2016-05 Perth

Page 36

;";1"1.., ,�.,"1,;S<-· --;> '- .. � '� ,(
D_.-r ;;ii,_,.,S. . � � ◄ �'!) X. a,,'{� �.-- Ii.� j.J � � �i � � a"'Nj .J �f � �
THE GREENBAY ULTIMATE INCLUSIONS T NO EXTRA COST! BED3 L'DRY LINEff BED2 4170X 3100 THEATRE 4200X 3590 BED4 3690X 3170 GAMES 2670,3000 �-- --ii II - -7 --7 r FR r ' I IREC.r -- .J �ITCHEN !: · ·GASHP I · UBO ' ' RHOOO ' ;'r1 PTY -------"1 ALFRESCO DINING 4600X 4170 LIVING 5850X 4440 SOFFIT =--------oil STUDY 4220X 2450 GARAGE C ENTRY � -----------------7 MASTER SUITE 4130 X 3600 Call Saurabh Anand 0420 665 678 or visit me at our display home: The Marina Bay - Oakbella Parade, Harrisdale DISPLAY HOME OPEN: Monday &Wednesday2pm-5pm,Saturday lpm-5pm,Sunday 12pm 5pm :;: Termsord condlttons appy.Price correct at t1meof printing. P cture for n ustrotion purposesony. Buider s Registration No.9769. 2 MAV2016 r- REMOTE 1 I --.SE_CTIONALDOOR - - - - - - - --·--COMMODORE HOMES www.indianlink.com.au l'J

Superannuation and smokes to fund election budget

Aday after the budget, P1Vf Malcolm Turnbull aJI but confirmed 2July as the date for the next federal election. All that needs co be done is the drive down to the Gover.nor General's office to formally notify him to issue the writs and then the unofficial election campaign of the past few weeks becomes legit.

Knowing that this will be happening, there was intense pressure on the PM and the Treasurer to deliver a budget which would excite and yet be fiscally responsible. At first overview, they seem co have done chat with a budget that takes away from the wealthy but largely does not disenfranchise the poor. ]\,fiddle Australia does get some loving but not to the extent small businesses do.

Cigarette taxes will help raise funds, overseas firms which have been rorting the system will have to pay their taxes, and superannuation invescors will have

some of their benefits and entitlements cut. i'vlonies wiU flow towards business tax cuts, helping smooch out superannuation contributions and ta..xes for middle income families and help young, unemployed people train and gee work. A small amount will also go towards paying down debt, but tl1e budget emergency as identified in the Abbott-Hockey budget has now been downgraded to warning levels only.

From the migrant perspective, the news is generally good. While few will be affected by tl1e loss in superannuation entitlements, more will benefit from the add-ons which the government is offering to .low and middle income earners in superannuation and carry forward entitlements. The bad news is that the government is cappingthe S37 Medicare rebate for doccors' visits which over ti.me will force the doctors co seek co-payment from the patients for their visits. Also, the Government's child care reforms will be deferred by one year to a scarring date of 1July, 2018 due to the Family Tax Benefit reforms required to fw1d the chi.Id care package not being passed by the Senate. This \Viii put pressure on women from migrant backgrounds who are in casual employment. As has been observed, over the past

decade or so, migrants from tl1e subcontinent have moved more into selfemployment than any otl1er time in the history of Indian migration to Australia. To tl1ese entrepreneurs, tl1e sweeteners of lower tax and immediate tax deductibility for asset purchases costing less than $20,000 until 30June, 2017 will be welcomed.

ln tllis budget, there is a provision of $814.2 million for SBS over three years from 2016-17, good to have this support for the nmlticultura.l broadcaster. Bm interesting co note time it is actually tbe new CEO of tl1e ABCMichelle Guthrie who wants more diversity on ABC and we have not heard a word from tl1e multicultural broadcaster SBS on this topic.

All in aU, a budget which the current government feels that it can prosecute weU during tl1e inevitable election campaign. But, in a few days' ti.o1e, when rbe election is called, both Labor and the Coalition will fire their initial salvos from their traditional positions of strength. Labor will talk about the lack of funding for schools and hospitals in this budget, the Coalition will talk about how their economic management is the best way forward for Australia. The budget will be praised and pilloried - depending which side of politics you are on.

INDIAN LINK PUBUSHER . -·- - . Pawan Luthra EDITOR Rajni Anand Luthra ASSISTANT.EDITOR Kira Spucys-T�h�r . ,, . . - . ·· _ MELBOURNE COORDINATOR PreetiJabbal CONTRIBUTORS NishaJoseph,Tasneem Zavery, Usha Ramanujam Arvind,Virat Nehru, Jasmeet Sahi, Rani Jhala, Gaurav Masand, Petra O'Neill, Devna Luthra, Nan�y Jade P. lthea, ADVERTISING WA Sales Manager Ram Naidu 0435 581 571 National Sales Vive�Trivedi 0292l>2 1w, ADVERTISING ASSISTANT• Indian Link is a monthly newspaper published in English. No material, including advertisements designed by Indian Link, may be reproducedCin part or in whole without the written consent of the editor. Opinions carried in Indian Link are those of the writers and not necessarily endorsed by Indian.· Link. AUcorre�pondenceshould . beaddressed to• Indian Link Level 24/44 Market St,Sydney 2009 or GPO Box 108, Sydney 2001 Ph: 02 9279·2004 !=ax: 02 9279·2005· Email: infc.@indianlink.com.au· editorial
EU�O SOLa TakingcoreofhrnutGeneration ELECTR CALCONTRACTOR LICENCENO.ECt04\7. ·Tern-.sanefcoooit,oosappt; D;:IOClinQ(l.liQibartyfor�ia.rooooss.cncme a.RCSyouagreetoassiontoo t)ghts tQcreateSTCstoP&N NSWl>ty LtdT/AE11oSotu flatroot doubles:t:lrey m·e11coox upg(ad-Osandaflyotheranomanesmayr&qwr1lextamatcrcatswhlc:hWilbequotOOsq,aratety. Umltedt.ne/stockofltt.This pice s uptiSOkmra<hus flomtheJo::aJoHke.11.Addltt0nalch.Jrocsapptyforanyoctrapanels adocdtoUIISad\lilrt�cdsystem Call us now or visit EUROSOLAR.com.au ServicingOLD NSW VIC. SA WA &TAS: Mon • Fri 8am- 6pm &Sat 10am • 2pm lNDlANLIHK MAY2O16 3

YOURSAY

SHARING ANANZAC MOMENT

Ever since I was young, I was told stories by my grandparents and school teachers about those who sacrificed their lives for India's independence. Many years ago my family migrated toAustralia, and ever since then the Anzac Day parade has constantly reminded me of the similar Republic Day parades I used to watch as a child.

This year, along with six other leaders and the school band, I got to represent my school in theAnzac Day parade. Walking in between the tram tracks with the heavy weight of the school banner up against my arms; the smell of diesel from the vintage car infront of us, carrying veterans too frail to walk; watching the soldiers marching, proudly holding their military units banner; hearing the school band play 'Waltzing Matilda' for the cheering crowd; these images brought this memorable experience to life.

Throughout the march, many gleaming medalscaught my eye, making me realise just how real and strong theAnzac spirit is and will continue to be.

While the parade had everyone cheering, clapping, giggling and having a good time, the Shrine of Remembrance showed us the real reason why Anzac Day is important. The mood turnedsolemn as we marched up the stairs and read the words 'Let all men know this is holy ground, we will remember then' that are etched on to the stairs leading up to the eternal flame. Looking around I could see these words reminded everyone of the soldiers who went to Gallipoli and sacrificed their lives for their country.

Although the entire march was a great experience, the highlight of the day was just after we f nished paying our respects to the fallen heroes, when a soldier from WW2 came up to me and gave anAnzac penny minted in 1934 as a token of his gratitude. I felt humbled, clasped the penny in my hand and stood there for a moment in silence to pay my homage to the fallen.

Lest we forget.

AnavlChandhok, Melbourne

ANZAC POETRY

We posted the poems 'Poppies and crosses' byArjun Gill and 'Floating memories' by Viney Kumar on social media and they received a great response.

SanamSharma wrote: Such wonderful writing - good on you young men!

MonikaAgrawal wrote:Very deep, good workArjun

Reenu Katoch wrote: Beautifully written. Good on youArjun

SandhyaBlrla wrote: Wow! Viney you are really a shining star in the evening rising high and spreading its glow! You make all of us feel so proud.

RaghuRaman wrote: Really wonderful work, Viney Kumar keep it up!

SAYIT AGAIN

"A FTA with India will drive Oz exports and create jobs. Talked trade with India's Finance Minister Arun Jaitley while he was inAustralia."

SteveClobo,Ministerfor TradeandInvestment

KATE ANDWILLIAM ININDIAAND BHUTAN

Our album ofphotos from the Duke and Duchess ofCambridge's tour nearlybroke the internet! They metAishwarya and SRK in Mumbai, toured slums and charities, took part in gala dinners and visited the Taj Mahal RajnlLuthra wrote:Aish, straight from Sydney to Wills and Kate event?

Ajeshnl Pravlna Raj wrote: Aishwarya's every bit as beautiful as the British royalty. Love Madhuri Dixit's million dollar smile

SumltChatterjee wrote: When Prince meets Badsha

ShaPrasad wrote: Wow! So sweet and adorable. She'ssuch a beauty in those Bollywood outfits just love Indian clothing!

Jasmine KongBlllnskl wrote: Jumping in heels! Wow, is there nothing this woman cannot do? She is awesome!

NldhlBldhl wrote: Ugly souls. They hunt animals for fun.

RajRajpalSandhuwrote:These guys are notspecialdon't treat them like they're special

CatherineFolettl wrote: They are true royals, I love them all

SueAnn wrote: Love all her dresses! Simple but nice

PashllnlSupramanlam wrote:All her dresses are so pretty! Beautiful!

AnneKoh wrote: So much respect. I really love that

CharleneChew wrote: Duchess Kate is always so glamorous! Love her sense of fashion

SidhuBrarDrGajan wrote: I have sat on the same bench, but the Taj Mahal was closed to the public during their visit

TO AMUMWHO LIVES INLOVE

A poem by RaniJhala

This Mother's Day, no presents will be packed, No restaurant booked, no surprises planned. This Mother's Day, an empty grip Will,hold my aching heart within.

This Mother's Day your child will cry, And curse the day you said goodbye. And when the pain has all poured out I'llclose my eyes and look about.

I'll look for you within the kitchen walls, Then search around your divine shrine. I'll feel your strength in the bangles you wore; As I reach to hold your hand again.

I'll hear you through the letters you left, And memorise each word you wrote. I'llspeak of you, to those you loved, And dream of you in your new realm.

So maybe a present, willstill be packed, Just to hear you say "No, don't do that." And I'll send my all, to you this day, My special mum who lives in love! Happy Mother's Day Mummy.

"India's inclusion inAPEC would facilitate greater regional trade and investment, and would lead India to play a greater role in the region at large."

4 MAV2016
www.indianlink.com.au l'J

HE MADE US THINK, HE MADE USLAUGH

RajniAnand Luthra paid tribute to Indian Link columnist Ma/IiIyer

LPAyer wrote: I am sad to learn of the demise of

MalIi Iyer who, over many years, brought cheers to Indian Link readers and, at the same time, made them think on the serious issues in our lives. Of the many writers to the Link, I wanted to correspond with him but I had the opportunity only once.Please convey my sympathies to his family who I believe will cherish his memory remembering the ripples of laughter he would have generated among them and the readers at large.

SandlpHor wrote: So sad to learn about Malli passing away, he was a perfect gentleman.

RupaKumar wrote: Beautiful tribute, Rajni. May his soul rest in peace.

RaniJhala wrote: May his soul rest in peace.

ShaPrasad wrote: RIP.A very motivating and inspiring writer, I enjoyed all his work.

PreetlJabbalwrote: RIPand condolences to the family

DhanyaSamuel wrote: Heartfelt condolences.

MythlllIyer wrote: Dear Rajni,

We all appreciate your gesture and the great tribute to Malli written by you. I was really touched by your genuine feelings and the respect you hold for Malli. It really made a very nice readandI have been getting many responses from our various friends about that tribute. He will be remembered forever, Rajni!

Thank you once again.

RIP SANAYASAHIB

Sofina Nikat, the mother of14-month-oldSanayaSahib, whose body was found in a Melbourne creek, was charged with her murder

Deepa Bhatia wrote: Shame to a mother who murders her own child for whatever reason!

Raghu Rules wrote: Killing isn't the solution for any problem. RIP the little princess, no one deserves to die like that

Geetha Nair wrote: Indeedsad, this is not a normal behaviour of any mother, unless there are underlying issues. Encourage anyone going through any kind if depression or hurt to recognise this and seek help. It is easier said than done, but the joy of life is so worth it.

ShaPrasad wrote:This is an absolute horror! A mother ended upkilling her own child!A young, vulnerable mother not in the right frame of mind, going through a divorce with the husband claiming custody of her child, trapped in an extreme cycle of violence.

As she makes her way to the creek, pushing the baby in her pram, only looking for her own personal space, she doesn't realise what she has done.And this image of this young, helpless, vulnerable mother is going to hauntAustraliaand all of us forever. Blame the system! The health professionals visited that home earlier and they shouldhave addressed the issue and prevented this sort of tragedy. I hope we won't exploit this young mother's tragedy. Some of the comments by individualwriters online are very insulting to the family and the respective community. We are all victims of this horrible tragedy.

DIGITAL ARCHIVES FOR CARNATICMUSIC

Chitra Sudarshan wrote about R.T Chari who has archived about 10,000 hours ofrecorded concert music and shares his love for Carnatic music in Melbourne recently

Muralldaran wrote:A tremendous effort by Mr. Chari. In spite of his busy schedule working at Madras MusicAcademy, he is able to do so much. His passion is awesome. I wish he would share his collection online so that avid lovers of Carnatic music like me could benefit by listening.

A HARYANA-BORNAUSSIE PEHELWAN

Rajni Anand Luthra spoke with Vinod Kumar, who is heading offto Rio representingAustralia MollnaSwarupAsthanawrote: What a fantasticachievement,Vinod Kumar. We will get the Indian community to support you.This is a victory forAustralia's multiculturalism and the government shouldcome out to support you.

ArupChanda wrote: Best of luck for the Olympics!

Saurabh Sata wrote: Wow Congratulations bro, well done!

THE SPICING UPOFJEWISHCUISINE

Dhanya Samuel went to the In One Voice Jewish Street Festival in Melbourne and learned about Indian Jewish cuisine

InOneVoice wrote: A great write up, photos and even a recipe from Indian Link, who came down to the festival to see the Indian cooking demonstration withSalome Erulkar andJennifer Mordechai as part of our NoshTent festivities!

NovaMorgan wrote: I love fusions where culture and tradition and various paths butt up and create something wonderful.

DennisPhllllps wrote: My wife is Jewish but she does not know anything about Jewish food. I think all that was lost with her grandfather who is buried in Fort Cochin where there used to be a big contingent of people with Jewish ancestry.

TIME FOR AISH!

Aishwarya Rai was in Sydney in her role as a Longines ambassador and was hounded bythe local IndianAustralian media GeorgeBesong wrote: Beautiful, my queen, my beloved sweetheart. TapasBhaumlk wrote: Is she paying taxes?

RameshPemmasanl wrote: No comment. But we are all paying attention SagarShlpurkar wrote: I want to meet her

SanjayKevinSabharwal wrote: Big deal, who cares!

Leman Sahll wrote: Jealous

(Name withheld) wrote: It is high time (no pun intended) Indians in general, more so media folks, show some manners. I liked the line "everyone wanted a piece of her''. Personally, I would like to have a piece of her Panamabank account.

The gem in this story (besides the ones in the watch) is that she came two hours late for the launch of Swiss watch(es) known for their precision. One Indian political leader who always used to come hours late for his public meetings, told his ally, "I want to test my popularity to see how long people are prepared to wait to hear me." Maybe Madonna did the same thing when she was here last month!

+JOIN THECONVERSATION

> LOG on to your own Facebook orTwitter account

>TYPE "Indian Link" into thesearchboxat the top ofthe screen and clickon the linkthatcomesup

>CLICK 'Like' tojoin the Indian Link Facebookcommunity or 'Follow' @lndian LinkonTwitter

"I'm sharingsnippets ofsongsfrom the record, thisfirst one is titled "NeverAlone". I wrote it aboutsome of mygreatestinspirations:heroes from the historypagesofPanjab."

L-FRESHthe LION onthe releaseofhisnewalbumthis month

IHDIAHLIHK
"Some very, very poor children in a village brought me drinks. They had nothing yet wanted to share with me whatever they had. It made me cry because itshould have been the other way around."
Ultramarathon runnerPat Farmer onhisSpirit oflndla run
..f [el
Thrilled at announcement of Kiran Mazumdar Shaw as anAustralian Global AlumniAmbassador Harlnder Sidhu, Australla'sHigh Commissioner to lndla
MAY2016 5

Getinvolved:Become abonemarrowdonor

A Perth family's attempt at battling their son's Leukaemia turns into a global awareness mission

ChemNayar,arenewableenergy engineer andprofessoratCurtin Universityin Perch,wasn'tready toconsent cothebitter truth exposedbydoctorsattheWesley HospitalinBrisbane.

Hisentirefamilywasshockedcolearn thathis36-year-oldson,Sujith,was diagnosedwithAcuteLympboblastic LeukaemiaPhiladelphiaChromosomeposmvein ovemberlastyear.

