__MAIN_TEXT__
feature-image

Page 1

Auktion 279 Kunst der Antike, Afrika, Asiatica, Präkolumbische Kunst

9. Juli 2021


Repräsentanz in Berlin Dr. Annika Backe-Dahmen Tel.: +49-(0)176/457 987 23 E-Mail: annika.backe-dahmen@posteo.de

Representative in Russia Mr. Andrey Pyatygin BC „Berta House“ Staropimenovskiy per. 18 125009 Moscow, Russia Office Phone: 007 916 723 9527 Email: gornyandmosch@mail.ru

Die Echtheit der Stücke wird gewährleistet. All objects are guaranteed genuine. Gorny & Mosch ist Partner von Art Loss Register. Sämtliche Gegenstände in diesem Katalog, sofern sie eindeutig identifizierbar sind, wurden vor der Versteigerung mit dem Datenbankbestand des Registers individuell abgeglichen. Gorny & Mosch have retained the Art Loss Register to check all uniquely identifiable items offered for sale in this catalogue against the Art Loss Register‘s computerized database of objects reported as stolen or lost.


Auktion 279 Kunst der Antike, Afrika, Asiatica, Präkolumbische Kunst 9. Juli 2021 in den eigenen Geschäftsräumen at our office

GORNY & MOSCH Giessener Münzhandlung GmbH Maximiliansplatz 20 · D-80333 München Tel. +49 (0)89 24226430 · Fax +49 (0)89 2285513 E-Mail: info@gmcoinart.de · www.gmcoinart.de Amtsgericht München HRB Nr. 75528 · Geschäftsführer: Dieter Gorny, Dr. Hans-Christoph von Mosch


Ihre Ansprechpartner Mit Ihren Fragen und Anliegen können Sie sich direkt an die dafür zuständigen Mitarbeiter wenden. Geschäftsführung Dieter Gorny Dr. Hans-Christoph von Mosch Sekretariat Anna Pryazhennikova Tel.: +49-(0)89/2 42 26 43-0 Dace Tretjaka Tel.: +49-(0)89/2 42 26 43-13 Auktionsverwaltung Sybille Ostendorf Tel.: +49-(0)89/2 42 26 43-20 Maria Borshchevska Tel.: +49-(0)89/2 42 26 43-36 Antike Münzen und Kunstobjekte Dr. Georg Morawietz Tel.: +49-(0)89/2 42 26 43-19 Dr. Martin Schulz Tel.: +49-(0)89/2 42 26 43-23 Dr. Margret Nollé Tel.: +49-(0)89/2 42 26 43-25 Münzen und Medaillen von Mittelalter bis Moderne Sascha Praisler Tel.: +49-(0)89/2 42 26 43-15 Buchhaltung Anne Otter Tel.: +49-(0)89/2 42 26 43-21 Online-Kommunikation Irene Rulka, M.A. Tel.: +49-(0)89/2 42 26 43-22

GORNY & MOSCH Giessener Münzhandlung GmbH Maximiliansplatz 20 D-80333 München Tel.: +49-(0)89/2 42 26 43-0 Fax: +49-(0)89/2 28 5513 www.gmcoinart.de E-mail: info@gmcoinart.de Amtsgericht München HRB Nr. 75528 Geschäftsführer: Dieter Gorny, Dr. Hans-Christoph von Mosch Ust-IdNr. DE 129 359 049

Konten Bank Accounts Postbank BLZ 700 100 80 Kto.-Nr. 1503 84-802 BIC (SWIFT): PBNKDEFF IBAN: DE28 7001 0080 0150 3848 02 Commerzbank München BLZ 700 400 41 Kto.-Nr. 66 67 117 00 BIC (SWIFT): COBADEFF XXX IBAN: DE73 7004 0041 0666 7117 00 HypoVereinsbank München BLZ 700 202 70 Kto.-Nr. 002 860 120 BIC (SWIFT): HYVEDEMM XXX IBAN: DE36 7002 0270 0002 8601 20


Inhaltsübersicht Table of Contents

Besichtigung

in den eigenen Geschäftsräumen

Auction lot viewing at our office

Freitag, den 9. Juli 2021 10:00 Uhr Griechenland und Rom Vasen . . . . . . . . . . . . . . . . . . . . 001-063 Terrakottaskulptur . . . . . . . . . 064-087 Steinskulptur . . . . . . . . . . . . . 088-100 Bronzeskulptur . . . . . . . . . . . . 101-144 Sammlung Militärdiplome . . 145-171 Geräte . . . . . . . . . . . . . . . . . . . 172-184 Lampen . . . . . . . . . . . . . . . . . . 185-187 Schmuck . . . . . . . . . . . . . . . . . 188-227 Kameen, Gemmen, Siegel . . 228-239 Glas . . . . . . . . . . . . . . . . . . . . . 240-264 Nordafrika . . . . . . . . . . . . . . . . . . 265-288 Alter Orient . . . . . . . . . . . . . . . . . 289-312

14.00 Uhr Ur- und Frühgeschichte . . . . . . 313-344 Byzanz . . . . . . . . . . . . . . . . . . . . . 345-350 Ikonen . . . . . . . . . . . . . . . . . . . . . 351-361 Afrika und Ozeanien . . . . . . . . . 362-420 Islam. . . . . . . . . . . . . . . . . . . . . . . . . . .421 Altamerika . . . . . . . . . . . . . . . . . 422-473 Asien . . . . . . . . . . . . . . . . . . . . . . 474-503 Mittelalter . . . . . . . . . . . . . . . . . . . . . .504 Antikisierendes – After the Antique . . . . . . . . . . . . 505-512 Lots . . . . . . . . . . . . . . . . . . . . . . . . 513-896 Literatur . . . . . . . . . . . . . . . . . . . . 898-904

Ab sofort: Montag bis Freitag 10.00 – 13.00 Uhr und 14.30 – 18.00 Uhr und nach vorheriger Vereinbarung sowie Sonntag, den 4. Juli 2021 von 13.00 – 17.00 Uhr Starting from now: Monday through Friday 10.00 a.m. – 1.00 p.m. and 2.30 – 6.00 p.m. and by appointment as well as Sunday, July 4, 2021 from 1.00 – 5.00 p.m. Unsere Ergebnisliste steht drei Tage nach unserer Auktion im Internet für Sie bereit: Our list of prices realized is available three days after the sale: http://www.gmcoinart.de

3


LIVE BIDDING – EIN KOSTENLOSER SERVICE Nutzen Sie unsere komfortable Möglichkeit der Teilnahme an unseren Auktionen via Internet von überall auf der Welt. Alles was Sie dazu brauchen ist ein aktueller Webbrowser, wie zum Beispiel Mozilla Firefox oder Google Chrome. Sie können über ein Smartphone, Tablet, Notebook oder PC jederzeit mitbieten. Seien Sie »live« dabei, wenn der Hammer fällt. Hören Sie den Auktionator und sehen Sie das aktuelle Los inkl. aktuellem Gebotsstand sowie Beschreibung. Nutzen Sie die Gelegenheit, Ihre Lieblingsstücke zu ersteigern. Verpassen Sie keinen Ausruf Ihrer Lieblingsstücke und bieten Sie jederzeit – von zu Hause aus oder unterwegs – einfach und bequem per Mausklick mit.

In nur fünf Schritten zu Ihrem erfolgreichen Zuschlag: 1. 2. 3. 4. 5.

Registrieren Sie sich bitte unter www.gmcoinart.de (bis spätestens 24 Stunden vor Auktionsbeginn). Aktivieren Sie anschließend die Registrierung über den Link in Ihrer Bestätigungs-E-Mail. Der Anmeldeprozess ist nun abgeschlossen. Sie erhalten Ihre Zugangsdaten per E-Mail. Bereits jetzt haben Sie die Möglichkeit, Ihre Gebote abzugeben. Am Auktionstag reicht eine kurze Anmeldung auf www.gmcoinart.de und Sie können jederzeit »live« in die Auktion einsteigen.

www.gmcoinart.de – immer einen Besuch wert. 4


FREE LIVE INTERNET BIDDING Take advantage of this comfortable possibility to attend our current auction via Internet from all over the world at any given time. All you need is a current web browser, e.g. Mozilla Firefox or Google Chrome. At any time you can place your bid via smartphone, tablet computer, notebook or personal computer. Be live with us when the hammer falls. Listen to the auctioneer and watch the current lot as well as its latest price and description. Take the opportunity to buy your favorite piece. Don’t miss any starting price of a lot and bid at any time – wherever you are – simply and comfortably by a mouse click.

Only five steps to your successful hammer price: 1. 2. 3. 4. 5.

Please register on www.gmcoinart.de (at least 24 hours before the auction starts). Activate the registration with the link in your confirmation email. The registration process has finished now. You will receive your login data with an email. You already have the opportunity to place your bids now. On the day of the auction only a quick login on www.gmcoinart.de is necessary for being “live” any time at our auction.

www.gmcoinart.de – always worth a visit. 5


無料ライブ入札サービス 弊社のインターネットオークションなら世界中どこからでも快適にご参加いただけ Mozilla Firefox、Google Chrome、 といった最新のウェブ ブラウザのみ。スマートフォン、タブレット、ノートパソコン、またはデスクトッ プから、いつでも入札にご参加いただけます。 落札のその瞬間をぜひ「ライブ」でご体験ください。オークショニアの声を聞き、 最新の入札状況、説明つきで商品をご覧ください。お気に入りの品をオークション で獲得できるこの機会をぜひご利用ください。お気に入りの品の開始価格を見逃す ことなく、ご自宅からでも外出先でも、いつでもクリックするだけで簡単、快適に 入札できます。

たった 5 つのステップで入札が可能です: 1. www.gmcoinart.de から登録します(オークション開始の 24 時間前まで)。 2. 確認メールのリンクから登録を有効にします。 3. 申し込み手続きはこれで完了です。アクセスデータがメールで送信されます。 4. これで入札価格を提示することができます。 5. オークションの日に www.gmcoinart.de からログインするだけで、簡単に「ラ イブ」オークションに参加できます。 www.gmcoinart.de ∼一見の価値あり。 6


Deutsch

Hinweise für Käufer 1.

Der Ausruf erfolgt zu 80% des im Katalog angegebenen Schätzpreises. Gebote darunter werden nicht akzeptiert! 2. Differenzbesteuerte Ware: Der Zuschlagpreis bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld. Käufern aus Deutschland und EU-Ländern wird ein Aufgeld von 25% berechnet; die gesetzliche Umsatzsteuer ist in diesem Betrag bereits enthalten. Käufern aus Drittländern wird ein Aufgeld von 20% berechnet. Wird die Ware vom Käufer selbst oder durch Dritte in Drittländer ausgeführt, wird die gesetzliche Umsatzsteuer berechnet, nach Vorlage der gesetzlich geforderten Ausfuhrnachweise jedoch erstattet. Wird die Ware von uns selbst in Drittländer ausgeführt, wird die gesetzliche Umsatzsteuer nicht berechnet. Die Beachtung der Zollvorschriften des Bestimmungslandes liegt in der Verantwortung der Bieter. 3. Vollbesteuerte Ware bzw. Ware in Vorübergehender Verwendung: In Ausnahmefällen unterliegen die Stücke der Vollbesteuerung (gekennzeichnet mit +) bzw. befinden sich in der Vorübergehenden Verwendung (gekennzeichnet mit ); betroffene Losnummern werden als solche gekennzeichnet. Die Details bzgl. Aufgeld und Steuern entnehmen Sie bitte den Versteigerungsbedingungen am Ende des Kataloges. 4. Mit dem beiliegenden Formular können Sie schriftliche Gebote abgeben. Kaufen Sie erstmals bei uns ein, geben Sie bitte auf dem Formular den Namen eines Händlers an, dem Sie gut bekannt sind (Referenz). 5. Änderungen nach Drucklegung des Kataloges finden Sie im OnlineKatalog auf unserer Website unter www.gmcoinart.de/kataloge. 6. Die Bezahlung kann in bar, mit Scheck, per Überweisung oder mit EC-Karte erfolgen. Bankspesen bei Auslandsschecks und -überweisungen betragen 15 € bzw. 50 € ab einem Betrag von 25.000 €. 7. Der ideale Weg, Objekte zu ersteigern, ist die persönliche Teilnahme an unseren Auktionen. Selbst kurz vor der Auktion und in den Pausen können die Objekte noch in aller Ruhe besichtigt werden. 8. Die Kosten für Verpackung, Versicherung und Versand werden gesondert ausgewiesen. 9. Das Abonnement von vier Katalogen kostet 45 €. Wenn Sie unsere Kataloge abonnieren wollen, überweisen Sie bitte den entsprechenden Betrag auf unser Postbank-Konto (siehe S.2). Der Preis für einen einzelnen Katalogband beträgt 15 €. 10. Im Streitfall gelten die Versteigerungsbedingungen am Ende des Kataloges.

Hinweise für Einlieferer Wenn Sie einzelne Objekte oder eine Sammlung versteigern lassen wollen, sind Sie bei uns an der richtigen Adresse! 1. 2.

3. 4. 5. 6. 7.

8. 9.

Wir garantieren Ihnen eine fachgerechte Bearbeitung und qualitative Publikation Ihrer Stücke in unseren Katalogen. Unsere Kataloge erreichen einen großen internationalen Kundenkreis, der durch unsere Präsenz auf den wichtigen internationalen Börsen stetig erweitert wird. Mit dieser Voraussetzung können wir Ihnen einen guten Verkauf Ihrer Stücke versprechen. Es werden nur Objekte einzeln in die Auktion aufgenommen, deren Schätzwert über 500 € liegt. Für nicht verkaufte Stücke werden keine Gebühren berechnet. Unsere Verkaufsprovision beträgt 20% des Zuschlagspreises. Die Firma Gorny & Mosch schätzt Ihre Stücke nach dem derzeitigen Marktwert. Zu hoch angesetzte Limite werden nicht akzeptiert. Drei Wochen vor der Auktion übersenden wir Ihnen eine Auflistung der Objekte, die in die Auktion aufgenommen wurden, mit den dazugehörigen Schätzpreisen. Auf diese Weise sind Sie über den Bestand Ihrer Objekte in unserem Hause bestens informiert. Die Auszahlung der Einlieferer erfolgt 70 Tage nach der Auktion. Unsere Verträge für Einlieferungen können Sie unverbindlich anfordern. Haben Sie noch Fragen? Wir freuen uns auf Ihren Anruf. Telefon: +49-(0)89/24 22 643-0.

7


Guide for Bidders 1.

Lots will open at 80% of the estimates listed in the catalogue. No bids under this limit will be accepted. 2. Goods subject to sale in the margin: the hammer price is the basis for the calculation of the buyer´s premium. Buyers from Germany and EU-countries will be charged a premium of 25%; the relevant VAT is already included in this amount. Buyers from countries outside the EU will be charged a premium of 20%. As far as these buyers export the goods in person or by a third party the relevant VAT will be charged but refunded after receiving the legal proof of exportation. In case that we export the goods the relevant VAT will not be charged. Bidders are responsible for respecting customs laws of the countries of destination of the lots. 3. Goods subject to tax in full or to temporary admission: in exceptional cases the lots are subject to taxation in full (marked with +) or to temporary admission (marked with ); these lot numbers will be indicated as such. For details regarding buyer´s premium and taxes please see the conditions of sale at the end of the catalogue. 4. Bidders can submit written bids with the accompanying bid sheet. If you are bidding in our auction sale for the first time, please give us the name of another dealer that knows you well as a reference. 5. Changes made after the printing of the catalogue are reflected in our online-catalogue on our website at www.gmcoinart.de/en/catalogs. 6. Payment may be made by cash, valid check or bank/post wire. Bank charges of 15 € (50 € for amounts of 25.000 € or more) will occur in case of payment by foreign check or bank wire. 7. The best way to take part in our auctions is to attend in person. Up to the time of sale and even between the sessions you will be able to view the lots at your leisure. 8. Packing, insurance and postage are charged separately. 9. A subscription of four catalogues costs 45 €. Would you like to subscribe our catalogues please credit the appropriate amount to our Postbank account (see page 2). The price for a single catalogue is 15 €. 10. The conditions of sale at the end of the catalogue will be used as guidelines in case of dispute.

Guide for Consigners Whether you are consigning single objects or a collection, we are the people to see! 1. 2.

3. 4. 5. 6. 7.

8. 9.

8

We guarantee a competent description of your objects and quality presentation in our catalogues. Our catalogues reach a vast international clientele which is constantly increased by our presence at the largest international shows. This promises favourable results when we auction your objects. Only objects with an estimated value of over 500 € will be sold as individual lots. You will not be charged any fees for your unsold lots. Our seller’s commission is 20% of the hammer price. The company Gorny & Mosch estimates your objects according to current market value. Artificially high reserves will not be accepted. Three weeks before auction we will send you a list of your objects which are in sale with their corresponding estimates. This way you are fully informed of the status of the objects you have entrusted to us. Payment to consigners is made 70 days after the sale. Would you like to receive copies of our contracts without making any commitment or do you have any other question? We will be pleased to help you. Please call on +49-(0)89/24 22 64 3-0.

English


Italiano

Avvertenze per compratori 1.

Al principio dell´asta viene chiamato l´80% del prezzo di stima indicato nel catalogo. Offerte inferiori non saranno prese in considerazione! 2. Merce a regime di margine: il prezzo aggiudicato costituisce la base di calcolo per il soprapprezzo da pagare da parte dell’acquirente. Agli acquirenti residenti in Germania e nei paesi europei viene calcolato il 25 % di soprapprezzo; In questa somma é gia compresa l’IVA prevista dalla legge. Agli acquirenti residenti in paesi terzi viene calcolato il 20%. Se la merce sarà esportata tramite terzi o dall’acquirente stesso in paesi terzi, viene calcolata l’IVA prevista dalla legge, ma verrá rimborsata alla presentazione di un certificato di esportazione previsto dalla legge. Se la spedizione e quindi l’esportazione verso paesi terzi verrà effettuata da Gorny & Mosch, non viene calcolata l’IVA prevista dalla legge. L’offerente risponde all’osservanza del regolamento doganale del paese di destinazione. 3. Merce a tassazione piena ovvero merce a utilizzo provvisorio: in casi d’eccezione i lotti sono soggetti a tassazione piena (contrassegnati con +) ossia si trovano in uno stato di utilizzo provvisorio (contrassegnati con ). I lotti coinvolti saranno indicati come tali. Informazioni dettagliate su soprapprezzo e tassazione, sono indicate nelle condizioni dell’asta in fondo al catalogo. 4. Offerte in forma scritta possono essere rilasciate compilando il modulo in allegato. Se acquista per la prima volta da Gorny&Mosch, La preghiamo di indicare nel formulario il nome di un commerciante di Sua conoscenza come referenza. 5. Eventuali correzioni effettuate dopo la stampa del catalogo sono disponibili nel nostro sito ufficiale sotto il link www.gmcoinart.de/en/ catalogs. 6. Il pagamento può essere effettuato in contanti, tramite assegno valido o via bonifico bancario. Le spese bancarie per pagamento mediante assegno estero o bonifico bancario equivalgono a 15 € (ossia 50 € a partire da un ammontare di 25.000 €). 7. Partecipare di persona all’asta è un modo migliore per acquistare oggetti. Durante l’asta si ha l’occasione di ispezionare gli oggetti e valutarne personalmente la qualità. 8. Le spese di imballaggio, di assicurazione e di spedizione vengono addebitati a parte. 9. Il prezzo dell´abbonamento di quattro cataloghi è di 45 €. Se ha interesse ad un abbonamento, La preghiamo di versare la corrispondente somma sul nostro conto corrente postale (vedi pag. 2). Il prezzo per un singolo catalogo è di 15 €. 10. In caso di controversie, valgono le condizioni di vendita elencate in fondo al catalogo. Avvertenze per venditori Se vuole consegnare singoli oggetti o collezioni per la vendita all’asta – siamo le persone giuste a cui rivolgersi! 1. 2.

3. 4. 5. 6. 7. 8. 9.

Le garantiamo una schedatura e una pubblicazione professionale della merce a noi affidata. I nostri cataloghi raggiungono una vasta cerchia internazionale di collezionisti, che viene continuamente allargata per l´impegno promozionale che poniamo nel partecipare alle più importanti manifestazioni internazionali del settore. I clienti presenti alle nostre aste sono collezionisti seri e professionali. All´asta vengono accettati singolarmente solo oggetti il cui valore è superiore a 500 €. Non vengono addebitate spese per oggetti invenduti. La nostra commissione di vendita ammonta al 20% del prezzo d’aggiudicazione. Gli oggetti vengono valutati a seconda del valore di mercato attuale. Limiti troppo elevati non vengono accettati. Tre settimane prima dell´asta, Le verrà inviata la lista degli oggetti che saranno messi all´asta con il corrispettivo valore stimato. In tal modo teniamo al corrente il cliente sulla situazione della merce a noi affidata. Il pagamento del venditore verrà effettuato 70 giorni dopo la fine dell´asta. Può fare richiesta, non impegnativa, dei contratti per la consegna di oggetti. In caso di ulteriori domande, siamo a Sua completa disposizione. Ci può contattare al numero: Tel.: +49-(0)89/24 22 643-0.

9


Informations pour les enchérisseurs 1.

Les enchères débuteront à 80% du prix estimé dans le catalogue. Toute offre inférieure ne sera pas acceptée. 2. Objets sous le régime de la marge bénéficiaire: la commission à payer se calcule à partir du prix d’adjudication. Elle est de 25% pour les clients provenant d’Allemagne ou d’autres pays européens (la TVA applicable étant déjà prise en compte dans ce montant) et de 20% pour ceux provenant de pays hors de l’UE. Si la marchandise est exportée hors de l’UE par le client ou un tiers, la TVA réglementaire est tout d’abord facturée, avant d’être remboursée dès réception des preuves officielles d’exportation. Si la marchandise est envoyée hors de l’UE par nos soins, la TVA n’est pas calculée. Les enchérisseurs sont responsables du respect de la réglementation douanière en vigueur dans le pays de destination. 3. Objets sous le régime d´imposition intégrale ou d’admission temporaire: dans certains cas, les pièces sont soumises au régime d’imposition intégrale (marquées par +) ou d’admission temporaire (marquées par ); les numéros concernés seront indiqués comme tels. Pour toute information sur la commission et les taxes, veuillez consulter les conditions de vente à la fin du catalogue. 4. Le formulaire ci-joint vous permet de faire une offre d’achat écrite. Si vous achetez pour la première fois chez nous, merci de nous fournir le nom d’une maison de vente aux enchères où vous êtes bien connu(e) (référence). 5. Toute modification après édition du catalogue est affichée dans notre catalogue en ligne. Vous pouvez consulter celui-ci sur www.gmcoinart.de/en/catalogs. 6. Le règlement peut se faire en espèces, par chèque ou virement. Le paiement par chèque ou virement de l’étranger augmente de 15 € ou bien 50 € à partir d‘un montant de 25.000 €. 7. L’idéal est de participer personnellement aux enchères: vous pouvez juste avant la vente et pendant les pauses examiner les objets à volonté. 8. Les frais d’emballage, de port et d’assurance seront calculés/ indiqués séparément. 9. Le prix d’un catalogue s’élève à 15 €; l’abonnement à quatre catalogues à 45 €. Pour vous abonner, veuillez verser ce montant sur notre compte postal „Postbank“ (voir p.2). 10. En cas de litige, les conditions de vente exposées à la fin du catalogue font foi. Informations pour les vendeurs Vous souhaitez vendre aux enchères un objet unique ou votre collection? Vous êtes chez nous à la bonne adresse! 1. 2.

3. 4. 5. 6. 7. 8. 9.

10

Nous garantissons une description professionnelle de vos objets et une publication de haute qualité dans nos catalogues. Nos catalogues s’adressent à une vaste clientèle internationale, qui augmente continuellement grâce à notre participation aux grands salons professionnels mondiaux. De cette façon, vos pièces ont de grandes chances d’être vendues à de bons prix. Les objets, dont l’estimation est supérieure à 500 €, sont vendus séparément. Aucun frais ne vous sera facturé pour les pièces non vendues. Notre commission se chiffre à 20% du prix de l’adjudication. La société Gorny & Mosch GmbH évalue vos objets conformément aux prix du marché. Les prix de réserve trop élevés ne seront pas acceptés. Trois semaines avant la vente aux enchères, nous vous envoyons un inventaire des pièces proposées avec leur estimation. Ainsi, vous restez informé(e) du statut des objets que vous nous avez confiés. Le produit de la vente est versé 70 jours après celle-ci. Vous pouvez nous adresser, à titre indicatif, une demande de contrat de dépôt de pièces. Vous avez d’autres questions? Nous sommes heureux de pouvoir y répondre au +49-(0)89/24 22 64 3-0.

Français


Japanese

ご購入者の皆様へ

1. 開始価格はカタログに指定された査定価格の 80% とします。それ以下の入札は お受けできませんのでご了承ください。

2. 不均一課税品:落札価格は購入者負担の手数料の算出基準となります。ドイツ

3.

4.

5. 6.

7.

8. 9.

10.

および EU 内の購入者は手数料として 25% が加算されます。 法定売上税はこの 金額にすでに含まれています。 第三国の購入者は手数料として 20% が加算され ます。商品が購入者自身または第三者によって第三国に輸出される場合、法定 売上税が加算されますが、 法が要請する輸出関連書類の提示に従い、 払戻を受 けます。 商品が当社によって第三国に輸出される場合、 法定売上税は加算されま せん。 行き先国の関税規則の順守についての責任は入札者が負うものとします。 完全課税品または一時輸出入品:完全課税品 (+マークを記載) または一時輸出 入品 (•マークを記載) は例外となります。 該当するロット番号はそのようにマーク されます。 手数料および税金に関する詳細はカタログの最後にあるオークション 規則を参照してください。 添付のフォームで書面による入札を提示することもできます。 当社で初めてご購 入される方は、 参考としてあなたのことをよく知るディーラーの名前をフォームに ご記入ください。 カタログ印刷後の変更については当社のウェブサイト www.gmcoinart.de/en/catalogs. からオンラインカタログをご覧ください。 お支払いは現金、 小切手または振込をご利用いただけます。 外国小切手および 振込にかかる銀行手数料は 15 €、 または 25,000 € 以上の金額の場合 50 €とな ります。 物品のご購入は、 当社のオークションにご自身で直接ご参加いただくのが最適 な方 法です。 オークション直前や休憩中でも、 物品をじっくりと検討していただ けます。 梱包、 保険および配送にかかる費用は別途示されます。 カタログ 4 冊の定期購入は 45 € となります。 当社カタログの定期購入をご希望 の方は、 当社の Postbank 口座まで該当金額をお振込みください (2 ページを参 照) 。 カタログ 1 冊の単価は 15 € となります。 争議となった場合カタログの最後にあるオークション規則が適用されます。

ご出品者の皆様へ 単品の物品、 またはコレクションをオークションに出品したい方にとって、 当社はま さに最適です!

1. 当社はお品の専門的な取扱いおよびカタログでの高品質なプレゼンテーション を保証します。

2. 当社のカタログは世界各国の広範囲にわたるお客様に届けられるため、重要な

3. 4. 5. 6. 7.

8. 9.

国際 的市場における当社の存在感はますます拡大しています。 これらの前提に もとづき、 当社は皆様にお品の最適な販売をお約束できます。 査定価格が 500 € を超える物品のみ、 単品でオークションにかけられます。 落札に至らなかったお品については手数料は発生しません。 当社の販売手数料は落札価格の 20% となります。 Gorny & Mosch 社はお品を現時点における市場価値にもとづいて査定しま す。 高すぎる最高値設定はお受けできませんのでご了承ください。 オークションの 3 週間前に当社よりオークションに出品される物品のリストを、 その査定価格とともにお知らせします。 このように出品される物品の当社での保 有状況 を詳細にお知らせします。 出品者へのお支払いはオークション終了から 70 日後に実施されます。 当社の出品契約はご自由にご要請いただけます。 ご質問、 お問い合わせはお気軽 に当社までお電話ください。 TEL: +49-(0)89/24 22 64 3-0

11


GRIECHENLAND UND ROM VASEN

1

13


1

1• Attischer Kelchkrater. Y&KU+FP%PLW+HQ NHOQ FP k 0©QGXQJ FP k )Xg FP 8QWHU GHU 0©QGXQJHLQURW}JXULJHU)ULHVDXVGRSSHOWHQ3DOPHWWHQVRQVW ©EHUZLHJHQGPLW*ODQ]WRQ©EHU]RJHQStück von großer Eleganz! Mit französischer Exportlizenz! 'UHL JURgH 5DQGIUDJPHQWH JH EURFKHQXQGRKQH)HKOVWHOOHQZLHGHUDQJHVHW]WVRQVWLQWDNWXQG LQVHKUJXWHP=XVWDQG u Provenienz: Ehemals in einer Privatsammlung in Monte Carlo; erworben in GHQHUQLQGHU*DOHULH3LHUUH(ULF%HFNHU&DQQHV =XUJULHFKLVFKHQ*ODQ]WRQNHUDPLNDOOJHPHLQV)6.QDXg-*HEDXHU +UVJ  %ODFN LV %HDXWLIXO  *ULHFKLVFKH *ODQ]WRQNHUDPLN $XVVWHOOXQJ 0©QFKHQ   $WWLFFDO\[NUDWHUZLWKUHG}JXUHSDOPHWWHVDQGEODFNJOD]H%& 7KUHHODUJHULPIUDJPHQWVDUHEURNHQDQGUHDWWDFKHGZLWKRXWDQ\PLVVLQJ SDUWVRWKHUZLVHLQWDFWDQGLQVXSHUEFRQGLWLRQGraceful piece! With French export licence!

 $WWLVFKHU*ORFNHQNUDWHUGHV(XSROLV0DOHUY&KU+ FP % PLW +HQNHOQ FP k 0©QGXQJ FP k )Xg FP5RW}JXULJ$XIEHLGHQ6HLWHQVWHKHQVLFKHLQH0”QDGH XQG HLQ 6DW\U LQ E©UJHUOLFKHU +DOWXQJ JHJHQ©EHU (LQ +HQNHO HUJ”Q]WNOHLQH%HVWRgXQJHQXQGLP,QQHUHQJU¤gHUH$ESODW]XQJ DP%RGHQ]DKOUHLFKH6LQWHUUHVWH u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU 7K\UVRVVW”EHXQGGLHVSLW]HQ2KUHQGHUP”QQOLFKHQ*HVWDOWHQZHLVHQGLH )LJXUHQDOV0”QDGHQXQG6DW\UQDXV(LJHQWOLFK]XPZLOGHQ*HIROJHGHV 'LRQ\VRVJHK¤UHQGHUVFKHLQHQVLHDXIGLHVHQ%LOGHUQMHGRFKJDQ]LP+DELWXV GHU E©UJHUOLFKHQ .RQYHQWLRQHQ 6WDWW GLH 0”QDGHQ ZLOG ]X EHGU”QJHQ EH}QGHQVLFKGLH6DW\UQKLHULPUXKLJHQ*HVSU”FKPLWLKQHQ8QGDOOHWUDJHQ E©UJHUOLFKH .OHLGXQJ $OOHLQ HLQ 6DW\U LVW QDFNW GRFK JDQ] GHU 2UGQXQJ HQWVSUHFKHQG LVW VHLQ *OLHG LQ}EXOLHUW KRFKJHEXQGHQ  9RQ EHVRQGHUHP ,QWHUHVVHVLQGGLH]DKOUHLFKHQJXWVLFKWEDUHQ9RU]HLFKQXQJHQGLHEHOHJHQ GDVVGHU0DOHUXUVSU©QJOLFKJDQ]DQGHUH.¤USHUKDOWXQJHQLP6LQQKDWWH 9HUJOHLFKEDUH6DW\UGDUVWHOOXQJHQGHV(XSROLV0DOHUV}QGHQVLFK]XP%HLVSLHO DXIGHP.RORQHWWHQNUDWHU:LHQ.XQVWKLVWRULVFKHV0XVHXP%HVRQGHUV LQWHUHVVDQWLVWEHLXQVHUHP.UDWHUGLH'DUVWHOOXQJGHV/RUEHHU]ZHLJHVGHVVHQ %O”WWHUHQJDP5DQGOLHJHQ'LHVH$UWGHU:LHGHUJDEH}QGHWVLFK]XHUVWEHLP IU©KNODVVLVFKHQ9LOOD*LXOLD0DOHUXQGVHLQHU*UXSSHLQGHVVHQ1DFKIROJH GHU KRFKNODVVLVFKH (XSROLV0DOHU VWHKW (LQH EHVRQGHUV HQJH 3DUDOOHOH ]X GHP /RUEHHU DXI XQVHUHP .UDWHU }QGHW VLFK DXI GHP .UDWHU 1HZ <RUN 0HWURSROLWDQ0XVHXPGHVYHUZDQGWHQ'DQDH0DOHUV,QGLHVHU +LQVLFKWVWHKWDXFKGHU0DOHUGHU/RXYUH.HQWDXURPDFKLHXQVHUHP0DOHU QDKHV]XP.UDWHUGHV(XSROLV0DOHUVLQ:LHQ-'%HD]OH\$WWLF5HG )LJXUH9DVH3DLQWHUV  6 $59 %HD]OH\$UFKLYH3RWWHU\ 'DWDEDVH %$3' ]X%HLVSLHOHQDXVGHU+DQGGHV9LOOD*LXOLD 0DOHUV%$3'XQG]XGHP.UDWHUGHV'DQDH 0DOHUVLQ1HZ<RUN$59%$3']X%HLVSLHOHQGHV0DOHUV GHU/RXYUH.HQWDXURPDFKLH%$3'XQG $WWLFUHG}JXUHEHOONUDWHURIWKH(XSROLV3DLQWHU%&2QERWK VLGHVHDFKDFRXSOHRIPDHQDGDQGVDW\ULQWKHKDELWXVRI$WKHQLDQFLWL]HQV With very interesting preliminary sketches. 2QHKDQGOHLVPRGHUQOLWWOH VSOLQWHUVRIWKHVXUIDFHDQGDSDUWRIWKHERWWRPLQVLGHDUH~DNHGRIIVHYHUDO UHPDLQVRIVLQWHU

1

14




15




 0RQXPHQWDOHDSXOLVFKH.DOSLV +\GULD GHV3DWHUD0DOHUV8P Y&KU+FP%PLW+HQNHOQFPk.¤USHUFP k0©QGXQJFPXQG)XgFP5RW}JXULJPLWJHOEHQXQG ZHLgHQ'HWDLOV$XIGHU9RUGHUVHLWHLQHLQHP1DLVNRVGLHVLW]HQ GH9HUVWRUEHQH]ZLVFKHQHLQHU'LHQHULQPLW6FKPXFNN”VWFKHQ XQGHLQHU*HI”KUWLQPLW)”FKHU6HLWOLFKGDYRQREHQ]ZHLVLW]HQ GHXQGGDUXQWHU]ZHLVWHKHQGH*HI”KUWLQQHQGLH$WWULEXWHGHU 6FK¤QKHLWKDOWHQ6HLWOLFKXQGDXIGHU5©FNVHLWHJURgH3DOPHW WHQ5DQNHQ2UQDPHQWH=ZLVFKHQGHQ+HQNHODQV”W]HQMHZHLOV HLQZRKOEHUHLWVDQWLNHV/RFKMit italienischer Exportlizenz von 2021! $XV )UDJPHQWHQ ]XVDPPHQJHVHW]W NOHLQHUH )HKOVWHOOHQ VRZLHDEJHSODW]WH)DUEVWHOOHQUHWXVFKLHUW u 3URYHQLHQ]%LVLQGHXWVFKHU3ULYDWVDPPOXQJI©UGLHVHEHL+HOPXW /LHEHUW$QWLTXLW”WHQ.UHIHOGHUZRUEHQ 0RQXPHQWDO$SXOLDQUHG}JXUHK\GULDRIWKH3DWHUD3DLQWHU$ERXW%& 2QWKHIURQWLQVLGHRIDQDLVNRVWKHVLWWLQJGHFHGHQWEHWZHHQDVHUYDQWZLWK FDVNHWEHKLQGKHUDQGDFRPSDQLRQZLWKIDQ/HIWDQGULJKWRIWKHQDLVNRV IXUWKHUFRPSDQLRQVZLWKDWWULEXWHVRIEHDXW\2QWKHVLGHVDQGEDFNODUJH SDOPHWWHVZLWKWHQGULOV%HORZWKHKDQGOHVHDFKDQDQFLHQWKROH5HDVVHPEOHG IURPIUDJPHQWVOLWWOHPLVVLQJSDUWVDQGORVWFRORUDUHUHWRXFKHGWith Italian export lincence from 2021!



16




17






4

18


4

4• Euböischer Kolonettenkrater. (UHWULD IU©KHV  -K Y &KU + FP%PLW+HQNHOQFPk.¤USHUFPk0©QGXQJ FPk)XgFP6FKZDU]}JXULJPLWZHLgHQ'HWDLOV$XI GHUHLQHQ6HLWHGHU$EVFKLHG]ZHLHU.ULHJHUGHQHQMHZHLOVHLQH )UDXXQGHLQ”OWHUHU0DQQJHJHQ©EHUVWHKHQ$XIGHUDQGHUHQ 6HLWH HLQ 7KLDVRV PLW MHZHLOV ]ZHL WDQ]HQGHQ 6DW\UQ XQG 0” QDGHQ$XVJURgHQ)UDJPHQWHQ]XVDPPHQJHVHW]WGDEHLNOHLQH $EVSOLWWHUXQJHQDQGHQ%UXFKNDQWHQXQGGHU0©QGXQJ5HVWH YRQ6LQWHU u

3URYHQLHQ](KHPDOV&ROOHFWLRQ-DFRE0DUFXV,VUDHOHUZRUEHQ $XI(XE¤DZXUGHQLQGHUDXVJHKHQGHQ$UFKDLNJHUQH9DVHQQDFKDWWLVFKHP 9RUELOG KHUJHVWHOOW 6LH XQWHUVFKHLGHQ VLFK QHEHQ GHP HWZDV ~©FKWLJHQ =HLFKHQVWLOGXUFKGHQPDQFKPDOGXQNHOEUDXQJHEUDQQWHQ0DOVFKOLFNHUV ]XGHQ9DVHQDXV(XE¤D-%RDUGPDQ(DUO\*UHHN9DVH3DLQWLQJWKWR WK&HQWXU\%&$+DQGERRN  6I (UHWULDQEODFN}JXUHFROXPQNUDWHU(DUO\WKFHQWXU\%&2QRQHVLGHWKHID UHZHOORIWZRZDUULRUVE\DZRPDQDQGDQHOGHUPDQ7KHRWKHUVLGHGHSLFWLQJ DGLRQ\VLFWKLDVRVZLWKHDFKWZRPLQFLQJVDW\UVDQGPDHQDGV5HDVVHPEOHG IURPODUJHIUDJPHQWVVHYHUDOVSOLQWHUVDWWKHFUDFNVDQGPRXWKDUHPLVVLQJ UHPDLQVRIVLQWHU

19


5

5 $WWLVFKH+DOVDPSKRUDYLHOOHLFKW(XSKLOHWRV0DOHUY &KU+FPk.¤USHUFPk0©QGXQJFPk)Xg FP6FKZDU]}JXULJPLWURWHQXQGZHLgHQ'HWDLOV$XIGHUHL QHQ6HLWHOHQNWHLQ0DQQHLQH4XDGULJDQDFKUHFKWVKLQWHUGHU HLQ.ULHJHUPLW/DQ]HQVWHKWYRUGHQ3IHUGHQHLQ-©QJOLQJ$XI GHU DQGHUHQ 6HLWH VSLHOW HLQ 0XVLNDQW GHQ 'RSSHODXORV OLQNV YRQLKPHLQ”OWHUHUXQGUHFKWVHLQM©QJHUHU0DQQDOV=XK¤UHU ,QGHQ+HQNHO]RQHQ3DOPHWWHQ5DQNHQXQG/RWXVEO©WHQ$XI GHU6HLWHGHU0XVLNV]HQH]DKOUHLFKHJHERKUWH/¤FKHUGLH]XHL QHUDOWHQYLHOOHLFKWVFKRQDQWLNHQ5HSDUDWXUJHK¤UHQ$XV)UDJ PHQWHQ ]XVDPPHQJHVHW]W GDEHL NOHLQH PRGHUQH (UJ”Q]XQJHQ DQGHQ%UXFKNDQWHQOHGLJOLFKDXIGHUOLQNHQ6HLWHGHU0XVLNV]H QHJU¤gHUHHUJ”Q]WH)HKOVWHOOH u 3URYHQLHQ]$XVGHU6DPPOXQJYRQ%HUQKDUG:LFNLHUZRUEHQLQGHQHU -DKUHQEHLHLQHP0©QFKQHU+”QGOHU 'LH$PSKRUDVWDPPWDXVGHP9HUP”FKWQLVGHV6FKDXVSLHOHUVXQG5HJLVVHXUV %HUQKDUG:LFNLGHU]XGHQJU¤gWHQ*HVWDOWHQGHVGHXWVFKHQ1DFKNULHJV}OPV ]”KOWLQ6W3¤OWHQ1LHGHU¤VWHUUHLFKJHERUHQZXUGH:LFNLDXIHLQHQ

20

6FKODJPLWVHLQHP$QWLNULHJV}OP'LH%U©FNHwZHOWZHLWEHNDQQW.XU]QDFK GHU8UDXII©KUXQJVHLQHUOHW]WHQ5HJLHDUEHLW'DV6SLQQHQQHW]wYHUVWDUEHU $QIDQJLQ0©QFKHQ =XP (XSKLOHWRV0DOHU V $%9  - %RDUGPDQ 6FKZDU]}JXULJH 9DVHQ DXV $WKHQ (LQ +DQGEXFK   6  9JO ]XP %HLVSLHO GLH 3IHUGHDXIGHU0©QFKQHU+\GULD-DKQ $%9%HD]OH\$UFKLYH 3RWWHU\'DWDEDVH GLH3URSRUWLRQHQGHV+HQNHORUQDPHQWHVVRZLH GLH$UWGHUEHUVFKQHLGXQJHQGHU3DOPHWWHQDXIGHU$PSKRUD7KRUYDOGVHQ 0XVHXP.RSHQKDJHQ $%9%HD]OH\$UFKLYH3RWWHU\'DWDEDVH  RGHUGLHZHOOHQDUWLJHQ)LQJHUGHV~¤WHQVSLHOHQGHQ6DW\UVDXIGHU +\GULD%ULWLVK0XVHXP% $%9%RDUGPDQD2$EE %HD]OH\$UFKLYH3RWWHU\'DWDEDVH  $WWLF EODFN}JXUH QHFNDPSKRUD SHUKDSV (XSKLOHWRV 3DLQWHU    %& 2Q RQH VLGH D FKDULRW WR WKH ULJKW EHKLQG D ZDUULRU DQG LQ IURQW RI WKHKRUVHVDER\2QWKHRWKHUVLGHD~XWHSOD\HUEHWZHHQWZRPHQ2QWKLV VLGHVHYHUDOGULOOHGKROHVIURPDQROGSHUKDSVDQFLHQWUHSDLU5HDVVHPEOHG IURPIUDJPHQWVIHZOLWWOHPRGHUQVSRWVDWWKHFUDFNVOHIWRIWKHPXVLFVFHQH DODUJHUSDUWLVPLVVLQJFrom the estate of the famous German actor and }OPGLUHFWRU%HUQKDUG:LFNLZKRSXUFKDVHGWKHDPSKRUDLQWKHWLHV in Munich!


5



 $WWLVFKH2OSH.UHLVGHV$QWLPHQHV0DOHUVY&KU+ FPk.¤USHUFPk0©QGXQJFPk)XgFP 6FKZDU]}JXULJ PLW ZHLgHQ XQG URWHQ 'HWDLOV 9RUQH DXIZ”Q GLJYRQ6FKDFKEUHWWPXVWHU/RWXVNQRVSHQ*UDQDWDSIHOIULHVXQG (IHXUDQNHQJHUDKPWHV%LOGIHOGGDULQYRU:HLQUDQNHQGLH*H VFKZLVWHU $UWHPLV PLW .URQH XQG .¤FKHU VRZLH $SROORQ GLH .LWKDUD VFKODJHQG Kleines Meisterwerk! .OHLQH UHWXVFKLHUWH )HKOVWHOOHDQGHU0©QGXQJDXIGHU8QWHUVHLWHREHU~”FKLJH$E VSOLWWHUXQJVRQVWLQWDNW u 3URYHQLHQ](KHPDOVLQGHUGHXWVFKHQ3ULYDWVDPPOXQJ'U:&HUZRUEHQ DXIGHPGHXWVFKHQ.XQVWPDUNW $WWLFEODFN}JXUHROSHIURPWKH&LUFOHRIWKH$QWLPHQHV3DLQWHU %&$WWKHIURQW$UWHPLVZLWKFURZQDQGTXLYHUDQGKHUEURWKHU$SROORQ SOD\LQJ WKH FLWKDUD DOO HODERUDWHO\ IUDPHG E\ LY\ ORWXV SRPHJUDQDWH DQG FKHFNHU/LWWOHPLVVLQJIUDJPHQWDWWKHULPLVUHWRXFKHGDVXU}FLDOVSOLQWHU EHORZWKHERWWRPLVPLVVLQJRWKHUZLVHLQWDFWLittle masterpiece!

21


 

e Euböische Amphora. (UHWULD IU©KHV  -K Y &KU + FP %PLW+HQNHOQFPk.¤USHUFPk0©QGXQJFP k)XgFP6FKZDU]}JXULJPLWURWHQ'HWDLOV$XIGHUHLQHQ 6HLWHGLH(LQI©KUXQJGHV+HUDNOHVLQGHQ2O\PSLP%HLVHLQYRQ +HUPHVXQGVHLQHU6FKXW]J¤WWLQ$WKHQD$XIGHUDQGHUHQ6HLWH HLQ WDQ]HQGHU 6DW\U )UDJPHQWH GHU 0©QGXQJ JHEURFKHQ XQG ZLHGHUDQJHVHW]WGDEHLNOHLQH$EVSOLWWHUXQJHQ5HVWHYRQ6LQ WHU u 3URYHQLHQ](KHPDOV&ROOHFWLRQ-DFRE0DUFXV,VUDHOHUZRUEHQ (UHWULDQEODFN}JXUHDPSKRUD(DUO\WKFHQWXU\%&2QRQHVLGHWKHULVH RI+HUDFOHVWRWKH2O\PSRVDFFRPSDQLHGE\+HUPHVDQG$WKHQD2QWKH RWKHUVLGHDPLQFLQJVDW\U6HYHUDOIUDJPHQWVDWWKHPRXWKDUHEURNHQDQG UHDWWDFKHGIHZVSOLQWHUVDUHPLVVLQJUHPDLQVRIVLQWHU

22

 Apulische Pelike. 8PY&KU+FPk.¤USHUFP k0©QGXQJFPk)XgFP5RW}JXULJPLWZHLgHQXQG JHOEHQ'HWDLOV$XIGHU9RUGHUVHLWHHLQHXQEHNOHLGHWH)UDXPLW .”VWFKHQ YRU HLQHP 3HULUUKDQWHULRQ YRU LKU VLW]W HLQH ZHLWHUH MXQJH)UDXDXIHLQHP)HOVHQXQGEHWUDFKWHWVLFKLP6SLHJHO$XI GHU5©FNVHLWH]ZHL0DQWHOM©QJOLQJHXQGVHLWOLFK3DOPHWWHQMit ([SHUWLVHGHV$QWLNHQ.DELQHWW%HUQG*DFNVW”WWHU)UDQNIXUWD0 0©QGXQJJHEURFKHQXQGZLHGHUDQJHVHW]WNOHLQH$EVSOLWWHUXQJ DQGHU/LSSHXQWHUGHU0©QGXQJXQGGHP)Xg5HVWHYRQ6LQ WHU u 3URYHQLHQ] ([ 6DPPOXQJ 5 9LOOLQJHU6FKPHOOHU %D\HUQ HUZRUEHQ YRU  $SXOLDQUHG}JXUHSHOLNH$ERXW%&2QVLGH$DQXGHZRPDQZLWK ER[EHVLGHDSHULUUKDQWHULRQLQIURQWRIKHUDVLWWLQJ\RXQJZRPDQORRNLQJDW KHUVHOILQDPLUURU2QVLGH%WZRGUDSHG\RXWKVDQGRQWKHVLGHVSDOPHWWHV 0RXWKEURNHQDQGUHDWWDFKHGWLQ\VSOLQWHUDWWKHULPLVPLVVLQJEHORZWKH PRXWKDQGXQGHUWKHIRRWUHPDLQVRIVLQWHU:LWKH[SHUWLVHRIWKH$QWLNHQ .DELQHWW%HUQG*DFNVW”WWHU)UDQNIXUWD0


9

9 .OHLQHNDPSDQLVFKH.DOSLV +\GULD GHV&DLYDQR0DOHUV&DSXD ,    Y &KU + FP % PLW +HQNHOQ FP k .¤USHUFPk0©QGXQJFPk)XgFP5RW}JXULJ PLW JHOEHQ XQG ZHLgHQ 'HWDLOV $XI GHU 9RUGHUVHLWH HLQ (URV PLW 7”QLH XQG 6FKDOH ]X VHLQHQ )©gHQ HLQ $OWDU $XI GHU 5©FNVHLWH3DOPHWWHXQG5DQNHQ0LW7/$QDO\VHGHV5DWKJHQ )RUVFKXQJVODERU%HUOLQYRQ,QWDNWPLW5HVWHQYRQ6LQWHU u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU 6PDOO&DPSDQLDQUHG}JXUHNDOSLVRIWKH&DLYDQR3DLQWHU&DSXD, %&(URVZLWKWDHQLDDQGERZOEHVLGHDQDOWDU$WWKHEDFNODUJHSDOPHWWH EHWZHHQ WHQGULOV ,QWDFW ZLWK UHPDLQV RI VLQWHU :LWK 7/DQDO\VLV RI WKH 5DWKJHQ)RUVFKXQJVODERU%HUOLQIURP

10

10 .DPSDQLVFKH %DXFKOHN\WKRV GHV :HLgJHVLFKW)ULJQDQR0DOHUV &DSXD ,, XP  Y &KU + FP k .¤USHU FP k 0©QGXQJ FP k )Xg FP 5RW}JXULJ PLW JHOEHQ XQG ZHLgHQ 'HWDLOV $XI GHU 9RUGHUVHLWH HLQH XQEHNOHLGHWH )UDX EHLP :DVFKHQ DP 3HULUUKDQWHULRQ VWHLQHUQHV :DVFKEHFNHQ  OLQNVJLHgWHLQH'LHQHULQ]XV”W]OLFK:DVVHUDXVHLQHU+\GULDLQ GDV%HFNHQ$XIGHU5©FNVHLWHHODERULHUWHV3DOPHWWHQRUQDPHQW %HVWH NDPSDQLVFKH 9DVHQPDOHUHL $XV JURgHQ )UDJPHQWHQ ]XVDPPHQJHVHW]WDQGHQ%UXFKVWHOOHQNOHLQH(UJ”Q]XQJHQGLH .¤SIH©EHUZLHJHQG©EHUPDOW u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU &DPSDQLDQ UHG}JXUH VTXDW OHN\WKRV RI WKH :KLWHIDFH)ULJQDQR 3DLQWHU &DSXD ,, DERXW  %& 8QGUHVVHG ZRPDQ ZDVKLQJ KHUVHOI DW D SHULUUKDQWHULRQRQWKHOHIWDVHUYDQW}OOLQJZDWHUIURPDK\GULDLQWKHEDVLQ 2QWKHEDFNVLGHDHODERUDWHGRUQDPHQWZLWKSDOPHWWHVWHQGULOVDQGEORVVRPV 5HDVVHPEOHGIURPODUJHIUDJPHQWVDWWKHFUDFNVIHZOLWWOHPRGHUQUHWRXFKHG DGGLWLRQV WKH ZRPHQhV KHDGV PRVWO\ RYHUSDLQWHG Excellent Campanian YDVHSDLQWLQJ

23


11 .DPSDQLVFKHU/HEHV*DPLNRVLQGHU$UWGHV.DVVDQGUD0DOHUV &DSXD ,    Y &KU + PLW 'HFNHO FP k .¤USHU FP k 'HFNHO FP k )Xg FP 5RW}JXULJ $XI GHP 'HFNHO]ZLVFKHQ3DOPHWWHQ.¤SIHHLQHU)UDXPLW6DNNRVXQG HLQHV E”UWLJHQ 0DQQHV 'LH 0DOHUHL DXI GHP .¤USHU ]HLJW DXI GHU HLQHQ 6HLWH HLQHQ DXI HLQHP 7\PSDQRQ VLW]HQGHQ 6DW\U PLW 6FKDOH DXI GHU DQGHUHQ 6HLWH HLQHQ 0DQWHOM©QJOLQJ XQG GD]ZLVFKHQ 3DOPHWWHQ 5DQNHQ XQG %O©WHQ 8QJHEURFKHQ PLW ]DKOUHLFKHQ5HVWHQYRQ6LQWHUEHLGHQ)LJXUHQXQG%O©WHQDXI GHP.¤USHUNOHLQHPRGHUQH5HWXVFKHQ u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU &DPSDQLDQ UHG}JXUH OHEHV JDPLNRV 0DQQHU RI WKH &DVVDQGUD 3DLQWHU &DSXD,%&2QWKHOLGKHDGVRIDZRPDQZLWKVDNNRVDQGRID EHDUGHGPDQ2QWKHFRUSXVRQRQHVLGHDVHDWHGVDW\UZLWKERZORQWKHRWKHU DGUDSHG\RXWK$OOGHFRUDWHGZLWKSDOPHWWHVWHQGULOVDQGEORVVRPV,QWDFW ZLWKPDQ\UHPDLQVRIVLQWHUIHZUHWRXFKLQJVDWWKH}JXUHVDQGEORVVRPVRQ WKHFRUSXV

11



24




 (LQ3DDUDSXOLVFKHU2LQRFKRHQDXVGHU:HUNVWDWWGHV%DOWLPRUH Malers. Y&KU+XQGFPk.¤USHU XQGFPk)XgXQGFP5RW}JXULJH.DQQHGHU)RUP PLWJHOEHQXQGZHLgHQ'HWDLOV'LHHLQHGHUDOV3DDUJHDUEHL WHWHQ9DVHQ]HLJWHLQHVLW]HQGHMXQJH)UDXPLW.”VWFKHQ6SLHJHO XQG)”FKHUGLHDQGHUHHLQHQVLW]HQGHQ(URVPLW.”VWFKHQ.D ODWKRVXQG7\PSDQRQ5HLFKHURUQDPHQWDOHU'HNRUDXI.¤USHU 6FKXOWHUXQG+DOVHLQVFKOLHgOLFKJURgHU3DOPHWWHDXIGHU5©FN VHLWH $P REHUHQ XQG XQWHUHQ +HQNHODQVDW] MH HLQ SODVWLVFKHU )UDXHQNRSI%LVDXIZLQ]LJH)DUEDEVSOLWWHUXQJHQLQWDNWPLWJH ULQJHQ6LQWHUUHVWHQ u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU

 (LQ 3DDU DSXOLVFKHU .DQWKDURL GHV 6WRNHRQ7UHQW0DOHUV 8P Y&KU+XQGFP%PLW+HQNHOQXQGFP k0©QGXQJXQGFPk)XgXQGFP5RW}JX ULJPLWJHOEHQXQGZHLgHQ'HWDLOV%HLGVHLWLJMHZHLOVHLQ)UDX HQNRSIPLW6DNNRV]ZLVFKHQ7K\UVRL$PREHUHQXQGXQWHUHQ +HQNHODQVDW]MHHLQSODVWLVFKHU)UDXHQNRSI:LQ]LJH$EVSOLWWH UXQJHQVRQVWLQWDNW u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU 3DLURIUHODWHGUHG}JXUHG$SXOLDQNDQWKDURLRIWKH6WRNHRQ7UHQW3DLQWHU $ERXW%&(DFKGHSLFWLQJRQERWKVLGHVWKHKHDGRIDZRPDQZLWKVDNNRV EHWZHHQWK\UVRL$WWKHKDQGOHVDERYHDQGEHORZHDFKDSODVWLFPRXOGHGKHDG RIDZRPDQ7LQ\VSOLQWHUVDUH~DNHGRIIRWKHUZLVHLQWDFW

3DLURIUHODWHGUHG}JXUHG$SXOLDQRLQRFKRHVRIVKDSHIURPWKH:RUNVKRS RIWKH%DOWLPRUH3DLQWHU%&2QHGHSLFWLQJDVHDWHGJLUOZLWKER[ PLUURUDQGIDQWKHRWKHUDVHDWHG(URVZLWKER[NDODWKRVDQGW\PSDQRQ %RWKJHQHURXVO\GHFRUDWHGZLWKRUQDPHQWDOGHFRU$WWKHKDQGOHVDERYHDQG EHORZHDFKDSODVWLFDOO\PRXOGHGKHDGRIDZRPDQ7LQ\SDUWVRIWKHSDLQWLQJ DUH~DNHGRIIRWKHUZLVHLQWDFWZLWKIHZUHPDLQVRIVLQWHU

25


14 *URgHU DWWLVFKHU 6N\SKRV +HURQ.ODV VH  GHU &+&*UXSSH    Y &KU + RKQH +HQNHO FP % PLW +HQ NHOQFPk0©QGXQJFPk)Xg FP 6FKZDU]}JXULJ PLW ZHLgHQ XQG URWHQ'HWDLOV$XIEHLGHQ6HLWHQ]ZLVFKHQ 6SKLQJHQHLQH0”QDGHXQGHLQ6DW\UW”Q ]HOQG QDFK UHFKWV $XV )UDJPHQWHQ ]X VDPPHQJHVHW]WNOHLQH)HKOVWHOOHQDQGHQ %UXFKNDQWHQVLQGUHWXVFKLHUW u 14

3URYHQLHQ]$XVGHU6DPPOXQJ006©GED\HUQ LQ'HXWVFKODQGVHLWPLQGHVWHQV &+&VWHKWI©U&KDULRW&RXUWLQJ*URXS=XGLHVHU 0DOHUJUXSSHV-'%HD]OH\$WWLF%ODFN)LJXUH 9DVH3DLQWHUV $%9  6II /DUJH $WWLF EODFN}JXUH VN\SKRV +HURQ &ODVV  RIWKH&+&*URXS%&2QERWKVLGHV EHWZHHQ 6SKLQJHV D PDHQDG DQG VDW\U GDQFLQJ WR WKH ULJKW 5HDVVHPEOHG IURP IUDJPHQWV OLWWOH PLVVLQJSDUWVDWWKHFUDFNVDUHPRGHUQUHWRXFKHG

15 .DPSDQLVFKHU 6N\SKRV GHV &DLYDQR0D lers. &DSXD,Y&KU+FP% PLW+HQNHOQFPk.¤USHUFP k0©QGXQJFPk)XgFP5RW }JXULJPLWZHLgHQ'HWDLOV$XIHLQHU6HL WHHLQHVLW]HQGH)UDXPLW6DNNRVEORgHP 2EHUN¤USHUXQG+©IWPDQWHODXIGHUDQ GHUHQHLQQDFNWHUVLW]HQGHU-©QJOLQJGD ]ZLVFKHQ 3DOPHWWHQ ,QWDNW PLW 5HVWHQ YRQ6LQWHU u 3URYHQLHQ] $XV GHU 6DPPOXQJ 5 . +HVVHQ HUZRUEHQYRU 15

&DPSDQLDQ UHG}JXUH VN\SKRV RI WKH &DLYDQR 3DLQWHU &DSXD ,    %& 2Q RQH VLGH DVHDWHGZRPDQRQO\GUHVVHGZLWKVDNNRVDQGD KLPDWLRQDURXQGKHUOHJVRQWKHRWKHUVLGHDQXGH VHDWHG\RXWKEHWZHHQWKH}JXUHVODUJHSDOPHWWHV ,QWDFWZLWKUHPDLQVRIVLQWHU

 Apulischer Eulenskyphos. +”OIWH-K Y&KU+FP%PLW+HQNHOQFP k0©QGXQJFPk)XgFP5RW} JXULJ%HLGVHLWLJHLQQDFKOLQNVVWHKHQGHU 6WHLQNDX] ]ZLVFKHQ /RUEHHU]ZHLJHQ ,Q WDNWPLW5HVWHQYRQ6LQWHU u 3URYHQLHQ] $XV GHP 1DFKODVV GHU ED\ULVFKHQ 6DPPOXQJ.+LQ'HXWVFKODQGVHLWYRU *HPHLQKLQ VSULFKW PDQ EHLP :DSSHQWLHU GHU *¤WWLQ$WKHQDVWHWVYRQHLQHU(XOH.RQNUHWLVWDEHU GHU6WHLQNDX]JHPHLQWZDVDXFKVHLQ]RRORJLVFKHU 1DPH$WKHQHQRFWXD]XP$XVGUXFNEULQJW%HL GLHVHP6N\SKRVVWHKHQGLH6WHLQNDX]HQDFKOLQNV ZDVVHKUYLHOVHOWHQHUYRUNRPPWDOVQDFKUHFKWV VWHKHQGH 

26

$SXOLDQ UHG}JXUH RZOVN\SKRV VW KDOI WK FHQWXU\ %& 2Q ERWK VLGHV DQ RZO WR WKH OHIW EHWZHHQ ODXUHOEUDQFKHV ,QWDFW ZLWK UHPDLQV RI VLQWHU


e Apulischer Eulenskyphos. +”OIWH-K Y&KU+FP%PLW+HQNHOQFP k0©QGXQJFPk)XgFP5RW} JXULJ %HLGVHLWLJ HLQ QDFK UHFKWV VWHKHQ GHU6WHLQNDX]]ZLVFKHQ/RUEHHU]ZHLJHQ (LQJURgHV)UDJPHQWJHEURFKHQXQGZLH GHUDQJHVHW]WHLQ+HQNHOHUJ”Q]W u 3URYHQLHQ] (KHPDOV LQ GHU +DUU\ 7RXOFK &ROOHFWLRQ 0RQWUHDO I©U GLHVH  HUZRUEHQ EHL/C$UW$QFLHQ0RQWUHDO $SXOLDQUHG}JXUHRZOVN\SKRVVWKDOIWKFHQWXU\ %&2QERWKVLGHVDQRZOWRWKHULJKWEHWZHHQ ODXUHOEUDQFKHV2QHODUJHIUDJPHQWEURNHQDQG UHDWWDFKHGRQHKDQGOHLVPRGHUQ



 Attischer Schalenskyphos. (QGH  -K Y &KU + PLW +HQNHOQ FP XQG RKQH FP % PLW +HQNHOQ UHNRQVWUXLHUW FP k 0©QGXQJ FP k 5LQJ IXgFP5RW}JXULJ$XIEHLGHQ6HLWHQ MHHLQ3DDU0DQWHOM©QJOLQJHHLQHUGDYRQ PLW6WULJLOLV,QGHQ+HQNHO]RQHQ3DOPHW WHQ XQG 5DQNHQ VRZLH LQQHQ DP 5DQG (IHXUDQNH$XVGUHLJURgHQ)UDJPHQWHQ ]XVDPPHQJHVHW]W HLQ +HQNHO XQG ]ZHL )HKOVWHOOHQHUJ”Q]WXQGUHWXVFKLHUW u 3URYHQLHQ] $XV GHU 6DPPOXQJ 5 . +HVVHQ HUZRUEHQYRU $WWLFUHG}JXUHFXSVN\SKRV/DWHWKFHQWXU\%& 2Q ERWK VLGHV HDFK D FRXSOH RI GUDSHG \RXWKV RQH ZLWK VWULJLOLV $W WKH KDQGOHV SDOPHWWHV DQG WHQGULOV DQG LQVLGH EHORZ WKH ULP D LY\WHQGULO 5HDVVHPEOHG IURP WKUHH ODUJH IUDJPHQWV RQH KDQGOH DQG WZR PLVVLQJ SDUWV DUH PRGHUQ DQG UHWRXFKHG





27


19

19 Apulische Lekanis in der Nachfol JHGHV%DOWLPRUH0DOHUV8P Y&KU+JHVDPWFP%6FKD OH PLW +HQNHOQ FP k 'HN NHO FP XQG 6FKDOH FP k .QDXI FP XQG )Xg FP *ODQ]WRQVFKDOH PLW URW}JXUL JHP'HFNHOPLWJHOEHQXQGZHL gHQ 'HWDLOV =ZLVFKHQ 3DOPHWWHQ EHLGVHLWLJ MH HLQ VLW]HQGHU -©QJ OLQJPLW6SLHJHO'HFNHODXV]ZHL 7HLOHQ ]XVDPPHQJHVHW]W ZHQLJH NOHLQH $EVSOLWWHUXQJHQ VRQVW JX WHU=XVWDQGPLW6LQWHUUHVWHQ u 3URYHQLHQ] $XV GHU 6DPPOXQJ 5 . +HVVHQHUZRUEHQYRU $SXOLDQ UHG}JXUH OHNDQLV IURP D /DWH )ROORZHURIWKH%DOWLPRUH3DLQWHU$ERXW  %& 2Q WKH OLG WZR VLWWLQJ \RXWKV ZLWK PLUURUV EHWZHHQ SDOPHWWHV /LG UHDVVHPEOHG IURP WZR SDUWV IHZ OLWWOH VSOLQWHUVDUHPLVVLQJRWKHUZLVHLQJRRG FRQGLWLRQZLWKUHPDLQVRIVLQWHU

19

e 2VWLRQLVFKH 5DQGVFKDOH 6DPRV XP  Y &KU + FP % PLW +HQNHOQ FP k 0©QGXQJ FP k )Xg FP ,QQHQ XQGDXgHQ/LQLHQGHNRULP,QQH UHQNOHLQHU7RQGRPLWNRQ]HQWUL VFKHQ .UHLVHQ $XV )UDJPHQWHQ ]XVDPPHQJHVHW]W GDEHL HLQH NOHLQHUHWXVFKLHUWH)HKOVWHOOH u 3URYHQLHQ] ([ *RUQ\  0RVFK 0©QFKHQ $XNWLRQ   /RV  DXVHLQHU3ULYDWVDPPOXQJH[&KULVWLHhV /RQGRQ$XNWLRQ/RV



28

,RQLDQEODFN}JXUHOLSFXS6DPRVDERXW  %& ,QVLGH D VPDOO WRQGR ZLWK FRQFHQWULF FLUFOHV 5HDVVHPEOHG IURP IUDJPHQWV RQH VPDOO PLVVLQJ IUDJPHQW LVUHWRXFKHG






 $WWLVFKH%DQGVFKDOHY&KU+FP%PLW+HQNHOQ FPk0©QGXQJFPk)XgFP6FKZDU]}JXULJPLW URWHQXQGZHLgHQ'HWDLOV,QQHQHLQNOHLQHU7RQGRPLWNRQ]HQ WULVFKHQ.UHLVHQ$XgHQW”Q]HOQDXIEHLGHQ6HLWHQMH]ZHL6DW\UQ XPHLQHLQGHU0LWWHVLW]HQGH0”QDGH%LVDXIZLQ]LJH$ESODW ]XQJHQGHV*ODQ]WRQVLQWDNW u

3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQHU-DKUHQ $WWLFEODFN}JXUHEDQGFXS%&,QVLGHDVPDOOWRQGRZLWKFRQFHQWULF FLUFOHV2XWVLGHRQHDFKVLGHWZRVDW\UVPLQFLQJDURXQGDVLWWLQJPDHQDGLQ WKHFHQWUH([FHSWWLQ\FKLSSLQJVRIWKHEODFNJOD]HLQWDFW

29






 $WWLVFKH6FKDOHGHU/HD~HVV*UXSSHY&KU+FP %FPk0©QGXQJFPk)XgFP6FKZDU]}JXULJ PLWURWHQXQGZHLgHQ'HWDLOV,QQHQNOHLQHU7RQGRPLW6DW\U $XgHQ MHZHLOV HLQ )ULHV PLW ]ZHL VLW]HQGHQ *¤WWLQQHQ GLH .U”Q]H KDOWHQ 9RU LKQHQ 'LRQ\VRV PLW 5K\WRQ XQG +HUPHV PLW)O©JHOVFKXKHQ(LQSDDUNOHLQHREHU~”FKOLFKH$ESODW]XQJHQ VRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ(8%D\HUQLQ'HXWVFKODQGVHLWYRU $WWLFEODFN}JXUHFXSRIWKH/HD~HVV*URXS%&,QVLGHDPLQFLQJ VDW\URXWVLGHRQHDFKVLGHDIULH]HZLWKWZRVHDWHGJRGGHVVHVKROGLQJDZUHDWK EHIRUH'LRQ\VRVZLWKUK\WRQDQG+HUPHVZLWKZLQJHGVKRHV7LQ\VSOLQWHUVRI WKHVXUIDFHDUHPLVVLQJRWKHUZLVHLQWDFW

30

 $WWLVFKH 6FKDOH GHV 40DOHUV $QIDQJ  -K Y &KU + PLW +HQNHOQ FP XQG RKQH FP % PLW +HQNHOQ FP k 0©QGXQJFPk)XgFP5RW}JXULJH6FKDOHGHU)RUP %,QQHQJURgHU7RQGRPLW0”DQGHUGDULQQDFKUHFKWVODXIHQGHU 6DW\UPLW7K\UVRV$XIEHLGHQ6HLWHQMHZHLOVHLQ3DDUEHVWHKHQG DXVHLQHPQDFNWHP-©QJOLQJPLW'LVNXVXQGHLQHU0”QDGHPLW 7K\UVRV ,Q GHQ +HQNHO]RQHQ GUHLWHLOLJH 3DOPHWWHQRUQDPHQWH .OHLQH)HKOVWHOOHDP)XgVRZLH$EVSOLWWHUXQJHQDP%HFNHQUDQG VRQVWLQWDNWPLW5HVWHQYRQ6LQWHU u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU $WWLFUHG}JXUHFXSW\SH%RIWKH43DLQWHU :RUNVKRSRIWKH-HQD3DLQWHU  (DUO\WKFHQWXU\%&2QERWKVLGHVDFRXSOHRIDQDNHGDWKOHWHZLWKGLVNXV DQGDPDHQDGZLWKWK\UVRVEHWZHHQODUJHRUQDPHQWVZLWKSDOPHWWHVLQWKH KDQGOHDUHDV/LWWOHSDUWRIWKHIRRWDQGIHZWLQ\VSOLQWHUVRIWKHULPDUHPLVVLQJ RWKHUZLVHLQWDFWZLWKUHPDLQVRIVLQWHU








31




32


e Attischer Glockenkrater. /HW]WHV9LHU WHO  -K Y &KU + FP % PLW +HQNHOQ FP k .¤USHU FP k0©QGXQJFPk)XgFP 8QWHU GHU 0©QGXQJ HLQ URW}JXULJHU /RUEHHUIULHV VRQVW ©EHUZLHJHQG PLW *ODQ]WRQ ©EHU]RJHQ $XV JURgHQ )UDJPHQWHQ]XVDPPHQJHVHW]WNOHLQH )HKOVWHOOHQHUJ”Q]WXQGUHWXVFKLHUW u 3URYHQLHQ] (KHPDOV LQ GHU 6FKZHL]HU 6DPPOXQJ YRQ 'U &KULVWRSK /HRQ %DVHO I©UGLHVHHUZRUEHQLQGHQHU-DKUHQ $WWLFEHOONUDWHUZLWKUHG}JXUHODXUHOZUHDWK DQG EODFN JOD]H /DVW TXDUWHU WK FHQWXU\ %& 5HDVVHPEOHG IURP ODUJH IUDJPHQWV OLWWOHPLVVLQJSDUWVDUHPRGHUQO\DGGHGDQG UHWRXFKHG

e Apulische Pelike.  +”OIWH  -K Y &KU + FP k .¤USHU FP k 0©QGXQJ FP k )Xg FP .DQQH GHU *ODQ]WRQZDUH :HQLJH ZLQ]LJH$EVSOLWWHUXQJHQVLQGIDUEOLFK UHWXVFKLHUWVRQVWLQWDNW u



