXFWVEDVHG QRWRQDQDWLRQDOVDOHVSODQEXW RQWKHLURZQLQWHUHVWVDQGWKH QHHGVRIWKHLUORFDOFXVWRPHUV JXDUDQWHHVDPXFKEURDGHUUDQJH RISURGXFWFKRLFHV SOURCE:WWW.ILSR.ORG


TRIP BURNS

Hitting the Lottery by R.L. Nave Chitoes African Deli 1700 Terry Road, 601-965-6161 chitoescaterinservice.webs.com

Rosemary Emmanuel brought her heritage to Jackson in the form of Chitoes African Deli.

I

COURTESY MIKE UPTON

n 2004, Rosemary Emmanuel hit the lottery. The U.S. Department of State’s diversity visa program, which selects recipients on a lottery system, selected Emmanuel and her family from Kaduna State in north-central Nigeria. Emmanuel, who taught 12th-grade science in Nigeria, believed America offered better educational opportunities for her children. With her husband, Emmanuel Nwokocha (Rosemary uses her husband’s first name as her surname), already living in Mississippi, Rosemary moved to south Jackson with five of their children (two of the children currently live in Nigeria). Six years later, the couple opened Chitoes African Deli.

“I wanted to have my own business, and I love cooking for other people,” Emmanuel says. Chitoes is Mississippi’s only restaurant specializing in West African cuisine. Emmanuel’s favorite meal is a staple of West African diets: fufu and soup. She makes fufu made by adding hot water to yams and beating them into a doughy mixture with a consistency similar to mashed potatoes. Traditionally, diners eat fufu with soups and stews such as egusi, which contains okra or other vegetables, spices and sometimes meats. Those uninitiated to West African food typically start off with a dish of jollof rice, plantains and fried chicken wings. Emmanuel keeps a few American comfort foods on the menu such as French fries, and chicken wings, tenders and nuggets. Some people have suggested that she add more American favorites like cheeseburgers to the menu to

entice less adventurous locals. Emmanuel resists, refusing to sell anything in Chitoes that she would not serve to her own family. “I don’t eat burgers. I don’t eat pizza. Why should I put it (on the menu)?” she asks. “Our food is good, has good taste. It’s healthy. Since I was born, I’ve been eating the food. It’s not food that if you eat it, you’ll have a big stomach. That’s what people don’t understand. One burger will give you more calories than fufu and soup.” It should be an easy sell in today’s increasingly health-conscious culture, but business is not always as robust as Emmanuel would like. When her family first arrived from Nigeria in 2004, Emmanuel said businesses were thriving on her section of Terry Road and along U.S. Highway 80. Since Chitoes opened, the national recession has hit many local businesses hard.

Some shut down, while others limp along and are barely hanging on. “This is the only West African restaurant in Mississippi, and it’s not doing well,” she says, resignation in her voice. “Sometimes I feel that should shut it down and go find a job, but I know that if I shut it down, a lot of people would not be happy with me.” Emmanuel is committed to keeping her business in Jackson despite advice she’s received to abandon the capital city. She is scouting locations closer to the areas many of her customers come from— Fondren, downtown or near the big hospitals on the State Street/Lakeland Drive corridor—for Chitoes’ unique food. “Jackson is a good place—no matter what they say on the news,” she said. Chitoes African Deli is open Tuesday through Saturday from 11 a.m. to 8 p.m. Visit chitoescaterinservice.webs.com for a menu and additional information.

Fearful and Fun by Briana Robinson

Mike Upton opened the first Upton Tire Pros store in June 1989. Now, he has four locations.

M

ike Upton’s business came from a love for cars and a desire to better his community. Upton, who has never worked on cars for a living—and promises that no one should ever want him to—respects those with the gift. “These guys who (work on the vehicles) have a great talent, and they’re not valued as much as they should be in general, because they really work real hard,” Upton says. “This stuff almost comes to them intuitively; they can just look at a car or a part and know how to fix it.” While he can’t work on cars, Upton is a talented businessman. He opened Upton Tire Pros to provide the community with

quality tires and vehicle services nearly 25 years ago, and now Upton has four locations in the metro area: Brandon, Madison, north Jackson and Flowood. In 1977, he left college to marry Denise, his wife of 38 years now. Upton started working with Firestone Complete Auto Care as a sales representative. He easily moved up the ladder to assistant manager, and eventually the company promoted Upton to manager of its Vicksburg location, a job he held for about 15 years. Upton wanted to try working for himself and noticed a need in Brandon. “There was just an opportunity there. They didn’t have a nice, modern tire store in Brandon back in ’89,” he says. He opened his first Upton Tire Pros store there in June of that year. “It was exhilarating, which can be both fearful and fun—and it was a little of

both,” Upton says about opening his new business. “We had some good people working for us. I work real hard morning, noon and night to keep it going, and it worked out real well.” Several years later, Upton noticed a similar situation in Madison where he lives. He opened up shop there in 2000, and it gets the most business of his four locations. Upton continued to expand by buying a competitor’s property in Jackson in 2003, and he opened his newest store in 2007 on Lakeland Drive in Flowood. “By size, it’s our biggest store, and we have big hopes for it,” Upton says. Upton Tire Pros offers full auto services, from oil changes to engine replacements, and sells tire brands such as Bridgestone, Continental, Michelin, General and Goodyear. Upton says the business pretty evenly splits between ser-

vicing cars and selling tires. With four locations, Upton can’t be everywhere at once. To oversee operations for the stores, he employs four store managers and a general manager to oversee them. Despite this, he stays accessible and is fully involved with his company. “I’m easy to get a hold of if you need me in case something comes up—and it does in our business,” Upton says. “I make sure we’re doing the right thing for our customers.” Upton Tire Pros strives to be forward thinking with technology. Not only does each location have computers available for customers to use while waiting, but customers can also go online to book appointments, view prices and information on previously received services. All Upton Tire Pros locations are open Monday through Friday 7 a.m. to 5:30 p.m., and Saturdays 7 a.m. to 1 p.m.

jacksonfreepress.com

Upton Tire Pros 6371 Interstate 55 N., Jackson, 601-977-8473 210 Orleans Way, Brandon, 601-825-8473 5312 Lakeland Drive, Flowood, 601-919-8473 2019 Strawberry Hill Drive, Madison, 601-856-8473 uptontirepros.com

23


TRIP BURNS

CORNER STORE from page 23 January 2014 Wedding Announcement

An Honest Attitude

Don’t miss out the opportunity to be have your nuptials featured in this inaugural issue of Hitched. This glossy edition of Hitched will be a keepsake for you, your family and friends.

by Kathleen M. Mitchell

*All payments and materials due by October 31

W /

Two Page Announcement

with Andrew McLarty

Pub Quiz

F /

Larry Waters Duo S /

650-700 word announcement plus six photos.

Pete Dawson Band

One Page Announcement

Karaoke w/ Matt

M /

T /

Open Mic

with Jason Bailey

Work. Live. Play. Prosper.

X

$600 325-350 word announcement plus three photos.

Half Page Announcement

Visit Fenian’s

Taps Pub Stage & Vendor Tent at CelticFest!

September 4 - 10, 2013

$375

24

225-250 word announcement plus one photo. For more information and to submit your information visit www.boomjackson.com/ hitched.html

Debra Griffin brings lessons from nowclosed coffee shops to downtown’s The Coffee Roastery.

T /

Nine-8ths Irish

$1,100

The Coffee Roastery 308 E. Pearl St. 601-949-6994 thecoffeeroastery.com

Friday Sept. 6th thru

Sunday 8th

D

ebra Griffin has an honest attitude when it comes to past business failures. After two decades as a hospital administrator, Griffin decided to open The Coffee Roastery in 2002 in the then-just-blossoming Dogwood area in Flowood. Although demand was high, the business ultimately wasn’t successful. “I did it as a sole owner who had had some success in health care but maybe underestimated what it took to run a retail business,” she says. “There was money to be made, but I had business flaws: My space was too large; I was too trusting with employees.” That original coffee shop closed in 2007 after five years, when the lease was up. “I was grateful for it. I exhaled,” Griffin says. “I’ve learned when something doesn’t work out, I don’t focus on it. It’s just yesterday. The milk is spilled. Get a towel, wipe it up; try to pour another glass or get something else.” The experience helped Griffin realize that she wanted more independence in her work. When Humphreys County Memorial Hospital terminated her from an administrator position in 2007, she decided to pursue other venues of employment. Although she hadn’t necessarily plan to open another coffee shop, developer Ted Duckworth reached out to her, looking to add something to his downtown Electric 308 Building (308 E. Pearl St.). “He knew my business in Dogwood and wanted a coffee shop in this space,” Griffin says. “To tell the truth, he helped me to get this space open.” These days, the Coffee Roastery remains as dedicated to a quality

product as it was in its previous incarnations, albeit at a lower volume of production. The shop roasts organic Camaroon Boyo beans onsite, as well as a decaf beans. “I would say the reason I am committed to coffee is because I appreciate a good product,” Griffin says. “The reason I roast is because I can control the inventory levels, but also the inventory freshness. Coffee is like a produce: Anything that has been on the shelf for a certain amount of time, the characteristics and flavor profiles are going to deteriorate.” The Coffee Roastery remains a low-profit endeavor, but it’s also a low-cost one. Griffin has no plans to expand, but rather wants the coffee shop to become a part of the downtown ecology. “My hope for it is to let it marinate and get integrated into the local downtown culture,” she says. Griffin says the most important thing she’s learned is to balance personal enthusiasm with the professional business necessities. “I think people that want to do something, they should move forward on it. The business plan is so important—it’s a blueprint, and if you don’t really understand your blueprint, you’ve got hodgepodge,” she says. “I think some people get jaded where they want to be the sole proprietor and get the profit. But I say: You want to be the sole proprietor, you’ll have to bring up all the capital. So I urge people to partnerships, because there are strengths and weaknesses in various people. What you can’t bring to the table, someone else can. And spend a little money with an attorney and get a really good agreement.” Although she is the sole owner of the store, Griffin’s day-to-day employment remains in the health-care world. She is an independent healthcare consultant and co-owns Physician Hospice Care.


WELLNESS p 27 FOOD p 28

Raising Kids Au Naturale

T

onight after dinner, dishes still stacked unwashed in the sink, my son put on his socks and his striped rain boots. He found the dog’s leash, and then we went for a walk in the rain—one mama, one dog and one naked young boy in a cool summer rain. I believe in fresh air and sunshine and puddles and dirt smudged on play clothes or all over bare skin. So often as a parent, it is all too easy to lose our playfulness and sense of adventure, to slip into a more task-oriented groove, trying to stay on top of the endless cycle of dishes and laundry and homework and bills and all of these other admittedly essential things amidst the relative chaos of living with tiny humans. It is easy to get sucked into the world of cartoons and apps and the latest Disney movie. Sometimes, it is important to just relax, unwind and be fully present with kids in nature—for the sake of everyone’s physical and mental health. If you’ve been stuck inside all summer, plastered to the television and air conditioning, use the gradually cooling weather as an excuse for a nighttime neighborhood walk with the family, a romp in the park closest to your house or an all new outdoor adventure for the whole family.

Mayes Lake is a great place to unplug with kids. It offers proximity to Jackson and relative quiet.

(OWTO%NCOURAGE.ATURE!PPRECIATIONAT(OME

• • • • • "OOKSFOR+IDS

´7KH<RXQJ%LUGHU¡V *XLGHWR%LUGVRI 1RUWK$PHULFDÂľE\ %LOO7KRPSVRQ,,, +RXJKWRQ0LIĂ&#x20AC;LQ+DU FRXUW

´1DWXUH¡V$UW%R[¾E\ /DXUD&0DUWLQ 6WRUH\ 3XEOLVKLQJ 

´$7UHHIRU$OO6HDVRQV¾ E\5RELQ%HUQDUG 1DWLRQDO*HRJUDSKLF &KLOGUHQœV%RRNV 

"OOKSFOR!DULTS

´,/RYH'LUW$FWLYLWLHV WR+HOS<RXDQG<RXU.LGV 'LVFRYHUWKH:RQGHUVRI 1DWXUH¾E\-HQQLIHU:DUG 5RRVW%RRNV

´7KH1DWXUH3ULQFLSOH 5HFRQQHFWLQJZLWK/LIHLQ D9LUWXDO$JH¾E\5LFKDUG /RXY $OJRQTXLQ%RRNV 

´+LNLQJ0LVVLVVLSSL$ *XLGHWR7UDLOVDQG 1DWXUDO$UHDV¾E\+HOHQ 0F*LQQLV 8QLYHUVLW\3UHVV RI0LVVLVVLSSL

0ETRI½ED&OREST3CAVENGER(UNT â&#x20AC;˘ a train caboose â&#x20AC;˘ a bench made from petrified wood â&#x20AC;˘ giant shark jaws â&#x20AC;˘ a different rock for every color of the rainbow â&#x20AC;˘ petrified wood that looks reptilian â&#x20AC;˘ a little cave where an animal might live â&#x20AC;˘ Hinds County petrified wood â&#x20AC;˘ a wild animal

(IKING0ACK,IST

SLFQLFPHDORUVQDFNV ZDWHU EXJVSUD\ VXQVFUHHQ VRFNVDQGVWXUG\VKRHV KDW VXQJODVVHV FDPHUD DJDWKHULQJEDVNHW IROORZSRVWHG UXOHVDERXWFROOHFWLQJDQGUHPRY LQJVSHFLPHQVIURPDQ\JLYHQ SURSHUW\

â&#x20AC;˘ ROGWRZHOVDQGFKDQJHVRIFORWKLQJ WROHDYHLQWKHFDUMXVWLQFDVH â&#x20AC;˘ RSWLRQDOÂżHOGJXLGHPDSV â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

2OCKY3PRINGS3CAVENGER(UNT â&#x20AC;˘ an old graveyard â&#x20AC;˘ a snake (donâ&#x20AC;&#x2122;t get too close!) â&#x20AC;˘ a stone-shaped like a heart â&#x20AC;˘ an old-timey refrigerator â&#x20AC;˘ a white sand beach â&#x20AC;˘ a fish â&#x20AC;˘ leaves from six different kinds of trees â&#x20AC;˘ a great picnic spot

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

Take lots of walks. Stop to pick up pine cones, examine spider webs, and listen to the mockingbirds. Keep a field guide and binoculars on a table in view of the bird feeder. Dress the kids in clothes they can get dirty, or let them run around in the yard in their underwear or a bathing suit. Grow a garden together. Go on a family camping trip. Dry your laundry on a clothesline. Construct â&#x20AC;&#x153;fairy housesâ&#x20AC;? from bark and stones and acorns. Try out and rate all the different local parks and playgrounds according to your familyâ&#x20AC;&#x2122;s needs and wants turn your yard into a wildlife habitat. Subscribe to age-appropriate nature magazines such as Ranger Rick. Walk barefoot in the grass. Recycle together. Put on pajamas and stay up late to watch a meteor Mayes Lake is a great place to shower in sleeping bags. unplug with kids, with both close proximity and relative quiet in Splash in mud puddles with your kids. its favor. Take neighborhood night walks with a flashlight. Build birdfeeders and birdhouses out of wood, milk jugs, pine cones or whatever materials are available. Check out library books about their favorite plants and animals.

-AYES,AKE,E&LEUR´S"LUFF 3CAVENGER(UNT â&#x20AC;˘ a bridge â&#x20AC;˘ four different bird species â&#x20AC;˘ an animal that lives in the water â&#x20AC;˘ animal tracks â&#x20AC;˘ poison ivy â&#x20AC;˘ a place where a squirrel might live â&#x20AC;˘ a boat â&#x20AC;˘ a science museum

-YNELLE'ARDENS3CAVENGER(UNT â&#x20AC;˘ a shady bench â&#x20AC;˘ three turtles â&#x20AC;˘ a fountain â&#x20AC;˘ a lady with a beautiful necklace â&#x20AC;˘ a swing â&#x20AC;˘ pink flowers, purple flowers and white flowers â&#x20AC;˘ a tree to climb â&#x20AC;˘ a fireplace

jacksonfreepress.com

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

KELLY BRYAN SMITH

KELLY BRYAN SMITH

by Kelly Bryan Smith

25


Kickboxing Fitness Class

K AR DI O

BY KIMBERLY

NOW

Every Monday at 6:30 $30 for 8 Weeks OR $5 Drop In

398 Hwy. 51 • Ridgeland, MS (601) 853-3299 • www.villagebeads.com

605 Duling Ave. Jackson, MS

601.884.0316

Don’t Just Learn To Play, Learn To Rock! LESSONS FOR BANJO, MANDOLIN, DRUMS, BASS, GUITAR, PIANO & VOICE.