"Sujithhasalwaysbeenahardworking, cheerfulandhealthyman, andwenever imagined hewouldundergothis,"bismum AmbikaNayarcoldIndianLink.

AnInformationTechnologygraduate fromMurdochUniversity inWA,Sujitb grewupinPerth.Careeropportunitiesasan ITspecialisttookhiminitiallytoCanberra andthencoBrisbane.Heismarriedto Allokaandhas beenlivinginMiddle Park, Brisbanesince2006.

Sujithhas finishedsixrmmdsof chemotherapyatWesleyHospital. Accordingtohisdoctor,heisinremission nm"However,therreatmentwillbe completeonly when he undergoesabone

marrow(stemcell)transplant

InAustralia,theRedCrossmanagesthe Bone.MarrowRegistryandhascurrently about 176,000peopleregistered,the majorityof whomareCaucasians.Evenon tl1eglobalregistry,Caucasiansmakeup80 percentof thedonors.

Sujithwouldbehighlylikelytofinda matchfromIndiansinthe 18-45yearsage group.

First,Sujith'ssister,Lakshmi,livingin USwastested,butunfortunatelywasnot asuitablematch.Itwasthen decidedto findunrelateddonorsfrom tl1erestofthe worldwideIndiancomrnw1it:y.

\x;'hiletherearebonemarrowregistries internationally,thereareveryfewIndians registered,andallattemptsatfindingthe eightmatchesfailed.SobegantheNayar family'smissionatorganisingdonordrives spreadingacrossIndia,theUSAand Australiawiththehelpof relativesand friends.

Thereiswidespreadmisconceptionand fearassociatedwithbonemarrowdonation. Peopleconnecttheexperiencewithpainful honedrillingsurgeriesandlengthymedical procedures,butthefactisitinvolvesneither of these.Thesadtruthisthatnotmany evenknowabout thebonema.rrowregistry.

"Thereareprobablymanypatientslike Sujithlookingfordonorsandsowedecided toeducateandspreadawarenessaboutstem celltransplant,"saidChem ayat

Atarecent bonemarrowdriveat BluegumRecreationCentreinBrentwood, W'A,nearly200donors (mostlyIndians) cameforwardtodonatebloodsamplesfor

donorprocesscalledPeripheralBlood StemCell(PBSC)donationforSujith.In thisprocess,stemcellsarecollectedvia thebloodstream.Ondiedayof donation, thedonor's bloodiscollectedfromone armandpassedthroughamachinethat separates outdie bloodstem cells. The remainingbloodisren1rnedtothedonor throughtheocherarm.This isanonsurgicaloutpatientprocedurethatrakes aroundfourhours.

Thefan1i1yplanstoorga11isedrivesin Brisbane,Canberra,MelbourneandSydney next.Aseriesof awarenessmessagesand can1paignshavealsobeen publishedon Indiancommunitywebs.itesandsocial networkingsites.

Asthey resolutely thankedallthe volunteersanddonorswhocameforward, the ayars'hands wereshaky,yettheyput onacourageoussmilehopefulthatd1eir n1issionandprayerswillnorgo unanswered.

Learn moreabouttheAustralianBone Man·owDonorRegistryatabmd,·.org.au testing,andto learnaboutthis wholeprocedure. Lookingatthe largeresponse forth.isnoble cause,thedrive whichwasinitially scheduledfrom 10am m2pm,was extendedbeyond 4pm.Many attendeeshave nowregistered withtheAustralian BoneMarrow Registryasdonors. Doctorshave recommendeda simpleandsafe

fundraiser
6 MAY2016
I Registered T0 Be A Marrow � Donor #Hope4Sujith
www.focebOOh.com/BoneMorrowSujith
www.indianlink.com.au l'J

$500offOurProfessionalFeeforallFamilyVisaincluding Partnervisa, Child Visa, RemainingRelative.

Permanent,Temporary Residency&Citizenship. FamilyVisas,PartnerVisa,Parentvisa,Tourist&workingholiday, Skill Migrations, DistinguishedTalent, EmployerSponsored457, ENSand RSMS Visas

StudentVisas includingchangeofcourse, Admissions in Universities/Institutes& GraduateTemporaryVisas.

MRTAppeals &VisaCancellation issues.

Wespecialise incomplicated casesandsubmission reports

OurClientsareourTestimonies&ProvethatweCareand

Registered Migration - Age.nt # 0321 1.7 7

Member of MIA 1923 I Me11nber of Migration AJ!lianoe

)' Mo.(,ud; Days� Buy online • This mother's day we unlocked the science of love... Follow us to keep up to date malgudidays.com.au /malgudidays.coffee /maJgudidayscoffee IJlTRAFASTMIGRAil8NSAIJSTRAlIA ESTA8USHEPSINCE2001 WE PLEP8E COURTESY, SINCERITV. PROHSSIONAUSM. EfflCIENCV AND Q
DAYOFFER
MOTHER'S
WeCan!
INDIANLINK WHY CH OOSE US? Registered and Licensed m Friendly and efficient service n Export Core, Deol with experienced professionals Ptompf Allenllon; Don·1 wall 4n suspense Ftxedprice$: No sudden or hidden charges Honest l;'ldvlce: Be Infor,rned In easy to unde.-stond terms
Llngual MAY 2016 7
MulU

A Sydneyacademic's fascination with the mathematician Srinivasa Ramanujan, who is the subject ofa new film starring Dev Patel

Toinfinityandbeyond,thatisthe journey of impoverishedIyengar prodigySrinivasaRamanujan (1887-1920).Hisinspirational butheartbreakingtalebegan atahumbleagrabara111(Brahminenclave) adjoiningtheSaarangapanitemplein colonial Kumbakonam,whereparents Komalatammal,amusicteacherandfather SrinivasaIyengar,aclerkwithmodest meansandlimitedambition,nurtured similarintentionsforhisyoLmglad-d1e pathtoself-sufficiency.

Littledidtheyrealisethattheintuitive mamematicianwasordainedforgreatness, albeitposdmrnously.Exceptionally advancedind1inkingforhisbackgrmmd, maths consumed hisvery existence,ashe travelledfrom KumbakonamroCambridge insearchof hisdestiny.

Rarnanujanwentontobecomed1efirst lnd.ianFeliowof bothTrinityCollege andRoyalAcademyinmeearlytwentiem cenmry,whenWorld\'(farOneunleashedits horrorson society.

Thetreacherouspersonalvoyage, however,culminatedinanLmtimelytragedy, butthe younggenius,whosawpatternsand possibilitiesintheverygrai.nsof sand,had already leftanindelible.impressionind1e realm of numbers.Hislegacyliveson.

Carryingformd1etorchof India's robustmathematicalhistorywhichdares backtotheVedicera,Ramanujan'sseminal work,oftenscribbledonscrapsof paper, includes4000formulaeandmeorems,all ofwhichcontinueroan1azeandchallenge mathematicianstothisday.Heisparticularly renownedforinfiniteseriesof pi.

TbeMan IV'boK11eJ1JTiifini!J'is amoving accountof theunlikelyfriendshipbetween menrorandapprentice,avowedatheistand devoutBrahmin,acelebratedacadetnic andhighschooldropout-GH Hardy andRamanujan-oneof megreatest collaborationsinmathematical history. Thesubjectof thislatestbiopichasfinally garneredd1einternationalattentionhis geniusandlegacytrulydeserve.

DirectedbyMathewBrownandfeamring DevPatel,JeremyIrons,TobyJones, StephenFry,JeremyNortham,TheMm1 /,l9"bo Kne1vl1ifi11irystrivestobeasensitive andpoignantrepresentationof d1eman andhismathematics,winningpraisefrom not onlyfilrncriticsbut alsod1eacademic fraternity.

"I'mcertainlylookingforwardtorhe

MATHS RAMANUJANSTYLE

> 1729 is called the Hardy-Ramanujan number, after a famous encounter between the British mathematician GH Hardy and Ramanujan in 1918. Hardy had ridden in taxi cab number1729 and remarked that the number seemedto berathera dull one. 'No,' Ramanujan replied. 'It is thesmallest numberexpressible asthe sum oftwocubes in two differentways: 1729 = 13 + 123 = 93 + 103.' Ittriggered an interest in numbersthatare the smallest numberthat can be expressed as thesum oftwo cubes in n distinct ways, and are now called �taxicab numbersn

>A remarkable result ofthe legendarysix-year-long Hardy-Ramanujan collaboration was a formula for the numberp(n) ofpartitions of a number n. A partition of a positive integern isjust an expression for n as a sum ofpositive integers, regardless of order. Thus p(4) = 5 because 4 can be written as 1+1+1+1, 1+1+2, 2+2, 1+3, or 4. Leonard Eulerinitiallyfound a formula forthegeneratiqgfunction of p(n) (that is, forthe infinite series whose nthterm is p(n)xn). While this allows oneto calculate p(n) recursively, it doesn't lead to an explicitformula. Hardy and Ramanujan came up with such a formula (though they only proved itworks asymptotically, GermanAmerican mathematician Hans Rademacher proved itgivesthe exactvalue ofp(n) in 1937, validating Ramanujan's earliersupposition

> Ramanujan identified several efficient and rapidly converging infinite seriesfor the calculation ofthe value of TT, someofwhich could compute 8 additional decimal plaees ofTT with each term in the series. Theseseries (and variations on them) have become the basis forthe fastest algorithms used by modern computersto compute TT to ever increasing levels of accuracy (currentlyto about 5 trillion decimal places).

Source:StoryofMathematics

coverstory ■
8 MAV2016
www.indianlink.com.au l'J

film,"Prof.NaliniJoshi,professorof mathematicsattheUniversityofSydney, told T11dia11Link."Itintriguesmethat, forRamanujan,mathswasaspirirnaland creativeendeavour.Itwasalmostasifhe dreamtuphismathematicalthoughts-he allowedthemtoflower,andthenwrote themdown.Hiscontributionscontinue tobeincrediblyimportanttothisday,and canbefoundrightattheleadingedge,in functionstodowithquanrnmmechanics, forinstance."

Dr Sydney Srlnivas: The namesake Tndia11Unk'sownresidentmathsandscience expertDrSydneySrinivasisamassiveand unabashedfan,andhasspentmuchtime researchingandwritingabouttheman,his ownnamesake.

''"\XlhenthestellarBritishproductionwas screenedinSydneylastNovemberaspart ofaBritishFilmFestivalattwohouseful shows,limmediatelydecidedthatIneeded tobringittoawideraudience,particularly theIndiancommunity,"wellknownauthor, columnist,retiredacademicandauthorityon Ramaoujan,SydneySrinivastoldIndianUnk. HispushtodeliverRamanujan'slegacy beyondtheworldofacademiahasfinally paiddividends,withtwospecialprescreeningsofthelatestfilmatCircularQuay andLiverpoolaheadofitsAustralianrelease

'-·' 500 �- � �AAt,Wl\llA" inearlyMay.

"AlthoughIwasfirstmadeawareof Ramanujan'scontributionsasaYear8 studentbackinBangalore,hardlyanyone spokeabouthiminourcircles,"regrets theformerDeputyHeadofUniversityof Sydney'sSchoolofAerospace,Mechanical andMechatronicEngineerjng.

"Whattriggeredmyongoinginterest wasacasuallunchtimecommentbySteven Armfield,HeadofSchoolatSydney UniversityafterreadingDavidLeavitt's TheIndianClerkAccordingtothebook, Ramanujandiedfrompoisoningaftereating foodthathecookedincans,"herecalled.

Overcomebyasenseofshameat knowingsolittleofthetragedy,Srin.ivas borrowedtbebook.leremindedhimoftl1e RobertKanigelclassicTheJvfan117hoKJmv Infinity(1991).HealsoreadCPSnow's forewordroGHHardy'sfamousbookA Nfathe111atician's ApologywhereSnowdescribes thesequenceofeventstl1atHardywent throughafterreceivingtheletterfrom Ramanujan.(Hardywouldclaimfamously, manyyearslater,thatheconsideredthe discoveryofRamanujanhisgreatest contributiontomadiematics).

TbechainofeventssetSrinivasonhis ownpersonalquest-tounravelthemany mysteriesofthegiftedcompatriotand unsunggenius.

Abomdiesametime,hewasaskedtogive

From left:A rarephoto ofRamanujan;(inset)a commemorativepostage stamp;AcademicDrSydney Srinivas and his bookonthe mathsgenius;(below)scenes fromthefilm

MATHSONTHEFILMSET

He may have played a young Ramanujan, India's greatest mathematician, butfor26-year-old actor Dev Patel, mathematics as a subjectin the school curriculum was always a scourge.

"I was terrible atmathematics," Dev revealed recently. "It was worse because my father is an accountant."

Ramanujan notwithstanding, a// Indians are notgoodatmaths, so stop stereotyping, readers!

To get Dev to understand his character better, young director Matt Brown, itis believed,worked very closely with contemporary mathematicians Ken Ono and Manjul Bhargava {who won both the FieldsAward and the Padmashree) in cracking the formula to get it all down pat.

"I was involved because they wanted to gettheir mathematics right," Japanese-American Ono said in astatement. "Before I knew it, I was on the sets in England, helping out with so many differentthings. It was, of course, difficultto explain howto be a mathematicianto someone who is not a mathematician."

He added, "'My favourite scene in the film is where Dev Patel completes a complex mathematical formula on the blackboard and one can see that he has done it in real time. My challenge was to selecta formula that he could remember easily andcomplete it in the sequence."

Executive producerSwati Bhise said, "They worked for a long time, exactly on the formulas and how they were written, h0w partitions were done. Much attention was given to each aspect of the film to bringthe realistic quality forward."

INDIANLINK� \NOii'
MAY 2016 9

acalk toyoungstersby1V1and1ana,a Sydney-basedorganisationrunbyHindu SwayamSevakSangh.

"\X-Thacbettersubjectwasthereto choose?InacurallyspokeonRamanujan," hequipped.

Requeststopublishensuedandthisled toS1ini11asaRat11at119a11:ATaleofAgot!)'t111d EcslaJ); which wasfollowedbyaKannada translationas wellasamoredetailed biographythroughanlndi.anpublishing house.

Insearchof truth,unravellingfactfrom fiction,Srin.ivasembarkedonasacred pilgrimage.DrSrinivas'sextensiveresearch tookhimtoRamanujan'sunpretentious residenceinKumbakonam,whichis nowpreservedasamuseum.Itishere

MATHEMATICS INMOVIES

21 (2008)

21 Grams (2003)

Agora (2009)

A Beautiful Mind (2001)

The Bank (2001)

The Butterfly Effect (2004)

Colossus: The Forbin Project (1970)

ConceivingAda (1988)

Cube (1997)

Cube 2: Hyp.ercube (2002)

Cube Zero (2004)

Fermat's Room (2007)

Good Will Hunting (1997)

Hidden Figures (upcoming)

IQ (1994)

The Man Who Knew Infinity (2015)

Moebius (1996)

MoneybaU (2011)

The Number23 (2007)

The Oxford Murders (2008)

Pi (1998)

The Professor's Beloved Equation (2006)

Travelling Salesman (2012)

Proof (2005)

Raising Genius (2004)

Ramanujan (2014 Tamil)

Stand and Deliver (1988)

Sneakers (1992)

Summer Solstice (2003)

Suspect X (2008)

The Theory of Everything (2014)

Travelling Salesman (2012)

X+Y (2014)

An Invisible Sign (2011)

thatRamanujanspentmanyaproductive day,armedwithhislegendaryslateand chalk-piece,scribblingawaypathbreaking notations,tmmindfulof thedinof everyday life.Inanoft-quotedincidentfromhis childhood,Ramanujan famouslyquestioned hisYear3mathsteacher."If threefruits areequally dividedbetweenthreepeople, everybodygetsoneeach.Sowhathappens whennofruitsaredividedamongnoone, willeachstillgetone?"

.Morethanacenturylater,Ramanujan's roominSannidhiStreetisstillintact.A framedcatalogueatRamanujan'shouse proclaimsthatit·wasattheKumbakonam schoolthatthe 15-year-oldcameacrossG SCarr'sSynopsisefElementaryResultsi11Pu,-e JVfothefllatics,abookchatwastoinfluencethe youngboyinwaysfewin1agined.

RetracingRamanujan'ssteps,DrSri.nivas alsovisited Naamakkal,Saarangapaniand Parthasarthytemples,a!Jof whichwere thedeeplyreligiousRamanujan'sfavourite ham1tsduringhistroubled days.

"lewasamad1ematical pilgrimage going mKnmbhakonarn(hisplaceof childhood, hewasactuallyborninErode),d1etown highschoolwherebestudiedanddie collegewherehecontinuouslyfailedin allsubjectsexceptmamematics.Then 1 went toChennaitohavealookatthe placewherehescudied(nowdemolished), visitedhiswife'sadoptedsonNarayanan andhis wife,Vishwanathan,diegrandson ofNarayanaIyer,hisIndianmentor.In fact,IevenvisiteddieNamagiriTemplein Nan1akkalwhereRamanujanofferedspecial semtofindoutwhedierthedivinewasin support of hisintendedtriptoEngland. Divinepermissionwasindeedgranted," Srinivasrecounted."�fynextdestination wasCambridgeandTrinityColiegein particular.[becameanewperson having seenaUthesefu:st hand wid1myowneyes."

DrSrinivas'booksonRamanujanare nowwidelysoldinIndiaandhaveseen threeormorereprints.

"Thishasalsoencouragedmetowrite onAlbertEinsteininEnglishandchistoo is goingwell. ThenexttocomeisIsaac Newton. ln addition,1havewrittenin KannadaaboutEinstein, ewton,Galileo, MarieCurie,AlanTuring,HenryFordand AlfredNobel.Itgivesasenseof pridechat my bookshavefoundaplaceintheWren LibraryinCambridgeandthe ational Libraryof Australi..'linCanberra,"he added.