3URYHQLHQ] (KHPDOV 3ULYDWVDPPOXQJ 'U &KULVWRSK /HRQ %DVHO HUZRUEHQ LQ GHQ HU-DKUHQ =XU)RUPYJOGLH3HOLNHGHU8QWHUZHOW*UXSSH 1HDSHO 3ULYDWVDPPOXQJ - %RDUGPDQ 5RW}JXULJH 9DVHQ DXV 8QWHULWDOLHQ XQG 6L]LOLHQ(LQ+DQGEXFK  $EE $SXOLDQ EODFNJOD]H SHOLNH QG KDOI WK FHQWXU\%&)HZWLQ\FKLSSLQJVDUHUHWRXFKHG ZLWKFRORURWKHUZLVHLQWDFW

 Paestanischer Glockenkrater.  'ULW WHO  -K Y &KU + FP k .¤U SHU FP k 0©QGXQJ FP k )Xg FP *QDWKLDZDUH PLW EHLG VHLWLJ JHULW]WHQ 5DQNHQ XQG ZHLgHQ (IHXEO”WWHUQ XQG .RU\PEHQ VRZLH DXI HLQHU 6HLWH ]ZHL 6WHUQH GDUXQWHU Seltene Gnathiaware aus Paestum! Mit 7/$QDO\VH$P5DQGXQGLP,QQH UHQNOHLQH$EVSOLWWHUXQJHQ*ODQ]WRQ VWHOOHQZHLVHYHUULHEHQVRQVWLQWDNW u 3URYHQLHQ] (KHPDOV LQ GHU GHXWVFKHQ 3ULYDWVDPPOXQJ 'U ) . HUZRUEHQ  DXIGHPGHXWVFKHQ.XQVWPDUNW 5DUH3DHVWLDQEHOONUDWHURIWKH*QDWKLDZDUH ZLWKHQJUDYHGWHQGULOVDQGZKLWHSDLQWHGLY\ OHDYHVDVZHOODVWZRVWDUVEHORZRILWRQRQH VLGHQGWKLUGWKFHQWXU\%&7LQ\VSOLQWHUV DW WKH ULP DQG LQVLGH DUH ~DNHG RII EODFN JOD]H SDUWLDOO\ UXEEHG RII RWKHUZLVH LQWDFW :LWK7/DQDO\VLV



33




 %¤RWLVFKHU .DQWKDURV  -K Y &KU + PLW E]Z RKQH +HQNHO E]ZFP%PLW+HQNHOQFPk0©QGXQJFP k)XgFP*ODQ]WRQZDUHPLWJHULW]WHP'HNRUXQGZHLgHU %HPDOXQJ LQ )RUP YRQ (IHXUDQNHQ XQG UHWURJUDGHP 6)ULHV %HPDOXQJVWHOOHQZHLVHYHUULHEHQVRQVWLQWDNW u 3URYHQLHQ] ([ *RUQ\  0RVFK 0©QFKHQ $XNWLRQ   /RV  HKHPDOVLQGHU6DPPOXQJ$$0©QFKHQI©UGLHVH]ZLVFKHQXQG HUZRUEHQ %ODFNJOD]H NDQWKDURV ZLWK HQJUDYHG WHQGULO DQG ZKLWH SDLQWHG LY\OHDYHV %RHRWLDQWKFHQWXU\%&:KLWHFRORUSDUWLDOO\UXEEHGRIIRWKHUZLVHLQWDFW

 Apulische Oinochoe.  +”OIWH  Y &KU + FP k .¤USHU FP k 5LQJIXg FP .DQQH GHU )RUP  PLW *ODQ]WRQ %LVDXIZLQ]LJH)DUEDEVSOLWWHUXQJHQLQWDNWPLWJHULQJHQ6LQWHU UHVWHQ u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU $SXOLDQEODFNJOD]HGRLQRFKRHRIVKDSHQGKDOIWKFHQWXU\%&7LQ\ VSOLQWHUVRIWKHEODFNJOD]HDUH~DNHGRIIRWKHUZLVHLQWDFWZLWKIHZUHPDLQV RIVLQWHU

 Apulische Oinochoe. (QGHIU©KHV-KY&KU+FP k .¤USHU FP k 5LQJIXg FP .DQQH GHU )RUP  PLW *ODQ]WRQ XQG YHUWLHIWHQ 5LSSHQ :LQ]LJH $EVSOLWWHUXQJHQ DQ GHU0©QGXQJVRQVWLQKHUYRUUDJHQGHP=XVWDQG u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU $SXOLDQEODFNJOD]HGRLQRFKRHRIVKDSHZLWKULEEHGFRUSXV/DWHWKRU HDUO\UGFHQWXU\%&7LQ\VSOLQWHUVRIWKHPRXWKDUHPLVVLQJRWKHUZLVHLQ SHUIHFWFRQGLWLRQ

34



e Apulischer Kothon.  -K Y &KU + FP k .¤USHU FP %HFKHUPLW'RSSHOKHQNHOVRZLHJHULSSWHP.¤USHUGHU*ODQ] WRQZDUH,QWDNW u 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVDXV HLQHU6FKZHL]HU3ULYDWVDPPOXQJGHUHUELVHU-DKUH $SXOLDQEODFNJOD]HNRWKRQZLWKGRXEOHKDQGOHDQGULEEHGFRUSXVWKFHQWXU\ %&,QWDFW

 Kampanische Trinkschale. +”OIWH-KY&KU+RKQH+HQNHO FP%PLW+HQNHOFPkFPk)XgFP1LHGULJH 6FKDOH GHU *ODQ]WRQZDUH PLW 5LQJIXg XQG 6WHPSHOGHNRU LP ,QQHUHQ(LQ+HQNHOJHEURFKHQXQGZLHGHUDQJHVHW]WGDEHLHLQH NOHLQH$EVSOLWWHUXQJJHULQJH5HVWHYRQ6LQWHU u 3URYHQLHQ](KHPDOVLQGHU3ULYDWVDPPOXQJ6$7HUZRUEHQEHLGHU +HOLRV*DOOHU\/RQGRQLQ'HXWVFKODQGVHLW 6WHPOHVVFXSRIWKH&DPSDQLDQEODFNJOD]HZDUHZLWKVWDPSHGGHFRULQVLGH VWKDOIWKFHQWXU\%&2QHKDQGOHEURNHQDQGUHDWWDFKHGWKHUHE\WLQ\ VSOLQWHUPLVVLQJOLWWOHUHPDLQVRIVLQWHU








35






e Apulischer Teller.  -K Y &KU + FP k FP .OHLQHU 1DSIPLWNRQNDYHP,QQHUHQVRZLHJHULSSWHP5DQGGHU*ODQ] WRQZDUH,QWDNW u 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVDXV HLQHU6FKZHL]HU3ULYDWVDPPOXQJGHUHUELVHU-DKUH 6PDOO$SXOLDQEODFNJOD]HGLVKZLWKULEEHGULPWKFHQWXU\%&,QWDFW

e Apulischer Teller.  -K Y &KU + FP k FP .OHLQHU 1DSIPLWNRQNDYHP,QQHUHQVRZLHJHULSSWHP5DQGGHU*ODQ] WRQZDUH,QWDNW u 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVDXV HLQHU6FKZHL]HU3ULYDWVDPPOXQJGHUHUELVHU-DKUH 6PDOO$SXOLDQEODFNJOD]HGLVKZLWKULEEHGULPWKFHQWXU\%&,QWDFW

 Kampanischer Guttus. /HW]WH9LHUWHO-KY&KU+FP/ FPk.¤USHUFP*ODQ]WRQZDUHPLWJHULSSWHP&RUSXV XQG KRKHP $XVJXVV $XI GHP 5©FNHQ DOV SODVWLVFKHV 5HOLHI IURQWDOHU .RSI HLQHV 6LOHQV PLW (IHX.RU\PEHQ.UDQ] ,QWDNW PLW6LQWHUUHVWHQ u

36

3URYHQLHQ]([6DPPOXQJ*+DXFN6©GGHXWVFKODQGHUZRUEHQDXV HLQHUGHXWVFKHQ$OWVDPPOXQJGHVXQGIU©KHQ-KV &DPSDQLDQEODFNJOD]HJXWWXVZLWKULEEHGFRUSXVDQGORQJVSRXW/DVWTXDUWHU WKFHQWXU\%&$ERYHSODVWLFUHOLHIGHSLFWLQJWKHKHDGRIDVLOHQZLWKLY\ ZUHDWK,QWDFWZLWKUHPDLQVRIVLQWHU

 Griechischer Krater. 6S”WSURWRJHRPHWULVFK  +”OIWH  -K Y &KU+FP%PLW+HQNHOQFPk.¤USHUFPk 0©QGXQJFPk)XgFP0LVFKJHI”gPLW]ZHL'RSSHO KHQNHOQXQGVHLWOLFKHQ1RSSHQVRZLHGXQNHOEUDXQHU%HPDOXQJ %HLGVHLWLJLPPHKUIDFKJHUDKPWHQ%LOGIHOGNRQ]HQWULVFKH.UHL VHDXI6HLWH$VLHEHQXQGDXI6HLWH%I©QI6W©FN,PXQWHUHQ7HLO JHEURFKHQXQGZLHGHU]XVDPPHQJHVHW]WGDEHLNOHLQH$EVSOLW WHUXQJHQDP)Xg%HPDOXQJVWHOOHQZHLVHOHLFKWYHUULHEHQ'D]X HLQHVS”WU¤PLVFKH7RQODPSHXQGYLHU)UDJPHQWHYRQKHOOHQLVWL VFKHQ*HI”gHQ u 3URYHQLHQ]$XVGHUQRUGGHXWVFKHQ3ULYDWVDPPOXQJ++HUZRUEHQ DXVHLQHP1DFKODVVLQ'HXWVFKODQGVHLWPLQGHVWHQV *UHHNNUDWHUZLWKFRQFHQWULFFLUFOHV/DWH3URWRJHRPHWULF3HULRGQGKDOI WKFHQWXU\%&/RZHUSDUWEURNHQDQGUHDVVHPEOHGOLWWOHVSOLQWHUVRIWKH IRRWDUHPLVVLQJFRORUDUHVOLJKWO\UXEEHGRIIDWVHYHUDOVPDOOVSRWV3OXVD /DWH5RPDQFOD\ODPSDQGIRXUIUDJPHQWVRI+HOOHQLVWLFSRWWHU\






37




 .RULQWKLVFKH 2LQRFKRH GHV $QRGRV0DOHUV 0LWWHONRULQWKLVFK Y&KU+PLWPRGHUQHU(UJ”Q]XQJFPk.¤U SHUFPk5LQJIXgFP6FKZDU]}JXULJPLWURWHQXQGZHL gHQ'HWDLOV$XI.¤USHUXQG6FKXOWHUGUHLGXUFKIDUELJH%”QGHU JHWUHQQWH7LHUIULHVHPLWHLQHUP”QQOLFKHQ6LUHQH3DQWKHUQ=LH JHQE¤FNHQ+LUVFKN©KHQXQGHLQHP6FKZDQ$XV)UDJPHQWHQ ]XVDPPHQJHVHW]W7HLOHGHU6FKXOWHU+DOVXQG+HQNHOPRGHUQ NOHLQH5HWXVFKHQEHLGHU%HPDOXQJ u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU =XUWDWV”FKOLFKHQ)RUPGHV+DOVHVXQGGHU0©QGXQJVLHKH'$$P\[ &RULQWKLDQ9DVH3DLQWLQJRIWKH$UFKDLF3HULRG  7DI]XP0DOHU HEHQGD7DIDEVRZLH6 &RULQWKLDQEODFN}JXUHRLQRFKRHRIWKH$QRGRV3DLQWHU0LGGOH&RULQWKLDQ %&7KUHHIULH]HVZLWKDQLPDOVLQFOXGLQJDEHDUGHG6LUHQSDQWKHUV JRDWVKLQGVDQGDVZDQ5HDVVHPEOHGIURPIUDJPHQWVKDQGOHPRXWKQHFN DQGSDUWRIWKHVKRXOGHUDUHPRGHUQIHZUHWRXFKLQJVDWWKHSDLQWLQJ

 Ostgriechische Kleeblattoinochoe. 0LOHW    Y &KU + RKQHPLW+HQNHOFPk.¤USHUFPk5LQJIXg FP :LOG *RDW 6W\OH $XI GHU 6FKXOWHU VHLWOLFK HLQHV =ZHL JHV YLHU 7LHUH E]Z :HVHQ UHFKWV HUNHQQEDU HLQH 6SKLQ[ XQG HLQ”VHQGHU+LUVFK'DUXQWHU]ZHL5HLKHQYRQ/RWXVEO©WHQMit 7/$QDO\VH 0©QGXQJ YRUQH JHEURFKHQ REHU~”FKLJH $EVSOLW WHUXQJHQXQGXQWHUGHP+HQNHOHLQ/RFK%HPDOXQJWHLOZHLVH VW”UNHUEHULHEHQ u

FUHDWXUHVLGHQWL}DEOHRQWKHULJKWVLGHDVSKLQ[DQGDGHHU%HORZWZRIULH]HV ZLWKORWXVEXGV7RSRIWKHPRXWKLVEURNHQIHZVSOLQWHUVRIWKHVXUIDFHDUH PLVVLQJDKROHXQGHUWKHKDQGOHSDLQWLQJLVSDUWLDOO\UXEEHGRII:LWK7/ analysis!

 Korinthische Oinochoe. 0LWWHONRULQWKLVFK    Y &KU + FP k .¤USHU FP % 0©QGXQJ FP k 5LQJIXg FP .DQQH PLW .OHHEODWWP©QGXQJ XQG *ODQ]WRQ©EHU]XJ GDUDXI URWHU /LQLHQGHNRU 8QJHI”KU GLH +”OIWH GHU 0©QGXQJ IHKOWXQGLVWPRGHUQHUJ”Q]WVRQVWLQWDNW u 3URYHQLHQ](KHPDOVLQHLQHUGHXWVFKHQ6DPPOXQJI©UGLHVHLQGHQHU -DKUHHUZRUEHQ 3XEOL]LHUW.XQVWGHU$QWLNH$QFLHQW$UW*DOHULH*©QWHU3XK]H.DWDORJ 1U &RULQWKLDQ EODFNJOD]H WUHHIRLO RLQRFKRH ZLWK UHG OLQH GHFRU 0LGGOH &RULQWKLDQ    %& $ERXW WKH KDOI RI WKH PRXWK LV PLVVLQJ DQG PRGHUQRWKHUZLVHLQWDFW

e Korinthische Kotyle. 0LWWHOSURWRNRULQWKLVFKY&KU+ FP%PLW+HQNHOQFPk0©QGXQJFP6FKZDU] }JXULJ$XgHQ)ULHVPLWYLHUDXIGHP.RSIVWHKHQGHQ)LVFKHQ $XV )UDJPHQWHQ ]XVDPPHQJHVHW]W GDEHL NOHLQH $EVSOLWWHUXQ JHQ u

3URYHQLHQ]([6DPPOXQJ070©QFKHQVHLWGHQHU-DKUHQ

3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVDXV GHU6DPPOXQJ-HDQ$XG\  LQ)UDQNUHLFK

(DVW*UHHNWUHHIRLORLQRFKRHRIWKH:LOG*RDW6W\OH0LOHVLDQ %& 2Q WKH VKRXOGHU EHVLGH RI D EUDQFK VHYHUDO DQLPDOV RU P\WKRORJLFDO

%ODFN}JXUH0LGGOH3URWRFRULQWKLDQNRW\OHZLWKIRXU}VK%& 5HDVVHPEOHGIURPIUDJPHQWVIHZVSOLQWHUVDUHPLVVLQJ

38










39


40

40 Urne mit Helmdeckel. 9LOODQRYD    -K Y &KU + 8UQH FP +HOP FP k 8UQH FP % +HOP FP XQG kFP'XQNHOEUDXQHV,PSDVWRPLWHLQJHGU©FNWHP3XQNW XQG 6FKQXUGHNRU VRZLH JHULW]WHQ XQG JHSXQ]WHQ 2UQDPHQ WHQ %LNRQLVFKH HLQKHQNHOLJH 8UQH PLW 'HFNHO LQ )RUP HLQHV .DPPKHOPHV 0©QGXQJ WHLOZHLVH UHVWDXULHUW PLW UHWXVFKLHU WHQ(UJ”Q]XQJHQVRQVWELVDXINOHLQH$EVSOLWWHUXQJHQLQWDNW u 3URYHQLHQ]([3ULYDWVDPPOXQJ:)0©QFKHQVHLWYRU 9LOODQRYDELFRQLFDOXUQZLWKOLGLQIRUPRIDFUHVWHGKHOPHWWKWKFHQWXU\ %& 'DUN EURZQ LPSDVWR ZLWK LPSUHVVHG GRWV DQG OLQH GHFRU DV ZHOO DV LQFLVHGDQGVWDPSHGRUQDPHQWV0RXWKLVSDUWLDOO\UHVWRUHGZLWKIHZPRGHUQ UHWRXFKLQJVRWKHUZLVHH[FHSWRIIHZPLVVLQJVSOLQWHUVLQWDFW

41 %©JHONDQQH9LOODQRYD-KY&KU+PLW%©JHOFPXQG RKQH FP k .¤USHU FP 'XQNHOEUDXQHV ,PSDVWR PLW HLQJHGU©FNWHP 3XQNW XQG 6FKQXUGHNRU .OHLQH UHWXVFKLHUWH )HKOVWHOOH DQ GHU 0©QGXQJ VRQVW ELV DXI $EVSOLWWHUXQJHQ DP )XgLQVHKUJXWHP=XVWDQG u 3URYHQLHQ]([3ULYDWVDPPOXQJ:)0©QFKHQVHLWYRU 9LOODQRYDVWLUUXSMXJWKFHQWXU\%&'DUNEURZQLPSDVWRZLWKLPSUHVVHG GRWVDQGOLQHGHFRU5HWRXFKLQJIRUDOLWWOHPLVVLQJSDUWRIWKHPRXWKRWKHUZLVH H[FHSWRIIHZPLVVLQJVSOLQWHUVDWWKHIRRWLQWDFW

41

3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU (DUO\(WUXVFDQULQJDVNRVZLWKGRXEOHVSRXWRQHRILWZLWKVLHYHPDGHRIGDUN EURZQLPSDVWRZLWKLPSUHVVHGOLQHGHFRUQGKDOIWKFHQWXU\%&2QHVSRXW LVEURNHQDQGUHDWWDFKHGVHYHUDOFUDFNVLQWKHFRUSXV

 )U©KHWUXVNLVFKH.HJHOKDOVNDQQH+”OIWHELVIU©KHV-KY &KU+FPk.¤USHUFP'XQNHOEUDXQHV,PSDVWRPLW 'RSSHOKHQNHO VRZLH HLQJHGU©FNWHP 6FKQXUGHNRU XQG SODVWL VFKHQ5LSSHQ$QGHU0©QGXQJVFKQDEHOI¤UPLJHU$XIVDW]PLW 6LHEIXQNWLRQ)DQWDVWLVFKHV6W©FN.OHLQHVUHWXVFKLHUWHV/RFKLP 5LSSHQEHUHLFKVRQVWKHUYRUUDJHQGHU=XVWDQG u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU (DUO\(WUXVFDQMXJPDGHRIGDUNEURZQLPSDVWRZLWKGRXEOHKDQGOHDVZHOO DVZLWKLPSUHVVHGOLQHGHFRUDQGSODVWLFULEVRQWKHFRUSXV$WWKHPRXWK DQ DWWDFKPHQW ZLWK VLHYH QG KDOI WK WR HDUO\ WK FHQWXU\ %& /LWWOH UHWRXFKHG KROH DW WKH FRUSXV RWKHUZLVH LQ H[FHOOHQW FRQGLWLRQMarvelous piece!

44 )U©KHWUXVNLVFKH 2OSH  +”OIWH  ELV IU©KHV  -K Y &KU + FPk.¤USHUFP'XQNHOEUDXQHV,PSDVWRPLWHLQJH GU©FNWHP6FKQXUGHNRUXQGWRUGLHUWHP+HQNHO$XV)UDJPHQWHQ ]XVDPPHQJHVHW]WYROOVW”QGLJ u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU

 )U©KHWUXVNLVFKHU5LQJDVNRV+”OIWH-KY&KU+FP% FPk.¤USHUFP5XQGHV*HI”gPLWGRSSHOWHP$XV JXVVHLQHUGDYRQPLW6LHEIXQNWLRQDXVGXQNHOEUDXQHP,PSDVWR PLW HLQJHGU©FNWHP 6FKQXUGHNRU (LQ $XVJXVV JHEURFKHQ XQG ZLHGHUDQJHVHW]WPHKUHUH5LVVH u

40

(DUO\(WUXVFDQROSHRIGDUNEURZQLPSDVWRZLWKLPSUHVVHGOLQHGHFRUDQG DWZLVWHGKDQGOHQGKDOIWKWRHDUO\WKFHQWXU\%&5HDVVHPEOHGIURP IUDJPHQWVFRPSOHWH






44

41


45



45 )U©KHWUXVNLVFKH .HJHOKDOVNDQQH  +”OIWH  ELV IU©KHV  -K Y &KU + FP k .¤USHU FP %UDXQHV ,PSDVWR PLW HLQJHGU©FNWHP6FKQXUGHNRUXQGJHVWHPSHOWHQ.UHLVHQ.OHLQH $EVSOLWWHUXQJ DQ GHU 0©QGXQJ LP %RGHQEHUHLFK HLQ SDDU 5LVVH u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU (DUO\(WUXVFDQMXJPDGHRIEURZQLPSDVWRZLWKLPSUHVVHGOLQHGHFRUDQG VWDPSHGFLUFOHVQGKDOIWKWRHDUO\WKFHQWXU\%&/LWWOHVSOLQWHURIWKH PRXWKLVPLVVLQJIHZFUDFNVDWWKHERWWRP

 )U©KHWUXVNLVFKH $PSKRUD  +”OIWH ELV 0LWWH  -K Y &KU + FP k .¤USHU FP %UDXQHV ,PSDVWR PLW 'HNRU DXV SODVWLVFKHQ /LQLHQ ,Q +DOV XQG 6FKXOWHU PHKUHUH 5LVVH VRQVW LQWDNW u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU (DUO\(WUXVFDQDPSKRUDPDGHRIEURZQLPSDVWRZLWKSODVWLFGHFRUVWKDOI WRPLGGOHRIWKHWKFHQWXU\%&)HZFUDFNVLQQHFNDQGVKRXOGHURWKHUZLVH LQWDFW

 )U©KHWUXVNLVFKH $PSKRUD  +”OIWH ELV 0LWWH  -K Y &KU + FPk.¤USHUFP%UDXQHV,PSDVWRPLWHLQJHGU©FNWHP 6FKQXUGHNRU XQG SODVWLVFKHQ /LQLHQ .OHLQH $EVSOLWWHUXQJ DQ GHU0©QGXQJVRQVWLQWDNW u 3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU 

42

(DUO\(WUXVFDQDPSKRUDPDGHRIEURZQLPSDVWRZLWKLPSUHVVHGOLQHVDQG SODVWLFGHFRUVWKDOIWRPLGGOHRIWKHWKFHQWXU\%&/LWWOHVSOLQWHURIWKH PRXWKLVPLVVLQJRWKHUZLVHLQWDFW




 )U©KHWUXVNLVFKH $PSKRUD  +”OIWH  -K Y &KU + FP k .¤USHU FP 'XQNHOEUDXQHV ,PSDVWR PLW QHJDWLYHP 5LSSHQGHNRU $Q +DOV XQG HLQHP +HQNHO UHWXVFKLHUWH 5H VWDXULHUXQJHQ u 3URYHQLHQ](KHPDOVGHXWVFKH3ULYDWVDPPOXQJ6HUZRUEHQLPGHXWVFKHQ .XQVWKDQGHOLQGHQHU-DKUHQ (DUO\(WUXVFDQULEEHGDPSKRUDPDGHRIGDUNEURZQLPSDVWRVWKDOIWK FHQWXU\%&5HWRXFKHGUHVWDXUDWLRQVDWQHFNDQGRQHKDQGOH

49 Etruskische Kleeblattkanne. Y&KU+FPk.¤U SHUFP%XFFKHURVRWWLOHPLWIHLQHP6WLFKHOXQG5LW]GHNRU ,QWDNWPLW6LQWHUUHVWHQ u 3URYHQLHQ](KHPDOVLQGHUGHXWVFKHQ3ULYDWVDPPOXQJ'U).HUZRUEHQ I©UGLHVHYRQ:: (WUXVFDQWUHHIRLOMXJPDGHRIEXFFKHURVRWWLOHZLWKGRWWHGDQGHQJUDYHGGHFRU %&,QWDFWZLWKUHPDLQVRIVLQWHU

49

43


50

50 • Stülpdeckelpyxis. +HOOHQLVWLVFK-KY&KU+JHVDPWFP k .¤USHU FP 3\[LV PLW NRQLVFKHP .¤USHU XQG SUR}OLHU WHP)XgGHU)RUP%PLWU¤KUHQI¤UPLJHP'HFNHO+HOOEUDXQHU 7RQPLWEUDXQHPEHU]XJ$XIGHP'HFNHONOHLQHU7RQGRPLW SODVWLVFKHU)UDXHQE©VWH]ZLVFKHQ]ZHL(URWHQGDUXPPLWKHOO EUDXQHU)DUEHHLQ(LHUVWDE=ZHLZLQ]LJH$EVSOLWWHUXQJHQVRQVW LQWDNW u 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVYRU I©UGLHGHXWVFKH3ULYDWVDPPOXQJ$WHQDVRYHUZRUEHQ +HOOHQVWLFS\[LVZLWKOLGRIWKHIRUP%UGFHQWXU\%&%ULJKWEURZQFOD\ ZLWKGDUNEURZQVOLS2QWKHOLGDVPDOOWRQGRZLWKSODVWLFEXVWRIDZRPDQ EHWZHHQWZRFXSLGVDURXQGLQEULJKWEURZQSDLQWLQJHJJDQGGDUW7ZRWLQ\ VSOLQWHUVDUHPLVVLQJRWKHUZLVHLQWDFW

50

51 5HOLHIEHFKHUVRJ0HJDULVFKHU%HFKHU+HOOHQLVWLVFK    -K Y&KU+FPk.¤USHUFP5RWEUDXQHU7RQPLWGXQNHO EUDXQHPEHU]XJ)RUPJHW¤SIHUW$XIGHU8QWHUVHLWHHLQH5R VHWWHGDU©EHU$NDQWKXVXQGDEVFKOLHgHQG(LHUVWDE2EHU~”FKH DP5DQGVWHOOHQZHLVHYHUULHEHQVRQVWLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ ( ) 5KHLQODQG3IDO] HUZRUEHQ  EHLP .¤OQHU0©Q]NDELQHWW7\OO.URKD 6RFDOOHG0HJDULDQERZOZLWKURVHWWHDFDQWKXVDQGHJJDQGGDUW+HOOHQLVWLF QG  VW FHQWXU\ %& 6XUIDFH SDUWLDOO\ UXEEHG RII DW WKH ULP RWKHUZLVH LQWDFW

 5¤PLVFKH7HUUD6LJLOODWD)ODVFKHDXVGHU:HUNVWDWWGHV1DYLJLXV $IULFD 3URFRQVXODULV    Q &KU + FP k .¤USHU FP )RUPJHW¤SIHUWH )ODVFKH YRP 7\SXV  VRJ $IULFDQ 5HG6OLS:DUHDXVGHU:HUNVWDWWGHV1DYLJLXV$XIGHU6FKXO WHU(;2),&,1$1$9,*,6HLWH$,QGHU0LWWH0DUVOLQNV 6DW\UXQG6LOHQUHFKWV9LNWRULD9HQXVODJHUQGHU)OXVVJRWWXQG %DFFKDQWLQ XQWHQ KDOWHQ ]ZHL (URWHQ HLQHQ +HOP 6HLWH % ,Q GHU0LWWHVFKO”JWGHUVLW]HQGH2USKHXVGLH/HLHUOLQNV6LOHQXQG 0HUNXU UHFKWV 9LNWRULD XQG 6\PSOHJPD XQWHQ VW©W]HQ ]ZHL 6DW\UQ GHQ MXJHQGOLFKHQ %DFFKXV 0LW 7/$QDO\VH XQG .RSLH GHU5HFKQXQJ(LQ+HQNHOJHEURFKHQ6SUXQJLP.¤USHU u 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVDXV GHUGHXWVFKHQ6DPPOXQJ(%H[6DPPOXQJ'U:LHGQHUHUZRUEHQLP 6HSWHPEHUEHL1XPLVPDWLF $QFLHQW$UW*DOOHU\=©ULFK =X GHU :HUNVWDWW GHV 1DYLJLXV V 0 )OHFNHU (; 2),&,1$ 1$9,*, 'LH:HUNVWDWWGHV1DYLJLXVLQ+HQFKLUHV6ULUD =HQWUDOWXQHVLHQ .¤OQHU -DKUE©FKHU   6  9JO LQVEHVRQGHUV ]X GHU 'HXWXQJ GHU %LOGHU 3 & %RO +UVJ  6S”WDQWLNH XQG IU©KHV &KULVWHQWXP $XVVWHOOXQJ )UDQNIXUW D 0   6  I .DW  - *DUEVFK  % 2YHUEHFN 6S”WDQWLNH ]ZLVFKHQ +HLGHQWXP XQG &KULVWHQWXP $XVVWHOOXQJ 0©QFKHQ  6I.DW 5RPDQPRXOGPDGHUHOLHIERWWOHRIW\SH7HUUDVLJLOODWD$IULFDQ5HG6OLS ZDUHRIWKHZRUNVKRSRI1DYLJLXV$IULFDSURFRQVXODULV$'6LGH $0DUVEHWZHHQ9HQXVDULYHUJRG9LFWRU\DQGWKH'LRQ\VLDFHQWRXUDJH 6LGH%2USKHXVVXUURXQGHGE\D6LOHQRV0HUFXU\DQG9LFWRU\EHORZWZR VDW\UVVXSSRUWWKHGUXQNHQ%DFFKXVDQGDQHURWLFVFHQH2QHKDQGOHLVPLVVLQJ FUDFNLQWKHFRUSXV:LWK7/DQDO\VLVDQGFRS\RIWKHLQYRLFHIURP

51

44






45








46




 *URgHU5¤PLVFKHU7HUUD6LJLOODWD7HOOHU$UH]]RFODXGLVFK Q&KU+FPkFPk)XgFP&RQVSHFWXV $XgHQDSSOL]LHUWHU'HNRU]ZHL*LUODQGHQDQ:HLQODXEGD]ZL VFKHQ YLHU 7”Q]HULQQHQ PLW .URWDOHQ XQG GUHL PLW ZHKHQGHP *HZDQG VRZLH HLQ .LWKDUD VSLHOHQGHU (URV ,QQHQ DEJHGUHKWH NRQ]HQWULVFKH .UHLVH GD]ZLVFKHQ 5”GFKHQGHNRU =HQWUDO HLQ :HUNVWDWWVWHPSHOLQ6DQGDOHQIRUPPLW01(Mit Kopien der 5HFKQXQJ XQG HLQHV =HUWL}NDWHV GHU *DOHULH VRZLH /LWHUDWXU ]X dem Stempel! (LQJURgHV)UDJPHQWZLHGHUDQJHVHW]W]ZHL(U J”Q]XQJHQDP5DQG u



3URYHQLHQ]%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVDXV GHU6DPPOXQJ5%%D\HUQLP1RYHPEHUEHL$UHWH*DOHULHI©U DQWLNH.XQVW=©ULFKHUZRUEHQ 'HQ6WHPSHO01(NDQQPDQDOV$0DQQHLXVDX~¤VHQ'DEHLKDQGHOWHV VLFKZRKOXPGHQDUUHWLQLVFKHQ7¤SIHUHLEHVLW]HU$0DQQHLXV.DSHOOD &RUSXV 9DVRUXP$UUHWLQRUXP  /DUJH 5RPDQ WHUUD VLJLOODWD SODWH &RQVSHFWXV   $UH]]R WLPH RI WKH HPSHURU&ODXGLXV$'2XWVLGHDSSOLHGGHFRUEHWZHHQWZRJDUODQGV ZLWKYLQHOHDYHVVHYHQIHPDOHGDQFHUVIRXURIWKHPZLWKNURWDOHVDQGDQ(URV ZLWKFLWKDUD,QVLGHDVWDPSLQIRUPRIDVDQGDOZLWK01(ZKLFKVKRZV WKDWWKHSODWHKDVEHHQSURGXFHGE\WKHZRUNVKRSRI$0DQQHLXV.DSHOOD 2QHODUJHIUDJPHQWLVEURNHQDQGUHDWWDFKHGWZRPLVVLQJSLHFHVRIWKHULP DUHUHWRXFKHG:LWKFRSLHVRIWKHLQYRLFHDQGFHUWL}FDWHSOXVDUHIHUHQFH for the stamp!

54 *URgHU7HUUD1LJUD%HFKHU5¤PLVFKFD-KQ&KU+FP k.¤USHUFPk0©QGXQJFP%HOJLVFKH:DUHPLW5LO OHQXQG5”GFKHQGHNRU6FKZDU]HUEHU]XJDQZHQLJHQNOHLQHQ 6WHOOHQYHUULHEHQVRQVWLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ ( ) 5KHLQODQG3IDO] HUZRUEHQ  EHL $QWLTXLW”WHQ*=XPHU:ROIVKHLP /DUJH5RPDQ7HUUD1LJUDMDUZLWKVFUROOHGGHFRURIWKH%HOJLDQZDUH$ERXW QGFHQWXU\$'%ODFNVOLSDWIHZOLWWOHVSRWVDUHPLVVLQJRWKHUZLVHLQWDFW

54

47


55 Griechische Transportamphora MGS 6. 0DJQD*UDHFLD-KY&KU+FPXQGPLW 6W”QGHUFP+HOOEUDXQHU7RQ0LW6W”QGHU,QWDNWPLWVFK¤QHP0HHUHVEHZXFKV u 3URYHQLHQ] $XV HLQHU 3ULYDWVDPPOXQJ LQ 1RUGUKHLQ:HVWIDOHQ I©U GLHVH HUZRUEHQ EHL $GROI %XFK 1RUGUKHLQ:HVWIDOHQYRQGLHVHPLQ6XFXUDM.URDWLHQJHNDXIWXQGPLWHLQHURI}]LHOOHQ*HQHKPLJXQJ DXVJHI©KUW .RSLHYRUOLHJHQG  *UHHNWUDQVSRUWDPSKRUD0*60DJQD*UDHFLDUGQGFHQWXU\%&/LJKWEURZQFOD\,QWDFWZLWK QLFHVHDLQFUXVWDWLRQVWith stand!

 5¤PLVFKH7UDQVSRUWDPSKRUD'UHVVHO&,WDOLHQW\UUKHQLVFKH.©VWH-KY&KU+ FPXQGPLW6W”QGHUFP+HOOEUDXQHU7RQ0LW6W”QGHU)UDJPHQWHGHU0©Q GXQJJHEURFKHQXQGZLHGHUDQJHVHW]WDP+DOVJHUHLQLJWVRQVWPLW0HHUHVEHZXFKV u 3URYHQLHQ] $XV HLQHU 3ULYDWVDPPOXQJ LQ 1RUGUKHLQ:HVWIDOHQ I©U GLHVH HUZRUEHQ EHL $GROI %XFK 1RUGUKHLQ:HVWIDOHQYRQGLHVHPLQ6XFXUDM.URDWLHQJHNDXIWXQGPLWHLQHURI}]LHOOHQ*HQHKPLJXQJ DXVJHI©KUW .RSLHYRUOLHJHQG  5RPDQWUDQVSRUWDPSKRUD'UHVVHO&,WDO\7\UUKHQLDQFRDVWQGVWFHQWXU\%&/LJKWEURZQFOD\ )UDJPHQWVRIWKHPRXWKDUHEURNHQDQGUHDVVHPEOHGQHFNLVFOHDQHGRWKHUZLVHZLWKVHDLQFUXVWDWLRQV With stand!

 5¤PLVFKH7UDQVSRUWDPSKRUD9DULDQWHGHV7\SXV%ULQGLVL,WDOLVFKH$GULDN©VWH-KY &KU + FP XQG PLW 6W”QGHU FP +HOOEUDXQHP 7RQ 0LW 6W”QGHU ,QWDNW PLW VFK¤QHP0HHUHVEHZXFKV u

55

3URYHQLHQ] $XV HLQHU 3ULYDWVDPPOXQJ LQ 1RUGUKHLQ:HVWIDOHQ I©U GLHVH HUZRUEHQ EHL $GROI %XFK 1RUGUKHLQ:HVWIDOHQYRQGLHVHPLQ6XFXUDM.URDWLHQJHNDXIWXQGPLWHLQHURI}]LHOOHQ*HQHKPLJXQJ DXVJHI©KUW .RSLHYRUOLHJHQG  5RPDQWUDQVSRUWDPSKRUDRIWKHW\SH%ULQGLVLOLNHZLWKIXQQHOQHFN$GULDWLFFRDVWRI,WDO\VWFHQWXU\ %&/LJKWEURZQFOD\,QWDFWZLWKQLFHVHDLQFUXVWDWLRQVWith stand!

 5¤PLVFKH7UDQVSRUWDPSKRUD'UHVVHO9HVXYLDQD,WDOLVFK(QGH-KY&KU$QIDQJ  -K Q &KU + FP 5RWEUDXQHU 7RQ 0LW VFK¤QHP 6W”QGHU *HUHLQLJW XQG DXV JURgHQ)UDJPHQWHQ]XVDPPHQJHVHW]W u 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[3ULYDWVDPPOXQJ/: VHLWLQ%D\HUQ 5RPDQWUDQVSRUWDPSKRUD'UHVVHOYHVXYLDQD,WDOLDQODWHVWFHQWXU\%&HDUO\VWFHQWXU\$' $XEXUQFOD\&OHDQHGDQGIURPELJIUDJPHQWVUHDVVHPEOHGWith nice stand!

59 5¤PLVFKH 7UDQVSRUWDPSKRUD 'UHVVHO  %HOWU’Q ,,$  %DHWLFD    -K Q &KU + FPXQGPLW6W”QGHUFP+HOOEUDXQHU7RQ0LW6W”QGHU.OHLQH$EVSOLWWHUQJHQ DQ0©QGXQJXQG)XgWHLOZHLVHJHUHLQLJWWHLOZHLVHPLW0HHUHVEHZXFKV u 3URYHQLHQ] $XV HLQHU 3ULYDWVDPPOXQJ LQ 1RUGUKHLQ:HVWIDOHQ I©U GLHVH HUZRUEHQ EHL $GROI %XFK 1RUGUKHLQ:HVWIDOHQYRQGLHVHPLQ6XFXUDM.URDWLHQJHNDXIWXQGPLWHLQHURI}]LHOOHQ*HQHKPLJXQJ DXVJHI©KUW .RSLHYRUOLHJHQG  5RPDQWUDQVSRUWDPSKRUD'UHVVHO %HOWU’Q,,$ %HWLFDVWQGFHQWXU\$'/LJKWEURZQFOD\/LWWOH VSOLQWHUVRIPRXWKDQGIRRWDUHPLVVLQJSDUWLDOO\FOHDQHGRWKHUZLVHZLWKVHDLQFUXVWDWLRQVWith stand!

 5¤PLVFKH 7UDQVSRUWDPSKRUD 'UHVVHO  %HOWU’Q ,,$  %DHWLFD    -K Q &KU + FP %UDXQHU 7RQ $XV JURgHQ )UDJPHQWHQ ]XVDPPHQJHVHW]W %UXFKNDQWHQ UHWXVFKLHUW5HVWHYRQ0HHUHVEHZXFKV u 3URYHQLHQ] $XV HLQHU 3ULYDWVDPPOXQJ LQ 1RUGUKHLQ:HVWIDOHQ I©U GLHVH HUZRUEHQ EHL $GROI %XFK 1RUGUKHLQ:HVWIDOHQYRQGLHVHPLQ6XFXUDM.URDWLHQJHNDXIWXQGPLWHLQHURI}]LHOOHQ*HQHKPLJXQJ DXVJHI©KUW .RSLHYRUOLHJHQG  5RPDQWUDQVSRUWDPSKRUD'UHVVHO %HOWU’Q,,$ %HWLFDVWQGFHQWXU\$'%URZQFOD\5HDVVHPEOHG IURPODUJHIUDJPHQWVFUDFNVDUHUHWRXFKHGUHPDLQVRIVHDLQFUXVWDWLRQV 

48






59



49






 5¤PLVFKH7UDQVSRUWDPSKRUD'UHVVHO,WDOLHQW\UUKHQLVFKH.© VWH-KQ&KU+FPXQGPLW6W”QGHUFP5RWEUDXQHU 7RQ 0LW 6W”QGHU $XV JURgHQ )UDJPHQWHQ ]XVDPPHQJHVHW]W %UXFKNDQWHQ UHWXVFKLHUW DQ HLQHU 6FKXOWHU XQG DP )Xg JHUHL QLJWVRQVWPLW5HVWHQYRQ0HHUHVEHZXFKV u 3URYHQLHQ] $XV HLQHU 3ULYDWVDPPOXQJ LQ 1RUGUKHLQ:HVWIDOHQ I©U GLHVH HUZRUEHQEHL$GROI%XFK1RUGUKHLQ:HVWIDOHQYRQGLHVHPLQ6XFXUDM .URDWLHQJHNDXIWXQGPLWHLQHURI}]LHOOHQ*HQHKPLJXQJDXVJHI©KUW .RSLH YRUOLHJHQG  5RPDQ WUDQVSRUW DPSKRUD 'UHVVHO  ,WDO\ 7\UUKHQLDQ FRDVW VW  QG FHQWXU\$'5HGGLVKEURZQFOD\5HDWWDFKHGIURPODUJHIUDJPHQWVFUDFNV DUHUHWRXFKHGFOHDQHGDWRQHVKRXOGHUDQGIRRWRWKHUZLVHZLWKUHPDLQVRI VHDLQFUXVWDWLRQVWith stand!

 6S”WUKRGLVFKH 7UDQVSRUWDPSKRUD &DPXORGXQXP  5¤PLVFKH .DLVHU]HLW 5KRGRV    -K Q &KU + FP +HOOEUDXQHU 7RQ)UDJPHQWHDXIHLQHU6HLWHJHEURFKHQXQGZLHGHUDQJHVHW]W %UXFKNDQWHQUHWXVFKLHUW5HVWHYRQ0HHUHVEHZXFKV u

50



3URYHQLHQ] $XV HLQHU 3ULYDWVDPPOXQJ LQ 1RUGUKHLQ:HVWIDOHQ I©U GLHVH HUZRUEHQEHL$GROI%XFK1RUGUKHLQ:HVWIDOHQYRQGLHVHPLQ6XFXUDM .URDWLHQJHNDXIWXQGPLWHLQHURI}]LHOOHQ*HQHKPLJXQJDXVJHI©KUW .RSLH YRUOLHJHQG  /DWH 5KRGLDQ WUDQVSRUW DPSKRUD &DPXORGXQXP  5RPDQ ,PSHULDO 3HULRG5KRGRVVWQGFHQWXU\$'/LJKWEURZQFOD\2QRQHVLGHVHYHUDO IUDJPHQWVDUHEURNHQDQGUHDWWDFKHGFUDFNVDUHUHWRXFKHGUHPDLQVRIVHD LQFUXVWDWLRQV

 6S”WU¤PLVFKH 7UDQVSRUWDPSKRUD .HD\ ;;9 1RUGDIULND    -KQ&KU+FP5RWEUDXQHU7RQ.OHLQHREHU~”FKOLFKH $EVSOLWWHUXQJHQ VRQVW LQWDNW WHLOZHLVH JHUHLQLJW WHLOZHLVH PLW 0HHUHVEHZXFKV u 3URYHQLHQ] $XV HLQHU 3ULYDWVDPPOXQJ LQ 1RUGUKHLQ:HVWIDOHQ I©U GLHVH HUZRUEHQEHL$GROI%XFK1RUGUKHLQ:HVWIDOHQYRQGLHVHPLQ6XFXUDM .URDWLHQJHNDXIWXQGPLWHLQHURI}]LHOOHQ*HQHKPLJXQJDXVJHI©KUW .RSLH YRUOLHJHQG  /DWH5RPDQWUDQVSRUWDPSKRUD.HD\;;91RUWK$IULFDWKWKFHQWXU\ $'5HGGLVKEURZQFOD\/LWWOHVSOLQWHUVDWWKHVXUIDFHDUHPLVVLQJRWKHUZLVH LQWDFWSDUWLDOO\FOHDQHGRWKHUZLVHZLWKVHDLQFUXVWDWLRQV


7(55$.277$

 -XQJH 'DPH PLW (IHXNUDQ] LP 0DQ tel. 0DJQD*UDHFLD-KY&KU +FP+HOOEUDXQHUOHLFKWJU©QOL FKHU7RQNOHLQH5HVWHZHLgHU(QJR EHVRZLHEHVRQGHUVLP+DDUXQGDP .UDQ] 5HVWH URWEUDXQHU XQG EODXHU )DUEH 0DWUL]HQJHIRUPW PLW .DOWDU EHLW 5©FNZ”UWLJ HLQ %UHQQORFK (LQ (IHXEODWWIHKOWVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ(8%D\HUQLQ 'HXWVFKODQGVHLWYRU 7HUUDFRWWDRIDGUDSHG\RXQJODG\ZLWKLY\ ZUHDWK0DJQD*UDHFLDUGQGFHQWXU\ %&/LJKWEURZQWHUUDFRWWDZLWKUHPDLQVRI white engobe and reddish brown and blue FRORU2QHLY\OHDILVPLVVLQJRWKHUZLVHLQWDFW

51






 )UDXLP0DQWHO0DJQD*UDHFLD-KY&KU+FP+HOO EUDXQHU OHLFKW JU©QOLFKHU 7RQ JHULQJH 5HVWH ZHLgHU (QJREH 0DWUL]HQJHIRUPW PLW .DOWDUEHLW ,P +DOV JHEURFKHQ XQG JH NOHEWVRQVWLQWDNW u

 Jüngling mit Phiale. 0DJQD *UDHFLD  -K Y &KU + FP 5¤WOLFKHU 7RQ 0DWUL]HQJHIRUPW PLW .DOWDUEHLW -©QJOLQJ PLW .UDQ]XQG3KLDOHLQ&KLWRQXQG+LPDWLRQ5©FNZ”UWLJ%UHQQ ORFK,P+DOVXQGDQGHU%DVLVJHEURFKHQXQGJHNOHEW u

3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU

3URYHQLHQ]$XVGHU6DPPOXQJ5.+HVVHQHUZRUEHQYRU 9JO:+DPGRUI)/HLWPHLU'LH}J©UOLFKHQ7HUUDNRWWHQGHU6WDDWOLFKHQ $QWLNHQVDPPOXQJHQ0©QFKHQ%DQG  6(

7HUUDFRWWD RI D GUDSHG ZRPDQ 0DJQD *UDHFLD WK FHQWXU\ %& /LJKW EURZQWHUUDFRWWDZLWKVPDOOUHPDLQVRIZKLWHHQJREH%URNHQDWWKHQHFN DQGUHDWWDFKHGRWKHUZLVHLQWDFW

 9HQXV5¤PLVFKH.DLVHU]HLW(QGH$QIDQJ-KQ&KU+ FP +HOOURWHU 7RQ $XI HLQHP SUR}OLHUWHQ KDOEUXQGHQ 3R GHVW VWHKHQGH ZHLEOLFKH )LJXU GLH IURQWDO LKUHQ QDFNWHQ .¤U SHUSU”VHQWLHUW'LH*¤WWLQK”OWLQGHUHUKREHQHQ5HFKWHQGHQ %DXVFK LKUHV 0DQWHOV GHU 8I¤PLJ KHUDEIDOOHQG LKUHQ .¤USHU UDKPW'LHJHVHQNWH/LQNHVW©W]WVLFKDXIHLQYRQ*HZDQGIDOWHQ YHUK©OOWHV2EMHNW/LQNVHLQVHQNUHFKWDEVWHLJHQGHU'HO}Q'LH DXIZ”QGLJH)ULVXUHQWVSULFKWGHUVHYHULVFKHQ0RGH5©FNVHLWH QLFKWDXVJHDUEHLWHW$XVJURgHQ)UDJPHQWHQZLHGHU]XVDPPHQ JHVHW]WDEHUNRPSOHWW u 3URYHQLHQ]([6DPPOXQJ(8%D\HUQLQ'HXWVFKODQGVHLWYRU 7HUUDFRWWD}JXULQHRI9HQXVZLWK6HYHUDQKDLUVW\OH5RPDQ,PSHULDO3HULRG ODWHQGHDUO\UGFHQWXU\$'5HDVVHPEOHGIURPODUJHIUDJPHQWVEXW FRPSOHWH

52

7HUUDFRWWDRIDGUDSHG\RXWKZLWKZUHDWKDQGSKLDOH0DJQD*UDHFLDUG FHQWXU\%&5HGGLVKWHUUDFRWWD%URNHQDWQHFNDQGEDVHDQGUHDWWDFKHG

 3WROHP”LVFKH ,VLV$SKURGLWH 1RUGDIULND    -K Y &KU + FP5RWHU7RQPLWEUDXQURWHPEHU]XJ'LHQDFNWH*¤WWLQ PLW FKDUDNWHULVWLVFKHQ ,VLVORFNHQ XQG HQJDQOLHJHQGHQ $UPHQ EHU]XJPLW6SU©QJHQXQGLP8QWHUWHLODEJHVSOLWWHUW u 3URYHQLHQ]([6DPPOXQJ+-6+HVVHQH[*RUQ\ 0RVFK0©QFKHQ $XNWLRQ/RVH[6DPPOXQJ*1VHLW0LWWHGHUHU-DKUH GDYRU1DFKODVV(:1RUGUKHLQ:HVWIDOHQLQ'HXWVFKODQGVHLWYRU 3WROHPDLF,VLV$SKURGLWHUGQGFHQWXU\%&6OLSZLWK}VVXUHVDQGFKLSSHG RIIDWWKHERWWRPSDUW






 Jüngling mit Petasos, Hahn und Schultermantel. %¤RWLHQ  +”OIWH-KY&KU+FP5¤WOLFKHUJHPDJHUWHU7RQPLW NOHLQHQ 5HVWHQ ZHLgHU (QJREH 0DWUL]HQJHIRUPW 5©FNZ”UWLJ JURgHVYLHUHFNLJHV%UHQQORFK:LQ]LJHREHU~”FKLJH$ESODW]XQ JHQNOHLQH)HKOVWHOOHU©FNZ”UWLJDQGHU%DVLV u 3URYHQLHQ]$XVGHP1DFKODVVYRQ+HLQULFKYRQ=©JHOLQ'HXWVFKODQGVHLW YRU +HLQULFKYRQ=©JHO JHELPVFKZ”ELVFKIU”QNLVFKHQ0XUUKDUGWJHVW LQ0©QFKHQ ZDUHLQEHGHXWHQGHUGHXWVFKHU,PSUHVVLRQLVWGHUYRUDOOHQ 'LQJHQI©UVHLQH7LHUGDUVWHOOXQJHQEHNDQQWZDU6HLW3URIHVVRUDQGHU 0©QFKQHU.XQVWDNDGHPLHZXUGHHUGXUFKGDVED\HULVFKH.¤QLJVKDXV JHDGHOW(UZDUHLQ*U©QGXQJVPLWJOLHGGHU0©QFKQHU6H]HVVLRQXQGIU©KHV 0LWJOLHGGHV'HXWVFKHQ.©QVWOHUEXQGHV 9JO):+DPGRUI)/HLWPHLU'LH}J©UOLFKHQ7HUUDNRWWHQGHU6WDDWOLFKHQ $QWLNHQVDPPOXQJHQ0©QFKHQ%DQG  61U' 7HUUDFRWWDRID\RXWKZLWKSHWDVRVFRFNLQWKHULJKWKDQGDQGGUDSHU\RQWKH OHIWVKRXOGHU%RHRWLDQVWKDOIWKFHQWXU\%&7LQ\VXU}FLDOFKLSSLQJVOLWWOH VSOLQWHUDWWKHEDFNRIWKHEDVHLVPLVVLQJ)URPWKHHVWDWHRIWKHZHOONQRZQ German impressionistic painter Heinrich von Zügel!



53


 Oberkörper einer weiblichen Statuette. 0DJQD*UDHFLDXP Y&KU+FP%FP%UDXQHUOHLFKWRUDQJHU7RQ0D WUL]HQJHIRUPW-XQJH)UDXPLW3RORVXQG6FKOHLHU0LW6W”QGHU ,QGHU.¤USHUPLWWHJHEURFKHQ$UPHIHKOHQ2EHU~”FKHHWZDV YHUULHEHQ u 3URYHQLHQ]([6DPPOXQJ()5KHLQODQG3IDO]DP2NWREHUDXI GHU0©Q]E¤UVH.DUOVUXKHHUZRUEHQ 8SSHU SDUW RI D WHUUDFRWWD VWDWXHWWH RI D \RXQJ YHLOHG ZRPDQ ZLWK SRORV 0DJQD*UDHFLDDERXW%&%URZQVOLJKWO\RUDQJHWHUUDFRWWD%URNHQ LQWKHPLGGOHRIWKHFRUSXVDUPVDUHPLVVLQJVXUIDFHVOLJKWO\UXEEHGWith stand!



 Jüngling mit Tunika und Mantel. (WUXVNLVFK-KY&KU+ FP%HLJHU¤WOLFKHU7RQ9HUVLQWHUWREHUKDOEGHU.QLHJHEUR FKHQ u 3URYHQLHQ]([6DPPOXQJ+-6+HVVHQH[*RUQ\ 0RVFK0©QFKHQ $XNWLRQ/RVH[6DPPOXQJ&0*LQ'HXWVFKODQGVHLW  (WUXVFDQWHUUDFRWWDYRWLYH}JXUHRIDPDOH\RXWKZHDULQJWXQLFDQGPDQWOH 5HGGLVKEHLJHFOD\WKUGFHQWXU\%&6XUIDFHFRYHUHGZLWKVLQWHUEURNHQ DERYHWKHNQHHV



54






 9RWLYNRSI HLQHV -©QJOLQJV (WUXVNLVFK  -K Y &KU + FP XQGPLW6W”QGHUFP%UDXQHUJHVSUHQNHOWHU7RQ'HWDLOVLQ .DOWDUEHLW5©FNVHLWHQLFKWDXVJHDUEHLWHW0LW6W”QGHU,P+DOV JHEURFKHQ u 3URYHQLHQ]([3ULYDWVDPPOXQJ:)0©QFKHQVHLWYRU 7HUUDFRWWDYRWLYHKHDGRI\RXQJPDQZLWKORQJKDLU(WUXULDWKFHQWXU\%& %URZQVSRWWHGWHUUDFRWWD%URNHQDWWKHQHFNWith stand!

 :HLEOLFKHU9RWLYNRSI(WUXVNLVFK-KY&KU+FPXQGPLW 6W”QGHU FP %UDXQHU JHVSUHQNHOWHU 7RQ 0DWUL]HQJHIRUPW .RSI HLQHU )UDX PLW 0LWWHOVFKHLWHOIULVXU FDSLWH YHODWR Mit 6W”QGHU.OHLQH)HKOVWHOOHQDQGHQ5”QGHUQ u 3URYHQLHQ]([3ULYDWVDPPOXQJ:)0©QFKHQVHLWYRU 7HUUDFRWWDYRWLYHKHDGRIDYHLOHGZRPDQ(WUXULDUGFHQWXU\%&'DUNEURZQ VSRWWHGWHUUDFRWWD)HZPLVVLQJIUDJPHQWVDWWKHVLGHVWith stand!

 0”QQOLFKHU9RWLYNRSI(WUXVNLVFK-KY&KU+FPXQGPLW 6W”QGHUFP%UDXQHUJHVSUHQNHOWHU7RQ0DWUL]HQJHIRUPW +DOEHU .RSI HLQHV MXQJHQ 0DQQHV FDSLWH YHODWR 0LW 6W”QGHU .OHLQH)HKOVWHOOHQDPXQWHUHQ5DQG u 3URYHQLHQ]([3ULYDWVDPPOXQJ:)0©QFKHQVHLWYRU



7HUUDFRWWDYRWLYHKHDGRIDYHLOHG\RXWK(WUXULDUGFHQWXU\%&'DUNEURZQ VSRWWHGWHUUDFRWWD)HZPLVVLQJIUDJPHQWVDWWKHORZHUULPWith stand!

55


 (WUXVNLVFKHU9RWLYNRSIHLQHV0”G chens. (QGH-KY&KU+FP %FP+HOOURWHU7RQ(LQVHL WLJDXVJHIRUPWHV7RQUHOLHIPLWGHU SHUOHQNHWWHQJHVFKP©FNWHQ %© VWH HLQHU MXQJHQ 'DPH PLW LGHD OLVLHUWHQ*HVLFKWV]©JHQ'DV+DDU LVW ©EHU GHU 6WLUQPLWWH JHVFKHL WHOWXQGI”OOWLQEXFNHOLJHQ6WU”K QHQ]XGHQ6HLWHQKHUDE$XIGHU 6WLUQ OLHJW HLQ 'LDGHP GHU +LQ WHUNRSI ZLUG YRQ HLQHP 6FKOHLHU EHGHFNW.OHLQHU'XUFKEUXFKXQG 5LVV OLQNV DP +DOV .OHLQH II QXQJLP+DDU6RQVWQXUPLQLPD OH %HVWRgXQJHQ GDUXQWHU DQ GHU 1DVHQVSLW]H u 3URYHQLHQ]([3ULYDWVDPPOXQJ:) 0©QFKHQ H[ +LUVFK 1DFKI $XNWLRQ /RV 9JO'LH:HOWGHU(WUXVNHU$XVVWHOOXQJ %HUOLQ6I.DW1U' (WUXVFDQ YRWLYH KHDG RI D \RXQJ ODG\ KHUQHFNDGRUQHGZLWKDEHDGHGFKDLQ KHUKDLUZLWKDGLDGHP/DWHWKFHQWXU\ %& %ULJKW FOD\ VPDOO RSHQ DUHD DQG FUDFNDWWKHOHIWQHFNDQGVPDOOKROHLQ WKHKDLU6PDOOFKLSVDWQRVHDQGDWEDVH 1RUHVWRUDWLRQV



 :HLEOLFKHU 9RWLYNRSI (WUXVNLVFK -KY&KU+FPXQGPLW 6W”QGHU FP +HOOEUDXQHU JHVSUHQNHOWHU 7RQ 0DWUL]HQJH IRUPW .RSI HLQHU )UDX PLW 0LW WHOVFKHLWHOIULVXUFDSLWHYHODWRMit 6W”QGHU+LQWHUNRSIIHKOWLP+DOV JHEURFKHQ u 3URYHQLHQ]([3ULYDWVDPPOXQJ:) 0©QFKHQVHLWYRU 7HUUDFRWWDYRWLYHKHDGRIDYHLOHGZRPDQ (WUXULD UG FHQWXU\ %& /LJKW EURZQ VSRWWHG WHUUDFRWWD %DFN RI WKH KHDG LV PLVVLQJEURNHQDWWKHQHFNWith stand!



56


 :HLEOLFKHU 9RWLYNRSI 0DJQD *UDHFLD-KY&KU+FP 5¤WOLFKHU 7RQ 0DWUL]HQJHIRUPW .RSI HLQHU )UDX PLW 0HORQHQ IULVXU FDSLWH YHODWR 5©FNZ”UWLJ %UHQQORFK0LW7/$QDO\VH:LQ ]LJH $EVSOLWWHUXQJ DQ 1DVH XQG XQWHUHP5DQG u 3URYHQLHQ] $XV GHU 6DPPOXQJ 5 . +HVVHQHUZRUEHQYRU 7HUUDFRWWDYRWLYHKHDGRIDYHLOHGZRPDQ 0DJQD*UDHFLDUGFHQWXU\%&5HG GLVKWHUUDFRWWD7LQ\VSOLQWHUVDWQRVHDQG ORZHUULPDUHPLVVLQJ:LWK7/DQDO\ sis!



 Knabenkopf. (WUXVNLVFK  -K Y &KU + FP XQG PLW 6W”QGHU FP +HOOEUDXQHU JHVSUHQ NHOWHU7RQ0LW6W”QGHU,P+DOV JHEURFKHQ u 3URYHQLHQ]([6DPPOXQJ0%+HV VHQVHLWYRU 7HUUDFRWWDKHDGRIDER\(WUXULDVWFHQ WXU\%&/LJKWEURZQVSRWWHGWHUUDFRWWD %URNHQDWWKHQHFNWith stand!



57


 )UDXHQNRSISURWRPH PLW 3RORV 0DJQD*UDHFLD+”OIWH-KY &KU+FP%FP%HLJHU 7RQ0DWUL]HQJHIRUPW,QWDNW u 3URYHQLHQ] ([ ¤VWHUUHLFKLVFKH 3ULYDW VDPPOXQJ06VHLWHU-DKUHQ 3URWRPH LQ IRUP RI D ZRPDQhV KHDG ZLWKSRORV0DJQD*UDHFLDVWKDOIWK FHQWXU\%&%HLJHWHUUDFRWWD,QWDFW



e Europa auf dem Stier. *ULHFKHQ ODQG  -K Y &KU + FP % FP5RWHU7RQ5XKLJVWHKHQ GHU6WLHUQDFKOLQNVDXIGHP(X URSD LQ HLQHP JHJ©UWHWHQ &KLWRQ VHLWOLFKVLW]W,KUH+DDUHVLQGQDFK KLQWHQJHQRPPHQDXIGHP.RSI VLW]WHLQ'LDGHP,KUH5HFKWHKLHOW GHQ6WLHUDP+RUQ " GLH/LQNH LVW DXI GHQ 7LHUU©FNHQ JHVW©W]W $XV JURgHQ )UDJPHQWHQ ]XVDP PHQJHVHW]WUHFKWHU$UPXQG%HL QH GHU )UDX VRZLH UHFKWHV +RUQ GHV 6WLHUHV QLFKW HUKDOWHQ OHLFKW YHUVLQWHUW u 3URYHQLHQ] ([ *RUQ\  0RVFK 0©QFKHQ$XNWLRQ/RVH[ 6DPPOXQJ3LHUUH &ODXGH9˜ULW˜3DULV HUZRUEHQ]ZLVFKHQHUXQGHU &KULVWLHyV6DOH3DULV /RV 9JO):+DPGRUI)/HLWPHLU'LH }J©UOLFKHQ 7HUUDNRWWHQ GHU 6WDDWOLFKHQ $QWLNHQVDPPOXQJHQ0©QFKHQ%DQG  1U'



58

7HUUDFRWWDJURXSGHSLFWLQJ(XURSDULGLQJ WKHEXOO*UHHFHWKFHQWXU\%&5HDV VHPEOHGRXWRIVHYHUDOODUJHIUDJPHQWV (XURSDVy DUP DQG OHJV DV ZHOO DV RQH KRUQRIWKHEXOOQRWSUHVHUYHGOLJKWFR YHULQJ


 ,GRO DXV 7RQ ,WDOLVFK  -K Y &KU+FP%HLJHU7RQ1DFN WHVWHKHQGHP”QQOLFKH)LJXUPLW SODVWLVFKHU$QJDEHGHU%UXVWXQG GHV*HVFKOHFKWVVRZLHKHUYRUWUH WHQGHP*HV”g(LQ$UPLVWLQGHU +©IWHDXIJHVW©W]WGHUDQGHUHZDU ZDKUVFKHLQOLFK QDFK YRUQH DXV JHVWUHFNW 2EHU~”FKH EHULHEHQ UHFKWHU 8QWHUDUP XQG UHFKWHU 8QWHUVFKHQNHO VRZLH OLQNHV %HLQ XQG)UDJPHQWHGHV+LQWHUNRSIHV IHKOHQ u 3URYHQLHQ]([6FKZHL]HU3ULYDWVDPP OXQJHUZRUEHQYRU 3XEOL]LHUW .XQVW GHU $QWLNH  $QFLHQW $UW*DOHULH*©QWHU3XK]H.DWDORJ 1U 0DOHQDNHGLGRORIFOD\,WDOLFWKFHQWXU\ %&6XUIDFHZRUQULJKWORZHUDUPDQG ULJKWORZHUOHJOHIWOHJDQGIUDJPHQWVRI WKHEDFNRIWKHKHDGPLVVLQJ



 .OHLQHU.RSIHLQHV0”GFKHQV0D JQD *UDHFLD (QGH    -K Y &KU+FP5¤WOLFKHU7RQ'H WDLOV LQ .DOWDUEHLW .¤SIFKHQ HL QHV0”GFKHQVPLW0HORQHQIULVXU 1DVHQVSLW]HIHKOWXQGLP+DOVJH EURFKHQ u 3URYHQLHQ] $XV GHU 6DPPOXQJ 5 . +HVVHQHUZRUEHQYRU 7HUUDFRWWD KHDG RI D JLUO ZLWK PHORQH KDLUVW\OH0DJQD*UDHFLDODWHWKUG FHQWXU\%&5HGGLVKWHUUDFRWWD7RSRI WKHQRVHLVPLVVLQJEURNHQDWWKHQHFN



59






e 0DVNHGHV'LRQ\VRV0DJQD*UDHFLDOHW]WHV9LHUWHO-KY&KU +FP5RWEUDXQHU7RQ)ODFKHV5HOLHILQ)RUPGHV.RSIHV HLQHV E”UWLJHQ 0DQQHV PLW %XFNHOORFNHQ YROXPLQ¤VHP %DUW PLW ODQJHP 6FKQDX]HU LP DUFKDLVFKHQ 6WLO ,QWDNW PLW HLQHP 6RFNHO u 3URYHQLHQ] ([ *RUQ\  0RVFK 0©QFKHQ $XNWLRQ   /RV  H[ +£WHO 'URXRW (UEH DXV GHU 6DPPOXQJ &RORQHO : 0XWLDX[ 3DULV  /RV  H[ 6DPPOXQJ (XJ™QH 0XULDX[     H[ 6DPPOXQJ0:3DULVH[6DPPOXQJ)UDQ—RLVHXQG&ODXGH %RXUHOLHU 0LW=HUWL}NDWYRQ$UW/RVV5HJLVWHUIUDQ]¤VLVFKHU([SRUWOL]HQ]XQG5HFKQXQJ GHV+£WHO'URXRW .RSLHQ  9JO):+DPGRUI)/HLWPHLU'LH}J©UOLFKHQ7HUUDNRWWHQGHU6WDDWOLFKHQ $QWLNHQVDPPOXQJHQ0©QFKHQ%DQG  1U& 7HUUDFRWWDDSSOLTXHIURP0DJQD*UDHFLDGHSLFWLQJWKHKHDGRI'LRQ\VXVLQ DUFKDLFVW\OH/DVWTXDUWHURIWKFHQWXU\%&,QWDFWZLWKPRXQWLQJWith WKHFHUWL}FDWHRI$UW/RVV5HJLVWHUD)UHQFKH[SRUWOLFHQFHDQGWKHLQYRLFH of Hôtel Drouot (copies)!

e Maske eines Mannes. 0DJQD *UDHFLD OHW]WHV 9LHUWHO  -K Y &KU+FP5RWEUDXQHU7RQ$SSOLNLQ)RUPGHV.RSIHVHLQHV E”UWLJHQ0DQQHVPLWHLQHU.DSSH.OHLQH)HKOVWHOOHQPLWHLQHP 6RFNHO u 3URYHQLHQ] ([ *RUQ\  0RVFK 0©QFKHQ $XNWLRQ   /RV  H[ +£WHO 'URXRW (UEH DXV GHU 6DPPOXQJ &RORQHO : 0XWLDX[ 3DULV  /RV  H[ 6DPPOXQJ (XJ™QH 0XULDX[     H[ 6DPPOXQJ0:3DULVH[6DPPOXQJ)UDQ—RLVHXQG&ODXGH %RXUHOLHU 0LW=HUWL}NDWYRQ$UW/RVV5HJLVWHUIUDQ]¤VLVFKHU([SRUWOL]HQ]XQG5HFKQXQJ GHV+£WHO'URXRW .RSLHQ 



60

7HUUDFRWWDDSSOLTXHIURP0DJQD*UDHFLDGHSLFWLQJWKHKHDGRIDPDQZLWK DFDSLQDUFKDLFVW\OH/DVWTXDUWHURIWKFHQWXU\%&7LQ\FKLSSLQJZLWK PRXQWLQJ:LWKWKHFHUWL}FDWHRI$UW/RVV5HJLVWHUD)UHQFKH[SRUWOLFHQFH and the invoice of Hôtel Drouot (copies)!




 Canosinische Pseudooinochoe. 6S”WHV   IU©KHV  -K Y &KU + FP 6FKHLQJHI”g PLW ZHLgHU (QJREH XQG HKHPDOV PLW SRO\FKURPHU%HPDOXQJLQ)RUPHLQHV)UDXHQNRSIHVPLW.UDQ] XQGVHLWOLFKHQ=ZHLJHQGDUDXIHLQH6WDWXHWWHHLQHUMXQJHQ)UDX LP0DQWHOVRZLHHLQKRKHU%©JHOKHQNHO0LW=HUWL}NDWGHV$UW /RVV5HJLVWHU%HPDOXQJXQG7HLOHGHU(QJREHYHUORUHQVRQVW LQWDNW u 3URYHQLHQ]6HLWLQ'HXWVFKODQGH[6FKZHL]HU3ULYDWVDPPOXQJ'U7 I©UGLHVHLP6FKZHL]HU+DQGHOLQGHQHU-DKUHQHUZRUEHQ 3RO\FKURPHSVHXGRYDVHIURP&DQRVDLQIRUPRIWKHKHDGRIDZRPDQDERYH VWDWXHWWHRIDGUDSHGJLUODQGODUJHKDQGOH/DWHWKHDUO\UGFHQWXU\%& &RORXUDQGSDUWRIWKHHQJREHDUHPLVVLQJRWKHUZLVHLQWDFW:LWKFHUWL}FDWH of Art Loss Register!