Start Rocking Today 601.362.0313 607 Fondren Place | Jackson, MS | www.fondrenguitars.com Buy

Sell

Trade

Consign

Lessons

Repairs

SCHOOL IS BACK

FALL INTO

FITNESS

Educators and students receive no enrollment fee and first month free with school ID 901 Lakeland Place, Suite #10 Flowood, MS (in front of Walmart) flowood@anytimefitness.com

601.992.3488 2155 Highway 18, Suite E

Brandon, MS (across from Home Depot) brandon@anytimefitness.com

September 4 - 10, 2013

601-706-4605

26

4924 I-55 North, Suite #107 Jackson, MS (in front of Kroger) jacksonms@anytimefitness.com

601-321-9465 www.anytimefitness.com facebook.com/rainbowcoop

twitter.com/rainbowcoop

Voted One of the Best Places to Work Out Best of Jackson 2010-2012


LIFE&STYLE | wellness Danielleâ&#x20AC;&#x2122;s Healthy Tips

Leap of Faith

Â&#x2021;$FFHSWWKHIDFWWKDW\RXZLOOKDYHKDUGGD\V²LWGRHVQÂśWPDNH \RXDIDLOXUH3LFNEDFNXSDQGVWDUWRYHUWKHQH[WGD\²DOZD\V NHHSPRYLQJIRUZDUG

I

LE W NIEL Y DA RTES U O C

ELLS

t is usually our challenges in life that lead to our biggest accomplishments. Danielle Wells, 27, is a testament to this fact. Born in Jackson and raised in Clinton, Wells struggled with her weight from an early age. She was an only child until she was 9, spending most of her time with her mother while her dad deployed overseas with the navy. â&#x20AC;&#x153;I always ran to food. It didnâ&#x20AC;&#x2122;t become a problem for me until high school, and I started seeing that I was a little bit heavier than most other girls,â&#x20AC;? she says. At her heaviest, Wells tipped the scales at 330 pounds. As a singer, she had hopes of joining the show choir at her high school but didnâ&#x20AC;&#x2122;t see that dream realized. â&#x20AC;&#x153;I was upset about it. I love to sing, and I couldnâ&#x20AC;&#x2122;t be a part of the show choir because I was heavy,â&#x20AC;? Wells says, adding that the show choir girls all had a certain look, and no girl larger than the average size had been a member. â&#x20AC;&#x153;I made up in my mind that I needed to lose weight. But it wasnâ&#x20AC;&#x2122;t until after I had my daughter that I looked in the mirror and said, â&#x20AC;&#x2DC;Iâ&#x20AC;&#x2122;ve got to do something and quickly.â&#x20AC;&#x2122;â&#x20AC;? Since the beginning of her weight-loss journey, which started in late 2009, Wells has lost a total of 147.5 pounds. Unfortunately, she has received some negative criticism with people accusing her of having had surgery or using diet pills. â&#x20AC;&#x153;My weight loss has been completely natural. I have done Zumba and changed my diet,â&#x20AC;? she says.

Danielleâ&#x20AC;&#x2122;s Day AM²)ORRUH[HUFLVHV PLQXWHVRIDEGRPLQDODQGOHJH[HUFLVHV  Âł,GR WKHVHH[HUFLVHV DVDZD\WRUDLVHP\PHWDEROLVP´'DQLHOOHVD\VÂł,DOZD\V GULQNDERWWOHRIFROGZDWHUDVVRRQDVP\IHHWKLWWKHĂ&#x20AC;RRU´ "EFOREAM²%UHDNIDVWLVHLWKHUDQHJJZKLWHRPHOHWZLWKDWHDVSRRQRIVDOVD RDWPHDOZLWKDSLHFHRIIUXLW XVXDOO\DEDQDQD RUDIUXLWVPRRWKLHZLWKDGGHGSURWHLQ SRZGHU6KHDOVRKDVDFXSRIEODFNFRIIHHVZHHWHQHGZLWKRQH6SOHQGDSDFNHW AMORNOON²/XQFKLVÂżVK EDNHGRUEURLOHG DQGYHJHWDEOHV,IVKHLVVKRUW RQWLPH:HOOVJRHVIRUDKDOIVDODGIURP1HZNÂśV(DWHU\ZLWKYLQDLJUHWWHRUD:HLJKW :DWFKHUV6PDUW2QHVIUR]HQPHDO .OLATERTHANPM²'LQQHULVDQ\W\SHRIOHDQPHDWZLWKYHJHWDEOHV:KHQVKH GRHVQÂśWFRRNVKHZLOOKDYHDLQFKWXUNH\VXEVDQGZLFK QRFKHHVHRUFRQGLPHQWV D VDODGZLWKDYLQDLJUHWWHGUHVVLQJRUDSURWHLQVKDNH %VERYTWOHOURS LQEHWZHHQPHDOV ²6QDFNVDUHPDLQO\IUXLWRUSRSFRUQVWULQJ FKHHVHRU\RJXUWZLWKJUDQROD

Danielleâ&#x20AC;&#x2122;s Top 5 Workout Songs

Danielleâ&#x20AC;&#x2122;s Healthy Food Swaps

Zumba with Danielle %DSWLVW+HDOWKSOH[ &OLQWRQ3DUNZD\ &OLQWRQ  0RQGD\ DWSP7XHVGD\ DWSPDQGVRPH 6DWXUGD\VDW DP <0&$ /LQGDOH 6W&OLQWRQ  :HGQHV GD\DWSPDQG )ULGD\DWSP %ULFNKRXVH&DUGLR &OXE 7RS6W 6XLWH+)ORZRRG   7KXUVGD\DWSP

Danielleâ&#x20AC;&#x2122;s Favorite Recipe Baked Tilapia and Asparagus 4-ounce tilapia filet, per person 1 lemon, sliced 1 bunch of thin asparagus spears, trimmed and rinsed Lemon-pepper seasoning

Extra-virgin olive oil Black pepper Sea salt Water

Rinse and pat dry tilapia filets. Preheat oven to 350 degrees. Place tilapia in baking dish, sprinkle with seasoning and place a slice of lemon on top. Add a little water to the bottom of the baking dish and cover with foil. Bake in oven for 12 minutes or until fish flakes easily with a fork. While the fish is baking, boil asparagus for five minutes on medium-high heat. Remove from water and spread out on a baking sheet. Drizzle with a little olive oil, and add black pepper and a pinch of sea salt. Bake for five minutes in the same oven as the fish at 350 degrees until asparagus is fork tender.

jacksonfreepress.com

by ShaWanda Jacome

Â&#x2021;6WDUWDVXSSRUWV\VWHP3HRSOHFDQEHQHJDWLYH%HVXUHWR More than half of Wellsâ&#x20AC;&#x2122; weight loss VXUURXQG\RXUVHOIZLWKSRVLWLYHSHRSOH:HLJKWORVVLVQRWMXVW came after she began doing Zumba, after her SK\VLFDOLWLVDPHQWDODQGHPRWLRQDOFKDQJHDVZHOO aunt introduced her to it. Â&#x2021;/HWJRRIWKHHDV\WKLQJVOLNHVRGD5HPHPEHUFRQYHQLHQFH â&#x20AC;&#x153;I had never heard of it. I had no VWRUHVKDYHQRWKLQJKHDOWK\ idea what it was. (My aunt) said â&#x20AC;&#x2DC;Latin,â&#x20AC;&#x2122; Â&#x2021;1HYHUJRJURFHU\VKRSSLQJZKHQ\RXDUHKXQJU\:KHQ\RX and I said, â&#x20AC;&#x2DC;Woman, are you crazy? I PDNHODVWPLQXWHGHFLVLRQVDERXWIRRG\RXDUHPRUHOLNHO\WR cannot salsa. I cannot do any of EHWHPSWHGWRHDWDQ\WKLQJWKDWORRNVJRRG that. Thatâ&#x20AC;&#x2122;s not me,â&#x20AC;&#x2122;â&#x20AC;? she says. Â&#x2021;:DWHUZDWHUZDWHUDOOGD\ORQJ'DQLHOOHGULQNVDWOHDVW Twenty minutes into RXQFHVRIZDWHUGDLO\ her first class, Wells was Â&#x2021;&RQVLGHUDGHWR['DQLHOOHGHWR[HVHYHU\WKUHHPRQWKVÂł2QFH \RXJHWDOOWKDWEDGVWXIIRXWRI\RXUERG\LWÂśVDPD]LQJKRZ hooked and became PXFKEHWWHU\RXIHHO´VKHVD\V&KHFNZLWK\RXUGRFWRUEHIRUH a self-proclaimed JRLQJWKURXJKDGHWR[ â&#x20AC;&#x153;Zumba beast.â&#x20AC;? Wells works hard to live what she teaches. She knows that people, including her 8-year-old daughter, are watching her.  'DQLHOOHLVDGDPDQWWKDWKHDOWK\ZHLJKWORVVDQGZHLJKW â&#x20AC;&#x153;I didnâ&#x20AC;&#x2122;t want her to be PDLQWHQDQFHLVSHUFHQWGLHWDQGSHUFHQWH[HUFLVH6KHMXVW like me. I didnâ&#x20AC;&#x2122;t want her to be FHOHEUDWHGKHURQH\HDUDQQLYHUVDU\DVD=XPEDLQVWUXFWRU7KH overweight. I didnâ&#x20AC;&#x2122;t want her to /DWLQEDVHGGDQFHÂżWQHVVSURJUDPLVKHUJRWRH[HUFLVHUHJLPHQ go through what I went through,â&#x20AC;? Â&#x2021;Âł/LPER´E\'DGG\<DQNHH she says. Â&#x2021;Âł)HHO7KLV0RPHQW´E\3LWEXOOIHDWXULQJ&KULVWLQD$JXLOHUD People look to her for motivaÂ&#x2021;Âł3DUW\-XPSLQ´E\5.HOO\ tion every dayâ&#x20AC;&#x201D;whether sheâ&#x20AC;&#x2122;s at the Â&#x2021;Âł9LYLU0L9LGD´E\0DUF$QWKRQ\ gym or her full-time job as a certified Â&#x2021;Âł0U)HWH´E\0DFKHO0RQWDQR dental assistant at Endodontic Associates in Ridgeland or eating outâ&#x20AC;&#x201D;so she tries to be an example everywhere. She admits that she still has bad days because everyone makes Â&#x2021;,QVWHDGRIDIXOOJODVVRIZLQHPDNHDZLQHVSULW]HUZLWKKDOIZLQH mistakes. But she never gives up DQGKDOIVHOW]HU and encourages others to not give Â&#x2021;,QVWHDGRIUHJXODUSHDQXWEXWWHUWU\SEE\%HOO3ODQWDWLRQ,QWZR WDEOHVSRRQVWKLVSHDQXWEXWWHUSRZGHUKDVFDORULHVFDORULHVIURPIDW up, either. DQGJUDPVRIVDWXUDWHGIDWFRPSDUHGWRWUDGLWLRQDOSHDQXWEXWWHUWKDWKDV â&#x20AC;&#x153;The only thing that sepaFDORULHVFDORULHVIURPIDWDQGJUDPVRIVDWXUDWHGIDWIRUWKHVDPH rates us from change is fearâ&#x20AC;&#x201D; VHUYLQJVL]H our â&#x20AC;&#x2DC;betterâ&#x20AC;&#x2122; is on the other side Â&#x2021;,QVWHDGRI6NLWWOHVWU\IUR]HQJUDSHV of fear. Once you take that Â&#x2021;,QVWHDGRIIU\LQJÂżVKWU\SDQVHDULQJ Â&#x2021;,QVWHDGRIZKLWHULFHRUZKLWHSDVWDWU\EURZQULFHDQGZKROHZKHDWSDVWD leap of faith, thatâ&#x20AC;&#x2122;s when that change happens,â&#x20AC;? she says.

27


LIFE&STYLE | food

Follow the Jug by Brinda Willis

TRIP BURNS

Andrew Kehoe says the pub hopes to fill a niche in the craft-beer community.

TRIP BURNS

T

he owners and managers of Fondren Pubic worked a long time to make the bar a hotspot for a unique blend of young professionals and Fondren locals, and it paid off with Monday night’s grand opening. Patrons packed the house—choosing from an extensive beer, wine and spirit selection, playing bar games and watching Monday Night Football on any of the several flat-screen TVs. Some chose to play on one of the handbuilt bar games, while others mingled against a long wall covered in bold beerrelated text. The pub is the brainchild of a small group of Jackson investors who adopted #followthejug as the catchphrase for the establishment. “The phrase refers to a small jug—a growler—that is refillable with any kind of the 24 beers on tap that leads our new offerings of craft beer,” says Andrew Kehoe, the general manager of Fondren Public. The Growler costs $5, and refills start at $12. The jug is sealed onsite so patrons can enjoy it later. Fondren Public is nestled between

The owners of Fondren Public spent much of the summer renovating the space to a hip, inviting atmosphere, complete with an outdoor space and games such as bocce ball and shuffleboard.

the circa URBAN ARTISAN LIVING boutique and the Zoubir Tabout Antiques & Interieurs store in the Rainbow Co-Op shopping center on Old Canton Road. It opened Sept. 2, to the delight of beer lovers from Jackson and the surrounding areas. “We are looking forward to offering something that Jackson presently doesn’t have with respect to craft beer. We’re planning Fondren Public to be informative and interactive with an up-and-coming community like Fondren to grow and increase knowledge of craft beer of beer drinkers,” Kehoe says. “We also have a new, and possibly one of the only, bocce (ball) courts located outside to attract people who want to have fun while enjoying a great brew.” Bocce, an Italian game, is similar to

lawn bowling, but players throw the ball into the air in an underarm motion or roll it. Teams are made up of two to four members. Players must score seven to 13 points. The team that lands a sphericalshaped ball closer to the Jack, a smaller ball called a boccino, wins. Additionally, Fondren Public offers 40 to 50 specialty bottled beers such as Yazoo Dos Perros, Sam Adams Boston Lager and NOLA Brown, as well as five beer cocktails with names like Mississippi Mule, Dark & Stormy, and Black Velvet. The pub features nine different types of wines and eight domestic beers. The food menu boasts generous numbers of snacks, sliders, salads and “big bites.” Specialty snacks include boiled peanuts flavored with cumin, sweet heat and cayenne. For those of us who like it hot,

Call Us For All Of Your Catering Needs! BBQ Party Pack Serves 10 - $44.95

September 4 - 10, 2013

(2 lbs pork/beef or 2 whole chickens; 2 pints beans, 2 pints slaw, 6 slices Texas toast/10 buns)

28

there’s fried pepper jack cheese with candied bacon and sweet Tabasco glaze. The slider selection includes beef, chicken or pulled pork. Herbivores can try the veggie slider stuffed with eggplant, sautéed onions and a truffle white-bean spread. For those with heartier appetites, Fondren Public’s kitchen manager Matt Roberts created “big bites,” which include a Cajun corn dog, BLT, and a fried chicken and waffle taco served with a honey glaze. Other treats include an arugula salad and tomato salad drizzled with a choice of ranch dressing or homemade vinaigrette. For more information on Fondren Public (2765 Old Canton Road), visit its Facebook page or call 769-216-2589. For more photos from the grand opening, visit jfp.ms/fondrenpublicopening.

Skip the Lunch Time Hassle. Steve’s Downtown Delivers.

Feed 8 to 18 with Steve’s Sandwich Trays $50 - $73

Rib Party Pack Serves 4 - $52.15 (2 whole ribs, 1 pint of baked beans, 1 pint of slaw, 1 pint of potato salad, 4 slices of Texas toast)

Where Raul Knows Everyone’s Name -Best Barbecue in Jackson- 2003 • 2006 2008 • 2009 • 2010 • 2011 • 2012 1491 Canton Mart Rd. • Jackson • 601.956.7079

2 Locations

125 S. Congress St. • 601-969-1119 200 S. Lamar Ave. • 601-714-5683

for catering

call 601-969-1119

www.stevesdowntown.com


                           

    

MEDITERRANEAN GRILL & GROCERY 730 Lakeland Dr. â&#x20AC;¢ Jackson, MS Tel: 601-366-3613 or 601-366-6033 Fax: 601-366-7122 DINE-IN OR TAKE-OUT! Sun-Thurs: 11am - 10pm Fri-Sat: 11am - 11pm VISIT OUR OTHER LOCATION 163 Ridge Way - Ste. E â&#x20AC;¢ Flowood, MS Tel: 601-922-7338 â&#x20AC;¢ Fax: 601-992-7339

Check Out Our

WE DELIVER! Fondren / Belhaven / UMC area WE ALSO CATER! VISIT OUR GROCERY STORE NEXT DOOR.