The livesof manygreatscientists,poets, musiciansandwritershavebeenoneof agonyandecstasy, poimsoutSrinivas.l\farie CurieandAlanTuringaregoodexamples apartfromRamanujan.TSE!Jiotonce

rightlystatedthatSltfferingisactionand outof sufferingcomes poetry "Manyof thesegeniuseshavesufferedandd1eykept diesufferingtothemseh7es.Butwethe posterity,enjoythe fruitsof theiraction," Srinivassaid.

HedescribesRamanujanasaneccentric genius,avictimof hisownpassion."He wasbrilliantinmathematiq,nodoubt. Yet,hedidnothavethecommon sense thatmathematicsaloneisnotsufficient toleadagoodlife.Manyod1erthings arealsonecessary.Hisatticudemadehim suffer,mostlyinEngland.Hisfoodhabits, longanderratic working hours, whichhe imposeduponhimself,ledtohisuntimely demise;addtothisdieEnglishclimatic condi.tionsandhismother'sinterferencein everythingincludingbisassociationwithhis wifeJanaki.J\tragedybeyondwords."

Unsungherogetshisdue Quittenmver11Ji11,winnersnever·quit. These powerful wordsstunupthelifeandtravails of Indianmad1ematicalprodigySrinivasa Ramanujan.Besetbylifelongbeald1and financialtroubles,hewasasmalltown nobodyandcollegedropout,withneid1er socialstandingnorconnection.Yethis obsessionwidithemagicalworldof numbers tookhimtotheprivilegedhallsof Cambridge,evencuaUymalcinghimaFellow of theprestigiousRoyalCollege.

FueUedbyself-belief andsheer determination,Ramanujan left behinda richlegacyforwhichheisremembered today.Even whendeathknockedonhis doors,tl1ebumblegenius keptuphis tryst wid1numbers,workingawayatd1eoremsas wifeJanakiattendedtohisemaciatedbody. Ramanujan'syoungerbrod1er Tirunarayanan painstakinglycompiled andchronicled diescrapsof paperandhandwritten notescomainingsignificantformulaeon hypergeometcicseries,continuedfractions andsingularmoduli,preservinghislegacy forposterity.

Aheadof histime,Ramanujan's pioneering workopenednewpathways andresearchpossibilitiesthatarestillbeing explored.

Ond1e 125thanniversaryof hisbirth, Indiadeclaredhisbirthdayas ational MathematicsDay,whilebishomestate of TamilNaducommemorateditasState Information TechnologyDay.Google

honouredhimonhisbirthanniversarywith adoodleonitshomepage.

"The wo.rldof mathematicssawan astonishingpersonwhocouldarriveata resultmostof thetimebyintuition.Hesaid aGoddess wroteequationsonhistongue and camein hisdreamsandenlightened bin,.HeisonewhoisonparwithEuler andsuchgreatmathematicians.Hehad noacademictrainingandstillwasableto contributetotopicssuchaspartitions, continuedfractions,mockthetafunctions andmanysuchod1ers,"Srinivasstatedina poignanttribute.

"ImaypointomBruceBerndt(at theUniversity of l!Jinois),Michael Hirschhorn(atd1eUniversityof NS\X') andmanyothersarecontinuingresea.rch onRamanujan'smad1ematic-s.Manybooks andpapershavebeen written.Iamtold thathistheoremshavefoundapplication everywhere.Oneinamillionmaynothave thesparkd1atRarnanujanhad.Suchpeople flashuponthisuniverse-Einstein,Mozart, Beethovenandthelike."

DrSrinivasisoptimisticthatmodern mad1ematicianswillbeinspiredtofollow Ramanujan'sillustriousfootsteps."Most of dieresearchtodayinengineering andscienceisapplicationoriented.Pure mathematicstakesabackseat Engineers and scientists areaftersoftware thatcan carryoutcalculations,butto developgood software,mathematicsanditsknowledge areof paramountimportance."hesaid.

Heregretsdiecontemporarytrendof optingforreturns-basedlearningbutis hopefuld1atmainstreambiopicssuchas TheMan!/1/'hoKne1JJTnji11itywillnurturea renewedinterestintheoreticalmathematics.

Indian-originmad1ematician Krishnaswa.miAlladi,of theUniversity of Florida,alsotheFounderandEditorin-Chief of TheRa111amljttnJoumtt!saysthe filmshouldinspireyoungsterstopursuea subjectoutof purepassionandnotfashion.

Prof.Joshi,forberpart,hopesthatdie film\v111beabletobringoutthesheer beautyof numbers,foranewgeneration of students."Forkidstoday,diemainlesson fromRamanujaocanbethatmathsisnot onlyinteresting,bmcanactuillybethought aboutasanart."

'The Man'Who KnewInfinityin cinemas from5May

TAMILFILM RAMANUJAN (2014)

National award winning director Gnana Rajasekar's eponymous Tamil film Ramanujan (2014) first introduced movie goers to the world of mathematical genius. Biopics of trailblazing individuals are becoming quitethe normthese days, with cinematic representations clearly grabbing eyeballs where biographies have sadly languished.

Mathematics nevertheless is no easytask to portray on celluloid. Featuring debutantAbhinay Vaddi (grandson of goldencouple Gemini Ganesan and Savithri) and Barna (JanakiAmmal), Nizhalgal Ravi as father andSuhasini Maniratnam as domineering but doting mother, the Tamil film isalmostarchetypal Indian - how we repeatedly fail to recognise a genius, heaping ridicule atsigns 0f brilliance andoften equating itto madness.

The personaltragedy of Srinivasa Ramanujan makes for an inspiring story butthe film has been criticised for failing to resonate deep within. Nevertheless, it won kudos for being able to recreate the epoch with brilliance.

Besides a greatsoundtrack thatblends Carnatic and western melodies, beautifully laid outframes and deep insight into customs and beliefs of the time help convey the poignant message that Ramanujan tragically was a victim of the prejudices and attitudes prevalentatthe time.

Apart from the classical numbers that have already struck a chord with listeners (including VaniJayaram's comeback piece, the 'Zero to One' composition in the film is unique - a musical metaphor of Ramanujan's mind, which was always preoccupied with complex layers of calculation, according to musicdirector.

coverstory
10 MAY2016
www.indianlink.com.au l'J
INDIANLINK MAY2016 11

Anunlikelyfriendship

A Townsville student finds himself a newjob - and an entire family as new friends

Townsville'sRaghuSachdeva sharesauniquefriendshipwith hisemployerEmmaLynam. \'(Thar'sspecialaboutthisbond, youask?

EmmahasDownsSyndromeandmild autism,andishearing-impaired.

ShehiredRaghu,herfirstemployee, justoveramonthagotohelpherinher businessMasterShredder,whichshreds documentsforclients.

Raghu,25,iscurrentlypursuinghisMBA atJamesCookUniversity.

"IdriveEmmato herclients'premises, andsetuphershreddingequipmentwhich weighsaround100kilos,"Raghutoldlndinn Link."Onceshe is donewithherwork,I driveherbackhome.Ikeepatabon the hoursshe worksandgenerate herinvoices."

Raghufoundthejobadvertisedon campus. Theadaskedforanassistantfor adifferently-abledwoman,whowouldbe abletowork withherfamilyandsupport circle.Raghuwasquitekeenonthisjob, ashewasstill lookingatbuildinguphis confidenceinanew societywithhisrecent movetoAustralia. Hewasalsomissingbis familyback inAmritsar,Punjab, andthe family-centricnatureof thejobappealed tohim.

Emma'smum,JoLynam,siftedthrough theapplicants.

ShetoldIndianLink,"Isawsomething inRaghu's applicationthatIimmediately liked.\Y/einvitedhimforafternoontea ontheStmdaysothatourtwosonscould meethim.OnthisoccasionInoticedthat EmmasatbesideRaghuandseemedatease withhim.\'(ThenlaskedEmmawhoshe likedsheindicatedRaghu.Ihadexplained toRagbuthatduetoherautismit would probablytakeEmmaalongtimetobe comfortablewithhim,buttomyabsolute amazementshewashappyto startworking withhimveryquickly."

Raghu's workdaybeginsat9.30amand

goesuntil 12.30pm,dependingonEmma's clients,Monday-Thursday.Oncehesees heroff ataclient's,hethenhitsthelibrary andcompleteshisassignments.

Jotells usthatEmmawasbornwith a cleftpalate,soshehasverylittlespeech, whichisverydifficulttotmderstand. Signlanguageisherprimaryformof communicationbut shedoesalsousean iPadwhichhasacommunicationapponit that can speaJ,forher.

"Initiallysignlanguagewasabitdifficult, butwiththesupportof herfamily,Ihave learnthowtocommunicatewithEmma," Raghurevealed.

HowisRaghuinformedwhenheis supposedtopick upEmma?

"En1macallsandsays'now'."

WorkingalongsideEmmahasbeen inspirationalforRaghu."Ifeelenergetic andmotivated,"hesaid."Emmahascaught mepunctuality andtl1roughherIhave

learnttliatwhateverproblemyouarefaced with,youcanovercomeitif youtry-don't quit,butkeepmovingon."

Raghuhascreatedatremendousimpact onEmma'slifecoo.Joobserved,"Raghu ismoreLikeamemberof thefamilyratl1er thananemployee.Wehavetakenadvantage ofthelongweekendsbyplanningfamily picnics whereEmma wasverykeentoinvite Raghutoo.Raghuisagenuinelybeautiful youngmanwithanopenmindandagentle heart.IbelieveEmmahaspickedupon thesequalities."

AsforRaghuhimself,itisclearthathe is keentoworkhard whileheishereasa student,andcontributeto thesocietythat hasofferedhimthechancetoraisehis stationin Iife.

INDIAN LINK RADIO APP

australiawide
12 MAV2016
,, Raghu is a genuinely beautiful young man with an open mind and a gentle heart ,,
www.indianlink.com.au l'J

VOTING RULES HAVE CHANGED?

Make your vote count this federal election.

Atthisyear'sfederalelection,thewayyouvoteforthe Senatehaschangedandit'simportantthatyouunderstand howtovotecorrectly.

OnthelargewhiteSenateballotpaper,youcanchoose tovoteeitheraboveorbelowtheline.

Ifyouchoosetovoteabovetheline,younowneedtonumber atleast6boxes.Putthenumber'1'intheboxfortheparty orgroupthatisyourfirstchoice,a'2'foryoursecond choiceandsoonuntilyou'venumberedatleast6boxes.

Ifyouchoosetovotebelowtheline,youmustnumber atleast12boxes,from1to12,forindividualcandidates intheorderofyourchoice.

VotingfortheHouseofRepresentativeshasnotchanged. Onthegreenballotpaper,youmustnumbereverybox, startingwiththenumber'1'foryourfirstchoice,'2'foryour secondchoiceandsoonuntilyouhavenumberedeverybox. 'Howtovote'instructionswillbeclearlydisplayedonyour ballotpaper.Don'tworryifyoumakeamistake-justask foranotherballotpaper.

Advertsement DID YOU KNOW
This federal election your vote will help shape Australia. To learn more www.aec.gov.au 13 23 26 l c_:j AEC Australian Electoral Commission Authorised bythe Electoral Commissioner, 50 MarcusClarkeStreet, Ganberra ACT. INDIANLINK MAY2016 13
Advertisement
14 MAY2016 www.indianlink.com.au 1:1
Authorised bythe Australian Government, Capital Hill, Canberra.

• India • Pakistan • Nepal • Bangladesh • Sri Lanka • Singapore • Malaysia Office

Air Travels "Your Local Travel Consultant" Pleasecontact us fortheCheapest AirTicketsfor
Hours: Mon-Fri ; 9am
7pm, Sat ; 1Oam to 4pm, Sunday-Closed. * PLEASE D0 COMPARE OUR PRICES WITH OTHER AGENTS 2 Shreeve Road, Canning Vale WA6155 email: info@simranairtravels.com.au www.simranairtravels.com.au []w]lillllam�ITIJliJ:E�00u@JO�� INDIANLINK MAY2016 15
�Simran ��
to

''Anzacisnotmere!)•aboutloss. lt isaboutcourage, andendurance, andd11!J; andloveo co1111fl)\ andmatesbip, andgoodh11111011r audthesttrvivalofasenseof self1vorthtmdt!ece111y it1thefaceefdrcadfiil odds."

ThesewordsfromSirWilliamDeane, Governor-GeneralofAustraliain1999 sumupthesentimentsbehjndtheIndian participationattheAozacDayceremony. Everyyea.r,officersspruceup,polish theirtreasuredmedalsandironthcir uniformswjointheproudgroupof servicemenandwomenandtheirfamilies, tomarchintheAnzacDayparade.

Thisyearsomehighlydecorated servicemenofIndianoriginrookpartin themarch.

THANKS /I,I

Lt Cdr KGN Menon (ret'd)

94-year-oldLtCdrKGNMenon(ret'd), whogoesbythenameKayGee,joinedthe RoyalIndianlavyjnJuly1941,andtook partintheBmmaOperationsin1944/45 undertheoverallcommandofLordLouis Mountbatten.Theshiphewasin,HlvllS KistnawasthefirstshiptoenterRangoon Harbour,afterliberationfromJapanese troops.Hebadtheopporrunfrycovisitthe UKfortrainingin1948andreturnedin oneofthefirst3Destroyersboughtfrom theUK,arrivinginInruaon26January 1950,RepublicDay.Variousappointments laterbothinIndiaandabroad,hefound himselfonboardINSVikramforthe liberationofGoa.Heretiredfromthe IndianNavyinMarch1969andhasbeen livinginMelbourneeversince.

Cdr Subroto Ghosh (ret'd)

CdrSubroroGhishservedtheIndian Navyfor26years.Asanavionicsengi11eer, heworkedonboardaircraftcarriers.He sawactionintwoofthemostimportant mi.lirarycampaignsinIndia'srecenthistory, atSriLankaandatKargil.

"TheIndianPeaceKeepingForceatSri LankawasthefirsttimeIwasinvolvedi11 action.Myshippatrolledoffthecoastof SriLankaasweguardedthearea.Wealso helpedtransportIndianarmypersoru1eL DuringKargil,myvesselwasdeployed offthecoastofKarnaraka,astherewere reportsthatterroristswouldbelanding weaponsthereandsmugglethemnorthto Kashmir."

Anotherstand-outmemoryforCclr Ghoshisfrompeacetime,duringaroutine

patroloffthecoastofLakshadweep Islands."Afterabriefskirmishwewereable cointerceptandneutralisesmugglerswho werecarryingsilver.\Xfeconfiscatedtheir boarandgoods."

Cd.rGhoshmovedcoAdelaidesixyears agoandmarchedatlussecondAnzacDay paradethisyear,wearinglusnavyberetand medals.

Col Ashok Tara (ret'd)

VirChakraawardeeColAshokTara(ret'd) wasoneofthebattle-hardenedveterans whomarchedproudlythis)'earwiththe lndianconringentinMelbourne."The regardandrespectthatwereceiveatthe paradefromthepublicisveryrugh.Their josh (enthusiasm)andsupportgivesus agreatsenseofpride,andIenjoythe

anzacday
16 MAY2016
www.indianlink.com.au l'J

opporrunicytomeetofficers fromotber regimentsaswellasothercommunities,"be said when askedtosharesomehighlights fromtheparade.

ThisisthesecondtimeColTarajoined veterans atthe A.nzacparadeinl'vfelbourne. ColTarawascommissionedi.ntheBrigade of theGuards,aveteranof thel965(Battle of Gadra)and 1971 (Bartleof Gangasagar) engagements.HewasalsoaCommando lnstruccorat1vIHOWandamemberof the elite9 ParaCommandoRegiment. Hewas activelyinvolvedinspecialisedCounter InsurgencyOperationsi.ntheMizoHills andwasconferredtheVi.rCha.kraforhis valourintheBattleof Gangasagar.

Postretirement,in 1994,ColTarawas conferredthe'Friendsof Bangladesh Liberati.onWarHonour,'bythePrime Ministerof Bangladesh,Shei.khHasina. Hewasrecognisedforsa,7ingSheikh Hasina and herfamilyfromahousein Dhakawheretl1eywereheldcaptivebythe Pakistanimilitary.

Wing Cdr Chakravarti Zorawar Singh Sandu (ret'd) ForhighAyingWingCdrChakravarti. ZorawarSinghSandu (rec'd),alsoknown asCeeZee,tl1e2016AnzacDayParade wasauniqueexperience.Hehasonmany occasions,commandeda.i.rcraftsthatflew overtheRepublicDayparadein1ndiaand alsoledanIndependenceDayparadein Jodhpur.Howeveritwashis firstexperience of paradinginaforeigncountry. ''Ienjoyed beingpartof theparadeandlikedhow thepublicturnedoutenmassetocheerthe veterans,"besaid.

Durjnghis35yearsasafighterpilot,this highlyqualifiedservicemanflewmorethan 3000accident-freesortiesfor whichhewas awardedthreestarsof flyingbytheIndian AirForcewhichisequivalenttoVayu

SenaMedal.Hehasflownmanyaircrafts rightfromWorldWarIfighteraircraft TigerMothtotl1elatestgenerationfighter aircraftsthatincludesMIG'sandSukhoi (Russianaircrafts).