0LW 7/$QDO\VH 5©FNZ”UWLJ JHEURFKHQ HWZDV $EULHE VRQVW JXWH(UKDOWXQJPLW]DKOUHLFKHQ)DUEUHVWHQ u 3URYHQLHQ] ([ 6DPPOXQJ - ( %D\HUQ HUZRUEHQ VHLW GHQ HUQ LQ 'HXWVFKODQGVHLWYRU 3DLURIWHUUDFRWWDSODWHVIURPWKHFRUQLFH(WUXVFDQWKFHQWXU\%&%URNHQ DWWKHEDFNVOLJKWO\UXEEHGRIIRWKHUZLVHLQJRRGFRQGLWLRQZLWKQXPHURXV SDLQWUHPDLQV:LWK7/DQDO\VLV

 5DQGIUDJPHQW HLQHV 3LWKRV PLW 6WLHUNRSI *ULHFKLVFK  -K Y &KU + FP % FP 'XQNHOEUDXQHU 7RQ $XI 6W”QGHU PRQWLHUW]DKOUHLFKH6LQWHUUHVWH u 3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU

 Ein Paar Architekturterrakotten. (WUXVNLVFK  -K Y &KU + FP/FP+HOOHUOHLFKWU¤WOLFKHU7RQPLWEUDXQHU%HPD OXQJ=ZHL3ODWWHQYRP*HVLPVPLW=XQJHQVWDEXQG/RWXVIULHV

5LPIUDJPHQWRIDQ(DUO\$UFKDLFSLWKRVZLWKKHDGRIDEXOOPDGHRIGDUN EURZQWHUUDFRWWD*UHHFHWKFHQWXU\%&0RXQWHGRQDVWDQGZLWKVHYHUDO UHPDLQVRIVLQWHU



61


67(,16.8/3785

e )OXVVJRWW5¤PLVFKH.DLVHU]HLW-KQ&KU+FP/FP :HLgHU IHLQNULVWDOOLQHU 0DUPRU (LQH Y”WHUOLFKH P”QQOLFKH *RWWKHLW PLW ZDOOHQGHP .RSI XQG %DUWKDDU ODJHUW PLW DXIJHVW©W]WHP OLQNHQ (OOHQERJHQ XQG DXI +¤KH GHU .Q¤FKHO ©EHUNUHX]WHQ %HLQHQ DXI HLQHP JHZHOOWHQ 8QWHUJUXQG ,Q GHU DXIGHPUHFKWHQ2EHUVFKHQNHOOLHJHQGHQ5HFKWHQK”OWHUHLQHQ )LVFK6HLQZHLWHU0DQWHOEHGHFNWQXUGLH%HLQHXQWHUKDOEGHU +©IWHXQGELOGHWJOHLFKHLQHU0DQGRUODHLQHQ5DKPHQI©UGHQ SU”FKWLJHQ PXVNXO¤VHQ LQ OHLFKWHU 6HLWHQODJH SU”VHQWLHUWHQ .¤USHU GHV *RWWHV 8QWHU GHP OLQNHQ 8QWHUDUP EH}QGHW VLFK GHU$XVJXVVHLQHV4XHOOJHI”gHVGDVZLHDXVGHU'XUFKERKUXQJ ]X VFKOLHgHQ LVW LQ GHU $QWLNH DOV %UXQQHQDXVJXVV GLHQWH $EJHVHKHQYRQHLQLJHQNOHLQHUHQ%HVWRgXQJHQLQWDNW u 3URYHQLHQ]([&KULVWLHyV1HZ<RUN-XQL/RVDXVIUDQ]¤VLVFKHU 6DPPOXQJ3DULV 5RPDQIRXQWDLQ}JXUHRIDUHFOLQLQJULYHUJRGZLWKIXOOEHDUGDQGKDLUKLV ULJKWOHJEHQWDWWKHNQHHDQGFURVVLQJKLVOHIWZHDULQJDPDQWOHZUDSSHG DURXQGKLVOHJVOHDYLQJKLVWRUVREDUH+HLVOHDQLQJRQDMDUIURPZKLFKLVVXHV IRUWKZDWHUGHSLFWHGXQGXODWLQJEHORZDQGKROGVD}VKLQKLVULJKWKDQGVW FHQWXU\$'0LQLPDOGHQWVRWKHUZLVHLQWDFW

62




63




 Torso eines Epheben. 5¤PLVFKH .DLVHU]HLW  -K Q &KU + FP:HLgHUIHLQNULVWDOOLQHU0DUPRU(UKDOWHQLVWGHU+©IW XQG2EHUVFKHQNHOEHUHLFKHLQHV]DUWHQ.QDEHQGHVVHQUHFKWHV %HLQ YRUJHVHW]W GDV OLQNH HWZDV ]XU©FNJHVHW]W ZDU 'LH +©IWH LVWVWDUNJHEHXJWZDVLQVEHVRQGHUHDQGHQGHXWOLFKLQGHU+¤KH YHUVHW]WHQ*OXW”HQHUNHQQEDUZLUG$POLQNHQ2EHUVFKHQNHOHLQ JURgHU3XQWHOOR0LW$UW/RVV5HJLVWHU5HSRUW)UDJPHQWDULVFK u 3URYHQLHQ]([3ULYDWVDPPOXQJ2::LHQHUZRUEHQ$QIDQJGHUHU -DKUHLQGHU*DOHULH6RFRZL:LHQLQ'HXWVFKODQGVHLW

64

'LH)LJXUJHKWW\SRORJLVFKZRKODXI8UELOGHUGHUSRO\NOHWLVFKHQ6FKXOHZLHGHQ VRJ(SKHEHQ:HVWPDFRWWwRGHUGHQVRJ1DUNLVVRVw VHLWHQYHUNHKUW ]XU©FN /HW]HUHUVW©W]WVLFKPLWHLQHU+DQGDXIHLQHQ3IHLOHUZDV]XHLQHPHEHQVRVWDUN YHUVHW]WHQ6WDQGPRWLYI©KUW9JO+%HFN3&%RO0%©FNOLQJ +UVJ  3RO\NOHW'HU%LOGKDXHUGHUJULHFKLVFKHQ.ODVVLN$XVVWHOOXQJ)UDQNIXUWDP 0DLQ  6IIXQGEHVI.DW 0DUEOHWRUVRRIDVOHQGHUHSKHERV5RPDQFRS\RID*UHHNFODVVLFDOSURWRW\SHLQ WKHPDQQHURIWKHSRO\FOHLWDQVFKRROVWFHQWXU\$')UDJPHQWDU\




65


90 • Torso des Meleager. -KQ&KU+FP:HLgHUIHLQNULVWDO OLQHU0DUPRU5XQGSODVWLVFKH)LJXUHLQHVMXQJHQQXUPLWHLQHU DQGHUUHFKWHQ6FKXOWHUJH}EHOWHQ&KODP\VEHNOHLGHWHQ0DQQHV GHULQHLQHPDXVJHSU”JWHQ.RQWUDSRVWVWHKW'DV*HZDQGEH GHFNWGLH%UXVWXQGZDURIIHQEDULUJHQGZLHXPGHQOLQNHQ$UP JHVFKOXQJHQXQGI”OOW©EHUGHQ5©FNHQKHUDEMit Kopie der Ori ginalrechung!$XVJURgHQ)UDJPHQWHQ]XVDPPHQJHVHW]WNOHLQH )HKOVWHOOHQHUJ”Q]WXQGUHWXVFKLHUW u 3URYHQLHQ]%HL/y$UW$QFLHQw0RQWUHDOYRQGLHVHUHUZRUEHQI©UGLH +DUU\7RXOFK&ROOHFWLRQ0RQWUHDO 0HOHDJHUGHU.¤QLJVVRKQDXVŠWROLHQZDUGHU$QI©KUHUGHUNDO\GRQLVFKHQ (EHUMDJGXQGVWDUEHLQHQMXQJHQ7RGQDFKGHPHULP6WUHLWVHLQHEHLGHQ 2QNHOHUVFKODJHQKDWWHZHLOVLHVHLQH(QWVFKHLGXQJGLH6LHJHVWURSK”HGDV (EHUIHOOGHU$PD]RQH$WDODQWH]X©EHUODVVHQPLVVELOOLJWHQ'HU%LOGQLVW\SXV LVWLQ]DKOUHLFKHQU¤PLVFKHQ.RSLHQ©EHUOLHIHUWGLHLQHLQLJHQ(LQ]HOHOHPHQWHQ ZLH ]XP %HLVSLHO GHU &KODP\V YRQHLQDQGHU DEZHLFKHQ ZRKO DEHU DXI HLQ JHPHLQVDPHV NODVVLVFKJULHFKLVFKHV 8UELOG ]XU©FNJHKHQ GDV PDQ DXV VWLOLVWLVFKHQ*U©QGHQGHP:HUNGHV6NRSDV]XZHLVW 5RPDQPDUEOHWRUVRRI0HOHDJHU7KH\RXQJPDQLVGHSLFWHGQXGHRQO\ ZHDULQJDFKODP\VKHOGE\D}EXODDWWKHULJKWVKRXOGHUDQGFRYHULQJRQO\SDUWV RIWKHEUHDVWDQGRIWKHOHIWDUPVWFHQWXU\$')UDJPHQWDU\

66


90

67


91

91 .RSI HLQHV 0”GFKHQV *ULHFKHQODQG (QGH   $QIDQJ  -K Y &KU + FP :HLgHU IHLQNULVWDOOLQHU 0DUPRU /HLFKW XQWHUOHEHQVJURgHU .RSI HLQHV QRFK NLQGOLFKHQ 0”GFKHQV PLW LGHDOLVLHUWHQ =©JHQ XQG HLQHU ]HLWW\SLVFKHQ 0HORQHQIULVXU PLW HLQHP XP GHQ +LQWHUNRSI JHZLFNHOWHQ =RSI Mit spanischer ([SRUWJHQHKPLJXQJXQG$UW/RVV5HJLVWHU5HSRUW7HLOHGHU)ULVXU XQG1DVHEHULHEHQ%HVWRgXQJHQDP.LQQXQGDP+LQWHUNRSI 7HLOHGHU6WLUQHUJ”Q]W u

68


91

3URYHQLHQ]([3ULYDWVDPPOXQJ$$66SDQLHQHUZRUEHQLQGHQHU ELVHU-DKUHQLQ'HXWVFKODQGVHLW &KDUPLQJHDUO\KHOOHQLVWLFXQGHUOLIHVL]HPDUEOHKHDGRIDJLUOZLWK€PHORQy KDLUVW\OH/DWHWKHDUO\UGFHQWXU\%&6PDOOGDPDJHVDWQRVHFKLQDQG LQWKHKDLUSDUWRIWKHIRUHKHDGUHVWRUHG

69


 Kopf des Herakles. 5¤PLVFKH .DLVHU]HLW  +”OIWHQ&KU+FP:HLgHUIHLQNULVWDO OLQHU 0DUPRU .RSI HLQHV E”UWLJHQ 0DQQHV PLW NXU]HP $WKOHWHQKDDU LQ OHLFKWHU :HQ GXQJ QDFK OLQNV 'HU 0XQG LVW OHLFKW JH¤II QHWXQGGDV*HVLFKWYRQDXVJHSU”JWNU”IWLJHU 0XVNXODWXU+LQWHUGHPOLQNHQ2KUGHU5HVW HLQHU6W©W]H%DUWXQG+DDUVLQGDXIGHU$Q VLFKWVVHLWHPLW3XQNWERKUXQJHQDXIJHORFNHUW GDV.DUQDWJODWWSROLHUW.OHLQHUH%HVWRgXQJ LQVEHVRQGHUHLP%DUW u 3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQ HU-DKUHQ 5RPDQKHDGRIWKHEHDUGHG+HUDNOHVZHDULQJDORQJ EHDUGDQGVKRUWKDLU7KHKHDGLVVOLJKWO\WXUQHGWRWKH ULJKW)URPDVDUFRSKDJXVIURPWKHQGKDOIRIWKHQG FHQWXU\$'7UDFHVRIDVXSSRUWEHKLQGWKHOHIWHDU PLQRUGDPDJHVHVSHFLDOO\DWWKHEHDUG





70




71




94

e 3RUWU”WHLQHV0DQQHV-KY-KQ&KU+FP:HLgHU IHLQNULVWDOOLQHU0DUPRU)DVWYROOSODVWLVFKHU5HOLHINRSIPLWGHP %LOGQLV HLQHV EDUWORVHQ 0DQQHV PLWWOHUHQ $OWHUV .XU]H GLFNH /RFNHQIDOOHQLQGLH6WLUQ'HU+LQWHUNRSILVWQLFKWDXVJHDUEHLWHW XQG HV EOHLEW XQNODU RE PLW GHU VWHKHQJHODVVHQHQ 6WHLQPDVVH VHLWOLFKGHV+DOVODQJHVGLFKWHV1DFNHQKDDUJHPHLQWRGHUGLHV QRFK 7HLO GHV 5HOLHIJUXQGHV LVW 1DVH EHVWRgHQ 6SXUHQ YRQ 6”XUHUHLQLJXQJ u

2EZRKOGLH%HQHQQXQJSWROHP”LVFKHU+HUUVFKHULQQHQSRUWU”WVHLQVROFKHV OLHJW ]ZHLIHOVRKQH YRU  ZHJHQ GHU VWDUNHQ LGHDOLVLHUHQGHQ 7HQGHQ]HQ 6FKZLHULJNHLWHQEHUHLWHWVFKHLQWHLQH,GHQWL}NDWLRQDOV$UVLQRH,,,7RFKWHU 3WROHPDLRV,,XQG%HUHQLNH,,XQG*HPDKOLQYRQ3WROHPDLRV,9QLFKWDXV GHU/XIWJHJULIIHQ9LHOPHKUUHLKWVLFKGDV.¤SIFKHQDXIJUXQG]DKOUHLFKHU *HPHLQVDPNHLWHQ]ZDQJORVLQHLQH*UXSSHJOHLFKEHQDQQWHU3RUWU”WVHLQ ]XP%HLVSLHOHLQ0DUPRUNRSILQGHU6DPPOXQJGHU<DOH8QLYHUVLW\ ,QY  XQGHLQZHLWHUHV6W©FNLQ%RVWRQ 5LFKWHU3RUWUDLW)LJV I 'HU.RSILQ%HUOLQ,QYZLUGZDKOZHLVHDOV$UVLQRH,,RGHU,,, EH]HLFKQHW

3URYHQLHQ] $XV 6FKZHL]HU 3ULYDWVDPPOXQJ GHU HU -DKUH GDQDFK 3ULYDWEHVLW]HUZRUEHQLQ&DPHOV&RKHQ$XNWLRQ3DULV'H]HPEHU /RV%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV$

0DUEOHPLQLDWXUHSRUWUDLWRID3WROHPDLFTXHHQSRVVLEO\$UVLQRH,,,:RUQ VXUIDFHEDFNVLGHXQ}QLVKHG

0DUEOHUHOLHIKHDGRIDPDQZLWKVKRUWORFNVIDOOLQJLQWRWKHIRUHKHDGVW FHQWXU\%&VWFHQWXU\$'1RVHEURNHQIUDJPHQWDU\

94 .RSIHLQHU3WROHP”HULQZRKO$UVLQRH,,, Y&KU H FP :HLgHU IHLQNULVWDOOLQHU 0DUPRU +LQWHQ QLFKW DXVJH DUEHLWHWHU(LQVDW]NRSIPLWGHPZHLWJHKHQGLGHDOLVLHUWHQ%LOGQLV HLQHUMXQJHQ)UDXPLWLQGHU0LWWHJHVFKHLWHOWHP+DDU$OVHW ZDVLQGLYLGXHOOHUH=©JHHUVFKHLQHQGLHHQJHUVWHKHQGHQ$XJHQ XQGGLHGRFKUHFKWNU”IWLJH1DVH7\SLVFKSWROHP”LVFKGLHJUR gHQJODWWHQ:DQJHQ$QGHQ6FKO”IHQUDJHQ]ZHLQLFKWJHQDXHU GH}QLHUWH /¤FNFKHQ KHUYRU $XI GHU .DORWWH ]ZHL /¤FKHU GLH ZRKO ]XU %HIHVWLJXQJ HLQHV 'LDGHPV GLHQWHQ (WZDV EHULHEHQ $XIGHU8QWHUVHLWHDOWH$XNWLRQVQXPPHUwXQG1RWL] u 3URYHQLHQ] ([ 6DPPOXQJ ( 8 %D\HUQ LQ 'HXWVFKODQG VHLW YRU  HUZRUEHQEHL*DOHULHYRQ$EHUNURQ0©QFKHQHU-DKUH

72

95 *UDEUHOLHI GHV *DLXV ,XOLXV DXV %\]DQWLXP  -K Q &KU + FP%FP:HLgHUIHLQNULVWDOOLQHU0DUPRU3ODWWHPLW YHUWLHIWHP %LOGIHOG /LQNV WKURQW HLQH LQ &KLWRQ XQG ©EHU GHQ .RSI JH]RJHQHP +LPDWLRQ JHNOHLGHWH )UDX GLH LQ GHU +DQG ZDKUVFKHLQOLFK HLQH 0RKQNDSVHO WU”JW 5HFKWV QHEHQ LKU VWHKW LKU *HPDKO LQ JULHFKLVFKHU %©UJHUWUDFKW =X VHLQHU /LQNHQ HLQ 'UHLIXgWLVFK PLW 6SHLVHQ ,Q GHQ XQWHUHQ (FNHQ MH HLQ PLQLDWXULVLHUWHU'LHQHULQ7UDXHUKDOWXQJ$XIGHPREHUHQ5DQG GLH ,QVFKULIW GAIOS IOULIOS  BUZANTEINOS 8QWHUH .DQWH EHVWRgHQ TXHUODXIHQGHU JHNOHEWHU %UXFK VRQVW QXU PLQLPDOH%HVFK”GLJXQJHQ u 3URYHQLHQ]([&KHQHO&ROOHFWLRQ3DULV6RWKHE\yV/RQGRQ'H]HPEHU  /RV  (UZRUEHQ YRQ 2OLYHU )RUJH XQG %UHQGDQ /\QFK /RQGRQ H[%HVLW]'UXQG0UV/RXNYDQ5RR]HQGDDO+ROODQGH[&KULVWLHhV $PVWHUGDP0”U]/RV 6DPPOXQJ'HUNVHQ H[ $OH[:HQJUDI$UFDGH*DOOHU\/RQGRQDEJHELOGHWLQ7KH%XUOLQJWRQ 0DJD]LQHw)HEUXDU/;;,$Q]HLJH




95

3XEOL]LHUWLQ(3IXKO+0¤ELXV'LHRVWJULHFKLVFKHQ*UDEUHOLHIV,   6  1U  PLW 7DI  6XSSOHPHQWXP (SLJUDSKLFXP *UDHFXP %DQG61U$/DMWDU'LH,QVFKULIWHQYRQ%\]DQWLRQ ,QVFKULIWHQJULHFKLVFKHU6W”GWHDXV.OHLQDVLHQ%DQG6I1U 2OLYHU)RUJHDQG%UHQGDQ/\QFK/WG/RQGRQ$QFLHQW$UWIURPWKH 9DQ5RR]HQGDDO&ROOHFWLRQ1UPLW$EE

(DVWHUQ*UHHNPDUEOHJUDYHUHOLHIGHSLFWLQJDPDWURQVHDWLQJRQWKHOHIWDQG KHUKXVEDQGQDPHG*DLXV-XOLXVIURP%\]DQWLRQLQJUHHNGUHVVWRKHUOHIW ,QWKHFRUQHUVVPDOOVHUYDQWVDQGDWULSRGWDEOHODGHQZLWKFDNHVVWHDUO\ QGFHQWXU\$'3DUWRIWKHERWWRPORZHUHGJHEURNHQUHVWRUHGKRUL]RQWDO FUDFN2WKHUZLVHRQO\PLQLPDOGDPDJHV3XEOLVKHGLQ

73






 2VWRWKHNI©UGLHYHUVWRUEHQH)UDXGHV$SHOODV5¤PLVFKH.DLVHU ]HLW-KQ&KU+FP%FP7FP:HLgHUIHLQNUL VWDOOLQHU0DUPRU.DVWHQI¤UPLJHU6FKUHLQDXIGHU9RUGHUVHLWH PLW TXDOLW”WYROO DXVJHDUEHLWHWHQ )UXFKWJLUODQGHQ YHU]LHUW GLH PLWWLJ©EHUHLQHP6WLHUXQGDQGHUUHFKWHQ(FNH©EHUHLQHP :LGGHUNRSIK”QJHQ6HLWOLFKXQGU©FNZ”UWLJVLQGGLH*LUODQGHQ QXULQ%RVVHDXVJHI©KUW(LQJODWWHVNRQYH[HV3UR}OELOGHWGHQ XQWHUHQ $EVFKOXVV ,P ,QQHUHQ LVW GHU .DVWHQ QXU URK DXVJH VFKODJHQ$XIGHU9RUGHUVHLWHLVWDPREHUHQ5DQGXQGDXIGHP %RGHQSUR}OHLQH,QVFKULIWHLQJHPHLgHOW ...]H KATOICOMENH / APELLAS DIONUSIOU EFESIOS ZH $SHOODV GHU

74

(SKHVLHU6RKQGHV'LRQ\VLRV>KDWGDVDQIHUWLJHQODVVHQ@I©UGLH 9HUVWRUEHQH>@]XVHLQHQ/HE]HLWHQw 'LH)RUPGHUIDVWTXD GUDWLVFKHQ%XFKVWDEHQZHLVWDXIGDVHUVWHQDFKFKULVWOLFKH-DKU KXQGHUWKLQ'HFNHOIHKOW$XVEUXFKYRQKLQWHQ©EHUGLHOLQNH 6HLWHELV]XUOLQNHQREHUHQ(FNH u 3URYHQLHQ]$XVGHUGHXWVFKHQ3ULYDWVDPPOXQJ+:HUZRUEHQ0LWWHGHU HU-DKUH 2VWRWKHNIRUWKHGHFHDVHGZRPDQRI$SHOODV5RPDQ,PSHULDO3HULRGVW FHQWXU\$'/LGLVPLVVLQJOHIWDPLVVLQJSDUW




 *UDEUHOLHIPLW5HLWHUKHURVXQG)DPLOLH:RKOZHVWNOHLQDVLDWLVFK  -K Q &KU + FP % XQWHQ FP % REHQ FP 7 FP )HLQNULVWDOOLQHU 0DUPRU 6LFK OHLFKW YHUM©QJHQGH 5HOLHISODWWH PLWHLQHP%LOGIHOGGDVGLHREHUHQ]ZHL'ULWWHOHLQQLPPW'RUW GHU KHURLVLHUWH 9HUVWRUEHQH ]X 3IHUGH QDFK UHFKWV (LQ KLQWHU HLQHP$OWDUVWHKHQGHU'LHQHUK”OWGDV3IHUGDP=©JHO5HFKWV ]ZHL)DPLOLHQDQJHK¤ULJHHLQIURQWDOVWHKHQGHU0DQQXQGHLQH YHUVFKOHLHUWH )UDX 5HFKWV LP +LQWHUJUXQG HLQ %DXP LQ GHV VHQ*H”VWVLFKHLQH6FKODQJHZLQGHW8QWHUGHP%LOGIHOGGLH,Q VFKULIW ARTEMIDWROS HRWS XQGGDUXQWHU]ZHLQDFKUHFKWV VSULQJHQGH+LUVFKH2EHUNDQWHEHVWRgHQXQGVWDUNEHULHEHQ u

3URYHQLHQ]([3ULYDWVDPPOXQJ:)0©QFKHQH[+LUVFK1DFKI0©QFKHQ $XNWLRQ/RV 9JO(3IXKO+0RHELXV'LHRVWJULHFKLVFKHQ*UDEUHOLHIV  ,,6 II.DWII 6HSXOFKUDOPDUEOHUHOLHIVKRZLQJWKHGHFHDVHGDVKHURL]HGULGHUZLWKKLVIDPLO\ DQGDVHUYDQW,QIURQWRIKLPDQDOWDUDQGDWUHHZLWKDVQDNH:HVWHUQ$VLD 0LQRUDERXWVWFHQWXU\$':RUQVXUIDFH3DUWRIWKHXSSHUULPEURNHQ DZD\

75


 *UDEUHOLHI PLW )DPLOLH %DONDQJHELHW    -KQ&KU+FP%FP7FP)HLQNUL VWDOOLQHU0DUPRU4XHUUHFKWHFNLJHV)HOGPLW 5DKPHQ,P%LOGIHOGGLHIURQWDOHQ%©VWHQHL QHV (OWHUQSDDUHV ]ZLVFKHQ GHQHQ GLH %©VWH LKUHV 6RKQHV HUVFKHLQW 2EHUNDQWH EHVWRgHQ XQGVWDUNEHULHEHQ u 3URYHQLHQ] ([ 3ULYDWVDPPOXQJ : ) 0©QFKHQ H[+LUVFK1DFKI0©QFKHQ$XNWLRQ/RV  6HSXOFKUDOPDUEOHUHOLHIVKRZLQJWKHIURQWDOEXVWVRI DIDPLO\%DONDQDUHDVWQGFHQWXU\$':RUQ VXUIDFH



99 5HOLHI PLW VLW]HQGHU )LJXU    -K Q &KU + FP % FP 7 FP .DONVWHLQ /HLFKW SURYLQ]LHOOHU 6WLO 1RULFXP RGHU 3DQQRQLHQ"  )UDJPHQW YRQ GHU UHFKWHQ REHUHQ (FNH HLQHV *UDEUHOLHIV GDV HLQHQ QDFK OLQNV DXI HLQHP 6HVVHO PLW KRKHU /HKQHVLW]HQGHQMXQJHQ0DQQ]HLJWGHUPLW JHVHQNWHP .RSI DXI HLQ LQ VHLQHQ +”QGHQ EH}QGOLFKHV 2EMHNW 6DQGXKU"  EOLFNW 'HQ EHUJDQJ]XP5DKPHQELOGHWHLQOHVELVFKHV .\PDWLRQ 2EHQ GLH ,QVFKULIWHQUHVWH >@ (0(>@)UDJPHQWDULVFK u 3URYHQLHQ] ([ 3ULYDWVDPPOXQJ : ) 0©QFKHQ H[+LUVFK1DFKI0©QFKHQ$XNWLRQ/RV  )UDJPHQWRIDVDQGVWRQHJUDYHUHOLHIVKRZLQJD\RXQJ PDQVHDWHGRQDFKDLUZLWKKLJKFXUYHGEDFNKROGLQJ DXQFHUWDLQREMHFW KRXUJODVV" 6W\OHRIWKHQRUWKHUQ SURYLQFHV 1RULFXPRU3DQQRQLD" $ERXWVWQG FHQWXU\$')UDJPHQWDU\ 99

100 Löwenkopf. -KQ&KU%FP+FP :HLgHUIHLQNULVWDOOLQHU0DUPRU$UFKLWHNWXU RGHU6DUNRSKDJIUDJPHQWPLWHLQHPIURQWDOHQ /¤ZHQNRSIPLWOHLFKWDXIJHULVVHQHP0DXO  u 3URYHQLHQ]([6DPPOXQJ(8%D\HUQ%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV([ +LUVFK1DFKI$XNWLRQH[+LUVFK 1DFKI0©QFKHQ$XNWLRQ/RV,Q 'HXWVFKODQGVHLWYRU $UFKLWHFWXUDORUVDUFRSKDJXVIUDJPHQWZLWKWKHIURQWDO KHDGRIDOLRQQGUGFHQWXU\$')UDJPHQWDU\ ZRUQVXUIDFH 100

76


%521=(6.8/3785

101

101 /¤ZH XQG =LHJHQERFN DXV 6LOEHU *ULHFKLVFKDUFKDLVFK ZRKO 2VWLRQLHQIU©KHV-KY&KU'HU/¤ZH/FP%FP +FP=LHJH/FP%FP+FP0DVVLYHU*XVV 'HWDLOV LQ .DOWDUEHLW %HLGH )LJXUHQ DXI HLQHP VFKPDOHQ ~D FKHQOHLFKWJHERJHQHP%DQGGDVDQGHU8QWHUVHLWHDXgHQ~D FKH3UR}OHDXIZHLVW'HU/¤ZHKDWGDV0DXOJH¤IIQHWVRGDVV GLH=”KQHVLFKWEDUVLQG'LH9RUGHUSIRWHQVLQGQDFKYRUQHDXV JHVWUHFNWGLHDEJHNQLFNWHQ+LQWHUO”XIHOLHJHQDP.¤USHUDQGHU 6FKZDQ]LVWXPGDV+LQWHUWHLOJHOHJWXQGGLH6FKZDQ]VSLW]HYHU VFKZLQGHWXQWHUGHP.¤USHU'LH0”KQHVHW]WKLQWHUGHQ2KUHQ XQGXQWHUGHP.RSIDQXQGEHGHFNWGHQJHVDPWHQ+DOVXQGGLH 9RUGHUVHLWHELV]XGHQ3IRWHQXQGEHVWHKWDXV~DPPI¤UPLJHQ

6WU”KQHQ'LH=LHJHOLHJWPLWHLQJHNODSSWHQ9RUGHUEHLQHQXQG KDW GHQ .RSI QDFK OLQNV JHZHQGHW 'LH 2KUHQ VLQG ZDFKVDP DXIJHVWHOOWXQGGDVSU”FKWLJH*HK¤UQVWHKWZHLWQDFKKLQWHQDE (LQHODQJHJHVFKHLWHOWH0”KQH]LHKWVLFKYRP+LQWHUNRSI©EHU GHQ5©FNHQ8UVSU©QJOLFKZRKO*HU”WHDXIV”W]HEindrucksvolle Exemplare!7¤QXQJLQWDNW u 3URYHQLHQ]([3ULYDWEHVLW]070©QFKHQHU-DKUH &DVWVLOYHUO\LQJOLRQDQGDO\LQJZLOGJRDWRULJLQDOO\SDUWRIDGHYLFHDWWDFK PHQW(DVWHUQ*UHHNWKHDUO\WKFHQWXU\%&7RQHGLQWDFWImpressive pieces!

77


e Schlange (Glykon). 5¤PLVFKH .DLVHU ]HLW FD    -K Q &KU + FP / FP 9ROOJXVV $XIJHULQJHOWH 6FKODQJH PLW HUKREHQHP .RSI %DUW XQG .DPP 'LH6FKXSSHQVLQGLQ.DOWDUEHLWPLWUXQ GHQ3XQ]HQGLH%DXFKVFKXSSHQPLWER JHQI¤UPLJHQ5LW]XQJHQDQJH]HLJW*U©QH 3DWLQDLQWDNW u 3URYHQLHQ]6FKZHL]HU3ULYDWEHVLW]$$HKHPDOV 6FKZHL]HU3ULYDWVDPPOXQJ1HXFK“WHOI©UGLHVH HUZRUEHQ%HL*RUQ\ 0RVFK0©QFKHQ $XNWLRQ/RV 'DUJHVWHOOWLVWYHUPXWOLFKGHU6FKODQJHQJRWW*O\ NRQGHUGHP$VNOHSLRVNXOWHQWVWDPPWHXQGYRU DOOHP LP  XQG  -K Q &KU HLJHQH NXOWLVFKH 9HUHKUXQJ HUIXKU ,Q $ERXQRWHLFKRV EHJU©QGH WH GHU YRQ /XNLDQ EHVFKULHEHQH $OH[DQGHU YRQ $ERXQRWHLFKRVVHLQHLJHQHV6FKODQJHQRUDNHOGDV QDFK/XNLDQPLWWHOVHLQHU+DQGSXSSHEHWULHEHQ ZXUGH'HP.XOWGHV6FKODQJHQJRWWHVIROJWHQDEHU DXFKSURPLQHQWH0LWJOLHGHUGHV.DLVHUKDXVHVVR JDU0DUF$XUHOVROODQLKQJHJODXEWKDEHQ %URQ]H}JXUHRIDQHQFRLOHGVQDNHUDLVLQJLWhVKHDG ZLWKEHDUGDQGFRPESUREDEO\GHSLFWLQJWKHVQDNH JRG*O\NRQ5RPDQ,PSHULDO3HULRGFDQGUG FHQWXU\$'*UHHQSDWLQDLQWDFW



 )XgIUDJPHQW 6S”WKHOOHQLVWLVFK RGHU IU© KHUH.DLVHU]HLW  -K Y &KU   -K Q &KU / FP + FP +RKOJXVV )UDJ PHQW HLQHU OHEHQVJURgHQ %URQ]HVWD WXH 9RUGHUWHLO HLQHV UHFKWHQ )XgHV PLW 6DQGDOHQ ZDKUVFKHLQOLFK FDOLJDH GLH LQ HLQHPGLDJRQDOHP6\VWHP©EHUNUHX]JH EXQGHQVLQG+HUUOLFKHGXQNHOJU©QH3DWL QDH[]HOOHQWH4XDOLW”WIUDJPHQWDULVFK u 3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLW GHQHU-DKUHQ )UDJPHQW RI D OLIH VL]H ODWH KHOOHQLVWLF RU HDUO\ URPDQ LPSHULDO EURQ]H VWDWXH GHSLFWLQJ WKH IRUHSDUWRIWKHULJKWIRRWZHDULQJVDQGDOVZLWKDQ HODERUDWHV\VWHPRIVWULQJVVWFHQWXU\%&QG FHQWXU\$'$WWUDFWLYHSDWLQDLQWDFW

104 %URQ]HKDQG PLW *HZDQGVDXP 5¤PLVFKH .DLVHU]HLW    -K Q &KU / FP +RKOJXVV )UDJPHQW HLQHU HWZDV ©EHU OHEHQVJURgHQ %URQ]HVWDWXH 'LH OLQNH +DQG LVW OHLFKW JH¤IIQHW (UKDOWHQ VLQG GHU 'DXPHQ GHU 5LQJ XQG GHU 0LWWHO }QJHU$XIGHP0LWWHO}QJHUVLW]WHLQ5LQJ PLWRYDOHU3ODWWHZRKOHLQKHOOHQLVWLVFKHU RGHU IU©KNDLVHU]HLWOLFKHU 5LQJW\SXV 'HU KLQWHUH7HLOGHU+DQGLVWYRQHLQHP*H ZDQGVDXPEHGHFNW'XQNHOJU©QH3DWLQD H[]HOOHQWH4XDOLW”WIUDJPHQWDULVFK u 

78

3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLW GHQHU-DKUHQ 1DFKGHU$XVVWDWWXQJPLW5LQJXQG©SSLJHP*H ZDQGXQGGHUOHLFKWHQEHUOHEHQVJU¤gHG©UIWHGDV


104

)UDJPHQWZRKO]XU'DUVWHOOXQJHLQHUKRFKUDQJL JHQ 3HUV¤QOLFKNHLW GHV U¤PLVFKHQ .DLVHUUHLFKHV JHK¤UWKDEHQ )UDJPHQWRIDQRYHUOLIHVL]HURPDQEURQ]HVWDWXHRI DKLJKUDQNHGSHUVRQRIWKHHPSLUH3UHVHUYHGDUH WKXPEULQJDQGPLGGOH}QJHUWKHODWWHUDGRUQHG ZLWKDULQJRIWKHKHOOHQLVWLFRUHDUO\URPDQW\SH %DFNSDUWRIWKHKDQGFRYHUHGZLWKFORWKVWQG FHQWXU\$'*UHHQSDWLQDIUDJPHQWDU\

105 %URQ]HKDQG PLW JURgHP 5LQJ 5¤PLVFKH .DLVHU]HLW    -K Q &KU / FP +RKOJXVV )UDJPHQW HLQHU ©EHUOHEHQV JURgHQ%URQ]HVWDWXH'LHOLQNH+DQGK”OW HLQHQ VFKODXFKDUWLJHQ *HJHQVWDQG YLHO OHLFKW=©JHO$XIGHP5LQJ}QJHUVLW]WHLQ JURgHU5LQJPLWUXQGHU3ODWWHDXIGHUHLQ 6I¤UPLJHV 6\PERO VLW]W 'XQNHOJU©QH 3DWLQDIUDJPHQWDULVFK u 3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLW GHQHU-DKUHQ

105

)UDJPHQWRIDQRYHUOLIHVL]HURPDQEURQ]HVWDWXH 7KHKDQGKROGVDWXEXODUREMHFWSRVVLEO\UHLQV 7KHSRLQWHULVDGRUQHGZLWKDODUJHULQJZLWKD 6VKDSHGRUQDPHQWVWQGFHQWXU\$'*UHHQ SDWLQDIUDJPHQWDU\

79






80




109

 Handfragment. 5¤PLVFKH.DLVHU]HLW-KQ&KU/FP +RKOJXVV )UDJPHQW HLQHU HWZDV ©EHUOHEHQVJURgHQ %URQ]HVWD WXH'LHUHFKWH+DQGLVWOHLFKWJH¤IIQHW(UKDOWHQVLQGGLH)LQ JHUDXgHUGHP'DXPHQ$XVJHDUEHLWHWLVWQXUGLH2EHUVHLWHGHU +DQGGLHZDKUVFKHLQOLFKDXIHLQHP*HZDQGDX~DJ'XQNHOJU© QH3DWLQDIUDJPHQWDULVFK u 3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQHU-DKUHQ )UDJPHQWRIDVOLJKWRYHUOLIHVL]HURPDQEURQ]HVWDWXH7KXPEDQGORZHUVLGH RIWKH}QJHUVDUHQRWZRUNHGRXWUHVSHFWLYHO\RSHQVWQGFHQWXU\$' *UHHQSDWLQDIUDJPHQWDU\

 Geschlechtsteil. 5¤PLVFKH.DLVHU]HLW-KQ&KU+FP % FP +RKOJXVV )UDJPHQW HLQHU HWZDV ©EHUOHEHQVJURgHQ %URQ]HVWDWXH 'DV 6W©FN ZXUGH RIIHQEDU VHSDUDW JHIHUWLJW XQG HLQJHVHW]W 6HLWOLFK HLQH DQWLNH )OLFNXQJ 6FK¤QH GXQNHOJU©QH 3DWLQDUHFKWHXQGOLQNHREHUH(FNHJHEURFKHQ u 3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQHU-DKUHQ )UDJPHQWRIDQRYHUOLIHVL]HURPDQEURQ]HVWDWXH7KHJHQLWDOSDUWDSSDUHQWO\ KDVEHHQZRUNHGVHSDUDWHO\WREHLQVHUWHGVWUGFHQWXU\$'*UHHQSDWLQD XSSHUHGJHVEURNHQ

 %URQ]HKDQG 5¤PLVFKH .DLVHU]HLW    -K Q &KU + FP +RKOJXVV)UDJPHQWHLQHUXQWHUOHEHQVJURgHQ%URQ]HVWDWXH'LH

OLQNH +DQG LVW OHLFKW JH¤IIQHW XQG KLHOW ZDKUVFKHLQOLFK HLQHQ *HJHQVWDQG 'HU =HLJH}QJHU LVW DXVJHVWUHFNW 'XQNHOJU©QH 3DWLQDH[]HOOHQWH4XDOLW”WIUDJPHQWDULVFK u 3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQHU-DKUHQ )UDJPHQWRIDQXQGHUOLIHVL]HURPDQEURQ]HVWDWXH7KHOHIWKDQGLVVOLJKWO\ RSHQZLWKDVWUHFKWHGRXWSRLQWHUVWQGFHQWXU\$'*UHHQSDWLQD

109 • +HUDNOHV DOV %©VWHQJHZLFKW 5¤PLVFK    -K Q &KU + FP NJ PLW PRGHUQHP 0HWDOOVWLIW %URQ]H LQQHQ PLW %OHL YHUI©OOW *HZLFKW LQ )RUP HLQHU %©VWH GHV E”UWLJHQ +H UDNOHVPLWHLQHPVFKU”J©EHUGLH6FKXOWHUJHOHJWHQ5LHPHQHL QHP ©EHU GLH OLQNH 6FKXOWHU KLQDEIDOOHQGHQ /¤ZHQVNDOS XQG HLQHPSU”FKWLJHQ/RUEHHUNUDQ]GHVVHQ%LQGHQHQGHQLQ:HOOHQ DXIGHQ6FKXOWHUQDX~LHJHQ'XQNHOJU©QH3DWLQD7HLOGHU%LQGH IHKOWGLH6LOEHUHLQODJHQGHU$XJHQIHKOHQ u 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ 6FKZHL]HU 3ULYDWEHVLW] H[ RVWIUDQ]¤VLVFKH 3ULYDWVDPPOXQJ (UZRUEHQ YRQ 1LFRODV.RXWRXODNLV*DOOHU\3DULV 9JO 1 )UDQNHQ $HTXLSRQGLD )LJ©UOLFKH /DXIJHZLFKWH U¤PLVFKHU XQG E\]DQWLQLVFKHU6FKQHOOZDDJHQ  7DI$II 6WHHO\DUGZHLJKWLQIRUPRIDEXVWRI+HUDNOHVZHDULQJDODYLVKODXUHOZUHDWK 7KHOLRQVNLQOLHVRQKLVOHIWVKRXOGHU5RPDQVWQGFHQWXU\$'%URQ]H }OOHGZLWKOHDG2QWRSRIWKHKHDGLVDORRSIRUVXVSHQVLRQ'DUNJUHHQSDWLQD VLOYHULQOD\VRIWKHH\HVPLVVLQJ

81


110

111

82

110




110 Satyrkopf. 5¤PLVFKH .DLVHU]HLW    -K Q &KU + FP NJ +RKOJXVV PLW %OHL YHUI©OOW 'HU MXJHQGOLFKH 6DW\U PLW OHLFKW JH¤IIQHWHP 0XQG XQG DXIJHULVVHQHQ $XJHQ WU”JW HLQHQ 3LQLHQNUDQ]LPZLOGHQORFNLJHQ+DDU'DV6W©FNZXUGHRIIHQ EDUDOV0DUNWJHZLFKWEHQXW]W$XIGHU.DORWWHEH}QGHWVLFKHLQH YLHUHFNLJH9HUWLHIXQJLQGHUGLH$XIK”QJXQJEHIHVWLJWZDU'LH 8QWHUVHLWHLVWHEHQIDOOVRIIHQ+HUUOLFKHGXQNHOJU©QH3DWLQDH[ ]HOOHQWHU6WLO u 3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQHU-DKUHQ 5RPDQVWHHO\DUGZHLJKWLQIRUPRIDVDW\UyVKHDG7KH\RXQJVDW\UKDVKLVH\HV ZLGHRSHQDQGZHDUVDSLQHZUHDWKLQKLVZLOGFXUO\KDLUVWQGFHQWXU\ $'*UHHQSDWLQDH[FHOOHQWVW\OH

111 • 3IHUGHN¤S}JHU '”PRQ FD  -K Q &KU + FP 9ROOJXVV 0HQVFKOLFKH*HVWDOWPLWHLQHPOHLFKW]XU6HLWHJHQHLJWHQ3IHUGH NRSIPLW6WLUQVFKRSI6LHLVWPLWHLQHPNXU]HQ6FKXU]EHNOHLGHW YRQGHPHLQH6WRIIEDKQDXFK]ZLVFKHQGHQ%HLQHQGXUFKJHI©KUW XQGPLWHLQHPXPGLH+©IWHQJHI©KUWHQ:XOVWYHUNQRWHWLVW'LH UHFKWH+DQGOLHJWIUHLYRUGHP%DXFK'LHOLQNH+DQGKLHOWGHQ 5HVWHLQHV=DXP]HXJHVGDVZRKOPLWGHU.QHEHO7UHQVHDXIGHU OLQNHQ6FKXOWHUGHU)LJXUYHUEXQGHQZDU%HLGH+”QGHVLQGDXI I”OOLJJURgJHVWDOWHWEHUGDV*HV”g}HOGHP$QVFKHLQQDFKXU VSU©QJOLFKHLQODQJHU6FKZDQ]KLQDEGHUKHXWHIHKOWXQGGHVVHQ $QVDW]VWHOOHUHWXVFKLHUWLVW*U©QH3DWLQD6FKZHLIXQG$WWULEXWH IHKOHQ3URIHVVLRQHOOUHVWDXULHUWPLW(UJ”Q]XQJHQXQG:LHGHUDQ VHW]XQJHQDQGHQ%HLQHQXQG$UPHQ u

%OLW]E©QGHO GLH 5HFKWH ZDU DXI HLQ =HSWHU JHVW©W]W *U©QH 3DWLQD6FKOLHgPHFKDQLVPXVIHKOW u 3URYHQLHQ]([6DPPOXQJ,&%DGHQ:©UWWHPEHUJHUHU-DKUH 'LH)LJXUVWHOOWHLQH$EZDQGOXQJGHV7\SXV=HXV,QFH%OXQGHOOGDUEHLGHU $UPKDOWXQJXQG.RSIKDOWXQJXQGGDV6WDQGPRWLYXPJHNHKUWZXUGHQ'DV 9RUELOGGHV7\SXV,QFH%OXQGHOOI©KUWPDQ]XU©FNDXIHLQ:HUNDXVGHU+DQG GHV/HRFKDUHV(VZXUGHXPY&KUJHVFKDIIHQ8QWHUU¤PLVFKHU +HUUVFKDIWJHODQJWHGLH6NXOSWXUQDFK5RP1DFKGHP$XJXVWXV=HXVHLQHQ HLJHQHQ7HPSHODXIGHP.DSLWROVK©JHOJHZHLKWKDWWHZXUGHGHU7\SXVDXFK LQGHU.OHLQNXQVWEHOLHEW9JO$/HLEXQGJXW'LHU¤PLVFKHQ%URQ]HQLQGHU 6FKZHL],,$YHQFKHV  .DW7DI =HXV%URQWDLRV5RPDQVWFHQWXU\$'DIWHUD&ODVVLFDO*UHHNSURWRW\SH (\HVLQODLGLQVLOYHU RQHPLVVLQJ %HDXWLIXOROLYHJUHHQSDWLQD6FUDWFKHVDW WKHEDFNVLGH5LJKWKDQGDQGULJKWIRRWEURNHQ

 9HQXV PLW %UXVWEDQG 5¤PLVFK  9LHUWHO  -K Q &KU + FP XQG PLW 6RFNHO FP 9ROOJXVV Mit Sockel! *U©QH 3DWLQDLQWDNW u 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 1RUPDOHUZHLVHWUXJGLH5¤PHULQHLQHVROFKH%UXVWELQGH IDVFLDSHFWRUDOLV RGHUDXFKVDVFLDPDPLOOD XQWHULKUHP2EHUJHZDQGLQGHUJOHLFKHQ)XQNWLRQ ZLHGHUPRGHUQH%+,PHURWLVFKHP$PELHQWHZLHHWZDEHLP%HVXFKEHL HLQHU3URVWLWXLHUWHQNRQQWHGLHVHV.OHLGXQJVVW©FNDEHUDXFKDOV5HL]Z”VFKH 9HUZHQGXQJ}QGHQ 9HQXVZLWKIDVFLDSHFWRUDOLV5RPDQUGTXDUWHUQGFHQWXU\$'*UHHQ SDWLQDLQWDFWMounted on a base!

3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWDXV ,VUDHOPLW$XVIXKUJHQHKPLJXQJGHULVUDHOLVFKHQ$QWLNHQEHK¤UGHQ%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV 6ROFKH SIHUGHN¤S}JHQ '”PRQHQ HUVFKHLQHQ LQ GHU $QWLNH YRU DOOHP LQ GHQ 7H[WHQ GHU VRJ )OXFKWDIHOQw 0DQ KRIIWH GXUFK %HVFKZ¤UXQJHQ LQ GDV*HVFKHKHQDXIGHU5HQQEDKQHLQ]XJUHLIHQ3IHUGHUHQQHQZDUHQLQGHU 6S”WDQWLNHHLQHGHU+DXSWDWWUDNWLRQHQLQGHQ6W”GWHQ YJO$&DPHURQ&LUFXV )DFWLRQV%OXHVDQG*UHHQVDW5RPHDQG%\]DQWLXP>@ 'LH=XVFKDXHU RUJDQLVLHUWHQVLFKLQYHUVFKLHGHQHQYHUIHLQGHWHQ3DUWHLHQ%HL1LHGHUODJHQ NRQQWH HV ]X VFKZHUHQ $XVVFKUHLWXQJHQ NRPPHQ (LQH /LHEOLQJVW”WLJNHLW YRQ5HQQIDKUHUQXQG)DQVZDUHVIHLQGOLFKH*HVSDQQHGXUFK=DXEHU]X EHKLQGHUQ'DEHLVSLHOWHHLQSIHUGHN¤S}JHU'”PRQHLQH5ROOHZLHZLULKQKLHU YRUXQVKDEHQXQGGHQZLUDXVGHQ=DXEHUW”IHOFKHQNHQQHQ9RQ5LFKDUG :©QVFKZXUGHQVROFKH)LJXUHQI”OVFKOLFKHUZHLVHPLWGHP”J\SWLVFKHQ6HWK 7LHUwLQ9HUELQGXQJJHEUDFKWKHXWHZLVVHQZLUDEHUGDVVHVVLFKXPHLQHQ SIHUGHN¤S}JHQ'”PRQKDQGHOWYRQGHPPDQJODXEWHGDVVHU(LQ~XVVDXI GLH*HVSDQQHKDEHQN¤QQH YJOLQVEHVRQGHUH-**DJHU&XUVH7DEOHWVDQG %LQGLQJ6SHOOVIURPWKH$QFLHQW:RUOG>@61U =XGLHVHP '”PRQYJODXFK*1˜PHWK7KH+RUVH+HDG'HPRQ6\OORJH(SLJUDSKLFD %DUFLQRQHQVLV   6  9HUPXWOLFK VWDQG GHU SIHUGHN¤S}JH '”PRQDXIHLQHU%DVLVPLWGHUHQWVSUHFKHQGHQ)OXFK)RUPHOw %URQ]H }JXUH RI D KRUVHKHDGHG GHPRQ ZHDULQJ D VKRUW VNLUW 2Q KLV OHIW VKRXOGHUDKRUVHELW5RPDQ,PSHULDO3HULRGDERXWUGFHQWXU\$'*UHHQ SDWLQDWDLOEURNHQ ,Q/DWH$QWLTXLW\+RUVH+HDG'HPRQVZHUHVXSSRVHGWRLQ~XHQFHWKHFDUULDJH WHDPVRIKRUVHUDFLQJV,QWKLVZD\WKHVXSSRUWHUVRIDVSHFLDOWHDPKRSHGWR OD\DFXUVHXSRQWKHSDUW\WKH\GLVIDYRXUHGSUHYHQWLQJWKHLUYLFWRU\3UREDEO\ WKLVVWDWXHWWHZDVHPEHGGHGLQDEDVHLQVFULEHGZLKWKHVSHFL}FPDOHGLFWLRQ SKUDVH FI-**DJHU&XUVH7DEOHWVDQG%LQGLQJ6SHOOVIURPWKH$QFLHQW :RUOG>@SQR 

 =HXV5¤PLVFKH.DLVHU]HLW-KQ&KU+FP9ROOJXVV 1DFNWHU PXVNXO¤VHU VWHKHQGHU =HXV PLW HLQHP %OLW]E©QGHO LQGHUJHVHQNWHQ/LQNHQ'DVP”FKWLJH+DXSWXPZDOOWGLFNHV ORFNLJHV +DXSW XQG %DUWKDDU GDV LQ GHU $UW GHU )U©KNODVVLN V\PPHWULVFKDQJHOHJWLVW'LH$XJHQZDUHQLQ6LOEHUHLQJHOHJW ZREHLQXUGLHUHFKWH(LQODJHHUKDOWHQLVW$XFKGLH%UXVWZDU]HQ VLQG LQ DQGHUHP 0DWHULDO HLQJHOHJW 'LH /LQNH K”OW QRFK GDV



83


114

115

114 =HXV 5¤PLVFK    -K Q &KU + FP 9ROOJXVV =HXV PLW %OLW]E©QGHO LQ GHU JHVHQNWHQ 5HFKWHQ GLH HUKREHQ /LQNH ZDUHKHPDOVDXIHLQ=HSWHUJHVW©W]W6DPWLJHROLYJU©QH3DWLQD UHFKWHU)XgJHEURFKHQSURYLQ]LHOOHU6WLO u

 Merkur. 5¤PLVFK    -K Q &KU + PLW 6RFNHO FP 9ROOJXVV'HU*¤WWHUERWHPLWJH~©JHOWHP3HWDVRV&KODP\VXQG *HOGEHXWHO Mit Sockel! *U©QH 3DWLQD &DGXFHXV IHKOW VRQVW LQWDNW u

3URYHQLHQ]([6DPPOXQJ+-6+HVVHQH[*RUQ\ 0RVFK0©QFKHQ $XNWLRQ/RVH[6DPPOXQJ*.0©QFKHQHUZRUEHQLQ GHQHU-DKUHQ

3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 0HUFXU\ZLWKSXUVHRQEDVH5RPDQQGUGFHQWXU\$'*UHHQSDWLQD FDGXFHXVLVPLVVLQJRWKHUZLVHLQWDFW

=HXVZLWKWKXQGHUEROW5RPDQVWUGFHQWXU\$'2OLYHJUHHQSDWLQD ULJKWIRRWEURNHQSURYLQFLDOVW\OH

115 Harpokrates. 5¤PLVFKH.DLVHU]HLW-KQ&KU+FP9ROO JXVV'HWDLOVZLH]XP%HLVSLHOGLH+DDUHXQG3XEHVLQ.DOWDU EHLW)URQWDOVWHKHQGHUQDFNWHUHWZDVNRUSXOHQWHU-©QJOLQJPLW VFKXOWHUODQJHP+DDU,QGHU/LQNHQK”OWHUHLQ)©OOKRUQLQGHP HLQH8U”XVVFKODQJHVLW]W$QVDW]HLQHVXQNODUHQ$WWULEXWVDXIGHU UHFKWHQ 6FKXOWHU 6FK¤QH NDVWDQLHQEUDXQH 3DWLQD OLQNH +DQG XQGUHFKWHU8QWHUDUPQLFKWDXVJHJRVVHQ u 3URYHQLHQ]([6DPPOXQJ$$)UDQNUHLFK(KHPDOV3ULYDWVDPPOXQJ(OVD %ORFK'LHQHU6FKZHL]6DPPOXQJV]HLWUDXP %URQ]H}JXUHRIVWDQGLQJ+DUSRFUDWHVDVDER\ZLWKFRUQXFRSLDRQKLVOHIW DUP8UDHXVRQWRSRIFRUQXFRSLD " UGFHQWXU\$'$SSHDOLQJDXEXUQ SDWLQDOHIWKDQGDQGULJKWIRUHDUPQRWFDVWRXW

84

 Athena. 5¤PLVFKH .DLVHU]HLW    -K Q &KU + FP 9ROOJXVV ,Q ZDOOHQGHP *HZDQG HLQKHUVFKUHLWHQGH *¤WWLQ PLW ©EHU GLH %UXVW JHOHJWHU ŠJLV XQG HLQHP NRULQWKLVFKHQ +HOP $UPH )©gH XQG +HOPEXVFK JHEURFKHQ HLQH $XJHQHLQODJH IHKOW.RSIZLHGHUDQJHVHW]W'UXFNVWHOOHDQ1DVHXQG.LQQ u 3URYHQLHQ]([6DPPOXQJ,&%DGHQ:©UWWHPEHUJHUHU-DKUH 5RPDQEURQ]H}JXULQHRI$WKHQDLQ~RZLQJUREH7KHJRGGHVVLVZHDULQJ DHJLVDQGFRULQWKLDQKHOPHW$UPVIHHWDQGFUHVWEURNHQKHDGUHDWWDFKHG GHQWDWQRVHDQGFKLQ2QHH\HLQOD\PLVVLQJ






 Genius. 5¤PLVFKH .DLVHU]HLW MXOLVFKFODXGLVFKH 3HULRGH  +”OIWH-KQ&KU+FP9ROOJXVV6WHKHQGHU5¤PHUPLW .XU]KDDUIULVXU LP 6WLO GHV MXOLVFKFODXGLVFKHQ .DLVHUKDXVHV LQ HLQHUZHLWHQ©EHUGHQ.RSIJH]RJHQHQ7RJDPLWHLQHP)©OOKRUQ LQGHU/LQNHQXQGHLQHU2SIHUVFKDOHLQGHU5HFKWHQ5RWEUDXQH 3DWLQDLQWDNW u 3URYHQLHQ] ([ *ULPP &ROOHFWLRQ 3DULV ([ *RUQ\  0RVFK 0©QFKHQ $XNWLRQ/RV$XV6FKZHL]HU3ULYDWVDPPOXQJ 'HUDUWLJH )LJXUHQ ZXUGHQ DXFK DOV DOOJHPHLQH 'DUVWHOOXQJHQ U¤PLVFKHU )DPLOLHQJHQLHQLQWHUSUHWLHUW9JO$.DXIPDQQ+HLQLPDQQ'LHU¤PLVFKHQ %URQ]HQLQGHU6FKZHL],$XJVW  .DW+.XQFNHO'HUU¤PLVFKH *HQLXV  7DII.DW),XQG),, %URQ]H}JXUHRID5RPDQ*HQLXVZHDULQJKLV7RJDFDSLWHYHODWR&RUQXFRSLD LQKLVOHIWDQGDSDWHUDLQKLVULJKWKDQGKDLUVW\OHRI-XOLR&ODXGLDQ3HULRG VWFHQWXU\$'$XEXUQSDWLQDLQWDFW



85


119

119 Apollon. *ULHFKHQODQG9LHUWHO0LWWH-KY&KU+FP 9ROOJXVV1DFNWHU-©QOLQJLQOHLFKWNRQWUDSRVWLVFKHP6WDQGPLW HLQHU IU©KNODVVLVFKHQ +RFKVWHFNIULVXU 'LH JHVHQNWH 5HFKWH K”OW HLQH 3KLDOH GLH JHVFKORVVHQH /LQNH KLHOW HLQHQ VHQNUHFK WHQ VWDEDUWLJHQ *HJHQVWDQG YLHOOHLFKW HLQHQ %RJHQ +HUUOLFKH GXQNHOJU©QH3DWLQDLQWDNW u 3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQHU-DKUHQ *UHHN(DUO\&ODVVLFDOEURQ]H}JXUHRI$SROORDVDQDNHG\RXQJPDQZLWKDQ HDUO\FODVVLFDOKDLUVW\OHKROGLQJDSKLDOHLQKLVULJKWKDQG7KHOHIWRULJLQDOO\ SUREDEO\KHOGDERZ*UHHQSDWLQDLQWDFWQGTXDUWHUPLGWKFHQWXU\ %&

 Apollo beim Opfern. 5¤PLVFK+”OIWH-KQ&KU+FP 9ROOJXVV'HU*RWWPLW.¤FKHUDXIGHP5©FNHQK”OWHLQH3DWHUD XQGHLQHQ=ZHLJ6FK¤QHGXQNHOJU©QH3DWLQDZLQ]LJH.RUURVL RQVVSXUHQVRQVWLQWDNW u 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ $SROORZLWKTXLYHUSDWHUDDQGEUDQFK5RPDQQGKDOIQGFHQWXU\$' 1LFHGDUNJUHHQSDWLQDWLQ\WUDFHVRIFRUURVLRQRWKHUZLVHLQWDFW

86



 )RUWXQD5¤PLVFKH.DLVHU]HLW-KQ&KU+FP9ROO JXVV 6WHKHQGH *O©FNVJ¤WWLQ JHNOHLGHW LQ HLQHQ NXU]”UPHOLJHQ &KLWRQXQGHLQVFKU”JXPGLH+©IWHQJHOHJWHV+LPDWLRQ'LHJH VHQNWH5HFKWHKLHOWHKHPDOVHLQ6WHXHUUXGHULQGHU/LQNHQOLHJW HLQ©EHUERUGHQGHV)©OOKRUQ'DV+DDUHQGHWLQHLQHPNOHLQHQ 'XWW$XIGHP.RSIVLW]WHLQ'LDGHPXQGHLQ3RORV8PGHQ +DOV HLQ U¤PLVFKHU *ROGRKUULQJ ]XJHK¤ULJHV 9RWLY"  6FK¤QH JU©QH3DWLQDPLWU¤WOLFKHQ(LQVSUHQJVHOQ$EJHVHKHQYRQGHP IHKOHQGHQ5XGHULQWDNW u 3URYHQLHQ]([*ULPP&ROOHFWLRQ3DULV([*DOOHU\'UHHV$UFKHR3DULV -XQL'DYRUDOWHIUDQ]¤VLVFKH3ULYDWVDPPOXQJ 5RPDQEURQ]H}JXULQHRI)RUWXQDKROGLQJDFRUQXFRSLDLQKHUOHIW7KHKHDG LVDGRUQHGZLWKDGLDGHPDQGDSRORV7KHOHIWRULJLQDOO\KHOGDUXGGHU$ JROGHQURPDQHDUULQJDURXQGWKHQHFNPLJKWEHDEHORQJLQJYRWLYHVWQG FHQWXU\$'*UHHQSDWLQDDSDUWIURPWKHPLVVLQJUXGGHULQWDFW






 Eros. 5¤PLVFK-KQ&KU+FP9ROOJXVV(LQJHEUR FKHQHU%URQ]HDQVDW]DQGHUUHFKWHQ6FKXOWHU]HLJWGDVVHVVLFK XPHLQH%HJOHLW}JXUHLQHU$SKURGLWHVWDWXHWWHKDQGHOW*U©QH3D WLQDLQWDNW u 3URYHQLHQ]([6DPPOXQJ+-6+HVVHQH[*RUQ\ 0RVFK0©QFKHQ $XNWLRQ/RV1DFKODVVDXVGHU6DPPOXQJ-/RUHQ]2EHUQ]HOO GRUWVHLWFD (URV 2ULJLQDOO\ KH ZDV FRQQHFWHG WR D }JXULQH RI $SKURGLWH ZLWK D QRZ EURNHQEURQ]HEDUHQGLQJDWKLVULJKWVKRXOGHU5RPDQQGUGFHQWXU\ $'*UHHQSDWLQDLQWDFW

 Jupiter mit Adler. 5¤PLVFK    -K Q &KU + FP % FP 9ROOJXVV *U©QH 3DWLQD OLQNHU 8QWHUDUP JHEURFKHQ NOHLQHV)UDJPHQWGHV%OLW]HVIHKOW u 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ -XSLWHUDQGHDJOH5RPDQQGUGFHQWXU\$'*UHHQSDWLQDOHIWORZHU DUPLVEURNHQOLWWOHIUDJPHQWRIWKHWKXQGHUEROWLVPLVVLQJ



87






 Ausruhender Herakles. 5¤PLVFK    -K Q &KU + FP 9ROOJXVV'HU+HOGVLW]WDXIHLQHP)HOVHQVHLQH5HFKWHDXIGLH .HXOH JHVW©W]W 'XQNHOJU©QH 3DWLQD OHLFKWH .RUURVLRQVVSXUHQ DXIGHU2EHU~”FKHVRQVWLQWDNW u 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ +HUDNOHVVLWWLQJRQDURFNDQGUHVWLQJKLVULJKWRQWKHFOXE5RPDQVW QGFHQWXU\$''DUNJUHHQSDWLQDWLQ\WUDFHVRIFRUURVLRQDWWKHVXUIDFH RWKHUZLVHLQWDFW

 Etruskische Statuette. 0LWWH-KY&KU+XQGPLW6RFNHO FP9ROOJXVVPLW.DOWDUEHLW1DFNWHP”QQOLFKH*HVWDOWPLW YRUJHVWUHFNWHQ$UPHQMit Sockel!'XQNHOJU©QH3DWLQD8QWHU DUPHJHEURFKHQ u 3URYHQLHQ]([6DPPOXQJ*+DXFN6©GGHXWVFKODQGHUZRUEHQDXV HLQHUGHXWVFKHQ$OWVDPPOXQJGHVXQGIU©KHQ-KV (WUXVFDQPDOHVWDWXHWWHWKFHQWXU\%&'DUNJUHHQSDWLQDORZHUDUPVDUH EURNHQWith base!



88






 Etruskische Statuette. -KY&KU+XQGPLW6RFNHOFP 9ROOJXVV PLW .DOWDUEHLW 1DFNWH P”QQOLFKH *HVWDOW PLW DXVJH VWUHFNWHQ$UPHQMit Sockel!'XQNHOJU©QH3DWLQDLQWDNW u 3URYHQLHQ]([6DPPOXQJ*+DXFN6©GGHXWVFKODQGHUZRUEHQDXV HLQHUGHXWVFKHQ$OWVDPPOXQJGHVXQGIU©KHQ-KV (WUXVFDQPDOHVWDWXHWWHWKFHQWXU\%&'DUNJUHHQSDWLQDLQWDFW With base!

 Herakles. (WUXULHQ  -K Y &KU + FP 9ROOJXVV 'HWDLOV ZLH ]XP %HLVSLHO GLH +DDUH XQG 3XEHV LQ .DOWDUEHLW )URQWDO VWHKHQGHUQDFNWHU+HUDNOHVPLWQDFNHQODQJHP+DDU8PGHQ OLQNHQ $UP GDV /¤ZHQIHOO JHZLFNHOW YRQ GHP GDV +LQWHUWHLO KHUDEI”OOW'LHHUKREHQH5HFKWHKLHOWGLH.HXOHGLH/LQNHHLQHQ VHQNUHFKWHQ*HJHQVWDQG$XVJH]HLFKQHWH4XDOLW”W6FK¤QHGXQ NHOJU©QH3DWLQDLQWDNW u

e Etruskischer Krieger. -KY&KU+FP9ROOJXVV:RKO HLQ*HU”WHDXIVDW]$XIHLQHUVFKPDOHQ6WDQGSODWWHHLQDXVVFKUHL WHQGHUPXVNXO¤VHUQDFNWHU0DQQPLWHUKREHQHU5HFKWHUGLH ZRKOHKHPDOVHLQHQ6SHHUVFKOHXGHUWHXQGJHVHQNWHUQLFKWJDQ] DXVJHDUEHLWHWHU/LQNHUDQGHUXUVSU©QJOLFKHLQ6FKLOGEHIHVWLJW ZDU'DVNXU]HNDSSHQDUWLJDX~LHJHQGH+DDULVWLQGHWDLOUHLFKHU .DOWDUEHLWLQIHLQH6LFKHOORFNHQJHJOLHGHUW6FK¤QHGXQNHOJU©QH 3DWLQD+”QGHIHKOHQ u 3URYHQLHQ]([6RWKHE\yV/RQGRQ 7HLOHLQHV.RQYROXWVXQGDOV U¤PLVFKNODVVL}]LHUW  (WUXVFDQEURQ]H}JXULQHRIQDNHGZDUULRUZKRRULJLQDOO\KHOGDVSHDULQKLV UDLVHGULJKWKDQGDQGDVKLHOGLQKLVOHIW7KHVKRUWKDLUZLWKLQFLVHGORFNV WKUGFHQWXU\%&$WWUDFWLYHJUHHQSDWLQDKDQGVPLVVLQJ

3URYHQLHQ]([6DPPOXQJ$$)UDQNUHLFK(KHPDOV3ULYDWVDPPOXQJ(OVD %ORFK'LHQHU6FKZHL]6DPPOXQJV]HLWUDXP (WUXVFDQEURQ]H}JXUHRI+HUDFOHVZLWKDOLRQVNLQWKFHQWXU\%&([FHOOHQW JUHHQSDWLQDLQWDFW

89






 1XUDJKLVFKHV,GRO6DUGLQLHQ-KY&KU+FP9ROO JXVV )LJXU HLQHV 0DQQHV PLW JHK¤UQWHP +HOP PLW KRFKJH NODSSWHP9LVLHU6FKZHUW.¤FKHUXQGHLQH.HXOHVLQGDXIGHQ 5©FNHQJHVFKQDOOWEHUGLH%UXVWK”QJWHLQEUHLWHV%DQGKHUDE GDVLQHLQHPDEJHVHW]WHQ4XDGUDWHQGHW$XIGHUOLQNHQ6FKXOWHU OLHJWHLQ6WDEYHUPXWOLFKGHU5HVWHLQHV6FKZHUWHVDXI*U©QH 3DWLQD%HLQH$UPH+RUQGHV+HOPHVXQG2EMHNWDQGHUOLQ NHQ6FKXOWHUJHEURFKHQ.OHLQHV)UDJPHQWZLHGHUDQJHVHW]W u 3URYHQLHQ]([0©QFKQHU3ULYDWVDPPOXQJH[*RUQ\ 0RVFK0©QFKHQ $XNWLRQ/RVXQG$XNWLRQ/RVGDYRUGHXWVFKH 3ULYDWVDPPOXQJ5*HUZRUEHQLP6FKZHL]HU.XQVWKDQGHOXQWHU%HUDWXQJ YRQ/HR0LOGHQEHUJLQGHQHUELVHU-DKUHQYRUPDOV6DPPOXQJ 5RVHQEDXPLQ'HXWVFKODQGVHLWYRU 9JO7KH$UWRIWKH,WDOLF3HRSOHVIURP%&$XVVWHOOXQJ*HQI  II 1XUDJKLFEURQ]H}JXUHRUZDUULRUZLWKKRUQHGKHOPHWFDUU\LQJVZRUGTXLYHU DQGFOXERQKLVEDFN2QKLVOHIWVKRXOGHUDVWDIISUREDEO\WKHUHVWRIDQRWKHU VZRUG6DUGLQLDWKWKFHQWXU\%&*UHHQSDWLQDOHJVDUPVKRUQVDWWKH KHOPHWDQGREMHFWRQOHIWVKRXOGHUEURNHQZLWKDVPDOOIUDJPHQWUHDWWDFKHG

 Aufsatz mit Minervabüste. 5¤PLVFK-KQ&KU+FP 9ROOJXVV*U©QH3DWLQDXQWHQ5HVWHNRUURGLHUWHQ(LVHQV u 

90

3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ


$WWDFKPHQW LQ IRUP RI D 0LQHUYD EXVW 5RPDQQGUGFHQWXU\$'*UHHQSDWLQD ZLWKUHPDLQVRIFRUURGHGLURQ

 Schließe mit Herakles. 5¤PLVFK    -K Q &KU / FP 9ROOJXVV 'HU +HOG EHNOHLGHW PLW HLQHP /¤ ZHQIHOO VWHKW DXI HLQHP OLHJHQGHQ /¤ZHQ 'HQ $EVFKOXVV ELOGHW HLQ 6FKZDQHQNRSI *U©QH 3DWLQD 5HVWH NRUURGLHUWHQ(LVHQV u 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPP OXQJ06VHLWHU-DKUHQ 

&ODVS ZLWK +HUDNOHV DQG KHDG RI D VZDQ 5RPDQQGUGFHQWXU\$'*UHHQSDWLQD ZLWKUHPDLQVRIFRUURGHGLURQ

e Sphinx. 6S”WKHOOHQLVWLVFKIU©KH.DL VHU]HLW-KY&KU-KQ&KU+ FP / FP 9ROOJXVV :RKO HLQ *HU”WHDXIVDW] $XI HLQHU VFKPDOHQ 6WDQGSODWWH OLHJHQGH 6SKLQ[ PLW ODQ JHP+DDUXQGKRFKJHVWHOOWHQDQGHU 6SLW]H DXIJHUROOWHQ )O©JHOQ 6FK¤QH GXQNHOJU©QH XQG URWEUDXQH 3DWLQD LQWDNW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ ,VUDHOELV *UDHFR5RPDQ%URQ]H}JXULQHRIDO\LQJIH PDOHVSKLQ[ZLWKORQJKDLUDQGOLIWHGZLQJV ZKLFKWLSVDUHFXUOLQJLQ3UREDEO\DQDWWDFK PHQW RI VRPH NLQG RI WRRO /DWH +HOOHQLVWLF (DUO\5RPDQ3HULRG

 %URQ]HVWLHU *ULHFKHQODQG FD  -K Y&KU/FP+FP9ROOJXVVPLW 'HWDLOV LQ .DOWDUEHLW *U©QH 3DWLQD 5HVWHYRQ6LQWHULQWDNW u



3URYHQLHQ]([3ULYDWEHVLW]07LQ0©Q FKHQVHLWGHQHU-DKUHQ %URQ]H FDVW EXOO *UHHN DERXW WK FHQWXU\ %&*UHHQSDWLQDUHPDLQVRIVLQWHULQWDFW

 Hahn und Eule. 5¤PLVFKH .DLVHU ]HLW+GHU(XOHFP/GHV+DKQV FP9ROOJXVV2 Stück!'XQNHOJU© QH3DWLQD%HLQHXQGHLQH)HGHUEHLP +DKQJHEURFKHQ u 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPP OXQJ06VHLWHU-DKUHQ 5RRVWHU DQG RZO 5RPDQ ,PSHULDO 3HULRG 'DUN JUHHQ SDWLQD OHJV DQG RQH IHDWKHU RI WKHFRFNDUHEURNHQ2 pieces! 