Specials & Offers

Facebook Page For

2 LOCATIONS FOR THE FOOD YOU LOVE

10% OFF lunch & dinner â&#x20AC;¢ with this ad

2481 Lakeland Drive | Flowood 601.932.4070

Lunch Buffet: Mon - Fri â&#x20AC;¢ 11am - 2pm Sat & Sun â&#x20AC;¢ 11.30am - 2.30pm Dinner: Mon - Sun â&#x20AC;¢ 5 - 10pm

900 Suite E. County Line Rd. Former AJâ&#x20AC;&#x2122;s | 769.251.2657

862 Avery Blvd â&#x20AC;¢ Ridgeland, MS 601-991-3110 â&#x20AC;¢ ruchiindia.com

jacksonfreepress.com

Danny

29


JFPmenus.com Paid advertising section. Call 601-362-6121 x11 to list your restaurant

AMERICAN/SOUTHERN CUISINE Primos Cafe (2323 Lakeland 601-936-3398/ 515 Lake Harbour 601-898-3400) A Jackson institution for breakfast, blue-plates, catfish, burgers, prime rib, oysters, po-boys & wraps. Famous bakery! Two Sisters Kitchen (707 N. Congress St. 601-353-1180) Lunch. Mon-Fri, Sun. Koinonia (136 Adams St. 601-960-3008) Coffeehouse plus lunch and more! Broad Street Bakery (4465 Interstate 55 N. 601-362-2900) Hot breakfast,coffee espresso drinks, fresh breads and pastries, gourmet deli sandwiches.

PIZZA 904 Basil’s (904 E. Fortification, 601-352-2002) Creative pizzas, italian food, burgers and much more in a casual-dining atmosphere in the heart of Belhaven. Sal & Mookie’s (565 Taylor St. 601-368-1919) Pizzas of all kinds plus pasta, eggplant parmesan and the fried ravioli. Bring the kids for ice cream! Mellow Mushroom (275 Dogwood Blvd, Flowood, 601-992-7499) More than just great pizza and beer. Open Monday - Friday 11-10 and Saturday 11-11.

ITALIAN BRAVO! (4500 Interstate 55 N., Jackson, 601-982-8111) Award-winning wine list, Jackson’s see-and-be-seen casual/upscale dining. Cerami’s (5417 Lakeland Drive, Flowood, 601-919-28298) Southern-style Italian cuisine features their signature Shrimp Cerami.

STEAK, SEAFOOD & FINE DINING

Eslava’s Grille (2481 Lakeland Drive, 601-932-4070) Latin-influenced dishes like ceviche in addition to pastas, steaks, salads and other signature seafood dishes. Huntington Grille (1001 East County Line Road, Jackson Hilton, 601-957-2800) Mississippi fine dining features seafood, crayfish, steaks, fried green tomatoes, shrimp & grits, pizzas and more. Que Sera Sera (2801 N State Street 601-981-2520) Authentic cajun cuisine, excellent seafood and award winning gumbo; come enjoy it all this summer on the patio. Rocky’s (1046 Warrington Road, Vicksburg 601-634-0100) Enjoy choice steaks, fresh seafood, great salads, hearty sandwiches. The Penguin (1100 John R Lynch Street, 769.251.5222) Fine dining at its best.

MEDITERRANEAN/GREEK Aladdin Mediterranean Grill (730 Lakeland Drive 601-366-6033) Delicious authentic dishes including lamb dishes, hummus, falafel, kababs, shwarma. Vasilios Greek Cusine (828 Hwy 51, Madison 601-853-0028) Authentic greek cuisine since 1994, specializing in gyros, greek salads, baklava cheesecake & fresh daily seafood.

BARBEQUE

$10 Daily Lunch Specials Happy Hour Everyday 4p-7p

Late Night Happy Hour Sun - Thur, 10p - 12a

Daily Lunch Specials • Sept 4 - 6

Follow Us

Includes: Dessert, Iced Tea, & tax. Take Out Orders are welcomed.

Wed | Pulled Pork BBQ Sandwich or Country Fried Steak Thu | Chicken & Bowtie Pasta or Corned Beef & Cabbage Fri | Catfish Parmesan or Grilled Shoulder Steak

601.978.1839

September 4 - 10, 2013

6270 Old Canton Rd. Jackson, MS 39211

30

Join us for Happy Hour

4654 McWillie Dr. Jackson, MS Monday - Thursday: 10AM - 9PM Friday & Saturday: 10AM - 10PM Sunday: CLOSED

BBQ Pulled

NEW Chicken www.coolals.com

Cool Al’s

CoolAlsJxn

601.713.3020

Welcome Back Students!

Best of Jackson 2008 - 2013

In Town & in the USA

Visit www.ceramis.net for specials & hours.

-Best of Jackson 2003-2013-

5417 Lakeland Drive ~ Flowood, MS 39232

COFFEE HOUSES Cups Espresso Café (Multiple Locations, www.cupsespressocafe.com) Jackson’s local group of coffeehouses offer a wide variety of espresso drinks. Wi-fi. Hazel Coffee Shop (2601 N. State St. Fondren Across from UMC) Fresh locally roasted coffee and specialty drinks to perk up your day!

BARS, PUBS & BURGERS Burgers and Blues (1060 E. County Line Road, Ridgeland 601-899-0038) Best Burger of 2013, plus live music and entertainment! Hal and Mal’s (200 S. Commerce St. 601-948-0888) Pub favorites meet Gulf Coast and Cajun specialties like red beans and rice, the Oyster Platter or daily specials. Capitol Grill (5050 I-55 North, Deville Plaza 601-899-8845) Best happy hour & sports bar, kitchen open late, pub food with soul and live entertainment. Cherokee Inn (960 Briarfield Rd. 601-362-6388) Jackson’s “Best Hole in the Wall,” has a great jukebox, great bar and a great burger. Cool Al’s (4654 McWillie, 601-713-3020) Cool Al’s signature stacked, messy, decadent, creative burgers defy adjectives. And don’t forget the fries! Fenian’s Pub (901 E. Fortification St. 601-948-0055) Classic Irish pub featuring a menu of traditional food, pub sandwiches and Irish beers on tap. Martin’s Restaurant and Lounge (214 South State Street 601-354-9712) Lunch specials, pub appetizers or order from the full menu of po-boys and entrees. Full bar, beer selection. Musician’s Emporium (642 Tombigbee St., 601-973-3400) Delicious appetizers, burgers, sandwiches, and more. Great food goes with great music! Ole Tavern on George Street (416 George St. 601-960-2700) Pub food with a southern flair: beer-battered onion rings, chicken & sausage gumbo, salads, sandwiches. Underground 119 (119 South President St. 601-352-2322) Pan-seared crabcakes, shrimp and grits, filet mignon, vegetarian sliders. Live music. Opens 4 p.m., Wed-Sat Wing Stop (952 North State Street, 601-969-6400) Saucing and tossing in a choice of nine flavors, Wing Stop wings are made with care and served up piping hot.

ASIAN AND INDIAN

Tuesday-Saturday 5-7pm

601-919-2829

Hickory Pit Barbeque (1491 Canton Mart Rd. 601-956-7079) The “Best Butts in Town” features BBQ chicken, beef and pork along with burgers and po’boys. Haute Pig (1856 Main Street, 601-853-8538) A “very high class pig stand,” Haute Pig offers Madison diners BBQ plates, sandwiches, po-boys, salads.

-Food & Wine Magazine-

707 N Congress St., Jackson | 601-353-1180 Mon thru Fri: 11am-2pm • Sun: 11am - 3pm

Crazy Ninja (2560 Lakeland Dr., Flowood 601-420-4058) Rock-n-roll sushi and cook-in-front-of-you hibachi. Lunch specials, bento boxes, fabulous cocktails. Ruchi India (862 Avery Blvd @ County Line Rd. 601-991-3110) Classic Indian cuisine from multiple regions. Lamb, vegetarian, chicken, shrimp and more. Pan Asia (720 Harbor Pines Dr, Ridgeland 601-956-2958) Beautiful ambiance and signature asian fusion dishes and build-your-own stir-frys. Fusion Japanese and Thai Cuisine (1002 Treetop Blvd, Flowood 601-664-7588) Specializing in fresh Japanese and Thai cuisine, an extensive menu features everything from curries to fresh sushi


FILM p 32 | 8 DAYS p 33 | MUSIC p 36 | SPORTS p 38

Morbid Curiosity by Julie Skipper

“Sherlock Holmes and the Adventure of the Suicide Club” is at New Stage Theatre (1100 Carlisle St.) Sept. 10-14 and Sept. 18-21 at 7:30 p.m., with matinee showings Sept. 15 and 22 at 2 p.m. Tickets are $28, $22 for seniors and students. For tickets or more information, call 601-948-3533, ext. 222, or visit newstagetheatre.com.

Although the show moves throughout several scene changes, Lefavor says, “I wanted to keep the pace up and transition without any blackouts. I presented this as a challenge to Richert Schug, the set designer who joined us last year as an intern, and he’s done a great job accomplishing it.” With a high-energy cast and lots of visual treats, this fast-paced show promises to be a murder mystery that will keep you on the edge of your seat … and laughing.

Beth Kander, Ray McFarland and John Howell star in “Sherlock Holmes and the Adventure of the Suicide Club” at New Stage Theatre.

COURTESY NEW STAGE

N

secretary and happens to be a magician, to ensure that all the tricks and sleights of hand are just right. Regular New Stage audience members will see some new faces on the stage, as well as familiar ones. Among the 10 cast members, Ray McFarland played the role of Holmes with John Howell as Dr. Watson in a prior Sherlock Holmes play at the theater; both reprise those roles for this performance, joined by eight other actors. The play’s staging presents several technical challenges, but Lefavor says the cast and crew responded enthusiastically and will surprise the audience with what they’ve done. For instance, the story requires the depiction of several murders. This is accomplished through a series of silhouettes and backlights. Additionally, this being a Sherlock Holmes adventure, Holmes has to figure out a number of clues along the way. Lefavor, who has a background in lighting shows, worked with Doc Davis, production an–d lighting director at Belhaven University, to project the clues onto the stage so the audience gets to unscramble them. “Look for the phrases ‘Hector M. O. Fly MS’ and ‘Bounds Ice Joe,’” Lefavor says, adding that they hold keys to unraveling the mystery.

jacksonfreepress.com

COURTESY NEW STAGE

to the famous detective at the lowest point in his career—so low, in fact, that he’s considering offing himself. He joins a suicide club whose members are men all sharing the same objective. They accomplish it through what they call “Suicide by Second Party.” A game of chance selects a victim for the evening, as well as someone to carry out the deed. The play takes place over several Club meetings, which give rise to a mystery that Holmes must solve. The play’s source material is a series of three fictional detective short stories by Robert Louis Stevenson about a secret society of people out to self-destruct. Hatcher inserted the characters of Holmes and Dr. Watson into the mix, so Ray McFarland (with David Lind) plays Sherlock Holmes the story became a Sherlock for the second time on New Stage Theatre’s stage. Holmes adventure. Brent Lefavor, resident designer at New Stage, makes his directorial debut ew Stage Theatre kicks off its at the theater with this pro48th season with an intriguing duction. Lefavor says it’s an exciting piece story of mystery, magic and that promises the audience a lot of entermurder. But it’s also a play full tainment. “(The production) includes of dark humor and fun for the audience. magic, illusions and a lot of technical In “Sherlock Holmes and the Ad- wizardry,” Lefavor says. Robert Day, venture of the Suicide Club,” playwright a local magician, worked with acJeffrey Hatcher introduces the audience tress Ali Dinkins, who plays the club

31


6A0=3E84F DIVERSIONS | film A M A LC O T H E AT R E

South of Walmart in Madison

ALL STADIUM SEATING

PGG"OZPSEFS 'PSB-JNJUFE5JNF0OMZ

Riddick

R

The Ultimate Life PG This Is The End R Getaway

PG13

3-D One Direction: This Is Us PG One Direction: This Is Us (non 3-D) PG The Grandmaster PG13

Blue Jasmine PG13 Mortal Instruments: City Of Bones PG13 Lee Daniel’s The Butler PG13 Elysium

R

Planes (non 3-D) PG We’re The Millers

R

Closed Circuit R

Percy Jackson: Sea Of Monsters (non 3-D) PG

You’re Next

2 Guns

R

The World’s End R

R

Despicable ME 2 (non 3-D) PG

GIFT CARDS AVAILABLE

601.664.7588

1002 Treetop Blvd • Flowood Behind the Applebee’s on Lakeland www.fusionjapanesethaicuisine.com

September 6

ne

Hairica

September 7

September 4 - 10, 2013

Evelle

32

824 S. State St. Jackson, MS www.clubmagoos.com

601.487.8710

DAILY BARGAINS UNTIL 6PM Online Tickets, Birthday Parties, Group & Corporate Events @ www.malco.com

Movieline: 355-9311

by Anita Modak-Truran

After a harrowing police chase through the Christmas-park displays, Four Wheels and Magra idle in a dark underground location waiting for Whiskers’ next instruction. Snicker alert. Enter The Kid, a hoodie-clad, cherubcheeked Selena Gomez, who carjacks Four Wheels and Magra. A slick car outperforms Selena Gomez and Ethan Hawke The Kid is the in the regrettable “Getaway.” rightful owner of Four Wheels, we learn invited prodigal son for a Sunday af- through screenwriters Sean Finegan and ternoon movie getaway, giving him Gregg Maxwell Parker’s less-than-golden sparingly few details on the movie prose. While she barely looks old enough “Getaway.” He asked if this was a to be out of the house without nanny remake of the Steve McQueen classic. protection, The Kid is smart. Another I shook my head no. Michael said no. snicker alert. The Kid figures out the plan Given that Michael’s college getaway is to save the day based on her understandonly two weeks away, I pressed my case. ing of computer hacking, power stations, It may have been my relentless nagging, investment banking and spy cams. the thought of seeing music-idol Selena The only remotely developed charGomez on the big screen or the fact that acter in “Getaway” is Four Wheels. college tuition is due soon, but Michael Four Wheels has a performance-encaved. We packed into my high-powered hanced, supercharged engine, wildwood VW Golf and headed to the theater. brakes with six-piston fronts and fourWe both regretted the decision. This piston rear calipers She wears front-break movie is screechingly bad; it’s a turbo cooling ducts, which are necessary for squealing disaster. high speed chases, slam downs and re“Getaway,” directed by Courtney verse runs. Solomon (“Dungeon and Dragons,” She has a unique hood, which nev“An American Haunting”)—who is not er crushes upon impact, and beautiful female as his name might suggest—pro- stripes. She has a six-speed manual transvides a visual essay on the excesses of the mission, which a passenger can easily car chase. The film stars Four Wheels, a handle in case the driver has to shoot a customized Shelby Super Snake Mustang round at a madman on a motorcycle. complete with cobra stickers. The first (It amazes me that the bad guys, time we meet Four Wheels, the camera armed with automatic weapons and an lovingly languishes on the sinister cobra unlimited supply of ammunition, always tattoo affixed to her lovely bumper. While miss, but the good guy takes the killer some might think this is a tramp stamp, out with a single bullet from a kid-driven Four Wheels is as smooth and sexy as a moving car.) Barry White song. Four Wheels starts off magnificently How Four Wheels gets implicated and ends with barely a tire to her bombedinto the never-ending car-chase sequenc- out, gun-blasted shell. es requires some explanation. Somewhere No one else in the film is really worth in Bulgaria, former racecar driver Brent mentioning, except that Selena Gomez, a Magra (Ethan Hawke) opens the door kitten-cute child-woman, shoots off more to his flat and finds shattered glass orna- profanities than a sailor after a six-month ments, a ransacked Christmas tree and tour of duty. But The Kid does problood pools staining the floor. He looks vide canny insight when she says, “This high and low, but his beautiful wife (Re- is sh*t.” becca Budig) is missing. No truer words have been spoken. A cell phone rings. The scene cuts My cliché-filled advice is that “Getaway” to an extreme close-up of a mouth sur- is a train wreck without a train. Get away rounded by gray whiskers (Jon Voight). from “Getaway.” Steer clear unless you “Whiskers” explains that he has taken have a crush on muscle cars. Magra’s wife and she will live if—and My hope is for world peace and that only if—Magra follows his every instruc- Four Wheels will star in something more tion. These instructions lead Magra to substantial in the future—like “Fast and Four Wheels. Furious 13.” COURTESY AFTER DARK FILMS

7KDL)RRG $W,WV%HVW

Listings for Fri. 9/6 – Thur. 9/12

Excesses of the Car Chase

I


THURSDAY 9/5

SUNDAY 9/8

WEDNESDAY 9/11

fondRUN pub run is during Fondren After 5.

LatinFest is at the Mississippi Farmers Market.

“Sherlock Holmes and the Adventure of the Suicide Club” is at New Stage.

BEST BETS SEPT. 4 - 11 2013

William Winter speaks during History Is Lunch at noon at Old Capitol Museum (100 S. State St.). Free; call 601-576-6998. … Jackson Restaurant Week Charity Reveal Party is from 7:30-10 p.m. at Hal & Mal’s (200 S. Commerce St.) in the Big Room. $20 in advance, $24 at the door; call 948-0888; email jane@ halandmals.com; jacksonrestaurantweek.com.

Step Afrika! performs Sept. 10 at Jackson State University and gives an arts education workshop Sept. 11.