CeeZeewaspostedtoafightersquadron duringtheIndo-Pakwarin 1965.Hecook part.inthe 1971 Operationsandcarriedout 14missionsonSukhoiaircraftdeepinside Pakistan.Duringthelraq-Iranwarhewas senttotrainIraqipilotsforadvancedfighter training.

Cpt Pradeep Bharadwaj Adelaide'sCptPradeepBharadwajhassome interestingobservationsabouttl1eAnzac Dayparade.

"Themarchisawonderfulharkback tothegoodolddaysforme,"hetold Tndit111I.ink."lenjoyitalsobecauseitis friendlyandinclusive,unlikeinIndiawhere ourparadesarehighlyregimentedand veryceremonial.Thesecurity concerns overilierehave changedthetextureand complex.ionof ourlarge-scaleparades."

Of coursetl1eAnzacDayParadeincludes segmentsandcontingentsiliatarenotor havenotbeeninactiveservicesuchas fan1iliesanddescendants,andthisperhaps

addstotheinformalityof itall.

PradeepmovedtoAustraliain2008and iscurrentlyaneducationprovider.

Fromhisactivemilitaryservice,Cpt Bharadwaj recallsaparticularlyharrowing timei.ntheRajouri-Poonchareaveryclose totl1eLineof ControlalongtheIndiaPakborder.lnadevastatingaccident whileonthemove,manymembersof his unitwereleftseverelyinjuredordead."A seniorofficerwalkedtowards melooking like aghost,allbloodied,andcollapsedin myarms."Inthenextfewminutes,ashe rushedtheinjuredtomedicalcare,"many of them pukingblood",hewouldrealise hewasinchargeof theunit.Hewasbut22 yearsold.

Vikram Singh Grewal Canberra'sVikramGrewal landedinSydney afteratriptoLondononthemorningof 25 Aprilthis year.

"Ichanged atthearmy barracksand rushedtojointheparade,"hetold[lldit111 Lnk.

Vikram hasbeen participatingin ilieparadesince2007whenrheIndian

contingentwas firstgrantedpernussion Hewas partof mecommitteethatlobbied forthispermission.Hemarchesinmemory of hisgrandfatherwhowasasoldierintl1e Britisharmyfromthedaysof undivided India,andinmemoryof lusdadwho wasanofficerintheIndian AirForce and whosaw actioninthePakistanand Bangladeshwars,evenwinningaPresident's honourforhisservice.VikramJumself worksintheAust.raliangovernment's DefenceDepartmentcurrentlyin acivilian capacity,asViceChief of theJointForces InformationManagement.Heisnominated asaliaisonofficerfortheSikhcommunity.

Col Samir Roychowdhury (ret'd)

ColRoychmvdhuryjoinedtl1eIndian armyin 1964andhispostingsincludeda challengingstintattl1eLipulekhHimalayan pass and tenuresatSiachen Glacier,the world'shighest combatzone,andapeace postinginGwaliorinMadhyaPradesh.He alsocompleted twotenures asinstructorat meprestigiousNationalDefenceAcademy inKhadakwasla,Pune.Roychowdhury migratedtoAustraliaafterretiringfromthe Indianarmyin 1994.

Jung BahadurSingh Grewal Adelaide'sJungBahadurSiJ1ghGrewal also ma.rchesin memoryof hisfatheranduncle, Jong-servingarmymen whobothfoughtin WorldWa.r11.His dadisnomore,burhis uncle,93thisyear,livesin Canada. Heremembersfondlythetimein2010 heAewlusuncledowntoAustraliato participatein anAnzacDayceremony."He wasveryproudtoparticipateinaplaque ceremony.To!um,tomydad,andtoall theotherslikethembotbintl1ewar,l am thankfulandgrateful."

INDIANLINK
Melbourne
MAY2016 17
Preeti Jabbal and RajniAnand Luthra

Rajya Sabha ethicspanel recommends Mallya's expulsion

Theethicscommitteeof theRajya SabhahasrecommeJ1dedexpulsionof independentmember,liquorbaronVijay Mallya,adayafterhe sent hisresignationco ChairmanHamidAnsari.

Sourcessaidthecommitteehas recommendedMallya'sexpulsion,andalso thatthepanelwantsMallya'sresignation toberejected,andhisexpulsioninitiated throughdueprocedure.

Afterthereportissubmittedintheupper house,afinaldecisionrestswithcl1eRajya Sabhachairman.Thechairman hasnotyet acceptedhisresignation.

:tlfallyasent inhisresignationcoAnsari on2May,adaybeforetheethicspanelwas tomeet.

Helatertweeted,"Inal]humilityand notindefianceastheyreport,Iwould likeIndianmediatocheckandverifyfacts before callingmeadefaulter."

Anoc1ertweetonTuesdaysaid:"7686 WilfulDefaultersOwePSUbankRs.66,190 er•easytoblameonlyMallya."

Mallyais wantedfordefaultingbank loansto cl1etLmeof Rs.9,000crore.

Heisanindependentmemberfrom Karnataka,andhisterm endsonJune30. Thisishissecondtermintheupperhouse.

AccordingcoparliamentSOLtrces,during histenureof almost 10yearsasmemberof theRajyaSabha,Mallyawasdeclaringhis assetsandliabilitiesas"nil".

TheuniongovernmentrevokedMallya's passportafterhefailedtoturnupfora probeintotheloan default.Thissetin motiontheprocessforthebillionaire's possibledeporrntionfromBritain, wherehe isstayingatpresent.

[-Lscasewasreferredtomeechicspanel bytheRajyaSabhachairman,afterheAed thecountry.

Railway minister launches web-based project monitoring system

Railwayi'vlinisterSuresh Prabhurecently launchedthe ProjectManagementand InformationSystem (PMIS) whichwould

enabletherailwaystomonitoronlinetl1e progressof ongoingprojectsacrossthe country.

''PMISisaweb-enabledITapplication which wouldcovertheentirelifecycleof complexprojects.Irisastepinleveraging resourceswhichwouldempowerrailwaysin transformingthewayprojectsaredesigned, builtandcommissioned,"arailwayofficial said.

PivlISwouldusedronerecordingsand CCTVfootage tomonitortheprojects.

PrabhusaidPl'vilSwouldbehelpfulin implementingupcomingmajorrailway projectson time and savemoney.

"Theplanistorollout PMIStoallthe majorprojectsacrossthecountry.It will helpinonlinemonitoring,midcomse correctionstoensure fasterexecutionof theprojects.Therailways willsavecroresof moneyif projectsarein1plementedonor beforetime,"Prabhu said.

Hesaidmesystemwouldimprove withtimeandthattheinformation wouldbeavailabletothepublicaswell. Hesaidasystemwouldbedevelopedto gradeemployeesonthebasisof tbeir performance.

"Asystemwon.Idbedevelopedtoreward mosewhoperformwellandpunish thenon-performers.PMISwillhelpin identifyingtheperformance,"hesaid.

Ministerof StateforRailwaysManoj SinhacalledP:tl'1ISa"game-changer".

"If wemanagetoreducetheproject completiontimeitwillbeagame-changer fortherailways.It willalsogiveeconomic benefitstotherailways,"Sinhasaid.

Pl'v□Siscurrentlybeingimplemented intheUdhampur-Srinagar-Baramullahrail Linkasithascomplex geologicalformation which requiresextensiveandcontinuous monitoring.

Air India no longer lossmaking: Government Efficientfunctioningandreductionin operationalcostshashelpednationalcarrier AirIndiaturnfromaloss-makingairline intoan"operationalprofitunit",theLok Sabhawasinformedmismonth.

Thegovernmentalsoassertedclrntwith

regardtosafetyissuesforairtravellers,it willbetheendeavourof thegovernment "tokeepourairportsandskiesabsolutely safe"throughfoolproof adherenceto prescribedinternationalst.'lndards.

"Bycuttingitsoperationalexpensesby almost 11 percent AirIndiahasturned fromaRs.2,636crorelossmakingunitin 2014-15toaRs.8croreoperationalprofit unitin2015-16,"CivilAviationMinister AshokGajapatl1iRajusaidwhilereplying tothedebateondemandfor grantforhis ministry.

HealsopointedoutthatAirl.ndiajoined SrnrAlliancein2014, "whichhashelped ittointegratebetterwiththeinternational civilaviationmarket".

Theministeralsorecalledtheunique contributionof AirIndiainthe''hourof crisis-evacuatingabout6,000nationals fromYemen, 1,300fromIraqandLibya and 17,500passengersfromquake-affected epal".

Theministertoldmembersthatby2020, AirIndia'sAeetsizeislikelytogrow,by about l00aircraft coabout232,andof this 28moreaircraftwillbeaddedbyJanuary 2018.

Respondingtomemberswhoduringthe debateonMondayraisedissuesconcerning airpassengers,theministersaidthe DirectorateGeneralof CivilAviationhas decidedto usetechnologyasan"enabler" andthatacomprehensivee-governance projectwillbelaunchedtooffer 160 servicesonlinetostal<eholders.

"Thissystemwill promote transparency, increaseefficiencyandservicedelivery, leadingtogreatereaseof doingbusiness. Thefirstsetof suchserviceswillbe launchedinMay2016,"Rajusaid.

Amongomerinnovativeschemes,the ministersaidCocl1inairporthasbecome the"first intheworldtoexclusivelynmon solarenergywimatotalinstalledcapacity of 12megawatt".

DelhiandHyderabadinternational airportsalsohaveeightandfivemegawatt solarplantsrespectively.

Withregardtosafetyissues,Rajusaid itwillcontinuetobetheendeavourof megovermne.nt"tokeepourairportsand

Indianvisitorstakeaselfieatthe OctroioutpostgateattheIndia-Pak borderinSuchetgarh,nearJammu,the wintercapitalofKashmir.TheJammu andKashmirGovernmentispromoting bordertourismatSuchetgarh.Itis seekingtohavetheSuchetgarhSialkoteroadopen andtoorganise aceremonyonthepatternofAttari/ Wagahborderin Punjabstate. Photo: AP

skiesabsolutelysafemroughfoolproof adherencetoprescribedinternational standards".

Hesaidmerewasa''highdegreeof satisfaction"thatinaveryrecentsurveyit wasfoundthatpassengerandcargosecurity satisfactionlevelwereassessedtobe99.25 per centagainstaworldaverageof 66per cenL

ToaspecificissueraisedbyCongress memberK.C.Venugopalonthefateof the requestbyKeralagovernmentforanairline betweenKeralaandilieGulf countries, ilieminister said,"It (suchademand)isan imagination.Nogovernmentoranyairline intbename KeralaAirlinehasappliedwith thegovernmentof [ndia."

"I triedcomakemyenquiriesandno airlineof Keralagovernmentispending withthegovernmentof India. Theyhave notevenapplied,"hesaidamidrepeated interruptionsfromCongressmembers includingVenugopal.

Theminister'scontentionwassupported byBharatiyaJanat.'lParty(BJP)member DushyamSingh,whoalsosaidthe Kerala governmenthasnotmadeanysuch request tothecentre.

AtonepointVenugopalwasheardasking theministerandthetreasurybench,"what happenedtoyou,itismyrighttoaskthe question".

Theministersaidallregisteredairlines willhavetofollowtheIndianrulesandthe RouteDispersalRouteguidelines.

Thedemandforgrantwaslaterpassedby voicevoteafterthecutmotionswereeither rejectedorwithdrawn.

Chinese investorstofund 10 Indian startups

Asmanyas 15Chineseinvestors representingninefirmshaveshortlisted 10Indianstartups,operatinginmobile technologies,e-commerceandmedical technology,forupto$5millionseedand SeriesAfunding,itwasatmoll11cedthis month.

However,theshortlistedIndianstartups selectedatthe'DatewithChineseInvestors' werenotdisclosedtoavoid poachingfrom rivalinvestors,whileanotherfive coseven startupsarebeingreviewedforfi.mdi.ng.

"WehavechosenBengaluruover othercitiestostart becauseof the great infrastructureandtremendoussupport givenbystategovernment.Manyared1rilled toseethepotentialamongIndianstartups," saidinvescorandOn.ionFanCEOHutu.

PickupWheat(Shimai)Finance, HarmonyInvest,Grand(Dagnan)Capital, lncapital,ZhejiangWenChuangGroup, YeahMobi,HangzhouZhexin Information TechnologyandCyberCarrierareamong thefirmswhich participated intheevent scheduledfrom 1-3May.

TheChineseinvestorsvisitedthe Karnatakagovernment'sMobile 10X HubinDiamondDistricttoevaluatethe entrepreneurialpitchesof moreman 150 startups whicharrivedfromChennai, HyderabadandMumbai.

"Theeventwasaimedtoshowtl1e landscapeof ChineseandIndianventure andinvestment,andtofacilitatethe innovationandcommunicationbetweentl1e

indian news
18 MAY2016
_.,·SlAb · ·:. . �� .i . ' .... ., .. ."""ilt' j ..... '
www.indianlink.com.au l'J

twocountries,"saidanofficialstatement.

FundinginterestfromChinaisaimed atexpandingthebusinessrangeand globalimpactof Chineseinvestments organisationswhile011theotherhand lndianstartupsstandtobenefitfrombetter andeasierfonding.

Theeventwasorganisedby cechmedia andinvestmentcompanyOnionFanin associationwithMobile !OX.

Herecomesa toolto measure lungfunctionsover phone call lndian-originresearchershavedevelopeda newhealthsensingtoolthatcanaccurately measurelungfunctionoverasimple phonecallmadewithanyphone-notjust smartphooe-fromanywhereintheworld.

Thefindingscouldbeof specialhelpfor peopleinthedevelopingworld-whohave asthma,cysticfibrosisorotherchroniclung diseases-knowhow welltheirlungsare functioningwithoutvisitingadoctorora clinic,whichinsomeplacescantakedays of travel.

"\'{lewantedtobeable comeasurelung functiononanytypeof phoneyoumight encounteraroundtheworld-smarrphones, dumbphones,landlines,payphones,"said ShwetakPatel,professorattheUniversity of Washington.

Thenew rooliscalledSpiroCall.

"WithSpiroCall, youcancalla1-800 number,blow imothe phoneand use thetelephonenetworkcotestyomlm1g function," Patelsaid.

Thepatientstakeadeepbreathinand exhaleashardandfastastheycan until theycan'texhaleanymore.Thephone's microphonesensessoundandpressure fromthatexhalationandsendschedataroa centralserver, whichusesmachinelearning algorithmscoconvertthedataintostandard measurements of lungfunction.

"Peoplehavetomanagechroniclung diseasesfortheirentirelives,"leadauthor MayankGoel,computerscienceand engineeringdoctoralstudentatUniversity of Washington,said.

"Sothere'sarealneedtohaveadevice thataUowspatientscoaccuratelymonitor theirconditionathomewithouthaving toconstantlyvisitamedicalclinic,which insomeplacesrequireshoursordaysof trave�"Goelnoted.

SpiroCallisanadvancementover SpiroSmart whichtheresearchers introduced in2012toleepeoplemonitor dieir lungfunctionby blowingincotheir smartphones.

Overthelastfouryears,theteamhas collecteddatafrommore than4,000 patients who have visitedclinicsinSeattle andTacomaaswellasinIndiaand Bangladesh,whereclinicianshavemeasured lung function usingbothSpiroSmartanda commercialspirometer.

InsurveyingpatientsfromIndiaand Bangladesh,though,thereamrealised cbacasignificantpercentagedidnorown smarcphonesandwouldbeunabletouse SpiroSmartintheirownhomes which wasakeygoalof theproject.

The reamrealiseddiacdieonlysensor d1eywereusingwasamicrophone,which allphoneshave.

Sodieresearchersdecidedtodevelop asystemchat wouldworkwitbanyphone anywhereintheworldbyhavingdiepatient useacall-inservice.

Howthe coolmeets d1emedical community'sstandardsforaccuracywill bedescribedinapaperto bepresented inMayattheAssociationforComputing Machinery'sCHI2016conferenceinSaa Josc,California.

Nadella, Indra Nooyi, Bhavesh

AustralianHighCommissionertoIndia HarinderSidhutakestothecatwalkin anAbrahamandThakorecreationata fashionshowinNewDelhi.Organised byFashionDesignCouncilofIndia (FDCI)andTamana (an organisation workingwithautisticchildren and kids withspecialneeds),theeventfocused onkhadi,andsawdesignerswalkthe rampwithspecially-abledchildren and studentsfromDelhischools. Photo: Prokeraia.com

Patel make itto highest-paid CEOslist IndianoriginIndraNooyi,Bhavesh Patel andSaryaNadellamadeiccothelistof 100 highest-paidCEOsincheworldcompiled bycompensationinformationprovider Eqllilar.

LyondellBaselllndustriesCEO Patel wasplacedsixthonthelist withatotal compensationof $24.5millionwhile PepsiCo'sIndiaNooyiwasattheeighth positionwichapaychequeof $22.2million.

"adeUa,cheMicrosoftCEOmadethe cutat26thpositionind1e 100highest-paid CEOslistwichatotalcompensationof $18.3milion.

Oracle'sMarkV. HurdandSafraA.Caez toppedthe 100highestpaidglobalCEOs listwithatotalcompensationof $53.2 millioneach.

RobertA.lgerof WaltDisney($43.5 million),David?vLCoteof Honeywell International($33.lmillion),General Electric'sJeffrey R. lmmelt($26.4million), RandallL.Stephensonof AT&T($22.4 million),RupertMurdochof Twency-First CenturyFox($22.2million)andJames P. Gormanof 1forganStanley($22million) madeupthetop I0.

AccordingtoEqu.ilar,themedianpaywas $14.5milioninfiscal2015whichgrewby three percentfromthepreviousyear.