91






 6FK¤QH6DPPOXQJVLOEHUQHU)LJXUHQ5¤PLVFK-KQ&KU %”UWLJH *RWWKHLW PLW 3DWHUD =ZHLJ XQG :HLQWUDXEH + FP J  =ZHL (URWHQ + FP J  XQG FP J  %©VWH HLQHU *¤WWLQ + FP J  (LQVHLWLJ DXVJHIRUPWHU +DVH/FP J 0DXV/FP J +RFNHQGHU$IIH + FP J  7 Stück! .OHLQH )HKOVWHOOHQ EHL GHQ (URWHQ 6FKZDQ]GHU0DXVJHEURFKHQVRQVWLQWDNW u 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 1LFH&ROOHFWLRQRIVLOYHU}JXULQHVLQFODEHDUGHGJRGWZR(URWHVWKHEXVWRI DJRGGHVVDKDUHDQGPRXVHDVZHOODVDFURXFKLQJPRQNH\5RPDQQG UGFHQWXU\$'/LWWOHIUDJPHQWVDWWKHERWK(URWHVDUHPLVVLQJWKHWDLORI WKHPRXVHLVEURNHQRWKHUZLVHLQWDFWSLHFHV

 9HQXV $QDG\RPHQH 5¤PLVFKH .DLVHU]HLW FD  -K Q &KU + FP %OHLJXVV 9HQXV QDFK GHP %DGH ZULQJW VLFK PLW HLQHU +DQGGLH+DDUHDXV]XLKUHQ)©gHQ(URV'XQNHOJUDXH3DWLQD 6WDQGSODWWHDEJHNQLFNWUHFKWHU$UPYHUGUHKWVRQVWLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ ( 8 %D\HUQ H[ +LUVFK 1DFKI 0©QFKHQ $XNWLRQ/RVLQ'HXWVFKODQGVHLWYRU 9HQXV$QDG\RPHQHZLWK(URVFDVWRIOHDG5RPDQDERXWQGFHQWXU\$' %DVHGHIRUPHGULJKWDUPVNHZHGRWKHUZLVHLQWDFW

 %©VWHGHV6DUDSLV5¤PLVFKH.DLVHU]HLW-KQ&KU+FP %©VWHGHVE”UWLJHQODQJKDDULJHQ6DUDSLVPLWUDQNHQYHU]LHUWHP 3RORVXQGOHLFKWHU:HQGXQJQDFKOLQNV*U©QH3DWLQDLQWDNW u



3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQHU-DKUHQ

92






%URQ]HEXVWRI6DUDSLVZLWK3RORV5RPDQ,PSHULDO3HULRGUGFHQWXU\$' *UHHQSDWLQDLQWDFW

 Applik mit Gorgoneion. 5¤PLVFK    -K Q &KU k FP 9ROOJXVV (LQVHLWLJ JHVWDOWHWH %URQ]HVFKHLEH PLW HLQHP IURQ WDOHQ *RUJRQHLRQ $XI GHP +LQWHUJUXQG ~RUDOH 2UQDPHQWH LQ .DOWDUEHLW XQG GUHL %HIHVWLJXQJVO¤FKHU 'D]X HLQH 6FKHLEH DOV 5DKPHQ +HUUOLFKH JU©QH 3DWLQD GLH 5DKPHQVFKHLEH PLW 5DQGDXVEU©FKHQVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ5:86$HU-DKUH([*RUQ\ 0RVFK 0©QFKHQ$XNWLRQ/RV,Q'HXWVFKODQGVHLW

 Phalera mit Gorgoneion. 5¤PLVFK-KQ&KUkFP5XQ GHU OHLFKW NRQYH[HU 7RQGR PLW GUHLIDFKHP .UHLVUDKPHQ $XI GHU 9RUGHUVHLWH ]HQWUDO HLQ SODVWLVFKHV *RUJRQHLRQ PLW .RSI ~©JHOQ XQG ZDOOHQGHP +DDU 6FK¤QH OLQGJU©QH 3DWLQD HWZDV YHUERJHQDP5DQG    u 3URYHQLHQ]1DFKODVVDXVED\HULVFKHU6DPPOXQJ.+,Q'HXWVFKODQGVHLW YRU %URQ]HSKDOHUDZLWK*RUJRQHLRQ5RPDQQGFHQWXU\$'$WWUDFWLYHROLYH JUHHQSDWLQDLQWDFW

5RXQGHOZLWKIURQWDO*RUJRhVKHDG3OXVDVHSDUDWHIUDPLQJGLVN5RPDQ ,PSHULDO3HULRGQGUGFHQWXU\$'3KDQWDVWLFJUHHQSDWLQDLQWDFW

93


140 Löwenkopf. 5¤PLVFKH.DLVHU]HLW-KQ&KU+FP(LQ VHLWLJHV %URQ]HUHOLHI +HQNHODWWDVFKH PLW HLQHP IURQWDOHQ /¤ ZHQNRSI PLW P”FKWLJHU 0”KQH XQG DXIJHULVVHQHP 0DXO $XI GHP8QWHUJUXQGGUHL%HIHVWLJXQJVO¤FKHU+HQNHODQVDW]PRGHUQ EHJUDGLJW XQG UHWXVFKLHUW ([]HOOHQWH 4XDOLW”W $XVJH]HLFKQHWH GXQNHOJU©QH3DWLQD u 3URYHQLHQ] ([ 1DFKODVV * 0 +DPEXUJ LQ GHVVHQ 6DPPOXQJ VHLW PLQGHVWHQV %URQ]HOLRQKHDGUHOLHILQH[FHOOHQWVW\OH/RZHUKDQGOHDWWDFKPHQWRIDMXJ 5RPDQ,PSHULDO3HULRGVWQGFHQWXU\$'$WWUDFWLYHGDUNJUHHQSDWLQD URGZRUNHGRIIDQGUHWRXFKHG

140

141 Medaillon. 5¤PLVFKIU©KHV-KQ&KUkFP*HWULHEHQHV %URQ]HEOHFKPLW5HOLHIGDVGHQ.DLVHUEHLP7ULXPSKLQHLQHU 4XDGULJD]HLJW'DYRUHLQ6ROGDWPLW7URSDHXPLP+LQWHUJUXQG HLQ %RJHQPRQXPHQW PLW 7URSDHXP XQG VHLWOLFK VLW]HQGHQ *HIDQJHQHQ'XQNOH3DWLQDZLQ]LJH)HKOVWHOOHDP5DQGXQWHQ JHORFKW u 141

3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 'LH'DUVWHOOXQJG©UIWH%H]XJQHKPHQDXIGLH'DNHUNULHJHGHV.DLVHUV7UDMDQ RGHUQ&KU 5RPDQEURQ]HPHGDLOORQGHSLFWLQJWKHWULXPSKRIWKH(PSHURU7UDMDQDIWHU WKH'DFLDQ:DUVDQG$''DUNSDWLQDWLQ\IUDJPHQWDERYH LVPLVVLQJEHORZSXQFKHG

 9RWLYSODNHWWHPLW*¤WWLQ'RQDXODQGHPLWWOHUH.DLVHU]HLWFD -KQ&KU[FP%URQ]HSODNHWWHPLWGHU%©VWHHLQHU ZHLEOLFKHQ*RWWKHLWPLWKRFKJHJ©UWHWHP*HZDQG6FKOHLHUXQG 3RORV6FK¤QHJU©QH3DWLQD+¤KHQOHLFKWEHULHEHQLQWDNW u 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ *RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV



%URQ]H'DQXELDQYRWLYHSODTXHGHSLFWLQJDYHLOHGIHPDOHJRGGHVVZHDULQJD SRORVQGUGFHQWXU\$'*UHHQSDWLQDOLWWOHZRUQDWWKHKLJKHVWSRLQWV RWKHUZLVHLQWDFW

e )LJ©UOLFK YHU]LHUWHV 3O”WWFKHQ DXV %HLQ 5¤PLVFK    -K Q &KU  [ FP /HLFKW NRQYH[ JHZ¤OEWHV 3O”WWFKHQ ZRKO YRQ HLQHU 3\[LV 'DUDXI HLQ .QDEH PLW .UDQ] XQG 3DOP]ZHLJ DOV 6\PEROHLQHV6LHJHV:LQ]LJH$EVSOLWWHUXQJHQDP5DQGVRQVW LQWDNW u 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVDXV HLQHU6FKZHL]HU3ULYDWVDPPOXQJHUZRUEHQEHL$UWHPLV0©Q]HQXQG $QWLTXLW”WHQ'HXWVFKODQG



6PDOOVOLJKWO\FRQYH[SODWHPDGHRIERQHIURPDS\[LVZLWKDFXSLGZLWKZUHDWK DQGSDOPEUDQFK5RPDQUGWKFHQWXU\$'7LQ\VSOLQWHUVDWWKHULPDUH PLVVLQJRWKHUZLVHLQWDFW

144 %URQ]HQH 6ZDVWLND 5¤PLVFKH .DLVHU]HLW    -K Q &KU % FP$SSOLNLQ9ROOJXVVPLWI©QI%HIHVWLJXQJVO¤FKHUQ6FK¤ QHJU©QH3DWLQDNOHLQH)HKVWHOOHDQHLQHP$UPHQGH u 3URYHQLHQ](KHPDOVLQGHXWVFKHU6DPPOXQJGHUHU-DKUH %URQ]HVZDVWLNDZLWK}YH}WWLQJKROHV5RPDQ,PSHULDO3HULRGVWQG FHQWXU\$'1LFHJUHHQSDWLQDOLWWOHIUDJPHQWLVPLVVLQJ

144 94


SAMMLUNG MILITÄRDIPLOME

145

145 Militärdiplom einer Auxiliareinheit. Römische Kaiserzeit, Zeit des Domitian, 88 n. Chr. Ursprünglich H 19,7cm, B 16cm. Bronze. Erhalten ist größtenteils Tabella I. Kopie der Konstitution vom 7. November 88 n. Chr. für die Provinz Syria, die 5 Alae und  .RKRUWHQ DX~LVWHW 9HUOLHKHQ ZXUGH GDV 'LSORP DQ GHQ Reiter Bithus der Ala Praetoria Singularium, die von A. Furius 6DWXUQLXV NRPPDQGLHUW ZXUGH %HL %LWKXV KDQGHOW HV VLFK XP einen belegten, thrakischen Personennamen. 15 Stück! Dunkle Patina, Reste von Brandspuren, Fragmente. 800,–

Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 721 f. Nr. 330; 3:HLg=HLWVFKULIWI©U3DS\URORJLHXQG(SLJUDSKLN6 15 fragments of a Roman military diploma with the copy of the constitution of 1RYHPEHUIRU6\ULDZKLFKOLVWHG}YHDODHDQGWZRFRKRUWV,WZDVDZDUGHG WRWKH7KUDFLDQFDYDODU\PDQRI$OD3UDHWRULD6LQJXODULXP5RPDQ,PSHULDO 3HULRGWLPHRI'RPLWLDQ$''DUNSDWLQDWUDFHVRI}UHIUDJPHQWDU\ Published! 15 pieces!

95


146 Militärdiplom einer Auxiliareinheit. Römische Kaiserzeit, Zeit GHV +DGULDQ  Q &KU + FP % FP %URQ]H =ZHL Fragmente der rechten unteren Ecke der Tabella I. Kopie der Konstitution vom 17. Juli 122 n. Chr. für die Provinz Dacia LQIHULRU9HUOLHKHQZXUGHGDV'LSORPDQHLQHQJHZLVVHQ%HVVXV GHVVHQ 7RFKWHU HEHQIDOOV HUZ”KQW LVW 2 Stück! Braungrüne Patina, fragmentarisch. 250,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 762 Nr. 361; 3:HLg=HLWVFKULIWI©U3DS\URORJLHXQG(SLJUDSKLN6 Two right bottom corner fragments of a Roman military diploma with the copy RIWKHFRQVWLWXWLRQRI-XO\IRU'DFLDLQIHULRU,WZDVDZDUGHGWR%HVVXV ZKRVHGDXJKWHULVDOVRPHQWLRQHG5RPDQ,PSHULDO3HULRGWLPHRI+DGULDQ 122 A.D. Greenbrown, fragmentary. Published! 2 pieces!

147 Militärdiplom einer Auxiliareinheit. Römische Kaiserzeit, Zeit des Domitian, 88 n. Chr. H 8,3cm, B 6,5cm. Bronze. Fragment der rechten oberen Ecke der Tabella II. Kopie der Konstitution YRP1RYHPEHUQ&KUI©UGLH3URYLQ]6\ULD9HUOLHKHQ ZXUGHGDV'LSORPDQHLQHQWKUDNLVFKHQ$QJHK¤ULJHQGHU$OD SUDHWRULDVLQJXODULXP'XQNHOEUDXQHELVVFKZDU]H3DWLQDDQWLN oval zugerichtet. 200,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 723 Nr. 331; 3:HLg=HLWVFKULIWI©U3DS\URORJLHXQG(SLJUDSKLN6 Siehe auch Los 145. Fragment of the right upper corner of a Roman military diploma with the copy RIWKHFRQVWLWXWLRQRI1RYHPEHUIRU6\ULD,WZDVDZDUGHGWRD7KUDFLDQ RIWKHDODSUDHWRULDVLQJXODULXP5RPDQ,PSHULDO3HULRGWLPHRI'RPLWLDQ 88 A.D. Darkbrown to black patina, antique ovally trimmed. Published! See also lot 145!

148 Militärdiplom einer Auxiliareinheit. Römische Kaiserzeit, Zeit des Hadrian, 125 n. Chr. (?). H 6,6cm, B 5,2cm. Bronze. )UDJPHQWYRQGHUUHFKWHQ6HLWHGHU7DEHOOD,(UZ”KQWLVWQDFK P. Weiß ein Konsul Ti. Lartidius Celer. Dunkelbraune Patina, fragmentarisch. 200,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 766 Nr. 365; :(FN3:HLg&KLURQ6 One fragment of the right side of a Roman military diploma. After Weiß WKHFRQVXO7L/DUWLGLXV&HOHULVPHQWLRQHG5RPDQ,PSHULDO3HULRGWLPH of Hadrian, probably 125 A.D. Darkbrown patina, fragmentary. Published!

149 Militärdiplom einer Auxiliareinheit. Römische Kaiserzeit, Zeit GHV+DGULDQFDQ&KU+FP%FP%URQ]H =ZHL)UDJPHQWHYRQGHUOLQNHQ6HLWHGHU7DEHOOD,*HOLVWHWVLQG DFKW.RKRUWHQXQGHLQH$ODQ”POLFKGLH$OD,,3DQQRQLRUXP (UZ”KQW LVW 7 )ODYLXV ,WDOLFXV GHU LQ GLHVHU =HLW 6WDWWKDOWHU GHU 3URYLQ] 'DFLD 3RUROLVVHQVLV ZDU 2 Stück! Grüne Patina, fragmentarisch. 200,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 781 Nr. 378; 3:HLg=3(6

96

Two fragments of the left side of a Roman military diploma. Listed are HLJKWFRKRUWVDQGRQHDODWKH$OD,,3DQQRQLRUXP$OVRPHQWLRQHGLVWKH SUDHVLGLDOJRYHUQRURIWKHSURYLQFH'DFLD3RUROLVVHQVLV7)ODYLXV,WDOLFXV 5RPDQ,PSHULDO3HULRGWLPHRI+DGULDQDERXW$'*UHHQSDWLQD fragmentary. Published! 2 pieces!

150 Militärdiplom einer Auxiliareinheit. Römische Kaiserzeit, Zeit GHV +DGULDQ FD    Q &KU + FP % FP %URQ]H Fragment von der linken, unteren Ecke der Tabella II. Es stammt aus einer Konstitution für Moesia inferior aus dem Jahr 118 oder  Q &KU (UZ”KQW VLQG GLH $OD , 9HVSDVLDQD 'DUGDQRUXP GLH YRQ 3 %DHELXV NRPPDQGLHUW ZXUGH 'XQNHOJU©QH 3DWLQD fragmentarisch. 200,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 747 Nr. 349; :(FN3:HLg&KLURQ6 )UDJPHQWRIWKHOHIWERWWRPFRUQHURID5RPDQPLOLWDU\GLSORPD,WLVDFRS\ of a constitution for Moesia inferior of the year 118 oder 119. Also mentioned LVWKH$OD,9HVSDVLDQD'DUGDQRUXPZKLFKZDVFRPPDQGHGE\3%DHELXV 5RPDQ,PSHULDO3HULRGWLPHRI+DGULDQDERXWRU$''DUNJUHHQ patina, fragmentary. Published!

151 Militärdiplom einer Auxiliareinheit. Römische Kaiserzeit, Zeit des Hadrian, 19. Oktober 120 n. Chr. H 7,9cm, B 9,3cm. Bronze. )UDJPHQWYRPXQWHUHQOLQNHQ9LHUWHOGHU7DEHOOD,,9RQHLQHU Konstitution für Moesia und Pannonia inferior vom 19. Oktober Q&KU(UZ”KQWLVWGLH$OD,)ODYLD*DHWXORUXP*UDXJU©QH Patina, Korrosionslöcher, fragmentarisch. 200,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 755 f. Nr. 3:HLg=3(6 )UDJPHQWRIWKHOHIWERWWRPTXDUWHURID5RPDQPLOLWDU\GLSORPD,WLVDFRS\ of a constitution for Moesia and Pannonia inferior of 19 October 120 A.D. $OVRPHQWLRQHGLVWKH$OD,)ODYLD*DHWXORUXP5RPDQ,PSHULDO3HULRGWLPH of Hadrian. Greygreen patina, holes of corrosion, fragmentary. Published!

152 Militärdiplom einer Auxiliareinheit. Römische Kaiserzeit, Zeit GHV+DGULDQQ&KU+FP%FP%URQ]H =ZHL ]XVDPPHQSDVVHQGH )UDJPHQWH YRQ GHU REHUHQ UHFKWHQ (FNHXQGGHP=HQWUXPGHU7DEHOOD,9RQHLQHU.RQVWLWXWLRQ I©U'DFLDLQIHULRUDXVGHU=HLW]ZLVFKHQGHP'H]HPEHU XQGGHP'H]HPEHUQ&KU(UZ”KQWVLQGQHEHQGUHL$ODH GLHYH[LOODWLRHTXLWXP,OO\ULFRUXPVRZLHI©QI.RKRUWHQ2 Stück! *U©QVFKZDU]H3DWLQD6SXUHQYRQ.RUURVLRQIUDJPHQWDULVFK 200,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 778 f. Nr. 3:HLg=3(6 Two joining fragments of the upper right corner and part of the center of D5RPDQPLOLWDU\GLSORPD,WLVDFRS\RIDFRQVWLWXWLRQIRU'DFLDLQIHULRU between 10 December 129 and 9 December 130 A.D. Also mentioned are WKUHHDODH}YHFRKRUWVDQGWKHYH[LOODWLRHTXLWXP,OO\ULFRUXP5RPDQ,P SHULDO3HULRGWLPHRI+DGULDQ$'*UHHQEODFNSDWLQDWUDFHVRI corrosion, fragmentary. Published! 2 pieces!


147

146

149

148

150

152

151

97


153 Militärdiplom einer Auxiliar- und Flotteneinheit. Römische Kaiserzeit, Zeit des Antoninus Pius, 146 n. Chr. H 6,5cm, B 11,3cm. Bronze. Sechs zusammenpassende Fragmente von der oberen Hälfte der Tabella I. Von einer Konstitution für Moesia inferior aus dem Jahr 146 n. Chr. Erwähnt sind neben fünf Alae und 11 Kohorten der Statthalter der Provinz, Ti. Claudius Saturnius. 6 Stück! Braungrüne Patina mit roten Einsprengseln, Spuren von Korrosion, fragmentarisch. 500,–

156 Militärdiplom. Römische Kaiserzeit, Zeit des Elagabal, 222 n. Chr. H 14,2cm, B 9,8cm. Bronze. Vier Fragmente der linken Hälfte der Tabella II. Anhand der Titulatur von Elagabal und Severus Alexander als Caesar wird das Diplom auf den 7. Januar 222 n. Chr datiert. Der Name des Empfänger des Militärdiploms ist nicht überliefert, wohl aber der seines Vaters Bithus aus Philippopolis in Thrakien. 4 Stück! Dunkelgrüne Patina, Korrosionspuren, fragmentarisch. 300,–

Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: M. Roxan - P. Holder, Roman Military Diplomas IV (2003) S. 516 f. Nr. 270; P. Weiß, Zeitschrift für Papyrologie und Epigraphik 124, 1999, S. 279 - 286.

Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 894 Nr. 459 (dort 5 Fragmente!); P. Weiß, Zeitschrift für Papyrologie und Epigraphik 127, 1999, S. 239-241.

Six joining fragments of the upper half of a Roman military diploma. It is a copy of a constitution for Moesia inferior of the year 146 A.D. Also mentioned are five alae, eleven cohorts and the governor T. Claudius Saturnius. Roman Imperial Period, time of Antoninus Pius, 146 A.D. Greenbrown patina with red sprinkles, traces of corrosion, fragmentary. Published! 6 pieces!

Four fragments of the left part of tabella II of a Roman military diploma. The titulature of Elagabal and Severus Alexander as caesar dates it to 7 January 222 A.D. Roman Imperial Period, time of Elagabal, 7 January 222 A.D. Darkgreen patina, traces of corrosion, fragmentary. Published (five frag­ ments, one may be lost)! 4 pieces!

154 Militärdiplome einer Auxiliareinheit. Römische Kaiserzeit. a. H 9,5cm, B 6,4cm. Bronze. Komplette Hälfte der Tabella II. Von einer Konstitution für Pannonia superior vom 21. Juni 159 n. Chr. Verliehen wurde das Diplom an Dese, den Sohn des Deso. Vermutlich handelt es sich um einen Thraker. Zeit des Antoninus Pius, 159 n. Chr. Grüne Patina. b. H 11cm, B 6,9cm. Bronze. Komplette Hälfte der Tabella II. Mit Zeugenliste. 1. August 142 - 9. Oktober 148 n. Chr. Grüne Patina mit roten Flecken. 2 Stück! 300,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 848 Nr. 424; P. Weiß, Chiron 29, 1999, S. 152-153 (a). L‘Année Èpigraphique 1997, S. 605, Nr. 1766 (a). Two fragments of the complete half of Roman military diplomas. a. It is the third copy of a constitution for Pannonia superior of 21 June 159 A.D. Dese, the son of Deso, was recipient, probably a Thracian. Time of Antoninus Pius. Green patina. b. List with the names of witnesses. 1 August 142 - 9 October 148 A.D. Green patina with red sprinkles. Roman Imperial Period. 2 pieces! Published!

155 Militärdiplom einer Auxiliareinheit. Römische Kaiserzeit, Zeit des Antoninus Pius, 159 n. Chr. H 5,9cm, B 9cm. Bronze. Fragment des unteren Teil der Tabella I. Von einer Konstitution für Pannonia superior vom 21. Juni 159 n. Chr. Erwähnt werden fünf Alae und sechs Kohorten. Der Empfänger des Militärdiploms hat in der Ala I Thracum victrix civium Romanorum gedient. Er hieß Suris, Sohn des Dialpurus, und stammte wahrscheinlich aus Nicopolis ad Nestum. Dunkelgrüne Patina, Korrosionspuren v.a. auf der Innenseite, fragmentarisch. 300,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 845 f. Nr. 422; P. Weiß, Chiron 29, 1999, S. 148-182. One fragment of the bottom part of a Roman military diploma. It is the copy of a constitution for Pannonia superior of 21 June 159 A.D. Suri, the son of Dialpurus, was recipient, probably a Thracian who served in Ala I Thracum victrix civium Romanorum. Roman Imperial Period, time of Antoninus Pius. Darkgreen patina, traces of corrosion mainly on the inner side, fragmentary. Published!

98

157 Militärdiplom für eine Flotteneinheit. Römische Kaiserzeit, Zeit des Elagabal, 221 n. Chr. H 13,1cm, max. B 8cm. Bronze. Fünf Fragmente der linken unteren Ecke der Tabella I. Von einer Konstitution vom Oktober 221 n. Chr. für einen Veteran der italischen Flotte von Ravenna mit dem Namen Bassus, Sohn des Derus, der aus Nicopolis ad Istrum in der Provinz Moesia inferior stammte. 5 Stück! Grüne Patina, Korrosionspuren, fragmentarisch. 300,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 891 f. Nr. 457/317 B; P. Weiß, Archäologisches Korrespondezblatt 29, 1999, S. 553555. Five fragments of the left bottom corner of tabella I of a Roman military diploma. Recipient was a veteran of the Ravenne fleet with the name of Bassus, son of Derus, of Nicopolis ad Istrum in the province Moesia inferior. Roman Imperial Period, time of Elagabal, 221 A.D. Green patina, traces of corrosion, fragmentary. Published!

158 Militärdiplome für Reiter-, Prätorianer- und Auxiliartruppen. Römische Kaiserzeit, 97 - 223 n. Chr. a. H 5,3cm, B 3,8cm. Bronze. Fragment vom rechten unteren Bereich der Tabella I. Kopie einer Konstitution für die equites singulares Augusti vom 7. Januar 223 n. Chr. Der Empfänger, dessen Vater wahrscheinlich Mucatralis hieß, kam aus der thrakischen Provinz Moesia inferior. Grüne Patina. b. H 6,8cm, B 6cm. Bronze. Fünf Fragmente der rechten oberen Ecke der Tabella I. Von einer Konstitution vom 9. September 97 n. Chr. für Moesia inferior. Besonderheit ist, dass auf diesem Diplom der aktuelle und der ehemalige Provinzstatthalter Sex. Octavius Fronto erwähnt sind. Gereinigt, moderner Bruch aufgrund der Reinigung, messingfarben (5 Stück). c. H 5,4cm, B 5,2cm. Bronze. Fragment der Mitte der rechten Seite der Tabella I. Von einer Konstitution aus dem Jahr 155 n. Chr. für Moesia inferior. Dunkelbraune Patina. d. H 5cm, B 4,9cm. Bronze. Fragment der rechten, oberen Ecke Tabella I. Kopie einer Praetorianerkonstitution vom 8. - 14. März 204 n. Chr. Hellgrüne Patina, etwas korrodiert. e. H 6,4cm, B 4,8cm. Bronze. Fragment der rechten, oberen Ecke der Tabella II. Kopie einer Konstitution aus den Jahren 80 - 84 n. Chr. Grünschwarze Patina. 8 Stück! 500,–


Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 897 Nr. 462; S. 734 Nr. 338; S. 835 Nr. 414; S. 883 Nr. 452; S. 716 Nr. 326. Fragments of Roman military diplomas for equestrian, praetorian and au [LOLDU\XQLWV5RPDQ,PSHULDO3HULRG$'8 pieces! Published!

153 154

159 0LOLW”UGLSORPH I©U $X[LOLDU XQG )ORWWHQHLQKHLWHQ Römische .DLVHU]HLW    Q &KU a. H 8,7cm, B 6,5cm. Bronze. Fragment vom mittleren Bereich der Tabella II. Kopie einer Konstitution aus dem Jahr 124 n. Chr. Dunkelgrüne Patina mit roten Einsprengseln. b. +FP%PD[FP%URQ]H=ZHL]X sammenpassende Fragmente von der linken Seite der Tabella II. 'HU(PSI”QJHUZXUGHQ&KUUHNUXWLHUW*U©QH3DWLQDc. H 3,3cm, B 4cm. Bronze. Fragment vom linken Rand der Tabel OD,9RQGHU.RQVWLWXWLRQYRP0DLI©U0RHVLD,QIHULRU Olivgrüne Patina. d. H max. 3,1cm, B max. 3,4cm. Bronze. Fast GUHLHFNLJHV)UDJPHQWYRPOLQNHQXQWHUHQ9LHUWHOGHU7DEHOOD, Dunkelgrüne Patina. e. H 5,6cm, B 5,4cm. Bronze. Fragment von der linken, unteren Ecke der Tabella II. Es handelt sich um HLQH .RQVWLWXWLRQ GHU 0LVHQLVFKHQ )ORWWH ZDV GXUFK GLH GUHL Rahmenlinien und die genannten Zeugen belegt ist. Dunkelgrü ne Patina. 6 Stück! 500,–

155

Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 764 Nr. 363 +LHU]ZHL)UDJPHQWHHUZ”KQW 61U61U6 1U H 05R[DQ3+ROGHU5RPDQ0LOLWDU\'LSORPDV,9   S. 493 Nr. 253. )UDJPHQWVRI5RPDQPLOLWDU\GLSORPDVIRU~HHWDQGDX[LOLDU\XQLWV5RPDQ ,PSHULDO3HULRG$'6 pieces! Published!

156

160 0LOLW”UGLSORPHI©U$X[LOLDUXQG)ORWWHQHLQKHLWHQRömische Kai VHU]HLWQ&KUa. H 4,4cm, B max. 4cm. Bronze. Frag PHQWYRPXQWHUHQ5DQGGHU7DEHOOD,9RQGHU.RQVWLWXWLRQI©U Pannonia superior vom 21. Juni 159 n. Chr. Dunkelbraune Pati na. b. H 3,1cm, B 4,2cm. Bronze. Fragment der unteren linken +”OIWHGHU7DEHOOD,9RQGHU.RQVWLWXWLRQI©U0DXUHWDQLD7LQ gitana vom 26. Oktober 153 n. Chr. c. H 10,4cm, B max. 6cm. %URQ]H=ZHL)UDJPHQWHGHUXQWHUHQOLQNHQ+”OIWHGHU7DEHOOD ,9RQGHU.RQVWLWXWLRQYRP)HEUXDUI©UGLH0LVHQLVFKH Flotte. Grüne Patina auf der Außenseite (2 Stück). d. H 2,5cm, %FP%URQ]H5HFKWHFNLJHV)UDJPHQWYRQGHUREHUHQ+”OIWH GHU7DEHOOD,9RQHLQHU.RQVWLWXWLRQI©U0DXUHWDQLD&DHVDULHQ VLVZ”KUHQGGHV3URFXUDWVYRQ09HWWLXV/DWUR'XQNHOJU©QH Patina. e. H 4,8cm, B 4,3cm. Bronze. Fragment von der obe ren Mitte der rechten Seite der Tabella I. Braungrüne Patina. f. H 2,4cm, B 3,3cm. Bronze. Fragment von der rechten unte ren Ecke der Tabella I. Wahrscheinlich Teil eines Diploms für Moesia inferior. Grüne Patina. g. H 3,2cm, B 2,6cm. Bronze. )UDJPHQWYRPOLQNHQXQWHUHQ7HLOGHU7DEHOOD,9RQGHU.RQ stitution vom 6. Oktober 142 für die Misenische Flotte. Grüne Patina mit Loch im Zentrum. 8 Stück! 500,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 847 Nr. 423; 61U%61U KLHUGUHL)UDJPHQWH 61U  $( 61U $( 61U0 5R[DQ3+ROGHU5RPDQ0LOLWDU\'LSORPDV,9  61U I 

157

158

159

)UDJPHQWVRI5RPDQPLOLWDU\GLSORPDVIRUDX[LOLDU\DQG~HHWXQLWV5RPDQ ,PSHULDO3HULRG$'8 pieces! Published!

160

99


161 0LOLW”UGLSORPHI©U$X[LOLDUXQG)ORWWHQHLQKHLWHQRömische Kai VHU]HLWQ&KUa. H 3,4cm, B 4,7cm. Bronze. Fragment YRQGHUOLQNHQXQWHUHQ(FNHGHU7DEHOOD,9RQGHU.RQVWLWXWL RQDXVGHP-DKUQ&KUI©U$IULFD%U”XQOLFKH3DWLQDb. H 2,6cm, B 3cm. Bronze. Kleines Fragment vom mittleren Bereich GHUXQWHUHQ+”OIWHYRQ7DEHOOD,9RQGHU.RQVWLWXWLRQI©UGLH 3URYLQ]'DFLD,QIHULRU*U©QEUDXQH3DWLQDHWZDVNRUURGLHUWc. H 5,1cm, B 8,1cm. Bronze. Fragment der linken, oberen Ecke YRQ7DEHOOD,,9RQGHU.RQVWLWXWLRQI©UGLH)ORWWHYRQ5DYHQ na im Zeitraum von Januar bis Oktober 221. Dunkelgrüne Pa WLQD HWZDV .RUURVLRQ NOHLQHUH %HVFK”GLJXQJHQ d. H 4,3cm, B 5,7cm. Bronze. Fragment vom unteren Rand rechts von der 0LWWHYRQ7DEHOOD,,.RSLHGHU.RQVWLWXWLRQYRP0”U] Q&KU5RWJU©QH3DWLQDHWZDVNRUURGLHUWe. H 3,8cm, B 6cm. %URQ]H=ZHL]XVDPPHQSDVVHQGH)UDJPHQWHYRPXQWHUHQOLQ NHQ%HUHLFKGHU7DEHOOD,9RQHLQHU.RQVWLWXWLRQYRP$SULO I©U7KUDFLD5RWJU©QHXQGURWEUDXQH3DWLQDHWZDVYHUER gen. f. H 4,4cm, B 4,5cm. Bronze. Fast dreieckiges Fragment YRQGHUOLQNHQ6HLWHGHU7DEHOOD,,'HU(PSI”QJHUGHV'LSORPV ZDUHLQ'HFXULR9HWHUDQQ&KU*U©QH3DWLQDHWZDVNRU rodiert. 7 Stück! 500,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 769 Nr. 61U61U61U61U  $(    0 5R[DQ  3 +ROGHU 5RPDQ 0LOLWDU\ 'LSORPDV,9 (2003) S. 425 Nr. 210. )UDJPHQWVRI5RPDQPLOLWDU\GLSORPDVIRUDX[LOLDU\DQG~HHWXQLWV5RPDQ ,PSHULDO3HULRG$'7 pieces! Published!

162 0LOLW”UGLSORPHI©U)ORWWHQ$X[LOLDU5HLWHU (6$ XQG3U”WR rianereinheiten. 5¤PLVFKH.DLVHU]HLWQ&KUa. H 5,4cm, B 4cm. Bronze. Fragment von der rechten, oberen Ecke GHU7DEHOOD,9RQHLQHU.RQVWLWXWLRQYRQQ&KUI©U GLH3UDHWRULDQHU)ORWWHLQ5DYHQQD*U©QH3DWLQDHWZDVNRUUR diert. b.  + FP % FP %URQ]H =ZHL ]XVDPPHQSDVVHQGH )UDJPHQWHYRQGHU0LWWHGHU7DEHOOD,9RQHLQHUEHVRQGHUHQ 9HUOHLKXQJ GHV U¤PLVFKHV %©UJHUUHFKWV GHU .RKRUWH , 8OSLD %ULWWRQXPPLOOLDULDWRUTXDWDSLD}GHOLVFLYLXP5RPDQRUXPDP $XJXVWQ&KU6FKZDU]H3DWLQDc. H 3cm, B 6,4cm. %URQ]H =ZHL ]XVDPPHQSDVVHQGH )UDJPHQWH YRP XQWHUHQ UHFKWHQ %HUHLFK YRQ 7DEHOOD , 9RQ HLQHU .RQVWLWXWLRQ I©U GLH 3URYLQ] 6\ULD 3DODHVWLQD DXV GHP -DKU  2OLYJU©QH 3DWL na. d. +FP%FDFP%URQ]H=ZHL]XVDPPHQSDVVHQGH Fragmente der Tabella I. Diplom für die cohortes praetoriae RGHUXUEDQDH:LHGHUYHUZHQGHW YRQ(UVWEHVFKULIWXQJ0XQG& HUNHQQEDU 6FKZDU]JU©QH3DWLQDHWZDVNRUURGLHUWe. H 3,9cm, B ca. 4,2cm. Bronze. Rechte, untere Ecke der Tabella II mit =HXJHQOLVWH +HOOJU©QH 3DWLQD HWZDV NRUURGLHUW f. Ca. 3 x 3 bis 1,5 x 2,5cm. Bronze. Fünf kleine Fragmente vom oberen, UHFKWHQ9LHUWHOGHU7DEHOOD,]ZHL)UDJPHQWHDQHLQDQGHUSDV send. Diplom für die equites singulares Augusti. Olivgraue Pati QDHWZDVNRUURGLHUWg. H 5cm, B 3cm. Bronze. Fragment vom UHFKWHQ5DQGGHU7DEHOOD,,9RQHLQHU.RQVWLWXWLRQI©U0RHVLD LQIHULRUYRP)HEUXDUQ&KU+HOOJU©QH3DWLQD]ZHL5LV se, Korrosion. 14 Stück! 500,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert in: P. Holder, Roman Military Diplomas V (2006) S. 759 Nr. 358; 61U61U3:HLg(LQ3U”WRULDQHUGLSORP6HYHUXV $OH[DQGHUV DXI HLQHU ZLHGHUYHUZHQGHWHQ %URQ]HWDIHO =3(   6  G 3:HLg1HXH0LOLW”UGLSORPH=3(6 1U H 61U I XQG1U J 

100

)UDJPHQWVRI5RPDQPLOLWDU\GLSORPDVIRU~HHWDX[LOLDUHTXHVWULDQDQGSUDH WRULDQXQLWV5RPDQ,PSHULDO3HULRG$'14 pieces! Published!

163 0LOLW”UGLSORPHI©U$X[LOLDUXQG3U”WRULDQHUHLQKHLWHQRömische .DLVHU]HLW    Q &KU a. H 6,2cm, B 6,3cm. Bronze. )UDJPHQWYRPOLQNHQXQWHUHQ9LHUWHOGHU7DEHOOD,$XVHLQHU .RQVWLWXWLRQI©U0RHVLDRGHU'DFLDDXVGHU=HLWQ&KU Dunkelgrüne Patina, an einer Ecke verbogen. b. H 2,3cm, B 3,5cm. Bronze. Fragment vom linken, oberen Teil der Tabella I. $XVHLQHU.RQVWLWXWLRQI©UGLH3U”WRULDQHUJDUGHYRP-DQXDU Q&KU*UDXJU©QH3DWLQDVHKUJXWHUKDOWHQH2EHU~”FKHc. H 4,5cm, B 3,7cm. Bronze. Fragment von der linken unteren (FNHGHU7DEHOOD,$XVHLQHU.RQVWLWXWLRQI©UGLH3U”WRULDQHU JDUGHDXVGHU=HLWYRP-DQXDUQ&KUI©U0$XUHOLXV aus Pautalia. Braungrüne Patina. d. H 4,2cm, B 5,3cm. Bronze. Fragment der rechten oberen Ecke der Tabella II mit der Zeu JHQOLVWH&DQ&KU'XQNOHEUDXQJU©QH3DWLQDe. H 6,7cm, B 3,1cm. Bronze. Fragment der rechten, unteren Ecke der Tabella I. Kopie einer Konstitution für Pannonia inferior. 'HU(PSI”QJHUZDUVRZRKO0LWJOLHGHLQHU)ORWWHQDOVDXFKHL ner Auxiliareinheit. Hellgrüne Patina. f. H 5,8cm, B 4cm. Bron ze. Fragment der rechten oberen Ecke der Tabella I. Aus einer Konstitution von Antoninus Pius für Pannonia inferior vom 21. -XQLQ&KU*UDXJU©QH3DWLQDVHKUJXWHUKDOWHQH2EHU~” che, leicht korrodiert. g. H 4,5cm, B 4,4cm. Bronze. Fragment der rechten oberen Ecke der Tabella I. Aus einer Konstitution von Antoninus Pius für Dacia Porolissensis von Sommer 142 bis Herbst 144. Olivgrüne Patina. h. . H 3,2cm, B 3,7cm. Bron ]H=ZHL]XVDPPHQSDVVHQGH)UDJPHQWHYRQGHUOLQNHQREHUHQ Ecke der Tabella I. Aus einer Konstitution für Dacia inferior RGHU%ULWDQQLDDXVGHU=HLWQ&KU6FKZDU]JU©QH3D tina, leicht korrodiert. 9 Stück! 500,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. 3XEOL]LHUWLQ3:HLg0LOLW”UGLSORPHXQG5HLFKVJHVFKLFKWH'HU.RQVXODW des L. Neratius Proculus und die Vorgeschichte des Partherkriegs unter Marc Aurel und Lucius Verus, in: R. Haensch, J. Heinrichs (Hrsg.), Herrschen und Verwalten. Der Alltag der römischen Administration in der Hohen Kaiserzeit  67DI;, D 3:HLg1HXH3U”WRULDQHUGLSORPHGHV -DKUKXQGHUWVLQ5¤PLVFK*HUPDQLVFKHV=HQWUDOPXVHXP +UVJ +21( 67$0,66,21()HVWVFKULIWI©U%DUEDUD3IHUGHKLUW  61U  0D[LPLQXV7KUD[ 1U 6HYHUXV$OH[DQGHU XQG1U EG 00 5R[DQ5RPDQ0LOLWDU\'LSORPDV  6I1U 3:HLg=3(  6 H 3:HLg$X[LOLDUGLSORPHI©UGLH dakischen Provinzen, Pannonia superior und eine „provincia inermis“, ZPE   6I6I6II IK  )UDJPHQWVRI5RPDQPLOLWDU\GLSORPDVIRUDX[LOLDU\DQGSUDHWRULDQXQLWV 5RPDQ,PSHULDO3HULRG$'9 pieces! Published!

164 0LOLW”UGLSORPIUDJPHQWHI©U$X[LOLDUXQG)ORWWHQHLQKHLWHQRömi sche Kaiserzeit, Zeit des Hadrian und Antoninus Pius. a. H FP % FP %URQ]H =ZHL JU¤gHUH )UDJPHQWH GHU UHFK WHQ IDVW NRPSOHWWHQ +”OIWH GHU 7DEHOOD ,, VRZLH GUHL NOHLQHUH )UDJPHQWH 9RQ ]ZHL .RQVWLWXWLRQHQ YRP  -DQXDU XQG  Februar 126 n. Chr. von Hadrian für Dacia superior für die €QRUPDOHQy$X[LOLDUWUXSSHQVRZLHGLH3DOP\UHQLVDJLWWDULLHLQH berittene Bogenschützentruppe. Erhalten ist die Zeugenliste. b. H 3,5cm, B 4cm. Bronze. Fragment vom rechten unteren Rand GHU7DEHOOD,(UKDOWHQVLQGGLH1DPHQGHU.LQGHUGHV(PSI”Q JHUVQ&KU6FKZDU]JU©QH3DWLQDEHVFK”GLJWGXUFK +LW]HHLQZLUNXQJc. H 5,5cm, B max. 2,4cm. Bronze. Ein Frag PHQWYRPUHFKWHQ7HLOXQWHUKDOEGHU0LWWHGHU7DEHOOD,9RQ HLQHU.RQVWLWXWLRQI©UGLHPLVHQLVFKH)ORWWH(PSI”QJHUZDUHLQ 7KUDNHU  Q &KU 6FKZDU]H 3DWLQD PLW GXQNHOJU©QHQ =R QHQVHKUJXWHUKDOWHQH2EHU~”FKHd. H max. 2,5cm, B 6cm.


%URQ]H=ZHL]XVDPPHQSDVVHQGH)UDJPHQWHYRPOLQNHQ5DQG direkt aus der Mitte von Tabella I. Reste eines Flottendiploms. 6FKZDU]H WHLOZHLVH GXQNHOJU©QH 3DWLQD e. H 2,4cm, B max. 2,6cm. Bronze. Fragment aus dem rechten unteren Teil der Ta bella I. Rest eines Flottendiploms für die Flotte von Ravenna YRP$XJXVWQ&KUDXVJHVWHOOWI©UHLQHQ9HWHUDQHQDXV 1LNRSROLV6FKZDU]EUDXQH3DWLQDf. H 4cm, B max. 2,5cm und +FP%PD[FP%URQ]H=ZHL)UDJPHQWHYRQGHUXQWH UHQ+”OIWHGHU7DEHOOD,9RQHLQHU.RQVWLWXWLRQYRP-XOLXQG 6HSWHPEHUQ&KU'HU(PSI”QJHUVWDPPWDXV$UDGRV LQ3K¤QLNLHQ%UDXQJU©QH3DWLQDWHLOZHLVHNRUURGLHUWGDVNOHL nere Fragment mit Gussfehler. g. H 6,1cm, B 4,6cm. Bronze. )UDJPHQWDXVGHU0LWWHGHUREHUHQ+”OIWHYRQ7DEHOOD,,9RQ einer Konstitution von Antoninus Pius vom 30. September 160 Q &KU YLHOOHLFKW I©U 0RHVLD LQIHULRU *U©QH 3DWLQD =ZHLWYHU ZHQGXQJh. H 2,1cm, B 3,6cm. Bronze. Fragment vom rechten XQWHUHQ5DQGGHU7DEHOOD,9RQHLQHU.RQVWLWXWLRQYRQ$QWRQL nus Pius vom 26. Oktober 153 n. Chr. für Mauretania Tingita QDI©UHLQH$X[LOLDUXQG)ORWWHQHLQKHLW*U©QH3DWLQDPLQLPDO korrodiert. i. H 3,8cm, B 2,8cm. Bronze. Fragment vom Rand GHU7DEHOOD,,9RQHLQHU.RQVWLWXWLRQGHV+DGULDQYRP$X gust 127 n. Chr. für Britannia oder Germania inferior. Leichte grüne Patina. 15 Stück! 500,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. 3XEOL]LHUW3:HLg$X[LOLDUGLSORPHI©UGLHGDNLVFKHQ3URYLQ]HQ3DQQRQLD superior und eine „provincia inermis“, ZPE 181, 2012, 183 ff. Nr. 1; 188 ff. 1UE3:HLg1HXH)ORWWHQGLSORPHI©U7KUDNHUDXV$QWRQLQXV3LXVyVS”WHQ Jahren, ZPE 139, 2002, S. 219 f. Nr. 1, S. 221 Nr. 3 und S. 224 f. Anhang; 3:HLg6WDWWKDOWHUXQG.RQVXOQGDWHQLQQHXHQ0LOLW”UGLSORPHQ=3( 2009, S. 242 ff. Nr. 6; S. 247 ff. Nr. 9; S. 245 ff. Nr.10. und S. 237 f. Nr. 3. )UDJPHQWVRIPLOLWDU\GLSORPDVIRUDX[LOLDU\DQG~HHWXQLWV5RPDQ,PSHULDO Period, time of Hadrian and Antoninus Pius. 15 pieces! Published!

165 0LOLW”UGLSORPIUDJPHQWHI©U)ORWWHQXQG$X[LOLDUHLQKHLWHQRömi sche Kaiserzeit, Zeit des Domitian bis Severus Alexander. a. H 3,5cm, B 5,3cm. Bronze. Fragment vom rechten Rand der 7DEHOOD,HLQHV3U”WRULDQHUGLSORPVYRP-DQXDUQ&KU Hellgrüne Patina. b. H 3,3cm, B 2,5cm. Bronze. Fragment vom linken oberen Rand der Tabella I. Aus einer Konstitution von $QWRQLQXV3LXVQ&KUI©UGLH(LQKHLWHLQHUSURYLQ]L alen Flotte. Grüne Patina mit rotbraunen Flecken. c. H 2,8cm, %FP%URQ]H)UDJPHQWYRPOLQNHQ5DQGGHUREHUHQ+”OI WHGHU7DEHOOD,$XVHLQHU.RQVWLWXWLRQYRP0”U]Q &KU *U©QH 3DWLQD =ZHLWYHUZHQGXQJ d. B 4,3cm, H 2,1cm. %URQ]H)UDJPHQWDXVGHUREHUHQ+”OIWHGHU7DEHOOD,$XVHL ner Konstitution von Hadrian bald nach 130 n. Chr. für Dacia inferior. Dunkelgrüne Patina mit leichten Korrosionsspuren. e. H 5,1cm, B 4,8cm. Bronze. Fragment von der rechten unteren Ecke der Tabella I. Aus einer Konstitution von Antoninus Pius YRP2NWREHUQ&KUI©U$X[LOLDUXQG)ORWWHQHLQKHLWHQ LQ0DXUHWDQLD7LQJLWDQD(PSI”QJHUGHV'LSORPVZDUHLQ0RH sier. Braungrüne Patina. f. H 4,6cm, B 4cm. Bronze. Fragment DXVGHU0LWWHGHUXQWHUHQ+”OIWHGHU7DEHOOD,)©UHLQHQ6ROGD ten einer unbekannten Flotte aus der Zeit nach 120 n. Chr. Dun kelgrüne Patina. g. H 7,8cm, B 7,6cm. Bronze. Fragment der OLQNHQXQWHUHQ+”OIWHGHU7DEHOOD,$XVHLQHU.RQVWLWXWLRQYRP  -XQL  Q &KU I©U 0RHVLD LQIHULRU I©U HLQH $X[LOLDU XQG eine provinziale Flotteneinheit. Hellgrüne Patina mit Korrosion, DQWLNH =ZHLWYHUZHQGXQJ PLW M©QJVW JHUHLQLJWHU 6WHOOH LP =HQ trum. h. H 3,3cm und B 2,4cm, H 2,3cm und B 2,1cm. Bronze. =ZHLNOHLQHQLFKWDQHLQDQGHUSDVVHQGH)UDJPHQWHYRPOLQNHQ Rand der Tabella I. Aus einer Konstitution von Nerva von Ende +”OIWHQ&KUI©UHLQH$X[LOLDUHLQKHLWZDKUVFKHLQOLFK LQ 0RHVLD LQIHULRU 2OLYJU©QH 3DWLQD WHLOZHLVH YHUERJHQ i. H

2,7cm, B 2,4cm, Bronze. Kleines Fragment der rechten Seite der Tabella I. Aus einer Konstitution von Domitian aus der Zeit von FDQ&KUI©U0RHVLDLQIHULRUXQGHLQHZHLWHUH3URYLQ] mit Einbeziehung eines Decurio. Hellgrüne Patina. 10 Stück! 500,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. 3XEOL]LHUW3:HLg1HXHDXVJHZ”KOWH'LSORPIUDJPHQWH=3( 61U ]XVDPPHQJHK¤ULJPLW50',,,DE 6II1U3 :HLg1HXH0LOLW”UGLSORPHI©UGHQ([HUFLWXVLQ%ULWDQQLD=3( 6II1U3:HLg1HXH'LSORPHI©U6ROGDWHQGHV([HUFLWXV'DFLFXV =3(6I1U3:HLg:HLWHUH0LOLW”UGLSORPHI©U6ROGDWHQ 0DXUHWDQLD7LQJLWDQDDXVGHP%DONDQUDXP=3(6II1U 3; P. Weiß, Neue Fragmente von Flottendiplomen des 2. Jahrhunderts n. Chr., =3(6II1U3:HLg1HXH0LOLW”UGLSORPH'RPLWLDQV und Nervas für Soldaten Niedermösiens. Zur Rubrik dimisso honesta missione LP(PSI”QJHUWHLOYRQ8UNXQGHQ=3(6II1U6 II1U3:HLg(LQH%©UJHUUHFKWVNRQVWLWXWLRQ7UDMDQVPLW(LQEH]LHKXQJ HLQHV'HFXULR=3(6 )UDJPHQWVRIPLOLWDU\GLSORPDVIRU~HHWDQGDX[LOLDU\XQLWV5RPDQ,PSHULDO 3HULRGWLPHRI'RPLWLDQWR6HYHUXV$OH[DQGHU10 pieces! Published!

166 0LOLW”UGLSORPIUDJPHQWHI©U)ORWWHQXQG$X[LOLDUHLQKHLWHQRömi VFKH.DLVHU]HLW=HLWGHV+DGULDQELV/XFLXV9HUXVa. H 5,1cm, B 2,8cm. Bronze. Fragment der rechten oberen Ecke der Tabel OD,9RQHLQHU.RQVWLWXWLRQYRQ$QWRQLXV3LXVYRQ RGHUQ&KUI©UGLH5HLFKV~RWWHRGHUGLHFODVVLV%ULWDQQLFD 6FKZDU]H3DWLQDPLWJU©QOLFKHQ6WHOOHQb. H 1,9cm, B 3,4cm, %URQ]H .OHLQHV )UDJPHQW YRQ GHU ”XgHUHQ UHFKWHQ 6HLWH GHU Tabella I. Kopie einer Konstitution von Marc Aurel und Luci XV9HUXVYRQELVQ&KUI©UGLH5HLFKV~RWWH 0LVHQXP oder Ravenna). Dunkelgrüne Patina. c. H 1,9cm, B 2cm, Bron ]H.OHLQHV)UDJPHQWYRPREHUHQ5DQGGHU7DEHOOD,9RQHLQHU Konstitution aus der Zeit von Elagabal oder Severus Alexander. Grüne Patina. d. Insgesamt H ca. 6,1cm, B ca. 8,5cm. Bronze. 'UHL)UDJPHQWH]ZHLGDYRQDQHLQDQGHUSDVVHQGDXVGHPREH UHQ%HUHLFKGHU7DEHOOD,9RQHLQHU.RQVWLWXWLRQYRQ$QWRQL QXV3LXVYRP-XOLQ&KU%UDXQJU©QH3DWLQD]ZHL Fragmente verbogen. e. H 4,1cm, B 4,1cm, Bronze. Fragment DXVGHPOLQNHQ0LWWHOWHLOGHU7DEHOOD,9RQHLQHU.RQVWLWXWLRQ YRQ0DUF$XUHOXQG/XFLXV9HUXVYRQ2NWREHUELV$QIDQJ 169 n. Chr. Braungrüne Patina. f. H 4,4cm, B 3,25cm, Bronze. )UDJPHQWYRPUHFKWHQ5DQGGHU7DEHOOD,9RQHLQHU.RQVWLWX WLRQYRQ0DUF$XUHOXQG/XFLXV9HUXVYRQ2NWREHU "  ELV $QIDQJ  Q &KU (WZDV NRUURGLHUW JU©QH 3DWLQD g. H 4,4cm, B 5,1cm. Bronze. Fragment vom linken, oberen Bereich GHU7DEHOOD,9RQHLQHU.RQVWLWXWLRQDXVGHUJHPHLQVDPHQ5H JLHUXQJV]HLWYRQ0DUF$XUHOXQG/XFLXV9HUXVQ&KU Olivgrüne Patina. h. H 3,7cm, B 4cm. Bronze. Fragment der OLQNHQXQWHUHQ6HLWHGHU7DEHOOD,9RQHLQHU.RQVWLWXWLRQ Oktober 120 n. Chr. für Pannonia inferior oder Moesia inferior. %UDXQJU©QH3DWLQDHWZDVNRUURGLHUW10 Stück! 500,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Publiziert: P. Weiß, Neue Fragmente von Flottendiplomen des 2. Jahrhunderts Q &KU 0LW HLQHP %HLWUDJ ]XP 8UNXQGHQZHUW GHV $XgHQWH[WV EHL GHQ 0LOLW”UGLSORPHQLQ=HLWVFKULIWI©U3DS\URORJLHXQG(SLJUDSKLN   6II1U6II1UXQG6II005R[DQ3:HLg'LH $X[LOLDUWUXSSHQGHU3URYLQ]7KUDFLD1HXH0LOLW”UGLSORPHGHU$QWRQLQHQ]HLW in: Chiron 28 (1998) S. 373 ff. Nr. 1; S. 282 ff. Nr. 2; S. 402 ff. Nr. 5; S. 406 f. Nr. 6; P. Holder, Roman Military Diplomas V (2006) S. 867 Nr. 441 HUZ”KQWVLQG]ZHL)UDJPHQWH :(FN3:HLg+DGULDQLVFKH.RQVXOQ 1HXH=HXJQLVVHDXV0LOLW”UGLSORPHQLQ&KLURQ  6IIE  )UDJPHQWVRIPLOLWDU\GLSORPDVIRU~HHWDQGDX[LOLDU\XQLWV5RPDQ,PSHULDO Period, time of Hadrian to Lucius Verus. 10 pieces! Published!

101


167 0LOLW”UGLSORPIUDJPHQWH I©U 3U”WRULDQHU XQG $X[LOLDUHLQKHLWHQ Römische Kaiserzeit, Zeit des Domitian und 246 n. Chr. a. H 6,4cm, B 5,9cm. Bronze. Fragment der rechten, oberen Ecke GHU 7DEHOOD ,, 9RQ HLQHU .RQVWLWXWLRQ YRP  -DQXDU  Q Chr. für Moesia inferior oder Thracia. Zeugenliste. Braungrüne 3DWLQDHWZDVNRUURGLHUWb. H 2,8cm, B 3,3cm. Bronze. Kleines )UDJPHQW DXV GHP PLWWOHUHQ %HUHLFK GHU 7DEHOOD , 9RQ HLQHU .RQVWLWXWLRQ YRP  1RYHPEHU  Q &KU 6FKZDU]JU©QH 3D tina. c. H 1,1cm, B 2,7cm. Bronze. Sehr kleines Fragment aus GHUREHUHQ+”OIWHGHU7DEHOOD,.RSLHHLQHU.RQVWLWXWLRQYRP 7. November 88 n. Chr. Dunkelgrüne Patina. d. H 4,7cm, B 6,3cm. Bronze. Fragment aus dem mittleren Bereich der Tabella I. Kopie einer Konstitution vom 12. Mai 91 n. Chr. Dunkelgrü ne Patina. 4 Stück! 300,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. 3XEOL]LHUW3:HLg$XVJHZ”KOWHQHXH0LOLW”UGLSORPHLQ&KLURQ   6II1U3:HLg'LH$X[LOLHQGHVV\ULVFKHQ+HHUHVYRQ'RPLWLDQ bis Antoninus Pius, in: Chiron 36 (2006) S. 252 f. Nr.1; S. 253 f. Nr. 2; S. 255 Nr. 2. )UDJPHQWVRIPLOLWDU\GLSORPDVIRUSUDHWRULDQDQGDX[LOLDU\XQWLV5RPDQ ,PSHULDO3HULRGWLPHRI'RPLWLDQWR$'4 pieces! Published!

168 Sammlung von Militärdiplomfragmenten. Römische Kaiserzeit. H FP%FP%URQ]H)UDJPHQWHDXVYHUVFKLHGHQHQ Bereichen von Tabella I oder II. 16 Stück!+HOOELVGXQNHOJU©QH Patina, teils Korrosionsspuren. 750,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Collection of fragments of military diplomas from different parts of Tabella ,RU7DEHOOD,,5RPDQ,PSHULDO3HULRG/LJKWJUHHQWRGDUNJUHHQSDWLQD partially traces of corrosion. 16 pieces!

169 Sammlung Militärdiplomfragmente. 5¤PLVFKH.DLVHU]HLW -KQ&KU+FP%FP%URQ]H)UDJPHQWHYRQ unterschiedlichen Bereichen der Tabella I oder II. Aus der Zeit GHV'RPLWLDQ7UDMDQ+DGULDQ$QWRQLQXV3LXV " 0DUF$XUHO XQG/XFLXV9HUXV6HSWLPLXV9HUXV)©U$X[LOLDUHLQKHLWHQ3U” torianer. Mit Angaben zur Herkunft und der Zeugen, Bürger rechtstexten, dem Kaisernamen, der Datumsangabe. 28 Stück! +HOOJU©QHELVGXQNHOJU©QHXQGEUDXQH3DWLQDWHLOZHLVH.RUUR sion. 1.000,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. Collection of fragments of bronze military diplomas of different areas of the 7DEHOOD,RU,,)URPWKHWLPHRI'RPLWLDQ7UDMDQ+DGULDQ$QWRQLQXV3LXV " 0DUFXV$XUHOLXVDQG/XFLXV9HUXV6HSWLPLXV6HYHUXV)RUDX[LOLDU\XQLWV SUDHWRULDQV:LWKGHWDLOVRIRULJLQDQGZLWQHVVHVFLYLOULJKWWH[WVWKHHPSHURUyV QDPHWKHGDWH5RPDQ,PSHULDO3HULRGVWUGFHQWXU\$'/LJKWJUHHQ to dark green patina, brown patina, partially corrosion. 28 pieces!

170 Militärdiplomfragmente für Auxiliareinheiten. Römisch, Zeit des 9HVSDVLDQ 'RPLWLDQ 7UDMDQ +DGULDQ $QWRQLQXV 3LXV a. H 5,9cm, B 3,7cm. Bronze. Fragment von der rechten oberen Ecke GHU7DEHOOD,PLW%LQGXQJVORFK9RQHLQHU.RQVWLWXWLRQYRP $SULOQ&KUI©U0RHVLD6FKZDU]JU©QH3DWLQDb. H 5,7cm, %FP%URQ]H)UDJPHQWDXVGHUUHFKWHQ+”OIWHGHVXQWHUHQ Teils der Tabella I. Kopie einer Konstitution vom 7. Februar 78

102

Q&KU'XQNHOJU©QH3DWLQDPLW*UDI}WR;,,E]Z,,; =ZHLW YHUZHQGXQJ  c. H max. 3,8cm, B 3,5cm. Bronze. Fragment aus linken, oberen Bereich der Tabella I (Eckfragment fehlt). 9RQHLQHU.RQVWLWXWLRQYRQ0”U]ELV'H]HPEHURGHU0LWWH 0”U]ELV0DLQ&KU'XQNHOJU©QH3DWLQDPLWURWHQ)OHFNHQ d. H 3,1cm, B 3,1cm. Bronze. Kleines Fragment aus dem Mit telteil der Tabella II. Kopie einer Konstitution vom 7. Februar (?) 160 n. Chr. für Moesia superior. Grüne Patina, korrodiert. e. H 5,4cm, B 4,9cm. Bronze. Fragment der rechten Seite der 7DEHOOD,,9RQHLQHU.RQVWLWXWLRQYRP0DLQ&KUI©U 0RHVLD LQIHULRU 6FKZDU]JU©QH 3DWLQD f. H 5,4cm, B 4,9cm. %URQ]H)UDJPHQWDXVGHPOLQNHQ9LHUWHOGHU7DEHOOD,.RSLH einer Konstitution aus der Zeit um 113 n. Chr. für Moesia inferi or. Dunkelgrüne Patina. g. H 5,7cm, B 8cm. Bronze. Fragment aus der rechten oberen Ecke der Tabella I. Kopie einer Konsti WXWLRQDXVGHU=HLWYRQ0DL'H]HPEHUQ&KUI©U0RHVLD LQIHULRU*U©QEUDXQH3DWLQDWHLOZHLVHNRUURGLHUW7 Stück! 500,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. 3XEOL]LHUW 3 :HLg 0LOLW”UGLSORPH I©U 0RHVLD 0RHVLD 0RHVLD LQIHULRU Moesia superior), in: Chiron 38 (2008) S. 270 ff. Nr. 1; S. 273 f. Nr. 2; S. 275 ff. Nr. 3; S. 290 f. Nr. 7; S. 292 f. Nr. 8; S. 293 ff. Nr. 9; S. 296 ff. Nr. 10. )UDJPHQWVRIPLOLWDU\GLSORPDVIRUDX[LOLDU\XQLWVRIWKHSURYLQFH0RHVLDD )UDJPHQWIURPWKHXSSHUULJKWFRUQHURI7DEHOOD,ZLWKELQGLQJKROH)URP DFRQVWLWXWLRQGDWHG$SULO$'%ODFNJUHHQSDWLQDE)UDJPHQWIURP WKHULJKWKDOIRIWKHORZHUSDUWRI7DEHOOD,)URPDFRQVWLWXWLRQGDWHG)H EUXDU\$''DUNJUHHQSDWLQDZLWKJUDI}WR;,,RU,,; VHFRQGXVH F )UDJPHQWIURPOHIWXSSHUDUHDRI7DEHOOD, FRUQHUIUDJPHQWPLVVLQJ )URP DFRQVWLWXWLRQIURP0DUFKWR'HFHPEHURUPLG0DUFKWR0D\$' Dark green patina with red spots. d. Small fragment from the central part of 7DEHOOD,,)URPDFRQVWLWXWLRQGDWHG)HEUXDU\ " $'IRU0RHVLD VXSHULRU*UHHQSDWLQDFRUURGHGH)UDJPHQWRIWKHULJKWVLGHRI7DEHOOD,, &RS\RIDFRQVWLWXWLRQGDWHG0D\$'IRU0RHVLDLQIHULRU%ODFNJUHHQ SDWLQDI)UDJPHQWIURPWKHOHIWTXDUWHURI7DEHOOD,)URPDFRQVWLWXWLRQ from around 113 A.D. for Moesia inferior. Dark green patina. g. Fragment IURPWKHXSSHUULJKWFRUQHURI7DEHOOD,)URPDFRQVWLWXWLRQIURPWKHSHULRG RI0D\'HFHPEHU$'IRU0RHVLDLQIHULRU*UHHQLVKEURZQSDWLQD partly corroded. 7 pieces! Published!

171 Militärdiplomfragmente für Auxiliareinheiten. Römische Kai serzeit, Zeit des Antoninus Pius, Provinz Moesia inferior. a. Fragment (Bronze, H 3,3cm, B 2,4cm) aus dem linken oberen %HUHLFKGHU7DEHOOD,VRZLH]ZHLDQSDVVHQGH)UDJPHQWH ]XVDP men H max. 4,7cm, B max. 8cm) aus dem Mittelteil der Tabel OD,,.RSLHHLQHU.RQVWLWXWLRQYRP-DQXDU1RYHPEHUQ Chr. Grüne Patina mit roten Flecken (3 Stück). b. H 2,1cm, B FP%URQ]H)UDJPHQWYRPOLQNHQ7HLOGHUREHUHQ+”OIWHGHU 7DEHOOD,9RQHLQHU.RQVWLWXWLRQDXVGHU=HLWXPQ&KU Hellgrüne Patina, leicht korrodiert. c. H 3,8cm, B 2,4cm. Bron ze. Kleines Fragment aus dem rechten Mittelteil der Tabella I. 9RQHLQHU.RQVWLWXWLRQNXU]YRURGHUQDFKQ&KU*UDX grüne Patina, leicht korrodiert. d. H 1,4cm, B 2,2cm. Bronze. Kleines Fragment vom linken Rand der Tabella I. Kopie einer .RQVWLWXWLRQYRQQ&KU*U©QH3DWLQDe. H 7cm, B 6cm. Bronze. Fragment vom rechten Rand der Tabella I (Zu VDPPHQJHK¤ULJPLW50'9 9RQHLQHU.RQVWLWXWLRQ vom 7. April 145 n. Chr. Hellgrüne Patina mit Resten von Kor rosion. 7 Stück! 500,– Provenienz: Aus der Sammlung Peter Weiß, Kiel, erworben zwischen 1967 und 2015. 3XEOL]LHUW 3 :HLg 0LOLW”UGLSORPH I©U 0RHVLD 0RHVLD 0RHVLD LQIHULRU Moesia superior), in: Chiron 38 (2008) S. 302 ff. Nr. 12; S. 307 f. Nr. 13; S. 309 ff. Nr. 14; S. 312 ff. Nr. 15; S. 314 f. Nr.16.


)UDJPHQWVRIPLOLWDU\GLSORPDVIRUDX[LOLDU\XQLWVRIWKHSURYLQFH0RHVLD inferior, time of Antoninus Pius: a. Fragment from the upper left section of 7DEHOOD,DVZHOODVWZRPDWFKLQJIUDJPHQWVIURPWKHPLGGOHVHFWLRQRI7DEHO OD,,)URPDFRQVWLWXWLRQIURP-DQXDU\1RYHPEHU$'*UHHQSDWLQD with red spots (3 pieces). b. Fragment from the left part of the upper half of 7DEHOOD,IURPRIDFRQVWLWXWLRQIURPDURXQG$'/LJKWJUHHQSDWLQD VOLJKWO\FRUURGHGF%URQ]H6PDOOIUDJPHQWIURPWKHULJKWFHQWHUVHFWLRQRI

7DEHOOD,)URPDFRQVWLWXWLRQMXVWEHIRUHRUDIWHU$'*UH\JUHHQSDWLQD OLJKWO\FRUURGHGG6PDOOIUDJPHQWIURPWKHOHIWERWWRPRI7DEHOOD,)URPD FRQVWLWXWLRQIURP$'*UHHQSDWLQDH)UDJPHQWIURPWKHULJKW ERWWRPRIWKH7DEHOOD, EHORQJLQJWRJHWKHUZLWK50'9 )URP of a constitution dated April 7, 145 A.D. Light green patina with remnants of corrosion. 7 pieces! Published!

162

161

164

163

166

167

165

168 169

170

171

103


GERÄTE

172

104


172

172 Helmgesichtsmaske aus Bronze. Römisch, 1. Jh. n. Chr. H FP%FP7\SXV.DONULHVH0DVNHPLWZHLWHQVWLOLVLHUWHQ %UDXHQE¤JHQXQGPDQGHOI¤UPLJHQ$XJHQ¤IIQXQJHQVRZLHZHL WHUHQIIQXQJHQI©U0XQGXQG1DVH2EHQZDUGLH0DVNHPLW tels eines heute fehlenden Scharniers am Helm befestigt. Diese Art von Helmen gehörte zur Paradeausstattung der Kavallerie. *U©QH3DWLQDPLQLPDOH$XVEU©FKHXQG5LVVHDQGHQ5”QGHUQ 12.000,–

3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQHU-DKUHQ 9JO+%RUQ0-XQNHOPDQQ5¤PLVFKH.DPSIXQG3DUDGHU©VWXQJHQ %DQG9,6DPPOXQJ$[HO*XWWPDQQ  6II %URQ]HFDYDOU\SDUDGHKHOPHWIDFHPDVNRIWKHW\SH.DONULHVH5RPDQVW FHQWXU\$'*UHHQSDWLQDPLQLPDO}VVXUHVDQGDWLQ\IUDJPHQWPLVVLQJDW the edges.

105


173

173

106


174

173 • Achämenidische Silberphiale. 5. Jh. v. Chr. H 3,4cm, Ø 21,6cm (368g). Aus getriebenem Silber. Mit schöner Tönung, intakt. 13.000,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVDXV einer deutschen Privatsammlung, 2004 im deutschen Kunsthandel erworben. 9JO]XP%HLVSLHOGLHVLOEHUQHQ3KLDOHQGHV$UWD[HU[HV, Y&KU  LP%ULWLVK0XVHXP/RQGRQ ,QY XQG0HWURSROLWDQ0XVHXP RI$UW1HZ<RUN ,QY  $FKDHPHQLGVLOYHUSKLDOHWKFHQWXU\%&,QWDFW

174 6LOEHUQH 3KLDOH *ULHFKLVFK    -K Y &KU + FP k 21,6cm (400g). Getrieben. Schale mit abgesetztem Rand, in QHQXPHLQHQ2PSKDORVODQ]HWWI¤UPLJH%O”WWHU.OHLQH.UDW]HU sonst intakt. 5.000,–

3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ Chased silver phiale with offset rim, inside lanced formed leaves around of an RPSKDORV*UHHNWKWKFHQWXU\%&6PDOOVFUDWFKHVRWKHUZLVHLQWDFW

175 .OHLQH 6LOEHUVFKDOH PLW SODVWLVFKHP 3~DQ]HQIULHV Römisch, 1. +”OIWH-KQ&KU+FPkFP J *HJRVVHQPLW .DOWDUEHLW $XgHQ SDUWLHOO HWZDV JHW¤QW DQ HLQHU 6WHOOH HWZDV eingedrückt, sonst intakt. 4.000,– 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ Gut zu vergleichen ist die Silberschale New York, Metropolitan Museum of Art 45.160 (suche: metmuseum.org 254540) Small Roman silver bowl with plastic vegetal friezes and engraved outlines. 1st half 3rd century A.D. Outside partially with tinge, little dent, otherwise intact.