THE NAPOLEON COMPLEX PROJECT

WEDNESDAY 9/4

THURSDAY 9/5

MACK BARHAM

Cedars Juried Art Exhibition reception is from 5-8 p.m. at The Cedars Historic Home (4145 Old Canton Road). Free; call 601-981-9606; fondren.org. … fondRUN is at 6 p.m. in Fondren. Free; liverightnowonline.com. … College BOUND Workshop Registration ends today at Mississippi State University School of Architecture (509 E. Capitol St.). Free; call 662-325-9839; email cmcneal@caad.msstate. edu; caad.msstate.edu/collegebound.

Drive). $12 weekend pass, discounts available; celticfestms. org. … Maze Featuring Frankie Beverly and Tank perform at 8 p.m. at Mississippi Coliseum (1207 Mississippi St.). $26.50-$56.50; call 800-745-3000.

SATURDAY 9/7

Celtic Fest Mississippi is Sept. 6-Sept. 8 at the Mississippi Agriculture and Forestry Museum.

September 4 - 10, 2013

Greater Jackson Quilt Celebration is from 9 a.m.-5 p.m. at Mississippi Craft Center (950 Rice Road, Ridgeland). $5; call 601-856-7546; email gjqc2013@aol.com; gjqc2013. com. … CelticFest Mississippi is at 7 p.m. at Mississippi 33 Agriculture and Forestry Museum (1150 Lakeland

DFM Invitational is at 11 a.m. at Annandale Golf Club (419 Annandale Parkway, Madison). $250, $1000 team of four; call 601-957-7878 or 1-877-DFMCURE; msdiabetes.org. … Wine with the Blind is from 5:30-7:30 p.m. at BRAVO! Italian Restaurant & Bar (4500 Interstate 55 N., Suite 244). $25; call 601-984-3264; email jeffg@bravobuzz.com; mibfoundation.org.

Mississippi Chorus Harmony Kickoff is from 10 a.m.2 p.m. at Wesley Biblical Seminary (787 E. Northside Drive). Free; call 601-278-3351; mschorus.org. … Magnolia Roller Vixens take on the Crescent Wenches of New Orleans in roller derby at 7 p.m. at Jackson Convention Complex BY BRIANA ROBINSON (105 E. Pascagoula St.). $12 in advance, $15 at the door, $5 JACKSONFREEPRESS.COM children; call 960-2321; email info@magnoliarollervixens. FAX: 601-510-9019 com; magnoliarollervixens. DAILY UPDATES AT com. … Bass Invasion 2: YoJFPEVENTS.COM Glow Edition is at 9 p.m. at Martini Room (400 Greymont Ave.). $10-$12; call 601-969-2141; find “Bass Invasion 2 #Yo-Glow Edition” on Facebook.

MS Dinner of Champions is at 5:30 p.m. at Country Club of Jackson (345 St. Andrews Drive). This year’s HOPE Award recipient is William R. “Randy” James. $150; call 601-856-5831; email lora.bingham@nmss.org; nationalmssociety.org/alc. … Jackson Metro Cyclists Time Trial is from 6-6:30 p.m. at Xerox Building (384 Galleria Parkway, Madison). Helmets required. Free; call 601-988-2422; jacksonmetrocyclists.com. … Step Afrika! performs at 7 p.m. at Jackson State University (1400 John R. Lynch St.) in McCoy Auditorium. 15, $5 JSU students, $50 signature event season ticket; call 601-979-7036.

SUNDAY 9/8

WEDNESDAY 9/11

EVENTS@

FRIDAY 9/6

MONDAY 9/9

All 4 Children Consignment Fall/Winter Sale is from 8 a.m.-noon at Mississippi Trade Mart (1200 Mississippi St.). Call 601-566-7046; email cbpampa@yahoo.com; all4childrenconsignment.com. … LatinFest is from 1-7 p.m. at Mississippi Farmers Market (929 High St.). $7 in advance, $10 at the door, children under 12 free; call 601354-6573; email labalink@gmail.com; latinfest.org.

TUESDAY 9/10

Poker Run is at 6 p.m. at Soulshine Pizza Factory (1111 Highland Colony Parkway, Ridgeland). After-party at Cazadores (500 Highway 51, Suite R, Ridgeland). Free; call 601-899-9696; fleetfeetjackson.com. … “Sherlock Holmes and the Adventure of the Suicide Club” is at 7:30 p.m. at New Stage Theatre (1100 Carlisle St.). $28, $22 seniors and students; call 601-948-3533, ext. 222; newstagetheatre.com.


SUFFERING FROM LOWER BACK PAIN? FREE SEMINAR



*&0 30/.3/2%$%6%.43 LatinFest Sept. 8, 1-7 p.m., at Mississippi Farmers Market (929 High St.). The celebration of Latin culture in Mississippi includes traditional food, children’s activities, dancing and music. Cucho and Sus Amigos, and Jesse Robinson perform. A portion of proceeds benefits the American Red Cross. $7 in advance through Sept. 6, $10 day of event, children under 12 free; call 354-6573; email labalink@gmail.com; latinfest.org.

#/--5.)49

If you’re tired of living with pain, we invite you to join us for a Free Seminar.

DO any OF THE FOLLOWING APPLY TO YOU? • Back, pelvis or buttock pain after accident, fall or pregnancy? • Do you point to pain on your lower back or pelvis? • Do you wear an SI belt? • SI joint injections? • Continued pain after prior lumbar fusion surgery? •Physical therapy for strength & alignment of your back pelvis or hip?

September 4 - 10, 2013

If you answered yes to any of the above, then you might be suffering from SI joint pain. SI joint pain can contribute up to 30% of all lower back pain, yet is rarely evaluated.

34

WHEN: Wednesday, September 11/ 7:00 pm HOST: Dr. Winston Capel & Dr. J Edwin Dodd WHERE: Hilton Jackson 1001 East County Line Road, Jackson, MS 39157

RSVP: 877-287-6114 - CALL TODAY! © 2013 SI-Bone, Inc. All Rights Reserved.

Events at Jackson Zoo (2918 W. Capitol St.). Call 601-352-2580; jacksonzoo.org. • Tailgating with the Tigers Sept. 5, 6-9 p.m. Enjoy music, food samples, a tiger tour and meeting representatives from Jackson State University. Wear a college football team jersey or T-shirt. For ages 18 and up; must be 21 to get a drink wristband. $20, $2 Tiger-ritas (benefits Tiger Conservation Fund). • Critters and Crawlers: Animal Games Sept. 7, 10-10:45 a.m. The program for toddlers includes games, crafts, animal encounters and more. Admission covers one toddler and one adult. Registration required. $15, $6 members (includes zoo admission); call ext. 240. • Senior Day Sept. 11, 8 a.m.-noon. Seniors ages 65 and older enjoy guest vendors, treats and sessions on health, diet and more. Register by Sept. 6. Free for seniors. Events at Mississippi Center for Nonprofits (201 W. Capitol St.). Registration required. Call 601-968-0061; msnonprofits.org. • Writing a Grant Proposal: The Essentials Sept. 11-12, 9 a.m.-4 p.m. The two-day workshop covers all the essentials for writing a grant proposal including budgeting, researching and managing awards. $369, $189 members. • Completing the IRS Form 1023 Sept. 6, 9 a.m.-noon The workshop takes you pageby-page to complete the IRS Form 1023 for tax-exempt Status for your organization. $99, $59 members. Events at Mississippi Children’s Museum (2145 Highland Drive). Call 601-981-5469; mississippichildrensmuseum.com. • College Savings Day Sept. 7, 10 a.m.-2 p.m. Representatives from the State Treasurer’s office help families prepare for their children’s college education through MACS, Mississippi’s 529 savings plan. Register to win one of two $1,000 scholarships at the event. Children’s activities included. $5.29, children under 12 months and members free. • Grandparents Day Crafts Sept. 7, 9 a.m.4 p.m. Celebrate your grandparents by making a special craft just for them. $8, children 12 months and under free. • Fall Fix-up Sept. 9-13. Volunteer to help spruce up the museum by making repairs, painting and more. The museum is closed during the maintenance period. Events at Ridgeland Public Library (397 Highway 51, Ridgeland). Free; call 601-856-4536; mcls.ms. • Teen Time (Grades 6-12) Sept. 5, 4-5 p.m. Teens enjoy games, comic book swaps, snacks and more on first Thursdays. Volunteers welcome. • Rising Readers Story Time (Ages 3-5) Tuesdays, 4-4:30 p.m. through Nov. 19. The program incorporates songs, rhymes, movement and storytelling to strengthen early literacy skills and build enthusiasm for reading.

• Baby Bookworms Wednesdays, 10:30 a.m.11 a.m. through Nov. 20. Parents and caregivers interact with children ages 0-2 through a variety of nursery rhymes, action rhymes, songs and stories. COMSTAT Meeting Sept. 5, 9 a.m., at Jackson Police Department Headquarters (327 E. Pascagoula St.). The JPD shares the latest Jackson crime statistics at the biweekly meeting. Open to the public. Call 601-960-1375; jacksonms.gov. Precinct 1 COPS Meeting Sept. 5, 6 p.m., at Jackson Police Department, Precinct 1 (810 Cooper Road). These monthly forums are designed to help resolve community issues or problems, from crime to potholes. Call 601-960-0001. First Friday: The September Soul Edition Sept. 6, 10 p.m.-2 a.m., at ISH Grill and Bar (333 N. Mart Plaza). Enjoy music from Larry D. Johnson and a guest deejay. Wear upscale attire. $10, $80 table, $120 VIP section (includes four passes); firstfridayjxn.com. Swing into Fall with MPB Sept. 6, 5:30-7:30 p.m., at Highland Village (4500 Interstate 55 N.). In the courtyard. Mississippi Public Broadcasting’s cocktail reception features special guest Robin Young, host of NPR’s “Here and Now,” and music from Swing de Paris. Advance tickets. $40, $60 couples; call 601-982-5861; mpbonline.org/swingintofall. Kindred Spirits Whisky Tasting Sept. 6, 7-9 p.m., at Mississippi Agriculture and Forestry Museum (1150 Lakeland Drive) In Sparkman Auditorium. Enjoy a self-paced tasting of more than 40 whiskies, hors d’oeurves and a lecture on distilling. Proceeds benefit CelticFest Mississippi. Admission includes a commemorative glass. Must be 21 to enter. $40 in advance, $60 at the door; call Wine and Spirits in the Quarter at 601366-6644 or Kristen Williams at 601-573-8642; celticfestms.org. NFL Punt, Pass and Kick Competition Registration through Sept. 6, at Metrocenter Mall (1395 Metrocenter Drive), at the Department of Parks and Recreation, suite 104. The program is for children ages 6-15. Birth certificate required. Register by Sept. 6 for the Sept. 12 competition at Hughes Field. Participants may not wear shoes with cleats at the event. Free; call 601-960-0471. TGI Fridays Sept. 6, 10 a.m., at T’s Event Hall (1900 Highway 80 W.). Family Affair and Cuzzo Entertainment host the party. Enjoy drink specials, and music from DJ Freeze and King George. Upscale attire; no white T-shirts. Doors open at 9 p.m. BYOB. Cover charge applies; follow @FamilyAffairJxn on Twitter. Jackson Audubon Society First Saturday Bird Walk Sept. 7, 8 a.m., at LeFleur’s Bluff State Park (2140 Riverside Drive). An expert birder leads the walk. Bring binoculars, water, insect repellent and a snack. Call ahead if you would like to borrow a pair of binoculars. Adults must accompany children under 15. Free, $3 car entrance fee. Free; call 601-832-6788. Backyard Brawl XIV Sept. 7, 7 p.m., at Millsaps College (1701 N. State St.), at Robinson-Hale Stadium. The Millsaps Majors take on the Mississippi College Choctaws at the annual football game. $11 in advance, $15 at the gate; call 601-974-1038; email griffdj2@millsaps.edu; gomajors.com. W.C. Gorden Classic Sept. 7, 6 p.m., at Mississippi Veterans Memorial Stadium (2531 N. State St.). Jackson State University takes on Alabama State University in the annual football game. JSU fans are encouraged to wear white. $25-$45 in advance, $30-$50 game day, parking and tailgating fees vary; call 601-979-2420; jsutigers.com.


Jackson Touchdown Club Meeting Sept. 9, 11:30 a.m., at River Hills Club (3600 Ridgewood Road). Club members with an interest in football meet on most Mondays through Dec. 2. Ole Miss Coach Hugh Freeze is the speaker. Includes lunch. Call for information on membership dues. $30 non-members; call 601-506-3186; jacksontouchdownclub.com. Small Business Administration Loan Clinic Sept. 10, 1-3 p.m., at Small Business Administration District Office (Regions Plaza, 210 E. Capitol St., 10th floor), in the conference room. Learn about the SBA’s guaranty loan programs and participating lenders. Free; call 601-965-4378, ext. 16; email delores.smith@sba.gov; sba.gov/ms. West Jackson Plan Public Meeting Sept. 10, 6 p.m., at Lynch Street CME Church (2175 John R. Lynch St.). The purpose is to empower residents and stakeholders to invest in sustainable and inclusive social, physical and economic development within the community. Call 601-713-1128. History Is Lunch Sept. 11, noon, at William F. Winter Archives and History Building (200 North St.). Conservation expert Kim Du Boise of USM presents “Conservation Saves Memories.” Free; call 601-576-6998. Tutoring Registration through Sept. 30, Monday-Friday, 10 a.m.-5 p.m., at Genesis and Light Center (4914 N. State St.). The Genesis and Light Center is accepting applications for its tutoring program. Free; call 601-362-6736; email GenesisandLightCenter@att.net; genesisandlightcenter.com.

7%,,.%33 Sickle Cell Patient and Parent Support Group Sept. 7, 11 a.m., at Jackson Medical Mall (350 W. Woodrow Wilson Ave.). The group meets on first Saturdays in the Common Area. Free; call 601-366-5874; mssicklecellfoundation.com. Oh, My Achy Legs Sept. 9, 11:45 a.m.-1 p.m., at Baptist Health Systems, Madison Campus (401 Baptist Drive, Madison). In the Community Room. Dr. Daniel Ramirez talks about peripheral vascular disease. Registration required. Free, $5 optional lunch; call 601-948-6262; mbhs.org. Look Good Feel Better Program Sept. 9, 2-4 p.m., at St. Dominic Cancer Center (2969 N. Curran Drive). Cancer patients learn beauty techniques to manage the appearancerelated side effects of cancer treatment. Preregistration required. Free; call 800-227-2345; lookgoodfeelbetter.org. Living with Alzheimer’s for Caregivers: Early Stages Workshop Sept. 10, 10-11:30 a.m., at

Baptist Healthplex, Clinton (102 Clinton Parkway, Clinton). Learn what plans should be made, and what programs and resources are available. Registration required. Free; call 601-987-0020; email smurphy2@alz.org; alz.org/ms. Free Prostate Screening Sept. 10, 5-7 p.m., at Baptist Medical Center (1225 N. State St.). At the Hederman Cancer Center. Includes a PSA test and a digital rectal exam. Certain restriction apply. By appointment only. Free; call 601-948-6262; mbhs.org. “Hope and Healing” Breast Cancer Support Meeting Sept. 10, 5:30-6:30 p.m., at The Face and Body Center (Riverchase Medical Suites, 2550 Flowood Drive, Flowood). The meetings are on second Tuesdays. Refreshments included. RSVP. Free; call 601-936-0925; email cfox@phsa-ms.com. Crossfit 601 Yoga Mobility Sundays, 3-4 p.m. through Sept. 22, at CrossFit 601 South (789 Harris St.). Butterfly Yoga owner Scotta Brady teaches the class to help athletes improve their mobility. $5-$10; call 601-941-8904; email info@crossfit601.com; crossfit601.com.

34!'%!.$3#2%%. “United States of BBQ” Film Screening Sept. 5, 6 p.m., at Triangle Cultural Center (332 N. Main St., Yazoo). The Rob Travalino documentary is about the history of barbecuing in America. Refreshments from Ubon’s BBQ included. Free; call 800-381-0662; visityazoo.org. “God’s Favorite” Sept. 5-7 and Sept. 12-14, 7:30 p.m., and Sept. 8 and Sept 15, 2 p.m., at Black Rose Theatre (103 Black St., Brandon). The Neil Simon comedy is a modern-day Job story about a businessman whose faith is tested. $15, $10 students, military and seniors; call 601-825-1293; blackrosetheatre.org. Nameless Open Mic Sept. 7, 9 p.m., at Suite 106 (106 Wilmington St.). On first and third Saturdays at 9 p.m. Poets, singers, actors and comedians are welcome. $5 admission, $3 to perform; call 601-720-4640.

-53)# St. Paul and the Broken Bones Sept. 5, 8 p.m., at Duling Hall (622 Duling Ave.). Cocktails at 7 p.m. For ages 18 and up. $8 in advance, $10 at the door, $3 service charge for ticket holders under age 21; call 601-292-7121; ardenland.net. Mockingbird Trio Sept. 6, 7:30 p.m., at Mississippi College (200 S. Capitol St., Clinton), at the Jean P. Williams Recital Hall in Aven

Hall. The classical ensemble plays pieces from Beethoven, Bach and Mendelssohn. Limited seating. $20, $5 students; call 601-925-3440; music.mc.edu.

exhibition. Includes live music and other activities. $12, $10 seniors 60 and older, $6 ages 6–college, ages 0-5 and members free; call 601-960-1515; msmuseumart.org.