Asmanyeight womenCEOsmadeitco thelist."Mediancompensationforcbese eightwomenwas$20millionin2015,while averagepaywas$22.7million,"saidEqu.ilar. California-basedprivately heldEqu.ilar generatesinformationonexecutive compensationpackages.

Impactof recent regulatory move on Make in India ManufacturinginIndiahasnotbeen particularlystrong.Thisisbecauseof ahostof reasonsemanatingfromthe India'ssocialistera. Prominentamong theseincludelabourlaws resultingintrade unionism, licenses forregulatingproduction activityandthelike.

Buttheperformanceof theseccor evenpostdiacperiod(initiatedin 1980s andculminatingintothereformsof 1990s) hasbeenfarfrom sceUar.A.Ithough manufaccuringsectorhas grownoverall,che shareof manufacturinginGDP hasstayed constantataround 15 percent.Thechoice forconsumershasincreased manifold,but cbeoutputof manufacturinggrowtl1has beensteady.

Incomparisontotheservicessector, d1emanufacturingsectorhasbeenclearly alaggard.ln spiceof d1is,alargenumber of sub-sectorshave developedand deepenedcbemanufaccuringcapabilitylike cbeautomotiveindustry,pharmaceutical industry,etc.Another prominentfeamre of Indianmanufacturingisthatstillamassive portionisdonebycbesmallandmedium sectorenterp1ises.

Itisinthislightof thiscontextand backdropchattherecentmovebythe Departmentof IndustrialPolicyand Promotion(DIPP)(whichawaitsfinal approval of thefinanceminister)becomes important.Themovedoesawaywithd1e

30 percentsourcingrequirementforApple, theCupertinobasedtechnologygiant The sourcingrequirementmandatesthatin singlebrandretail30percentofcontentis tobesourcedlocally.Theapparentlogic beinggivenbytheIndiangovernmentis thatitcangramcompaniesanexceptionif theyarefoundcomakestate-of-the-artand cutting-edgeproducts.

Appletilldatehasnotbeenableto enterIndia,burmostlikelyseeslndiaas akeymarketasithasalowsmartphone penetration(<20percent)andshipped roughly 1.9milliondevicestoIndiain 2015.Also,intheyearsahead,Indiais slatedtobeoneof diebiggestmarketsfor smartphones.Tilldate,resellerswereselling AppleproducesinIndia.Thiscouldchange if themoveseesthe financeminister's approval.

Therearethreeimportantissues surroundingthemove.First,ittriesto rectifyapolicy problem withaspecific move.Thec1uestionno,vis,how iscbe decisiononcuttingedgeproductsbeing made.Appleisintoelectronicconsumer durableslikephonesandlaptops.Jcdoes notappearcuttingedge.Jf achangehasto bemaded1echangeshouldhappenacd1e FDIpolicy level.

Also,itwillbe verydifficult toreject applicationsbyplayerslikeXiaomi,the Chinesesmartphonemaaufacmrer,as itsproductsusesimilartechnology.ln acompetitivemarkerchiscouldvery easilyspelldoomforincumbentIndian companieslikei\ficromax,whohadnoi: facedmassiveinternationalcompetitiontill dace.Thisbringsustotherelatedissueof theimpactof themove.

Second,themoveisslatedtoimpact differentstakeholdersdifferently.Forthe

consumerschoiceandserviceisgoing toincreaseandmostlikelythepricesare goingtogetstreamlinedwithinternational pricesof Appleproducts.Thismaybeseen asbeneficialin1paccof Apple'sentryfor consumers.

However,with regard co keyprograms like'MakeinIndia'themovecouldhave a'noeffecttoanegativeeffect'unless Applealsoinvestsinmanufacmring.The movedoesprovideApplewithaccessto 1ndianmarketbutdoesnotprovideIndian industryespeciallyMSi'vfE'swithmuch scope for capacitybuilding.Itisbecause theclusterof ancillaryfirmswhichcould supplyparestoApple bylocalproduction andmanufacruringwillnottakeplacenow. lnadditionif XiaomialsoentersIndia chancesof incumbent firms facingstiffer competitionmay be bad from'Makein India'pointof view.

Third,themovedoesnothelpthecause of makingIndiaahubof ESDM sector. Thisisbecauseitjustmakeslndiaamarket butnotaproductiondestination.Ideall)r, Appleshouldmakeacommitmentcoinvest inIndiaascosesarelowwithrespect co labour(eventhoughApple'sbusinessisnot verylabourintensiveanditoutsourcesmost of itsproduction).

Thecapacity buildingeffortinIndia canalsohelp AppleimmenselyasIndiais adiversenationandcanthrowup unique insightsintooperatinginemergingmarkets. TheFMmuselook intoallthederails of what went into the movebyDIPPbefore signingthedocument.Also,it seemslikeit .istimefor reviewof sourci.ngrequirements if d1eyareindeedcomingind1ewayof progressin cbe present policycontext.

IANS

INDIANLINK
MAY2016 19

Lovingraysfrombeyond thes n

hadnohesitationingiving herpermission.

a!"alittlevoice brokeintoRadhika's thoughts.

"Yes,mylittleone," shesaidtotbethreeyear-old."\'iv'hatis thisyouhaveinyour hands?"

"A giftforMother'sDay."

AsRadhikatookthegift inco herhands, sherealisedthemudscrucrurewasstillwet.

'1tisbeautiful,Seema,butweshould letitdry abitmore.Shall}leaveiton the windowsill?"

"Butdoyouknowwhatitis?"Seema questioned.

Radh"ikalookedatthestructure-asquare block.Shewhisperedwithasmile,"Asign of yourlove?"

" o,sillyNfa,itisal10L1se, ourhouse. \Vewillalllivethere.EvenArnnBhai,"she pointed tothephotoonrhedesk.

AsRadhikagaveSeemaacuddle,the rearsthatsherefusedtoreleaseinfrontof herkids,fellinstreams.Shetriedco wipe tl1etearsbeforeSeemasawchembutwas notfastenough.

"Don'tyoulikeourhouse,Ma?"

'1tis themostbeautifulhouseanyone hasbuiltforme.rowgooutandplaywith theothers.Soonitwillbedark.Go,l will comeoursoon."Gently,Radhikawalked Seematothedoorandthenreturnedto lookarthehouse.

Herdream too hadstartedlikethishouse, builtoutof loveandforthosesheloved. Slowly thepages fromherpastAew openastheyrookhertothedayshehad wedherbelovedhusbandandcometohis home.Likea dream,happinesspresented itself timeandtimeagain,intheformof a beautifulhome,in theformof herfamily andtl1enagainintheformof herchild.She wascontent bringingupherbeautifulboy Arnn.

Hewasagentlesoul whoaskedfor nothingbut.love.Whogaveaway histoys if hesawachildinneed.Whohappily sharedhismealwiththedisadvantagedwho walkedpastthegates.Whoinsistedthatthe stra)'animalsbefed.Ateenagerwhoonly everspokeingentletonesandwhowould standupcobullies cosavehisclassmates.So gentleasoulthatRadhikaoftenfeared for hisfurureiaaworldtl1at oftenforgetswhat itmeanstobehuman.

Just likebisname (Hindi for'slll1'),he radiatedwarmtl1whereverhewent.Even histeacherscommendedhisbehaviour andheldhimupasarolemodel.His friends lookedtOAnmforguidanceaad tl1eneighbourhoodreferredto himas'the perfectchild'.

TimeflewtowhentheHSCexamswere justaround die corner.Arnn andbisfriends hadpreparedwell,oftensrudyinglateinro tl1enight.SowhenoneweekendArnn askedcogooutwithhisfriends,Radhika

AsRadhikaandher husbandsatdowntodiilller, shesuddenly feltapangin herheart.Itlastedbutafew minutes,andwasgoneas soon asshehadaglassof water.Buewhile thephysical sympromhadgone,apart of herwasnorabletorest easy.

Itwas pre-mobile daysso after dinnerthey wentrothe frontlawnandsattherein thedark waitingforArun. Attheapproachingcar,she letoutasign of relief,only tohaveit turntofearasshe saw thatthecarwasactually apolicecar.Evenbeforetl1e officershadenteredtl1egate, Radhikaknew.Herheart knew.Andevenherhusband knew.Thepartof tl1emtlrnt was thebest,tl1epartof them that was aauesymbol of theirlove,wasgone.

Herhusbandwemto identifytheirson.Shecould notbringherself rogo. Insteadshewentandsat inArun'sroomholding hislatestnotesinher hand.

Hisfarewelland hislastrites was adifficulttime fortheentire neighbourhood. Arnnhad somehowmanaged comakehimself tl1eirsaswell.Hadit notbeen forherfamily and herfriends,Radhika wouldnothaveknownhowto passthathorribletime.Even thewalls closedinonher, andthesoundof everycar madeherrelivethelossof Atun.Heronly solace wasinhis dreamsandbismemories.

Andtl1enoneday, whenshewasrecalling herconversationswitl1herson,hismessage cametl1roughloudandclear.Hishadbeen alifeof giving,of lovingandof caring. His actionswerealwaysthoseof protectionand solace.Intheshorttimehehadvisitedtliis earth,hehadleftamightylegacy.Nowit wasupcothemtokeepitgoing.

orwithtearswhichdidnotquench thethirstof theparched,not withsorrow whichdidnotcomforttheneedy,andnot withsadnesswhichdidnotshelterthe homeless.

Andsoadreamwasborn. Withoutfinance,witlioutlabourand withouteven land, ahopearoseandawill tookformtoseethelegacycomealive.The tearsthathadoftendrenchedtl1eircheeks wereneveragainallowedtofall.

GuidedbyArun'smemory,they knocked ontl1edoorsof anticipation.Likea miracle,thedoorsopenedonebyone. The permissionthatwasprayedforwas given and tl1eventuresbegantotake its shape.

Anindustrialistdonated someland,abusinessman bricks.Acarpenterputin thedoors,anelectrician wired thehome, wholesalersgavethem paintandnurseriesplantedagarden. Finallytheroomswerefittedwitl1cotsand beds.Staff wereemployed,butonlythe onesthatreAectedthekindof lovetl1at Arunwasknownfor.

Ontl1eday tbe lastact wasdone,the namingof theirnewplace,Radhikaandher husbandcriedagain.

Itdidnottakelongforthewordto spreadthattl1eirgateshadopened.Radhika stillrememberedtl1ebittersweetmoment whensheheldthe firstbaby inherarms, leftatthedoorstep withjustalittlenote: Takecareofhim-frollla111othe1·111hocan't.That wastheday shebecame'Ma'again.

Fromlookingafterafewchildren,the venture grew asthey were unable torefuse theirlovinghometoanyone.Anditwas thendrntRaclhikareceivedhersign Itwas asif Arun wassaying,"Nooneisours forever;andjustasyouwereabletoletme go,sotoomustyouletthemgointhename of love."

Aweeklatershe put the firstbaby up foradoption.Inalandwherecaste,creed andlegitimacy weresoimportant, shehad fearedthatsocial taboosmightbecomean obstacleintheircause.Buttheloveof a

childandacouple'sneedforababywere both fartoopowerfula forcetostandin thewayof afewpeople'sprejudices.Slowly theysawchildafterchildsettledincoloving homes.

Thechildren werelike passinggifcsthat cameintotl1eirlifeasremindersof Anm's love,andleft withlovingparentsasa validationof hislegacy.

"Ma,it'sdarknow,isourhousedry?" Seemabrokeintoherthoughtsagain.

Radhikajrnnpedoutof chairand walked rowardsthemodel.Touchingit,shesaid ''Notyetmylove,tomorrowwhenitisdry, IwillnameitArnnAashray."

Seemabeamedasshesaid,"Justlikeour borne!"

Suddenlyshefeltherhusband'sarm abouthershoulder,andheardhiswhisper "Theywantherastheirdaughter."And then,hertearsfellagain.

Thisisa workoffictionbasedonand dedicatedtothe 1·ealRadhika.All conversationsarethe imagination ofthe unite,; The realRadhikaandherhusband havebuilta homef01·India's own 'Blossoms intheDust: children who,for whateverreason,arel.eftbytheirparents attheirdoontep. The venture welcomes donationtotheirt-rustforthecareofthe childrenatt-heir home.Formoredetails andfordonations, visitthe website www.aruna.ashray.com

fiction
''
A heart-warming short story, based on real life, on the power of a mother's love
20 MAV2016
www.indianlink.com.au l'J

Injust over four years, 66 children have been rescued. 40 adopted by loving families. J.2 reunited wtth their own biological families. Th other children are being nurtured at Arun Aashray

INDIANLINK
MAY 2016 21

Ifyou'reanemployerlookingtohire, it'stimetoletyourlocaljobactiveprovider find the right matureageworkerforyou.

Yourbusinesscanbenefitfromtheirlifetimeofexperience. Workersaged50andolder arereliable, flexibleand readytocontributefromdayone.Andthankstothe Restart programme, there'sa$10,000*wagesubsidyforemployerswhohire maturestaff. It's all partoftheAustralianGovernment'swayofconnectingemployersto activejob seekers.

·Receve upto $10,000 (GSTinc)ffyou empoyand retain ajobseekeraged 50 yearsofageoroverwhohas been registered wth therlocaljobactive providerforsxmont.hsormore.

Advertisement
AustralianGovernment
restart
the right fit Search for jobactive to find your local provider Authorisedby!tie Australian Government, Capta Hill, Canberra 22 MAY2016 www.indianlink.com.au l'J
II}}}jobactive
Find
Overseas VIKRANTCHADHA rr'ravefs Sevv�that"mattev� NoOverseasCallCcn(cr, ServiceFromMelbourneOfficeOnly 1call Special fares from India to Australia starting $999*Luggayc; Ju1<g beforeyou bookyourairticket Special faresfor India, Pakistan, , Srilanka, Nepal, Europe & USA (c'l!l:t-61-0451050693.+61-0414424376.+61-(03)95683906 : • � travelsoverseas13@gmail.com :;;::-!";'..�-: -INDIANLINK GREAT KNOWLEDGE COMES FROM THE HUMBLEST OF ORIGINS DEV PATEL JEREMY IRONS THE MAN WHO KNEW INFINITY !Nl'RODUC!NG DEVIKA BHISE Wffll STEPHEN FRY AND TOBY JONES BASED ON THE TRUE STORY MAV 2016 23

Shanul Sharma has had quite thejourney from lead singer in a heavymetal band to tenor soloist

ShanulSharmahasnochadwhat youwouldcallanordinary life.Froma 19-year-oldwho arrivedonAustralianshores withtheincentioncopursue ITEngineering,hefoundhimselfgracing thestageastheleadvocalistoftheheavy metalbandSobrusionbeforetransitioning cosinginginthewesternclassicalsc:yle.The bandpartedwaysin2012,butSharmahad bythenalreadysethissightsonacareerin opera.

Today,heappearsasatenorsoloistinthe showCanzoniDi.MioPadre(.'011gsi\,'[yFather TaughtMe)-aneclectic mixofNeapolitan andpopularItaliansongsperformed withchebackingofamajestic55-piece symphonicorchestra.Thebrainchildof talentedmusicianandconductorDaniele Ciurleo,ShanulSharmaappearsalongside DavidVisentinexecutingsongsin the styleofoperaticlegendssuchasLuciano Pavarotti.

Shanna'stransitionandrisefroma heavymetalandrock'n'rollartistbasedin regional SW,toanopera singertrainingin Melbourne,isasfascinatingasitisunusual. However,hisfirstmemoriesofmusicare muchclosertohome.

"Mydadalwaysmaintainedthatmy firstexperienceofmusicwaslisteningto oldMohammedRafiandKi.shoreKumar Bollywoodsongs inthe backoftbecar," hesays.

Note,'lactlyhowyouwouldimaginetbe musicalleaningsofeitheraheavymetalor anoperasinger totakeshape now,would you?ButchacchangedswiftlywhenSharma arrivedinAustraliatopursuefurther scudies.

"Istartedoffwicl1Bollywoodmusic," heexplains."Then,duringmy highschool years,1wasexposedtowesternmusicMichaelJacksonwasabiginfluence.1 got aheavymetalalbumbyDefLeopardand chacbasicallysetthecourseforwesternrock 'n' roll."

\Vhenthetimecan1e,icwasadifficult choicetomakebetweenwhachas traditionallybeenconsideredtwodifferem pathstofollow-career(ITEngineering)or

,, Ityouhear

MohammedRafi singthat famous song 'Madhuban Mein Radhika Nachi', it's got all those ups and downs and all those trills ''

passion(singing).However,Sharmahadthe determinationcommhispassionintohis career.Butheadmitstbatwouldn'thavebeen possiblewithoutthesupportofhis father.

"My dadalwaysencouragedme copursue singing,"Sharmasays."Healwayssaid chatthere,villbemany ITengineersinthis world,butonlyafewofuswhocansing, sopursueyoursingingwhileyoudoyour scudies."

Sharma hadalreadystartedinfusing westernclassicalelementsintobisstyle ofsingingaround2010,whenhewas panoftheheavymetalband.Still,heavy metalandwesternclassical appeartobe polar opposite genres-notjuststylistically butalsointermsofexecution.Irwas Sharma'saffinityforoldBollywoodand Indianclassicalmusicthataidedhiminhis transitionintowestern operasinging.The overlap betweenthetwoclassicalmusic stylesisstrongerthanonemightimagine.

"Iexploredwesternclassicalsingingas astylisticexpressionandwassurprised achownaturallyitcametome,"Sharma reveals."Thevowels,whichisbasicallythe coreofthesoundin Hindi,areverysimilar cothevowelsinItalian.lc'sa very open language,withanopenthroat,soitwasn't allthatalienrome."