175

107


176

176 Gewölbte Schale. 6DVDQLGLVFKRGHUKHSKWDOLWLVFK-KQ&KU L 23cm, H 7,3cm, B 10,4cm. Bronze versilbert mit rotbrauner 3DWLQD/”QJOLFKH6FKDOHDXIHLQHP7URPSHWHQIXg'HU&RUSXV LVWGXUFKO”QJVODXIHQGH5LSSHQLQJHZ¤OEWH)HOGHUJHJOLHGHUW,Q GHU:DQGXQJDQWLNH5HSDUDWXUXQGZLQ]LJHU'XUFKEUXFK 2.400,– 3URYHQLHQ] ([ 6DPPOXQJ $ XQG ( 2IIHUPDQQ HUZRUEHQ DP  September 2009 bei Münzzentrum Rheinland, Solingen. Davor rheinische 3ULYDWVDPPOXQJ,Q'HXWVFKODQGVHLWPLQGHVWHQV &HQWUDO$VLDQOREHGVLOYHUHGEURQ]HERZO6DVDQLDQRUKHSKWDOLWH " WKWK century A.D. Ancient repair at the wall and tiny hole.

177 Aryballos aus Bergkristall. -KY-KQ&KU+FP% 5,6cm. Kleine Sprünge, sonst intakt. 800,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQLQ'HXWVFKODQGVHLWYRU $U\EDOORV PDGH RI URFN FU\VWDO VW FHQWXU\ %&  VW FHQWXU\ $' /LWWOH cracks, otherwise intact.

178 Alabastron. Griechisch, 5. Jh. v. Chr. L 14cm, Ø 2,8cm. Ala EDVWHU6FKPDOHVODQJJH]RJHQHV6DOEJHI”gPLWUXQGHP%RGHQ NXU]HP ]\OLQGULVFKHQ +DOV XQG UXQGHU IIQXQJ PLW ~DFKHU EDQGDUWLJHU /LSSH DQ GHU 6FKXOWHU ]ZHL ZDDJUHFKWH 3VHXGR Griffnoppen. Moderne Durchbohrung am Boden, im unteren %HUHLFKEHVWRgHQ7HLOGHU0©QGXQJHUJ”Q]WZLQ]LJH)UDJPHQ te der Mündung fehlen. 800,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQ,Q'HXWVFKODQGVHLWYRU $ODEDVWHUDODEDVWURQZLWKODWHUDOSVHXGRJULSNQREV*UHHNWKFHQWXU\%& Modern drilling in bottom, in the lower part surface worn, part of the mouth reattached, tiny fragments of the mouth missing.

108

179 (QVHPEOHDXVHLQHP*HI”gPLW]ZHLHURWLVFKHQ$QK”QJHUQRö mische Kaiserzeit. Aus vergoldeter Bronze. Ein halbkugeliges *HI”g +FPkFP PLWHLQHUNOHLQHQUXQGHQIIQXQJDXI GHVVHQ~DFKHU6FKXOWHUYLHU6FKQXU¤VHQVLW]HQXQGHLQ3DDU$Q K”QJHU /FP PLWMHZHLOVHLQHPP”QQOLFKHQ*HVFKOHFKWVWHLO 3 Stück!7HLOZHLVHJU©QH3DWLQD5HVWHGHU9HUJROGXQJHUKDOWHQ als Ensemble gesockelt. 500,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ Collection Nancy Mallen, London, 1988. Set of an ovoid vessel with eyelets on the shoulder and a pair of pendants each LQVKDSHRIDPDOHJHQLWDOLDPDGHRIJLOGHGEURQ]H5RPDQ,PSHULDO3HULRG Partially green patina, rests of the gilding, together on a stand. 3 pieces!

180 Bronzener Spiegel. 6N\WKLVFK    -K Y &KU / FP k 20,8cm. Am Rand gepunzter Dekor. Schöne samtgrüne Patina, Kratzer, sonst intakt. 800,– 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ Scythian bronze mirror with stamped decor. Nice green patina, few scratches, otherwise intact.

181 Bronzenes Sieb. (WUXVNLVFK-KY&KU/PLW*ULIIFP k 6LHE FP )RUP  6LHE LQ *HVWDOW ]ZHLHU JHJHQO”X}JHU :LUEHO*ULIIHQGHLQ)RUP]ZHLHUO\UDI¤UPLJHU6FKZDQHQN¤S fe. )DQWDVWLVFKHV6W©FN Feine Risse am Siebrand. Mit herrlicher malachitfarbener Patina. 2.000,– 3URYHQLHQ]([6DPPOXQJ()5KHLQODQG3IDO]HUZRUEHQDXVGHU 6DPPOXQJ%DUWVFK(SSVWHLQLQ6©GKHVVHQ %URQ]HVWUDLQHUZLWKKDQGOHRIW\SH(WUXVFDQWKWKFHQWXU\%&)LVVXUHV at the sieve. With beautiful malachit colored patina. 2XWVWDQGLQJREMHFW


179

177

180

178 181

109


182 Bronzenes Sieb. (WUXVNLVFK Jh. v. Chr. L mit Griff 30,9cm, Ø Sieb 13,2cm. Form 3. Griffende in Hakenform in Form eines sti lisierten Tierkopfes. Dunkelgrüne Patina, intakt. 1.000,– 3URYHQLHQ] ([ 6DPPOXQJ * +DXFN Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. %URQ]H VWUDLQHU ZLWK KDQGOH RI W\SH  (WUXVFDQ WK  UG FHQWXU\ %& 'DUN green patina, intact.

182

183 Kasserole. 6S”WU¤PLVFK  -K n. Chr. H 11,1cm, Ø 19,9cm, L 35,3cm. Getriebene Bronze mit Kaltarbeit. Auf dem Griffrücken gepunzter Dekor. Am Griffende und am Boden antike Reparatu ren. Mehrere sehr kleine Löcher. 500,– 3URYHQLHQ] ([ 6DPPOXQJ * +DXFN Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs.

183

%URQ]HFDVVHUROH/DWH5RPDQ,PSHULDO Period, 4th century A.D. On the handle punched decor. At the end of the handle and on the bottom ancient repairs. Several tiny holes.

184 Wasserhahn mit Schafskopf. Rö misch, 1. Jh. n. Chr. H 13cm, L FP +\GUDXOLVFKHV 9HQWLO PLW einem Zylinder mit einem dreh EDUHQ9HUVFKOXVVHLQHP$XVJXVV in Form eines Schafskopfes und HLQHU U©FNZ”UWLJHQ =XOHLWXQJ Grüne Patina, Teile des Dreh knopfes gebrochen, sonst intakt. 2.000,– 3URYHQLHQ] ([ 6DPPOXQJ 8 / Westfalen, seit den 1980er Jahren. Roman bronze water spout. The spout LQ IRUP RI D VKHHShV KHDG %HKLQG WKDW a cylinder with valve and a long pipe. Green patina.

184

110


LAMPEN

185 Bronzelampe mit Kandelaber. Frühby ]DQWLQLVFK-KQ&KU+JHVDPW 37,6cm, H Lampe 9,2cm, L Lampe FP + 6W”QGHU FP % 6W”QGHU FP 9ROOJXVV /DPSH PLW 'HFNHO und Kreuzgriff. Dreibeiniger Kande laber mit Blattschürze. Dunkle Patina, intakt. 3.500,– 3URYHQLHQ] $XV GHP 1DFKODVV 0 % LQ Deutschland seit vor 1964. %URQ]HODPSZLWKOLGDQGFURVVKDQGOHDQGFDQ GHODEUXP (DUO\ %\]DQWLQH WK  WK FHQWXU\ A.D. Dark patina intact.

111


187

186 Bronzelampe und Kandelaber. )U©KE\]DQWLQLVFK   7. Jh. n. Chr. H Lampe 11,2cm, L Lampe 16,7cm, H 6W”QGHUFP%6W”QGHUFP9ROOJXVV/DPSHPLW Maske am Griffende. Der dreibeinige Kandelaber mit Tierfüßen und Blattschürze ist zeitgleich entstanden, DEHUQLFKW]ZLQJHQG]XJHK¤ULJ'XQNOH3DWLQD'HFNHO der Lampe fehlt, sonst intakt. 2.500,– 3URYHQLHQ]$XVGHP1DFKODVV0%LQ'HXWVFKODQGVHLWYRU %URQ]HODPSZLWKPDVNDWWKHHQGRIWKHKDQGOH(DUO\%\]DQWLQH WKWKFHQWXU\$'/LGLVPLVVLQJRWKHUZLVHLQWDFW3OXVDEURQ]H candelabrum from the same period which must not belonging. ,QWDFW%RWKZLWKGDUNSDWLQD

186

187 7RQODPSH PLW (URV Römisch, östliches Mittelmeerge biet, 1. Jh. n. Chr. L 12cm, H 2,8cm. Loeschcke Typ ,96FKXOWHU9$XVU¤WOLFKHP7RQPLWURWHPEHU]XJ 5XQGHU&RUSXVPLWYRUNUDJHQGHU6FKQDX]HPLW9ROX ten und Brennloch. Auf dem Spiegel Eros, der auf ei QHP /¤ZHQ QDFK UHFKWV UHLWHW XQG HLQHQ ~LHJHQGHQ 9RJHOI©WWHUW6LQWHUXQGEHULHEHQLQWDNW u 3URYHQLHQ]([6DPPOXQJ(OVD%ORFK'LHQHU%HUQ   ,Q'HXWVFKODQGVHLW Terracotta lamp of reddish clay with red slip depicting Eros riding a lion and feeding a bird. Roman, 1st century A.D. Surface slightly rubbed, traces of sinter.

112


SCHMUCK

188

188 Goldschmuckensemble mit Amethyst. 5¤PLVFK-KQ&KU a. Goldkette (L 47,8cm 39,63g, auf moderne Goldkette aufge zogen) aus 11 Amethystperlen, davon 9 bikonisch, eine kuge OLJXQGHLQHO”QJVRYDOGD]ZLVFKHQ5¤KUHQSHUOHQDXVJHULOOWHP Goldblech, linsenförmige Goldperlen und scheibenförmige *ROGSHUOHQ+DNHQXQGVHQYHUVFKOXVVPLWHLQHP0HGDLOORQ k FP HLQ ZLQ]LJHV /RFK  DXV JHSU”JWHU *ROGIROLH PLW GHP +DXSWGHU*RUJR0HGXVDPLW.RSI~©JHOQE*ROGULQJ 5LQJ JU¤gHJ PLWHLQHU6FKLHQHDXVGUHL6WU”QJHQ3HUOGUDKW XQG HLQHU )DVVXQJ PLW HLQHP O”QJVRYDOHQ JHZ¤OEWHP $PH WK\VWDQGHQ6FKLHQHQHQGHQDXIEHLGHQ6HLWHQMHZHLOVHLQH*UD nulatkugel. c) Paar Goldohrringe (moderner Clip, 7,11g) mit HLQHPO”QJVRYDOHQ$QK”QJHUDXVHLQHPELNRQLVFKHQ$PHWK\VW GHUYRQHLQHP*ROGEOHFKVWUHLIHQJHUDKPWZLUGGold. 8 Stück! Tragbar!2KUULQJHPLWPRGHUQHP&OLS .DUDW DQWLNH9HU schlussteile (4 Stück, 3,27g) beiliegend, intakt. 6.000,–

3URYHQLHQ]([6DPPOXQJ(:+HVVHQHUZRUEHQEHL*UDIXQG*U”}Q Pourtalès, Prien am Chiemsee. Angeblich aus der Sammlung de Clercq, Paris (kein Abbildungsnachweis). 0LW)RWRXQGKDQGVFKULIWOLFKHU1RWL]GHV6DPPOHUVXQGYRQ*UDIXQG *U”}Q3RXUWDO™VPLW+LQZHLVDXI+HUNXQIWDXVGHU6DPPOXQJGH&OHUT Gold jewellery ensemble with amethyst: a. Gold necklace (Strung on modern gold chain) of 11 amethyst beads, 9 of them biconical, one spherical and one longitudinal oval, in between tubular beads of grooved gold sheet, lenticular JROGEHDGVDQGGLVFVKDSHGJROGEHDGV+RRNDQGH\HFORVXUHZLWKDPHGDOOLRQ (Tiny hole) of embossed gold foil with the head of Gorgo Medusa with head ZLQJVE*ROG}QJHUULQJZLWKDKRRSRIWKUHHVWUDQGVRISHDUOZLUHDQGDVHWWLQJ with a longitudinal oval domed amethyst, at the ends of the hoop on either side a granule. c) Pair of gold earrings (With modern clip) with an elongated RYDOSHQGDQWRIDPHWK\VWIUDPHGE\DVWULSRIJROGVKHHW5RPDQUGWK century A.D. Earrings with modern clip, ancient clasp parts enclosed, all intact. SLHFHV:HDUDEOH:LWKSKRWRDQGKDQGZULWWHQQRWHE\WKHFROOHFWRUDQG &RXQWDQG&RXQWHVV3RXUWDO™VZLWKUHIHUHQFHWRRULJLQIURPWKHGH&OHUFT collection!

113


189

189 Halskette mit Granatanhängern. +HOOHQLVWLVFK-KY&KU 80,37g. L 40cm. Bestehend aus einem 1,2cm breiten Flechtband DXV*ROGGUDKWGDVPLWHLQHP+DNHQXQGVHQYHUVFKOXVVYHU VHKHQLVWGHUDXIEHLGHQ6HLWHQMHZHLOVHLQHUXQGH)DVVXQJPLW HLQHP 6WHLQLPLWDW LQ )RUP HLQHU JHZ¤OEWHQ PLW ZHLgHU (QJR EH©EHU]RJHQHQ7RQVFKHLEHDXIZHLVW$P)OHFKWEDQGEHIHVWLJW VLQGNOHLQH5RVHWWHQDQGHQHQDEZHFKVHOQGHLI¤UPLJHXQG WURSIHQI¤UPLJH $QK”QJHU K”QJHQ 'LH WURSIHQI¤UPLJHQ $Q K”QJHU EHVWHKHQ DXV *ROG XQG HQWKDOWHQ HLQHQ JHIDVVWHQ *UD QDWVWHLQ 'D]ZLVFKHQ EH}QGHQ VLFK (LFKHODQK”QJHU GLH PLW )XFKVVFKZDQ]NHWWHQ DQ GHQ 5RVHWWHQ HLQJHK”QJW VLQG XQG LQ GHU 0LWWH HLQH 5RVHWWH HQWKDOWHQ 'LH $QK”QJHU LQ )RUP YRQ (LHUQ XQG (LFKHOQ EHVWHKHQ DXV 7RQ VLQG PLW ZHLgHU (QJREH ©EHU]RJHQ XQG ZDUHQ XUVSU©QJOLFK YHUJROGHW 5HVWH GHU 9HU goldung sind noch erkennbar. *ROG3UDFKWH[HPSODU Intakt. 18.000,– 3URYHQLHQ] ([ 6DPPOXQJ ( : +HVVHQ HUZRUEHQ FD  EHL Kunsthandlung Neuhaus, Würzburg.

189

114

0LW )RWR XQG KDQGVFKULIWOLFKHU 1RWL] GHV 6DPPOHUV XQG YRQ $OEUHFKW 1HXKDXV 9JOHLQH”KQOLFKH.HWWHPLW)OHFKWEDQG&$GDP +UVJ *UHHN-HZHOOHU\ IURPWKH%HQDNL0XVHXP&ROOHFWLRQV  61U=XYHUJROGHWHQ 7RQDQK”QJHUQEHL.U”Q]HQXQG2KUULQJHQNRPSOHWWDXV7RQVLHKH*OL2UL di Taranto in Età Ellenistica. Ausstellungskatalog (1984) S. 88 Nr. 16; S. 91 II1U .U”Q]H XQG6II1U%HLGHQ6W©FNHQDXV7DUHQW handelt es sich vorwiegend um Grabbeigaben. Deswegen ist anzunehmen, GDVVXQVHU([HPSODUHEHQIDOOVDXVHLQHP*UDEIXQGVWDPPW$QVWHOOHYRQ *ROGZXUGHEHLGHQ$QK”QJHUQQXU7RQYHUZHQGHWGHUPLWHLQHUG©QQHQ Goldschicht oder weißer Engobe überzogen wurde, um das wertvolle Material einzusparen. Gold necklace consisting of a braided strap of gold wire with a hook and eye FORVXUH$WWDFKHGWRLWDUHVPDOOURVHWWHVIURPZKLFKKDQJDOWHUQDWLQJHJJ VKDSHGDQGGURSVKDSHGSHQGDQWV7KHHJJVKDSHGSHQGDQWVDUHPDGHRIFOD\ DQGZHUHRULJLQDOO\JROGSODWHG7KHWHDUGURSVKDSHGSHQGDQWVDUHPDGHRI JROGDQGFRQWDLQDVHWJDUQHWVWRQH,QEHWZHHQDUHDFRUQSHQGDQWVKXQJRQ WKHURVHWWHVZLWKIR[WDLOFKDLQVDQGFRQWDLQLQJDURVHWWHLQWKHFHQWHULWVHOI The oak pendants are made of clay and were originally gilded. Remnants of WKHJLOGLQJDUHVWLOOUHFRJQL]DEOH+HOOHQLVWLFWKUGFHQWXU\%&,QWDFW 6SOHQGLGQHFNODFH:LWKSKRWRDQGKDQGZULWWHQQRWHE\WKHFROOHFWRUDQG $OEUHFKW1HXKDXV


190

190 Goldkette mit verstellbaren Schiebern. 5¤PLVFK1RUGDIULND -KQ&KUJ/FDFP$XVYLHU)XFKVVFKZDQ]NHWWHQ DXV G©QQHP *ROGGUDKW GHUHQ (QGHQ LQ ]ZHL YDVHQI¤UPLJH 6FKLHEHUHLQJHK”QJWVLQGXQG]ZDUVRGDVVGLH.HWWHQYRUKHU GXUFK GHQ MHZHLOLJHQ *HJHQVFKLHEHU ODXIHQ $XI GLHVH :HLVH O”VVWVLFKGLH/”QJHGHU.HWWHYHU”QGHUQ$XgHUGHPODXIHQGLH )XFKVVFKZDQ]NHWWHQ GXUFK HLQH JHULHIHOWH ELNRQLVFKH 7©OOH aus dünnem Goldblech. Die Schieber haben zentral einen quadratischen Querschnitt und sind mit einem Kreisornament VRZLH 3DOPHWWHQ LQ GHQ =ZLFNHOQ GLH JHSXQ]W VLQG GHNRULHUW Gold. 7©OOH DQ HLQHP (QGH HWZDV EHVFK”GLJW XQG DQWLN repariert. 6.000,– 3URYHQLHQ]([0©Q]]HQWUXP5KHLQODQG6ROLQJHQ$XNWLRQ-XQL /RVHKHPDOV6DPPOXQJ.ODXV6FK©OOHU,Q'HXWVFKODQGVHLWYRU

3XEOL]LHUWLQ$QWLNHQDXVUKHLQLVFKHP3ULYDWEHVLW]$XVVWHOOXQJ%RQQ   Kat. 414 mit Taf. 185. Es gibt zwei Parallelstücke zu unserer Kette, die beide in Ägypten gefunden ZXUGHQ XQG PLW 0©Q]DQK”QJHUQ GHNRULHUW ZDUHQ %HLGH 6W©FNH ZHLVHQ in Herstellungstechnik und Konstruktion große Übereinstimmungen mit XQVHUHP6W©FNDXI'HUM©QJVWH0©Q]DQK”QJHUVWDPPWYRQ*RUGLDQ,,,  Q&KU 6LHKHGD]X5XGROSK/HSNHyV.XQVW$XFWLRQV+DXV%HUOLQ .DWDORJ   /RV  PLW 7DI  6DPPOXQJ %DXUDW 6FKLOOHU  .HWWHLP.XQVWKLVWRULVFKHQ0XVHXPLQ:LHQ ,QY$QWLNHQVDPPOXQJ9,, /LW29RHWWHU6DPPOXQJ%DFKRIHQYRQ(FKW5¤PLVFKH0©Q]HQXQG Medaillons [1903] Taf. 46). *ROGQHFNODFHPDGHRIIRXUIR[WDLOFKDLQVRIWKLQJROGZLUHWKHHQGVRIZKLFK DUHKRRNHGLQWRWZRYDVHVKDSHGVOLGHUVDQGLQVXFKDZD\WKDWWKHFKDLQV SUHYLRXVO\SDVVWKURXJKWKHUHVSHFWLYHFRXQWHUVOLGHU5RPDQ1RUWK$IULFD UGWKFHQWXU\$'*URPPHWDWRQHHQGVOLJKWO\GDPDJHGDQGDQWLTXH repaired.

115


191

191 &ROOLHU DXV .DUQHRO XQG *ROGSHUOHQ Nordafrika, römische .DLVHU]HLW / FP &ROOLHUDUWLJH .HWWH PLW YLHU 6WU”QJHQ DXV kugeligen Karneolperlen, die durch vier miteinander verbunde nen, kugeligen Goldperlen stegartig gegliedert sind und in ei nem Strang enden. Gold.0RGHUQDXIJHI”GHOWPLW9HUVFKOXVV 2.000,– 3URYHQLHQ]$XVGHUDOWHQ3ULYDWVDPPOXQJ$QGU˜5RQGH([9HQWH&ROOLQ GX%RFDJH 3DULV

Necklace with four strands of spherical cornelian beads, which are barred by four interconnected spherical gold beads, ending in one strand. North Africa, 5RPDQ,PSHULDO3HULRG0RGHUQVWULQJLQJZLWKFORVXUH

192 Goldkette mit Granatsteinen. 6S”WU¤PLVFK-KQ&KUJ / FP $XV  JHZ¤OEWHQ UXQGHQ RGHU RYDOHQ *UDQDWVWHL nen, die in Gold gefasst sind. Die einzelnen Elemente sind mit Golddrahtösen verbunden. Gold. Tragbar mit Verschluss! Ein *UDQDWVWHLQIHKOWHLQHUJHEURFKHQ5HVWHYRQ6LQWHUHWZDV]HU drückt. 1.500,– 3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU Gold necklace with 20 mounted garnets. Late Roman, 4th century A.D. One garnet stone missing, one broken, traces of sinter, partially crushed. :HDUDEOH ZLWKFORVXUH

193 Kettenteil aus Goldscheiben und Granatperlen. 6DUPDWLVFK Jh. n. Chr. L 39cm. Fünf mit Granulat und halben Goldkügel chen reich dekorierte runde Scheiben aus Goldblech, in deren 0LWWHHLQJHZ¤OEWHUUXQGHU*UDQDWVWHLQPRQWLHUWLVWXQGGLHPLW einem rautenförmigen Element, das ebenfalls einen runden, ge Z¤OEWHQ*UDQDWVWHLQDXIZHLVWIHVWYHUEXQGHQVLQG'D]ZLVFKHQ kugelige Granatperlen. Gold. 0RGHUQ DXIJHI”GHOW RKQH 9HU schluss, ein Granatstein fehlt. 1.500,– 3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU 3DUWRIDQHFNODFHRI}YHURXQGGLVFVRIJROGVKHHWULFKO\GHFRUDWHGZLWKJDUQHWV and half gold beads, with a domed round garnet stone mounted in the center DQGFRQQHFWHGWRDGLDPRQGVKDSHGHOHPHQWZKLFKDOVRKDVDURXQGGRPHG JDUQHWVWRQH%HWZHHQWKHPDUHVSKHULFDOJDUQHWEHDGV6DUPDWLDQVWWK century A.D. Modern stringing with closure, one garnet stone missing.

194 Bronzekette mit vergoldeten Tonanhängern. +HOOHQLVWLVFK Jh. v. Chr. L 78cm. Kette aus Bronzedrahtelementen, an der 60 WURSIHQI¤UPLJH$QK”QJHUDXVXUVSU©QJOLFKYHUJROGHWHP7RQEH IHVWLJWVLQG5HVWHGHU9HUJROGXQJHUKDOWHQ0LW)RWRGHV6DPP lers! (LQ $QK”QJHU ORVH HLQ $QK”QJHU IHKOW .HWWH PLW JU©QHU Patina, intakt. 800,– 3URYHQLHQ]([6DPPOXQJ(:+HVVHQVHLW %URQ]H QHFNODFH RI ZLUH HOHPHQWV ZLWK GURSVKDSHG SHQGDQWV PDGH RI RULJLQDOO\JLOGHGFOD\7UDFHVRIJLOGLQJSUHVHUYHG+HOOHQVWLFWKUGFHQWXU\ %&2QHSHQGDQWPLVVLQJRQHSHQGDQWORRVHFKDLQZLWKJUHHQSDWLQDLQWDFW :LWKSKRWRE\WKHFROOHFWRU

116


192

193

194

117


195

196

195 Kette aus Glasperlen. 5¤PLVFK-KQ&KU/FP$XV OLQVHQI¤UPLJHQ3HUOHQDXVEODXHP*ODVGLHPLW6LOEHUGUDKW Ösen miteinander verbunden sind. 3HUOHQ WHLOZHLVH PLW VHKU schöner Iris!9HUVFKOXVVIHKOW u

$OV (QGVW©FNH DXI EHLGHQ 6HLWHQ MHZHLOV HLQ WUDSH]I¤UPLJHV Element in Druchbruchstechnik. Mit Scharnierverschluss. Gold. 3UDFKWH[HPSODU 7UDJEDU 0LW )RWR XQG KDQGVFKULIWOLFKHU 1RWL] des Sammlers! Intakt. 5.000,–

1HFNODFHRIOHQWRLGEHDGVRIEOXHJODVV5RPDQQGUGFHQWXU\$' Closure missing, beads with QLFHLULGHVFHQVH

3URYHQLHQ]([6DPPOXQJ(:+HVVHQHUZRUEHQEHL.XQVWKDQGOXQJ Neuhaus, Würzburg. 9JO 'LH :HOW YRQ %\]DQ]  (XURSDV ¤VWOLFKHV (UEH $XVVWHOOXQJVNDWDORJ München (2004) S. 287 Nr. 483. Das als Kragenschmuck bezeichnete Stück ist in Material und Herstellungstechnik gut vergleichbar.

196 Kette aus Gagat. 5¤PLVFK-KQ&KU/FDFP$XV 30 unterschiedlich geformten Gagatperlen (tropfenförmig, ku gelig, bikonisch, amygdaloid), in der Mitte ein rechteckiges Ele PHQWPLWI©QIKDOENXJHOLJHQ9HUWLHIXQJHQ0RGHUQDXIJHI”GHOW ZLQ]LJHIHKOHQGH)UDJPHQWHDQHLQLJHQ3HUOHQ u

*ROG EUDFHOHW LQ RSHQZRUNWHFKQLTXH ZLWK KLQJH FORVXUH FRQVLVWLQJ RI  HOHPHQWVFRQQHFWHGE\KLQJHV,QWKHFHQWHUDVTXDUHSDQHOIUDPHGE\GRWWHG gold wire with four set nacre beads and a square set lapis lazuli. On the right and on the left, three rectangular elements framed by dotted wire in openwork technique. As end pieces on both sides a trapezoidal element in openwork WHFKQLTXH(DUO\%\]DQWLQHWKFHQWXU\$',QWDFW:HDUDEOH([WUDRUGLQDU\ SLHFH:LWKSKRWRDQGKDQGZULWWHQQRWHE\WKHFROOHFWRU

3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU

3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU 'HUGHXWVFKH1DPH€*DJDWyOHLWHWVLFKYRQGHU)XQGVWHOOHLQGHU1”KHGHV )OXVVHVXQGGHU6WDGW*DJDLLQ/\NLHQ 7©UNHL DE,QGHU$QWLNHZXUGHQ die Steine liqoj gagathj 6WHLQHDXV*DJDL JHQDQQW*DJDWLVWGXUFK +XPXVJHORGHU%LWXPHQLPSU”JQLHUWHVIRVVLOHV+RO]GDVVLFKLPEHUJDQJ YRQ%UDXQ]X6WHLQNRKOHEH}QGHW 1HFNODFHRIGLIIHUHQWO\VKDSHGMHWEHDGV5RPDQQGUGFHQWXU\$' Modern stringing, tiny fragments of several beads missing.

197 Goldarmband in Durchbruchstechnik. Frühbyzantinisch, 6. Jh. n. Chr. 64,26g. L 19cm, B 2,7cm. Bestehend aus 11 Elementen, die mit Scharnieren verbunden sind. Im Zentrum eine quadratische, YRQ SVHXGRWRUGLHUWHP *ROGGUDKW JHUDKPWH 3ODWWH PLW YLHU gefassten Perlmuttperlen und einem quadratischen, gefassten /DSLVOD]XOL5HFKWVXQGOLQNVMHZHLOVGUHLUHFKWHFNLJHYRQSVHXGR tordiertem Draht gerahmte Elemente in Durchbruchstechnik.

118

198 Goldener Armreif mit Antilopenköpfen. Hellenistisch, 4. Jh. v. Chr. 12,48g, Ø 6,8cm. Offener Reif aus gedrehtem Goldblech und tordiertem Draht, der in Antilopenköpfen endet. Gold. Mit Kopie der Rechung von Rouillac!5HLIHWZDVYHUERJHQ 2.500,– Provenienz: Aus der alten Sammlung des Cabinet of Curiosités des Schlosses Chenay in der Stadt Vouzon; aus der Sammlung der Enkelin des Gründers GHU$XWRPDUNH+LVSDQR6XL]D  HUZRUEHQEHL5RXLOODF$XNWLRQ Juni 2017, Los 317 (Teil). 9JO 7KH :DOWHUV $UW 0XVHXP %DOWLPRUH $FFHVVLRQ 1XPEHU 92  6LHKH%'HSSHUW/LSSLW]*ULHFKLVFKHU*ROGVFKPXFN  6IIXQG7DI;,; Gold open bracelet of twisted and folded hollow tubes with terminals in shape RIDQWHORSHKHDGV+HOOHQLVWLFWKFHQWXU\%&6OLJKWO\EHQW:LWKFRS\RI WKHLQYRLFHIURP5RXLOODF


197

198

119


199

200

199 Goldarmreif mit Scharnier. 6HOGVFKXNLVFK-KQ&KU 13,12g, Ø 6,3cm. Aus Goldblech geformter Reif, der zu den (QGHQ KLQ NRQLVFK YHUO”XIW XQG LQ HLQHU +”OIWH HLQ 6FKDUQLHU DXIZHLVW$P9HUVFKOXVV*UDQXODWGHNRUGold. Intakt. 800,– 3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU Gold bracelet made of gold foil with conical endings and hinge, at the closure JUDQXOHVGHFRUDWLRQ6HOMXNWKWKFHQWXU\$',QWDFW

200 *ROGHQH1DGHOPLW/¤ZHQNRSI+HOOHQLVWLVFK(QGH$QIDQJ Jh. v. Chr. 3,69g, L 5,5cm. Konisch zulaufender Schaft aus tor GLHUWHQ*ROGGU”KWHQPLWJODWWHU6SLW]H'DUDQDQVFKOLHgHQGHLQH PLW*ROGGUDKWGHNRULHUWH0DQVFKHWWHGLHLQHLQHP/¤ZHQNRSI endet. Gold. *ROGGUDKW DP 6FKDIW ]ZHL 0DO JHEURFKHQ VRQVW intakt. 600,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ 6DPPOXQJ9/5KHLQODQG 6LHKH86LIIHUW9RQGHU$QWLNHELV]XU0RGHUQH7LHUGDUVWHOOXQJHQDXVYLHU Jahrtausenden in der Sammlung Preuß (2014) S. 92 Nr. 76. Höchstwahr scheinlich handelt es sich um einen aufgebogenen Ohrring, wofür auch der gebrochene Golddraht des Schaftes spricht. Gold pin with a tapered shaft made of twisted gold wires with smooth tip HQGLQJLQDOLRQyVKHDG+HOOHQLVWLFHQGRIWKHDUO\UGFHQWXU\%&*ROG wire on shaft broken twice, otherwise intact.

201 /XQXOD$QK”QJHUDXV*ROG5¤PLVFK-KQ&KUJ% FP+FP0RQGVLFKHOI¤UPLJHU$QK”QJHUDXV*ROGEOHFK PLWUHOLH}HUWHUVHREHQXQGGUHLDXVJHVWDQ]WHQ/¤FKHUQXQWHU der Öse und gepunzten Kreisen. Gold. Winzige Kratzer, intakt. 500,– 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ /XQXODVKDSHGJROGSHQGDQWZLWKH\HOHWDQGSXQFKHGFLUFOHV5RPDQQG 3rd century A.D. Tiny scratches, intact.

202 • *ROG}EHO 7KUDNLVFK    -K Y &KU J / FP 0DVVLYHU%©JHOGHU]XGHQ(QGHQKLQNRQLVFKYHUO”XIWXQGPLW Manschetten dekoriert ist, in der Mitte des Bügels eine Kugel. Auf dem sanduhrenförmigen Nadelhalter gepunzte Kreispunkte VRZLH HLQH HLQVHLWLJH 6SLUDOH 9HUELQGXQJ ]ZLVFKHQ %©JHO XQG Nadelhalter mittels einer Spirale. Gold. Intakt. 7.500,– 120

201

3URYHQLHQ](['6LPRQ&ROOHFWLRQHUHU-DKUH 9JO*ROGGHU7KUDNHU$UFK”RORJLVFKH6FK”W]HDXV%XOJDULHQ$XVVWHOOXQJV NDWDORJ.¤OQ  6I1U KLHUDOOHUGLQJVDXV%URQ]H  *ROGERZ}EXODZLWKVSLUDODQGDQHHGOHKROGHUZLWKSXQFKHGFLUFOHV7KUDFLDQ WKWKFHQWXU\%&,QWDFW

203 9HUJROGHWH6LOEHU}EHOPLW$OPDQGLQ)U”QNLVFK+”OIWH-K n. Chr. L 2,3cm. In Form eines stilisierten Adlers mit Alaman GLQHLQODJHDP$XJHXQGLP6FKZDQ]EHUHLFKUHGX]LHUWHU.HUE schnittdekor im Bereich des Körpers. Nadel aus Eisen. Gold. Am Schnabel restauriert, Nadel korrodiert. 500,– 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ *LOGHGVLOYHU}EXODLQVKDSHRIDVW\OL]HGHDJOHZLWKDOPDQGLQHLQOD\VDQG UHGXFHGFKLSFDUYHGGHFRU)UDQNLVKVWKDOIRIWKFHQWXU\$'5HVWRUHGDW the beak, needle corroded.

204 'RSSHONRSI}EHO DXV %URQ]H Keltisch, Latène A, 5. Jh. v. Chr. L 6cm, H 3cm. Gegossener, WI¤UPLJHU %©JHO GHU LQ ]ZHL VWLOLVLHUWHQ'UDFKHQN¤SIHQHQGHWLQGHU0LWWHHLQH$UWSUR}OLHUWHU Knauf. Mit Armbrustspiralkonstruktion. Grüne Patina, Spirale leicht korrodiert. 1.500,– 3URYHQLHQ]([3ULYDWVDPPOXQJ&1'HXWVFKODQGHUZRUEHQLQGHQHU Jahren aus deutschter Privatsammlung. %URQ]HGRXEOHKHDG}EXODZLWKDFDVWERZHQGLQJLQVW\OL]HGGUDJRQKHDGV &HOWLF/DW™QH$WKFHQWXU\%&*UHHQSDWLQDVSLUDOSDUWLDOO\FRUURGHG

205 0DVNHQ}EHODXV%URQ]HKeltisch, Latène A, 5. Jh. v. Chr. L 3cm, H 2,6cm. Gegossener Bügel in Form eines Tieres mit langem +DOVXQG]XU©FNJHZHQGHWHP.RSIDP)XgHQGHHLQ.RSIPLW ]ZHLJURgHQ$XJHQ0XQGXQG1DVHGHNRULHUWPLWJHSXQ]WHQ Kreisen. Mit Armbrustspiralkonstruktion. Grüne Patina, Nadel HWZDVYHUERJHQ6SLUDOHOHLFKWNRUURGLHUW u 3URYHQLHQ]([3ULYDWVDPPOXQJ&1'HXWVFKODQGHUZRUEHQLQGHQHU Jahren aus deutschter Privatsammlung. %URQ]HPDVN}EXODZLWKDFDVWERZLQVKDSHRIDVW\OL]HGDQLPDODQGDKXPDQ OLNHIDFHDWWKHIRRW&HOWLF/DW™QH$WKFHQWXU\%&*UHHQSDWLQDQHHGOH slightly bent, spiral partially corroded.


202

203

204

205

121


206 Sammlung goldene Schmuckelemente. +HOOHQLVWLVWLVFK-K Y &KU J 'DUXQWHU ]ZHL UHFKWHFNLJH (OHPHQWH / FP B 0,6cm) aus Goldblech mit Ösen an den Ecken und auf der 5©FNVHLWH$XIGHU9RUGHUVHLWH5DQNHQDXVSVHXGRWRUGLHUWHP *ROGGUDKW9LHOOHLFKWKDQGHOWHVVLFKXP*HZDQGDSSOLNHQRGHU (OHPHQWH YRQ HLQHP *©UWHO =ZHL 0DQVFKHWWHQ / FP % FP PLWODQ]HWWI¤UPLJHQ%O”WWHUQZDKUVFKHLQOLFKYRQHLQHP $UPEDQGVRZLHHLQNOHLQHV6W©FN*ROGGUDKWGold. 5 Stück! Ein Element mit Riss. 500,–

210 )UDXHQNRSIRKUULQJ+HOOHQLVWLVFK(QGH$QIDQJ-KY&KU 2,87g, H 1,5cm. Tordierter Bügel, der in eine Manschette mit Frauenkopf übergeht. Gold. Winziger Riss im Frauenkopf. 800,–

Provenienz: Aus der Sammlung M. S., in Deutschland seit vor 1990.

211 Zwei Goldohrringe mit Schild und Kugelanhänger. Römisch, 1.   -K Q &KU J / FP 8QWHUVFKLHGOLFK JURgH %©JH lohrringe mit einem kleinen Schild auf dem Bügel und einem NXJHOLJHQ XQEHZHJOLFKHQ $QK”QJHU PLW *UDQXODWVSLW]H Gold. 2 Stück! Beide Kugeln mit feinem Riss. 750,–

&ROOHFWLRQRIJROGMHZHOOHU\HOHPHQWV+HOOHQLVWLFQGVWFHQWXU\%&2QH HOHPHQWZLWKWLQ\}VVXUH5 pieces!

207 3DDU *ROGRKUULQJH PLW $QK”QJHUQ Byzantinisch, 7. Jh. n. Chr. 6,15g, L ca. 5cm. Bügelohrringe mit einem birnenförmigen An K”QJHUDXVJHSU”JWHUGXUFKEURFKHQJHDUEHLWHWHU*ROGIROLHGHU HLQH3DOPHWWHDXIHLQHP6WDPP]HLJW$P5DQGGHV$QK”QJHUV fünf Rundeln. Gold. Intakt. 1.200,– Provenienz: Aus der Sammlung M. S., in Deutschland seit vor 1990. 9JO$<HURXODQRX'LDWULWD3LHUFHGZRUNJROGMHZHOOHU\IURPWKHUGWRWKH 7th century (1999) S. 278 f. 3DLURIJROGHDUULQJVZLWKDSLHUFHGZRUNSHDUVKDSHGSODTXHKDQJLQJIURP DKRRN7KHFHQWHULVGHFRUDWHGZLWKDSDOPHWWHRQDWUXQNDWWKHHGJH}YH URXQGHOV%\]DQWLQHWKFHQWXU\$',QWDFW

208 3DDUJROGHQH6WLHUNRSIRKUULQJH+HOOHQLVWLVFKY&KU J k FP %©JHO DXV WRUGLHUWHQ *ROGGU”KWHQ GLH LQ HL ner glatten Spitze enden. Auf der anderen Seite schließt eine Manschette mit goldender Kugel an, die in einen Stierkopf über JHKW GHVVHQ $XJHQ XUVSU©QJOLFK HLQJHOHJW ZDUHQ 8QWHU GHP .LQQHLQ5LQJGHUDOV9HUVFKOXVVGLHQWHGold. Bügel bei beiden Ohrringen gebrochen, bei einem nachantik repariert, Einlagen fehlen. 1.000,– 3URYHQLHQ]([1DFKODVV+52EHUVFKZDEHQPLQGHVWHQVVHLWYRU 6LHKH 0 3IURPPHU 8QWHUVXFKXQJHQ ]XU &KURQRORJLH IU©K XQG hochhellenistischen Goldschmucks (1990) S. 162 f. und Taf. 30 Nr. 33f. Pair of golden bow earrings of twisted gold wires with a bull head with RULJLQDOO\LQODLGH\HV+HOOHQLVWLF%&%RWKERZVEURNHQRQHRI them repaired after the antique, inlays missing.

209 *ROGHQHU)UDXHQNRSIRKUULQJ+HOOHQLVWLVFK(QGH$QIDQJ -KY&KUJkFP%©JHODXVWRUGLHUWHQ*ROGGU”KWHQ der in einer glatten Spitze endet. Auf der anderen Seite schließt HLQH0DQVFKHWWHDQGLHLQHLQHQ0”GFKHQNRSI©EHUJHKW'LHVHU ist hohl gearbeitet und hat am Hinterkopf ein Loch für die Aufnahme des Bügels. Gold. Bügel an einer Stelle angebrochen, HWZDVYHUGU©FNW u 3URYHQLHQ]([1DFKODVV+52EHUVFKZDEHQPLQGHVWHQVVHLWYRU 6LHKH 0 3IURPPHU 8QWHUVXFKXQJHQ ]XU &KURQRORJLH IU©K XQG hochhellenistischen Goldschmucks (1990) S. 181 ff. und Taf. 30 Nr. 52. Golden bow earring of twisted gold wires with a woman head. Hellenistic, HQGRIUGHDUO\QGFHQWXU\%&%RZEURNHQDWRQHSRLQWVOLJKWO\FUDVKHG

122

Provenienz: Aus der Sammlung M. S., in Deutschland seit vor 1990. *ROGZRPDQKHDGERZHDUULQJ+HOOHQLVWLFHQGRIUGEHJLQQLQJRIQG FHQWXU\%&7LQ\}VVXUHLQWKHZRPDQKHDG

3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ 6DPPOXQJ9/5KHLQODQG 7ZRJROGHQERZHDUULQJVZLWKVPDOOVKLHOGRQWKHERZDQGJOREXODU}[HG SHQGDQWZLWKJUDQXOHWLS5RPDQVWQGFHQWXU\$'%RWKVSKHUHVZLWK WLQ\}VVXUH2 pieces!

212 3DDU JROGHQH +DDUVSLUDOHQ 0HVRSRWDPLVFK  +”OIWH  -W Y Chr. 7,49g, Ø 2,2cm. Aus Goldblech mit einer Wicklung, an den Außenseiten gerippt. Gold.(WZDV]HUGU©FNWZLQ]LJH/¤FKHU und Risse, ein Stück antik repariert. 600,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ 6DPPOXQJ9/5KHLQODQG 3DLURIJROGKDLUVSLUDOVPDGHRIVKHHWRQHFRLOHGDQGZLWKULEEHGGHFRUDWLRQ RQWKHRXWVLGH0HVRSRWDPLDQHQGUGPLOOHQLXP%&,QWDFW

213 Goldener Hochzeitsring. 6S”WU¤PLVFK-KQ&KUJ 5LQJJU¤gH  'LH 6FKLHQH LVW RIIHQ JHDUEHLWHW XQG EHVWHKW auch drei gleichgroßen Ringen, die mit Granulatkügelchen miteinander verbunden sind. Auf der rechteckigen, von einer Punktlinie gerahmten Platte eingraviert die drapierten Büsten ei QHU)UDXXQGHLQHVE”UWLJHQ0DQQHVGDU©EHUHLQ.UHX]Gold. Intakt. 3.500,– Provenienz: Aus der Sammlung M. S., in Deutschland seit vor 1990. *ROG ZHGGLQJ }QJHUULQJ ZLWK RSHQZRUNHG KRRS RQ WKH UHFWDQJXODU SODWH HQJUDYHGDFRXSOHDERYHWKHPDFURVV/DWHDQWLTXHWKWKFHQWXU\$' ,QWDFW

214 Goldring mit Achatgemme. 5¤PLVFK-KQ&KUJ Ringgröße 51. Schmale, nach außen konvexe, nach oben breiter ZHUGHQGH 6FKLHQH DXI GHU 3ODWWH HLQJHODVVHQ HLQH TXHURYDOH Gemme aus Lagenachat, auf dem Intaglio ein stehender Hund auf einer Standlinie nach links. Gold. Intakt. 2.800,– Provenienz: Aus der Privatsammlung Marc Grandguillot, erworben 1991 bei Gérard Dessagnes. *ROG }QJHUULQJ ZLWK JHPVWRQH RI OD\HUHG DJDWH GHSLFWLQJ D VWDQGLQJ GRJ 5RPDQVWQGFHQWXU\$',QWDFW


208 206

207

211 209

210

212

214

213

123


215 Moderner Goldring mit Karneolgemme. Ring modern, Gemme U¤PLVFK-KQ&KUJ5LQJJU¤gH6FKPDOHQDFK außen konvexe Schiene mit Mittelgrat, deren Enden die Fas sung zangenartig umschließen. In der Fassung eine querovale Gemme aus orangerotem Karneol. Auf dem Intaglio eine nach links springende Sphinx. Mit Signatur „S.02“ seitlich auf der Fassung. Aus der Goldschmiede Schleede. Gold. Mit Gutachten YRQ:ROIJDQJ6NROXGDHU*ROG.DUDW Intakt mit Gebrauchsspuren. 1.600,– 3URYHQLHQ]5LQJH[6DPPOXQJ-:+DPEXUJVHLW*HPPHH[ &ROOHFWLRQ-HDQ$ODLQ0DULDXGGH6HUUHVH['URXRW0RQWDLJQH3DULVH YHQWH$SULO/RV,Q'HXWVFKODQGVHLW

215

0RGHUQJROG}QJHUULQJ FDUDW ZLWKJHPVWRQHRIUHGRUDQJHFRUQHOLDQ GHSLFWLQJDOHDSLQJVSKLQ[*ROGULQJPRGHUQJHPVWRQH5RPDQUGFHQWXU\ $',QWDFWZLWKWUDFHVRIXVHZLWKVLJQDWXUH3LHFHRIWKHJROGVPLWK6FKOHHGH Hamburg. :LWKH[SHUWLVHRI:ROIJDQJ6NROXGD

216 Moderner Goldring mit antiker Karneolgemme. Ring nach 1968, *HPPHU¤PLVFK-KQ&KUJ5LQJJU¤gH6FKPD OHQDFKDXgHQNRQYH[HXQGQDFKREHQHWZDVEUHLWHUZHUGHQGH 6FKLHQH,QGHU)DVVXQJHLQHKRFKRYDOHJHZ¤OEWH*HPPHDXV rotem Karneol. Auf dem Intaglio die Büste des Serapis, darun ter der hockende Greif der Nemesis, der eine Pfote auf ein Rad gelegt hat, auf einer Grundlinie. Innen auf der Schiene vier Pun zen: eine runde Punze mit Rauten, eine Werkstattmarke „GS“ (= Goldschmiede Thomas Schleede, Hamburg), eine Punze mit w XQG HLQH ZHLWHUH :HUNVWDWWPDUNH PLW 76w  7KRPDV Schleede). *ROGHU*ROG .DUDW 6W©FNGHV*ROGVFKPLHGV 7KRPDV6FKOHHGH+DPEXUJ Intakt mit Gebrauchsspuren. 1.500,–

216

3URYHQLHQ]([6DPPOXQJ-:+DPEXUJVHLW 9JO]XGHPLQGHU$QWLNHJ”QJLJHQ0RWLYHLQH*HPPHLP0XVHXPRI)LQH $UWV%RVWRQ $FFHVVLRQ1XPEHU GHV-KVQ&KU$XIGLHVHP 6W©FN VLQG ]XV”W]OLFK ]XU 6HUDSLV%©VWH XQG GHP *UHLI GHU 1HPHVLV QRFK ein achtstrahliger Stern sowie eine Mondsichel dargestellt. Der hockende Greif mit dem Rad als Attribut der Nemesis ist ein verbreitetes Motiv der hellenistischen und römischen Zeit. 0RGHUQJROG}QJHUULQJ FDUDW ZLWKDQFLHQWJHPVWRQHRIUHGFRUQHOLDQ GHSLFWLQJWKHEXVWRI6HUDSLVDQGDVLWWLQJJULI}QZLWKRQHSRZRQDZKHHO )LQJHUULQJDIWHUJHPVWRQH5RPDQVWQGFHQWXU\$',QWDFWZLWKWUDFHV of use. 3LHFHRIWKHJROGVPLWK7KRPDV6FKOHHGH+DPEXUJ

217 Moderner Goldring mit Gemme aus roter Glaspaste. Ring nach *HPPHQDFKDQWLN " J5LQJJU¤gH6FKPDOH QDFK DXgHQ NRQYH[H QDFK REHQ EUHLWHU ZHUGHQGH 6FKLHQH ,Q der Fassung eine querovale Gemme aus roter, opaker Glaspaste. $XIGHP,QWDJOLRHLQ$GOHUPLWHLQHU6FKODQJHLQGHQ)”QJHQ Auf der Schiene innen Meisterstempel „TS“ und Wertangabe „750“. $XVGHU*ROGVFKPLHGH7KRPDV6FKOHHGH+DPEXUJ Gold. HU*ROG.DUDW Intakt mit Gebrauchsspuren. 1.000,– 3URYHQLHQ]([6DPPOXQJ-:+DPEXUJVHLW

217

0RGHUQJROG}QJHUULQJ FDUDW ZLWKJHPVWRQHRIUHGJODVVSDVWHGHSLFWLQJ an eagle with a snake in the fangs. Ring after 2000, gemstone after the Antique " ,QWDFWZLWKWUDFHVRIXVHZLWKPDQXIDFWXUHUyVPDUN3LHFHRIWKHJROGVPLWK 7KRPDV6FKOHHGH+DPEXUJ

218 0RGHUQHU *ROGULQJ PLW -DVSLV*HPPH Ring modern, Gemme KHOOHQLVWLVFK-KY&KU RGHU-K J5LQJJU¤gH 0RGHUQHU*ROGULQJPLWHLQHUJOHLFKP”gLJEUHLWHQ]ZHLJHWHLOWHQ

124


218 219

Bandschiene und einer Ringfassung, die unten offen ist. Darin eine hochovale Gemme aus orangem Karneol, auf dem Intaglio GLHJHJHQVW”QGLJHQYHUEXQGHQHQ.¤SIHHLQHVMXQJHQXQGHLQHV ”OWHUHQE”UWLJHQ0DQQHVGold. Intakt. 1.000,– 3URYHQLHQ]([3ULYDWEHVLW]07LQ0©QFKHQVHLWGHQHU-DKUHQ 9JO'LHDQWLNHQ*HPPHQGHV.XQVWKLVWRULVFKHQ0XVHXPV:LHQ%DQG (1991) Taf. 72 Nr. 2095. 0RGHUQ JROG }QJHUULQJ ZLWK JHPVWRQH RI RUDQJH FRUQHOLDQ GHSLFWLQJ WKH opposite joined heads of a young and an older, bearded man. Ring modern, JHPVWRQH+HOOHQLVWLFVWFHQWXU\%& RUWKFHQWXU\ ,QWDFW

219 Goldring mit Glasstein. 5¤PLVFK-KQ&KUJ5LQJ JU¤gH6FKPDOHQDFKDXgHQNRQYH[HQDFKREHQEUHLWHUZHU GHQGH 6FKLHQH DXI GHU 3ODWWH HLQJHODVVHQ HLQ 5LQJVWHLQ,PLWDW aus blaugrünem Glas. Gold. Intakt. 1.000,– Provenienz: Aus der alten Privatsammlung André Ronde (vor 1989).

220

*ROG}QJHUULQJZLWKDRYDOJUHHQEOXHJODVVLPLWDWLQJWKHULQJVWRQH5RPDQ VWQGFHQWXU\$',QWDFW

220 Goldring mit Karneolgemme. %\]DQWLQLVFK    -K Q &KU J5LQJJU¤gH'XUFKEURFKHQJHDUEHLWHWH6FKLHQHDXV Weinlaubranken, darauf eine blütenkelchartige Fassung mit ei ner hochovalen Gemme aus rotem Karneol. Auf dem Intaglio ein Frosch. Gold. Intakt. 800,– 3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU *ROG}QJHUULQJZLWKDKRRSLQRSHQZRUNHGWHFKQLTXHRIWHQGULODQGOHDYHV DQGDPRXQWHGJHPVWRQHRIUHGFRUQHOLDQGHSLFWLQJDIURJ%\]DQWLQHWK WKFHQWXU\$',QWDFW

221 Goldring mit Karneolgemme. 5¤PLVFK-KQ&KUJ 5LQJJU¤gH  6FKPDOH QDFK DXgHQ NRQYH[H QDFK REHQ EUHLWHUZHUGHQGH6FKLHQH'LH3ODWWHPRGHUQXPJHDUEHLWHWI©U GLH $XIQDKPH HLQHU O”QJVRYDOHQ *HPPH DXV GXQNHORUDQJHP Karneol. Auf dem Intaglio ein Hahn nach links. Gold. Intakt, Platte modern umgearbeitet. 800,– 3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU

221

*ROG}QJHUULQJZLWKJHPVWRQHRIUHGRUDQJHFRUQHOLDQGHSLFWLQJDURRVWHU 5RPDQ QG  UG FHQWXU\ $' ,QWDFW SODWH PRGHUQO\ UHZRUNHG IRU WKH mounting of the gemstone.

125


222

225

222 0RGHUQHU *ROGULQJ PLW -DVSLV*HPPH Ring modern, Gemme U¤PLVFK-KQ&KUJ5LQJJU¤gH0RGHUQHU*ROG ULQJPLWHLQHUJOHLFKP”gLJEUHLWHQJHULHIHOWHQ%DQGVFKLHQHXQG einer mit Golddrahtvoluten, Granulatkügelchen und tordiertem Draht verzierten Fassung. Darin eine querovale Gemme aus ro tem Jaspis, auf dem Intaglio eine Jagdszene, in der ein Hund ]ZHL+DVHQKHW]WGold. Intakt. 800,– 3URYHQLHQ]([3ULYDWEHVLW]07LQ0©QFKHQVHLWGHQHU-DKUHQ 0RGHUQJROG}QJHUULQJZLWKJHPVWRQHRIUHGMDVSHUGHSLFWLQJDGRJKXQWLQJ WZRUDEELWV5LQJPRGHUQJHPVWRQH5RPDQVWQGFHQWXU\$',QWDFW

223 Goldring mit Glasgemme. Ring modern (?), Gemme, hellenistisch, -KY&KUJ5LQJJU¤gH6FKLHQHDXVUXQGHP Golddraht, darauf eine hochovale Fassung mit einer Gemme aus rotem Glas. Der Intaglio zeigt eine Büste des Herakles mit XPJHNQRWHWHP /¤ZHQIHOO Gold. Schöne Heraklesdarstellung! Fragment der Gemme fehlt. 800,– 3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU *ROG}QJHUULQJZLWKJHPVWRQHRIUHGJODVVGHSLFWLQJWKHEXVWRI+HUDFOHVZLWK NQRWWHGOLRQVNLQ5LQJPRGHUQ " JHPVWRQH+HOOHQLVWLFQGVWFHQWXU\ %&7LQ\IUDJPHQWRIWKHJHPVWRQHPLVVLQJ

224 Goldring mit männlichem Kopf. 5¤PLVFK    -K Q &KU J 5LQJJU¤gH  6FKPDOH QDFK DXgHQ NRQYH[H QDFK REHQEUHLWHUZHUGHQGH6FKLHQHPLWHLQHURYDOHQ)DVVXQJ'DULQ HLQ JHZ¤OEWHU *UDQDWVWHLQ DXI GHP ,QWDJOLR HLQ P”QQOLFKHU Kopf. Gold..OHLQHU5LVVLQQHQDQGHU6FKLHQH*HPPHZLHGHU eingesetzt. 750,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ Privatbesitz M. T., München, 1980er Jahre. *ROGHQ}QJHUULQJZLWKJHPVWRQHRIJDUQHWGHSLFWLQJDPDOHKHDG5RPDQVW QGFHQWXU\$'7LQ\}VVXUHLQVLGHWKHKRRSJHPVWRQHUH}[HGLQWKHEH]HO

126

223

224

226

227

225 *ROGULQJPLW*UDQDW*HPPHHellenistisch, 1. Jh. v. Chr. 4,75g, Ringgröße 43. Schmale, bandartige Schiene, die in eine hohe )DVVXQJ©EHUJHKWGDULQHLQHJHZ¤OEWH*HPPHDXV*UDQDWPLW einer Lanzenspitze und einem Monogramm. Gold. Intakt. 600,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ 6DPPOXQJ9/5KHLQODQG *ROG}QJHUULQJZLWKJDUQHWJHPVWRQHGHSLFWLQJDVSHDUKHDGDQGDPRQRJUDP +HOOHQLVWLFVWFHQWXU\%&,QWDFW

226 *ROGULQJPLW1LHOOR'HNRU)U©KE\]DQWLQLVFK-KQ&KU J5LQJJU¤gH6HKUVFKPDOH]XU3ODWWHEUHLWHUZHUGHQGH Schiene, auf der runden Platte ein von einem Punktkreis ge UDKPWHV.UHX]LQ1LHOOR'HNRUGold. Intakt. 600,– 3URYHQLHQ] ([ 6DPPOXQJ & 6 0©QFKHQ (UZRUEHQ LP 0©QFKQHU .XQVWKDQGHO *ROG}QJHUULQJZLWKFURVVLQQLHOORGHFRU(DUO\%\]DQWLQHWKWKFHQWXU\ $',QWDFW

227 Bronzering mit Karneolgemme. 5¤PLVFK-KQ&KU5LQJ JU¤gH  6FKPDOH QDFK REHQ EUHLWHU ZHUGHQGH QDFK DXgHQ NRQYH[H6FKLHQHPLW6FKXOWHUNQLFNXQG5HOLH}HUXQJHQLPREH ren Bereich. Auf der Platte eine erhabene Gemme aus Karneol, auf dem querovalen Intaglio ein Adlerkopf. Grüne Patina, in takt. 300,– 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ %URQ]H}QJHUULQJZLWKFRUQHOLDQJHPVWRQHGHSLFWLQJDQHDJOHKHDG5RPDQ QGUGFHQWXU\$'*UHHQSDWLQDLQWDFW


KAMEEN, GEMMEN, SIEGEL

228

229

230

228 Karneolgemme mit Athena. Baktrisch, 2. Jh. v. Chr. H 2,7cm. Roter Karneol, auf dem hochovalen Intaglio stehende, behelmte Athena mit Rundschild und Lanze. Mit Abdruck! Intakt. 1.000,– 3URYHQLHQ] ([ 6DPPOXQJ . * 5KHLQODQG HUZRUEHQ LP GHXWVFKHQ Kunsthandel 1960er Jahre bis 2003. $WKHQDZLUGLQ”KQOLFKHU:HLVHDXIEDNWULVFKHQ0©Q]HQGHV0HQDQGHU, 6RWHU FDY&KU GDUJHVWHOOW V]XP%HLVSLHO+*&  $OOHUGLQJVVFKOHXGHUWVLHDXIGHQ0©Q]HQHLQ%OLW]E©QGHOZ”KUHQGVLHDXI XQVHUHP6W©FNHLQH/DQ]HK”OW Red cornelian gemstone depicting helmeted Athena with round shield and ODQFH%DFWULDQQGFHQWXU\%&,QWDFW:LWKLPSULQW

229 Jaspisgemme mit Gryllos. 5¤PLVFK-KQ&KU+FP $XVURWHP-DVSLVPLWVFKZDU]HQ$GHUQDXIGHPKRFKRYDOHQ,Q taglio ein Gryllos bestehend aus einem Adlerkopf, einem Wid GHUNRSI XQG HLQHP E”UWLJHQ P”QQOLFKHQ .RSI DOOHV DXI ]ZHL 9RJHOEHLQHQ GDKLQWHU ]ZHL 3IHLOH XQWHQ UHFKWV HLQ &DGXFHXV *URgHV([HPSODU Intakt. 800,–

231

230 Karneolgemme mit erotischer Szene. 5¤PLVFK-KQ Chr. H 2,9cm. Aus rotorangem Karneol. Auf dem hochovalen Intaglio eine Szene mit Eros mit Eimer und Stab links, Priapos LQHLQHP:DVVHUEDVVLQUHFKWVXQGLQGHU0LWWH9HQXVGLH]ZHL ŠKUHQ©EHUNUHX]©EHUGHQ.RSIK”OW,QWDNW  u 3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU Gemstone of redorange cornelian depicting an erotic scene with an eros with situla and rod and Priapos standing on a water bassin, inbetween Venus with FRUQHDUVLQKHUKDQGV5RPDQVWQGFHQWXU\$',QWDFW

231 .DUQHROJHPPHPLW3RUWU”WHLQHV%”UWLJHQRömisch, 3. Jh. n. Chr. H 13,2mm. Aus rotem Karneol, auf dem hochovalen Intaglio GLH GUDSLHUWH %©VWH HLQHV E”UWLJHQ 0DQQHV QDFK OLQNV ,QWDNW ZLQ]LJH.UDW]HUDXIGHU2EHU~”FKH u Provenienz: Aus der alten süddeutschen Sammlung D. L., vor 1980. Gemstone of red cornelian depicting the portrait of a bearded, draped man. 5RPDQUGFHQWXU\$',QWDFWZLWKWLQ\VFUDWFKHVDWWKHVXUIDFH

3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU Gemstone of red jasper depicting a gryllos, the combination of an eagle head, a ram head and a bearded, male head on bird feet, behind two arrow, in front RILWDFDGXFHXV5RPDQVWQGFHQWXU\$',QWDFW+XJHH[HPSODUH

127


232 .DUQHROJHPPH PLW 3HUVRQL}NDWLRQ Römisch, 2. Jh. n. Chr. B 13,3mm. Aus rotem Karneol, auf dem querovalen Intaglio die QDFKOLQNVJHODJHUWH3HUVRQL}NDWLRQGHU9LD7UDLDQDGLHVLFKPLW dem linken Arm auf einen Felsen stützt und mit der Rechten ein 5DGK”OW:LQ]LJHV5DQGIUDJPHQWIHKOW u Provenienz: Aus der alten süddeutschen Sammlung D. L., vor 1980. 'DV0RWLYGHUSHUVRQL}]LHUWHQ9LD7UDLDQDLVWYRQ0©Q]HQGHV.DLVHUV7UDMDQ Q&KU EHNDQQWDXIGHQHQHVGDV5HYHUV]LHUWYJO]XP%HLVSLHO 5,& 'HQDU 'LH%H]HLFKQXQJ€9LD7UDLDQDyZLUGI©ULQVJHVDPWYLHU DQWLNH6WUDgHQDEVFKQLWWHYHUZHQGHWGLH9LD$SSLD7UDLDQDLQ,WDOLHQGLH9LD 7UDLDQD&DODEUDYRQ%ULQGLVLQDFK2WUDQWRGLH9LD7UDLDQDDXIGHU%DONDQ halbinsel von Oescus bzw. Novae nach Philippopolis und zur Via Egnatia und die Via Traiana Nova in der Provinz Arabia Petraea. *HPVWRQHRIUHGFRUQHOLDQGHSLFWLQJWKHSHUVRQL}FDWLRQRIWKHYLDWUDLDQDZLWK wheel. Roman, 2nd century A.D. Tiny fragment missing.

233 Gemme aus orangem Karneol mit Gryllos. 5¤PLVFKZRKO$TXL OHLD-KQ&KU[FP+H[DJRQDOHU,QWDJOLR'DUDXI HLQIDQWDVWLVFKHV)DEHOZHVHQEHVWHKHQGDXVHLQHP9RJHO6WUDXg dessen Leib vorne als Silensmaske und nach hinten als Widder kopf gebildet ist. Als Reiter fungiert eine Maus mit Peitsche, die GLH=©JHOK”OW0LW.RSLHGHU5HFKQXQJ6HOWHQHVHKULQWHUHVVDQ te Ikonographie!=ZHLZLQ]LJH$EVSOLWWHUXQJHQDQGHU6HLWHE]Z Unterseite, sonst intakt. 400,– 3URYHQLHQ]$XVGHUED\HULVFKHQ3ULYDWVDPPOXQJ+:H[*RUQ\ 0RVFK München Auktion 275, 2020, Los 232; erworben am 15. Juni 2013 bei Nemesis New York (Nr. 9936). 9JO DOV 3DUDOOHOH HLQH *HPPH LQ :LHQ ( =ZLHUOHLQ'LHKO 'LH DQWLNHQ *HPPHQ GHV .XQVWKLVWRULVFKHQ 0XVHXPV LQ :LHQ %DQG ,,,   1U 'RUW}QGHWVLFKDXFKGHU9HUZHLVDXIHLQH*HPPHDXV$TXLOHLDGLH $QODVVGD]XJLEWGLHVH6WDGWDOV3URGXNWLRQVVW”WWHDQ]XQHKPHQ*6LHQD Chiesa, Gemme del Museo Nazionale di Aquileia (1966) Nr. 1007. Zum 9RJHO6WUDXgLQGHUU¤PLVFKHQ$QWLNHVGHQRQOLQH]XJ”QJOLFKHQ$UWLNHO $:DFNH'HU9RJHO6WUDXgDOVIU©KHV%HLVSLHOI©U*HVHW]HVDQDORJLHHLQ Phantasma? Grenzfragen bei der römischen Tierhalterhaftung. Fundamina 3UHWRULD YROQ3UHWRULD=XU9HUZHQGXQJGHV%HJULIIV*U\OORV für derartige Mischgebilde auf Gemmen s. J. Hammerstaedt, Gryllos. Die DQWLNH%HGHXWXQJHLQHVPRGHUQHQDUFK”RORJLVFKHQ%HJULIIHV=HLWVFKULIWI©U Papyrologie und Epigraphik 129, 2000, 29 ff. +H[DJRQDO JHPVWRQH PDGH RI RUDQJH FRUQHOLDQ *U\OORV FRPSRVHG RI DQ ostrich with mask of Silen and head of a ram, on his back a mouse with ZKLS5RPDQSUREDEO\$TXLOHLDQGUGFHQWXU\$'7LQ\VSOLQWHUVDUH missing, otherwise intact. :LWKFRS\RIWKHLQYRLFH9HU\UDUHDQGLQWHUHVWLQJ LQWDJOLR

234 Sammlung Gemmen mit Kaiserporträts. 5¤PLVFK    -K Q Chr. a. H 2,2cm. Aus rotem Glas mit moderner Goldfassung PLW$XIK”QJHU$XIGHPKRFKRYDOHQ,QWDJOLRGUDSLHUWH3DQ]HU E©VWHGHV(ODJDEDOPLW/RUEHHUNUDQ],QWDNW(UZRUEHQLP0DL 2004 beim MünzZentrum Rheinland, Solingen. Mit vergrößer tem Abdruck der Staatlichen Münzsammlung, München. b. H 2,2cm. Aus rotem Glas mit moderner Goldfassung mit Auf K”QJHU $XI GHP KRFKRYDOHQ ,QWDJOLR .RSI GHV 0D[LPLDQXV PLW/RUEHHUNUDQ],QWDNW(UZRUEHQLP$XJXVWEHL/RQ don Ancient Coins Ltd. c. H 1,4cm. Aus brauner Glaspaste mit ZHLgHQ6WUHLIHQ,QWDJOLRDXIIDVWTXDGUDWLVFKHU3ODWWH$XIGHP runden Intaglio Kopf des Tiberius mit Lorbeerkranz. Intakt. (UZRUEHQ LP $SULO  EHL 3DXO)UDQFLV -DFTXLHU .HKO DP Rhein. 3 Stück! Alle mit Kopie der Rechnung! 600,–

0D[LPLDQXVDQG7LEHULXV5RPDQ,PSHULDO3HULRGVWUGFHQWXU\$' ,QWDFWWZRRIWKHPZLWKPRGHUQJROGPRXQWLQJSLHFHV$OOZLWKFRS\RI WKHLQYRLFH

235 Stempelsiegel aus Serpentin. 6LHJHO-WY&KU'DUVWHOOXQJ sasanidisch, 5. Jh. n. Chr. 2,5 x 2,3cm. Giebelförmig mit Boh UXQJ DXI GHU IDVW TXDGUDWLVFKHQ 6LHJHO~”FKH YLHU NUHX]I¤UPLJ DQJHRUGQHWHP”QQOLFKH%©VWHQPLW.\UEDVLDGD]ZLVFKHQ3DOP ]ZHLJH2EHU~”FKHHWZDVEHVWRgHQ u 3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU Die Siegelform ist für die sasanidische Zeit nicht belegt. Deswegen ist DQ]XQHKPHQGDVVGLH6LHJHO~”FKHDQWLNXPJHDUEHLWHWZXUGH Gable stamp seal of serpentine, on the rectangular sealing surface male busts ZLWKN\UEDVLDDUUDQJHGLQDIRXUFURVVVKDSHSDOPEUDQFKHVEHWZHHQWKHP 6HDOWKUGPLOOHQLXP%&LOOXVWUDWLRQ6DVDQLDQWKFHQWXU\$'6XUIDFH partially worn.

236 Stempelsiegel aus Chalzedon. Sasanidisch, 5. Jh. n. Chr. Ø 1,7cm. +DOENXJHOLJPLW%RKUXQJ$XIGHU6LHJHO~”FKHHLQVHFKVVSHLFKL JHV 5DG PLW 6WLHUN¤SIHQ DQ GHQ 6SHLFKHQHQGHQ 2EHU~”FKH HWZDVEHVWRgHQZLQ]LJH)UDJPHQWHIHKOHQ u 3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU +HPLVSKHULFDOVWDPSVHDORIFKDOFHGRQ\RQWKHVHDOLQJVXUIDFHDVL[VSRNH wheel with bull heads at the ends of the spokes. Sasanian, 5th century A.D. Surface partially worn, tiny fragments missing.

237 Stempelsiegel aus Achat. Sasanidisch, 5. Jh. n. Chr. H 1,7cm, B 6LHJHO~”FKH FP (OOLSVRLG PLW /”QJVERKUXQJ $XI GHU 6LH JHO~”FKHHLQJH~©JHOWHV3IHUGGDVVLFKXPZHQGHWGDKLQWHUHLQ Emblem. Mit Abdruck! Winzige Fragmente fehlen. 300,– 3URYHQLHQ] ([ 6DPPOXQJ . * 5KHLQODQG HUZRUEHQ LP GHXWVFKHQ Kunsthandel 1960er Jahre bis 2003. Ellipsoid stamp seal of agate with drilling depicting a winged horse and an emblemata. Sasanian, 5th century A.D. Tiny fragments missing. With LPSULQW

238 Stempelsiegel mit Inschrift. ,VODPLVFK(QGH$QIDQJ-K n. Chr. H 1,4cm, L 2,4cm. Achat, halbkugelig mit Querboh UXQJ$XIGHU6LHJHO~”FKHNDOOLJUD}VFKH,QVFKULIWLQ1DVFKLHL QHU6FKULIWGLHLP-DKUKXQGHUWGLHNX}VFKH6FKULIWDEO¤VW Mit Abdruck!6LHJHO~”FKHLQWDNW&RUSXVHWZDVEHVWRgHQ u 3URYHQLHQ] ([ 6DPPOXQJ . * 5KHLQODQG HUZRUEHQ LP GHXWVFKHQ Kunsthandel 1960er Jahre bis 2003. Hemispherical stamp seal of agate with drilling depicting naschi inscription. ,VODPLFHQGRIWKEHJLQQLQJRIWKFHQWXU\$'6HDOLQJVXUIDFHLQWDFW corpus partially worn. :LWKLPSULQW

239 Kegelsiegel aus grauem Stein. 1HRDVV\ULVFK    -K Y &KU + FP k 6LHJHO~”FKH FP $XI GHU 6LHJHO~”FKH VWLOLVLHUWHV Raubtier. Absplitterung am Rand. 300,–

Provenienz: Aus der bayerischen Privatsammlung H. W.