Tightrope Escapade Sept. 6, 10 p.m., at The Yellow Fiddle (6202 Highway 49 N., Hattiesburg). The acoustic duo, Clay Keith and Jacquelynn Pilcher, play a mix of musical styles. $3 cover; call 601-602-3572; tightropeescapade.tumblr.com.

Lincoln: The Constitution and the Civil War through Sept. 20, at Hinds Community College, Raymond Campus (501 E. Main St., P.O. Box 1100, Raymond), at the McLendon Library. The traveling interactive exhibit is a historical account of Abraham Lincoln’s activity as president. The opening reception is Sept. 5 at 10 a.m., and additional receptions are Sept. 10 at 9 a.m. and Sept. 17 at 10 a.m. Free; call 601-857-5261; email mary.applin@hindscc.edu; hindscc.edu.

Sunday Funday Sept. 8, 2-7 p.m., at Wasabi Sushi & Bar (100 E. Capitol St., Suite 105). The party includes music from DJ Scrap Dirty, The NastySho, DJ George Chuck and DJ Reign. Enjoy drink and sushi specials, and giveaways from Mississippi Greek Weekend. No cover; call 948-8808; find “SUNDAY FUNDAY @WASABI DOWNTOWN JXN” on Facebook. Music in the City Sept. 10, 5:15 p.m., at Mississippi Museum of Art (380 S. Lamar St.). Enjoy hors d’oeuvres and a cash bar and music from Hristo Hristov and Shawn Leopard. Free, donations welcome; call 601-960-1515; msmuseumart.org.

,)4%2!29!.$3)'.).'3 Events at Lemuria Books (4465 Interstate 55 N., Suite 202). Call 601-366-7619; email info@ lemuriabooks.com; lemuriabooks.com. • “Island of Fire” Sept. 4, 5 p.m. Lisa McMann signs books. $16.99 book. • “The Woman Who Lost Her Soul” Sept. 11, 5 p.m. Bob Shacochis signs books. Reading at 5:30 p.m. $28 book. • “Risked” Sept. 4, 5 p.m. Margaret Haddix signs books. $16.99 book.

#2%!4)6%#,!33%3

Grace Orsulak Art Exhibit through Sept. 29, at Arts Center of Mississippi (201 E. Pascagoula St.). See Orsulak’s paintings and other creations in the upper and lower atriums. Opening reception Sept. 7 from 2-4 p.m. Free; call 601960-1557, ext. 224. Horizon Realm: Contemporary Art from Taiwan through Nov. 6, at Dollye M.E. Robinson Liberal Arts Gallery (Jackson State University, 1400 John R. Lynch St.). See paintings, sculptures, installations, videos and photography from 10 Taiwanese artists. Opening reception Sept. 5 at 3 p.m. Free; call 601-979-7036.

"%4(%#(!.'% Farm to Table 100 Sept. 4, 6-8 p.m., at Table 100 (100 Ridge Way, Flowood). Enjoy a fourcourse meal from Chef Mike Romhïld paired with wine or beer selections from “The Wine Guy” Paul Ruiter. Includes a meet-and-greet with Mississippi Agriculture Commissioner Cindy Hyde Smith. Proceeds benefit Farm Families of Mississippi. $110 plus tax and tip; call 601-420-4202; tableonehundred.com.

Shut Up and Write! Sept. 7, 10 a.m.-12:30 p.m., at JFP Classroom (2727 Old Canton Road, Suite 224). Reserve your spot for Donna Ladd’s popular creative non-fiction six-class series. Meets every other Saturday from 10 a.m.-12:30 p.m. through Nov. 16. Includes snacks and materials. Space limited. $150; call 601-362-6121, ext. 15; email class@writingtochange.com.

Fire & Feast BBQ Competition and Festival Sept. 6, 5 p.m., and Sept. 7, 9 a.m.-6 p.m., at Yazoo County Fairgrounds (203 Hugh McGraw Drive, Yazoo). The barbecue competition includes a concert Sept. 6 and a festival Sept. 7 with arts and crafts, and a kid’s zone. Concessions sold. Benefits the Gateway MAP Coalition and the Lifesavers Program. No coolers. $10 Sept. 6, free admission Sept. 7; call 800-381-0662; fireandfeast.org.

%8()")43!.$/0%.).'3

Check jfpevents.com for updates and more listings. To add an event, email all details (phone number, start and end date, time, street address, cost, URL, etc.) to events@jacksonfreepress.com or fax to 601-510-9019. The deadline is noon the Thursday prior to the week of publication. Or add the event online yourself; check out jfpevents.com for instructions.

50 Paintings in 50 Hours: Old Masters to Monet Final Weekend Sept. 6, 3 p.m.-Sept. 8, 5 p.m., at Mississippi Museum of Art (380 S. Lamar St.). The museum is open for 50 straight hours to commemorate the final weekend of the

IT PAYS TO BE BILINGUAL! On average bilingual employees make 5%-20% more. Classes start in August English and Spanish Free language demo and open house the first Friday of each month at 7 pm

NEW LOCATION! 6712 OLD CANTON RD SUITE 10 RIDGELAND | 601.500.7700 | LINGOFEST.COM

Otis Lotus

Fri | September 6 | 9 pm | $5 Cover

Blues & BBQ

D’Lo Trio | Every Thursday 5-7 pm | No Cover

601-362-6388

1410 Old Square Road • Jackson www.cherokeedrivein.com

jacksonfreepress.com

Now registering for Fall semester, adults and children.

35


music in theory

9.99

Weekly Lunch Specials

$ 2happyfor 1 well drinks hour m-f 4-7 pm Open for dinner Sat. 4-10 2 for 1 house wine

starting at •

pm

Thursday September 5

LADIES NIGHT W/ DJ Stache • Ladies Drink Free

Friday September 6

Whitespike with Mater’s Mart & Argiflex

HAPPY HOUR! Mon-Fri •1 - 3:30pm $2 Domestics • $3 Wells

WEDNESDAYS

9/04

LADIES NIGHT 2-for-1 Wells & Domestic 5pm - close

THURSDAYS

9/05

$4 APPETIZERS • 5 -9PM 2 FOR 1 DRAFT FRIDAY

9/06

SATURDAY

9/07

MONDAY

9/09

STATIC ENSEMBLE

DIME BROS OPEN MIC/ TALENT Local bands tryout for gigs On stage w/ pro sound & lights Both bars open

Saturday September 7

Gary Burnside

1.50 Pick & Grab Beers & 2 for 1 draft TUESDAY

9/02

SHRIMP BOIL 5 - 10 PM

MATT’S KARAOKE 5 - 9 & 10 - close

$1 PBR & HIGHLIFE $2 MARGARITAS 10 - 12pm

UPCOMING SHOWS

Tuesday September 10 Highlife, Highlife Lite, PBR, Schlitz, Fatty Natty

Open Mic with Jason Turner

Wednesday September 11

KARAOKE

September 4 - 10, 2013

with DJ STACHE

36

FREE WiFi

416 George Street, Jackson Open Mon-Sat Restaurant Open Mon-Fri 11am-10pm & Sat 4-10pm

601-960-2700

facebook.com/Ole Tavern

9.13: Flowtribe 9.21: Space Capone 9.27: Up Until Now

(on tour with STS9 & Umphrey’s McGee)

9.28: Good Enough For Good Times (Members Of Galactic) 10.4: Cosby Sweater 10.19: The Revivalists 11.8: Unknown Hinson 11.23: Zoogma

SCAN

ME! SEE OUR NEW MENU

W W W. M A R T I N S L O U N G E . N E T

214 S. STATE ST. 601.354.9712 DOWNTOWN JACKSON

A Critique on Critics

I

almost hate to enact the typical 10thgrade speech-class introduction, but I think we can all glean something important from defining the term “critic.” Today, it has pretty negative connotations, but these aren’t always true. Most agree that critics are people who share their assessments of an art form in either a positive, negative or well-balanced light. But the thing that should be emphasized—and written in bulky, bold letters—is that a critic is merely a sharer of opinions. I am an avid reader of music criticism. Being a music critic is a tough gig. I should know, not because I am one (though that is true) but because I can be incredibly judgmental of critics. Sometimes this is for good reason, as in cases where a critic refuses to see the positive features of a record. Other times, I’m just protective of a band that I love. I’m sure you’ve been there, too. Fans tend to cling to a particular album or artist that meets them where they are and tugs at them in just the right way. They defend those songs like you would a newborn baby in a bear cave. One of my favorite albums, easily in my top 10, is Fireworks’ “Gospel.” Though Fireworks is labeled as punk, a genre that I’m either not anarchical enough or too civil to enjoy, “Gospel” rises above the “I don’t care” attitude and the grungy vocals of punk music. Instead, it’s marked with crafty instrumentation, catchy lyrics and brilliant turns of phrase. It’s about staying true to your past through the ever-uncertain future, dealing with self-doubt and falling back on real friendships. Noted music-reviewing magazine Under the Gun gave “Gospel” a 7.5 out of 10. For some perspective, this same reviewer, whom I won’t name, recently reviewed Katy Perry’s new album “Prism” and its single “Roar.” He wrote, “The bar for the competition has been set not one, but four or five notches higher.” He reviewed “Gospel” back in 2011, and I still think about it. I was shocked and, admittedly, upset about this bland score for one of my favorite records. But here’s why I shouldn’t have been and why I now do my best to avoid defensiveness: Most reviewers are fully aware that their reviews are only their opinion, not gospel (pun fully intended). Is it fair that Perry’s song, which references Disney’s “Hercules” in passing, scores higher than any number of Fireworks’ metaphorical phrases? For instance, “The Wild Bunch” begins with a meaningful Beach Boys allusion to life

on the road: “Like a landlocked Brian Wilson, always aching for the tides, our heads are comfortable on a pillow but always sinking on the other side.” But, the thing is, no matter how strongly I feel about a song, record or a band, thousands more feel the exact opposite way. The same reasons why I love “Gospel” may be exactly why another listener hates it. Welcome to the struggle of the music reviewer. No opinion can please everyone because no music can please everyone. That’s why we have an endless cornucopia of genres, subgenres and micro-genres such as “astral house” or “intelli-pop.” Certain elements of genres just don’t resonate with all people. Realistically, a majority of music consumers are casual listeners—roamers of radio stations who don’t care if a song COURTESY_FLICKR_GEORGE_KELLY

SEARCH NIGHT

by Micah Smith

Music reviews are often polarizing because music itself is polarizing.

uses a celebrated surf-pop writer as a metaphor for discontent. They want songs that are applicable to their lives, can be cranked to high volumes during long car rides and belted like Celine Dion on the bow of the Titanic. This variability in preference goes far beyond pop and permeates all levels of audio entertainment. If I like screaming in music, you may hate it. If I like vuvuzela … OK, no one likes vuvuzela. But you get the point. All a music critic can truly do is to offer his or her best appraisal of the agreeable and disagreeable elements in any piece, hopefully, in a manner that is both non-insulting and fair-minded. The funny thing about a review, though, is that it’s another form of art. It’s literature, plain and simple, and even critics are susceptible to criticism. If you strongly disagree with a music critic or if you really believe that Ke$ha is the modern Madonna, you don’t have to be silent. Be analytical, be unbiased—but most of all, be honest.


0XVLFOLVWLQJVDUHGXHQRRQ0RQGD\WREHLQFOXGHGLQSULQW DQGRQOLQHOLVWLQJVPXVLF#MDFNVRQIUHHSUHVVFRP

3%04 7%$.%3$!9

5HHG3LHUFHœV%\UDP6RXWKRI SPIUHH 6DPœV/RXQJH-RH6PLWK 7KH *RLQJ&RQFHUQ 6KXFNHUœV0HPSKLV<DKRRV SP7UDYHOLQ¡-DQH GHFN  SPIUHH 6RXO:LUHG&DIp0,1'JDVP (URWLF3RHWU\1LJKW 8QGHUJURXQG6RXWKHUQ.RP IRUW%UDVV%DQGSP

%XUJHUV %OXHV-HVVH´*XLWDUµ 6PLWKSP +XQWLQJWRQ¶V-RKQQ\%DUUDQFR SP .ULVWR¶V0DGLVRQ)LOWHU7KH 1RLVHSP 0%DU&HQW:HGQHVGD\VZ '-'XUG\&RVWHOORSPIUHH 2OJD¶V-RVHSK/D6DOODSP 6RXO:LUHG&DIp6XJDU:DWHU 3XUSOH-D]] )XVLRQ 8QGHUJURXQG$GLE6DELU SPIUHH

3%04 3!452$!9 %RWWRPV8SÂą'-'DQFLQJ 6KRZ SPFRYHU %XUJHUV %OXHV:HV/HHSP &OXE0DJRRÂśV(YHOOH )HQLDQÂśV3HWH'DZVRQSP *HRUJLD%OXH)ORZRRG$DURQ&RNHU

%XUJHUV %OXHV&DVVLH 6WDFLH SP &KHURNHH,QQ'·OR7ULR )-RQHV&RUQHU$PD]LQJ/D]\ %RL%DQGPLGQLJKW )HQLDQ¶V1LQHWKV,ULVKSP *HRUJLD%OXH)ORZRRG-DVRQ7XUQHU *HRUJLD%OXH0DGLVRQ6KDXQ 3DWWHUVRQ +DO 0DO¶V6W3DXO 7KH%UR NHQ%RQHVSPDGYDQFH GRRUDUGHQODQGQHW +XQWLQJWRQ¶V-RKQQ\%DUUDQFR SP ,6+/LYH-D]]SPDIWHUSP 0%DU.DUDRNH7KXUVGD\VZ'- -R1DVW\SPIUHH 0XVLFLDQ¶V(PSRULXP.HQQ\ 'DYLV 2OJD¶V+XQWHU*LEVRQSP 3DQ$VLD:D\QH$PPRQVSP 3RS¶V6DORRQ$DURQ&RNHU 4XH6HUD6HUD'RXEOH6KRW] 6KXFNHU¶V7ULSOH7KUHDW SPIUHH 8QGHUJURXQG.LQJ6WUHHW SPIUHH

COURTESY FILTER THE NOISE

3%04 4(523$!9

8QGHUZRRG +RXQG'RJ/XF\ SP 6KXFNHUÂśV)XOO0HDVXUH SPIUHH 6RPEUD0H[LFDQ.LWFKHQ-RKQ 0RUDDP 6RSKLDÂśV)DLUYLHZ,QQ.QLJKW %UXFHDP 7DEOH5DSKDHO6HPPHV DP

3%04 -/.$!9 +DODQG0DOÂśV&HQWUDO06%OXHV 6RFLHW\ UHVW SP .HPLVWU\6DOVD0RQGD\VSP /DVW&DOO6SRUWV*ULOO,/RYH 0RQGD\VZ'-6SRRQDIWHU SP 0DUWLQÂśV2SHQ0LF)UHH-DP 7KH3HQJXLQ0HOORZ0RQGD\V

3%04 45%3$!9 %XUJHUV %OXHV-HVVH´*XLWDU¾ 6PLWKSP )HQLDQœV2SHQ0LF 7KH/DLU6RXQG7KH5XLQ

Filter The Noise

*HRUJLD%OXH0DGLVRQ%ULDQ -RQHV 7KH/DLU1HXURWLF1RYHPEHU SP 0%DU6DWXUGD\1LJKW/LYHZ'- 6KDQRPDNIUHH 0DUWLQÂśV'LPHEURV 0DUWLQL5RRP%DVV,QYDVLRQ <R*ORZ(GLWLRQIHDW'9'- 5HLJQ:DUGH0DOLJQDWH5RE 5R\'-530DQG8QNO5\DQ SP 06$JULFXOWXUH )RUHVWU\0XVH 3%04 &2)$!9 XP&HOWLF)HVW %RWWRPV8S'-'DQFLQJZ6SH FLDO(YHQWVSPFRYHU 0RUQLQJ%HOO5HFRUGV:HLUG*LUO SPDOODJHV %XUJHUV %OXHV5LFKDUG6KDZQ 2OH7DYHUQ*DUU\%XUQVLGH .HQQ\SP 2OJDÂśV-RKQ3RZHOOSP &KHURNHH,QQ2WLV/RWXVSP 3RSÂśV6DORRQ7UDGHPDUN  5HHG3LHUFHÂśV%\UDP6RXWKRI &OXE0DJRRÂśV+DLULFDQH SPIUHH 'UHDP]0D]HIHDW)UDQNLH%HY 6KXFNHUÂśV0LNH 0DUW\ GHFN  HUO\Z7DQNSP SPIUHH0HPSKLV<DKRRV )HQLDQÂśV/DUU\:DWHUV'XRSP SP7ULSOH7KUHDW GHFN  *HRUJLD%OXH)ORZRRG&KULV*LOO SPIUHH *HRUJLD%OXH0DGLVRQ0D\'D\ 6RXO:LUHG&DIp6WULFWO\6RXO +DO 0DOÂśV6ZLQJGH3DULV 6DWXUGD\V UHVW 6HOIDZDUHZROI 55