"IfyouhearMohammedRafisingth.at famoussong'Mr1dh11hanMei11R.adhika Na,chi',it'sgotall those ups andclownsand allchosetrills,"Sharmasays."Thec:ypeof singingchat1 doinoperaincludesallthose aspectsaswell.Inaway,it'ssortofnatural. Thestylesareactuallyquitecloselylinked onceyouanalyseit."

Youwouldn'tthi.u.kit, butbeing partofa heavymetalbandprovedcobetheperfect training groundforanoperatictenorinthe making.

"Naturallyspeaking, 1 don'thavewhat they calla'big'voice.Myvoiceis that of alyrictenor.Jt'sa'sweeter'sound.Jr'snot Likea bulldozer.It'sLi.keabeautifulRolls Royce,soyouhavecotreatitwithca.re andhaveprecisioninyourapproachco

singing,"Sharmaexplains. "Thataspect led metoexploretheclassicalstyle,because it'sbased onefficiency.Theheavymetal bandwasactuallyquiteloudandcobeable cosingontopofthatensemble -wich theheavyguitarandthebigdrums-you have todevelopfrequenciesinyomvoice thatareverysimilartowhataclassical singerdoes.Ihadtoinstinctively develop allcl1oseaspectsinmy voiceinmyrock 'o'rollyears.Inmyownway,Itaught myselftosingclassicalmusicwithouteven realisingit!"

Always lookingto improveandchallenge himself,Sharmahasalreadytakenagiant strideinestablishingasingingcareer.

"I'vebeen acceptedi.urocheWales InternacionalAcademyofVoice.This schooltakesaboutfifteensingersevery year,fromawholepoolofsingersacross theworld,cotrainchemintoprofessional internationaltouringartiscs.I'mtryingco fundraiseatthemoment,comakemyway toCardiff.Staythereforelevenmoncl1s, learnasmuchasIcanandhopefullygeeon theinternationalcircuit."

cover sto
24 MAV 2016
www.indianlink.com.au l'J

apakehtehainhada1/{ldfllkareg" Betah11maraaisakaa111kareg"

Perhapsnorinthesamewords, butinspiritarlea.st,that'swhat tenor soloistShanulSbarma successfuUyaccomplishedinhisrecent performanceattheElisabeth1\ilurdoch HailattheMelbourneRecitalCentre. Sharma,alongwithDavidVisentin, performedacollectionof eapoliranand popularItaliansongsaspareofCm,zoni DiMioPadre (.1011gslv[yFatherTa11ghtMe), beautifullyarrangedandorchestratedby conductorDanieleCiurleo.

lcouldnotcontainmyexcitementat gettingrowatchanIndian-bornperform Italianopera.Wasittherarityof sucha combinationthatmadeitsothrilling?Or wasittheconnectionof myhomeland inalargelyforeign landscape thatadded tothejoyofwatchingthisliveopera performance?

Tbehallwasavisioninitself.Exquisite hand-cuewoodenpanelslinethewailsand ceilingofrhe 1000seatauditorium,which hasthetraditionalboxshapeofEuropean concertha.Us.lt,vasmood-litforwhatwas goingtobeanenthrallingafternoon.

/\siscmromary,the55-piecesymphonic orchestrawasalreadyonstagenming theirinstrumentsandrestingthem.The hostessarrivedacoupleof minuteslater andintroducedtheconductorCiucleoand therwotenors,SharmaandVisendn,wbo cameonstageandcooktheirpositions.

Theircrisp linen shirtsandstarched

collarscontrastedthedarkjacketsthey wore.Wbatwasmostendearingwasthe camaraderietheyshared•shakinghands, bugging,noddingheadsandsmilingateach other.

Theybeganwithasongca.Lied'Qua.nro SeiBellaRoma',whichquiteliterally translatesto'Howbeautiful areyouRome' Intotaltheysang20songsbetweenthem, withthreein tbeorchestralinterlude.

NotknowinganyItalianwastheleastof myworries,sincethepowerandbeaury oftheirvoicestookmetoplaceswhere alanguage barrierissurpassedbythe enjoymentofmusic.

WhileVisentin hadthecontrolofan experienced,moremarureperformer, Sharmacomplimentedhimwithhissweet, full-throated,unrestrainedsound.Itwould beremissnortoaddthatoperasinging requiresarangeof vocals,andbothtenors displayedthatrangetoasuperblyengaged

audiencethroughouttheconcert. lcwasanunusualandjoyfulexperience. Fromwhat1haveseenof operason the television andin.films,Ifeltitwasahigh a.rtthatexpectedacertainlevelof snooty colcL1essanddistant pleasureatbest.But tbatwasnotthecasehere.

Thosewhoknewthesongswere encouragedtosing,andsingtheydid. Sharmamadecommentsandquips throughout,smilingandjokingwitbthe audience Bothtenorsencouragedthe audiencetoactuallyclapalongtothesongs theywereperforming. Theatmosphere wascharged andcarrieditselfoutsidetoo whereSharmaandVisentinweremobbed bycbeaudienceforpictures,hugsand autographs.

Afterseeingthepairreceiveastanding ovationfromtheaudience,Ileftwitha sensethatanythingispossibleifpassions a.refollowedthrough.

BYJASMEET SAHi
INDIANLINK
MAV 2016 25

ethnic business awards

founding partners

IT�NIC �USIN�SS AWARDS ,n 5

2016 NOMINATIONS NOW OPENJ

Were you born in a country outside Australia?

Are you a permanent resident or an Australian citizen?

Are you full owner or part owner of a successful business?

Then you are entitled to nominate yourself or to be nominated for one of Australia's longest running business awards.

The Ethnic Business Awards have been designed to recognise and reward the valuable and innovative contribution made by migrants to the Australian economy

We are also looking for stories of inspiration from the Indigenous community for our 'Indigenous In Business· category

LET YOUR STORY BE AN INSPIRATION TO OTHERS - NOMINATE NOW

For more information contact Maria on 02 9568 5022 or visit www.ethnicbusinessawards.com

NOMINATIONS CLOSE 31 st MAY 2016

(
-
ards
YOU TO OUR SPONSORS ETHANGROUP GLOBAL CAJ"')JTA. DIVERSITY SBS • Aui.tralian ('..m-cmmml Departru€•nlorSoeiRIStn1cu TVB 1!51RobinsonLegal A.08TRA.l,U funhPtP!Iil:E5J DTOP M (, o WhletheEthncBusinessAwardsPtyLtdwilluseitsbestendeavourstoensuretl1attheawardstakepaceInaccordancewitl,pubishedgudelines.Ethnc Busness AwardsPtyLtdwllnotberesponsiberorany ossordamagetoany sponsoror thirdpartyars ng rromtheneedtornodiryorevenc.ance the.awa dsasa resultorcircumstances reasonablyoutsdethecontrolofEthnc BusnessAwardsPtyLtd. 26 MAY2016 www.indianlink.com.au l'J
THANK

AustraIiaIndia

BusinessCouncil

Celebrating30years

SPEAKERS INCLUDE:

Engaging with India 2016

The Annual Australia-IndiaTrade and Investment Forum

16-17May2016 I Swissotel Sydney

Hon AndrewRobbAOMP, Special Envoy for Trade, Federal Memberfor Goldstein

MrPeterVargheseAO, Secretary, Department of Foreign Affairs and Trade

His Excellency Mr NavdeepSuri, The High Commissioner of India to Australia

Hon Stuart Ayres MP, Minister for Trade, Tourism and Major Events, NSW Government

Lance Hockridge, CEO, Aurizon

Michael Blythe, Chief Economistand Managing Director of Economics, Commonwealth Bank

BVanlalvawna, Consul General of India, Sydney Consul General

SUPPORTED BY:

AustrnlianGovernment Anstrade

SPONSORED BY:

JeyakumarJanakaraj, CEO, Adani Mining

SushmitaChadha, CEO, State Bank of India

AshokJacob, Chairman and Chief Investment Offcer, Ellerston Capital, Chairman Australia India Council

Gaurav Gupta, Managing Director & Head, Macquarie Capital India

Dipen Rughani, National Chairman, Australia India Business Council

Michael Kasprowicz, Member ofthe Board of Cricket Australia - Australia India Council & Former International Cricketer

Australia _. UNLIMITED �"I!@ HighCommissonofIndia

Kathy Klugman, First Assistant SecretarySouth &WestAsia Division, Departmentof Foreign Affairs and Trade

PawanLuthra, CEO, Indian Link Media Group

ofAustralia /

c

Indian Link

DISCOUNTED RATES FOR AIBC MEMBERS, SMESAND START-UPS APPLY

'r ----= �--
FINANCIALREVIEW
)
/�) \E
·:·
� � FRAG0MEN vI ... I ) \'' ! Lr I. ,11estpac
::.eg::.
CRICKET AUSTRALIA BOOKYOUR PLACEAT> www.afrindia.com.au INDIANLINK MAV 2016 27

Grown In Australia. For food where100 per cent of the ingredients are Australian grown.

Product of Australia. Forall food where 100 per cent of the ingredients are Australian and all major processing has been done here.

All imported foods produced, made, grown or packed outside Australia with their country of origin on the label.

Made In Australia. Major processing has been done here. Imported foods that are only sliced, canned, reconstituted or repackaged here cannot make this claim.

Packed In Australia. Features only a bar chart which shows the percentage ofAustralian ingredients.

New food labels offer a clear choice.

From July 1, the Australian Government is introducing new food labelling, making it clearer where your food comes from. Easy to understand labels will tell you at a glance where your food is

grown, produced, made or packed. And the percentage of Australian ingredients will be displayed in a simple bar chart to help you make more informed decisions for you and your family.

ADVERTISEMENT
AustralianGovernment P Search clearer food labels See what you're getting AuthorisedbytheAustralianGovernment,CapitalHill.Canberra. 28 MAY2016 ■ ■ ■ ■ www.indianlink.com.au l'J

zucc n1

Z might come at the end of the alphabet, but the versatile zucchini comes first for delicious healthy recipes

Zucchini,orcourgette,isoneof theeasiestvegetablestogrow ina temperatecLimate.\'v'ith itsancestryinAmerica,this veggieisalsocalledmarrow in somepartsof theworld,andbelongsto d1esamefamilyaspumpkins,squashand cucumbers Tbehumblezucchiniisverylowin caloriesandloadedwid1 folate,pro-vitamin Aandpotassium.Ithasonly 17 calories per 100grams.UnLikecucumber,you

can cookzucchiniin aversatilemanner. Thebe.stpartaboucchissquashisiliat ithasadeLicateAavour.Youcancookit wiili verylittlebutteroroilmakingitan idealvegetableforsalads,soups,juices, breads,ratatouille,bakingandcrepes,asis oftenseenin Europe.Youcanalsoserve zucchiniwiilimincedmeac,rice andherbs inastewlikeinilieMidclJeEast.These daysstuffedzucchiniandzucchini curryis verypopularinmanyAfricannations.

Zucchini Aowersareanexquisite delicacy,friedinalittleoil withalight coatingof tempurabatter.InMexicothey enjoythevegetableAowersasafillingin quesaclillaso.rinsoups.

Youcanalsocutzucchini witha spiralizercomaketheverypopular zucchininooclJesor'zooclJes'likeilieydo inVietnamorThailand.

ZucchiniMuthia

You must have seen recipes of Laukimuthlamade from bottle gourd. This recipe uses zucchiniinstead of bottle gourd - you can make the same great tasting recipes in countries like Australia where bottle gourd is an exotic vegetable and not so easily available in markets. The quantity of dry ingredients has been slightly changed as bottle gourd has a higherwater content thanzucchini.

Ingredients

2 cups grated zucchini

½ cup whole wheat f our

½ cup besan (chickpea f our)

1 cupsemolina

1 tbsp oats f our

½ tsp turmeric powder

¼ tsp asafoetida

¼ tsp baking soda

½ tsp cumin seeds

1 tsp ginger paste

1 green chilli, chopped finely

10 sprigs coriander, chopped finely

1 tsp lemonjuice

3tsp olive oil

Salt to taste

ForTempering

2 tbsp oil

½ tsp mustard seeds

2 tsp white sesame seeds

Method

Grate zucchini and keep aside. In a bowl mix all ingredients with

RawZucchiniPasta

Which is the healthiest type of pasta? Generally we think it must be whole wheat or organic varieties, but, there is another, healthier way of having pasta - making it yourself from natural, raw ingredients. Yes, you read that correctly, raw 'pasta' - it's very tasty! Have a look at the recipe below and try it, you won't be disappointed.

Ingredients

2 small zucchini, ends trimmed

½ cup fresh basil leaves

½ cup coriander/parsley leaves

1 clove garlic

2 tbsp extra-virgin olive oil

1 tsp fresh lemon juice

Salt and pepper to taste

Cherry tomatoes (optional)

Method

Use a julienne peeler or spiralizer to slice the zucchini into noodles. Set

aside. Pulse the basil, coriander and garlic in a food processor until coarsely chopped.

Add the olive oil to the mix and pulse again. Scrape the sides of the processer with a rubber spatula.

Add lemonjuice; season with salt and pepper.

Combine the zucchini noodles and pesto.Add cherry tomatoes if desired. Serve at room temperature or chilled.

zucchini.

Knead it into a soft dough. Use water if needed

Prepare steamer.Add about an inch of water and let it come to the boil. Apply some oil to steamer tray.Apply some oil to your palms anddivide the dough into four equal portions

Shape each portion into a cylindrical roll approximately 5 inches long and 1 inch in diameter and arrange on greased tray

Steam for20 minutes. You can check if the muthia is done by inserting a toothpick - it should come out clean

Let cool for 10 minutes then cut into half inch slices

Heat oil in a pan on medium for tempering

Once hot add mustardseeds and sesame seeds. Let them splutter Add sliced muthia. Mix gently so muthia do not break andsaute until you get light brown and crispy muthia. Serve hot.

■ ■
• . . . • • . • • • • . . . • • . . . • • . . • • . • • . • • • • • . . • • . • . . • • . • • . . • . . . . . • • . . . • . • . . . • . • • . .........................................................
INDIANLINK
• . . • • . • • • • . . • • . • • . • • • • . . • . • . . . • . • . . . • • . . • . . . . . • . . . . • . • . . . • . . • • . • • • • • . • • food ........................................................
MAV2016 29

Thelarge,glossyblackskink remainedquitestillwatching us,whileadiminutivewombat rustledinthe undergrowth.Our waU,hadbegun deepwithin Lamingron NationalPark,settingout fromO'ReiUy'sRainforestRe[reatalonga trackshadedbymassiverainforesttrees, tumblingvinesandbanyanrootstwisted aroundboulders.

MydaughterLaurenandIhadjoined otherguestsforamorningwalkwithour guideLukecoElabanaFalls,following a crackalongsidearockstrewnfreshwater streamthatrequired ustoclamberacross toviewthewaterfall.Onourrenunwesaw brightbluespinycrayfishontherocksand then,lyingcurledupintl1ecentreof the tracksunningitself,wasaredbelliedblack snake.Witl1adietthatcomprisesmainly frogs,westillconsidereditprudentco sidesteponeof Australia'smostvenomous snakes.

Lam.ingtonNationalPark isavast wildernessareajustundertwohours'drive inlandandaworldawayfrommeglitzy highrisebuildingsof tl1eGoldCoast. AndwhiletheGoldCoastisoneof our topvacationdestinations,fewvenmreco Australia'slargestremnantof subtropical rainforest,aplaceof waterfalls,deep vaUeys,steepcliffsgougedomof volcanic rockandruggedmountainranges.

ListedasaWorldHeritagesitein recognitionof.itsbiodiversity,itoffers variousforesttypes.includingcool, temperateancientAntarcticbeechtrees, datingbackmousands of years,their trunksgreen,vimmoss.Lush subtropical rainforestsfoundinthevalleyshavepink barkedBrushbox,mottledCoachwood, Redcedarandtheworld'slargestcollection of toweringHooppine,oneof theworld's oldestconifers.Inthedrier,openareas, expansivescentedeucalyptforestsare hometobrightcrimsonrosellas,wallabies and koalas.

Ona journeyfromtl1e copof tl1e McPhersonrange,ataheightof 1100 metresabovesealevel,down rl1eslopesto meopenforestyouwillpassapproximately 300different species of trees,85different speciesof vines,90differenrfernand orchidspeciesaswellasmanyvarietiesof mosses,Lichensandfungi.Asaresltltof suchadiverseenvironment,Larn.ington NationalPark,coveringanareaof 20,000 hectares,sustainsastaggeringnumber of animals-over 160speciesof birds, 70speciesof mammals,aswellasmany reptilesandtnvertebrates.

Togetusd1ere,webookedatransfer withDavidStrong,whohasbeendriving toO'Reilly'stodeliversuppliesfor decades. Heknowsrheareasowellthathe doubledasourtourguide,stoppingatthe picturesquehistorictownshipof Canungra.

Theroadthentookonconsiderable elevationwithlongsweepingnuns until we arrivedatO'Reill)"sRainforestRetreat intimetowatchthebirdof preyshow, showcasingmebirdsfoundherein free Aightincludingabarkingowl,kite, brown falconandStella, aspectacularwedge tail

travel
30 MAV2016
www.indianlink.com.au l'J

eagle, witheachbirdbroughtinrestingon thearm of l\fark'TheBirdman'Cull.econ. Watchingthebirdswasfascinating,in panbecausethey followedMark'severy commandandbecausetherewasnothing tostopthem Ayingaway.