3URYHQLHQ] ([ 6DPPOXQJ . * 5KHLQODQG HUZRUEHQ LP GHXWVFKHQ Kunsthandel 1960er Jahre bis 2003.

Collection of Roman gemstones of red glass paste and brown glass paste with white stripe depicting portraits of the Roman Emperors Elagabal,

Concial stamp seal with drilling made of grey stone depicting a stylized animal. 1HRDVV\ULDQWKWKFHQWXU\%&6SOLQWHUDWWKHVLGHLVPLVVLQJ

128


232

233

234

209

235

236

238

237

239

129


GLAS

240

130


241

240 *URgH$VFKHQXUQHPLW'HFNHO5¤PLVFKH.DLVHU]HLW-K Q&KU+PLW'HFNHOFP%O”XOLFKHV.ODUJODVJHEODVHQ$S IHOI¤UPLJHUKHQNHOORVHU7RSIPLWJHZ¤OEWHP%RGHQXQGEUHLWHU KRUL]RQWDOHU/LSSHGLHDXgHQDXIGHPNXU]HQ+DOVDX~LHJWZR VLHHLQPDOJHVWDXFKWLVW'HU'HFNHO~DFKLP=HQWUXPNRQLVFK aufsteigend mit einem kleinen, abgesetzten Griff oben. Intakt. 8.000,– 3URYHQLHQ]([6DPPOXQJ3'H[*RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW /DUJHDVKFLQHUD\XUQZLWKOLG7KHERG\DSSOHVKDSHGZLWKZLGHKRUL]RQWDO ULP7KHOLGFRQLFDOZLWKWZRKRUQHGNQRE5RPDQ,PSHULDO3HULRGVWQG FHQWXU\$',QWDFW

241 • *URgHU9LHOKHQNHOWRSIVWOLFKHU0LWWHOPHHUUDXP-KQ Chr. H 13,2cm. Aus hellgrünem Klarglas. Bauchiger Körper mit kurzem zylindrischen Hals, großem Kragen und gerundeter Lip SH%UHLWHUDQJHVHW]WHUXQGHLQJHWLHIWHU)XgPLW6WDQGULQJ9RP .¤USHU DXI GHQ 5DQG XQG YRP .¤USHU DXI GHQ 6WDQGULQJ MH ZHLOV]DKOUHLFKH+HQNHODXVGXQNHOJU©QHP*ODVMHZHLOVPHKU PDOV JH]ZLFNW =ZHL +HQNHO SDUWLHOO JHEURFKHQ 6SU©QJH XQG Fehlstellen im Boden. 18.000,– 3URYHQLHQ]([3ULYDWVDPPOXQJ0U&6FKZHL]HU-DKUH%HL *RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV 9JO<,VUDHOL$QFLHQW*ODVVLQWKH,VUDHO0XVHXP  61U Large Eastern Mediterranean jar with multiple pinched handles of light green DQGJUHHQFOHDUJODVVWKWKFHQWXU\$'7ZRKDQGOHVQRWFRPSOHWH}VVXUHV and small missing parts in bottom.

131


242 Zweihenkeliges Töpfchen mit fei QHP)DGHQGHNRUÖstlicher Mittel PHHUUDXP FD    -K Q &KU H 8cm. Klarglas. Ovoider Cor pus mit eingezogenem Hals und ZHLWHU ]ZHLIDFK JHVFKZXQJH ner Lippe. Auf dem Corpus ein querlaufender Fadendekor. Die beiden Henkel einmal gefaltet. In takt, herrliche Iris. 7.000,– 3URYHQLHQ] ([ 6DPPOXQJ 3 ' ([ *RUQ\  0RVFK 0©QFKHQ $XNWLRQ   /RV  ,Q 'HXWVFKODQG seit 2002.

242

7ZRKDQGOHG MDU ZLWK JOREXODU ERG\ VKRUW ZLGH QHFN DQG YHUWLFDO GRXEOH rounded rim. Two handles rise from the shoulers, join the ridge at right angle and run along till the top of the rim. The body is decorated with a slender trailing running around the body. Eastern Medi WHUUDQHDQUGWKFHQWXU\$'([FHO lently preserved iridescence, intact.

243 %ODXH 3DWHOOD6FKDOH 1. Jh. v. &KU-KQ&KU+FPk 11,5cm. Blaues, durchscheinen des Glas. Halbkugeliger Napf mit runder Standplatte und aus kragender Faltung unterhalb der Lippe. Intakt. 5.000,– 3URYHQLHQ] ([ 6DPPOXQJ 3 ' ([ *RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW Vgl. D. Whitehouse, Roman Glass in the &RUQLQJ0XVHXPRI*ODVV,   1U*O”VHUGHU$QWLNH6DPPOXQJ 2SSHQO”QGHU  1UII %OXHSDWHOODFXS5RPDQ,PSHULDO3HULRG VWFHQWXU\$'7KHERG\ZLWK~DULQJ sides on pad foot, the short vertical rim HPHUJLQJ IURP D IROGHG ~DQJHG FROODU ,QWDFW

243

132


244 Blauer Becher. Römische Kaiser ]HLW    -K Q &KU k FP H 7,5cm. Konischer Becher aus blauem Klarglas mit horizontalen Schliffringen. Intakt. 2.500,– 3URYHQLHQ] ([ 6DPPOXQJ 3 ' ([ *RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW %OXHJODVVEHDNHUZLWKZKHHOFXWULQJV 5RPDQ ,PSHULDO 3HULRG VW  QG FHQWXU\$',QWDFW

244

245 :HLgEODXH 5LSSHQVFKDOH Römi VFKH .DLVHU]HLW QHURQLVFK  ~D visch, 1. Jh. n. Chr. Ø 9,5cm. =DUWH6FKDOHDXVRSDNHPZHLgHQ Glas mit siebzehn Rippen aus ei QHP EODXZHLgHQ VSLUDOLJ YHU drehten Faden. Auf der Schulter umlaufender blauer Faden. Aus vielen Scherben geklebt, aber ohne Fehlstellen. 10.000,– 3URYHQLHQ] ([ 6DPPOXQJ 3 ' ([ *RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW 9JO *O”VHU GHU $QWLNH 6DPPOXQJ 2SSHQO”QGHU   1U  ' Whitehouse, Roman Glass in the &RUQLQJ 0XVHXP RI *ODVV ,, 6  Kat. 760. Opaque ribbed bowl with light blue trail DQG RXWVSOD\HG ULP 5RPDQ ,PSHULDO Period, 1st century A.D. Reassembled from fragments but complete. 245

133


246

247

246 1DYLFHOOD6FK”OFKHQ  -K Y &KU   -K Q &KU + FP k 9,5cm. Weißes, opakes Glas, formgeschmolzen. Schale mit Standring, gebauchter Wandung und doppelter Kehlung unter der Lippe. Form Dragendorff 27. Intakt. 3.000,– 3URYHQLHQ]([6DPPOXQJ3'([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW 9JO$QWLNH*O”VHU$XVVWHOOXQJ$QWLNHQPXVHXP%HUOLQ  1U :KLWH1DYLFHOODERZOVWFHQWXU\%&VWFHQWXU\$',QWDFW

247 :HLgHV'RSSHONRSIJHI”gVWOLFKHU0LWWHOPHHUUDXP-K Q&KU+FP2SDNHVZHLgHV*ODV)RUPJHEODVHQPLWGHQ *HVLFKWHUQHLQHVSDXVE”FNLJHQ.QDEHQXQGHLQHVMXQJHQ0DQ QHVPLW6WLUQELQGHXQGZDOOHQGHP+DDUDP&RUSXV=\OLQGUL scher Hals mit ausgebogener, nach innen umgebördelter Lippe. Intakt. 3.000,–

248

3URYHQLHQ]([6DPPOXQJ3'([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW 9JO*O”VHUGHU$QWLNH6DPPOXQJ(UZLQ2SSHQO”QGHU  1U 2SDTXHZKLWH~DVNLQIRUPRIMDQLIRUPKHDGRID\RXQJPDQDQGDORQJ F\OLQGULFDOQHFN,QWDFW

134


249

248 • 'RSSHONRSI~DVFKHVWOLFKHU0LWWHOPHHUUDXP-KQ&KU +FP*HOEOLFKHV*ODVPLWMDQXVI¤UPLJHP*HVLFKW)HKOHQGH 7HLOHGHU0©QGXQJVLQGPRGHUQHUJ”Q]W u Provenienz: Aus einer israelischen Privatsammlung, erworben vor 2000. (DVWHUQ0HGLWHUUDQHDQEORZQGRXEOHKHDG~DVNRI\HOORZLVKJODVVQGUG century A.D. Missing parts of the mouth are modern retouched.

250

251

250 *HOEHV€VLGRQLVFKHVy)O”VFKFKHQLevante, 1. Jh. n. Chr. H 7,4cm. 'XUFKVFKHLQHQGHV IRUPJHEODVHQHV *ODV 2YRLGHV )O”VFKFKHQ mit vertikalen Rippen und umlaufendem Weinrankenornament DXIGHP%DXFK'HUDQGHU/LSSH]ZHLPDOJHIDOWHWH+HQNHODXV blassblauen Glas. ([]HOOHQWH(UKDOWXQJ Reste von Iris, intakt. 1.200,– 3URYHQLHQ]([6DPPOXQJ'U001RUGUKHLQ:HVWIDOHQ,Q'HXWVFKODQG seit vor 1972. 9JO5RPDQ*ODVVLQWKH&RUQLQJ0XVHXPRI*ODVV,,  I1U $QWLNH*O”VHU$XVVWHOOXQJ$QWLNHQPXVHXP%HUOLQ1U

249 Honiggelb marmoriertes Alabastron. Römische Kaiserzeit, 1. Jh. Q&KU+FP*URgHVELUQHQI¤UPLJHV*HI”gPLWQDFKLQQHQ umgebördelten Rand. Weiß und honiggelb marmoriertes, opakes Glas. Wieder zusammengesetzt mit kleineren Fehlstellen. 2.000,– 3URYHQLHQ]([6DPPOXQJ3'([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW <HOORZ DQG ZKLWH PDUYHUHG RSDTXH JODVV XQJXHQWDULXP 5RPDQ ,PSHULDO 3HULRGVWFHQWXU\$'5HDVVHPEOHGZLWKVPDOO}OOHGXSDUHDV

<HOORZLVK€VLGRQLDQy~DVNZLWKWHQGULOVDWWKHERG\DQGEOXHKDQGOHVWFHQWXU\ A.D. Traces of iridescence, intact.

251 • 6LGRQLVFKHV 5HOLHI~”VFKFKHQ Levante, 1. Jh. n. Chr. H 9,1cm Opakes, hellblaues, formgeblasenes Glas. Mündung gebrochen XQGZLHGHUDQJHVHW]W u Provenienz: Aus einer israelischen Privatsammlung, erworben vor 2000. /LJKW EOXH 6LGRQLDQ ~DVN /HYDQW VW FHQWXU\ $' 0RXWK EURNHQ DQG reattached.

135


252

253

252 %HUQVWHLQIDUEHQH'DWWHO~DVFKH5¤PLVFKH.DLVHU]HLW-K n. Chr. L 7cm. Formgeblasen. Kurzer Hals mit nach außen um gebördelter Lippe. Intakt, Reste von Sinter. 600,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQ,Q'HXWVFKODQGVHLWYRU Vgl. A. von Saldern, Antikes Glas (2004) S. 262 Taf. 230; Sammlung 2SSHQO”QGHU  6 $PEHUGDWH~DVN5RPDQVWQGFHQWXU\$'7UDFHVRIVLQWHULQWDFW

253 • *URgHU$PSKRULVNRVLQ6DQGNHUQWHFKQLNÖstlicher Mittelmeer UDXP-KY&KU+FP$XVNREDOWEODXHPRSDNHQ *ODV .RQLVFKHV *HI”g PLW .QRSIIXg GLFNHP ]\OLQGULVFKHQ +DOVXQGJHUXQGHWHPDXVODGHQGHP5DQG$QGHQ6HLWHQ]ZHL leicht geknickte Henkel an die Schulter und den Hals angesetzt. (LQZHLgHUXQGJHOEHU)”GHQODXIHQVSLUDOLJHQWVSUHFKHQGYRP Rand bis zum Boden und vom Rand bis zur Körpermitte, auf dem Körper zum Federmuster ausgezogen. Wunderschöne 3HUOPXWW,ULVLQWDNW u 3URYHQLHQ]([3LYDWVDPPOXQJ6FKZHL]HUZRUEHQLQ%HL*RUQ\  Mosch, München Auktion 268, 2019, Los 288. 9JO<,VUDHOL$QFLHQW*ODVVLQWKH,VUDHO0XVHXP  61U (DVWHUQ0HGLWHUUDQHDQFRUHIRUPHGDPSKRULVNRVRIGDUNEOXHWUDQVOXFHQW glass with knob base and two handles, decorated with white and yellow feathered WUDLOVQGVWFHQWXU\%&0DUYHOORXVQDFUHLULGHVFHQFHLQWDFW

136

254

254 Miniaturkännchen. Östlicher Mittelmeerraum, ca. 4. Jh. v. Chr. H 11cm. Kleine Oinochoe mit Kleeblattmündung in Sandkern technik aus opakem, dunkelblauen Glas. An der Lippe und am )Xg HLQH JHOEH )DGHQDX~DJH (LQ ZHLWHUHU JHOEHU )DGHQ LVW LQ mehreren Windungen um den Hals geführt. An der Schulter VHW]HQHLQZHLgHUXQGHLQJHOEHU)DGHQDQGLHHQWODQJGHV%DX FKHV]XHLQHPOHLFKWJHULSSWHP=LFN]DFNPXVWHUJHN”PPWVLQG )DFKP”QQLVFKUHVWDXULHUWPLWPLQLPDOHQ(UJ”Q]XQJHQXQG5H tuschen, Reste von Iris. 3.000,– 3URYHQLHQ]([6DPPOXQJ3'([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ 119, 2002, Los 3002. 9JO*O”VHUGHU$QWLNH6DPPOXQJ(UZLQ2SSHQO”QGHU1U &RUHIRUPHGPLQLDWXUHRLQRFKRHPDGHIURPRSDTXHGDUNEOXHJODVVGHFRUDWHG ZLWK\HOORZDQGEULJKWEOXHKRUL]RQWDOWUDLOLQJFRPEHGLQ]LJ]DJSDWWHUQDW the center. Additional yellow trail at rim and neck. Eastern Mediterranean, DERXWWKFHQWXU\%&5HDVVHPEOHGZLWKWLQ\PLVVLQJSDUWV}OOHGXSDQGIHZ retouched cracks. A splinter of the rim missing (antique damage).

255 Amphoriskos. VWOLFKHU 0LWWHOPHHUUDXP    -K Y &KU + FP6DQGNHUQWHFKQLN$XVRSDNHPGXQNHOEODXHQ*ODV9RQ GHU6FKXOWHUDXVJHKHQGO”XIWHLQJHOEHU)DGHQXPGHQ&RUSXV Am Bauch tritt ein hellblauer Faden hinzu. In der Mitte sind GLH )”GHQ ]X HLQHP =LFN]DFNPXVWHU JHN”PPW 'HU KHOOEODXH und gelbe Faden enden unterhalb der Mittelzone. Weitere gelbe )”GHQVLQGDQGHU/LSSHXQGXQWHUKDOEGHV%DXFKHVXPJHOHJW 3HUIHNWH(UKDOWXQJ Perlmuttiris, intakt. 1.500,–


255

256

3URYHQLHQ]([6DPPOXQJ'U001RUGUKHLQ:HVWIDOHQ,Q'HXWVFKODQG seit vor 1972. 0LQLDWXUH JODVV DPSKRULVNRV WK  WK FHQWXU\ %& ([FHOOHQW FRQGLWLRQ ,QWDFWZLWKQDFUHLULGHVFHQFH

256 )ODVFKH PLW JUDYLHUWHQ .UHLVHQ 4. Jh. n. Chr. H 21cm. Große Flasche aus Klarglas mit kugeligem Corpus und zylindrischem +DOV$XIGHP&RUSXVJHULW]WH9HU]LHUXQJDXVKRUL]RQWDOHQ5LQ JHQ XQG YLHU PDO YLHU NRQ]HQWULVFKHQ .UHLVHQ 'LH =ZLVFKHQ U”XPH ]ZLVFKHQ GHQ .UHLVHQ WHLOZHLVH JODWW RGHU JHZHOOW 0LW Sprüngen, aber ohne Fehlstellen. 4.000,– 3URYHQLHQ]([6DPPOXQJ3'([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW Vgl. 3000 Jahre Glaskunst. Ausstellung Luzern (1981) S. 88 Nr. 318. Large greenish clear glass bottle decorated with wheel cut rings. Globular body with long tubilar neck. Roman Period, 4th century A.D. Cracks, but complete.

257 .XJHOLJH )ODVFKH 5¤PLVFKH .DLVHU]HLW    -K Q &KU + 21,6cm, Ø 18,2cm. Grünliches Klarglas. Herrliches Stück! In takt. 1.000,– 3URYHQLHQ]([6DPPOXQJ()5KHLQODQG3IDO]DXIGHU0©Q]E¤UVH Karlsruhe von Franz Javorschek erworben.

257

5RPDQJOREXODUJODVV~DVN,PSHULDO3HULRGQGUGFHQWXU\$',QWDFW 7HUUL}FSLHFH

137


258

260

258 %HFKHUDXIQLHGULJHP)Xg5¤PLVFKH.DLVHU]HLW-KQ&KU H 11,5cm, Ø 7,5cm. Gelbliches Klarglas. Der glockenförmige Körper auf einem niedrigen Fuß ist diagonal gerippt. Intakt. 1.500,– 3URYHQLHQ]([6DPPOXQJ3'([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW Elegant glass beaker on low stem with diagonally ribbed body made from \HOORZLVKFOHDUJODVV5RPDQ,PSHULDO3HULRGUGWKFHQWXU\$',QWDFW

259 %HFKHUDXINRQLVFKHP)Xg-KQ&KU+FPkFP Farbloses Klarglas. Becher mit konkav eingezogener Wandung und umlaufendem Faden auf der Wandung auf niedrigem, konischen Fuß. Intakt. 500,– 3URYHQLHQ]([6DPPOXQJ3'([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ 137, 2004, Los 118. 5RPDQFOHDUJODVVEHDNHULQFRQLFDOIRRW5RPDQ,PSHULDO3HULRGQGUG FHQWXU\$',QWDFW

138

259

261

260 • )DOWHQEHFKHUPLWRSDNHU,ULVVWOLFKHU 0LWWHOPHHUUDXP    Jh. n. Chr. H 10,8cm. Farbloses Klarglas. Zylindrischer Körper mit Standfuß und abgeschliffenem Rand. Konvexe Seiten mit YLHU JURgHQ 5LSSHQ $P +DOV ]ZHL G©QQH 6FKOLIIULQJH :HLgH Iris, kleiner Sprung im Körper. 1.300,– 3URYHQLHQ]([3ULYDWVDPPOXQJ6FKZHL]HUZRUEHQDXVGHPHXURS”LVFKHQ .XQVWKDQGHO%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV 316. (DVWHUQ0HGLWHUUDQHDQIROGHGEHDNHUZLWKFRQYH[VLGHVVWQGFHQWXU\ $':KLWHLULGHVFHQFH}VVXUHLQERG\

261 • %HFKHU PLW 3HUOPXWW,ULV Östlicher Mittelmeerraum, 4. Jh. n. Chr. H 11,4cm. Hellgrünes Klarglas. Zylindrischer Körper mit breitem Standfuß, leicht gestauchtem Hals und gerundeter /LSSH8PGHQ.¤USHUHLQG©QQHU)DGHQULQJ:HLgH3HUOPXWW Iris, intakt. 1.100,– 3URYHQLHQ]([3ULYDWVDPPOXQJ6FKZHL]HUZRUEHQDXVGHPHXURS”LVFKHQ .XQVWKDQGHO%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV 317. 9JO<,VUDHOL$QFLHQW*ODVVLQWKH,VUDHO0XVHXP  61U


262

263

Eastern Mediterranean cylindrical beaker with a thin ring trail. 4th century A.D. White nacre iridescence, intact.

262 =ZHL )ODVFKHQ PLW ]\OLQGULVFKHP +DOV Römische Kaiserzeit, 2. -KQ&KU+XQGFP=ZHL.ODUJODV~DVFKHQPLW kugeligem Corpus und abgesetztem, zylindrischen Hals. Das eine Stück mit horizontalen Schliffringen. Beide mit Sinter und intakt. 800,– 3URYHQLHQ]([6DPPOXQJ3'([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW 7ZRVSKHULFDOJODVVERWWOHVZLWKORQJWXEXODUQHFN5RPDQ,PSHULDO3HULRG QGUGFHQWXU\$'%RWKZLWKVLQWHUDQGLQWDFW

263 Schliffglasbecher. 6DVDQLGLVFK RGHU IU©KLVODPLVFK    -K Q Chr. H 11,5cm. Grünliches Klarglas. Konischer Becher mit NOHLQHU UXQGHU 6WDQG~”FKH =ZHL 5HLKHQ YRQ JHVFKOLIIHQHQ Strichmarken rahmen eine zentral umlaufende Reihe von ge schliffenen Ovalen. Wieder zusammengesetzt mit nur kleiner (UJ”Q]XQJDQGHU/LSSH u

264

3URYHQLHQ]([6DPPOXQJ'U001RUGUKHLQ:HVWIDOHQ,Q'HXWVFKODQG seit vor 1972. &RQLFDOEHDNHUZLWKZKHHOFXWJHRPHWULFDOGHFRU6DVDQLDQRU(DUO\,VODPLF DERXWWKWKFHQWXU\$'5HDVVHPEOHGZLWKRQO\DVPDOOIUDJPHQWDWWKH ULP}OOHGXS

264 Spätantiker Amphoriskos aus schwarzem Glas. Östlicher Mittel PHHUUDXP-KQ&KU+FP%DXFKLJHV0LQLDWXUJHI”g DXVRSDNHPVFKZDU]HP*ODVPLW6WDQGSODWWHGLDJRQDOHQ5LS SHQDP%DXFKXQG]ZHLNXU]HQ+HQNHOQPLW*ULIISODWWHQ.OHLQH Klebestelle an einem Henkel. 1.200,– 3URYHQLHQ]([6DPPOXQJ3'([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV,Q'HXWVFKODQGVHLW 9JO*O”VHUGHU$QWLNH6DPPOXQJ2SSHQO”QGHU  1U<,VUDHOL $QFLHQW*ODVVLQWKH,VUDHO0XVHXP  6.DW %ODFNPLQLDWXUHMDUZLWKGLDJRQDOO\ULEEHGFRUSXVDQGKLJKKDQGOH(DVWHUQ 0HGLWHUUDQHDQWKWKFHQWXU\$'6PDOOUHVWRUDWLRQDWRQHKDQGOH

139


NORDAFRIKA

265

140


265 +RUXVGDV.LQGw DXI HLQHU /RWXVEO©WH Dritte =ZLVFKHQ]HLW    '\QDVWLH    Q Chr. H 11,5cm. Lichtblau glasierte Fayence. Sehr fein und detailreich gearbeitete Statuette des auf einer Lotusblüte hockenden Harpokrates, der in GHU5HFKWHQGLH*HLgHOK”OWXQGGHQ=HLJH}QJHU seiner linken Hand an den Mund führt. Auf dem .RSI WU”JW HU GLH 'RSSHONURQH YRQ 8QWHU XQG 2EHU”J\SWHQ 'HU YLHOEO”WWULJ DXIJHI”FKHUWH /R WXVHQWVSULHgWHLQHPJODWWHQUXQGHQ6WDPP~DQ NLHUW YRQ ]ZHL VHLWOLFKHQ .QRVSHQ (LQH ~DFKH rechteckige Basis bildet den unteren Abschluss. *HNOHEWHU %UXFK DP +DOV =HLJH}QJHU GHU /LQ ken und Teile der Krone fehlen. Sehr seltenes 2EMHNW0LW]ZHLRULJLQDOHQ(FKWKHLWV]HUWL}NDWHQ 3.500,– Provenienz: Aus italienischer Privatsammlung Professor Semolini, Arezzo, vor 1978; davor „La Miniera“, Desio 0DLODQG XQGLQGHU)DPLOLH%DWWDULQL 0DLODQG  'HU1DPH+RUXVGDV.LQGwZXUGHGHP6RKQGHV2VLULV XQGGHU*¤WWLQ,VLVJHJHEHQGLHGDV.LQGLQGHQ3DS\UXV Sümpfen von Chemmis im nördlichen Delta gebar und es DXV)XUFKWYRUGHP*RWW6HWKGRUWKHLPOLFKDXI]RJ%HL der vorliegenden Darstellung steigt das Horuskind auf der /RWXVEO©WHDXVGHP8UJHZ”VVHUGHU6FK¤SIXQJKHUYRU 3DUWLFXODU\ }QHO\ FUDIWHG DQG OLJKW EOXH JOD]HG IDLHQFH statuette of the god Harpocrates seated on a Lotus blossom. *OXHGEUHDNDWQHFNDUHDLQGH[}QJHURIOHIWKDQGPLVVLQJ DOVRSDUWRIFURZQRWKHUZLVHLQH[FHOOHQWFRQGLWLRQ7KLUG ,QWHUPHGLDWH3HULRGFD%& +RUXVZDVWKHFKLOGRI,VLVDQG2VLULVZKRZDVFRQFHLYHG DIWHUWKHGHDWKRI2VLULVDWWKHKDQGVRI6HW%URXJKWXSLQ VHFUHWE\,VLVKHZDVGHSLFWHGDVDQDNHGLQIDQWZHDULQJ WKHVLGHORFNRI\RXWKZLWKRQH}QJHUKHOGWRKLVOLSV7KH faience presents the divine child seated on a lotus blossom and rising from the primordial waters of creation.

266 %URQ]HVWDWXHWWHGHU1HLWKSaitische Zeit, 26. Dy QDVWLHFLUFDY&KU+FP9ROOJXVV Statuette auf einem Sockel in Schrittstellung mit HLQHPHQJDQOLHJHQGHQ*HZDQGEHNOHLGHWEHU Brust und Nacken liegt ein fein ziselierter Hals NUDJHQ'LH*¤WWLQWU”JWGLHURWHdeshret Krone YRQ8QWHU”J\SWHQ'LH+LHURJO\SKHQLQVFKULIWDXI drei Seiten des Sockels lautet: „Worte zu spre FKHQ 5H]LWDWLRQ 1HLWKJLEW/HEHQ*HZHLKWYRQ Ba[...]Be, Sohn von Amenardis, (er) hat es ge macht.“ Schöne dunkelgrüne Patina, oberer Teil der Krone abgebrochen, Arme fehlen, sonst in takt. 5.000,– 3URYHQLHQ]([6DPPOXQJ5%ORFK0©QFKHQYRU 3XEOL]LHUWLQ5%ORFK$QWLNH.OHLQNXQVW6 Abb. 107 und 108. Solid cast bronze statuette of Neith. The goddess stepping IRUWKLQDWLJKW}WWLQJJDUPHQWZLWKDEURDGFROODUZHDULQJ the red crown of Lower Egypt. The rectangular integral base inscribed on three sides: „ Words spoken (recitation): Neith LVJLYLQJOLIH&RQVHFUDWHGE\%H>@%DVRQRI$PHQDUGLVKH KDVPDGHLWw8SSHUSDUWRIFURZQPLVVLQJDOVRERWKDUPV otherwise intact. Fine dark green patina. Saite Period, 26th G\QDVW\FD%&

266

141


267 2VLULVXQG1HSKW\V6S”W]HLWY&KU%URQ]HOHJLHUXQJ 9ROOJXVVD +RKQH6RFNHOFP+6RFNHOFP$PXOHWWGHU Göttin Nephtys mit Hathorkrone und ausgebreiteten Flügeln, PLW GHQHQ VLH GLH 9HUVWRUEHQHQ VFK©W]W 6FKZDU]H 3DWLQD LQ takt und auf modernen Holzsockel montiert. b) H ohne Sockel 8cm, H Sockel 3cm. Stehender Osiris in Mumienform mit Fe derkrone, die Arme mit Krummstab und Geißel über der Brust JHNUHX]WDP5©FNHQ$XIK”QJH¤VH7LHIJU©QH3DWLQDLQWDNWXQG auf modernen Holzsockel montiert. 2 Stück! 700,–

267

3URYHQLHQ]([6DPPOXQJ(8%D\HUQLQ'HXWVFKODQGVHLWYRU $EGHU'\QDVWLH}QGHQVLFKEURQ]HQH$PXOHWWHGHU*¤WWLQ1HSKW\VDOV 7RWHQZ”FKWHULQK”X}JHULQ0XPLHQELQGHQHLQJHZLFNHOWHEHQVRZLHVROFKH des Osiris. Two bronze board type amuletts of Nephtys and Osiris as protectors of the deads. They were often wrapped in mummy bandages since the 22nd dynasty. Fine black patina, intact; mounted on modern wooden bases. Late Period, ca. %&

268 Isis und Harpokrates. 6S”W]HLWFLUFDY&KU%URQ]H OHJLHUXQJ9ROOJXVVD +FP6LW]VWDWXHWWHGHU,VLVPLWGHP +RUXVNQDEHQDXIGHP6FKRg'LH*¤WWLQWU”JWHLQHGUHLJHWHLO WH3HU©FNHXQGGHQ8QWHUVDW]GHUYHUORUHQJHJDQJHQHQ+DWKRU .URQH0LWGHUUHFKWHQ+DQGK”OWVLHLKUHOLQNH%UXVWXPGDV .LQG ]X V”XJHQ 'LH )©gH VWHKHQ DXI HLQHU NOHLQHQ 3ODWWH PLW Einlasszapfen. Schöne grüne Patina, Oberteil der Krone fehlt, VRQVW LQWDNW E  + FP 6LW]VWDWXHWWH GHV QDFNWHQ MXJHQGOL FKHQ +DUSRNUDWHV (U WU”JW HLQH HQJ DQOLHJHQGH .DSSH XQG die breite „Jugendlocke“, über der Stirn eine sich aufrichtende 8U”XV6FKODQJH6FK¤QHJU©QEUDXQH3DWLQDLQWDNW2 Stück! 1.000,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQLQ'HXWVFKODQGVHLWYRU

268

7ZREURQ]HVWDWXHWWHVD 6LWWLQJ,VLVZLWK+RUXVFKLOGRQKHUODSZHDULQJ Hathor crown of which only the modius had been preserved. With her right hand she supports her left breast. Green patina, intact. b) Seated nude youthful Harpokrates with the „lock of youth“ on the right side of his head, his arms SODFHGFORVHWRWKHERG\$WWUDFWLYHJUHHQUHGSDWLQDLQWDFW0RXQWHGRQD PRGHUQZRRGHQVHDW/DWH3HULRGFD%&

269 $PXOHWW GHV +RUXV DXI .URNRGLOHQw +RUXVVWHLQw  3WROHP” LVFKH (SRFKH    Y &KU + FP % FP 6FKZDU]HU Steatit. Rechteckige Platte, oben halbrund, unten kleine halbrun de, vorstehende Basis. Die dominierende Figur ist das frontal VWHKHQGH+RUXVNLQGPLWGHUVHLWOLFKUHFKWVDP.RSIKHUDEK”Q JHQGHQ -XJHQGORFNHw 6HLQH DXVJHEUHLWHWHQ +”QGH KDOWHQ MH ZHLOVHLQH6FKODQJHXQGHLQHQ6NRUSLRQ6HLQH)©gHVWHKHQDXI ]ZHL.URNRGLOHQGLHGLHJHE”QGLJWH.UDIWGHV6HWKGHV%¤VHQ VFKOHFKWKLQ LP ”J\SWLVFKHQ 3DQWKHRQ  YHUN¤USHUQ +LHU ZHU GHQVLHV\PEROLVFKYRQGHP*RWWXQGVHLQHU0XWWHUEH]ZXQ JHQEHUGHP.RSIHUNHQQWPDQGLH0DVNHGHV%HV,QGHQ ]ZHLVHLWOLFKYHUWLNDOYHUODXIHQGHQ+LHURJO\SKHQ.ROXPQHQXQG LQGHQ,QVFKULIWHQEHLGHUVHLWVGHV.RSIHVZLUG,VLVDOV0DJLHULQ angerufen, die ihrem Sohn zu Hilfe eilt und ihn heilt. Auf der Unterseite der Basis sind ebenfalls Spuren einer Hieroglyphen LQVFKULIW LQ ]ZHL =RQHQ ]X HUNHQQHQ  Seltenes Objekt! Kleine Absplitterungen am Stein, hinten Mulde in Daumengröße und kleines Loch, sonst sehr gut erhalten. 600,–

269

142

3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU %HL GHQ VRJ +RUXVVWHLQHQ KDQGHOW HV VLFK XP %HVFKZ¤UXQJHQ JHJHQ Schlangenbisse und Skorpionstiche, gegen die die damalige Medizin keine Gegengifte kannte. Der Horusstein wurde ins Wasser getaucht, das sich auf GLHVH:HLVHPLWSRVLWLYHUPDJLVFKHU(QHUJLHDX~XGXQGGDQQGHP9HUJLIWHWHQ LQGHU+RIIQXQJDXI+HLOXQJ]XWULQNHQJHJHEHQZXUGH'LHVH2EMHNWH}HOHQ HKHULQGHQ%HUHLFKGHUSULYDWHQ0DJLHXQGZXUGHQDOV$PXOHWWHJHWUDJHQ


The Horus stele, or „cippus,“ was one of the most important items associated with magic in ancient Egypt. At the center of these stone slabs was the nude }JXUHRIWKHFKLOG+RUXVRU+DUSRFUDWHVDVVRFLDWHGZLWKWKHQHZERUQVXQ ZLWKWKHKHDGRIWKHJRG%HVDERYHKLP+RUXVWKH&KLOGwWKHVRQRI,VLV stands on two crocodiles and holds dangerous animals (snakes, scorpion, lion, and antelopes) in his hands, demonstrating that with supernatural powers even DFKLOGFDQRYHUFRPHGDQJHUV+LHURJO\SKLFWH[WVRFFXS\PRVWRIWKHHPSW\ VSDFH/DUJHUH[DPSOHVRIWKHVH+RUXVVWHODHZHUHSODFHGLQWHPSOHSUHFLQFWV where priests poured water over them to absorb the magical power of the spells and images. Drinking the water, it was believed, would protect against the harmful bites of dangerous creatures as well as other dangers and evils. 6PDOOHUYHUVLRQVZHUHXVHGDWKRPHDQGYHU\VPDOORQHVDVRXUH[DPSOHZHUH worn as amulets.

270 *URgHV +DOVNUDJHQHQGVW©FN LQ )RUP HLQHV )DONHQNRSIHV 6S”W ]HLWELV3WROHP”HU]HLWFLUFDY&KU+FP'XQNHO JU©QJODVLHUWH)D\HQFHPLWVFKZDU]JHI”UEWHQ'HWDLOV.RSIGHV *RWWHV+RUXVDOV)DONHREHQ6FKODXIHXQWHQ]ZHLIDFKJHORFKW Seltenes Objekt! Intakt. 500,–

270

3URYHQLHQ]$XVDOWHUGHXWVFKHU3ULYDWVDPPOXQJYRUH[$WRQ*DOOHU\ Oberhausen. (QGSLHFHRIDFROODUVKDSHGDVKHDGRI6XQJRG+RUXV'DUNJUHHQJOD]HG IDLHQFHGHWDLOVLQEODFNWZRSLHUFLQJVDQGORRSRQWRS,QWDFW/DWH3HULRG FD%&

271 3ODNHWWHPLW+DWKRU6S”W]HLWFDY&KU/FP+ 3,5cm. Blau glasierte Fayence. Kleine Plakette mit Darstellung der in einer angedeuteten Landschaft des Nildeltas nach rechts VFKUHLWHQGHQ +DWKRU .XK PLW 6RQQHQVFKHLEH ]ZLVFKHQ GHQ +¤UQHUQ ,P +LQWHUJUXQG YLHU 3DS\UXVVWDXGHQ =ZHL VHLWOLFKH Löcher zur Anbringung. Absplitterung an der linken oberen Ecke, sonst intakt. 500,–

271

3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU =ZHL”KQOLFKH6W©FNHVLQGSXEOL]LHUWLQ&*UHFR92HWHUVXQG0-5DYHQ (Hrsg.), „Tuinen van de Farao‘s“. Rijksmuseum van Oudheden (2012) S. 40 Nr. 32. %OXHJOD]HGID\HQFHSODTXHRIWKH+DWKRUFRZ'HSLFWHGLQSUR}OHZDONLQJWR the right wearing a solar disk between her horns against a Nilotic background of four lotus plants. One chip at left upper edge, minimal abrasion marks, two KROHV/DWH3HULRG%&

272 Kleines Siegel. 1HXHV 5HLFK VS”WH  '\QDVWLH $PDUQD =HLWw FLUFDY&KU/FP%ODXJODVLHUWH)D\HQFH 6WHPSHO LQ )RUP HLQHV ]ZHLIDFK DEJHEXQGHQHQ 3DS\UXV%©Q GHOV$XIGHU8QWHUVHLWH,GHRJUDPPGHV5H+DUDFKWH$WXPPLW Sonnenscheibe im eingetieften Relief. Intakt. 600,– 3URYHQLHQ] (UZRUEHQ LP HXURS”LVFKHQ .XQVWKDQGHO LP GHXWVFKHQ Privatbesitz seit mindestens 2015.

272

%OXHJOD]HGIDLHQFHVHDORQWKHXQGHUVLGHDUHSUHVHQWDWLRQRIJRG5H+RUDNKWL $WXPLQUHFHVVHGUHOLHI,QWDFW/DWHWKG\QDVW\ $PDUQD3HULRG FD %&

273 Skarabäus. 6S”W]HLW'\QDVWLH/FP7©UNLVJODVLHUWH Fayence. Amulett in Form eines naturalistisch gebildeten Skara E”XVDQGHU8QWHUVHLWH6FKODXIH,QWDNW u Provenienz: Seit 1. Februar 2021 in Deutschland; davor französische 3ULYDWVDPPOXQJ%RUGHDX[YRU 1DWXUDOLVWLFDOO\VKDSHGIDLHQFHVFDUDEDPXOHWORRSRQWKHXQGHUVLGH,QWDFW /DWH3HULRGWKWKG\QDVW\FD%& 273

143


275

274 8VKHEWLI©UGHQ*HQHUDO6HPDWDXL6S”W]HLWFLUFD-KY&KU+FP+HOOEODX glasierte Fayence. Mumienförmiges Ushebti mit über der Brust gekreuzten Armen, +DFNH XQG +DQGS~XJ KDOWHQG 7I¤UPLJH +LHURJO\SKHQLQVFKULIW (UOHXFKWHQ ODVVHQGHV2VLULVGHU6DPHUHI3ULHVWHUXQG2EHUVWHGHU7UXSSH6HPDWDXL6RKQ GHV 3DVFKHUL JHERUHQ YRQ 7DLHVVFKHSVHWKHUL JHUHFKWIHUWLJWw Mit ausführlicher %HVFKUHLEXQJXQG/LWHUDWXU Glasur partiell abgeplatzt, sonst intakt. 950,– Provenienz: Deutsche Privatsammlung seit 2011; ehemals englische Privatsammlung vor 1980. 274

%OXHJOD]HGIDLHQFHPXPP\IRUPVKDEWLRI6HPDWDXL6DPHUHISULHVWDQGFKLHIRIWKHWURRSV6RQ RI3DVFKHULERUQIURP7DLHVVFKHSVHWKHULMXVWL}HG6XUIDFHSDUWO\ZRUQRIIRWKHUZLVHLQWDFW/DWH SHULRGWKFHQWXU\%&

275 Zwei kleine Schminkpaletten. Frühzeit, Naquada III Periode, um 3000 v. Chr. a) Ø ca. 10cm. Dunkelgrüner Schiefer, glatt poliert. Schminkpalette in Form HLQHU6FKLOGNU¤WH0DXO6FKZDQ]XQGGLHYLHU)©gHDOVZLQ]LJH$XVEXFKWXQJHQ angegeben, über dem Kopf ein Befestigungsloch. b) Ø 9cm. Schminkpalette in Form einer Ziege mit Füßen und Horn (?), ein Befestigungsloch. 2 Stück!.UDW] XQG5HLEHVSXUHQDXIGHU2EHU~”FKHVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ(8%D\HUQLQ'HXWVFKODQGVHLWYRUH[+LUVFK1DFKI0©QFKHQ Auktion 183, 1994, Los 2753 und 2754. Two small palettes, made from polished siltstone: a) Turtle with notched tiny stubby tail and a barely protruding head, one drilled hole for suspension. b) Abstractly formed goat with horn, drilled hole. %RWKZLWKVFUDWFKLQJPDUNVYHU\JRRGFRQGLWLRQ3UHG\QDVWLF3HULRG1DTXDGD,,,FD%& 2 pieces!

276 Relieffragment mit Hieroglyphenschrift. Neues Reich, Ramessidenzeit, 19. Dynastie, FLUFD    Y &KU + FP % FP .DONVWHLQ PLW 5HVWHQ GHU )DUEIDV VXQJLQ5RWEUDXQXQG%ODX'DUJHVWHOOWLVWHLQNXU]HU$XVVFKQLWWGHU+LHURJO\SKHQ Schrift mit dem Dual „u i“, einem sitzenden Mann mit erhobenen Armen und einer darunter liegenden Buchrolle als Determinative. Im unteren Teil gebrochen und UHVWDXULHUWZHLWHUH5HVWDXULHUXQJDQGHU%UXFKNDQWHREHQNOHLQH%HVFK”GLJXQJHQ am Kopf des sitzenden Mannes. 800,– Provenienz: Aus der Sammlung H. J., Moers, erworben im Kölner Kunsthandel in den 1980er Jahren. )UDJPHQWRIDFRORXUHGOLPHVWRQHUHOLHIGHSLFWLQJDVKRUWH[FHUSWRIDKLHURJO\SKLFWH[W%URNHQLQ the lower part and restored, also repaired on the upper breaking edge. New Kingdom, 19th dynasty, FD%& 276

144


277

278

277 *URgH+RO]}JXUGHV3WDK6RNDU2VLULV6S”W]HLW'\QD VWLHFLUFDY&KU+FP+RO]VWXFNLHUWXQGEHPDOW Mumienförmige Statue mit Rückenpfeiler, der ursprünglich eine vertikal verlaufende Hieroglyphenschrift trug, von der noch Spuren zu erkennen sind. Sehr gut ausgeformtes Gesicht mit langem Zeremonialbart umrahmt von einer dreigeteilten Perük NH )DVVXQJ IDVW YROOVW”QGLJ DEJHULHEHQ YHUWLNDO YHUODXIHQGHU 6SUXQJLP+RO])XgWHLOYRUQHEHVFK”GLJWLP2EHUNRSIDOWHV UHFKWHFNLJHV=DS~RFKNHLQH5HVWDXULHUXQJHQ u Provenienz: Aus der Sammlung H. J., Moers, erworben im Kölner Kunsthandel in den 1980er Jahren. 6WDWXHWWHQ GHV 3WDK6RNDU2VLULV ZXUGHQ PHLVW LQ *U”EHUQ GHU 6S”W]HLW gefunden, weil man glaubte, dass sie den Toten wiederbeleben konnten. *HVVRHGDQGSDLQWHGODUJHZRRGHQ}JXUHRI3WDK6RNDU2VLULVSURWHFWRUJRG of the dead. The slender mummyform body has a very well shaped face framed by a tripartite wig. Vertical split running through the torso and breakout at the foot part. Rectangular antique tape hole in the upper head. Late Period, FD%&

278 Ushebti der Aiu. 1HXHV5HLFK'\QDVWLHFLUFD Y&KU+FP+RO]PLW%HPDOXQJLQ2FNHU6FKZDU]XQG Rot. Mumienförmiges Ushebti mit vierreihigem Halskragen. 'LH )LJXU WU”JW ©EHU MHGHU 6FKXOWHU HLQ :DVVHUJHI”g GDV YRQ HLQHPKLHUXQVLFKWEDUHQ-RFKDP5©FNHQKHUDEK”QJW$XIGHP .¤USHUYRUQHYHUO”XIWYHUWLNDOHLQH+LHURJO\SKHQLQVFKULIWw:VU QEW SU $LZ 0DDW KUZw (LQ 2VLULV GLH +HUULQ GHV +DXVHV Aiu, die Gerechtfertigte“). Kleine Abplatzungen an der Fassung, )XgWHLOEHVFK”GLJWVRQVWLQWDNW u

279

Shabti for the mistress of the house Aiu, gessoed and painted wood in mummyform with arms crossed. She wears a tripartite black wig and a large FROODUFRPSOHWHO\FRYHULQJWKHXSSHUSDUWRIWKH}JXUH7ZRVPDOOZDWHUSRWV one behind each shoulder, suspend from a here invisible yoke. Single vertical inscription which names the owner. The feet area is damaged, some minor chips to the painting, otherwise intact. New Kingdom, 19th dynasty, ca. 1292 %&

279 *URgHV8VKHEWLDXV+RO]Neues Reich, 19. Dynastie, circa 1290 Q&KU+FP+RO] $ND]LH" PLWIHLQHU*LSVVFKLFKW überzogen und bemalt. Mumienförmiges Ushebti mit blaube malter dreigeteilter Perücke. Gesicht und die überkreuz gehal WHQHQ $UPH XQG +”QGH SODVWLVFK JHVFKQLW]W GLH 2KUHQ QXU summarisch ausgeführt, Halskragen in feiner Bemalung angege ben. Um den Körper lief eine sauber ausgeführte, heute verrie bene Hieroglyphenschrift in mehreren Registern, die durch rote 4XHUVWULFKHDEJHWHLOWZDUHQ'LH%HPDOXQJLVWQXUDQGHU3HU©N NH XQG LP *HVLFKW HUKDOWHQ $XI GHU 9RUGHUVHLWH ]ZHL G©QQH lange Risse im Holz, Ausbruch am Fußteil, rückseitig Trocken risse. 900,– Provenienz: Aus der Sammlung H. J., Moers, erworben im Kölner Kunsthandel in den 1980er Jahren. *HVVRHGDQGSDLQWHGZRRGPXPP\IRUP8VKDEWL7KHWULSDUWLWHZLJLVEOXH WKHZHOOFDUYHGIDFHEURZQDQGWKHH\HEURZVOLGVDQGSXSLOVDUHSDLQWHGEODFN 7KH}JXUHZDVLQVFULEHGZLWKVHYHUDOKRUL]RQWDOURZVRISDLQWHGKLHURJO\SKV 7KH}JXUHLVLQJRRGFRQGLWLRQWZRYHUWLFDOVSOLWVLQWKHZRRGUXQQLQJWKURXJK the face and torso on the front side, the back has several cracks in the wood, EUHDNRXW DW WKH IRRW SDUW 1HZ .LQJGRP WK G\QDVW\ FD    %&

3URYHQLHQ],Q'HXWVFKODQGVHLWGDYRU6FKZHL]HU3ULYDWVDPPOXQJ5 /HUZREHQLQGHQHUHU-DKUHQ

145


280

281

280 *URgHV +RO]8VKHEWL Neues Reich, frühe 19. Dynastie, circa Y&KU+RKQH6RFNHOFP+6RFNHOFP+RO] mit Spuren von Stucküberzug und Bemalung. Ushebti in ho her, schlanker Form mit dreiteiliger Perücke. Die Details der ©EHUNUHX]DXIGHU%UXVWOLHJHQGHQ$UPHZDUHQDXIJHPDOW'DV RYDOHHWZDVYRUVSULQJHQGH*HVLFKWLVWVHKUJXWDXVJHIRUPW$XI der linken Körperseite breiter Spalt im Holz, Trockenrisse und ,QVHNWHQVFK”GHQ$XIPRGHUQHQUXQGHQ+RO]VRFNHOPRQWLHUW 1.000,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQLQ'HXWVFKODQGVHLWYRU Mummyform wooden ushabti of slender proportions with traces of stucco and SDLQWLQJ7KHRYDOVOLJKWO\SURWUXGLQJIDFHLVZHOOFDUYHGZLWKGH}QHGIHDWXUHV 7KHFURVVHGDUPVZHUHRQFHRXWOLQHG7KH}JXUHLVLQJRRGFRQGLWLRQDSDUW IURPDYHUWLFDOVSOLWLQWKHZRRGEHKLQGWKHOHIWVKRXOGHUH[WHQGLQJIURPWKH head down to the knees. There are also some minor breakouts. Mounted on DPRGHUQZRRGHQEDVH1HZ.LQJGRPHDUO\WKG\QDVW\FD %&

281 Ushebti aus Holz. Neues Reich, frühe 19. Dynastie, circa 1290 Y&KU+FP+RO] $ND]LH" PLWIHLQHU*LSVVFKLFKW überzogen und beige bemalt. Ushebti in hoher, schlanker Form PLW VFKZDU]EHPDOWHU GUHLWHLOLJHU 3HU©FNH 5HVWH GHU *LSV schicht, die den Körper überzog, noch am Oberkörper vorhan den. Ein mit roten Linien aufgemalter Halskragen bedeckte den Oberkörper; auf der Rückseite sieht man den gitterförmig ge malten Saatkorb. Die überkreuz auf der Brust liegenden Arme sind mit roten Strichen angegeben. Das ovale Gesicht mit den LQ6FKZDU]JHPDOWHQ$XJHQLVWJXWDXVJHIRUPW)DUEIDVVXQJWHLO ZHLVHDEJHULHEHQDXIGHUOLQNHQ6HLWHXQWHUGHP$UPDQVDW]UH

146

282

stauriert, Fußteil ausgebrochen, Trockenriß auf der Rsückseite. 900,– Provenienz: Aus der Sammlung H. J., Moers, erworben im Kölner Kunsthandel in den 1980er Jahren. *HVVRHGDQGSDLQWHGZRRGPXPP\IRUP8VKDEWLRIVOHQGHUSURSRUWLRQV7KH tripartite wig is painted black, a collar, painted in red lines, covers the breast. 7KHRYDOIDFHLVZHOOFDUYHGZLWKGH}QHGIHDWXUHV7KHFURVVHGDUPVDQGWKH EDVNHWRQWKHEDFNDUHRXWOLQHGLQUHG7KH}JXUHLVLQJRRGFRQGLWLRQWKHUH is a restauration under the base of the left arm, a crack on the back and EUHDNRXWDWWKHIRRWSDUW1HZ.LQJGRPHDUO\WKG\QDVW\FD %&

282 Kleine Gabenträgerin. 0LWWOHUHV 5HLFK    Y &KU + 23cm. Holz (Akazie?) mit Stuck überzogen und bemalt. Nack WH ZHLEOLFKH )LJXU PLW VFKZDU]EHPDOWHU GUHLJHWHLOWHU 3HU©FNH und mit eng am Körper anliegenden Armen, die mittels eines =DSIHQVEHZHJWZHUGHQNRQQWHQ$XIGHP.RSIWU”JWVLHHLQHQ großen trapezförmigen Korb, dessen Strukturen durch Strichbe PDOXQJDQJHJHEHQVLQG'LHYHUORUHQHQ)©gHZDUHQH[WUDHLQJH ]DSIW(LQ$UPXQG)XgWHLOIHKOHQ)DVVXQJDEJHULHEHQZLQ]LJH UHVWDXULHUWH%HVFK”GLJXQJDP.RUE u Provenienz: Aus der Sammlung H. J., Moers, erworben im Kölner Kunsthandel in den 1980er Jahren. *HVVRHGDQGSDLQWHG}JXUHRIDJLIWEHDUHUEDODQFLQJDODUJHEDVNHWRQKHU head. She wears a tripartite wig; the arms were attached to the body with rivets and movable, the lost foot part was tapped in. Surface worn off, one arm PLVVLQJ0LGGOH.LQJGRPFD%&


283

284

283 +¤O]HUQH*UDEVWDWXHWWHLQGHU7UDFKWGHU/HEHQGHQNeues Reich, '\QDVWLHFLUFDY&KU+FP+RO] $ND ]LH" PLW6SXUHQYRQ%HPDOXQJ0”QQOLFKH)LJXUPLWGUHLJHWHLO ter Perücke und über der Brust gekreuzten Armen, bekleidet mit HLQHPYRUVWHKHQGHQGUHLHFNLJHQ$OOWDJV6FKXU]GHUHLJHQWOLFK SOLVVLHUWZDU(VZDUGLH.OHLGXQJGHUYRUQHKPHQŠJ\SWHU'LH ©EHU GHU %UXVW JHNUHX]WHQ +”QGH XQG GDV RYDOH *HVLFKW VLQG grob geschnitzt. Farbspuren an der Perücke, tieferer Spalt am Oberkörper, mehrere Risse im Holz. 700,– Provenienz: Aus der Sammlung H. J., Moers, erworben im Kölner Kunsthandel in den 1980er Jahren. $EGHU'\QDVWLHWUHWHQYHUHLQ]HOWJU¤gHUH8VKHEWLVLQGHQ*U”EHUQDXIGLH nicht mumiengestaltig, sondern in einem langen plissierten Gewand dargestellt ZHUGHQ'LH©EHUGHP.¤USHUJHNUHX]WHQ+”QGHKDOWHQNHLQH(UGKDFNHQGLH HLQ8VKHEWLI©UGLH)HOGDUEHLWLP-HQVHLWVEHQ¤WLJW:DKUVFKHLQOLFKKDQGHOWHV VLFKXP(LQ]HOVW©FNHGLHQLFKW]XHLQHU8VKHEWL$UPHHYRQ([HPSODUHQ gehörten. Large wooden shabti wearing the characteristic triangular apron of daily life. 8QXVXDOSRVLWLRQRIWKHTXLWHZHOOPRGHOOHGDUPVZLWKFOHQFKHG}VWVFURVVHGRQ the chest. Traces of painting at the tripartite wig, vertical split running through the upper torso, several cracks in the wood and breakout at the foot part. New .LQJGRPWKG\QDVW\FD%&7KLVVWDWXHWWHLVSUREDEO\QRW an ordinary Shabti as the deceased is not presented as a mummy but in a long robe (originally pleated). He appears here in the guise of a noble man, perhaps as scribe or administrator.

284 *URgH0XPLHQPDVNHDXVGHP)D\XP3WROHP”LVFKH(SRFKH Y&KU[FP+RO]VWXFNLHUWXQGEHPDOW.RSIWHLOHL nes mumiengestaltigen Sarkophagdeckels. Das ovale, gut durch geformte Gesicht mit der geraden Nase und den abstehenden 2KUHQ ZLUG YRQ HLQHP EUHLWHQ ZHLgJUXQGLJHQ .RSIWXFK HLQ JHUDKPWGDVPLWURWHQXQGVFKZDU]HQ6WUHLIHQEHPDOWLVW'LH Hautpartien sind in einem leichten Rostrot gehalten, die schma len und langgezogenen Augen mit den breiten Augenbrauen ZHLgXQWHUOHJW$XIGHU%UXVWLVWHLQLQJHRPHWULVFKHQ0XVWHUQ aufgemalter Schmuck sichtbar. Auf der linken Kopfseite breiter Riss, oben links Abplatzung, kleinere Sprünge im Stuck, sonst sehr guter Zustand. 2.500,– 3URYHQLHQ]([3ULYDWVDPPOXQJ:)0©QFKHQVHLWYRU Large gessoed and painted headpiece of a wooden mummyform sarcophagus from the Fayum. With carved facial features and large ears wearing a red and black striped wig, the face painted in reddish brown with black and white details of the eyes. Large crack and breakout at the plaster on left side of the head, some minor chips, otherwise in a very good condition. Ptolemaic period, FD%&

147


285

285 )UDJPHQWHLQHV0XPLHQVDUNRSKDJHV6S”W]HLWFLUFD-KY Chr. L 34cm, B 15cm. Holz, innen und außen mit Leinen be zogen, stuckiert und bemalt in den Farben Dunkelgrün, Braun, Rostrot und Blau auf beigem Grund. Auf dem leicht nach in QHQJHZ¤OEWHQ)UDJPHQWLVWGLH*¤WWLQ1HSKW\VGDUJHVWHOOWZLH GHUEHJOHLWHQGH+LHURJO\SKHQWH[WLPREHUHQ'ULWWHOEHZHLVW6R VSULFKW1HSKW\VGLH*RWWHVVFKZHVWHUGLH:RKOW”WLJHw0LWLK ren ausgebreiteten Flügeln begleitet und beschützt sie den Toten. 'LHVRUJI”OWLJH9HUDUEHLWXQJXQGIHLQH%HPDOXQJGHV)UDJPHQ WHVO”VVWDXIHLQHQHKHUZRKOKDEHQGHQ9HUVWRUEHQHQVFKOLHgHQ Einige Absplitterungen an der Fassung, Farben ansonsten gut erhalten. 1.200,– Provenienz: Aus der Sammlung H. J., Moers, erworben im Kölner Kunsthandel in den 1980er Jahren. Polychrome wood sarcophagus fragment, the layer of gessoe on linen painted LQURVWUHGEOXHEURZQDQGGDUNJUHHQ,WVKRZVWKHJRGGHVV1HSKW\VZLWK spread wings as protector of the deceased. The translation of the hieroglyphic WH[W 6R VSHDNV 1HSKW\V WKH VLVWHU RI JRG WKH FKDULWDEOHw 6PDOO GHIHFWV DQG~DQNLQJVFRORXUVZHOOSUHVHUYHG/DWH3HULRGFDWKWKFHQWXU\%&

148

286

286 *URgH0XPLHQPDVNHPLW%DUW6S”W]HLWFLUFDY&KU/ 36cm, B ca. 21cm. Holz, stuckiert und bemalt. Das rot bemalte *HVLFKW PLW GHU NU”IWLJHQ JHUDGHQ 1DVH LVW JXW DXVJHIRUPW GLH VFKZDU] XPUDQGHWHQ $XJHQ ZHLg XQWHUOHJW PLW VFKZDU]HQ 3XSLOOHQGLH$XJHQEUDXHQODQJJHVFKZXQJHQJH]HLFKQHWEHU der Stirn ist der Ansatz der Perücke sichtbar, die mit roten und VFKZDU]HQ 6WUHLIHQ DXI ZHLgHP *UXQG EHPDOW ZDU (LQ ZHLg bemalter Bart bildet den unteren Abschluss des Kopfes. Stuck XQG %HPDOXQJ VWDUN DEJHULHEHQ DQ GHU 6WLUQ ]ZHL 6SU©QJH im Holz, Einlasszapfen links oben, auf der Rückseite antike Befestigungslöcher, moderne Ringschraube. 500,– Provenienz: Aus der Sammlung H. J., Moers, erworben im Kölner Kunsthandel in den 1980er Jahren. :RRGHQJHVVRSDLQWHGPXPP\PDVNWKHIDFHSDLQWHGLQUHGGLVKEURZQZLWK black details of the eyes. A long beard joins under the chin, once painted black originally. Stucco and painting heavily rubbed off, two cracks on the forehead, antique inlet spigots and holes, modern ring bolt. Late Period, ca. %&


287

287 2VWUDNRQ PLW GHP (UVWHQ 3HWUXVEULHIw    -K Q &KU / 45,5cm, B 20,5cm. Gebrannter Ton, einseitig beschrieben. Fast YROOVW”QGLJ HUKDOWHQH $EVFKULIW HLQHU 9HUVLRQ GHV (UVWHQ 3H trusbriefes“ auf Tonscherben (Ostraka) einer mittelgroßen $PSKRUHGLHLQQHXHUHU=HLWZLHGHU]XHLQHPJHVDPWHQ7H[W ]XVDPPHQJHVHW]W ZXUGHQ 'LH )HKOVWHOOHQ HUJ”Q]WH PDQ GDEHL mit rötlichem Ton. Der Text ist mit einem feinen Pinsel mit VFKZDU]HU)DUEH~©VVLJDXIHLQHKHOOJUXQGLHUWH2EHU~”FKHJH VFKULHEHQ7HLOZHLVHKDWGHU6FKUHLEHUYHUJHVVHQH:¤UWHUQRFK über die entsprechende Zeile gesetzt. Mit handschriftlicher Tran skription und Übersetzung des Vorbesitzers. 1.500,– 3URYHQLHQ]([6DPPOXQJ(.)UDQNHQVHLW 'LH 6FKHUEHQ VWDPPHQ YRQ HLQHP *HI”g GHVVHQ )RUP I©U ŠJ\SWHQ VHKU EHNDQQWLVWGHU”J\SWLVFKHQ$PSKRUHwGLHDEGHP-KQ&KUQDFK ZHLVEDULVWXQGLQGHU5HJHOHLQH%UHLWHYRQFDFPDXIZHLVW=XPZHOFKHP =ZHFNGLHVHDXI7RQJHVFKULHEHQHQ7H[WHPHLVW$XV]©JHJHEUDXFKWZXU GHQLVWQRFKQLFKWJDQ]JHNO”UW,QGHQZHQLJHQHUKDOWHQHQ,QYHQWDUHQYRQ .ORVWHUELEOLRWKHNHQ}QGHWVLFKQLHPDOVGLH0DWHULDODQJDEH 7RQw%LVKHU JLEW HV DOVR NHLQH SODXVLEOH (UNO”UXQJ I©U GLH FKULVWOLFKHQ 2VWUDND HV VHL GHQQPDQVLHKWVLHDOV+LOIVPLWWHO]XP$XVZHQGLJOHUQHQKHLOLJHU7H[WHDQ YJOGD]X&(5¤PHU2VWUDNDPLWFKULVWOLFKHQ7H[WHQDXVGHU6DPPOXQJ )OLQGHUV3HWULH=HLWVFKULIWI©U3DS\URORJLHXQG(SLJUDSKLN%G   6EHV6

288

2VWUDFDLQ6DKLGLFVFULSWZLWKDQDOPRVWFRPSOHWHWUDQVFULSWRIWKH}UVWOHWWHU of Peter (1. Petrus 1) to the churches in Pontus, Galatia, Cappadocia, Asia 0LQRUDQG%LWK\QLD7KHVKDUGVZHUHSXWEDFNWRJHWKHUZKHUHWKHGHIHFWV ZHUH}OOHGZLWKUHGGLVKFOD\,WLVFDUHIXOO\WUDQVFULEHGDQGWUDQVODWHGE\WKH IRUPHURZQHUWKWKFHQWXU\$'7KHUHLVDODUJHQXPEHURI&KULVWLDQ 2VWUDFDLQVFULEHGZLWKWH[WVUDQJLQJIURPWKHOLWXUJLFDOVXFKDVSUD\HUVRU H[FHUSWVIURP3VDOPV$FWVRU(SLVWOHVDOWKRXJKLWLVLPSRVVLEOHWRVD\H[DFWO\ ZKDWSXUSRVHWKH\ZHUHXVHGIRU&RUQHOLD5¤PHUVXJJHVWVWKDWWKHFRQWH[W WKDWEHVWH[SODLQVWKHSUHVHQFHRI&KULVWLDQWH[WVRQVKDUGVRIFOD\ZRXOGEHDQ educational environment and that they were used for memorization training.

288 Ostrakon mit Segensspruch.    -K Q &KU / FD FP + 10,8cm. Ostrakon in sahidischer Schrift mit dem Segensspruch: ,P1DPHQGHV9DWHUVXQGGHV6RKQHVXQGGHV+HLOLJHQ*HLVWHV LQDOOH(ZLJNHLWw,QWDNW u 3URYHQLHQ]([6DPPOXQJ(.)UDQNHQVHLWFLUFD 2VWUDFRQLQ6DKLGLFVFULSWZLWKWKHEOHVVLQJ,QWKHQDPHRIWKH)DWKHUDQG RIWKH6RQDQGRIWKH+RO\6SLULWIRUHYHUDQGHYHU$PHQw,QWDFWWKWK century A.D.

149


ALTER ORIENT

289

150


289

289 $FK”PHQLGLVFKHV3IHUGHSURWRPHQUK\WRQFD-KY&KU+ 16,5cm, L ca. 18,5cm. Corpus mit trichterartigem, quergeripp ten Corpus. Unterhalb der Mündung eine verbreiterte Rippe mit ornamentalen Gruppen von horizontalen Rippen. Die Pferde SURWRPHPLWVWDUNDQJHZLQNHOWHQ9RUGHUEHLQHQNXU]JHVFKRUH QHUDXIUHFKWVWHKHQGHU0”KQHXQG6FKLUUXQJ/HLFKW6I¤UPLJ JHVFKZXQJHQH/RFNHQVWUHEHQDXIEHLGHQ6HLWHQDQGHU6FKXOWHU QDFK YRUQH =ZLVFKHQ GHQ 2KUHQ OLHJHQ ]ZHL VHQNUHFKWH (LQ stecklöcher (separat gefertige Hörner oder Kopfschmuck?). Die $XVJXVVW©OOH EH}QGHW VLFK DXI GHU %UXVW GHV 3IHUGHV Mit Me tallanalyse! Kleine Ausbrüche an der Lippe und der Wandung. )UDJPHQWHOLHJHQWHLOZHLVHEHL u

3URYHQLHQ] ([ 6DPPOXQJ . * 5KHLQODQG HUZRUEHQ LP GHXWVFKHQ .XQVWKDQGHO HU -DKUH ELV  (LQ QDKHV 3DUDOOHOVW©FN LQ 6FK”W]H des Orients. Meisterwerke aus dem Miho Museum, Ausst. Wien 1999, 62 f. Kat. Nr. 25. 'LH .RPELQDWLRQ YRQ NXU]JHVFKRUHQHP 2EHUWHLO GHU 0”KQH XQG ODQJHQ „Nackenhaar“ scheint eine langlebige orientalische Mode zu sein und kommt JDQ]”KQOLFKDXIHLQHPIU©KLVODPLVFKHQ5HOLHILQ%HUOLQYRU 0XVHXPI©U LVODPLVFKH.XQVW,QY  $FKDHPHQLG VLOYHU UK\WRQ FRPSULVLQJ D IXQQHOVKDSHG ERG\ ZLWK ULEEHG ornament, terminal in the form of a horse‘s forepart with bridled head and short mane. Spout in the center of the breast. Two holes between the ears. 5th WKFHQWXU\%&6PDOOSDUWVRIWKHZDOODQGWKHULPPLVVLQJWith metal analysis!

151


290

152291


293 292

290 Ordosbronze. -KY&KU[FP'XUFKEURFKHQJHDUEHLWHWH *©UWHODSSOLNPLW]ZHLVHQDXIGHU5©FNVHLWH'DUJHVWHOOWLVWHLQ nach rechts stoßendes Yak. Intakt mit ausgezeichnet erhaltener 9HUJROGXQJ u 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ 6DPPOXQJ'U*©QWHU:LHGQHU%D\HUQH[*RUQ\ 0RVFK$XNWLRQ /RVH[&KULVWLHyV1HZ<RUN6DOH-XQL/RVH[ Sotheby´s New York , 17.12.1996, Los 177. 9JO7UHDVXUHVRIWKH(XUDVLDQ6WHSSHV$QLPDO$UWIURP%&WR A.D. Ausstellung New York (1998) S. 58 f. Nr. 58. 2SHQZRUNJLOGHGEURQ]HEHOW}WWLQJGHSLFWLQJD\DN2UGRVUHJLRQUGQG FHQWXU\%&,QWDFW([FHOOHQWO\SUHVHUYHGJLOGLQJ

291 *©UWHOVFKOLHgH PLW +LUVFK 7UDQVNDXNDVLHQ    -K Q &KU H 12,5cm, B 13cm. Bronzeguss. Fast quadratisches Relief mit HLQHP5DKPHQDXV)OHFKWE”QGHUQPLWNRQLVFKHQ.QXEEHQDQ den Ecken. Das Bildfeld ist durchbrochen gearbeitet und zeigt einen zusammenbrechenden Hirsch, der von drei Hunden DQJHJULIIHQZLUG*U©QH3DWLQDLQWDNW u 3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQHU-DKUHQ 9JO $ 0LURQ  : 2UWKPDQQ +UVJ  8QWHUZHJV ]XP *ROGHQHQ 9OLHV $XVVWHOOXQJ0©QFKHQ  6I.DW

292 $XJHQLGROGHV7HOO%UDN7\SXV+”OIWH-WY&KU+FP B 5,9cm. Weißer, feinkristalliner Marmor. Glockenförmiger &RUSXV PLW ]ZHL GXUFKERKUWHQ 5LQJHQ GHQ QDPHQJHEHQGHQ ‚Augen‘. Reste von Sinter, fehlendes Fragment am Corpus, im Bereich der ‚Augen‘ restauriert. 1.500,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQ,Q'HXWVFKODQGVHLWYRU 0DUEOHLGRORIWKHW\SH7HOO%UDNQGKDOIWKPLOOHQLXP%&7UDFHVRI sinter, tiny fragment of the corpus missing, restored in the area of the ‚eyes‘.

293 .LOL\D,GRO:HVWDVLDWLVFKFDY&KU+FP B 4cm, T 2,7cm. Weißer, feinkristalliner Marmor. Stark stilisier WHU~DFKHU.¤USHUPLWGLDJRQDODQJHZLQNHOWHQ8QWHUDUPHQXQG JHVFKORVVHQHQVFKODQNHQ%HLQHQVRZLHHLQHPEUHLWHQ.RSIPLW langer, dünner Nase und plastischer Angabe der Ohren. Reste YRQ6LQWHU.RSIXQG)©gHZLHGHUDQJHVHW]W u 3URYHQLHQ]([3ULYDWEHVLW]07LQ0©QFKHQVHLWGHQHU-DKUHQ 0DUEOHLGRORIWKH.LOL\DW\SH:HVWHUQ$VLDWLFDERXW%& Remains of sinter, head and feet reattached.

7UDQVFDXFDVLDQEURQ]HRSHQZRUNEHOWFODVSVWUGFHQWXU\$'7KHIUDPH LVGHFRUDWHGZLWKPXOWLSOHEUDLGVWULQJVDQGNQREVDWWKHHGJHV,QWKHFHQWHU a stylized deer attacked by three dogs. Green patina, intact.

153


294

295

297

296

298 299

294 2EHUN¤USHU HLQHV .LOL\D,GROV :HVWDVLDWLVFK FD    Y &KU + FP :HLgHU IHLQNULVWDOOLQHU 0DUPRU 6WDUNVWLOLVLHUWHU~DFKHU.¤USHUPLWGLDJRQDODQJHZLQNHOWHQ$U men und einem einem breiten Kopf mit langer, dünner Nase und plastischer Angabe der Ohren. Reste von Sinter. 750,– 3URYHQLHQ]([6DPPOXQJ8/:HVWIDOHQVHLWGHQHU-DKUHQ 8SSHUSDUWRIDPDUEOHLGRORIWKH.LOL\DW\SH:HVWHUQ$VLDWLFDERXW %&5HPDLQVRIVLQWHU

295 .RSI HLQHV JURgHQ .LOL\D,GROV :HVWDVLDWLVFK FD   Y&KU+FDFP%FP7FDFP:HLgHU feinkristalliner Marmor. Breiter Kopf mit plastischer, dünner Nase. Am Hals gebrochen, Fragment des Hinterkopfes fehlt. 2.500,– 3URYHQLHQ]([3ULYDWEHVLW]07LQ0©QFKHQVHLWGHQHU-DKUHQ%HL *RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV Marble head of huge idol of the Kiliya type. Western Asiatic, about    %& %URNHQ DW WKH QHFN IUDJPHQW RI WKH EDFNKHDG missing.