8QGHUJURXQG6KDG]2I*UH\ +XQWLQJWRQ¶V-RKQQ\%DUUDQFR Z&XFKR*RQ]DOHV SP ,6+)LUVW)ULGD\6HSWHPEHU6RXO (GLWLRQZ/DUU\'-RKQVRQ 3%04 35.$!9 SP %XUJHUV %OXHV'RV/RFRVSP 0%DU)OLUW)ULGD\VZ'-IUHH &KDU%LJ(DV\7KUHHDP 0DUWLQ¶V6WDWLF(QVHPEOH +D]HO)LOWHU7KH1RLVHSP 06$JULFXOWXUH )RUHVWU\0XVH +RW6KRWV%\UDP0LNHDQG XP&HOWLF)HVW 0DUW\·V-DP6HVVLRQ 2OH7DYHUQ:KLWHVSLNHZ )LW]JHUDOG¶V$QG\+DUGZLFN 0DWHU·V0DUWDQG$UJLIOH[ DP 2OJD¶V+RXU7RXUSP 0XVLFLDQ¶V(PSRULXP2SHQ 3RS¶V6DORRQ7UDGHPDUN 0LF7DOHQW6KRZFDVHZ/DUU\

0DUJDULWDÂśV-RKQ0RUDSP 0XVLFLDQÂśV(PSRULXP2SHQ-DP 1LJKWZ5DOSK0LOOHUSP 2OH7DYHUQ2SHQ0LF 6DO 0RRNLHÂśV)LOWHU7KH1RLVH SP 6KXFNHUÂśV/DUU\%UHZHU SP 7LPH2XW2SHQ0LF1LJKW 8QGHUJURXQG%DUUHO+RXVH 5DPEOHUVSPIUHH

3%04 7%$.%3$!9 %XUJHUV %OXHV-HVVH´*XLWDUµ 6PLWK SP +DO 0DO¶V1HZ%RXUERQ6W -D]]%DQG +XQWLQJWRQ¶V-RKQQ\%DUUDQFR SP 0%DU &HQW:HGQHVGD\V Z'-'XUG\&RVWHOOR SP IUHH 2OJD¶V-RVHSK/D6DOODSP 6RXO:LUHG&DIp6XJDU:DWHU 3XUSOH-D]] )XVLRQ

THIS WEEK WEDNESDAY 9/4:

Jackson Restaurant Week Charity Reveal Party: w Iron Chef American Judge, Simon Majumdar (7:30 pm Big Room) THURSDAY 9/5:

St. Paul & the Broken Bones

(Red Room, Doors open at 7, starts at 8)

FRIDAY 9/6:

Swing de Paris (Restaurant) That Scoundrel, The Greater States & Selfawarewolf (Red Room)

SATURDAY 9/7:

SBase Invasion II featuring Chicagoâ&#x20AC;&#x2122;s own : DJ Rozz EDM event (Red Room, 18+) MONDAY 9/9:

Central MS Blues Society presents Blue Monday (Restaurant)

TUESDAY 9/10:

Pub Quiz with Erin Pearson & Friends (Restaurant)

BUY GROWLERS O F Y O U R F AV O R I T E BEER TO TAKE HOME

$24

for first time fill for high gravity beer Refills are $20.00

$19

for first time fill for regular beer Refills are $15.00

*HWUHJLRQDOSLFNV QHZUHOHDVHVDQG RWKHUPXVLFQHZV HYHU\ZHHNDW 7KH0XVLF%ORJDW MISPVPXVLFEORJ

2-for-1 EVERYTHING*

Tuesday-Friday from 4:00-7:00 (*excludes food and specialty drinks)

Wednesday, September 4th

ADIB SABIR

(blues/folk) 6:30, No Cover

Thursday, September 5th

KING STREET

(blues) 8:00, No Cover

Friday, September 6th

SOUTHERN KOMFORT

(brass band) 9:00, $10 Cover

Saturday, September 7th

SHADZ OF GREY WITH CUCHO GONZALES (funk) 9:00, $10 Cover

Tuesday, September 10th

BARREL HOUSE RAMBLERS

(jazz) 6:30, No Cover

COMING SOON

&RQWDFWLQIRDW MISPVPXVLFYHQXHV

'LDQD5RVV+DUUDK·V&DVLQR7XQLFD 6WHHO\'DQ0XG,VODQG$PSLWKHDWUH0HPSKLV 5(26SHHGZDJRQ,3&DVLQR%LOR[L (GZDUG6KDUSH 7KH0DJQHWLF=HURV,URQ&LW\/LYH%LUPLQJKDP 0XPIRUG 6RQV2DN0RXQWDLQ$PSLWKHDWUH3HOKDP$/ /XFLQGD:LOOLDPV0LQJOHZRRG+DOO0HPSKLV

End Of Summer Happy Hour!

Visit HalandMals.com for a full menu and concert schedule

601.948.0888 200 S. Commerce St. Downtown Jackson, Mississippi

Mark â&#x20AC;&#x153;Mulemanâ&#x20AC;? Massey

Friday, September 13 119 S. President Street 601.352.2322 www.Underground119.com

jacksonfreepress.com

MUSIC | live

37


DIVERSIONS | jfp sports the best in sports over the next seven days

SLATE

College footballâ&#x20AC;&#x2122;s opening night has already shown us potentially the Game of the Year: Ole Miss versus Vanderbilt.

by Bryan Flynn

THURSDAY, SEPT. 5 NFL (7:30-11 p.m., NBC): The season kicks off with the defending Super Bowl champions the Baltimore Ravens at the Denver Broncos in a rematch of a great playoff game from last season. FRIDAY, SEPT. 6 College football (7-10 p.m., ESPN 2): An ACC highlights Friday night sees the Wake Forest Demon Deacons hit the road to face the Boston College Eagles. SATURDAY, SEPT. 7 College Football (2:30-6 p.m., CSS): The Mississippi State Bulldogs look to bounce back from their loss against Oklahoma State and avoid an FCS upset against the Alcorn State Braves. â&#x20AC;¦ (6-9 p.m., Big Ten Network): The Southern Miss Golden Eagles start the first of three road games, facing the Nebraska Cornhuskers. SUNDAY, SEPT. 8 NFL (noon-3 p.m., Fox): The New Orleans Saints get a chance to get the bad taste of the 2012 season out of their mouths against the Atlanta Falcons.

MONDAY, SEPT. 9 NFL (6 p.m.-1 a.m., ESPN): A NFL doubleheader features the return of RG3 and the Washington Redskins against former Oregon coach Chip Kelly and the Philadelphia Eagles, followed by the Houston Texans and the San Diego Chargers. TUESDAY, SEPT. 10 Soccer (7-9 p.m., ESPN): The march to Brazil 2014 continues for the United States Menâ&#x20AC;&#x2122;s National Team in a World Cup-qualifyingmatchagainstrivalMexico. WEDNESDAY, SEPT. 11 MLB (6-9 p.m., ESPN): The Boston Red Sox try to hold on to their AL East lead against second-place Tampa Bay Rays, who have a chance at one of the World Series wildcard spots. College football also brought back Heisman Trophy winner Johnny Manziel. It is great to see a kid on the field having fun, but Manziel went past having fun to being truly obnoxious. Follow Bryan Flynn at jfpsports.com, @jfpsports and at facebook.com/jfpsports.

bryanâ&#x20AC;&#x2122;s rant

Beware the FCS

T

September 4 -10, 2013

â&#x20AC;¢ Parties, Meetings, Concerts, Album Releases & Live Digital Recording Sessions â&#x20AC;¢ Onsite Catering and Full Service Bar â&#x20AC;¢ Call for Pricing and Availability

38

642 Tombigbee St. 601.973.3400 Thu, August 29th College Spaghetti Night All-You-Can-Eat $5.99 with school ID $7.99 without Live Music & Beer Specials

Sun, September 1st Open Mic Talent Showcase 3pm-7pm Larry Underwood and Hound Dog Lucy All Musicians Welcome

Tue, September 3rd Open Mic Jam with Ralph Miller 7pm-11pm

KLV\HDULQFROOHJHIRRWEDOOPLJKWSURYLGHDQLQ WHUHVWLQJWKHPHWRZDWFKIRU  7HDPVIURPWKH)RRWEDOO%RZO6XEGLYLVLRQ² RQFH'LYLVLRQ,²FDQ¶WRYHUORRNWKH)RRWEDOO&KDPSL RQVKLS6XEGLYLVLRQRU)&6IRUPHUO\'LYLVLRQ,$$  0DQ\)%6WHDPVVFKHGXOH)&6WHDPVIRUFUHDP SXIIRSHQLQJJDPHVRUIRUDQHDV\KRPHFRPLQJZLQ WRPDNHWKHIDQVKDSS\7KH)&6WHDPVJHWFDVKDQG H[SHFWWRWDNHDEHDWGRZQIRUDFFHSWLQJVDLGSD\RXW -XVWDERXWHYHU\)%6WHDPGRHVLW7KLVVHDVRQ0LV VLVVLSSL6WDWHSOD\V$OFRUQ6WDWHDQG2OH0LVVSOD\V 6RXWKHDVW0LVVRXUL6WDWH  )&6WHDPVVFKHGXOHWKHVHSD\RIIJDPHVWRIXQG WKHLUDWKOHWLFGHSDUWPHQWVIRUWKHFRPLQJ\HDU%XW ZKDWKDSSHQVZKHQ)&6WHDPVWDNHWKHPRQH\DQG WKHYLFWRU\KRPHZLWKWKHP"  ,W LV WKH SHUIHFW VFHQDULR IRU )&6 WHDPV DQG D QLJKWPDUH RQH IRU )%6 WHDPV 6XFK XSVHWV FRVW FRDFKHVWKHLUMREVDQGFDXVHIDQXSURDU  6HHPLQJO\QRWHDPLVLPPXQHWRWKH)&6XSVHW 0LVVLVVLSSL 6WDWH ORVW WR 0DLQH  LQ  DQG 2OH0LVVIHOOWR-DFNVRQYLOOH6WDWHLQRYHUWLPH LQ  /DVW ZHHNHQG ZDV IULJKWHQLQJ IRU )%6 WHDPV 6HYHQ)&6WHDPVZDONHGDZD\ZLWKDYLFWRU\DQGWKH FDVKDQGVHYHUDOPRUH)&6WHDPVNHSWJDPHVFORVH XQWLOWKHHQGEHIRUHORVLQJ  /DVWVHDVRQHLJKW)&6WHDPVKDGYLFWRULHVRYHU )%6VTXDGVODVWVHDVRQLI\RXFRXQW*HRUJLD6WDWH ORVLQJWR6DPIRUG *HRUJLD6WDWHLVWUDQVLWLRQLQJWR WKH)%6OHYHOZKLFKPHDQVWKH\ZHUHDQ)&6WHDP

RQO\DVHDVRQRUWZRDJRVRLWLVKDUGWRFRXQWWKLV DVDWUXH)&6RYHU)%6ZLQ

 1RWRQO\GLGQHDUO\WKDWPDQ\)&6WHDPVGHIHDW )%6WHDPVODVWZHHNHQGWKRVH)&6WHDPVZHUHEHDW LQJVFKRROVIURPWKH%&6FRQIHUHQFHV  'HIHQGLQJ %LJ FKDPSLRQV .DQVDV 6WDWH SDLG WR1RUWK'DNRWD6WDWHRQO\WRVHHWKH%L VRQZDONDZD\ZLWKDZLQ2UHJRQ6WDWHZDV VXSSRVHGWRFKDOOHQJH6WDQIRUGDQG2UHJRQLQWKH 3DFWKLVVHDVRQEXWDIWHUSD\LQJWRWDNH D  ORVV LW ORRNV OLNH WKH %HDYHUV DUH LQ IRU D URXJKFRQIHUHQFHVHDVRQ  7ZRWHDPVIURPWKHQHZO\IRUPHG$PHULFDQ$WK OHWLF&RQIHUHQFH IRUPHGDIWHUWKH%LJ(DVWEDVNHWEDOO VFKRROVOHIWDQGWRRNWKH%LJ7HQQDPHZLWKWKHP  IHOOWR)&6WHDPV&RQQHFWLFXWSDLG7RZVRQ RQO\WRORVHDQG0F1HHVH6WDWHWRRN IURP 6RXWK )ORULGD WR GURS D  EHDWGRZQ RQWKH%XOOV  7KH %LJ JRW KLW E\ DQ )&6 XSVHW WZLFH WKLV ZHHNHQG 1RW RQO\ GLG .DQVDV 6WDWH JR GRZQ EXW ,RZD 6WDWH SDLG  WR 1RUWKHUQ ,RZD DQG ORVW  6DQ'LHJR6WDWHRXWRIWKH0RXQWDLQ:HVW&RQ IHUHQFHSDLGWRJRGRZQWR(DVWHUQ ,OOLQRLV EHWWHU NQRZQ DV 7RQ\ 5RPR¶V DOPD PDWHU XQWLO6DWXUGD\6RXWK$ODEDPDRXWRIWKH6XQ%HOW &RQIHUHQFH SDLG  WR 6RXWKHUQ 8WDK RQO\ WRORVH  7KLVFRPLQJZHHNHQG068DQG2OH0LVVEHWWHU EHZDUHWKHSRWHQWLDO)&6XSVHW

See this weekâ&#x20AC;&#x2122;s College Football Top 25 poll at jfp.ms/2013pollweek2 and look for it to return to the paper in next weekâ&#x20AC;&#x2122;s issue.


METRO JACKSON OPEN HOUSES

2226 MEAGAN DR BYRAM, MS 39272

(3/2/$112,500) Traditional, 1 Story, Carpet, Laminate, 9+ Ceilings, All Window Treatments, Fireplace, Master Bath, Walk-In Closet, Walk-Up Attic, 1 Car, Attached Garage Open Date: 9/8/2013 2:00 PM-4:30 PM WEICHERT, REALTORS-MARTELLA-CLARK

229 SHENANDOAH RD BRANDON, MS 39047

(4/2/$117,000) Traditional, Laminate, Tile, All Window Treatments, Fireplace, 2 Car, Garage Open Date: 9/8/2013 2:00 PM-4:00 PM CRYE-LEIKE REALTORS

5216 BROOKVIEW DR JACKSON, MS 39272

(3/2/$149,900) Traditional 1 Story, Brick/Pavers, Carpet, Linoleum/Vinyl, 9+ Ceilings, Beamed Ceiling, Cathedral/Vaulted Ceiling, Fireplace, Master Bath, Walk-In Closet, Wet Bar, 2 Car, Attached Garage Open Date: 9/8/2013 2:00 PM-4:00 PM CENTURY 21 MASELLE & ASSOC

233 ROCKBRIDGE DR MADISON, MS 39110

(3/2/$209,999) Traditional 1 Story, Stone/Scored Concrete, Tile, 9+ Ceilings, Cathedral/ Vaulted Ceiling, Double Vanity, Fireplace, Master Bath, Separate Shower, Split Plan, 2 Car, Attached Garage Open Date: 9/7/2013 1:00 PM-4:00 PM NIX-TANN & ASSOCIATES, INC.

212 SUMMER OAK TRL MADISON, MS 39110

(4/3/$259,900) Traditional, 2 Story, Ceramic Tile, Slate, Wood, 9+ Ceilings, Attic Floored, Double Vanity, Fireplace, Master Bath, Separate Shower, Walk-In Closet, 3+ Cars, Attached Garage Open Date: 9/8/2013 2:00 PM-4:00 PM COLDWELL BANKER GRAHAM & ASSOCIATES

130 EASTSIDE DR BRANDON, MS 39047

(4/3.5/$289,000) Traditional, 1-1/2 Story, Tile, Wood, 9+ Ceilings, Fireplace, Split Plan, Walk-In Closet, Walk-Up Attic, 2 Car, Security Open Date: 9/8/2013 2:00 PM-4:00 PM CRYE-LEIKE REALTORS

546 FLORENCE DR MADISON, MS 39110

(4/3/$414,500) French Acadian, 1-1/2 Story, Brick/Pavers, Carpet, Tile, Wood, 9+ Ceilings, Double Vanity, Fireplace, Master Bath, Walk-In Closet, 2 Car, Garage Open Date: 9/8/2013 2:00 PM-4:00 PM KEYTRUST PROPERTIES PAULA RICKS

Information courtesy of MLS of Jackson Miss. Inc.