A4WDtourroKurrajongLookout followedwithsplendidviewsofthevalley belowandbilly teathatourguideJustin infusedwitheucalyptleaves,servedwith dampei:,theAustralianbushman'sanswer tothescone.

Atalmost1000metresabovesealevel, nightfallatO'Reilly'sbroughtchilly winds, tl1elandscapedrapedinmistandswirling clouds.Thecracklingopenlogfireinthe gnesthouseloungeroomprovidedacosy placeforgueststocurlupandreador recounttheday'sadventureswithother guests.

Justafterdaybreak 1 joinedaguided wall,,thebesttime toviewrosellas,btight greenandredkingparrotsandblackand gold regentbowerbirds.Overbreakfast 1scrutinisedtheparkmap.Thereare over 160kmsof walkingtrailsspanning distancesfrom400metresto32kilometres. Isettled ontheshortest-O'Reilly'sTree TopWalk-which allowsyoutowalk acrossasuspendedwall,way highabove tl1eforestAoorwithtwoobservation decks30metres abovetheground.Lacer tl1atafternoon,aguestladenwithserious hikinggearincludingbinoculars,emergency rationsandbeaconremrnedfromthe 21-kilometre AlbertRiverCircuit,which passesseveralwaterfallswithevocative AboriginalnamessuchasGurragungalli FallsandJimbolongerriCascades. Prior toEuropeansettlement,the Lamingtonregion wasinhabitedfor

thousandsof yearsby nomadicAboriginals of theYugarnbebkinship group wbolived by collecting abountiful harvestof nuts, nativeyan1,honey,macadamianutsand plantsandhuntingbirds, wallabiesand kangaroos.Evidenceof theiroccupation canbeseeni.nrocksheltersandonscarred trees.

Recognisedasoneof Australia'spremier birdwatchinglocations,severalgnestshad come for just mat.Wesawbowerbirds, fairy-wrens, honeyeatersandbushturkeys busy atwork,buildingtheirmoundsforme incubationof theireggs whiJesquawking blackcockatoosnibbledaway inthetree canopy.

Nextmorningtherewasan unmistakable odourof burningtoastcomingfromtl1e diningroomwithanelderly gentmanning theslowturningtoastermachine witha pairof tongs,seemingoblivioustothe slicesof charredbreadspurtingforthashe answeredaguest'squery indetail.Itwas MidO'Reilly whohadcometoleadone of theday'sexcursions.

LastyearLamingconNationalPark celebrated 100years,fouryearsafter thearrivalof theO'Reilly brotherswho rodeonhorsebackandsettledhereas dairy farmerscarvingoutgrazinglandby clearingvasttractsofdensescrubencircled by forest.Toprotecttl1eprizedhoop pinefromillegalloggingandtoprevent poaching,anationalparkwasdeclaredand theO'Reilly brothersbecameQueensland's firstparkrangers.Many kilometresof walkingtracks werebuiltthroughthepark duringthe1930stoprovideemployment duringtheGreatDepression,withthe 23-kilometreBorderTrackthemost famous.

,, Last year Lamington National Park celebrated 100 years, fouryears afterthe arrival of the O'Reillybrotherswho rode on horseback and settled here ,,

Onourfinalday,LaurenandIjoined aSegway ridetravellingthroughopen eucalyptforest,onwindingdirttracksand creekcrossings,toMoran'sFalls. That night,ourlastexcursionturnedoutto bemy favourite.WeremrnedtoMoran's Fallsnowmagically transformedtoview thecolony of thousandsofglowworms thatlightupagrotto.Sittingquitestill,our

guideJustinrecountedAboriginallegends, hiscommentary interrupted by thedistant callof thenocturnalmarbledfrogmouth. AswedrovebacktotheGoldCoast, passingplacenamessuchasStockyard CreekandDuckCreekRoad,andasday turned tonight,theneon lights were flashy andbrightin starkcontrasttotheglow wormgrotto'sgentletwinklinglights.

TransporttoO'Reilly's can bearrangedfromthe Gold CoastwithDavidStrong, E:transfers@mountaincoach.com.au

TheHiltonSurfers Paradise hasstunningviews overlookingthebeach.W:www. hiltonsurfersparadise.com.au

O'Reilly's RainforestRetreatoffersluxuryvillas (idealforselfcatering),suites, mountain orgardenviewroomsandsingle rooms. Excursionsand activitiesfor all agesare offeredwith an environmental focus. W:www.oreillys.com.au

INDIANLINK
MAY 2016 31
ThewetseasonspansNovemberto March.Strenuousbushwalksareadvisable between ApriltoSeptember. Bringwarm clothing.

MATRIMONIALS

SEEKINGGROOMS

Seeking suitable match for Sydney-based HinduPunjabi girl withstrong family values, born 1986and working as a school teacher. Height is 5'0";slim and attractive. Family well-settled in Sydney. Enquiries from families of groom with permanentresidency or Australian citizenship only. Professional match preferred. Please send photo and details to sydcity15@gmail.com

Looking for a suitable match for Sydney-based Sikh girl, 30, 5'7'', slim, fair, very beautiful. Currently working as dentist in dental clinic in Sydney. Family very well settled inSydney. Boy should be qualif ed and smart. Please email details with photo to inder7763@gmail.com

Seeking a successful, professional groom (d.octor, lawyer, banker etc.), preferablygrown up inAustralia, for a pretty and successful lawyer, 37, 5�5�, never married. She has been brought up in Sydney with a blend of Indian andAustralian values. Please respond to sdhmatri549@gmail.com

Seeking suitable match for 56-year-old divorcee,Perth-based, well-settled, Australian citizen, IndianChristian. Good looking, 5'3", much younger than age, down to earth, highly educated and employed. Prefer a compatible match from qualified, employed or semi-retired, age 56 onwards with Indian background, single or widower, caste no bar. Please send photos and details to emily.lotus@ hotmail.com

Seeking match for very fair, beautiful, 5'5", 1984 born, very cultured, educated and working, Australian citizen, Ghumar Sikh girl. All family settled inAustralia. Looking for an educated, professionally employed, Sikh match, preferably from Australia/Canada. Contact 0421 775 525 email ab09hii@hotmail.com

Suitable match for Punjabi girl, Born 12August 1980, height 5'0''. Graduate in textile and fashion design. MA in classical Indian dance.Parents doctors, brotherAustralian citizen settled in Sydney. Girl coming to Sydney 2nd week of May, upper caste no bar. Contact on 0402 312 591

Brother seeks suitable match for 1978 Mumbai born, never married Gujarati girl, 5'4", well cultured, medium build, Bachelor of Commerce and working for MNC Dubai shipping company. Coming to Sydney in mid-May. Hindu grooms please contact on 0412 346 590

SEEKING BRIDES

Match for KhatriAustralian Citizen, June 1987 born, 6'2" tall boy, looking for tall andbeautiful family oriented educated girl.Preferred girl to be inAustralia on any visa. Contact via email on office.blacktown@gmail.com

Qualified professional match for Punjabi boy, 31, 5'11",fair,Chartered Accountant,Australian citizen and working with a leading bank in Sydney. Girl should be Hindu, 24 to 29, slim, professionally qualified,Australian citizen or PR, andSydney based. Please send photo and details tosanjdeep6@gmail.com

South Indian Brahmin, 33 years old, 5'7'', fair, IT professional, non-smoker, non-drinker, born in India, working in USA, divorcee from a brief marriage, migrating to Australia on PR in July 2016. Visiting sister in Australia in May 2016. Looking for a suitable match - well educated, good looking, South Indian Brahmin bride, aged between 28 and 32, never married/divorced. Contact sister on +61 412 353 467 or email father snnsharma@gmail.com

Looking for a girl fromAustralia (student or permanent) for 26-year-old, tall, Hindu Gupta boy. Boy is in India (Punjab), graduate, fair and athletic. Sister is married and well-settled inAustralia. She can help with PR if required. Boy owns good property in India. Please contact Ripsy 0423206 898

Dosomething oboutyour situation now. Contactthe Department ofImmigration and Border Protection'sCommunityStatusResolutionService (CSRSJ Wewillgive you correctinformation about your options, answeryour questions and connect you with other organisationsfor further assistance ifneeded.

Indian

Contact: SonaI Agrawal SyedMohiuddin (JP) Ex-Visa officer MARN:1 169617, MARN:1171248, MFAA:54385

Level2,SuiteSA,48MacquarieStreet, Parramatta,Australia 21SO PH(02)86775161,FAX:(02)98916314

Email:contactus@Completemigrationservices.com.au (WeSpeakEnglish,Hindi,Marathi,Urdu, Telugu) Forquickvisa assessmentfilltheonlinevisa assessment formon www.completemigrationservices.com.au

Get the right information.
ADVERTISEMENT Talk to Immigration's CSRS
� Aus:tTalianGo,cr·oment ...-.., �· Departmentofimmigration :ifndBordtrProlection Visitwww.border.gov.au/csrs or call anonymously on 1300 853 n3 Authorsed by theAustralian Government. Capital Hill Canberra. 32 MAY 2016
COMPLETE MIGRATION SERVICES (ABN- 58 161 720 501) AFFORDABLE FEES • FREE ONLINE ASSESSMENT CALL NOW 02 8677 5161 •Advice on Migration pathways • General Skilled Migrationspecialist • StudentVisas( new and extension) • State Sponsored Visas/ ENS/ RSMS /457 • Business Migration • Partner and Family Migration specialist • Admission inAustralianCollegesand Universitie • MRT Review procedures inAustralia • OCI /POI/
in ... MA • Memberal MlgraUOOAlliance 1,'//1/I e 1_f!�f1t lv11grat10n Agents Reg!Stral!on Numller � \1N/WTQag:.:,vau
Loans(MFAACertified) specialist INTERNATIONALMONEYTRANSFERS
PassportApplication /Renewal Wealso specialize
Home/Commercial
Wehelpyou
pursue your dreams www.indianlink.com.au l'J
achievea betterlifeand

ARIES March 21 - April 19

This month you will feel inclined to re-shuffle your finances and take time out to change your financial situation. The cards are also showing that you will be thinking about your relationship. You will feel fairly energetic and healthy. Some upsets with family members may cause slight issues.Take some time out to continue your exercise and healthy eating routine. You may suffer from tummy issues midmonth. Check the oil and water in your car.

TAURUS April 20 - May 20

This month you will need to be careful how you deal with your relationship area. You may feel slightly unsure how to deal with a particularly sensitive matter that hasarisen. Luckily, the cards are indicating a time when you will be feeling very relaxed and happy at work, and there is a very good chance that you will be offered more responsibility and financial rewards are indicated too. Lots of socialising this month, but take time out for yourself.

GEMINI May 21 - June 20

This month you will be thinking about property. You may think about buying another property, decorating an existing property or extending. There will be a lot of planning and designing going on. Life will be very hectic and there will be no spare time this month. You will feel as though you are on a treadmill24 hours a day. You are very keen to sort things out in all areas. Love relationships seem smooth. Work will also be busy.

CANCER June 21 - July 20

This month you will feel like you need to settle down in relationships. You are feeling as though you may be missing out. Your friendsseem to be settled and moving on. Be patient, it will all work out. This month though, life will be adventurous and busy. You may take time out for ashort trip and also think about changing your car,now or in the future. Family is going to be a little demanding this month.

LEO July 21 - Aug 22

You may be going througha little bit ofan on-off relationship with your partner. Time to take things to another level and decide what you both want to do. Work will be demanding, as there seems to be a departmental shake up going on. The cards are indicating a time when you will be deciding if you would like to move on from this job. A sibling may come to you for some advice.Take time out to relax and meditate.

VIRGO Aug 23 - Sep 22

This month you may needto spend more time with your family. You seem to have beenspending a lot of time working and there has to be a balance of work, home and relationship. The cards are indicating a time when your partner will be feeling neglected. There may be some aspects of property that needs to be dealt with, you may be thinking of writing a will. Children will be needing support and advice this month.

PREDICTIONS FOR MAY 2016

LIBRA Sep 23 - Oct 22

This month the cards are indicating a time when you need to look after your health and takesome long walks and add a dailydose of meditation or relaxation into your schedule.Youmaynot be giving yourself enough time to unwind. There will be some conf icts with members of your team if you are in charge of a team, or indeed work colleagues. Financially you have been looking at changing your savings plans; time to look at taxes andwealth.

SCORPIO Oct 23 - Nov 21

This month you will be making plans to look at a business proposal. The cards are indicating a time when you will be looking at ways to increase your finances; you will be working hard, and a side line business is also indicated. You will find that your social calendar will be very busy, and you will be meetingsome interesting new people. But beware, relationships might be a little stressed, as you will be inclined tospend time alone.

SAGITTARIUS Nov 22 - Dec 21

This month you will find it astruggle to keep your relationship harmonious. There is an indication that you may find a work colleague or an old friend making advances towards you. You will be travelling quite frequently, and this may also cause stress in your relationship. There is the possibility that you will be thinking of buying a pet for your family. You will spring clean your finances and you may be thinking of investing in shares.

CAPRICORN Dec 22 - Jan 19

This month you will be in the mood for love and romance. The cards are indicating a time when you may meet someone and have more fun than you have had for some time. If you are in a relationship you will be feeling in a firty fun mood with your partner. You will need to be careful with your finances, but you are going to be in a good position, as luck seems to be on your side.

AQUARIUS Jan 20 - Feb 18

This month you will be feeling a little restless and agitated. Things are extremely stressful around your work and profession. You seem to be given a lot of extra work, and there will be situations where you may have to cover for colleagues. You may be thinking of increasing a small business you have, but you are advised not to involve friends. Your relationship area is fairly harmonious and you will be feeling pleased with the progress of your children.

PISCES Feb 19 - March 20

A burst of creativity surrounds you this month; taking up writing or painting?The cards are indicating a time when you will need to listen to your soul and go for what you desire. Work may be a little mundane, but better things are on the horizon. You will be attracted to someone at work, and you may go on work related outings where you get to know each other. Financially you will be thinking of saving for a holiday.

foretell
-------------------------------------
INDIANLINK
MAV 2016 33

IBAAGHI

STARRING: Tiger Shroff, Shraddha Kapoor, Sudheer Babu Posani, Paras Arora, Sunil Grover

DIRECTOR:Sabbir Khan

Adapted from two films, the Indonesian movie The Raid: Redemption (2001) and the 2004Telugu release Varsham, Baaghi is an action-packed, run-of-the mill love story of a rebel and his lady love.

Afraid of his son Ronney (Tiger Shroff) going wayward or becoming a rebel, Colonel SamarjitSingh packs him off to his friend's gurukul in Kerala, to "make

a man out of him".

En route to meet his father's friend, I Ronney meets Siya (Shraddha Kapoor)

I on the train. Love blossoms, but not before laying the seeds of the various obstacles which include Siya's opportunist father, E.P. Khurana, and Raghav, his guru's son, an equally formidable fighter, who also happens to be on the same train and falls in love with Siya too.Tiger Shroff performs 1 competently, displaying his impressive, I martial arts skill effectively. Though charismatic and sincere, he fails to leave an impact as Ronney. There is somethingendearingand earthy about Shraddha Kapoor as Siya.

Know Thyself as So I

You are a soul ofa permanent unchangeable nature, and if you would live as a soul, you would neverbe affected or changedby outer changes.

-Sant BaljitSingh

Nurtureyourspiritual life through meditation on the innerLightUyoti) and Sound (Naad)and realiseyourtrue self. All events arefree. forf•Jrthe infoma.ion

1800 462 193

www.knowthyself.org

She is equally effortless in the dancing and action sequences. Sunil Grover as her father, Mr Khurana gets into the skin of his character with ease. With a tinge of comic and subtle sliminess, he reminds one of Shakti Kapoor, in his hey days.

Sudheer Babu as Raghav is imposing. He is equally agile as Tiger and leaves an impact as the antagonist. With interesting camera angles capturing the moments of action and drama, cinematographer Binod Pradhan's camera work is striking.Also, his interior shots with aesthetic lighting and wide angled exterior shots in natural lighting are picture perfect.

Julius Packiam's background score, with its adrenaline packed beats, is effectively used to create the frenzied tempo of the action. The songs, "Toh naachu mein aaj, cham, cham'', an extempore dance in the rain, seems forced and the song "Agar tu hota to, na rote hum" doubles up as a background score. In totality, the songs are well picturised, but add nothing to the progression of the tale.

While the film is technically dazzling, the director has not paid attention to the narrative. The story written by Sanjeev Dutta is hackneyed and predictable, laden with loopholes andabandoned sub-plots. You expect this to be the story of a rebel, but unfortunately the rebel in Ronney does not surface, except in a weak exposition where his father writes a note to his friend stating that Ronney is a lovable rebel.

The script, punctuated with comic and actionsequences, is formulaically crafted.This makes the narration superficial and shallow in nature, making it difficult for the audience to relate to the characters.

The first two acts are moderately paced, it is the climax that is overstretched with a never-ending chase and action sequence, making the viewing a bit tedious.