296 .RSI HLQHV JURgHQ .LOL\D,GROV :HVWDVLDWLVFK FD   Y&KU+FDFP%FP7FDFP:HLgHU feinkristalliner Marmor. Breiter Kopf mit plastischer, dünner Nase. Am Hals gebrochen, kleine Fragmente des Hinterkopfes und am Kinn fehlen, partiell Belag. 1.800,– 154

3URYHQLHQ]([3ULYDWEHVLW]07LQ0©QFKHQVHLWGHQHU-DKUHQ Marble head of a large idol of the Kiliya type. Western Asiatic, about 2700 %&%URNHQDWWKHQHFNVPDOOIUDJPHQWVRIWKHEDFNKHDGDQG at the chin missing.

297 .RSI HLQHV JURgHQ .LOL\D,GROV :HVWDVLDWLVFK FD    Y &KU + FP % FP 7 FP :HLgHU IHLQNULVWDOOLQHU0DUPRU%UHLWHU.RSIPLW~DFKHUG©QQHU1DVH XQGSODVWLVFKHU$QJDEHGHU2KUHQ$P+DOVJHEURFKHQZLQ]LJH Fragmente fehlen. 1.500,– 3URYHQLHQ]([3ULYDWEHVLW]07LQ0©QFKHQVHLWGHQHU-DKUHQ 0DUEOHKHDGRIKXJHLGRORIWKH.LOL\DW\SH:HVWHUQ$VLDWLFDERXW %&%URNHQDWWKHQHFNWLQ\IUDJPHQWVPLVVLQJ

298 .RSI HLQHV JURgHQ .LOL\D,GROV :HVWDVLDWLVFK FD   Y&KU+FP%FP7FP:HLgHUIHLQ NULVWDOOLQHU0DUPRU%UHLWHU.RSIPLW~DFKHUG©QQHU1DVHXQG plastischer Angabe der Ohren. Reste von Sinter, am Hals gebro chen. 1.500,– 3URYHQLHQ]([3ULYDWEHVLW]07LQ0©QFKHQVHLWGHQHU-DKUHQ 0DUEOHKHDGRIKXJHLGRORIWKH.LOL\DW\SH:HVWHUQ$VLDWLFDERXW %&5HPDLQVRIVLQWHUEURNHQDWWKHQHFN


299 Sabäischer Alabasterkopf. FD     -K Y &KU + 12cm. Bartloser Einsatzkopf mit stark stilisierten Zü gen. Oberteil der Stirn und Nasenspitze gebrochen. 800,– 3URYHQLHQ] ([ 6DPPOXQJ ) ; 0 %D\HUQ H[ *RUQ\  0RVFK0©QFKHQ$XNWLRQ/RVH[6OJ%' %HUOLQ)©UGLHVHHUZRUEHQDXVGHU6DPPOXQJGHU%HUOLQHU ŠJ\SWRORJLQ&K+HUWHOHUZRUEHQLQGHQHU-DKUHQ 9JO-HPHQ.XQVWXQG$UFK”RORJLHLP/DQGGHU.¤QLQJLQYRQ Saba. Ausstellung Wien (1998) S. 346 Kat. 319. 6DEDHDQDODEDVWHUKHDGZLWKKLJKO\VW\OL]HGIHDWXUHV$ERXWWK WKFHQWXU\%&7RSRIWKHIRUHKHDGDQGWLSRIWKHQRVHEURNHQ

300 6WLHUPLW*HI”gHQ6DE”LVFK-KY&KU/FDFP H 12cm, B 12,8cm. Aus Kalkstein. Stehender Stier, GHU DXI GHP 5©FNHQ ]ZHL PLW HLQHP EUHLWHQ %DQG YHUEXQGHQH EDXFKLJH *HI”gH WU”JW 2EHU~”FKH HW ZDV EHULHEHQ 2KUVSLW]HQ XQG )©gH DEJHEURFKHQ )UDJPHQWHGHU*HI”gP©QGXQJHQXQG+LQWHUWHLOIHK len. 800,–

300

3URYHQLHQ]([6DPPOXQJ(8%D\HUQ,Q'HXWVFKODQGVHLW vor 1990. /LPHVWRQH EXOO ZLWK WZR YHVVHOV 6DEDHDQ QG FHQWXU\ %& Surface partially worn, tips of the ears and legs broken, fragments of the vessels and part of the back missing.

301 (OHIDQW DXV &KDO]LW 0HVRSRWDPLHQ 'MHPGHW 1DVU 3HULRGHFDY&KU/FP+FP %FP6WLOLVLHUWH7LHU}JXUPLWEORFNDUWLJHP.¤U per auf vier kompakten Beinen und einem langovalen Kopf mit Bohrungen für die Augen. Der „Rüssel“ ist PLW GHP .¤USHU YHUEXQGHQ GHU =ZLVFKHQUDXP LVW rund ausgebohrt. 0LW1RWL]GHV6DPPOHUV 2EHU~” che bestoßen mit Resten von Sinter, linkes hinteres %HLQXQGYRUGHUHUOLQNHU)XgHUJ”Q]W.RSIIUDJPHQW HUJ”Q]W u

301

3URYHQLHQ]([6DPPOXQJ0%+HVVHQVHLWYRU 6W\OL]HG }JXUH RI DQ HOHIDQW RI FDOFLWH 0HVRSRWDPLD -HPGHW 1DVUSHULRGDERXW%&6XUIDFHZRUQZLWKWUDFHV of sinter, left, rear leg and front, left foot restored, head fragment restored. :LWKQRWLFHRIWKHFROOHFWRU

302 0LQLDWXU:DJHQ DXV 7RQ 6\UR+HWKLWLVFK   1000 v. Chr. L 11cm, H 11cm, B 10cm. Aus bei JHP7RQ0LWYLHUVFKHLEHQI¤UPLJHQ5”GHUQGLHPLW PRGHUQHQ 3OH[LJODV$FKVHQ DP JHVFKORVVHQHQ :D JHQNDVWHQGHV3ODQZDJHQVEHIHVWLJWVLQG,P%RGHQ des Wagenkastens ein Loch für die Befestigung der 'HLFKVHO'LHQWHDOV9RWLY2EHU~”FKHHWZDVEHULH EHQ ZLQ]LJH )UDJPHQWH GHU 5”GHU IHKOHQ $FKVHQ modern aus Plexiglas. 1.200,– 3URYHQLHQ] ([ 6DPPOXQJ ( 8 %D\HUQ H[ +LUVFK 1DFKI München Auktion 175, 1992, Los 1761. &RYHUHGFOD\YRWLYHZDJJRQ6\URKLWWLWH%&:LWK IRXU ZKHHOV DQG PRGHUQ SOH[LJODVV D[OHV 6XUIDFH ZRUQ WLQ\ IUDJPHQWVRIWKHZKHHOVPLVVLQJD[OHVRISOH[LJODVV

302

155


304 303

303 Bronzenes Idol. Elamitisch, Mitte 2. Jt. v. Chr. L 15,4cm, B FP'HWDLOVLQ.DOWDUEHLW0”QQOLFKH)LJXUPLW~DFKHPEUHWW DUWLJHQ .¤USHU PLW XUVSU©QJOLFK DXV RGHU YRUJHVWUHFNWHQ $U PHQ LQ HLQHP ODQJHQ JHPXVWHUWHQ *HZDQG PLW *©UWHO LQ GHU Taille. Der Kopf ist vollplastisch als Janusgesicht mit abstehen GHQ2KUHQXQGKHUYRUWUHWHQGHU1DVHJHVWDOWHW'LH)LJXUWU”JW HLQHQ%DUWXQG]ZHLODQJH=¤SIH5HVWHYRQ6LQWHUJU©QH3DWLQD $UPHJHEURFKHQDQGHQ)©gHQJHEURFKHQ.RSIZLHGHUDQJH setzt. 1.800,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQ,Q'HXWVFKODQGVHLWYRUH[ Hirsch Nachf., München Auktion 257, 2008, Los 1764. %URQ]HPDOHLGROZLWKD~DWFRUSXVDQGDMDQLIRUPKHDG(ODPLWHPLGQG PLOOHQLXP%&7UDFHVRIVLQWHUJUHHQSDWLQDEURNHQDWWKHDUPVDQGIHHW head reattached.

156

304 • Bronzestatuette eines Gottes. .DQDD%URQ]H]HLWY &KU + FP 6WHKHQGH P”QQOLFKH VWLOLVLHUWH )LJXU GLH GLH Arme vor dem Körper auf Brusthöhe zusammengeführt hat. ,QGHQ+”QGHQEHIDQGHQVLFKXUVSU©QJOLFK$WWULEXWH$XIGHP Kopf ein konischer Aufsatz, unter den Füßen zapfenartige Fort V”W]H*URgH2KUHQHLQHKHUYRUVSULQJHQGH1DVHQVRZLHDXIJH legte Scheiben als Augen. Grüne Patina, Attribute fehlen. 4.000,– 3URYHQLHQ]([<'6&ROOHFWLRQ-HUXVDOHP,VUDHOVHLW 9JO+6HHGHQ7KH6WDQGLQJ$UPHG)LJXULQHVLQWKH/HYDQW3%),   Nr. 195. &DQDDQLWHEURQ]HVWDWXHWWHRID*RG0LGGOH%URQ]H$JH%& Green patina, missing attributes.


305

306 307

305 Standartenaufsatz aus Bronze. Luristan, 1000 v. Chr. H 7,3cm. 9ROOJXVV :HLEOLFKH )LJXU PLW GUHLHFNLJHP 2EHUN¤USHU PLW Stummelarmen und Klauenfüßen, die Brüste plastisch hervor gehoben. Seitlich am Kopf mit hervortretender Nase Ösen. Die )LJXULVWMDQXVDUWLJJHVWDOWHW3XEOL]LHUW Dunkelgrüne Patina, Tei le oben und unten fehlen. 700,–

Ende Zierleisten, am oberen Ende ein kelchartiger Abschluss. 3XEOL]LHUW Braungrüne Patina, intakt. 400,–

3URYHQLHQ]([6DPPOXQJ(8%D\HUQ([6DPPOXQJ5%ORFK0©QFKHQ vor 1976. 3XEOL]LHUWLQ5%ORFK$QWLNH.OHLQNXQVW  6IPLW$EE1DFK %ORFKHULQQHUQGLHHXOHQDUWLJHQ.ODXHQDQ'DUVWHOOXQJHQGHU*¤WWLQ/LOLWK GLHLQDOWEDE\ORQLVFKHU=HLWPLWYRJHO”KQOLFKHQ.UDOOHQDEJHELOGHWZXUGH

%URQ]H WXEH LGRO ZLWK MDQLIRUP KHDG /XULVWDQ WK  WK FHQWXU\ %& %URZQJUHHQSDWLQDLQWDFW

%URQ]HVWDQGDUWDWWDFKPHQWLQIRUPRIDIHPDOHMDQLIRUP}JXUHZLWKVWXEE\ DUPVDQGFODZHGIHHW/XULVWDQ%&'DUNJUHHQSDWLQDSDUWVDERYHDQG below missing.

3URYHQLHQ]([6DPPOXQJ(8%D\HUQ([6DPPOXQJ5%ORFK0©QFKHQ vor 1976. 3XEOL]LHUWLQ5%ORFK$QWLNH.OHLQNXQVW  6IPLW$EE 9JO/XULVWDQ$QWLNH%URQ]HQDXVGHP,UDQ$XVVWHOOXQJVNDWDORJ0©QFKHQ (2002) S. 119.

307 Röhrenidol aus Bronze. /XULVWDQ-KY&KU+FP9ROO guss. Röhre mit einem Abschluss, der mit stilisierten Tierköpfen dekoriert ist. Grüne Patina mit Resten von Sinter, intakt. 400,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQ,Q'HXWVFKODQGVHLWYRU

306 Röhrenidol aus Bronze. /XULVWDQ-KY&KU+FP9ROO guss. Röhre mit einem Januskopf am oberen Ende. Am unteren

%URQ]HWXEHLGROZLWKDQHQGLQJZLWKVW\OL]HGDQLPDOKHDGV/XULVWDQWK WKFHQWXU\%&*UHHQSDWLQDLQWDFW

157


308 Kleiner Bronzestier. Amlash, 1. Jt. v. Chr. L 7,5cm, H 4,4cm. 9ROOJXVV 'XQNHOJU©QH 3DWLQD mit Resten von Sinter, intakt. 400,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQ ,Q'HXWVFKODQGVHLWYRU %URQ]H PLQLDWXUH EXOO $PODVK VW PLOOHQLXP %& 'DUNJUHHQ SDWLQD ZLWK traces of sinter, intact.

309 $ODEDVWHUJHI”g PLW 6FKQXU¤VHQ Naher Osten, 1. Jt. v. Chr. Ø 10,4cm, H 5,5cm. Flaches Ge I”g PLW KDOEUXQGHP &RUSXV DE gesetztem Standfuß, bauchiger Wandung und leicht nach in QHQ HLQJH]RJHQHU ~DFKHU EUHL ter Lippe. Auf dem Corpus vier JOHLFKP”gLJ YHUWHLOWH KRUL]RQWD OH 6FKQXU¤VHQ 6SU©QJH ZLQ]L ges Fragment am Fuß fehlt, aber komplett. 1.200,–

308

3URYHQLHQ]([6DPPOXQJ(8%D\HUQ ,Q'HXWVFKODQGVHLWYRU Alabaster vessel with four eyelets on the FRUSXV1HDU(DVWHUQVWPLOOHQLXP%& Cracks and tiny fragment at foot missing, but complete.

310 Kannendeckel in Vogelform. He thitisch, 2. Jt. v. Chr. H 12cm, Ø FP$XVEU”XQOLFKHQ7RQPLW U¤WOLFKHP EHU]XJ 'HFNHO HLQHU .DQQHLQ*HVWDOWHLQHV9RJHOVPLW angedeuteten Flügeln und einer 9HU]LHUXQJ LQ )RUP YRQ HLQHP :LQNHOEDQG 2EHU~”FKH EHULH ben, kleines Randfragment fehlt. 1.350,– 3URYHQLHQ] ([ HQJOLVFKH 6DPPOXQJ erworben vor 1998; in Deutschland seit 1998. 309 Jug clay lid in form of a bird. Hittite, QGPLOOHQLXP%&6XUIDFHZRUQWLQ\ bottom fragment missing.

158


310

311

311 Keilschriftkissen. Akkadisch, 3. Jt. v. Chr. L 6,8cm, B FP7RQ.LVVHQI¤UPLJHV.HLOVFKULIW7”IHOFKHQPLWJXW lesbaren Zeichen. Intakt. 1.000,– 3URYHQLHQ]([6DPPOXQJ(66FKZHL]HU-DKUH6HLW Anfang der 2000er Jahre in Privatbesitz Deutschland. &XQHLIRUP WDEOHW ZLWK $NNDGLDQ VFULSW UG PLOOHQLXP %& ,QWDFW

312 7RQ3KDOORV<RUWDQY&KU+FP*UDXHU 7RQ )ODFKH 6WDQG~”FKH DQ GHU 6SLW]H HLQH IIQXQJ 'LHQWH DOV 9RWLY2EMHNW 2EHU~”FKH HWZDV EHULHEHQ intakt. 400,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQ,Q'HXWVFKODQGVHLWYRU 1990. 9JO%RQKDPyV$XNWLRQ/RV *UH\FOD\SKDOORVVHUYHGDVYRWLYH<RUWDQ%&6XUIDFH partially worn, intact.

312

159


8581')5+*(6&+,&+7(

313

160


313 1HROLWKLVFKHV,GRODXV0DUPRUZentralgriechenland, ca. 3. Jt. v. &KU + FP 6LW]HQGHV ZHLEOLFKHV ,GRO PLW QDW©UOLFKw JH bildetem Oberkörper und fettleibigem Unterkörper, Brüste nur angedeutet, eine Bauchfalte, Arme unterhalb der Brust zusam mengeführt, Stummelbeine, die spitz zulaufend nur aus einem 2EHUVFKHQNHO EHVWHKHQ $XV GUHL 7HLOHQ ZLHGHU ]XVDPPHQJH VHW]WUHFKWH)XgVSLW]HHUJ”Q]W u 3URYHQLHQ] ([ *RUQ\  0RVFK 0©QFKHQ $XNWLRQ  /RV  H[ 6DPPOXQJ 0 7 %D\HUQ H[ 6DPPOXQJ 6 0 HUZRUEHQ FD  DXV englischer Privatsammlung. Neolithic marble idol in shape of a sitting female with a normal torso and a FRUSXOHQWORZHUERG\&HQWUDO*UHHNDERXWUGPLOOHQLXP%&5HDVVHPEOHG of three parts, tip of the right foot reattached.

314 Bronzene Speerspitze. FDY&KU/FP%URQ]H JXVV$XIZ”QGLJPLWJHRPHWULVFKHP5LW]GHNRUYHU]LHUWH6SHHU VSLW]H PLW HUK¤KWHP 0LWWHOJUDW XQG JH~DPPWHP JHVWXIWHQ %ODWW ,Q GHU 7©OOH ]ZHL %HIHVWLJXQJVO¤FKHU 'XQNHOJU©QH 3DWL QDNOHLQH)UDJPHQWHDQGHUHWZDVEHULHEHQHQ6SLW]HIHKOHQ 3.500,–

314

Provenienz: Aus Privatsammlung C. N., Deutschland, erworben 2001. Davor GHXWVFKH3ULYDWVDPPOXQJJHELOGHWLQGHQHU-DKUHQ /DYLVKO\GHFRUDWHGFDVWEURQ]HVSHDUKHDGZLWKDOR]HQJHVKDSHGUDLVHGFHQWUDO ridge and layered blade. There are two piercings below for attachment pins. $ERXW%&'DUNJUHHQSDWLQDWLSZRUQDQGZLWKWLQ\IUDJPHQWV missing.

161


315 3DDUEURQ]HQH$UPVSLUDOHQ%URQ]H]HLWFD-KY&KU+ FDPkFP*URgH6SLUDOHQPLW~DFKHP4XHUVFKQLWWPLW Mittelrippe, die zu den Enden in einen runden Stab übergehen, der in quergestellten Endspiralen endet. Auf der Oberseite der Mittelrippen partiell Ritzdekor. Dunkelgrüne und blaugrüne Patina, intakt. 3.500,– Provenienz: Aus Privatsammlung C. N., Deutschland, erworben 2005. Zuvor EHOJLVFKH3ULYDWVDPPOXQJGHUVS”WHQHU-DKUH Pair of bronze spirals made of a band with a central ridge and with a spiral HQGDWHDFKVLGH%URQ]H$JHDERXWWKWKFHQWXU\%&9HU\QLFHEOXH JUHHQDQGGDUNJUHHQSDWLQDLQWDFW

316 3DDU%ULOOHQ}EHOQ(QGH%URQ]H]HLW$QIDQJ(LVHQ]HLW-K Y&KU/MHFDFP=ZHLPLWHLQDQGHUYHUEXQGHQHDXVYLHU kantigem Bronzedraht aufgerollte Spiralen mit intaktem Schließ mechanismus auf der Rückseite. 6FKDUINDQWLJH3UDFKWH[HPSODUH Herrliche dunkelgrüne Patina, intakt. 2.500,– Provenienz: Aus Privatsammlung C. N., Deutschland, erworben 2001. Davor GHXWVFKH3ULYDWVDPPOXQJJHELOGHWLQGHQHU-DKUHQ

315

3DLU RI EURQ]H VSHFWDFOH }EXODH PDGH RI WZR VSLUDOV RI EURQ]H ZLUH /DWH %URQ]H$JH(DUO\,URQ$JHWKWKFHQWXU\%&([FHOOHQWSDWLQDLQWDFW

317 Bronzene Doppelspirale. %URQ]H]HLW FD    -K Y &KU / 16,5m. Aus einem rundstabigen Draht gefertige Doppelspirale mit einer quergestellten Spiralverbindung in der Mitte. Herrliche dunkelgrüne Patina, intakt. 1.000,– Provenienz: Aus Privatsammlung C. N., Deutschland, erworben in den 2000er Jahren aus deutscher Privatsammlung. %URQ]H$JHGRXEOHVSLUDOPDGHIURPDURXQGEDU$ERXWWKWKFHQWXU\ %&9HU\DWWUDFWLYHGDUNJUHHQSDWLQDH[FHOOHQWSUHVHUYDWLRQLQWDFW

318 Bronzene Doppelspirale. %URQ]H]HLW FD    -K Y &KU / 16,5m. Aus einem vierkantigem Draht gefertige Doppelspirale mit einer quergestellten Spiralverbindung in der Mitte. Herrliche dunkelgrüne Patina, intakt. 1.000,– Provenienz: Aus Privatsammlung C. N., Deutschland, erworben in den 2000er Jahren aus deutscher Privatsammlung. %URQ]H$JHGRXEOHVSLUDOPDGHIULPDVTXDUHEDU$ERXWWKWKFHQWXU\%& 9HU\DWWUDFWLYHGDUNJUHHQSDWLQDH[FHOOHQWSUHVHUYDWLRQLQWDFW

319 Bronzener Doppelarmknauf. 0LWWHOHXURSDVS”WH%URQ]H]HLW -KY&KU%FP+FP9HUWLNDOSUR}OLHUWH6FKDIWU¤KUH PLW ]ZHL DQWLWKHWLVFKHQ ODQJHQ OHLFKW QDFK XQWHQ JHZ¤OEWHQ $UPHQXQG]ZHLNXU]HQ'RUQHQ$QGHQ$UPHQ5LW]YHU]LHUXQJ Grüne Patina, intakt. 2.500,– Provenienz: Aus Privatsammlung C. N., Deutschland, erworben 2005 aus deutscher Privatsammlung. 9JO01RYRWQD'LHŠ[WHXQG%HLOHLQGHU6ORZDNHL3%),;   Taf. 23. 316

162

(XURSHDQ%URQ]H$JHREMHFWZLWKWZRDUPVWKWKFHQWXU\%&*UHHQ patina, slightly worn, otherwise intact.


317

318

319

320

321

320 Vier Kugelkopfnadel aus Bronze. Frühe bis mittlere Bronzezeit, FD-KY&KU/FP%URQ]HJXVV%LNRQLVFKHU separat aufgegossener Nadelkopf. Der Schaft mit spindelartiger 9HUGLFNXQJLPREHUHQ9LHUWHOHLQ6W©FNGRUWPLWJHRPHWULVFKHP Ritzdekor. 4 Stück! Schöne grüne Patina, einmal Spitze gebrochen, einmal verbogen. 1.000,– 3URYHQLHQ]([6DPPOXQJ'U1*URgEULWDQQLHQVHLWYRU 1DGHOQLQGLHVHU*U¤gHZDUHQVLFKHUQLFKW]XPW”JOLFKHQ*HEUDXFKEHVWLPPW sondern dienten als Grabbeigaben für die Tracht bedeutender Persönlichkeiten.

321 Vier Kugelkopfnadel aus Bronze. Frühe bis mittlere Bronzezeit, FD-KY&KU/FP%URQ]HJXVV%LNRQLVFKHU separat aufgegossener Nadelkopf. Der Schaft mit spindelartiger 9HUGLFNXQJ LP REHUHQ 9LHUWHO 4 Stück! Schöne grüne Patina, alle intakt. 1.000,– 3URYHQLHQ]([6DPPOXQJ'U1*URgEULWDQQLHQVHLWYRU *URXSRIIRXUFDVWEURQ]HQHHGOHVZLWKELFRQLFDOKHDGV(DUO\0LGGOH%URQ]H $JHDERXWWKWKFHQWXU\%&$WWUDFWLYHJUHHQSDWLQDLQWDFW4 pieces!

Group of four cast bronze needles with biconical heads. One with engraved GHFRUDWLRQDWWKHXSSHUSDUWRIWKHVKDIW(DUO\0LGGOH%URQ]H$JHDERXWWK WKFHQWXU\%&$WWUDFWLYHJUHHQSDWLQDRQHWLSEURNHQRQHEHQW4 pieces!

163


322 3DDU EURQ]HQH $UPUHLIH 6S”WH %URQ ]H]HLW-KY&KUkXQG 6cm. Ritzdekor in Kaltarbeit. Grüne 3DWLQD2EHU~”FKHVWHOOHQZHLVHOHLFKW korrodiert und an einem Reif retu schiert. 500,– 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPP lung M. S., seit 1970er Jahren.

322

3DLU RI /DWH %URQ]H $JH EUDFHOHWV PDGH RI ERQ]H ZLWK HQJUDYHG GHFRU WK  WK FHQWXU\%&/LWWOHFRUURVLRQDWWKHVXUIDFH one bracelet with retouched spot.

323 )HXHUVFKO”JHU Wikinger, ca. 900   Q &KU + FP % FP Bronze mit gepunztem Dekor. Schö ne dunkelgrüne Patina, mit Resten des korrodierten Eisens. 500,– 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPP lung M. S., seit 1970er Jahren. 323

%URQ]H}UHVWULNHUZLWKSXQFKHGGHFRU9LNLQJ DERXW WK  WK FHQWXU\ $' 1LFH GDUN green patina, with remains of the corroded iron.

324 *URgHU VLOEHUQHU 7RUTXHV Thrakisch,    -K Y &KU k FP J  Beide Endspiralen fehlen. 1.200,– 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPP lung M. S., seit 1970er Jahren. /DUJH VLOYHU WRUTXHV 7KUDFLD UG  QG FHQWXU\$'%RWKVSLUDOVDWWKHHQGLQJVDUH missing.

325 2VWJHUPDQLVFKH 6LOEHUEOHFK}EHO 5. Jh. n. Chr. L 9,8cm (63,3g). Intakt. 600,–

324

3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPP lung M. S., seit 1970er Jahren. 2VWURJRWKLDQwVLOYHU}EXODWKFHQWXU\$' ,QWDFW

326 )LEHOSDDU 9¤ONHUZDQGHUXQJV]HLW Südrussland, 7. Jh. n. Chr. L 12,1cm. 9HU]LQQWH %URQ]H .OHLQH 'UXFNVWHO len, sonst intakt. 600,– 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPP lung M. S., seit 1970er Jahren.

325

164

326

3DLURI}EXODHPDGHRIWLQQHGEURQ]H0LJUD tion Period, South Russia, 7th century A.D. Little dents, otherwise intact.


327 (LVHQGROFK VRJ $NLQDNHV Skythisch, -KY&KU/FPMit kleinem Koffer!2EHU~”FKLJH.RUURVLRQVRQVW intakt und in guter Erhaltung. 600,–

327

3URYHQLHQ] ([ 6DPPOXQJ 6 0 :LHQ erworben bei Harry Hüttel, Wien, 1985. ,URQGDJJHUVRFDOOHGDNLQDNHV6F\WKLDQWK WKFHQWXU\%&6XUIDFHFRUURGHGRWKHUZLVH intact. :LWKVPDOOER[

328

328 (LVHQGROFK VRJ $NLQDNHV Skythisch,    -K Y &KU / FP Mit kleiner Schachtel! Korrodiert, sonst intakt. 400,– 3URYHQLHQ] ([ 6DPPOXQJ 6 0 :LHQ erworben bei Harry Hüttel, Wien, 1985. ,URQGDJJHUVRFDOOHGDNLQDNHV6F\WKLDQWK WKFHQWXU\%&&RUURGHGRWKHUZLVHLQWDFW :LWKVPDOOER[

329 Dakischer Tonbecher mit Applikende kor. ca. 2. Jh. n. Chr. H 25,6cm, Ø Körper 15,2cm. Hoher handgeform ter zylindrischer Becher aus braunem Ton. Beidseitig ein tordierter Torques als Applikendekor. Fehlstelle an einer $SSOLNHDP%RGHQXQGLP.¤USHUMH ein Riss. 500,– Provenienz: Aus einer deutschen Sammlung der 1980er Jahre. Dacian handmoulded cylindrical beaker made of brown clay with two appliques in form of twisted torques. About 2nd century A.D. Little fragment of one applique is missing, at the bottom and in the corpus each a crack.

330 )ODFKH6FKDOHNiederschlesien. 1. Jt. Y &KU + FP k FP 6FKZDU] grauer Ton. Lausitzer Kultur(?). Flache Tasse mit Omphalos, bauchi JHP &RUSXV XQG ZHLWHU 0©QGXQJ mit leicht auskragender, glatter Lip pe. Auf der Wandung geometrischer Ritzdekor aus linierten und karierten Dreiecken. An der Lippe ein klei ner Schlaufenhenkel. Auf der Unter seite Fundortangabe „Saarau, Kreis 6FKZHLGQLW]w .OHLQH (UJ”Q]XQJ DP Boden, sonst exzellent erhalten. 550,–

329

3URYHQLHQ] ([ 6DPPOXQJ 'U 6LHJIULHG =LPPHU7UDXQVWHLQYRU ,QY  Small prehistoric pottery cup from Silesia. VW PLOOHQLXP %& 7ULDQJXODU JHRPHWULFDO incised decor. Small restoration at the bottom.

330

165


331 1HROLWKLVFKHV 'RSSHOJHI”g H 7,3cm, B 17,2cm. Alter Ori ent. Dunkelgrüner, gesprenkel ter Stein. Drei abgesprungene Splitter separat beiliegend, sonst intakt. 1.000,– 3URYHQLHQ]([6DPPOXQJ(8%D\HUQ in Deutschland seit vor 1990. Western Asiatic Neolitic double vessel made of dark green spotted stone. Three separate splinters attached, otherwise intact. 331

332 1HROLWKLVFKH 5HLEHVFKDOH PLW 5HL bestein. Zentralsahara, Ténéré,    -W Y &KU / FD FP % max. 19,5cm, H ca. 25cm. Gro gHV VLFKHOI¤UPLJHV 2EMHNW DXV VFKZDU]HP9XONDQJHVWHLQPLWHL QHP O”QJOLFKHQ 5HLEHVWHLQ / FD 25cm). Mit Sockel! Beeindrucken des Stück! Intakt. 1.200,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPP OXQJ8+,Q'HXWVFKODQGVHLWYRU Neolithic stone grinding mill and pestle made from black volcanic stone. Cen WUDO 6DKDUD 7˜Q˜U˜ WK  WK PLOOHQL XP%&,QWDFW/DUJHDQGLFRQLFLWHP With stand!

332

333 1HROLWKLVFKH 5HLEHVFKDOH PLW ]ZHL Reibesteinen. =HQWUDOVDKDUD   6. Jt. v. Chr. L ca. 55cm, B ca. FP+FDFP2YDOHV~DFKHV QDFKDXgHQNRQNDYHV2EMHNWDXV grünlichgrauem Stein mit einem ovoiden Reibestein (L ca. 14cm) XQG HLQHP ZDO]HQI¤UPLJHQ 5HL bestein (L ca. 32cm). Mit Sockel! Intakt. 1.200,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPP OXQJ8+,Q'HXWVFKODQGVHLWYRU Neolithic stone grinding mill and two SHVWOHV PDGH IURP JUHHQJUH\LVK VWRQH &HQWUDO6DKDUDWKWKPLOOHQLXP%& ,QWDFWWith stand! 333

166


334 1HROLWKLVFKH 5HLEHVFKDOH PLW 5HL bestein. =HQWUDOVDKDUD-WY Chr. L ca. 53cm, B max. 37cm, H FD FP *URgH HLI¤UPLJH ~DFKH Scheibe aus sandfarbenem Stein mit einem ovoiden Reibestein (L max. ca. 18cm). %HVRQGHUH)RUP Intakt. 1.200,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPP OXQJ8+,Q'HXWVFKODQGVHLWYRU Neolithic stone grinding mill and pestle made from beige stone. Central Sahara, WKWKPLOOHQLXP%&,QWDFWIconic item!

334

335 1HROLWKLVFKH 5HLEHSODWWH PLW 5HL bestein. =HQWUDOH6DKDUD-W v. Chr. L ca. 38cm, B max. 29cm, H ca. 17cm. Große, linsenförmige Platte aus braunem Stein mit Mu scheleinschlüssen und ein ovaler scheibenförmiger Reibestein (L ca. 12cm). Intakt. 800,– 3URYHQLHQ]([6DPPOXQJ(+%D\HUQ seit 1980er Jahren. Neolithic stone grinding plate and pestle. &HQWUDO6DKDUDWKWKPLOOHQLXP%& ,QWDFW

335

336 1HROLWKLVFKH 5HLEHVFKDOH PLW 5HL bestein. =HQWUDOVDKDUD    -W v. Chr. Ø 23cm, H ca. 13cm. +DOENXJHOLJHV 2EMHNW DXV VDQG farbenem Stein mit einem runden Reibestein (Ø ca. 18cm). Mit Sok kel! Intakt. 400,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPP OXQJ8+,Q'HXWVFKODQGVHLWYRU Neolithic stone grinding mill and pestle made from beige stone. Central Sahara, WK  WK PLOOHQLXP %& ,QWDFW With stand!

336

167


337

338

339

168


337 1HROLWKLVFKHU 3~RFN 6©GVDKDUD    -W Y &KU / FD FP 6WDEI¤UPLJHV ]X HLQHU 6HLWH HWZDV NR QLVFK ]XODXIHQGHV 2EMHNW PLW DEJHUXQGHWHQ (QGHQ DXV EU”XQOLFKJUDXHP6WHLQ,QWDNW u 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ8+,Q'HXWVFKODQG seit vor 1999. 1HROLWKLFVWRQHSHJPDGHIURPEURZQJUH\LVKVWRQH6RXWK6DKDUD WKWKPLOOHQLXP%&,QWDFW

338 1HROLWKLVFKHU3~RFN6©GVDKDUD-WY&KU/FD FP 6WDEI¤UPLJHV ELNRQLVFKHV 2EMHNW PLW VSLW]HQ (QGHQDXVEU”XQOLFKJU©QHP6WHLQMit Sockel! Intakt. 800,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ8+,Q'HXWVFKODQG seit vor 1999.

340

1HROLWKLFVWRQHSHJPDGHIURPEURZQJUHHQLVKVWRQH6RXWK6DKDUD WKWKPLOOHQLXP%&,QWDFWWith stand!

339 1HROLWKLVFKHU3~RFN6©GVDKDUD-WY&KU/FD FP6WDEI¤UPLJHV2EMHNWPLWUXQGHQ(QGHQDXVJU©Q lichem Stein. Mit Sockel! Intakt. 600,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ8+,Q'HXWVFKODQG seit vor 1999. 1HROLWKLFVWRQHSHJPDGHIURPJUHHQLVKVWRQH6RXWK6DKDUDWK WKPLOOHQLXP%&,QWDFWWith stand!

340 Steinzeitliche Steingeräte. :HVWDIULNDFD Y&KU/FDXQGFP$XVJU©QJUDXEUDXQZHLg JHVSUHQNHOWHP6WHLQ(LQ*HU”WPLW.OLQJH0LW$XINOH bern zu den Fundorten „Gao Menaka“. 2 Stück! Intakt. 600,– 341 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ8+,Q'HXWVFKODQG seit vor 1999. 1HROLWKLFVWRQHWRROVZLWKWDJVQDPLQJWKH}QGVSRW1RUWKZHVW$IULFD DERXW%&,QWDFW2 pieces!

341 1HROLWKLVFKH .XJHOQ 1RUGVDKDUD    -W Y &KU k FD  XQG FP =ZHL SROLHUWH .XJHOQ DXV 4XDU]LW die eingebunden als Schmuck oder Spielstein dienten. 2 Stück! Mit Sockel! Intakt. 500,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ8+,Q'HXWVFKODQG seit vor 1999. Neolithic quartzite polished balls, originally used as jewellery or WRNHQ 1RUWK 6DKDUD WK  WK PLOOHQLXP %& ,QWDFW 2 pieces! With stand!

342 )DXVWNHLO DXV 4XDU]LW 1RUGDIULND 3DO”ROLWKLNXP FD 300.000 v. Chr. L ca. 25cm, B max. 10cm. Intakt. 500,–

342

3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ8+,Q'HXWVFKODQG seit vor 1999. +DQGD[HPDGHIURPTXDUW]LWH1RUWK$IULFD3DOHROLWKLF$JHDERXW %&,QWDFW

169


343

343 )DXVWNHLOHDXV4XDU]LW1RUGDIULND3DO”ROLWKLNXPFDY Chr. L ca. 17,5 und 14cm. 2 Stück! Mit Sockel! Intakt. 800,–

344 Schöne Sammlung steinzeitlicher Werkzeuge. 9LHU QHROLWKLVFKH +DPPHU”[WH/FPVRZLHHLQPHVROLWKLVFKHU$[WNRSI aus Feuerstein, L 10cm. Dazu ein mittelalterlicher Axtkopf aus Eisen, L 14,8cm. 6 Stück! 1.500,–

3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ8+,Q'HXWVFKODQGVHLWYRU 1999.

3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ

+DQGD[HVPDGHIURPTXDUW]LWH1RUWK$IULFD3DOHROLWKLF$JHDERXW %&,QWDFW2 pieces! With stand!

1LFH &ROOHFWLRQ RI IRXU 1HROLWKLF DQG RQH 0HVROLWKLF VWRQH D[HV 3OXV D PHGLHYDOLURQD[H6 pieces!

344

170


BYZANZ

345

345 • )LJXUHQSDDU DXV %HLQ .RSWLVFK "  XP    -K Q &KU + MHZHLOVFP:DKUVFKHLQOLFK+LUVFKRGHU5LQGHUNQRFKHQ=ZHL PHQVFKOLFKH )LJXUHQ XQGH}QLHUEDUHQ *HVFKOHFKWV /”QJOLFKH Gesichter mit stilisierten Gesichtszügen und mandelförmigen Augen, einer dünnen Nase und einem kleinen horizontalen Mund. Auf den Köpfen eine Krone oder ein dickes Diadem. Die .¤USHUVLQGYROOVW”QGLJYRQHLQHPJURgHQ]\OLQGULVFKHQ0DQWHO bedeckt, der in einem Fall mit einem großen Kreuz, im anderen PLWHLQIDFKHQJHSXQNWHWHQ.UHLVHQYHU]LHUWLVW$P+DOVMHZHLOV eine dicke „Halskette“. Rückseite einfach modelliert, nur die +DXSWOLQLHQGHV.¤USHUVVLQGDQJHJHEHQ .RSI*HV”g /HLFKWH gelbe Tönung, intakt. 4.500,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV aus Schweizer Privatbesitz; erworben bei Galerie David Ghezelbash, Paris im September 2009.

Die Knochenstatuetten, die nicht nur in Nordafrika, sondern im gesamten Mittelmeerraum verbreitet waren, konnten unterschiedliche Formen haben, die mehr oder weniger an den menschlichen Körper erinnern: Einige haben $UPH XQG %HLQH DQGHUH VLQG PLW HUKDOWHQHQ )UDJPHQWHQ YRQ 6WRIIHQ wie Kleidung und Haaren, andere sind sehr stilisiert, wie in diesem Fall, GDUJHVWHOOW'LH%HGHXWXQJGHU)LJXUHQLVWQLFKWLPPHUNODU9LHOOHLFKWZDUHQ VLH)UXFKWEDUNHLWVLGROHRGHU3XSSHQI©UMXQJH0”GFKHQGLHVLHDQ]LHKHQXQG schmücken konnten. Aufgrund ihrer Form kann man sich die beiden Figuren sogar auf einem Schachbrett vorstellen: Es könnten König und Königin sein. Vgl.: L’art copte en Egypte, 2000 ans de Christianisme (2000) S. 216 f; L. 7¤U¤N&RSWLF$QWLTXLWLHV,  6IIXQG7DI 3DLURI&RSWLF " ERQH}JXUHV SHUKDSVPDOHDQGIHPDOH ZLWKVW\OL]HGIDFHV GLDGHPVDQGGHFRUDWHGZLWKORQJFLUFOHVGUHVVHV$ERXWWKWKFHQWXU\ $'7KHERQH}JXULQHVRIGLIIHUHQWW\SHVZHUHYHU\SRSXODULQ1RUWKHUQ$IULFD DQG0HGLWHUUDQHDQDUHDLQ%\]DQWLQHSHULRGQHYHUWKHOHVVWKHLUSXUSRVHVWD\V unclear. Light yellow patina, intact.

171


346

350

346 Schale mit Tiermotiv. %\]DQWLQLVFKIU©KHV-KQ&KU kFP+FP6RJLQFLVHGVJUDI}WRUHGZDUH6FKDOHPLW Standring, konischer Wandung und senkrechtem Rand. Innen PLWZHLgHU(QJREHXQGJU©QOLFKHU*ODVXU,P=HQWUXPGHU,Q QHQ~”FKHHLQVWLOLVLHUWHV7LHUXPJHEHQYRQ]HQWULIXJDODQJHRUG QHWHQ'HNRUHOHPHQWHQ9HUI”UEXQJHQDXgHQVWHOOHQZHLVHDXFK am Innenrand, Meeresinkrustationen, kleines Fragment des Standringes fehlt. 500,– 3URYHQLHQ] ([ 6DPPOXQJ & 6 0©QFKHQ (UZRUEHQ LP 0©QFKQHU .XQVWKDQGHO

347

%RZO RI WKH VRFDOOHG LQFLVHGVJUDI}WR UHG ZDUH ZLWK VW\OL]HG DQLPDO DQG GHFRUHOHPHQWV%\]DQWLQHWKHDUO\FHQWXU\$''LVFRORUDWLRQVRQ WKHRXWVLGHLQSODFHVDOVRRQWKHLQVLGHHGJHVHDLQFUXVWDWLRQVWLQ\IUDJPHQW of the standring missing.

347 6FKDOHPLW2UQDPHQW7RQGR%\]DQWLQLVFKIU©KHV-K Q&KUkFP+FP6RJLQFLVHGVJUDI}WRUHGZDUH6FKDOH mit Standring, konischer Wandung und senkrechtem Rand. ,QQHQPLWZHLgHU(QJREHXQGJU©QOLFKHU*ODVXU,P=HQWUXP GHU ,QQHQ~”FKH JHUDKPWHU 'HNRUWRQGR 9HUI”UEXQJHQ DXgHQ VWHOOHQZHLVHDXFKDP,QQHQUDQG0HHUHVLQNUXVWDWLRQHQNOHLQHV Fragment des Standringes fehlt. 500,– 3URYHQLHQ] ([ 6DPPOXQJ & 6 0©QFKHQ (UZRUEHQ LP 0©QFKQHU .XQVWKDQGHO

348

%RZORIWKHVRFDOOHGLQFLVHGVJUDI}WRUHGZDUHZLWKGHFRUWRQGRLQWKHFHQWHU %\]DQWLQH WK  HDUO\  FHQWXU\ $' 'LVFRORUDWLRQV RQ WKH RXWVLGH LQ SODFHVDOVRRQWKHLQVLGHHGJHVHDLQFUXVWDWLRQVWLQ\IUDJPHQWRIWKHVWDQGULQJ missing.

348 6FKDOHPLW2UQDPHQW7RQGR%\]DQWLQLVFKIU©KHV-K Q&KUkFP+FP6RJLQFLVHGVJUDI}WRUHGZDUH6FKD le mit Standring, konischer Wandung und senkrechtem Rand. ,QQHQPLWZHLgHU(QJREHXQGJU©QOLFKHU*ODVXU,P=HQWUXP GHU ,QQHQ~”FKH JHUDKPWHU 'HNRUWRQGR 9HUI”UEXQJHQ DXgHQ VWHOOHQZHLVHDXFKDP,QQHQUDQG0HHUHVLQNUXVWDWLRQHQ u 3URYHQLHQ] ([ 6DPPOXQJ & 6 0©QFKHQ (UZRUEHQ LP 0©QFKQHU .XQVWKDQGHO %RZORIWKHVRFDOOHGLQFLVHGVJUDI}WRUHGZDUHZLWKGHFRUWRQGRLQWKHFHQWHU %\]DQWLQHWKHDUO\FHQWXU\$''LVFRORUDWLRQVRQWKHRXWVLGHLQSODFHV DOVRRQWKHLQVLGHHGJHVHDLQFUXVWDWLRQV 349

172

349 6FKDOHPLW2UQDPHQW7RQGR%\]DQWLQLVFKIU©KHV-K


n. Chr. Ø 27,3cm, H 9,3cm. Sog. in FLVHGVJUDI}WR UHG ZDUH 6FKDOH PLW Standring, konischer Wandung und VHQNUHFKWHP 5DQG ,QQHQ PLW ZHL ßer Engobe und grünlicher Glasur. ,P =HQWUXP GHU ,QQHQ~”FKH HLQ VWL OLVLHUWHU 9RJHO XPJHEHQ YRQ YLHU zentrifugal angeordneten, an Florette erinnernden Motiven. Reste von Sin ter, außen Engobespuren. 500,– 3URYHQLHQ]([6DPPOXQJ&60©QFKHQ Erworben im Münchner Kunsthandel 2012  %RZORIWKHLQFLVHGVJUDI}WRUHGZDUHZLWKD stylized bird and four decor elements in the FHQWHU %\]DQWLQH WK  HDUO\  FHQWXU\ A.D. Traces of sinter and engobe outside.

350 Schale mit Ornamentdekor. Byzanti QLVFK0LWWH+”OIWH-KQ&KU k FP + FP 6RJ }QHVJUDI}WR UHG ZDUH 6FKDOH PLW 6WDQGULQJ XQG NRQLVFKHU :DQGXQJ ,QQHQ PLW ZHL ßer Engobe und Glasur. Dekorati on in Form von drei konzentrischen %”QGHUQPLWXQWHUVFKLHGOLFKVWDUNVWL lisierten Ranken und einem zentralen 0HGDLOORQPLW9ROXWHQ9HUI”UEXQJHQ DXgHQ VWHOOHQZHLVH DXFK LQQHQ DXV ]ZHLJURgHQ)UDJPHQWHQ]XVDPPHQ gesetzt. 500,– 3URYHQLHQ]([6DPPOXQJ&60©QFKHQ Erworben im Münchner Kunsthandel 2012  %RZORIWKH}QHVJUDI}WRUHGZDUHZLWKGHFR ration in form of three concentric bands with varying degrees of stylized tendrils and a cen WUDOPHGDOOLRQZLWKYROXWHV%\]DQWLQHPLG 2nd half of 12th century A.D. Discolorations on the outside, in places also inside, reattached of two large fragments.

Ikonen 351 *URgIRUPDWLJH,NRQHPLWGHP$SRVWHO 3DXOXVDXVHLQHU,NRQRVWDVHRussland, Anfang 19. Jh. H 92,8cm, B 42cm. Eitempera über Kreidegrund, Nimbus YHUJROGHW+RO]WDIHOPLW]ZHL6SRQNL 0LW ([SHUWLVH GHV ,NRQHQPXVHXPV Schloss Autenried! Kleine Fehlstellen, sonst intakt. 2.400,– Provenienz: Aus einer süddeutschen Privat sammlung. Large icon showing the Holy Apostle Paul IURP D &KXUFK ,FRQRVWDVLV 5XVVLDQ HDU ly 19th century. Tempera on wood panel, with golden halo. Little missing fragments, otherwise intact. :LWKH[SHUWLVHRIWKH,FRQ 0XVHXP$XWHQULHG

0 351

173


352 *URgIRUPDWLJH,NRQHPLWGHP+O1LNR laus von Moschaisk. 5XVVODQGVS”WHV 18. Jh. H 53,2cm, B 37,5cm. Holzta fel, Eitempera auf Kreidegrund, mit *ROGJUXQG *DQ]}JXULJH 'DUVWHO lung des Hl. Nikolaus mit einem Mo dell der Kathedrale von Moschaisk LQGHU/LQNHQXQGHLQHP6FKZHUWLQ der Rechten. Seitlich des Nimbus die Gottesmutter und Christus Pantokra tor. Am Rand ein Schutzengel und der Hl. Georg. Intakt. 1.800,– Provenienz: Aus einer süddeutschen Privat sammlung. Large icon showing St. Nicholas of Mozhayzk holding a model of the Cathedral of Mochaisk and sword between the Mother of God and Christ Pantocrator, at the sides a guardian angel and St. George. Russian, late 18th century. Tempera on wood panel, with golden JURXQG,QWDFW

352

353 3DWURQDWVLNRQH PLW DXVJHZ”KOWHQ Heiligen und Silberoklad. Russland, Anfang 19. Jh. H 16cm, B 12cm. Ei tempera über Kreidegrund auf Holz, U©FNZ”UWLJ 6DPWDEGHFNXQJ PLW 6LO beroklad, darauf unten Punzen mit der Künstlermarke „A.K.“, der Da tierung „1831“, einer Stadtmarke und GHU$QJDEHw]RORWQLNL*DQ]}JX ULJH'DUVWHOOXQJYRQHOIDXVJHZ”KOWHQ Heiligen. Intakt. 1.200,– Provenienz: Aus einer süddeutschen Privat sammlung. ,FRQVKRZLQJVDLQWV5XVVLDQHDUO\WKFHQ tury. Tempera on wood panel, backside with velvet cover, with a chased and embossed sil ver oklad, on it the marks with the signature of the master „A.K.“, the date „1831“, the symbol of the town and the declaration „84“ ]RORWQLNL,QWDFW

174

353


354 (UZHLWHUWH)HVWWDJVLNRQHPLW+RFK IHVWHQ XQG 3DVVLRQV]\NOXV Russland, 19. Jh. H 44,5cm, B 37cm. Holzta fel, Eitempera auf Kreidegrund, mit Goldgrund, Rahmung reich graviert und farbig bemalt. Im Mittelfeld das Ostergeschehen mit Höllenfahrt und Auferstehung Christi gerahmt von 28 Bildern mit Festtagsthemen und dem Passionszyklus. Intakt. 850,– 3URYHQLHQ]([6DPPOXQJ.+6%D\HUQ Large icon showing the Descent to Hell and the Anastasis, around 28 scenes with the Great )HDVWVRI2UWKRGR[\DQGWKH3DVVLRQ&\FOH Russian, 19th century. Tempera on wood SDQHOZLWKJROGHQJURXQG,QWDFW

354

355 ,NRQHPLW(UZHLWHWHU'HHVLVRussland, 19. Jh. H 53cm, B 44,5cm. Eitempe ra über Kreidegrund auf Holz, Hin tergrund vergoldet. Im Zentrum des leicht vertieften Mittelfelds thronen GHU&KULVWXV~DQNLHUWYRQGHU*RWWHV mutter und dem Hl. Johannes. Hinter dem Thron stehen die Erzengel Mi FKDHO XQG *DEULHO VRZLH OLQNV GLH Heiligen Johannes der Theologe und 3HWUXV VRZLH UHFKWV GLH +HLOLJHQ 1L NRODXV XQG 3DXOXV ,P 9RUGHUJUXQG knien die Hl. Sossima und der Hl. 6DZDWLGLH*U©QGHUGHV.ORVWHUVGD hinter der Hl. Sergius von Radonesch XQG GHU +O %DUWKRORP”XV .OHLQH Retuschen, sonst intakt. 800,– 3URYHQLHQ]([6DPPOXQJ.+6%D\HUQ ,FRQVKRZLQJWKH([WHQGHG'HHVLV5XVVLDQ 19th century. Tempera on wood panel, with golden background. Small retouchings, otherwise intact.

175 355


356 Ikone mit der Gottesmutter von Wla dimir. Russland, 19. Jh. H 31cm, B 25,5cm. Tempera über Kreidegrund auf Holz, mit Nimbus aus Metall. Im leicht vertieften Mittelfeld Dar stellung der Gottesmutter, die den Christusknaben Wange an Wange in LKUHP UHFKWHQ $UP K”OW )HKOVWHOOHQ am Kreidegrund, Malerei intakt. 650,– 3URYHQLHQ]([6DPPOXQJ.+6%D\HUQ ,FRQ VKRZLQJ WKH :ODGLPLUVND\D 0RWKHU of God. Russian, 19th century. Tempera on wood panel, with metal Nimbus. Missing fragments of ground, painting intact.

356

357 ,NRQHPLWGHP+O1LNRODXVYRQ0\UD Russland, 19. Jh. H 35,5cm, B 31cm. Eitempera über Kreidegrund auf Holz, Hintergrund vergoldet. Im ver WLHIWHQ 0LWWHOIHOG GHU E”UWLJH +HLOLJH die Rechte im Segensgestus erhoben. 0LWGHUYHUK©OOWHQ/LQNHQK”OWHUGDV RIIHQH (YDQJHOLXP 6HLQ +DXSW ~DQ kieren Medaillons mit Christus und der Gottesmutter. Am Rand die Hl. ,ULQDXQGGHU+O9DVLOLM,QWDNW 650,– 3URYHQLHQ]([6DPPOXQJ.+6%D\HUQ ,FRQVKRZLQJ6W1LFKRODVRI0\UDEHWZHHQ 6W,ULQDDQG6W9DVLOLM5XVVLDQWKFHQ tury. Tempera on wood panel, with golden EDFNJURXQG,QWDFW

176

357


358 *URgIRUPDWLJH )HVWWDJVLNRQH PLW GHU Höllenfahrt und Auferstehung Christi. Russland, 19. Jh. H 53cm, B 45cm. /DXEKRO]WDIHO PLW ]ZHL 6SRQNL (L tempera über Kreidegrund auf Holz, Hintergrund vergoldet. Im Mittelfeld das Ostergeschehen mit der Höllen fahrt und Auferstehung Christi ge rahmt von 16 Festtagsthemen. Kleine Retuschen, sonst intakt. 650,– 3URYHQLHQ]([6DPPOXQJ.+6%D\HUQ Large icon with the Descent to Hell and the Anastasis surrounded by the 16 Great Feasts RI2UWKRGR[\5XVVLDQWKFHQWXU\7HPSHUD on wood panel, with golden backgroud. Small retouchings, otherwise intact.

358

359 Ikone mit der Geburt der Gottesmutter. Russland, 19. Jh. H 31,5cm, B 27cm. Eitempera über Kreidegrund auf Holz, mit versilbertem Metalloklad. Restauriert. 650,– 3URYHQLHQ]([6DPPOXQJ.+6%D\HUQ ,FRQVKRZLQJWKH%LUWKRIWKH9LUJLQZLWKVLOYHU plated metal oklad. Russian, 19th century. Restored.

359

177


360 Ikone mit der Gottesmutter von Kasan. Russland, Mitte des 19. Jh. H 31cm, B 27cm. Eitempera über Kreidegrund auf Holz, Hintergrund vergoldet. Die Gottesmutter mit dem Christuskna ben, der die Rechte im Segensgestus erhoben hat. Intakt. 600,– 3URYHQLHQ]([6DPPOXQJ.+6%D\HUQ 2UWKRGR[ LFRQ VKRZLQJ WKH .D]DQVND\D Mother of God. Russian, mid 19th century. Tempera on wood panel, partially gold plated. ,QWDFW

360

361 ,NRQHPLWGHP+O1LNRODXVYRQ0\UD Russland, 19. Jh. H 32,5cm, B 29cm. Eitempera über Kreidegrund auf +RO],PYHUWLHIWHQ0LWWHOIHOGGHUE”U tige Heilige, die Rechte im Segens gestus erhoben. Mit der verhüllten /LQNHQ K”OW HU GDV (YDQJHOLXP 6HLQ +DXSW ~DQNLHUHQ &KULVWXV XQG GLH Gottesmutter. Intakt. 500,– 3URYHQLHQ]([6DPPOXQJ.+6%D\HUQ ,FRQVKRZLQJ6W1LFKRODVRI0\UD5XVVLDQ WKFHQWXU\7HPSHUDRQZRRGSDQHO,QWDFW

178361


AFRIKA UND OZEANIEN

362

362 *URgHU7HUUDNRWWDNRSI1RN1LJHULDYQ&KU+FD FP5¤WOLFKJHVFKO”PPWH7HUUDNRWWD0LWGXUFKERKUWHQ$X JHQ XQG 1DVHQO¤FKHUQ RIIHQHP 0XQG XQG NXQVWYROOHU )UL sur, geschmückt mit kreisförmigen Medaillons, die in die Stirne K”QJHQ0LW7/$QDO\VHYRQ Teile des Halsansatzes abge brochen, ebenso Teile der Frisur, kleine Restaurierungen. 4.500,–

Provenienz: Aus der Sammlung des Museum der Völker, Schwaz, Österreich, YRQ*HUW&KHVL,Q'HXWVFKODQGVHLW Nok, Nigeria, large terracotta head with pierced eyes and nostrils, open mouth and elaborate coiffure, decorated with circular medaillons, hanging down on forehead; breakages on indicated neck and on coiffure, small restauration. :LWK7/$QDO\VLVRI

179


363

363 1RN.RSI1LJHULDYQ&KU/FP5¤WOLFKEUDX ne Terrakotta, vermutlich von einer Figur. Mit großen, durch ERKUWHQ$XJHQRIIHQHP0XQGXQGGXUFKERKUWHU1DVHVRZLH kunstvoller Frisur in mehreren, kugelförmigen Schöpfen. Mit 7/$QDO\VHGHV/DERUV.RWDOODYRQ .RSLH 'HU.RSIZDU RIIHQEDUDQPHKUHUHQ6WHOOHQJHEURFKHQZXUGHMHGRFKIDFKJH recht mit den Originalteilen geklebt. 3.000,– 3URYHQLHQ]([6DPPOXQJ$5:%HUOLQ(UZRUEHQEHL*DOHULH+RIIPDQQ 6WXWWJDUW,Q'HXWVFKODQGVHLWYRU 1RN1LJHULD%&$'WHUUDFRWWDKHDGSUREDEO\IURPD}JXUHZLWK open mouth, large pierced eyes and pierced ears, and with elaborate coiffure DUUDQJHG LQ YDULRXV EDOOVKDSHG OREHV WKH KHDG REYLRXVO\ ZDV EURNHQ RQ YDULRXVSODFHVEXWVFLHQWL}FDOO\JOXHGZLWKRULJLQDOSDUWV:LWK7/$QDO\VLV RIWKH/DERUDWRU\.RWDOODIURP &RS\ 

364 *URgHU.RSI1RN1LJHULDYQ&KU+FP5¤W OLFKEUDXQ JHVFKO”PPWH 7HUUDNRWWD .RSI HLQHU JURgHQ )LJXU mit großen, durchbohrten Augen, geschlossenem Mund und GXUFKERKUWHU 1DVH VRZLH EDOORQDUWLJHU 0©W]H RGHU )ULVXU "  mit abgebrochenen Hörnern oder Schöpfen. 0LW7/$QDO\VHGHV /DERUV.RWDOODYRQ Hinterer Teil des Kopfes abgebrochen, kleines Loch in der Kopfbedeckung. 1.400,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ8+,Q'HXWVFKODQGVHLWYRU 1999. 1RN1LJHULD%&$'WHUUDFRWWDKHDGSUREDEO\IURPDODUJH}JXUH ZLWKFORVHGPRXWKODUJHSLHUFHGH\HVDQGQRVHDQGZLWKEDOORRQVKDSHGFDS or coiffure (?) including two missing horns or lobes; small hole in cap. With 7/$QDO\VLVRIWKH/DERUDWRU\.RWDOODIURP

180

364

365 1RN)LJXUHQIUDJPHQW 1LJHULD  Y   Q &KU + FP 5¤WOLFKEUDXQJHVFKO”PPWH7HUUDNRWWD6LW]HQGHDV\PPHWULVFK NRQ]LSLHUWH)LJXULQGHU0LWWHXQWHUGHP1DEHOLQ]ZHL7HLOH zerbrochen, das rechte Bein angezogen und mit einer Maskaro ne auf dem Unterschenkel modelliert, das linke nach hinten ge zogen und auf der Ferse sitzend. 0LW7/$QDO\VHRechter Arm DEJHEURFKHQGHUE”UWLJH.RSIHEHQIDOOVJHEURFKHQXQGUHVWDX ULHUW )ULVXU WHLOZHLVH DEJHEURFKHQ DQ YHUVFKLHGHQHQ 6WHOOHQ restauriert. 4.000,– 3URYHQLHQ]([6DPPOXQJ::%HUOLQHUZRUEHQEHL.XQVWKDQGHO5©WWHQ $PVWHUGDP,Q'HXWVFKODQGVHLW 1RN1LJHULD%&$'WHUUDFRWWDVHDWHG}JXUHZLWKUHGGLVKEURZQ slip of asymmetric design, broken in two parts beneath the navel, the right knee bent and decorated with a mascarone, the left turned back under the body; right arm missing,the bearded head broken off and restored; restorations on various places. :LWK7/$QDO\VLV

366 2EHUWHLOHLQHUJURgHQ)LJXU1RN1LJHULDYQ&KU +FP5¤WOLFKEUDXQJHVFKO”PPWH7HUUDNRWWD2EHUWHLOHLQHU E”UWLJHQ)LJXUPLWJHEHXJWHPOLQNHQ$UPJURgHQGXUFKERKU ten Augen, offenem Mund und durchbohrter Nase (nur linkes Ohr durchbohrt); mit großem Halsschmuck und Schulterband; Frisur in großen und kleinen Schöpfen. 0LW7/$QDO\VHGHV/D bors Kotalla von 1999! Rechter Arm abgebrochen, Oberteil des Kopfes und Frisur restauriert. 4.000,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ8+,Q'HXWVFKODQGVHLWYRU 1999. 1RN1LJHULD%&$'WHUUDFRWWDXSSHUSDUWIURPDODUJH}JXUHRI a bearded man, with bent left arm, open mouth, large pierced eyes and nose


365 366

(only left ear pierced), and with large necklace and shoulder band; hairdo in various large and small lobes; restorations on upper part of head and coiffure, right arm missing. :LWK7/$QDO\VLVRIWKH/DERUDWRU\.RWDOODIURP

367 :HLEOLFKH)LJXU1RN1LJHULDYQ&KU+FP7HU UDNRWWDU¤WOLFKEUDXQJHVFKO”PPW$XIHLQHPOHLFKWJHNU©PP WHQ =\OLQGHU VWHKHQGH ZHLEOLFKH )LJXU PLW JHEHXJWHQ $UPHQ PLWJURgHP+DOVXQG.¤USHUVFKPXFNDXV]DKOUHLFKHQ.HWWHQ *©UWHO XQG DXIZ”QGLJHP +©IWVFKXU] VRZLH KDXEHQ”KQOLFKHU Frisur. 0LW 7/$QDO\VH YRQ  Komplett mit Restaurierun gen. 3.500,– 3URYHQLHQ]([6DPPOXQJ3*7K©ULQJHQ'DYRU)DPLOLHQEHVLW]VHLWGHQ 1970ern oder früher. 1RN1LJHULDWHUUDFRWWDIHPDOH}JXUHVWDQGLQJRQDVOLJKWO\EHQWF\OLQGULFDO base with bent arms, elaborate pubic apron, wearing a huge necklace of QXPHURXVVWULQJVRIEHDGVDQGVSRUWLQJDFDSVKDSHGFRLIIXUH5HVWRUHGEXW complete. :LWK7/DQDO\VLVIURP

367

181


368

368 .QLHQGH)LJXUDXV7HUUDNRWWD'MHQQ˜1LJHU%LQQHQGHOWD0DOL    -K Q &KU + FP .QLHQGH ZHLEOLFKH )LJXU DXV U¤WOLFKHUZHLgOLFKEHLJHJHVFKO”PPWHU7HUUDNRWWDEHNOHLGHWPLW einem Lendenschurz. Am Rücken drei Schlangen, von denen ]ZHLELV©EHUGLH6FKXOWHUQJHOHJWVLQGXPGLH$XJHQSXQNWI¤U mige Eindrücke; prominent gestalteter Nabel. 0LW7/7HVWGHU 8QLYHUVLW”W2[IRUGYRQXQG.RSLHGHU3XEOLNDWLRQ Intakt. 2.000,– 3URYHQLHQ]([6DPPOXQJ+DQV:ROI=©ULFKH[*DOHULH:DOX=©ULFKH[ *DOHULH(WKQRJUDSKLFD3IDGHQKDXHU0©QFKHQH[6DPPOXQJ);0RVHU 'MHQQ˜1LJHULQODQGGHOWD0DOL&HQWXU\$'.QHHOLQJIHPDOH }JXUHRIUHGGLVKFOD\ZLWKJUH\ZKLWLVKVOLSZHDULQJDORLQFORWK7KUHHVQDNHV crawling on her back of which two placed over the shoulders; around the eyes GRWWHGLPSUHVVLRQVSURPLQHQWO\PRGHOOHGQDYHO,QWDFW7/$QDO\VLVRI 2[IRUG8QLYHUVLW\ DQGFRS\RIWKHSXEOLFDWLRQ

369 *URgH $XIVDW]PDVNH Yoruba, Nigeria. H 107cm. Holz. Große Aufsatzmaske „epa“ in Gestalt eines abstrakt gestalteten Janus NRSIHVPLWGDU©EHUDXIHLQHP+RFNHUVLW]HQGHU0XWWHU}JXUPLW kammartiger Frisur, das Kind auf dem Rücken tragend. Rote *ODVSHUOHQNHWWHQXPGHQ+DOVZHLWHUH.RNRVQXVVVFKHLEHQXQG *ODVSHUOHQNHWWHQXPGHQ.¤SHU9HUVFKLHGHQH)DUEUHVWH9HU VFKLHGHQH DOWHUVEHGLQJWH 5LVVH XQG %HVFK”GLJXQJHQ JU¤gHUHV /RFKLQGHU6FK”GHOGHFNHGHU0DVNHUHFKWHU$UPGHV.LQGHV gebrochen. 8.500,– 3URYHQLHQ]([6©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  3XEOL]LHUWLQ.DWDORJGHU*DOHULH6FKZDU]:HLgFD1U 0¤JOLFKHUZHLVHHLQH$UEHLWGHV%DPJER\HRI2GR$ZD(NLWL  

182

1HEHQPDVVLYHQ6NXOSWXUHQXQGNRPSOH[HQ.RPSRVLWLRQHQZDUGLHVHUEH rühmte Schnitzer vor allem für seine monumentalen Aufsatzmasken bekannt, GLHHURUDQJXQwQDQQWHXQGGLHGXUFK]HQWUDOH5HLWHU}JXUHQXPJHEHQYRQ Adoranten und anderen Figuren gekennzeichnet waren, aber offenbar auch DQGHUH6NXOSWXUHQZLHGLHVH0XWWHU}JXU,QVHLQHQ2ULNLV 3UHLVOLHGHUQ ZLUG er als „Einer, der große Schnitzereien schuf“ bezeichnet. <RUXED}QHHSDwPDVN1LJHULD3DLQWHGSRO\FKURPHZLWKW\SLFDOO\DEVWUDFW FRQFHLYHGMDQLIRUPORZHUSDUWRIWKHPDVNVXUPRXQWHGE\DPDWHUQLW\}JXUH carrying her child on her back; strings of red glass beads around her neck, strings of glass beads and coconut discs around body; some cracks and da mages through long wear and tear; large hole in the crane of the mask, right arm of children broken. Published!

370 Aufsatzmaske. Idoma oder Ibo, Nigeria. H 92cm. Holz. Große $XIVDW]PDVNHVFKZDU]ZHLgXQGU¤WOLFKEHPDOWPLWHLQHPMD QXVI¤UPLJHQ.RSIPLW7URSHQKHOP (XURS”HU" HLQHPGDUXQ WHUVLW]HQGHQ.RSIXQG]ZHLVHLWOLFKHQ)O¤WHEODVHQGHQ)LJXUHQ der untere Teil mit zahlreichen Brüsten und anderen Emblemen beschnitzt; um den Hals Ketten aus Kokosnussscheiben und HLQH HLVHUQH .HWWH PLW HLVHUQHQ 2EMHNWHQ ZHLWHUH .HWWHQ VLQG GHU0DVNHXPJHK”QJW%DVLVGXUFK,QVHNWHQIUDgHWZDVEHVFK” digt. 5.500,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  ,GRPDRU,ER1LJHULDKXJHKHDGFUHVWSDLQWHGEODFNZKLWHDQGUHGGLVKDQG FDUYHGZLWKDWRZHULQJMDQXVIDFHGKHDGZLWKWURSLFDOKHOPHWDERYHDZKLWH DQGEODFNSDLQWHGKHDGDQGWZRVWDQGLQJ}JXUHVRQWKHVLGHVEORZLQJWKH ~XWH2QORZHUVLGHDQGRQUHDUDURZRIEUHDVWOLNHVFXOSWXUHVDQGRWKHU emblems. Some insect bite on base; two strings of coconut discs and an iron chaine with various objects around the neck, other strings of beads and discs ornate the dance crest itself.


369

370

369

370

183


371

372

373

184


374

371 Gesichtsmaske ‚cihongo‘. &KRNZH$QJROD+FP+RO]%UDXQ JHI”UEW $XJHQ XQG /LSSHQ VFKZDU] PLW KRUL]RQWDO NRQ]LSLHU tem, brettartigen Bart, großen Augen und breitem, offenem, die =”KQH]HLJHQGHQ0XQG1DUEHQWDWDXLHUXQJHQXQWHUGHQ$XJHQ XQGDXIGHU6WLUQ<DOHUHJLVWUDWLRQQXPEHU$E rieb durch langen Gebrauch, intakt. 4.000,– 3URYHQLHQ]YRQHLQHPDPHULNDQLVFKHQ+”QGOHUHUZRUEHQDQJHEOLFK aus alter amerikanischer Sammlung. Chokwe, Angola, face mask cihongo, dyed reddish, eyes and lips black, and FDUYHG ZLWK D KRUL]RQWDOO\ FRQFHLYHG ERDUGVKDSHG EHDUG ODUJH H\HV DQG EURDGRSHQPRXWKVKRZLQJWKHWHHWKVNLQVFDUL}FDWLRQPDUNVXQGHUWKHH\HV and on forehead; some abrations through long wear and tear.

372 Gesichtsmaske aus Holz. ,JDOD 1LJHULD / FP $XV VFKZDU] JHI”UEWHP+RO]PLWJURgHQPDQGHOI¤UPLJHQ$XJHQVFKPDOHU JHUDGHU1DVHXQGNOHLQHPGLH=”KQH]HLJHQGHQ0XQGDXIGHU 6WLUQH HLQH 9I¤UPLJH 1DUEHQWDWDXLHUXQJ $P +DOV ,QVHNWHQ fraß. 1.800,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ ([ *DOHULH 9LVVHU %U©VVHO H[ .DUO)HUGLQDQG 6FKDHGOHU H[ 1HXPHLVWHU München. ,JDOD1LJHULDIDFHPDVNZLWKODUJHDOPRQGVKDSHGH\HVVWUDLJKWQRVHDQG VPDOO PRXWK VKRZLQJ WKH WHHWKV RQ IRUHKHDG 9VKDSHG VNLQ VFDUL}FDWLRQ mark.