%<0$77-21(6

*HWÃ&#x20AC;LQFK\ 3ULQWHU¶VPHDVXUHPHQWV 6HDQRI³:LOO *UDFH´ ³-XUDVVLF3DUN´LQKDELWDQWVIRU VKRUW &KDUWHUBBB WUHHRQ&RQQHFWLFXW¶V VWDWHTXDUWHU

*LJJHDU &HOHEUDQWV³LQWKHKRXVH´ 0LFKHOOH2EDPDBBB5RELQVRQ 3UHNLVVVWDWHPHQW +DUGWRFDWFK &KDQQHOZLWKWKH86UHPDNHRI ³7KH&KDVH´ (DWLQJ/2/FDWV\OODEOH /LNHWKHIRXUWKHPHHQWULHVLQWKLV SX]]OHDVLWZHUH

$EEUIRU0RQRSRO\SURSHUWLHV 'RHVVRPHSDYLQJ 1RPRUHWKDQ 6KDNHVSHDUHZLWK³WKH´ *ORYHUZKRZDVEDQQHGIURP /HWWHUPDQ¶VVKRZ /LIWOLNHDJODVV &RPHXSVKRUW /LNHVRPHSDSHUWRZHOV $2/JLYHDZD\RIWKHSDVW %DWWOHVKLSVXFFHVV 6XQKHOPHWV

0DNHHTXDOSDUWVPD\EH 6SRUWZLWKFOD\SLJHRQV 'LVSOD\LQDJDOOHU\ +RPHRI,RZD6WDWH 5XVVLDQUHIXVDO ³:LWKRXWIXUWKHUBBB´ 6XJDUVXI¿[ Â&#x2039;-RQHVLQ¶&URVVZRUGV HGLWRU#MRQHVLQFURVVZRUGVFRP

,AST7EEK´S!NSWERS

)RUDQVZHUVWRWKLVSX]]OHFDOOFHQWVSHUPLQXWH0XVWEH 2UWRELOOWR\RXUFUHGLWFDUGFDOO5HIHUHQFHSX]]OH

$OWN

!CROSS

*XDUGVFKHFNWKHP $LUJXQSHOOHWV 6HQWWRWKHFDQYDV +HSOD\HGVWURQJVLOHQWUROHV &RPHG\FOXEODXJK (QJDJHLQPLPLFU\ 3UHFLRXVFRLQ" 6RDNXSWKHVXQ %ULWLVK2SHQZLQQHU(UQLH )LUVWQDPHLQVGD\WLPH79 2QHZD\WRDQVZHUDTXHVWLRQ &DOLIRUQLDYROFDQLFSHDN ,WFRPHVEHIRUH(

³,/RVW,WDWWKH0RYLHV´DXWKRU 3DXOLQH ³7KH)DU6LGH´RUJDQLVP 7KLQNLQJFOHDUO\ -XGJH¶VDI¿UPDWLRQV %XPSLQWR (DFKSULFHZLVH 0DNHURI0XVNFRORJQHDQG SHUIXPH 2R]\FKHHVH WLPH:623FKDPS8QJDU 0RUHOLNHNLWWHQYLGHRV (DUO\V\QWKHWLF¿EHU 3D\VWULEXWHWR 3RODULVHJ

%<0$77-21(6

,AST7EEK´S!NSWERS

±+AIDOKU²

(DFKRIWKHOHWWHUVRIWKHDOSKDEHWLVUHSUHVHQWHGLQWKLVJULGE\DQXPEHUEHWZHHQDQG8VLQJOHWWHU IUHTXHQF\ZRUGSDWWHUQUHFRJQLWLRQDQGWKHQXPEHUVDV\RXUJXLGHV¿OOLQWKHJULGZLWKZHOONQRZQ(QJOLVK ZRUGV +,17VLQFHD4LVDOZD\VIROORZHGE\D8WU\KXQWLQJGRZQWKH4¿UVW 2QO\ORZHUFDVHXQK\SKHQDWHG ZRUGVDUHDOORZHGLQNDLGRNXVR\RXZRQ WVHHDQ\WKLQJOLNH672&.+2/0RU/21*/267LQKHUH EXW\RX PLJKWVHH$)*+$1VLQFHLWKDVDQXQFDSLWDOL]HGPHDQLQJWRR 1RZVWRSZDVWLQJP\SUHFLRXVWLPHDQG 62/9(SV\FKRVXGRNX#KRWPDLOFRP

jacksonfreepress.com

±(UNTAND0ECK²²NH\VDUHWKHNH\

$SSO\IRUFH ³/LWWOH5DVFDOV´JLUO *UHHQYHJHWDEOH 3OD\WKHSDUW ³:KDW¶VZURQJZLWKWKH¿UVWRQH"´ ZRUN 7LPHRIRULJLQ 'LQHVODWH )RUPHUFKLOGDFWUHVV$PDQGD +RWGRJKROGHU 6WDGLXP¿OPHUV ³)LUHZRUN´VLQJHU $XVWUDOLDQJHP 6D\LWGLGQ¶WKDSSHQ 0XVOLPKROLGD\ *ROGWR0H[LFDQV 3DVVRYHU -HVVLFDRIWKH37/&OXEVFDQGDO %DQGLW¶VWDNH 6FRWWZKRSOD\V%RE/REODZ /DVWZRUGLQVHUPRQV 7RQJXHBBB VFROG

³,ILWZHUHBBBPH´ /RFDOORFNXS

39


SEPTEMBER 6 - 8, 2013

toMONET

MUM’s the word

OLD MASTERS

for

three centuries of french  painting from the  wadsworth atheneum

T

FALL!

THE ANNIE LAURIE SWAIM HEARIN MEMORIAL EXHIBITION SERIES

paintings   in

!"#$%$&'()$")*$"+",(%"

-$$.$,/"!0 Old Masters to

650 Hwy 51 | Ridgeland    Interiors Market | Fondren

Monet the Museum will

 www.martinsonsms.com  601.856.3078

&$"!1$,"#!,)2,3!34%5" 0!'"+"0)5"*!3'46""7242) 88869:9;:<;9=>?6@>A" 0!'"$B$,)"4#*$/3%$6

hours

voted the

Best Place For Luanckcshon

MISSISSIPPI MUSEUM of ART

In WesJatckJson 2013

601.960.1515 1.866.VIEWART 380 SOUTH LAMAR STREET JACKSON, MS 39201

Old Masters to Monet""24"!'C(,2D$/"&5")*$"8(/4-!')*"=)*$,$3E"934$3E"!0"=')F"G(')0!'/F"H?F"(,/"24"4311!')$/"&5"(,"2,/$E,2)5"0'!E")*$"I$/$'(%"H!3,#2%"!,")*$"=')4"(,/")*$"G3E(,2)2$46"J!#(%"1'$4$,)()2!,"!0")*24"$K*2&2)2!,"24"E(/$" 1!442&%$")*'!3C*")*$"C$,$'!34"4311!')"!0")*$">!&$')"96"G$('2,":311!')"I!3,/()2!,6"?*$"92442442112"934$3E"!0"=')"(,/"2)4"1'!C'(E4"('$"41!,4!'$/"2,"1(')"&5")*$"#2)5"!0"L(#.4!,F")*$"L(#.4!,"H!,B$,)2!,"M"7242)!'4"N3'$(3F"(,/" The Clarion-Ledger"9$/2("A'!316":311!')"24"(%4!"1'!B2/$/"2,"1(')"&5"03,/2,C"0'!E")*$"92442442112"=')4"H!EE2442!,F"("4)()$"(C$,#5F"(,/"2,"1(')"&5")*$"O()2!,(%"<,/!-E$,)"0!'")*$"=')4F"("0$/$'(%"(C$,#56""""" =N@7<P"72,#$,)"B(,"A!C*"QRSTUVRSWXYF":$%0Z[!')'(2)F"#6"RSS\6"!2%"!,"#(,B(46"RT"T]S"K"RU"R]^"2,6"H!%%$#)2!,"!0"8(/4-!')*"=)*$,$3E"934$3E"!0"=')F"G(')0!'/F"H?6"A20)"!0"[*2%21"J6"A!!/-2,"2,"E$E!'5"!0"*24"E!)*$'F"L!4$1*2,$":6"A!!/-2,F"RWT^6RS

Best of

136 S. Adams Street Jackson (Located on Metro Parkway) 601.960.3008 koinoniacoffee.net

Millsaps College

Driving the Conversation “Across the Street and Around the Globe” September 3, 7 p.m.

Arts & Lecture Series: Rambling Steve Gardner Gertrude C. Ford Academic Complex, Recital Hall Admission: $10

September 7, 7 p.m.

Backyard Brawl – Millsaps v. Mississippi College Robinson-Hale Stadium, Mississippi College Tickets available at gomajors.com

September 13, 12:30-1:30 p.m.

Friday Forum: Dance for PD® with David Leventhal and Misty Owens

September 4 - 10, 2013

Gertrude C. Ford Academic Complex, Room 215 Admission: Free

40

September 17, Begins at 9:30 a.m.

Summers Lecture: “The Harmony of Liturgy & Life: A Day with Don & Emily Saliers” Gertrude C. Ford Academic Complex, Room 215 Lectures are free and open to the public. Registration required. Lunch: $10

September 25, 8:30 a.m.

Else School of Management Fall Forum: Economists Darrin Webb and Greg Daco

Robert and Dee Leggett Special Events Center Admission: Free

www.millsaps.edu


BULLETIN BOARD: Classifieds

6)2'/!UG 3EPT 

,QKLV³6RQJRIWKH2SHQ5RDG´:DOW:KLWPDQZURWHVRPHO\ULFVWKDW,KRSHZLOOSURYLGH\RX ZLWKMXVWWKHULJKWVSDUN(YHQLI\RX¶UHQRWHPEDUNLQJRQDOLWHUDOMRXUQH\DORQJDELJZLGH KLJKZD\P\JXHVVLVWKDW\RXDUHDWOHDVWJRLQJWRGRWKHPHWDSKRULFDOHTXLYDOHQW³+HQFHIRUWK ,DVNQRWJRRGIRUWXQH²,P\VHOIDPJRRGIRUWXQH´VDLG8QFOH:DOW³+HQFHIRUWK,ZKLPSHUQR PRUHSRVWSRQHQRPRUHQHHGQRWKLQJ6WURQJDQGFRQWHQW,WUDYHOWKHRSHQURDG´

0\VWLFDOSRHW6W-RKQRIWKH&URVV  ZDV RQHRI6SDLQ¶VJUHDWHVWZULWHUV%XWQRWDOORIKLVZRUN FDPHHDVLO\:KHQKHZDVDULYDOUHOLJLRXVJURXS LPSULVRQHGKLPIRUKLVPLOGO\KHUHWLFDOLGHDV+HVSHQW WKHQH[WQLQHPRQWKVLQDWHQIRRWE\VL[IRRWMDLOFHOO ZKHUHKHZDVVWDUYHGEHDWHQDQGWRUWXUHG,WZDVWKHUH WKDWKHFRPSRVHGKLVPRVWUHQRZQHGSRHP³6SLULWXDO &DQWLFOH´'RHVWKDWSURYLGH\RXZLWKDQ\LQVSLUDWLRQ /LEUD",¶OOPDNHDZLOGJXHVVDQGVSHFXODWHWKDWPD\EH \RX¶UHLQDWRXJKVLWXDWLRQ\RXUVHOIULJKWQRZ,W¶VQRW HYHQRQHSHUFHQWDVWRXJKDV6W-RKQ¶VWKRXJK,IKH FRXOGVTXHH]HVRPHEULOOLDQFHRXWRIKLVSUHGLFDPHQW \RXFDQWRR

3#/20)//CT .OV 

7KH$PHULFDQQDWXUDOLVW-RKQ%XUURXJKV   WUDYHOHGZLGHO\DQGZURWHERRNV³,VWLOO¿QGHDFKGD\ WRRVKRUWIRUDOOWKHWKRXJKWV,ZDQWWRWKLQN´KHWHVWL ¿HG³DOOWKHZDONV,ZDQWWRWDNHDOOWKHERRNV,ZDQWWR UHDGDQGDOOWKHIULHQGV,ZDQWWRVHH´/HW¶VPDNHWKDW ORQJLQJIRUDEXQGDQFHVHUYHDV\RXUUDOO\LQJFU\GXULQJ WKHQH[WWZRZHHNV6FRUSLR$FFRUGLQJWRP\DQDO\VLV RIWKHDVWURORJLFDORPHQV\RXKDYHDFRVPLFPDQGDWH WRSXVKWRWKHOLPLWV²DQGVRPHWLPHVEH\RQG²DV\RX VDWLVI\\RXUTXHVWWREHVHHDQGGRHYHU\WKLQJ\RXORYH WREHVHHDQGGR

3!')44!2)53.OV $EC 

3XQNLFRQ+HQU\5ROOLQVGLGDQLQWHUYLHZZLWK0DULO\Q 0DQVRQURFNDQGUROO¶VPDVWHURIWKHJURWHVTXH,W¶VRQ <RXWXEH7KHFRPPHQWVVHFWLRQEHQHDWKWKHYLGHRDUH ULIHZLWKVSLWHDQGELOHGLUHFWHGWRZDUG0DQVRQGULYLQJ RQHIDQWRGHIHQGKHUKHUR³,ORYH0DULO\Q0DQVRQVR PXFKWKDW,FRXOGSXNHUDLQERZV´VKHWHVWL¿HG,WKLQN \RXZLOOQHHGWRWDSLQWRWKDWNLQGRIORYHLQWKHFRPLQJ GD\V6DJLWWDULXV¿HUFHLQWHQVHDQGGHYRWLRQDODQG\HW DOVRSOD\IXOIXQQ\DQGH[KLODUDWLQJ<RXGRQ¶WQHFHVVDU LO\KDYHWRSXNHUDLQERZVKRZHYHU0D\EH\RXFRXOG PHUHO\VSLWWKHP

#!02)#/2.$EC *AN 

,I\RXZDQWWRNQRZDVHFUHW,WDONOHVVFUD]\WR\RX &DSULFRUQVWKDQ,GRWRWKHRWKHUVLJQV,WRQHGRZQP\ ZLOGH\HGJRGGHVVGUXQNVKDSHVKLIWLQJDELW,UDUHO\ H[KRUW\RXWRGRQDQDQLPDOFRVWXPHDQGGDQFHZLWK WKHIDLU\IRONLQWKHZRRGVDQG,WKLQNWKHODVWWLPH, VXJJHVWHGWKDW\RXIDOOLQORYHZLWKDQDOLHQDQJHORU GHLW\ZDVQHYHU6RZKDW¶VP\SUREOHP"'RQ¶W\RX IHHOWDERRXUJHVDQGLOOLFLWLPSXOVHVQRZDQGWKHQ",VQ¶W LWWUXHWKDWOLNHHYHU\RQHHOVH\RXSHULRGLFDOO\QHHGWR VOLSDZD\IURP\RXUKDELWXDOJURRYHVDQGWDPSHUZLWK WKHFRQYHQWLRQDOZLVGRP"2IFRXUVH\RXGR:KLFKLV ZK\,KHUHE\UHSHDOP\H[FHVVLYHFDXWLRQ*HWRXWWKHUH &DSULFRUQDQGEHDVXQLQKLELWHGDV\RXGDUH

!15!2)53*AN &EB 

*HUPDQ\¶V2VWZDOO0XVHXPGLVSOD\HGDFRQFHSWXDO LQVWDOODWLRQE\WKHDUWLVW0DUWLQ.LSSHQEHUJHU9DOXHGDW PLOOLRQLWZDVFDOOHG³:KHQ,W6WDUWV'ULSSLQJIURP WKH&HLOLQJ´3DUWRILWZDVFRPSRVHGRIDUXEEHUWXE WKDWZDVSDLQWHGWRDSSHDUDVLILWKDGRQFHKHOGGLUW\ UDLQZDWHU2QHQLJKWZKLOHWKHPXVHXPZDVFORVHG DQHZMDQLWRUFDPHLQWRWLG\XSWKHSUHPLVHV:KLOH SHUIRUPLQJKHUWDVNVVKHVFUXEEHGWKHUXEEHUWXEXQWLO LWZDV³FOHDQ´WKHUHE\GDPDJLQJWKHDUW/HWWKLVEHD FDXWLRQDU\WDOH$TXDULXV,W¶VLPSRUWDQWIRU\RXWRDSSUH FLDWHDQGOHDUQIURPWKHPHVV\VWXIILQ\RXUOLIH²HYHQ DGPLUHLWVDUWLVWU\²DQGQRWMXVWDVVXPHLWDOOQHHGVWR EHVFRXUHGDQGGLVLQIHFWHG

0)3#%3&EB -ARCH 

,QKHUQRYHO³:KLWH2OHDQGHU´-DQHW)LWFKVXJJHVWVWKDW EHDXW\LVVRPHWKLQJWREHXVHG³OLNHDKDPPHURUD NH\´7KDW¶V\RXUDVVLJQPHQW3LVFHV)LQGSUDFWLFDOZD\V WRPDNH\RXUEHDXW\ZRUNIRU\RX)RUH[DPSOHLQYRNH