Overall, with a string of oft seen scenes and action sequences, Baaghi offers no novelty, in terms of visual and narrative stance, making it neither exciting nor appealing.

entertainment ■ --------------------------------------
\
*;( '
34 MAV2016
Cl-l�CK US OUT AT WWW.INDIANLINK.COM.AU www.indianlink.com.au l'J

eyandprocesswillbesenttocustomersregsteredemailaddresswIth1n14daysoracomp etedtransaction [hisoffercannot becombinedwithanyotherofferandalso,wouldbeapplicabe.-percuswmerbasisIrrespectve ofmult,pleloginIds TheInstantmoneytransferservicelscurrentlyavailabeford1rectcred,tsfromanybankaccountInAustrall,iimoanyaccounlw1th1nthe14l,stedbankswithinIndia.rheInstantlransferoptlonIsavaiab esub1ecttocertainl,mts ontheamountsentandalsocleanr.gmandatorycompl,anceverfcationprocesses.exchangeratesarelocked,natthetimeofbookingthetransactionandstandardfeeswoulaappyto each1ransfer

Rem1t2lnd1a-MoneyRemittanceto Indraatanaffordablepnce.Rem1t2IndratsasecureonlmemoneytransferserviceforNRs10sendmoneyto Indatram UnitedStates.UnitedK:ngdom Australia.Singapore,Canada.U.A.lc,HongKong,Germany Sp.irn&otherEuro Countnes.Iheser✓tceallowsNRlstosendmoneysatelyusingwrretransferandACl1/O1rectDeb1LIhemoneycanbereceivedinIndiathroughdirectaccountcredts.

All users get up to pa1sa extra per dollar* New users also get Guaranteed $35 Coles 0 Voucher Zero Transfer Fee* What's more, we now offer you Instant Tra nsfers to most ba nk accounts in India coupled with locked-in excha nge rates. Log on to Remit21ndia and use the code booki ng your transactio n. S www.remit2india.com LinkSO in the promotion code field while info@remit2india.com 1-800-859-876 •Thisofter savailableforalimitedperiodandtoeligiblecustomersonly.fhe Promononalcouponkey"Llnk50"hastobeusedwhile bookngthetransactononorbeiore31stMay2016.!heextrapa1sabenefitJSapplicableforall users lheColes voucheralongwithfeewaverandextrapa1Saisavailabeonlytousersuansaoingforthef1rsttime[hevoucherkeys/codesareprocuredthroughathrdpartyvendorandwdlbesharedwththeuserafterhe/shehascompletedatransact on fhe voucherredemptonk
INDIANLINK MAY2016 35

UP-TO-DATE NEWS ON WHAT'S HOT AND HAPPENING IN BOLLYWOOD

AUDIENCE IS CHANGING: MANOJ BAJPAYEE

National award-winning actor Manoj Bajpayee thinks the era ofescapist cinema is coming to a close.

"The audience has changed over the years," he said recently. "Now they are showing interest in real things.They wantconvincing and reliable. The audience has matured."

Manoj is currently promoting his film Traffic, which belongs to the "convincing and reliable" category, like much of Manoj's work including Satya, Shootand Zubeidaa.

Another thing he is glad of is that item numbers look like they are finally on their way out.

"Thank god item numbers are out," he said. "They were somewhere ruining the whole storytelling format. Whateverchangesthe industry isundergoing, it's good whether it's for mainstream or parallel cinema."

Trafficis an emotional thriller based on a road tripfrom Mumbai to Pune, and is based on a true story. The story centres on the transportation from Mumbaito Pune of a harvested heartfor a hearttransplant case, chasing a strictdeadline. Duringthe mission, the characters face numerous difficulties and obstacles, traffic being one ofthe major ones.

Manoj Bajpayee plays a traffic constable who decides to spearhead the situation amidstthe heavy traffic in Mumbai.

The film is a remake ofa hit Malayalam film. Completed by Rajesh Pillaijust before he died, the film is setto release on 6 May.

RANDEEP IN CHAINS

Actor Randeep Hooda, who will soon be seen in the Omung Kumar directorial Sarbjit, chained himself with heavy handcuffs weighing2.5kg in each hand, to get into character.

Sarbjit is based on the life of Sarabjit Singh, an Indian farmer who was convicted of charges of terrorism and spying in Pakistan and was sentencedto death.

"Randeep Hooda has shown immense dedication," Kumar said in a statement. "He is well known for his method acting but I believe Randeep has given his entire heart and soul for this film. The level of dedication needs immense acknowledgmentand it will be visible to others too once the movie releases."

As Randeep's character was trapped in a Pakistanjail for years and given heartless treatment, the actor made a dummy prison cell in an area ofjust 6x4 feet where he spent his entire day, fully chained, and with a minimum supply of food intake.

In spite of much irritation and even pain, the actor didn't give up in his self-made training and went beyond his limits to get a realistic performance on screen.

Aishwarya Rai Bachchan will be seen inthe role of Dalbir Kaur, Sarbjit's sister who fought tirelessly for his release, while Richa Chadha plays Sarabjit's wife.

THE RETURN OF DULHANIA!

It all started with some cryptic tweets.

Example,Alia Bhatt wrote, "The 'dulhania' is on the move! Is this true though? Dharma movies, Karan Johar, Varun Dhawan."

And so everybody thought it was a sequel for HumptySharma Ki Dulhania, the 2014 film starring rumoured couple Varun and Alia.

But it was Karan Johar that made the big announcement. On Twitter, of course.

"The second in our love franchise staring Varun Dhawan, Alia Bhatt. Directed by Shashank Khaitan," he wrote.

He also posted a little teaser from the film, showing Varun andAlia in a desi avatar in a rural backdrop set in a fair.

Shashank Khaitan, who directed the first movie, is expectedto don the director's hat yet again for the film whose title is rumoured to be Badrinath Ki Dulhaniya.

Produced by Hirao Yash Johar, Karan Johar and presented by Fox Star Studios, the Dharma Productions film is setto release on 10 March, 2017.

HRITHIK ROSHAN IN TRANSGENDER CAUSE

Hrithik Roshan will be seen shaking a leg withthe Brooke Bond Red Label 6-Pack Band,touted as India's first transgender band, in their latest track Ae Raju.

The song salutes the unabated spirit of the transgender community, and the actor says he was compelledto be part of the song as it addresses a "meaningful" message in a "fun and entertaining way".

The actor, who has himself successfully battled stammering and more, shared, •we cannotjust reject them just because they are different from us".

Brooke Bond Red Label tea in association with Y-Films, the youth films' wing of Yash Raj Films, is back with another song by the band.

In the song the members of the band are inspiredto fight discrimination and break all social barriers.

The song and its chorus are a lighter take on the trademark Ae Raju, a term used by the Hijra community. In the video, Hrithik motivates the members of the bandto unleash their inner superheroes. The video went live on Y-Films' YouTube channel recently.

"I've been following the Brooke Bond Red Label 6-pack Band and when I heard they are creating a meaningful message in a fun, entertaining way, I hadto be a part of it. Shooting with them was an amazing experience," Hrithik said.

The Brooke Bond Red Label 6-Pack Band aims to encourage everyone to be more accepting, overcome social prejudices and make the worlda more welcoming place. It has been welcomed with open arms by music lovers, and has had hit numbers in collaborations with Sonu Nigam, Zanai Bhosle andArjun Kapoor

The winds of change are slowly but surely blowing in.

SRIDEVI: SOME CROSSBORDER LOVE

Pakistani drama actorsAdnan Siddiqui and Sajal Ali are going to debut in Bollywood alongside veteran Indian actress Sridevi in the movie Mom.

entertainment
-----------------------------
36 MAY2016
www.indianlink.com.au l'J

Siddiqui will play the role of Sridevi's husband andAli's father. Sridevi, who is also the producer, will play a lead role in this women-centric film.

ActorAkshaye Khanna will make a comeback with the movie while actor Nawazuddin Siddiqui will have a special appearance. The Mom team is now shooting in Georgia, one report claimed.

Siddiqui also played a small role alongside actress and filmmaker Angelina Jolie and actor lrrfan Khan in the 2007 film A Mighty Heart.

NEW SET OF RODS FOR AAMIR

Hey, we thoughtAamir Khan was the soft new-age sensitive kinds but apparently he likes his hot rods. He showed off his latest toy recently, a brand new Bajaj V, a motorcycle which contains metal from India's de-commissioned aircraft carrier INS Vikrant.

Aamir was inspired to buy the V15 when he learnt that the new launch from Bajaj contains metal from the much-loved navy ship, the first aircraft carrier built in India. It played a role in the 1971 India-Pakistan war.

When Rajiv Bajaj, managing director of Bajaj Auto, got to know thatAamir, a personal friend, had placed an order for a V15, he decided to make it one with unique customisation.

The new V made forAamir has a customized embossing of the initial A on the fuel tank and one-off graphic design of "Chote Lal" affectionately inscribed on the rear seat cowl.

Bajaj personally delivered the vehicle to Aamir's home.

The V was launched in February this year. It is a 150cc commuter bike differentiated by its solid form and stand tall proportions.

The Dhoom 3 star was delighted to receive his new bike. He said in a statement: "The Vis a special bike and I wouldn't compare it with anything else. It has a piece of history ingrained into it. For me, it's a proud moment to own a piece of metal from INS Vikrant which was the military pride of India for decades."

See, we knew he was a true patriot!

SERIOUSLY COMIC: AKSHAY KUMAR

In 2015, actorAkshay Kumar juggled effortlessly between the intenseAirlift and the frivolous Singh Is Bliing. This year again he joyously juxtaposes the real-life saga Rustom with the crazily out of the world Houseful/ 3.

So he likes living in two different planets How does he manage this?

"I know there is a belief that men can't multi-task. Whoever believes that, hasn't met me as yet!"Akshay

WHO WORE IT BETTER?

JACQUELINE FERNANDEZ or � NATALIE DORMER in CUSHNIE ET OCHS?

+ Shareyourviews with us on our Facebook page /lndianLinkAustra/ia

said of himself.

But of course,just like all the topbracket stars in Bollywood, Akshay thinks he is invincible

Well, not exactly.

He went on, "I am not going to pretend it's easy. But I also can't deny that I enjoy doing both serious and comic roles.And let me tell you, comedy is also a serious business for me. I am happy to juggle the two contrasting genres. I embrace both happily. See, I adore my Housefull franchise, as muchas I adore the serious scripts that I choose."

WHAT'S UP AND COMING

Sonakshi Sinha's off to England. She has confirmed being a part of director Vipul Amrutlal Shah's Namastey England along withAkshay Kumar. The film will reportedly roll inAugust.

Meanwhile,Anupam Kher's Kaanu looks set to be different, and worth waiting for. He plays a Bengali coach in the football-based drama, with film maker and director Prabhat Bhattacharya playing the title role of the footballer. The story of the film traces the journey of Kaanu and his beloved Ghat Shila Football Club.

WHAT TWEETY BIRD TOLD US THIS WEEK

Match the stars to the following tweets: Amitabh Bachchan,Abhishek Bachchan, Priyanka Chopra, Salman Khan

Three cheers for @Abhinav_ Bindra, Olympic gold medallist & India's Goodwill Ambassador #RioOlympics2016 #MakelndiaProud

Happybirthday DJ DwayneJohnson. Have a wonderful year and lots of happiness to u. God bless you and your kind heart. See you back on set. Baywatch

Back now 3:54 am from Delhi and National Award! So humbled and touched, for President ofIndia to take my name in his speech!

My favorite track from #Sarbjit The Mrs. Got moves/

What's the chitchat here between newlyweds BIPASHA BASU and KARAN SINGHGROVER?

Send inyourresponsesto win@indianlink.com.au and win a surprize prize

What's the chitchat here between AKSHAY KUMAR and TWINKLE KHANNA?

AKSHAY: I'm still head over heels .!!

Mohit Banwa/ Arcadia NSW

Mohit wins a ticketto the film The Man Who Knew Infinity

HRITHIK ROSHAN
INDIANLINK
MAV2016 37

What did youget your mumfor Mother's Day?

Everyonesaystheirmotheris special.MyMum,ormyMatajias

Irefertoher (adeeply entrenched remnantfrornHindiSchool, thanksMalaAW1ty)isespecially specialasshecomeswithacertainAaw.She isvery hardrobuy giftsfor.

IstroUpasttheshopswith brightdisplays, advertisingtheirhardboundpastel-coloured Swedish-designedorganicpapernotebooks thatare 'Peifectfa,·.Nfti111this:Mother'sDt!J•f' AndIknowif Iboughtoneof these diamond-encrustednotebooks(that'sgotto bethereasonthey aresoexpensive,right?!)

shewouldgivemeabighuganda"Thank

givingittomeatthe lastminuteto'usetoday orthemoneywillgotowaste'. Breakfastinbedisnotidealeither.The firstthingmyMarajidoeswhensheawakens isbrushherteeth.Beforespeakingtoany of us.Beforebendingdowntopatthedog. Beforethefirst sipof chaiandexhaled 'ahhhh'thatfollows.Evenbeforechecking herphone!(Itoldyou special,right?)She's sufferedthroughenoughof thosetorturous Mother'sDaymornings,whereaSL't-yearoldandathree-year-oldhavetakenover thekitchenandtoldbernottogetoutof beduntilthey bringupher'surprise'.(This foUowingaweekof 'casualquestions'of whatshelikestoeatforbreakfastif she couldchooseanythingintheworld,and franticphonecaUstodadatworkasking whatavadais,andcanhebringsomehome.)

Andfellowkidstakenote,tmder nocircrnnst.mceshouldanyonegive theirmother cleaningsuppliesorany suchderivatives never.AsLilly Singh

you, darling!"

But1canjustguesswhatwillbe goingthroughherbead.

'WhoneedssuchjtJShioni.rtapaper?

Scrapp,rpcrisfinefarme. Illptt!thirinthe gjftsd,mverandgiveIfoneof11a•Jrimdr 011 theirbi,thda)'s.'

Mataji:'I.BilliondollarconsW11er markeradvertising:0.

\X/hataboutanicespavoucher?

Actuallyno payingsomeonecopress herfeetandpainthertoenailsbesides meseemsmorelikeapresenttomyself. AndIknowmyl\fatajitoowell,shewill keepputtingoff thedayshewillusethe voucheruntilC\vohoursbeforeicexpires,

Australia & New Zealand Distributors Required

('Superwoman'on YouTube)sopoetically pmit:"Don'tgiveyour mumcleaningsuppliesas presents.It'slikegivinga livechickenapacketof flavouredseasoningand saying'youknowwhat todowithit'."

So,wheredoesthis leaveus?Let'smakea

checklistof componentsrequiredinthisgift.

•Mustmakehersmileandfeelgenuinely happy tokeepit

•Mustalleviatestressesinherdaily life

•Mustbesomethinguseful

•Mustbesomethingsheactuallyenjoys

•Mustshowcheessenceof beingamother AbhalAftercarefulanalysis,itseemstbe only logicalpresentissomethingthatshe's hadallalong.

It'sme!

We are appointed as Authorised Importer/Distributor/Resellerfor products manufactured by Sai Ram Bakers, Hyderabad, India under the brand - "Karachi Bakery" forAustralia & New Zealand.

WearelookingforDistributorsforAustralia(OLD,VIC,NSW,SA,andWA)andNewZealand. WeareintendingtoimporttenexclusiverangesofBiscuitsexclusivelymanufacturedand packedforAustralianmarket.

IfyouareinterestedtotakeupdealershiporSuperRetailership,pleasecontactusbyemail siriimpexanz@gmail.comwithyourbackground,experienceinfoodproductsdistributionand contactdetails(preferablymobilenumber).Wewillgetintouchwithyouassoonaspossible anddiscussbusinessmodelandshareallthedetails.

backchat ■ ■
This voucher entitlesyou to f�Jbreakfast in bed EJa free carwash or
A_"-ife cio.y•LLw&_lj0�-1ft.wirn� Lovefrom
,, She's sufferedthrough enoughofthose torturous Mother's Daymornings, where a sixyear-oldandathree-year-oldhave taken over thekitchenandtoldhernot to getoutofbed untiltheybringupher 'surprise ,,
38 MAV2016
www.indianlink.com.au l'J
INDIANLINK That'swhywebringyou exchangeratesthatmatter $0 fee*when you send over$1000to a bankaccount moneygram.com.au 11/moneygram -@moneygramMe Sendat: rci) • •TRAVEL ta.•; MONEY()z· � AndanywhereyouseetheMoneyGram sign. S MoneyGram. moneytransfer •FeeappliestosendamountAUD1000orlower.Inadditiontothetransferfee acurrencyexchangerace mayasoapply.MoneyGramasomakesmoneyfrom cun-encyexchange.CashtoAccountservceonly avalableatselected7-Eeven ocatons.Call1300807088(opton2)tofindout fthisservce savaiabe atyot.Jrlocal7-Eevenstore MoneyGramandtheGlobearemarksofMoneyGram. Allothermarksarethe propertesoftherrespectiveowners.©2016MoneyGram. MAY2016 39
AU S S TM GROUP Z l WE ARE PROFESSIONALS WhyAussizz Group? •LeadingImmigration&EducationConsultantsofferingpremiumServices •4RegisteredMigrationAgents,10+QEACCertifiedEducationCounselors "ProvenrecordofClientsatisfactionandHighVisaSuccessrate " 1000+ Facebook 5 Star Reviews fromHappyclients Education I Migration I IELTS I Travel I)/aussizz m/aussizz • _ jl•,J 11''"ii/;� ,1!1u ll,'¥1 MgranonAgents Regstra11onNumber 1J I !�nITJI MgratonAgents Reg1s1rationNumbe1 ,/!. 1TI�tij�/Jlil M1g1aU011Agents Regis1ra11onNumbe, ('�QEAC ".... � MA • � WYovmara..+10--1..au � wwwm;:1ragovau � l'l'WI/T1aTd.QDVr!.U 1147 AUSTRALIA Memberof MIGRATIONINSTITUTE MigrationAllanc� -OfAUSTRALIA•MMIA:.3523• 40 MAV 2016 www.indianlink.com.aul'J

Turn static files into dynamic content formats.

Create a flipbook
Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.