LWWRKHOS\RXZLQIULHQGVDQGLQÀXHQFHSHRSOH3XWLW LQWRDFWLRQWRGUXPXSQHZRSSRUWXQLWLHVDQGKXQWGRZQ SURYRFDWLYHLQYLWDWLRQV$QGGRQ¶WWHOOPH\RXSRVVHVV LQVXI¿FLHQWEHDXW\WRDFFRPSOLVKWKHVHWKLQJV,JXDUDQ WHH\RXWKDW\RXKDYHPRUHWKDQHQRXJK7RXQGHUVWDQG ZK\,¶PVRVXUH\RXPD\KDYHWRVKHGVRPHXJO\GH¿QL WLRQVRIEHDXW\\RX¶YHXQFRQVFLRXVO\DEVRUEHGIURPRXU ZDUSHGFXOWXUH

!2)%3-ARCH !PRIL 

³1RUHJUHWV"5HDOO\"´DVNVDXWKRU5LFKDUG3RZHU³,KDYH UHJUHWV7KH\DUHVDFUHGWRPH7KH\LQIRUPP\FKDU DFWHU7KH\EHDUZLWQHVVWRP\HYROXWLRQ*OLPSVHVRI ORVWORYHDQGWUHDVXUHDUHKHOGLQVLGHRIWKHPOLNHVPDOO EHDXWLIXOFUHDWXUHVVXVSHQGHGLQDPEHU´,WKLQN\RX FDQVHHZKHUHWKLVKRURVFRSHLVJRLQJ$ULHV,¶PJRLQJ WRVXJJHVW\RXGRZKDW3RZHUVDGYLVHV³'RQRWDYRLG \RXUUHJUHWV(PEUDFHWKHP/LVWHQWRWKHLUVWRULHV+ROG WKHPWR\RXUKHDUWZKHQ\RXZDQWWRUHPHPEHUWKH SULFH\RXSDLGWREHFRPHZKR\RXWUXO\DUH´ )LQGPRUH E\5LFKDUG3RZHUKHUHWLQ\XUOFRP5LFKDUG3RZHU

4!5253!PRIL -AY 

8UEDQGLFWLRQDU\FRPVD\VWKDWWKHQHZO\FRLQHGZRUG ³RUJDVQRP´LVZKDW\RXFDOOWKHHFVWDWLFIHHOLQJV \RXKDYHDV\RXHDWHVSHFLDOO\GHOHFWDEOHIRRG,W¶V GHULYHGRIFRXUVHIURPWKHZRUG³RUJDVP´$FFRUGLQJ WRP\UHDGLQJRIWKHDVWURORJLFDORPHQV\RXDUHLQDQ H[FHOOHQWSRVLWLRQWRKDYHDQXPEHURIRUJDVPLFOLNH EUHDNWKURXJKVLQWKHFRPLQJZHHN2UJDVQRPVDUH FHUWDLQO\DPRQJWKHPEXWDOVRRUJDVDXUDOVRUJDVLJKWV DQGRUJDVYHUVDWLRQV²LQRWKHUZRUGVGHHSWKULOOVUHVXOW LQJIURPEOLVVIXOVRXQGVUDSWXURXVYLVLRQVDQGH[FLWLQJ FRQYHUVDWLRQV,ZRQ¶WEHVXUSULVHGLI\RXDOVRH[SHUL HQFHVHYHUDORWKHUNLQGVRIEHDXWLIXOGHOLULXP

HELP WANTED

RETAIL

$IRECT46IS(IRING

2EBECCA2OSE&LEA-ARKET

',5(&79LVFXUUHQWO\UHFUXLWLQJIRUWKHIROORZLQJ SRVLWLRQLQ-DFNVRQ6DWHOOLWH,QVWDOODWLRQ7HFKQLFLDQ ,I\RXDUHQRWDEOHWRDFFHVVRXUZHEVLWH',5(&79 FRPPDLO\RXUUHVXPHDQGVDODU\UHTXLUHPHQWV WR',5(&79$WWQ7DOHQW$FTXLVLWLRQ,QYHUQHVV 'ULYH:HVW(QJOHZRRG&27RDSSO\RQOLQH YLVLWZZZGLUHFWYFRPFDUHHUV(2(

(ELP7ANTED

PDNHH[WUDPRQH\LQRXUIUHHHYHUSRSXODU KRPHPDLOHUSURJUDPLQFOXGHVYDOXDEOHJXLGHERRN 6WDUWLPPHGLDWHO\*HQXLQHZZZ HDV\ZRUNIURPKRPHFRP $$1&$1

)NDUSTRIAL*OBS.OW

:RUNLQJ6ROXWLRQVLVVHHNLQJHPSOR\HHVIRUKHDY\ LQGXVWULDOZRUNLQ-DFNVRQ:HKDYHORQJDQGVKRUW WHUPRSSRUWXQLWLHV3UH+LUHGUXJVFUHHQUHT$SSO\ WRGD\DWZZZZRUNLQJVROXWLRQVXVDFRP

SERVICES 0ROFESSIONAL(OUSE#LEANING

:HRIIHUZHHNO\E\ZHHNO\PRQWKO\RURQHWLPH KRXVHRURI¿FHFOHDQLQJ%HVWUDWHVLQWKHDUHD ZZZKRXVHFOHDQLQJPVFRP  

4ERESAqS(OUSE#LEANING

/HWPHKHOSWRPDNH\RXUKRXVHDKRPH$IIRUGDEOH KLJKTXDOLW\FOHDQLQJVHUYLFH1RKRPHWRRELJRU VPDOO5HIHUHQFHVDYDLODEOH&DOOWRGD\  

&RPHMRLQXVLQ\RXUVHDUFKIRUKLGGHQWUHDVXUHV 2YHUVTIWRILQGRRUVKRSSLQJ2UJDQL]HG FOHDQIULHQGO\VHUYLFH&UHGLW'HELWFDUGVDFFHSWHG /LNHXVRQIDFHERRNUHEHFFDURVHÀHDPDUNHW +Z\65LFKODQG06  

$)3(462ETAILER

6WDUWLQJDWPRQWK IRUPRV  +LJK6SHHG ,QWHUQHWVWDUWLQJDWPRQWK ZKHUHDYDLODEOH  6$9($VN$ERXW6$0('$<,QVWDOODWLRQ&$//1RZ 

REAL ESTATE (ANDY-AN3PECIAL

EHGEDWK0XVW6HOO&DOO  

TO PLACE A CLASSIFIED AD: Post an ad at jfpclassifieds.com, call 601-362-6121, ext. 11 or fax to 601-510-9019. Deadline: Mondays at noon.

'%-).)-AY *UNE 

,I\RXZHUHDERXWWRUXQLQDORQJGLVWDQFHUDFH\RX ZRXOGQ¶WHDWDGR]HQGRXJKQXWV5LJKW",I\RXZHUH SODQQLQJWROHDYH\RXUQDWLYHODQGDQGVSHQGD\HDU OLYLQJLQ(WKLRSLD\RXZRXOGQ¶WLPPHUVH\RXUVHOILQ OHDUQLQJKRZWRVSHDN&KLQHVHLQWKHPRQWKEHIRUH\RX GHSDUWHG5LJKW",QWKDWVSLULW,KRSH\RX¶OOEHVPDUW DERXWWKHSUHSDUDWLRQV\RXPDNHLQWKHFRPLQJZHHNV 7KLVZLOOEHDWLPHWRSULPH\RXUVHOIIRUWKHDGYHQWXUHV LQVHOIH[SUHVVLRQWKDWZLOOEORRPLQODWH6HSWHPEHUDQG WKHPRQWKRI2FWREHU:KDWLVLW\RXZDQWWRFUHDWHDW WKDWWLPH":KDWZRXOG\RXOLNHWRVKRZWKHZRUOG DERXW\RXUVHOI"

#!.#%2*UNE *ULY 

7KH&RQVWLWXWLRQRIWKH8QLWHG6WDWHVLVWKHVXSUHPH ODZRIWKHODQG,W¶VWKHIRXQGDWLRQRIWKHPRVWSROLWLFDOO\ SRZHUIXOQDWLRQRQWKHSODQHW$QG\HWZKHQLWRULJL QDOO\ZHQWLQWRHIIHFWLQLWZDVRQO\ZRUGV ORQJ²DERXWWKUHHWLPHVWKHOHQJWKRIWKLVKRURVFRSH FROXPQ7KH%LOORI5LJKWVHQDFWHGLQDGGHGD PHUHZRUGV%\FRQWUDVW,QGLD¶V&RQVWLWXWLRQLV ZRUGVPRUHWKDQWLPHVORQJHU,I\RXFUHDWH DQHZPDVWHUSODQIRU\RXUVHOILQWKHFRPLQJPRQWKV &DQFHULDQ²DV,KRSH\RXZLOO²DFRPSDFWYHUVLRQOLNH $PHULFD¶VZLOOEHH[DFWO\ULJKW<RXQHHGGLDPRQGOLNH OXFLGLW\QRWVSUDZOLQJJXHVVZRUN

,%/*ULY !UG 

7KHUHDUHWZRVFLHQWL¿FWHUPVIRUWLFNOLQJ³.QLVPHVLV´ UHIHUVWRDVRIWIHDWKHU\WRXFKWKDWPD\EHPLOGO\ SOHDVXUDEOH,WFDQEHXVHGWRGLVSOD\DGRULQJWHQGHU QHVV7KHKHDYLHUGHHSHUNLQGRIWLFNOLQJLVFDOOHG ³JDUJDOHVLV´,ISOD\IXOO\DSSOLHGWRVHQVLWLYHSDUWVRI WKHDQDWRP\LWFDQSURYRNHIXQDQGODXJKWHU*LYHQWKH FXUUHQWSODQHWDU\DOLJQPHQWV/HR,FRQFOXGHWKDWERWK RIWKHVHZLOOEHULFKPHWDSKRUVIRU\RXLQWKHFRPLQJ GD\V,VXJJHVWWKDW\RXEHH[WUDDOHUWIRURSSRUWXQLWLHV WRV\PEROLFDOO\WLFNOHDQGEHWLFNOHG 36+HUH¶VDXVHIXO DOOHJRU\,I\RXGRWKHNQLVPHVLVWKLQJEHQHDWKWKH VQRXWRIDJUHDWZKLWHVKDUN\RXFDQK\SQRWL]HLW

+RPHZRUN,I\RXFRXOGPDNHPRQH\IURPGRLQJH[DFWO\ZKDW\RXORYHWRGRZKDWZRXOGLWEH" 7HVWLI\DW)UHHZLOODVWURORJ\FRP

#ALL2ICHARD3CHWARTZ

ANDHELLTAKEAWAYYOURCARWRECKBLUES Map your accident, find your car if you’ve lost it in the parking lot, and get contact info for the nearest police stations and hospitals. Download the new “1call app” to watch “Car Wreck Blues”.

 

 

!VAILABLEFORAFREEDOWNLOADINTHE!PPLEI4UNES3TORE ANDONANDROIDPHONES3EARCHhCALLAPPv

jacksonfreepress.com

,)"2!3EPT /CT 

As low as $20! jfpclassifieds.com

41


VOTE TUESDAY SEPTEMBER 24, 2013

Rock-N-Roll Hibachi & Sushi

Turns

BR^aT1XV 4eTah3Ph CWXb5^^cQP[[ BTPb^] Aug 28 - Sept 30

Join The Party

50¢ Boneless Wings Domestic Beer Specials

Sept 20th - 22nd

$8 Pitchers â&#x20AC;˘ $2.50 Pints

Drink Specials

$12 Pitchers â&#x20AC;˘ $3.50 Pints

Food Specials

BZX_CWTFPXc

& Balloons for the Kids!

Craft Beer Specials

Priorities:

â&#x20AC;˘CRIME PREVENTION â&#x20AC;˘ECONOMIC DEVELOPMENT â&#x20AC;˘EFFECTIVE COUNTY GOVERNMENT â&#x20AC;˘DEPENDABLE LEADERSHIP

Order Your Party Packs Online or by Phone 925 N State St, Jackson

601-969-6400

1430 Ellis Ave, Jackson

601-969-0606

398 Hwy 51 N, Ridgeland

601-605-0504

1001 Hampstead Blvd, Clinton

601-924-2423

2560 Lakeland Dr. â&#x20AC;˘ Flowood 601.420.4058 â&#x20AC;˘ like us on

www.Wingstop.com

With over 30 years of public service with the municipal and county government, I have the proven leadership and vision to move Hinds County forward. @DarrelMcQuirter

Darrel McQuirter

www.ElectMcQuirter.com â&#x20AC;˘ P. O. Box 1077, Clinton, MS 39060 Paid for by Friends to Elect Darrel McQuirter

WEâ&#x20AC;&#x2122;RE HAVING A LITTLE WORK DONE. Mississippi's only full service Hilton Hotel has kicked off a major renovation project. The renovation plan calls for updates in the hotel lobby, restaurants, 276 guest rooms, and a few more exciting enhancements. Entire project is scheduled to wrap up by the end of the year. We are excited about our renovation and look forward to providing you with an even better hotel!

September 4 - 10, 2013

For room reservations please visit hilton.com or call 601-957-2800

42

STAY HILTON. GO EVERYWHERE.

1001 East County Line Road | Jackson | MS 39211 | USA Š2013 Hilton Worldwide

Untitled - Page: 1

2013-06-27 15:51:19 +0100


D!D( C2DED!SPR

RTRHS-UVWH: F@G:AHA? !"#$%&'() *%+,"$%&'( #-(*./+.01." 2/034#$-#56+

789:;(<=:

4>8:?(

( : : ; < 8@(=><(*:A<

4@

*B><(<>7;8A4:8<

'(#'$%&1." " , <6 /+.0 0 *. /03J/ I

One winner every hour will get to spin the prize wheel to rescue up to $500 Cash, $250 !or cool electronic prizes including laptops, tablets, iPods® and more. Earn entries starting now. 20X entries every Sunday, Monday and Tuesday. 40X entries on Fridays and Saturdays.

30 Winners every Thursday bag big prizes! Five Hot Seat winners every hour are selected to play for a pile of money in our “mini” slot tournament. Everyone in the tournament wins – up to $500 in BonusPLAY!

L)+!J'KKGD "#$%!&'(()*+,*!-,'.!/!0123456(78!9:!;<"=#! ">=%%>%"?><"@?!/!(1A)(B'C3A123456(7D2,E

0141+!FC'G)(4!HC65!I,(!E,()!.)+'1C4D!964+!5)!@"!G)'(4!,I!'7)!,(!,A)(D!9'*'7)E)*+!()4)(A)4!'CC!! (17J+4!+,!'C+)(!,(!2'*2)C!K(,E,+1,*4!'+!'*G!+1E)!B1+J,6+!*,+12)D!L'E5C1*7!K(,5C)EM!H'CC!">===>NNN><%<%D!! O@#";!-1A)(B'C3!H'41*,!/!P,+)CD!QCC!(17J+4!()4)(A).D

jacksonfreepress.com

:Q0R

If you can’t save them, no one can!

43


Your

Fashion

Inspiration Location

HOME FOR SALE Located at Jackson, 2528 Belvedere Drive 3BR/1BA Single Family 1325 sqft, Detached Lease or Sale $750 DN, $357/mo

Call 877-535-6274 The Little Big Store Vinyl Records +45’s & 78’s

I’ve enjoyed serving you and look forward to seeing you at my new location!

ACEY’S CUSTOM HAIR DESIGN 3015 North State Street •Jackson Shelly Burns • 601.213.6688 Walk-Ins & Appointments

SOUTHLAND In Business since 1971

• CDs & Tapes Mon, Fri & Sat: • Posters 10am - 5pm • Back Issue Music Sun: 1 - 5pm Magazines & Books • T-Shirts & Memorabilia • Blu-Rays, DVDs, & VHS 601.857.8579 201 E. Main Street Raymond, Ms www.littlebigstore.com

The Law Offices of Charlie A. Carr, PLLC Attorney and Counselor At Law Criminal Defense & Civil Litigation Phone: 601.398.8663 Fax: 601.510.9643

Butler’s

AUTO SERVICE 1260 E. County Line Rd. Ridgeland platosclosetridgeland.com 601.487.8207

“Let Us Fight Your Battle For You!”

1220 E Northside Dr, Jackson, MS • 601-499-5277

5448 North State Street Jackson, MS 39206

Mention JFP2013 for

Monday-Friday 7:30 - 5:30

Repairs & Accessories

601-362-2253

SERVICES

15% Off

• A/C & Heating • Starting & Charging • Electrical Problems • Brakes & Clutches • General Maintenance • Tune-Ups & Oil Changes

GET HIM ON THE LINE. LINE.

• Transmission Service and much more!

TRY FOR FREE!

601-709-7084 More local numbers: 1.800.777.8000 Ahora en Español / 18+

The fastest growing social network for men who like men

Supplements…

Not just for baseball. (Every player wants to enhance their performance. Try a supplement and watch your batting average go up!)

175 Hwy 80 East in Pearl * 601.932.2811 M­Th: 10­10p F­Sa 10­Mid Su: 1­10p * www.shopromanticadventures.com


v11n52 - Where's the Corner Store? The 'Think Local' Business Issue