373 0”QQOLFKH+HOPPDVNHI©UGHQ0$3,.27DQ]GHU)UDXHQMa NRQGH 0RVDPELN  7DQVDQLD + FP $XV VFKZDU]EUDXQ JHVFKO”PPWHU7HUUDNRWWDPLW5HVWHQHFKWHU+DDUHDXI$XJHQ EUDXHQXQG.LQQEDUWRIIHQHPGLH=”KQH]HLJHQGHQ0XQG HL QLJH DXVJHEURFKHQ  XQG ZLQNHOI¤UPLJHQ 1DUEHQWDWDXLHUXQJHQ (LQLJH=”KQHIHKOHQ u

375

3URYHQLHQ]$XVGHU6DPPOXQJ0DUHLGLXQG*HUW6WROO0©QFKHQ ,QY  (LQHIDVWLGHQWLVFKH0DVNHLVWEHL*%OHVVH$UWIURP(DVW$IULFD.XQVWDXV Ostafrika (2004) S. 30 abgebildet. 0DNRQGH 0R]DPELTXH7DQVDQLD PDOH WHUUDFRWWD KHOPHW PDVN IRU WKH ZRPHQyV 0$3,.2 GDQFH ZLWK EODFNLVKEURZQ VOLS FKHYURQVKDSHG VNLQ VFDUL}FDWLRQPDUNVXQGUHOLFVRIKXPDQKDLURQH\HEURZVDQGFKLQ

374 Gesichtsmaske ‚kifwebe‘. Songe, D. R. Kongo. H 41cm. Holz. In NODVVLVFKHU$XVI©KUXQJVFKZDU]ZHLgXQGU¤WOLFKEHPDOWJUR ße hervortretende Augen mit schmalen Sehschlitzen und Ein kerbungen am unteren Lid. Rechteckig vorstehender Mund mit VWHUQI¤UPLJHU9HUWLHIXQJ1DVHLQ6WLUQZXOVWELV]XP0DVNHQ rand übergehend. Intakt. 2.500,– 3URYHQLHQ]([1HXPHLVWHU0©QFKHQ$XNWLRQ/RVH[ Sammlung Dieter Fichtner, München. 6RQJHNLIZHEHPDVNZLWKFODVVLFH[SUHVVLRQSDLQWHGEODFNZKLWHDQGUHGGLVK with large protruding eyes with narrow slits and indentations on lower lid, and ZLWKIRUHKHDGULGJHHQGLQJLQSURWUXGLQJHGJ\QRVH,QWDFW

375 *URgH 0DVNH LP .DOHEZH6WLO Songe, D. R. Kongo. L 53cm. +RO]VFKZDU]XQGZHLgWHLOZHLVHZLQNHOI¤UPLJEHPDOWPLWJUR ßem, scheibenförmigen Kopfputz, vorspringendem viereckigen Mund und schmalen Schlitzaugen (Inv. 24). Starke Gebrauchs spuren. 800,– 3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU 6RQJH'5RI&RQJRODUJHPDVNLQ.HOHEZHVW\OHFKHYURQOLNHSDLQWHGEODFN DQGZKLWHZLWKKXJHGLVFVKDSHGKHDGJHDUSURWUXGLQJUHFWDQJXODUPRXWK and large slit eyes. Traces of usage.

185


376

376 Schalenträgerin. Luba, D. R. Kongo. H 39cm. Holz. Sitzende 6FKDOHQWU”JHULQ €PHWRNRy HLQH UXQGH 6FKDOH YRU VLFK DXI GHQ %HLQHQKDOWHQGNXQVWYROOHW\SLVFKH.UHX]IULVXUU©FNZ”UWVPLW NOHLQHQZLQNHOI¤UPLJDQJHRUGQHWHQ=RSIUHLKHQ©EHUGHP.RSI von Ohr zu Ohr verlaufend; am Rücken vier rautenförmige Narbentatauierungen, um den oberen Teil des Topfes einge VFKQLWWHQHULQJI¤UPLJH2UQDPHQWHXQGZHLgOLFKH%HRSIHUXQJV VSXUHQ +LUVHEUHL"  ,QY 6FKZDU]EUDXQHWHLOZHLVHNUXVWLJH Patina mit Spuren von Insektenfraß am Unterteil der Beine. 10.000,– 186

3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU /XED'5RI&RQJRVHDWHGIHPDOHERZOKROGHU}JXUHPHWRNRZLWKWKHERZO holding in front of her on the legs, with typical cross coiffure on rear, small, FKHYURQVKDSHGDUUDQJHGSLJWDLOVSODFHGRYHUWKHKHDGIURPHDUWRHDUIRXU OR]HQJHVNLQVFDUL}FDWLRQPDUNVRQWKHEDFNDQGZLWKULQJVKDSHGFDUYHG ornaments around the upper part oft he bowl showing relics of whitish offering WUDFHVEODFNLVKEURZQFUXVW\SDWLQDZLWKWUDFHVRIPLQRULQVHFWELWHRQUHDU of feet.


377

377 )LJXU 0DPELOD 1LJHULD  .DPHUXQ + FP +RO] 6WHKHQ GHP”QQOLFKH)LJXUPLWJHEHXJWHQ$UPHQLQGHQ+”QGHQRI IHQEDU NOHLQH 2EMHNWH KDOWHQG JUDXH WHLOZHLVH NUXVWLJH 3DWLQD Minimale Risse, größerer Riss am Hinterkopf. 6.000,– 3URYHQLHQ],Q%U©VVHOHUZRUEHQ 0DPELOD 1LJHULD  &DPHURRQ VWDQGLQJ PDOH }JXUH ZLWK UDLVHG DUPV obviously keeping small objects in his hands; greyish, on places crusty patina; minimal crack, larger crack on rear of head.

378

378 =DXEHU}JXU 'RUI)HWLVFKw  Songe, D. R. Kongo. H 61,5 E]ZFPPLW+RUQ+RO]3DQJROLQ+DXW6FKLOGNU¤WHQSDQ]HU 6FKPXFNXQG*HOGNHWWHQ.XSIHUEOHFK7LHUKRUQ$XIUXQGHP 6RFNHOVWHKHQGGLH+”QGHDQGHQ/HLEKDOWHQGPLWJURgHQUXQ den Augen, Sehschlitzen und Messingknöpfen; Nase, Kinn und 6WLUQWHLOZHLVHPLW.XSIHUEOHFKEHGHFNWZHLWJH¤IIQHWHUJURgHU Mund, runde Öffnung im Leib für magische Ingredienzen (Inv. 25). Intakt, Gebrauchsspuren. 4.200,– 3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU 6RQJH'5RI&RQJRSRZHU}JXUH YLOODJHIHWLVKw VWDQGLQJRQURXQGEDVH with hands placed on the abdomen and with animal horn on top of the head falling back behind of the neck; forehead, chin and nose partly covered with copper sheet, large round eyes with slits and brass buttons, strings of plastic discs, glass beads and with open mouth, and round cavity on abdomen to hold magic material; traces of wear and tear.

187


379 381 0

379 )LJXUFante, Ghana. H 46cm. Holz. Auf einem kleinen, separat JHVFKQLW]WHQ .ODQ+RFNHU VLW]HQGH 0XWWHU}JXU GDV .LQG I©W WHUQG DXI GHP 6FKRg KDOWHQG Z”KUHQG GDV %DE\ GLH DQGHUH %UXVWGHU0XWWHUHUJUHLIWGLH0XWWHUWU”JW6DQGDOHQ1DUEHQWD WDXLHUXQJHQDQGHQ6FKO”IHQXQGGLHW\SLVFKH)DQWH)ULVXUPLW YLHUVHLWOLFKHQXQG]ZHLU©FNZ”UWLJHQ6FK¤SIHQ2 Stück! Hok NHUPLWVFKZDU]EUDXQHU2SIHUSDWLQD0XWWHU}JXUPLWVHLWOLFKHP 5LVVVRZLH$XVEUXFKXQG,QVHNWHQIUDgVWHOOHQDQGHQ)©gHQ 3.500,– 3URYHQLHQ]([&ROOHFWLRQ0UV(KUHQVSHUJHU ,QHLQHP%ULHIGDWLHUWYRP$XJXVWEHVW”WLJW0UV(KUHQVSHUJHUGDVV ihr Mann seine Sammlung afrikanischer Kunst (ca. 80 Stücke) in den Jahren ELVDXIJHEDXWKDW'LHPHLVWHQ2EMHNWHZXUGHQEHL%UHWVFKQHLGHU Gert Stoll, beide München und Karl Krieg, Gelsenkirchen, erworben. )DQWH*KDQDRQDFODQVWRROVHDWHGPDWHUQLW\}JXUHFUDGOLQJWKHFKLOGRQ her lap and nourishing it while the baby is grasping the other of its mothers EUHDVWVWKHPRWKHUZHDUVVDQGDOVDQGVFDUL}FDWLRQPDUNVRQKHUWHPSOHV and sports the typical Fante hairdo with four lobes on the sides and two on rear; crack on left side of mother, and some breakages and insect bite on her IHHWWUDFHVRIVDFUL}FLDORIIHULQJVRQWKHVWRRO2 pieces!

380 Kopfskulptur aus Holz. Lobi, Burkina Faso. H 32cm. Aus hell braunem Holz mit geschlossenen, bohnenförmigen Augen und vorspringendem Mund; Spuren von Beopferung. Am Hals Insektenfraß. 1.500,– 380

188

3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ


382

/REL%XUNLQD)DVRVFXOSWXUHRIDKHDGRIOLJKWFRORXUHGZRRGZLWKEHDQ shaped, closed eyes and protruding mouth; traces of offerings.

381 0”QQOLFKH =ZLOOLQJV}JXU €LEGHMLy Yoruba, Nigeria. H 25,5cm. 0LWDXIJHW©UPWHU)ULVXU%UDXQHPDWWJO”Q]HQGH3DWLQDLQWDNW 1.500,– 3URYHQLHQ]([6DPPOXQJ0DUHLGLXQG*HUW6WROO0©QFKHQ ,QY  <RUXED1LJHULDPDOHWZLQ}JXUH€LEHGMLyZLWKWRZHULQJFRLIIXUH,QWDFW

382 :HLEOLFKH =ZLOOLQJV}JXU €LEGHMLy Yoruba, Nigeria. H 26cm. Mit an den Oberschenkeln angelegten Armen und Resten von Rotholzmehl, vermutlich aus Ibadan. Riss im Oberkörper. 1.500,– 3URYHQLHQ]([6DPPOXQJ0DUHLGLXQG*HUW6WROO0©QFKHQ ,QY  <RUXED1LJHULDIHPDOHWZLQ}JXUH€LEHGMLyZLWKDUPVRQWKHWKLJKVDQGUHPDLQV RIFDPZRRGSRZGHUSUREDEO\IURP,EDGDQ&UDFNRQIURQW

383

384

383 :HLEOLFKH=ZLOOLQJV}JXU€LEHMLyYoruba, Nigeria. L 28cm. Holz. Aus Igbomina mit Schmuckketten aus Muschelscheiben und Glasperlen um Leib und Hals, einem Metallring um den lin NHQ$UPEODXJHI”UEWHUKRKHUVSLW]]XODXIHQGHU)ULVXUDXVYLHU JURgHQ =RSI$UUDQJHPHQWV XQG OLQLHQI¤UPLJHU 1DUEHQWDWDXLH UXQJDXIGHU6WLUQ'XQNHOURWEUDXQHJO”Q]HQGH3DWLQDDQ.RSI und Nacken, der Körper fast völlig bedeckt mit Rotholzmehl. Intakt. 1.500,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ <RUXED1LJHULDIHPDOHWZLQ}JXUHLEHGMLIURP,JERPLQDZHDULQJVWULQJVRI shell discs and glass beads around neck and waist, a metal ring around left DUPZLWKOLQLHDUVNLQVFDUL}FDWLRQPDUNVRQIRUHKHDGDQGVSRUWLQJDEOXH dyed towering coiffure made of four large plaits with tapering arrangement; reddish dark brown glossy patina on head and neck, camwood powder co YHULQJODUJHSDUWVRIWKH}JXUH,QWDFW

384 :HLEOLFKH=ZLOOLQJV}JXU€LEGHMLyYoruba, Nigeria. H 26cm. Mit XUVSU©QJOLFKEODXJHI”UEWHU.URQHQIULVXU,QWDNW u 3URYHQLHQ]([6DPPOXQJ0DUHLGLXQG*HUW6WROO0©QFKHQ ,QY  <RUXED1LJHULDIHPDOHWZLQ}JXUH€LEHGMLyZLWKRULJLQDOO\EOXHG\HGFURZQ VKDSHGFRLIIXUH,QWDFW

189


385

386 387

190


385 9LHU=ZLOOLQJV}JXUHQ<RUXED1LJHULD+FP+RO]9LHU =ZLOOLQJV}JXUHQLEGHMLGDYRQHLQ3DDUDXV,MHEX2GHGLH$UPH in die Hüften gestemmt, mit Narbentatauierungen auf den Wan JHQ XQG EODX JHI”UEWHU .DPP+DDUWUDFKW XQG SURPLQHQW JH VWDOWHWHP NRQLVFK ]XODXIHQGHP 1DEHO ]ZHL ZHLWHUH HLQ]HOQH ZHLEOLFKH =ZLOOLQJV}JXUHQ HLQH PLW VSLW]HQ %U©VWHQ VFKZDU] EODX JHI”UEWHU .DPPIULVXU XQG GUHLHFNLJHP LVODPLVFKHQ Amulett ‚tirah‘ um den Hals, die andere mit zahlreichen Narben WDWDXLHUXQJHQXQGEODXJHI”UEWHU)ULVXULQPHKUHUHQ6FK¤SIHQ4 Stück! Kleine Fehlstellen durch langen Gebrauch. 850,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  <RUXED1LJHULDIRXUWZLQ}JXUHVLEHGMLWKHURIRQHSDLUPDOHDQGIHPDOHZLWK FUHVWHGEOXHG\HGKDLUGRHVZLWKDUPVDNLPERVNLQVFDUL}FDWLRQPDUNVRQWKH cheeks and prominently carved conically conceived navel; two other female }JXUHVRQHZLWKFRQLFDOEUHDVWVFUHVWHGEOXHG\HGFRLIIXUHDQGWKHLVODPLF triangular tirah amulet, the other with small breasts, numerous skin scari }FDWLRQPDUNVDQGFRLIIXUHLQYDULRXVOREHVVPDOOEUHDNDJHVDQGDEUDWLRQV due to long wear and tear. 4 pieces!

386 =ZLOOLQJV}JXU <RUXED 1LJHULD + FP +RO] 0”QQOLFKH =ZLOOLQJV}JXU LEHGMLw EHNOHLGHW PLW HLQHU NXU]HQ +RVH WU”JW HLQHNXQVWYROOH.DPPIULVXUVFKZDU]EODXJHI”UEWXQGXP+DOV Leib und linken Arm eine Reihe von Schmuckketten aus bunten Glasperlen; Narbentatauierungen auf den Wangen; dunkelbrau ne Patina. Intakt. 650,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  <RUXEDPDOHWZLQ}JXUHLEHGMLwZHDULQJDSDLURIVKRUWVZLWKHODERUDWH FUHVWHGFRLIIXUHG\HGEODFNLVKEOXHDURXQGZDLVWQHFNDQGERG\DQXPEHU RIVWULQJVRIFRORXUHGJODVVEHDGVDQGZLWKVNLQVFDUL}FDWLRQPDUNVRQWKH cheeks; brown patina, intact.

387 =ZHL+RO]}JXUHQYaka, D. R. Kongo und Baule, Elfenbeinkü VWH+MHZHLOVFPD  6WHKHQGH=DXEHU}JXUGHU<DNDPLW W\SLVFKHU ZDO]HQI¤UPLJHU )ULVXU XQG JURgHQ $XJHQ XP GHQ 2EHUN¤USHU GUHL PLW 6WRII XPZLFNHOWH 3DNHWH PLW PDJLVFKHP Material; braune Patina. b) Stehende Figur der Baule mit rauten förmigem Gesicht und kammartiger Frisur aus parallel geordne WHQ=RSIUHLKHQWHLOZHLVHGLFNHNUXVWLJH2SIHUSDWLQD ,QYXQG 32cm) 2 Stück!.OHLQHU5LVVYRUQHEHLGHU<DND)LJXUJU¤gHUH 5LVVHYRUQHXQGVHLWZ”UWVEHLGHU%DXOH)LJXU u 3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU <DND'5RI&RQJRVWDQGLQJ}JXUHZLWKW\SLFDOUROOVKDSHGKHDGJHDUODUJH H\HVDQGZHDULQJWKUHHSDFNDJHVRIIDEULFZRXQGPDJLFPDWHULDODURXQG LWVVKRXOGHUVLQFOXGHGLQWKHORWLVD%DXOH,YRU\&RDVWVWDQGLQJ}JXUHZLWK OR]HQJHVKDSHGIDFHDQGFUHVWHGFRLIIXUHRISDUDOOHODUUDQJHGURZVRISODLWV WKLFNRQSODFHVFUXVW\VDFUL}FLDOSDWLQD2 pieces!

388

388 Kopf eines Häuptlings. Königreich Benin. H 50cm. Aus Holz, beschnitzt mit der typischen Feder, den Korallenketten und den quadratischen Intarsien aus Eisen (fehlen) auf der Stirn. Durch ,QVHNWHQIUDgEHVFK”GLJW u 3URYHQLHQ] ([ 6DPPOXQJ +DUDOG 6WHLQEDFK /DXI DQ GHU 3HJQLW] H[ 6DPPOXQJ 'U +HOJD 5HGOLFK *HOVHQNLUFKHQ H[ 8WD YRQ .DUGRII H[ Neumeister, München Auktion 52, 14.1.2012, Los 1030. 1DFKQHXHVWHU)RUVFKXQJGDWLHUHQGLHIU©KHVWHQ.¤SIHDXV%HQLQHWZDDXV GHP$QIDQJGHV-DKUKXQGHUWVXQGZDUHQYHUPXWOLFKVRZRKO7URSK”HQ N¤SIHDOVDXFK6DNUDOREMHNWH(VZDU©EOLFKGLH.¤SIHEHVLHJWHU+”XSWOLQJH DE]XVFKODJHQVLHGHP2ED]X©EHUJHEHQGHUVHLQHUVHLWVGLH%URQ]HJLHgHU EHDXIWUDJWHVLHLQ%URQ]H]XJLHgHQ6LHZXUGHQGDQQDXIGLH$KQHQDOW”UH JHVWHOOW$XgHUGHPGXUIWHQ%HQLQ+”XSWOLQJHVROFKH.¤SIHDXV+RO]KHUVWHOOHQ ODVVHQ Z”KUHQG .¤SIH DXV 7HUUDNRWWD GHQ 0LWJOLHGHUQ GHU %URQ]HJLHgHU =XQIWYRUEHKDOWHQZDUHQXPVRDXFKGLHVDNUDOHXQGWHFKQLVFKH%HVRQGHU heit von Terrakotta in ihrer Arbeit zu betonen. Siehe Philip J. C. Dark, An ,OOXVWUDWHG&DWDORJXHRI%HQLQ$UW  1U,OO %HQLQ.LQJGRPRI%HQLQZRRGHQKHDGRIDFKLHIWDLQFDUYHGZLWKWKHW\SLFDO feather, coral necklaces and the rectangular iron inlays on forehead (missing). Damages by insect bite.

191


389

389 Deckelschale. Afo, Nigeria. L 37cm. Holz. Deckelschale aus VFKZDU]JHI”UEWHP+RO]LQ*HVWDOWHLQHVJHK¤UQWHQ9LHUEHLQHUV mit einem auf dem Deckel stehenden Krokodil als Griff. Yale, *95$UFKLYHVUHJLVWUDWLRQQXPEHU,QWDNWNOHLQH Abriebstellen. 3.500,– 3URYHQLHQ](UZRUEHQYRQHLQHPEHOJLVFKHQ+”QGOHU Afo, Nigeria, lidded bowl, dyed black, in the shape of a horned quadruped, the handle conceived as a standing crocodile; some abrations, wear and tear.

390

192

390 Seltene Deckelschale. <RUXED 1LJHULD k FP +RO] ,ID Deckelschale, vermutlich für die Mitglieder des Geheimbundes Ogboni, auf dem Deckel geschnitzt mit Figuren und Reitern; DP5DQG=LFN]DFN0XVWHUEUDXQH3DWLQDSehr selten! Durch langen Gebrauch Ausbrüche und Risse an der Unterschale; Abrieb, vor allem an den Frisuren der Figuren. 1.800,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  5DUH,ID<RUXEDOLGGHGFLUFXODUERZOSUREDEO\IRUWKHPHPEHUVRIWKH2JERQL VHFUHWVRFLHW\WKHOLGFDUYHGZLWK}JXUHVDQGHTXHVWULDQVWKHULPLQFLVHGZLWK zigzag patterns; some cracks and damage through tear and wear on lower SDUWDEUDWLRQVHVSHFLDOO\RQWKHKDLUGRHVRIWKH}JXUHV


391 Schale. Senufo oder Jimini, Elfenbeinküste. Ø 19cm. Holz. Scha OH]XP$XIEHZDKUHQYRQ3DOPQ©VVHQI©UGDV,ID2UDNHODMHUH LID DXI UXQGHU %DVLV YRQ YLHU 6FKODPP}VFKHQ JHWUDJHQ GXQ NHOEUDXQHJO”Q]HQGH3DWLQD<DOH*95$UFKLYHVUHJLVWUDWLRQ QXPEHU0LW*XWDFKWHQYRQ/XGZLJ%UHWVFKQHLGHU  .RSLH  Intakt. 1.200,– Provenienz: Erworben 1975 in Lome, Togo. <RUXED1LJHULDZRRGHQGLYLQDWLRQERZODMHUHLIDVXSSRUWHGE\IRXUPXG}VK on a circular basis; dark brown, glossy patina, intact.

391

392 Runde Deckelschale. %HQLQ RGHU 2ZR 1LJHULD k FP 9HUPXWOLFKI©UGLH8WHQVLOLHQGHV,ID2UDNHOV2SRQ,JHGH 2ZR  der Deckel ist reich mit Tieren und einer Palme beschnitzt, der 'HFNHONQDXI PLW HLQHP $KQHQNRSI GHU ZLHGHUXP DXI HLQH +HUNXQIWDXV%HQLQ %LQL VFKOLHgHQO”VVWuGDQQP¤JOLFKHUZHLVH I©U GLH $XIEHZDKUXQJ YRQ .ROD1©VVHQ GLH 6FKDOH LVW LQQHQ HLQPDO JHWHLOW 6FKZDU]EUDXQH 3DWLQD GXUFK ,QVHNWHQIUDg DP 8QWHUWHLOEHVFK”GLJW u %HQLQRU2ZR1LJHULDOLGGHGFLUFXODUERZOSUREDEO\IRUWKHXWHQVLOVRIWKH,ID SURSKHV\FXOW2SRQ,JHGH 2ZR WKHOLGLVULFKO\FDUYHGLQUHOLHIZLWKDQLPDOV and a palm tree, the lid‘s knob shows an ancestral head which would indicate DQRULJLQIURP%HQLQ %LQL WKHQWRNHHSFRODQXWVWKHERZOLVVHSDUDWHGLQ WZRSDUWV%ODFNLVKEURZQSDWLQDVRPHGDPDJHE\LQVHFWELWHRQORZHUSDUW

392

393 Orakelbrett ‚opon ifa‘. Yoruba, Nigeria. Ø 40cm. Beschnitzt mit dem Kopf des Eshu, Menschen, Tieren und anderen Motiven. Intakt. 1.800,– 3URYHQLHQ]([6DPPOXQJ0DUHLGLXQG*HUW6WROO0©QFKHQ ,QY  Yoruba, Nigeria prophesy board ‚opon ifa‘, carved with the head of Eshu, KXPDQVDQLPDOVDQGRWKHUPRWLIV,QWDFW

393

193


395

394

394 Orakelbrett. Yoruba, Nigeria. Ø 49cm. Holz. Orakelbrett opon LID'HFNHOHLQHU,ID2UDNHOVFKDOHDP5DQGJHVFKQLW]WPLW]ZHL abstrakten, gegenüber liegenden Gesichtern des Eshu, dem 6FKODPP}VFKPRWLYXQGDQGHUHQ(PEOHPHQ,QWDNWDP5DQG HWZDVEHULHEHQ u 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  Yoruba, Nigeria, wooden prophesy board opon ifa, lid from an ifa prophesy bowl, carved on rim with two abstract opposite situated faces of Eshu, the PXG}VKPRWLIDQGRWKHUHPEOHPVVRPHDEUDWLRQVRQULP

395 Krone eines Oba. Yoruba, Nigeria. Konisch zulaufende Krone ei nes Oba, gefertigt aus einem Rohrgestell, gefüttert und vollkom PHQPLWZHLgHQEODXHQXQGVFKZDU]HQ*ODVSHUOHQEHVWLFNW$Q vier Seiten sind Gesichter angedeutet, die vermutlich Obatala darstellen. An der Spitze sitzt ein mit bunten Glasperlen bestick WHU9RJHOSehr selten! Kleine Fehlstellen. 2.000,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  Solche Kronen sind ausschließlich Obatala geweiht, dem Himmelsvater und Schöpfer der menschlichen Wesen, die durch den sanften Atem Olodumares zum Leben erweckt wurden. Dabei ist Obatala der Vater aller orishas und Olodumares Vertreter auf Erden, durch den auch die erste Stadt der Yoruba, ,IHJHJU©QGHWZXUGH Crown of an Oba, conically conceived with a wickerwork base, lined with cotton fabric and completely covered with white, blue and black glass beads. The Four faces on each side supposedly represent Obatala, on top a seated bird covered with cloloured glass beads. Some missing parts.

396

396 Zeremonialpaddel. <RUXED1LJHULD/FP+RO]6FKZDU]JH I”UEWHV=HUHPRQLDOSDGGHODXIHLQHU6HLWHLQ+RFKUHOLHIPLWHL QHP.URNRGLOJHVFKQLW]WGDVHLQHQ6FKODPP}VFKDQJUHLIWGHU Griff ist als Frauenkopf mit kunstvoller Frisur konzipiert; teil ZHLVHJO”Q]HQGH3DWLQD<DOHUHJLVWUDWLRQQXPEHU Kleine Fehlstelle am Frauenkopf, durch Insektenfraß unbedeu WHQGEHVFK”GLJW u Provenienz: Erworben 1980 in Lome, Togo.

194


397

Yoruba, Nigeria, wooden ceremonial paddle, painted black and carved on one VLGHLQKLJKUHOLHIZLWKDFURFRGLOHDWWDFNLQJDPXG}VKWKHKDQGOHFDUYHG with a female head with elaborate coiffure; glossy patina places, small insect bite on paddle and on rear of head.

397 Webrollenhalter. Senufo oder Jimini, Elfenbeinküste. H 15,5cm. +RO] :HEUROOHQKDOWHU VFKZDU] JHI”UEW PLW HLQHP %©IIHONRSI PLWJHERJHQHQ~DFKHQ+¤UQHUQXQGHLQHPGUHLHFNLJHP*HVLFKW PLWJHVHQNWHQ$XJHQJHVFKQLW]WEUDXQHXQGVFKZDU]JO”Q]HQGH Patina. 0LW *XWDFKWHQ YRQ /XGZLJ %UHWVFKQHLGHU  .RSLH  Intakt. 3.000,– Provenienz: Erworben 1975 in Abidjan, Elfenbeinküste. 6HQXIRRU-LPLQL,YRU\&RDVWKHGGOHSXOOH\G\HGEODFNDQGFDUYHGZLWKD EXIIDORKHDGZLWK~DWVOLJKWO\FXUYHGKRUQVWKHWULDQJXODUIDFHZLWKGRZQVHW H\HV%URZQDQGEODFNJORVV\SDWLQDLQWDFW

398

399

400 Brustschmuck. Yoruba, Nigeria. H 23,5cm. Bronze. Ovaler, ring I¤UPLJHU %UXVWVFKPXFN YHUPXWOLFK I©U GLH JHKHLPH 2JERQL Gesellschaft, geschmückt mit in Hochrelief gegossenen Köpfen DOWHUQLHUHQG PLW 6FKLOGNU¤WHQ GDEHL ZHLVHQ GLH .¤SIH DQ GHQ 6FKPDOVHLWHQMHZHLOVGDVZLQNHOI¤UPLJH2JERQL]HLFKHQDXIGHU 6WLUQDXIGLHEHLGHQ.¤SIHLP=HQWUXPGHU/”QJVVHLWH]HLJHQ GDJHJHQGLH=¤SIFKHQIULVXUGHUSLJWDLOVw$XIEHLGHQ/”QJVVHL WHQVHQ]XP8PK”QJHQ6SXUHQYRQ*U©QVSDQNOHLQH5LVVH 1.600,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  <RUXED1LJHULDRYDOULQJVKDSHGEURQ]HEUHDVWRUQDPHQWSUREDEO\IRUWKH Ogboni secret society, cast in high relief with heads alternating with turtles: KHDGVRQWKHQDUURZHQGVVKRZWKHFKHYURQVKDSHG2JERQLVLJQRQWKHLU foreheads while the heads in the center, escorted by the turtles port a pigtail hairdo; traces of verdigris, small cracks, loops on both sides for suspension.

398 Webrollenhalter aus Holz. Jimini oder Ligbi, Elfenbeinküste. + FP $XV VFKZDU]EUDXQ SDWLQLHUWHP +RO] JHVFKQLW]W PLW einem dreieckig gestalteten Kopf mit hoher, spitz zulaufender und einem Knoten endender Frisur; um den Hals eine kleine .HWWHDXVZHLgHQ*ODVSHUOHQ,QWDNW u 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ -LPLQLRU/LJEL,YRU\&RDVWKHGGOHSXOOH\WKHIDFHLQWULDQJXODUIRUPWKH WRZHULQJFRLIIXUHHQGLQJLQDVPDOONQREEODFNLVKEURZQJORVV\SDWLQD,QWDFW

399 Webrollenhalter aus Holz. Guro, Elfenbeinküste. H 16,5cm. Aus VFKZDU]EUDXQSDWLQLHUWHP+RO]JHVFKQLW]WPLWHLQHPJHK¤UQWHQ Tierkopf auf langem, leicht gebogenen Hals. Intakt. 800,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ *XUR,YRU\&RDVWKHGGOHSXOOH\FDUYHGZLWKDKRUQHGDQLPDOKHDGRQDORQJ VOLJKWO\EHQWKHDGEODFNLVKEURZQJORVV\SDWLQD,QWDFW

400

195


401 Armreif aus Bronze. Yoruba, Nigeria. Ø 19cm. Für den Og ERQL*HKHLPEXQG PLW YLHU 0DVNDURQHQ PLW GHP ZLQNHO I¤UPLJHQ 2JERQL=HLFKHQ DXI GHU 6WLUQ DOWHUQLHUHQG PLW kleinen Schellen. Grünspan, intakt. 850,– 3URYHQLHQ]$XVGHU6DPPOXQJ0DUHLGLXQG*HUW6WROO0©QFKHQ ,QY 091). Yoruba, Nigeria, bronze bracelet for the Ogboni secret society, showing IRXU PDVFDURQHV ZLWK WKH FKHYRURQVKDSHG 2JERQL VLJQV RQ WKHLU foreheads, alternating with clamps. Verdigris, intact.

402 Armreif aus Bronze. <RUXED1LJHULDkFP9HUPXWOLFK I©U GHQ 2JERQL*HKHLPEXQG DXV GHU ,MHEX5HJLRQ *H VFKP©FNW PLW YLHU .¤SIHQ GLH PLW )RUWV”W]HQ LQ PHQVFK OLFKH +”QGH ©EHUJHKHQ XQG ZRKO HLQH 8PNHKUXQJ GHV 6FKODPP}VFK%HLQH0RWLYVEHGHXWHQGDVXUVSU©QJOLFKYRQ Benin ausging und sich von dort auf die umliegenden Ethni en ausbreitete. Grüne und braune Patina, intakt. 750,– 401

3URYHQLHQ]$XVGHU6DPPOXQJ0DUHLGLXQG*HUW6WROO0©QFKHQ ,QY 075). 'HUP©QGOLFKHQEHUOLHIHUXQJ]XIROJHZXUGHQGLH%HLQH2ED2KHQVGHU LPRGHU-DKUKXQGHUWOHEWHQDFKHLQHP%HLVFKODISDUDO\VLHUWGHQ HUPLWGHU)UDXHLQHV+”XSWOLQJVKDWWH'LH%HLQHZXUGHQGDUDXIKLQYRQ den Webern (die auch Heilpraktiker waren) dick mit Stoffen umwickelt, GLH DXFK ]XJOHLFK DOV &DPRX~DJH VHLQHV /HLGHQV GLHQHQ VROOWHQ 'LH Weber erhielten daraufhin den Status einer besonderen Zunft (owina QyLGR GLHLKUHUVHLWVDXFKZLHGHUGDV6FKODPP}VFKPRWLYLQLKUHQ6WRIIHQ verwendeten. Yoruba, Nigeria, bronze bracelet probably for the Ogboni secret society, showing four heads with appendices which terminate in human hands and VXSSRVHGO\PHDQDQLQYHUVLRQRIWKHPXG}VKOHJPRWLIZKLFKRULJLQDWHG LQ%HQLQDQGVSUHDGIURPWKHUHWRWKHVXUURXQGLQJSHRSOHV*UHHQEURZQ patina, intact. According to oral tradition the legs of Oba Ohen who lived in the 14th or 15th century, were paralysed after he had slept with the wife of a chieftain. His legs were subsequently wrapped in thick cloths by the weavers (who ZHUHDOVRKHDOHUV ZKLFKDOVRVHUYHGWRFDPRX~DJHKLVFRPSODLQW$IWHU he had recovered, he bestowed on these weavers the status of a special JXLOG RZLQDQyLGR ZKRRQWKHLUWXUQXVHGWKHPXG}VKPRWLILQWKHLU cloths.

403 Schreintüre. Yoruba, Nigeria. 134 x 70cm, Holz. Türe eines Schreins, vermutlich für den Flussgott Erinle. Eine Arbeit des berühmten Schnitzers Maku of Erin, der um 1915 starb. Abriebspuren durch langen Gebrauch. 8.500,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  =ZHLJDQ]”KQOLFKH7©UHQHEHQIDOOVI©U(ULQOHZXUGHQYRQ8OOL %HLHULQVLWXIRWRJUD}HUW'LHVHZDUHQLQGHU1HXHQ5HVLGHQ]LQ %DPEHUJDXVJHVWHOOW6LHVLQGEHL8OOL%HLHULQGHVVHQ.DWDORJ<RUXED Das Überleben einer westafrikanischen Kultur“, S. 18 abgebildet.

402

5HLWHU}JXUHQKDEHQ0DNXRI(ULQOHEHVRQGHUVLQWHUHVVLHUWYHUPXWOLFK aus historischen Gründen: Zu Ende des 16. Jahrhunderts konnte das <RUXED.¤QLJUHLFKGHU2\RPLW+LOIHGHU.DYDOOHULHHLQYRQGHQ1XSH HLQLJH-DKU]HKQWH]XYRUHUREHUWHV7HUUDLQ]XU©FNJHZLQQHQ,QWHUHVVDQW für die Arbeiten von Maku ist die Stellung der Pferdefüße, die typisch für GLH6FKQLW]HUHLHQVLQG(LQHGHUVFK¤QVWHQ5HLWHU}JXUHQYRQ0DNXDXV GHU6DPPOXQJYRQ%%HUHQVRQLVWKHXWHLQGHU8QLYHUVLW\$UW*DOOHU\ LQ<DOH]X}QGHQ Wooden door of a shrine, probably for the river god Erin, carved by the famous artist Maku of Erin who died around 1915. Traces of use.

196


404 Ritualschwert. Yoruba, Nigeria. L 6FKZHUW FP 6FKHLGH FP (L VHQ%DXPZROOH*ODVSHUOHQ5LWXHOOHV 6FKZHUW RULVKD RNRw JHVFKPLHGHW DXV HLVHUQHQ +DFNHQ WHLOZHLVH PLW %DQGHLVHQXPZLFNHOWXQGPLW.Q¤S fen geschmückt; mit hölzernem, ge streift bemaltem Griff mit Bandeisen XPZLFNHOWXQGHLQHPHLVHUQHQ.QDXI versehen. Die überlange, große Schei GH DXV %DXPZROOH LVW YROONRPPHQ mit bunten Glasperlen besetzt, mit ]ZHL VHSDUDW JHDUEHLWHWHQ VWHKHQGHQ 9LHUEHLQHUQ XQG YHUVFKLHGHQHQ 0X VWHUQZLHGHP6FKOLQJEDQGPRWLYJH schmückt. Roststellen, intakt. 2.800,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ *HUWXQG0DUHLGL6WROO Der Kult um orisha oko geht auf eine Ge VFKLFKWHDXVGHP'RUI,UDZR]XU©FNLQGHU eine unschuldige unfruchtbare Frau dieses Namens beschuldigt wurde, aus Eifersucht das Kind einer ihrer Mitfrauen getötet zu haben. 2ULVKD RNR EHGHXWHW *RWW GHV %DXHUQKRIV und deshalb wird das Schwert vom Schmie GHPHLVWHU YRQ ,UDZR JHVFKPLHGHW XP GLH )U©FKWHGHV%DXHUQKRIV]XVFK©W]HQLQGHP 6LQQHGDVVVROOWHHLQ0DQQGHQ%DXHUQKRI ausrauben, der Stab ihn töten wird. Aufgrund seiner Geschichte und seines mythischen Ruh mes wird orisha oko als unfehlbar angesehen, wenn es darum geht, Frauen zu beurteilen, die GHU+H[HUHLEHVFKXOGLJWZHUGHQVLHKH5REHUW )DUULV 7KRPSVRQ %ODFN *RGV DQG .LQJV  <RUXED$UWDW8&/$   Ritual sword „orisha oko“ of forged iron, bea ten together, partly wound with iron bands and ornated with knobs; the wooden handle, partly painted with stripes, wound with iron bands and ending with a knob. The enlarged cotton weave sheath completely covered with coloured glass beads, two separately worked animals, the whole sheath ornated with vari ous motifs including the looped ribbon motif. Rosty spots, intact.

403

404

197


405

406

405 Trommel. Yoruba, Nigeria. H 37cm, Ø ca. 40cm. Holz, Le der. Große Trommel, vermutlich für die geheime Ogboni Ge sellschaft, bespannt mit Leder und in Hochrelief geschnitzt mit Menschen und verschiedenen Tieren. Minimale Risse und Be VFK”GLJXQJHQ$OWHUVVSXUHQHLQ3~RFNIHKOW u 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  Yoruba, Nigeria large wooden drum, probably for the secret Ogboni society, covered with leather and carve in high relief with humans and various animals; minimal cracks, traces of long wear and tear.

406 Trommel. Yoruba, Nigeria. H 58,5cm. Holz, Leder. Große Trommel, mit Leder bezogen und getragen von einer knien GHQP”QQOLFKHQ)LJXUPLWHUKREHQHQ$UPHQJURgHQKHUYRU tretenden Augen und einem prominent gestalteten Penis; Reste ZHLgHQ3LJPHQWV$XVEU©FKHXQGNOHLQH)HKOVWHOOHQDPXQWHUHQ 5DQG/HGHUEH]XJHWZDVEHVFK”GLJW u 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  Yoruba, Nigeria, large drum, covered with leather and supported by a kneeling PDOH}JXUHZLWKUDLVHGDUPVODUJHSURWUXGLQJH\HVDQGDSURPLQHQWO\FDUYHG penis; remains of white pigment; some breakages on bottom, small damages on leather covering.

407 Stützpfosten ‚toguna‘. Dogon, Mali. H 112cm. Stützpfosten aus +RO]I©UHLQ3DODYHU+DXVJHVFKQLW]WPLW]ZHL%U©VWHQ$EQ©W zungsspuren an den Brüsten; unterer Teil durch Insektenfraß EHVFK”GLJW u 407

3URYHQLHQ]$XVSULYDWHU$IULND6DPPOXQJ0©QFKHQ Dogon, Mali, supporting post toguna from a palaver house, carved with breasts; traces of wear and tear on breasts, lower part damaged by insect bite.

198


408 409

408 3ULHVWHUWDVFKH<RUXED1LJHULD&D[FP%DXPZROOH*ODVSHUOHQ 9RUGHUWHLOHLQHU8PK”QJHWDVFKHHLQHV3ULHVWHUVRGHU+HLOHUVDXV%DXP ZROOH EHVWLFNW PLW EXQWHQ *ODVSHUOHQ PLW ]ZHL 9LHUEHLQHUQ XQG GHP typischen Schlingbandmotiv. Unbedeutende Fehlstellen; das bestickte 7UDJHEDQGHWZDVEHVFK”GLJW u 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO Yoruba, Nigeria, front part from a cotton bag of a priest or healer, completely covered with red, black and white glassbeads decorated with various motifs including two horned animals and the typical looping ribbon motif; minimal damage; on embroidery of supporting ribbon some damage.

409 .XOWREMHNWXQG3ULHVWHUWDVFKH<RUXED1LJHULD+RKQH%HLZHUNE]Z FP.RUEJH~HFKW.DXULVFKQHFNHQ6SLHJHO%DXZROOVWRII.XOWRE MHNW +DXV GHV .RSIHVw LOH RUL YLHUHFNLJ NRQ]LSLHUW PLW NURQHQDUWL JHP$XIEDX%DVLVDXV.RUEJH~HFKWLQQHQJHI©WWHUWPLW5HVWHQDOWHQ %DXPZROOVWRIIHV%DVLVXQG$XIEDXPLWMHZHLOVYLHU6SLHJHOQXQGIDVW YROOVW”QGLJPLW.DXULVFKQHFNHQEHVHW]WDQGHQ(FNHQGHU%DVLVMHZHLOV ]ZHL6FKQ©UHPLWJH~RFKWHQHQ/HGHUE”QGHUQXQG.DXULVFKQHFNHQKHU DEK”QJHQG'DEHLGDV9RUGHUWHLOHLQHU3ULHVWHUWDVFKHNUHX]I¤UPLJPLW /HGHUVWUHLIHQXQG.DXULVFKQHFNHQEHVHW]W8PUDKPXQJXQG8PK”Q JHKDOWHUXQJ DXV %DXPZROOVWRII WHLOZHLVH HEHQIDOOV EHVHW]W PLW .DXUL schnecken (Inv.15 und 17). Am Aufbau des Kopfes fehlen drei Spiegel; 7DVFKHWHLOZHLVHGXUFKODQJHV7UDJHQEHVFK”GLJW u 3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU <RUXED1LJHULDULWXDOREMHFWKRXVHRIKHDGwLOHRURUHFWDQJXODUFRQFHLYHGZLWKFURZQ shaped superstructure, on a wickerwork base, the inside lined with old handwoven relics of cotton fabric, the outside completely covered with cowry shells and with mirrors on the four sides of both structures; two strings of cowry shells alternating with plaited leather stripes hanging down on each corner; three mirrors missing on superstructure. ,QFOXGHGLQWKHORWLVWKHIURQWSDUWRIDKHDOHUyVEDJGHFRUDWHGZLWKLQODLGOHDWKHUVWULSHV and with attached cowry shells; the cotton weave leash also decorated partly with cowry shells; some damage on bag.

410 Öllampe. Dogon, Mali. H 130cm. Eisen. Große Öllampe mit 12 Scha len, einer abstrakten Figur, die Arme hebend (Nommo?) und einer JHVFKPLHGHWHQ.HWWHPLW6SDWHO/¤VFKHUGLFNH5XgVSXUHQ,QWDNW 750,– 410 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ 'RJRQ0DOLODUJHRLOODPSZLWKERZOVDQDEVWUDFW}JXUHUDLVLQJWKHDUPV 1RPPR"  DQGDEODFNVPLWKHGFKDLQZLWKH[WLQJXLVKHUVSDWXOD7KLFNOD\HUVRIVRRWLQWDFW

199


411 )UDJPHQWHLQHV+RFNHUVYoruba, Ni geria. H 32,5cm. Holz. Fragment ei nes kleinen Hockers, getragen von GUHL)LJXUHQHLQHP”QQOLFKHVLW]HQG und Pfeife rauchend (fehlt), die bei GHQ DQGHUHQ ZHLEOLFK LKUH %U©VWH haltend; Reste verschiedener Farben. %DVLV IHKOW IDVW YROOVW”QGLJ VRQVW QXU kleine Risse und Abbrüche. 850,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ *HUWXQG0DUHLGL6WROO Yoruba fragment of a small stool, supported E\ WKUHH }JXUHV RQH VHDWHG WKH RWKHU WZR VWDQGLQJ UHPDLQV RI YDULRXV FRORXUV %DVH almost entirely missing, otherwise breakages and abrations.

411

412 )UDJPHQWHLQHV+RO]KRFNHUVYoruba, Nigeria. Getragen von drei Figuren, HLQHZHLEOLFKHVLW]HQGGLH+”QGHDXI die Schenkel legend, die beiden ande UHQP”QQOLFKVWHKHQGEHNOHLGHWXQG Fez tragend; Reste verschiedener Far EHQ%DVLVIHKOWIDVWYROOVW”QGLJVRQVW nur kleine Risse und Abbrüche. 800,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ *HUWXQG0DUHLGL6WROO Yoruba fragment of a small stool, supported E\WKUHH}JXUHVRQHIHPDOHVHDWHGZLWKKDQGV placed on her thighs, the other two male, standing wearing gowns and fez; remains of YDULRXVFRORXUV%DVHDOPRVWHQWLUHO\PLVVLQJ otherwise breakages and abrations.

413 6DPPOXQJ +RO]+RFNHU Bamileke  %DPXP .DPHUXQ XQG 1\DPZH ]L RGHU 8VDPEDUD%HUJH 7DQVDQLD +FP .DPHUXQ XQG+ FPkFP 7DQVDQLD =ZHL Hocker aus hellbraunem Holz mit UHFKWHFNLJ DEJHUXQGHWHQ 6LW]~”FKHQ auf quadratischen Stützen ruhend, der größere von beiden mit einge schnittenen linienförmigen Motiven (Kamerun). Die beiden anderen Hok NHU PLW UXQGHQ 6LW]~”FKHQ MHZHLOV DXIGUHL%HLQHQUXKHQGPLWVFKZDU] brauner und brauner Patina. 4 Stück! Alle Hocker mit Gebrauchsspuren. 750,–

412

3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP .RORVV%HUOLQ

0

200

413

7ZR%DPLOHNH%DPXP&DPHURRQVWRROVRI light coloured, brown wood with square seats and rectangular bases, and two Nyamwezi RU 8VDPEDUD 0RXQWDLQV 7DQ]DQLD VWRROV of circular form, resting on three feet with EODFNLVKEURZQDQGOLJKWEURZQSDWLQD$OO stools with traces of tear and wear. 4 pieces!


414 Zwei Schilde. 0D\RJR'5.RQJRXQG+DPED-RQJD7HWHOD a) H 103cm. Holz, Rupfen, Pelz (Mayogo). Rechteckiger Schild, VFKZDU] ZHLg XQG URW PLW 6WUHLIHQ XQG KH[DJRQDOHQ 0RWLYHQ bemalt und mit verschieden angeordneten Knöpfen versehen; LP0LWWHOWHLOHLQHPLW0HWDOOEOHFK©EHU]RJHQH9HUVW”UNXQJ2UL JLQDOUHSDUDWXUPLWS~DQ]OLFKHP*HZHEHHLQLJH.Q¤SIHIHKOHQ 0LQLPDO EHVFK”GLJW ,QY   E  + FP +RO] .RUEJH~HFKW 2YDOHU6FKLOGDXV.RUEJH~HFKWDQGHQ(QGHQVSLW]]XODXIHQG PLWK¤O]HUQHP*ULIIVFKZDU]ZHLgURWXQGEODXLQ6WUHLIHQEH malt. Intakt. (Inv. 11). 2 Stück! 1.200,– 3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU Mayogo, D. R. of Congo rectangular shield, black, white and red painted with VWULSHVDQGKH[DJRQDOPRWLIVDQGZLWKGLIIHUHQWO\SODFHGNQREVLQWKHFHQWHU DQ DGGLWLRQDO IDVWHQLQJ FRYHUHG ZLWK PHWDO VKHHW DQG D +DPED -RQJD Tetela oval wickerwork shield tapering at both ends, with wooden handle, DQGSDLQWHGEOXH%ODFNUHGDQGZKLWHZLWKVWULSHVWKH0D\RJRVKLHOGZLWK minor damages and with indigenous repair with fabric; some knobs missing. 2 pieces!

414

9LWDYRQ'U+DQV-RDFKLP.RORVV  LQ .¤QLJVEHUJ JHERUHQ PXVVWH GLH )DPLOLH YRQ +DQV-RDFKLP .RORVV LP 0”U]  QDFK *DQGHUNHVHH LP /DQGNUHLV 2OGHQEXUJ~LHKHQ+DQV-RDFKLPEHVXFKWHGDV*\PQDVLXPLQ'HOPHQKRUVWXQGPDFKWHGRUWGDV$ELWXU 7URW]DOOHU}QDQ]LHOOHQ6FKZLHULJNHLWHQuGHU9DWHUZDUDUEHLWVORVXQGHUKLHOWQXUHLQHNOHLQH5HQWHuZDUHV+DQV-RDFKLPVIHVWHU :XQVFKHLQ6WXGLXP]XEHJLQQHQXQGHUVFKULHEVLFKDQGHU8QLYHUVLW”W*¤WWLQJHQHLQ'DHUVLFKYRUDOOHPI©UNXOWXUXQG VR]LDOZLVVHQVFKDIWOLFKH)UDJHQLQWHUHVVLHUWHVXFKWHHUVLFKGDV)DFK9¤ONHUNXQGHDXVGDVGDPDOVPLWHWZDHLQHPKDOEHQ'XW]HQG 6WXGHQWHQXQGGHP,QVWLWXWVOHLWHU3URIHVVRU'U*©QWKHU6SDQQDXVHLQVRJHQDQQWHV2UFKLGHHQIDFKZDU 9RQEHVRQGHUHU%HGHXWXQJZDUHQI©U.RORVVGLHH[]HOOHQWHQ/HKUYHUDQVWDOWXQJHQYRQ(UKDUG6FKOHVLHU]XGHQHQGLH1HEHQI”FKHU 3U”KLVWRULHXQG*HRJUDSKLHDEHUYRUDOOHP3KLORVRSKLHNDPHQZREHLI©UVHLQZHLWHUHV6WXGLXPYRUDOOHPGLH3U”KLVWRULHLQWHUHVVDQW ZDUGDVLHMDDOV%DVLVI©UYLHOHNXQVWKLVWRULVFKH)RUVFKXQJHQLPHWKQRORJLVFKHQ%HUHLFKGLHQW (U KDWWH HQJHQ .RQWDNW ]X 3URI /‘V]O¡ 9DMGD GHU LP 0©QFKQHU ,QVWLWXW I©U 9¤ONHUNXQGH W”WLJ ZDU XQG DXV GHP VLFK HLQH IUHXQGVFKDIWOLFKH%H]LHKXQJHQWZLFNHOQVROOWH6LHEUDFKWHDXFKI©UVHLQH'LVVHUWDWLRQGLHHUEHL6SDQQDXV©EHU'LH+DXVWLHUKDOWXQJ LQ:HVWDIULNDwDEVROYLHUWHZLFKWLJH,PSXOVH (VIROJWHQYHUVFKLHGHQH$QVWHOOXQJHQ=XQ”FKVWHLQH$VVLVWHQWHQVWHOOHLQ*¤WWLQJHQEHL3URIHVVRU6FKOHVLHUGDQQHLQH%HVFK”IWLJXQJ LP,QVWLWXWI©UGHQZLVVHQVFKDIWOLFKHQ)LOPHEHQIDOOVLQ*¤WWLQJHQXQGZLHGHUHLQH6WHOOHDOVZLVVHQVFKDIWOLFKHU$VVLVWHQWYHUPLWWHOW YRQ $[HO YRQ *DJHUQ DQ GLH Y¤ONHUNXQGOLFKHQ 6DPPOXQJHQ GHU 6WDGW 0DQQKHLP LP 5HLg0XVHXP YRQ    'LHVH OHW]WHUH3RVLWLRQZDUI©U.RORVVPDgJHEHQGI©UVHLQHVS”WHUHQ)RUVFKXQJVDUEHLWHQLQ.DPHUXQVRZLHI©UVHLQH6WXGLHQLP%HUHLFK GHUDIULNDQLVFKHQ.XQVW(LQH$XVVWHOOXQJ©EHUR]HDQLVFKH.XQVWZXUGHHLQJURgHU(UIROJuDXFKSHUV¤QOLFKuGHQQQRFKDP $EHQGGHU(U¤IIQXQJHUKLHOW.RORVVYRQ)ULHGULFK.XVVPDXOGHP'LUHNWRUGHV/LQGHQ0XVHXPVLQ6WXWWJDUWGDV$QJHERWGRUW GLH/HLWXQJGHU$IULND$EWHLOXQJ]X©EHUQHKPHQ 6RKDWWHQVLFKVHLQHEHUX~LFKHQ=LHOHXQG:©QVFKHZHLWJHKHQGHUI©OOW.RORVVZDUYRQELV.XUDWRUHLQHUGHUJU¤gWHQXQG EHGHXWHQGVWHQ6DPPOXQJHQDIULNDQLVFKHU.XQVWLQ(XURSD6FKRQEHJDQQ.RORVVVHLQHWKQRORJLVFKHV)RUVFKXQJVSURMHNWLQ .DPHUXQGDVLKQ]XHLQHPGHUI©KUHQGHQ(WKQRORJHQLQ(XURSDZHUGHQOLHg=XQ”FKVWZLGPHWHHUVLFKGHPJDQ]HQ.DPHUXQHU *UDVODQGVFKOLHgOLFKNRQ]HQWULHUWHHUVLFKDXIGDV.¤QLJWXP &KHIIHULHw 2NXI©UGLHHUVLHEHQ)RUVFKXQJVDXIHQWKDOWHZ”KUHQG seiner Stuttgarter Zeit einplanen konnte. ORFNWHZLHGHUHLQ.DUULHUHVSUXQJ(UHUKLHOWGDV$QJHERWLQ%HUOLQGLH/HLWXQJGHU$IULND$EWHLOXQJ]X©EHUQHKPHQ'RUW JDOWHVXQWHUDQGHUHPHLQH$XVVWHOOXQJ©EHUDIULNDQLVFKH.XQVWLPGDPDOLJHQ=DLUH KHXWHZLHGHU.RQJR ]XRUJDQLVLHUHQuI©U GLH PHLVWHQ 9¤ONHUNXQGHPXVHHQ GDPDOV QRFK HLQ 1RYXP GHQQ ELVODQJ KDWWHQ UHLQ HWKQRORJLVFKH 6FKDXHQ GHQ 9RU]XJ 'LH $XVVWHOOXQJYRQZXUGHZLHGHUHLQJURgHU(UIROJXQG]XU(U¤IIQXQJNRQQWH.RORVVDXFKGHQ.¤QLJYRQ2NXEHJU©gHQ=ZDU ZDUI©U'U.RORVVGDV.DPHUXQHU*UDVODQGPLW2NXGDV+HU]VW©FNVHLQHU)RUVFKXQJVW”WLJNHLWGRFKNRQQWHHULPEHQDFKEDUWHQ 1LJHULDLP*HELHWGHU&HQWUDO(MDJKDPDP&URVV5LYHUYHUJOHLFKHQGH)RUVFKXQJHQLQGHQ-DKUHQXQGGXUFKI©KUHQHV ZDUHQ8QWHUVXFKXQJHQGLHHUVFKRQEHJRQQHQKDWWHDEHUHUVWLP=XJHQHXHU%HKDQGOXQJVPHWKRGHQGLHHVQXQI©UVHLQH Krankheit gab, erledigen konnte. Dr. Koloss musste auf Grund gesundheitlicher Probleme 2001 in den vorzeitigen Ruhestand gehen. =XVDPPHQIDVVXQJHLQHV,QWHUYLHZVGDV'U.RORVV3URIHVVRU+DOOHUJHZ”KUWH

201


415 416

417

418

202

419


415 Zwei Schilde. 7RSRNH XQG ZHVWOLFKH 0RQR  1JDWD  .XQGL EHLGH'5.RQJRD [FP+RO]/HGHU.RUEJH~HFKW 7RSRNH6FKLOG LQ UHFKWHFNLJHU )RUP WHLOZHLVH PLW /HGHU EHVSDQQWXQGPLW.RUEJH~HFKWEHGHFNW]ZHLUHFKWHFNLJH)HOGHU EHLGVHLWVGHU0LWWHEODXJHI”UEW ,QY E /FP+RO]6FKLOG GHU1JDWDXDDXV+RO]O”QJOLFKRYDONRQ]LSLHUWXQGVFKZDU] ZHLg XQG URW PLW 5DXWHQ XQG 'UHLHFNVPRWLYHQ EHPDOW ,QY 37). 2 Stück!%HLGHPLWEHPHUNHQVZHUWHQ*HEUDXFKVVSXUHQ 980,– 3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU Topoke D. R. of Congo, shield in rectangular shape, with wooden frame and ZLFNHUZRUNFRQVWUXFWLRQSDUWO\FRYHUHGZLWKOHDWKHUDQGZLFNHUZRUN}HOGV two rectangular parts on either side of the center painted blue. The wooden Ngata shield in elongated oval form and painted black, red and white with triangular and lozenge motifs; both shields with notable traces of tear and wear. 2 pieces!

416 Zwei Schilde. 1DQGH  0YXED ' 5 .RQJR XQG $PKDUD ŠWKLRSLHQ D   [ FP /”QJOLFKHU OHLFKW JHZHOOWHU 6FKLOG 1DQGH DXVJHRPHWULVFKDQJHRUGQHWHP.RUEJH~HFKWPLWK¤O ]HUQHP*ULIIDQGHQ5”QGHUQPLW7LHUKDXWHLQJHIDVVW ,QY  b) Ø 50cm. Runder Schild aus Tierhaut (Amhara), innen mit KHOOURWHP%DXPZROOVWRIIDXgHQPLWURWHP6DPWEH]RJHQXQG mit gepunzten Messingstreifen und Knöpfen geschmückt. In takt. (Inv. 41). 2 Stück! Intakt. 940,– 3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU 1DQGH0YXED'5RI&RQJRZLFNHUZRUNVKLHOGZLWKZRRGHQKDQGOHOLQHG on rims with animal hide, and an Amhara, Ethiopia, circular hide shield, lined with light red cotton weave, covered with red velvet and decorated with brass VWULSHVDQGNQREV,QWDFW2 pieces!

417 Zwei Rundschilde. 0DVVDL.HQLD7DQVDQLD ,UDQJL7DQVDQLD %HLGH/HGHUE]Z+DXW'DV0DVVDL6FKLOG /FP PLWK¤O]HU QHP*ULIIVFKZDU]XQGURWPLW=LFN]DFNXQGDQGHUHQ0RWLYHQ EHPDOWGDV,UDQJL6FKLOG /FP PLWGXUFKJHKHQGHP+RO] griff und in der Mitte gepunzt, um Platz für den Griff zu haben (Inv. 10 und 36). 2 Stück!,UDQJL6FKLOGPLW*HEUDXFKVVSXUHQ 850,– 3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU 0DVVDL7DQ]DQLD.HQ\DFLUFXODUOHDWKHU RUKLGH VKLHOGSDLQWHGEODFNDQG UHGZLWK]LJ]DJDQGRWKHUPRWLIVDQGDQ,UDQJL7DQ]DQLDKLGHVKLHOGZLWK wooden handle, punched in the center to give room for the handle. Only the ,UDQJLVKLHOGZLWKWUDFHVRIZHDUDQGWHDU2 pieces!

418 Zwei Schilde. 7XWVL+XWX7ZD%XUXQGLXQG6RPED7DPEHU PD7RJR%HQLQ7XWVL6FKLOG /FDFP DXV+RO]PLWSDUDO OHO DQJHRUGQHWHP .RUEJH~HFKW EHGHFNW XQG 6RPED6FKLOG k FP DXVJH~RFKWHQHQ3~DQ]HQIDVHUQPLW+RO]JULIIXQG9HU zierung aus gespaltenen Tierknochen (?) (magische Bedeutung für die Jagd ?) (Inv. 8 und 9). 2 Stück! Intakt. 750,– 3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU 7XWV%XUXQGLZRRGHQVKLHOGFRYHUHGZLWKSDUDOOHODUUDQJHGZLFNHUZRUNDQG a Somba shield made of wickerwork with wooden handle and split animal ERQHV "  DV GHFRUDWLRQ RU PDJLF GHYLFH IRU KXQWLQJ SXUSRVHV"  ,QWDFW 2 pieces!

419 Zwei Schilde. Mofu, Kamerun und Amhara, Äthiopien. a) L FP %©IIHOKDXW6FKLOG LQ )RUP HXURS”LVFKHU 6FKLOGH PLW zahlreichen in verschiedenen Mustern angeordneten gepunzten Noppen versehen. Einriss und kleine Fehlstelle am linken Rand. (Inv. 39). b) Ø 42cm. Runder Schild aus Tierhaut, innen mit KHOOURWHP%DXPZROOVWRIIDXgHQPLWEODXJUDXHP6DPWEH]RJHQ und mit gepunzten Metallstreifen und Knöpfen geschmückt. In takt. (Inv. 42). 2 Stück! 680,– 3URYHQLHQ]([6DPPOXQJ.:%D\HUQYRU Mofu, Kamerun, buffalo hide shield, decorated with numerous small punched burls, arranged in various designs, and an Amhara, Ethiopia, circular hide VKLHOGOLQHGZLWKOLJKWUHGFRWWRQZHDYHFRYHUHGZLWKEOXHJUH\LVKYHOYHWDQG decorated with silvery metal stripes and knobs; crack and small missing part on left rim of Mofu shield. 2 pieces!

420 +RO]*DEHO)LGVFKL,QVHOQIU©KHV-K/FP=HUHPRQLDO RGHU .DQQLEDOHQ*DEHO FXOD QL ERNROD  PLW EDOXVWHUI¤UPLJHP Griff, der mit einem knopfförmigen Endstück abschließt und vier feinen Zinken, aus einem Stück Holz gearbeitet. Dunkle 3DWLQD]ZHL=LQNHQLPYRUGHUHP%HUHLFKJHVSOLWWHUW u 3URYHQLHQ]([6DPPOXQJ.OHYHU%D\HUQVHLWHU-DKUHQ Derartige Gabeln werden oft als Kannibalengabeln bezeichnet, weil sie von 3ULHVWHUQ XQG +”XSWOLQJHQ ]XP 9HU]HKU YRQ 0HQVFKHQ~HLVFK YHUZHQGHW ZXUGHQ6LHZXUGHQDEHUDXFKYRQKRFKUDQJLJHQ,QGLYLGXHQEHQXW]WGLHDOV OHEHQGH5HSU”VHQWDWLRQHQYRQ*¤WWHUQQLFKWPLW1DKUXQJXPJHKHQGXUIWHQ Diener fütterten diese Personen, indem sie ihnen vorsichtig geweihtes Fleisch LQGHQ0XQGOHJWHQDEHUNHLQ0HQVFKHQ~HLVFK'DV%HU©KUHQGLHVHU*DEHOQ war für das gemeine Volk nicht erlaubt. Sie galten als heilig und wurden im Geisterhaus (bure kalou) aufbewahrt. Jede Gabel war individuell benannt und wurde von Generation zu Generation weitergegeben. &HUHPRQLDORU&DQQLEDOZRRGHQIRXUWLQHGIRUN)LML,VODQGVWKFHQWXU\ Two tines splintered in the front area.

420

203


ISLAM

421 Orientalisches Fliesenpaneel. Wohl Kadjarenzeit, 19. Jh., im Sa fawidischen Stil. 24 quadratische Fliesen bilden ein Bildfeld (96 x 64 cm), auf dem ein von einem Hund begleiteter Reiter und ein vor einem stilisierten Berg sitzender Mann, beide in prächti gen Gewändern, zu sehen sind. Gerahmt, intakt. 600,–

Provenienz: Ex Privatsammlung F.X.M, Oberbayern, 1930er – 1940er Jahre. An oriental tile panel depicting a rider and a man sitting at the slopes of a mountain. Safavid style, Qajar Period, 19th century A.D.


$/7$0(5,.$

422 Große Federmaske der Tapirapé („Cara grande“). Zweite Hälfte 20. Jh. n. Chr. H 95cm, B 104cm. Flaches, halbkreisförmiges Holzbrett, auf dem ein Gesicht in Form eines Federmosaiks in den Farben Gelb, Türkis und Rot gestaltet ist. Zwei Federrosetten sind vorne in die Scheibe gesteckt; den Rand ziert ein Kranz von verschiedenfarbenen Federn. Die Maske wurde mit beiden Händen vor dem Gesicht getragen und symbolisierte die Geister der getöteten Feinde. Intakt. 10.000,– Provenienz: Ex Privatbesitz A. H., München, aus dem Besitz eines bayerischen Museumsdirektors. In Deutschland vor den 1980er Jahren.

9JOGD]X%%UDXQ +UVJ $UWVRIWKH$PD]RQ  6'LHULWXHOOH Verwendung von Masken ist im indianischen Südamerika weit verbreitet, weil sie es den Indianern erlaubt, Brücken in andere Welten zu schlagen. Das Tragen von Masken steht immer in einem zeremoniellen Zusammenhang und spielt bei Fruchtbarkeitsriten, Krankenheilungen, Initiationsriten oder Totenfeiern eine wichtige Rolle. Large Tapirapé feather mask („Cara Grande“), symbolizing the spirits of the slain enemies. Intact. Second half of 20th century. Excellent and very large specimen!


423

424

423 Kleine Gesichtsmaske aus Bergkristall. Olmekoide Kultur, um Y&KU+FP%HUJNULVWDOO*XWDXVJHDUEHLWHWHV*H sicht mit breitem Mund, einer vorspringenden, gebogenen Nase und tief eingekerbten, schmalen Augen. Die Stirn springt leicht vor. Das Gesicht wird eingerahmt von einem Doppelstreifen, der vielleicht eine Frisur oder Kopfbedeckung andeuten soll. Vier Löcher dienten zur Befestigung des Objektes, dass sicher lich einmal das Mittelstück eines imposanten Pektorals bilde te. Absplitterung auf der rechten Seite hinten, sonst intakt. 5.000,– Provenienz: Ex Sammlung E. U., Bayern; in Deutschland seit vor 1990. 2OPHFIDFHPDVN}QHO\FXWIURPURFNFU\VWDOZLWKD~HVKHGRXWIDFH6SOLQWHULQJ RQWKHOHIWVLGHWLQ\GDPDJHVDURXQGFD%&

425

424 .OHLQH6WHLQ}JXUOlmekisch, mittlere präklassische Phase, cir FDY&KU+FP*U©QHOHLFKWJHVSUHQNHOWH-DGH Kleine Statuette eines stehenden Mannes mit großem, langgezo genem Kopf, die Arme vorgestreckt. Das Gesicht ist gut ausge DUEHLWHWPLWHLQHPEUHLWHQKDOEJH¤IIQHWHQ0XQGXQG~HLVFKLJHQ /LSSHQHLQHU~DFKHQ1DVHXQGVFKPDOHQ$XJHQPLWJHZ¤OEWHQ Lidern. Die Stirn ist niedrig und vorgewölbt, die Ohren nur als ~DFKH6WHJHDXVJHDUEHLWHW)LQJHUXQG=HKHQLQIHLQHQ6WULFKHQ angegeben. Linker Arm abgebrochen, am Oberarm bräunliche Verfärbung, sonst intakt. 1.000,– Provenienz: Ex Sammlung Dr. R. N. D., Norddeutschland. Erworben aus der Privatsammlung eines Forschers zwischen den 1970er Jahren und 1985. In 'HXWVFKODQGVHLWPLQGHVWHQV 2OPHFJUHHQMDGH}JXUHRIFRPSDFWDQGSRZHUIXOEXLOGSRVVLEO\GHSLFWLQJD

206


dwarf. Left arm missing, otherwise intact. Middle Preclassic 3HULRGFD%&

425 .OHLQH 6WHLQ}JXU 7HRWLKXDFDQ FLUFD    Q Chr. H ohne Sockel 6cm, H Sockel 4cm. Rötlicher, grün gesprenkelter Stein. Kompakte Statuette einer stehenden Frau (?) mit kurzen Gliedmaßen und ei QHP ~DFKHQ RYDO JHVWDOWHWHQ ©EHUGLPHQVLRQDOHQ Kopf. Nase, Augen und Mund sind gut ausgearbei tet, die Arme sind vom Körper gelöst und hängen frei herab. Seltenes Objekt in sehr gutem Zustand! Winzige Absplitterung am rechten Fuß, sonst intakt. 2.800,– Provenienz: Ex Privatbesitz A. H., München. Aus Münchner Auktionshaus ca. 2017. Small stone statuette of a woman (?) standing on tapering legs with arms detached from the body. The features of the large oval KHDGDUHGH}QHGE\JURRYHV([FHOOHQWSUHVHUYHG7HRWLKXDFDQ FXOWXUHFD$'

426

426 Kleines Lama. ,QND    Q &KU / FP %UDXQHU 6WHLQ PLW JUDXHQ (LQVFKO©VVHQ .OHLQH )L gur in Form eines Lamas mit gut modelliertem Kopf und Ritzmuster an Kopf und Hals, die das Fell des Tieres wiedergeben sollen. In der Mitte tief ausge höhlt, hinten kleiner Schwanz ausgearbeitet. Intakt. 800,– Provenienz: Ex Privatbesitz A. H., München. Aus deutscher Sammlung ca. 1990. Stylized stone lama, compact build with a distinctively carved head, deeply hollowed in the middle. Intact. Inca Period, ca. $'

 Hockendes Äffchen. 4LPED\D    Q &KU +FP7XPEDJD *ROGFD6LOEHUFD  Hohl gearbeitete Figur eines Äffchens. Hockender männlicher Affe mit angewinkelten Knien und aufge VW©W]WHQ(OOERJHQ'HQ.RSIKDWGDV7LHULQGLH+”Q de gelegt. Details wie Brustwarzen, Augen und Fell GXUFK }OLJUDQH %”QGHU XQG *UDQDOLHQ PDUNLHUW GLH 2KUHQDXV]X66SLUDOHQJHIRUPWHQ'UDKW$XIGHP 6FKHLWHO]\OLQGULVFKH*HI”g¤IIQXQJ]ZHL$XIK”QJH Ösen am Hinterkopf. Feine Patina, Druckstellen mit Durchbruch auf der rechten Schulter und am linken Knie, sonst intakt. 1.000,– Provenienz: Ex Sammlung Dr. W. G., München; ex Hermann Historica, Auktion 71, 2015, Los 3772; aus der Sammlung HLQHVV©GGHXWVFKHQ.©QVWOHUVHUZRUEHQLQGHQHU-DKUHQ im Kunsthandel. Qimbaya cast gold monkey pendant. Well formed body with projecting eyes and ears in openwork scrolling, details marked E\}OLJUDQHEDQGV7ZRVXVSHQGLQJORRSVDWWKHEDFNRIWKHKHDG 3UHVVXUHSRLQWVDWWKHNQHHVDQGULJKWVKRXOGHUZLWKEUHDNLQ RWKHUZLVHYHU\JRRGFRQGLWLRQ$' 

207


431 429

428 430

428 1DGHO PLW }J©UOLFKHP $XIVDW] &DOLPD    Q &KU + FP 7XPEDJD *ROG FD  6LOEHU FD   0DVVLYH sehr fein und detailreich gearbeitete Nadel, am oberen Schaf tende mit sieben übereinanderliegenden, ornamental ziselierten Bändern verziert, darüber Teller als Basis für einen hockenden Krieger mit kleinem Schild und Stab, der eine helmartige Kopf bedeckung trägt. Seine Ohren sind mit frei gearbeiteten Ringen JHVFKP©FNWDP5©FNHQ$XIK”QJHVHLQ)RUPHLQHV5HSWLOV Augen und Mund der Figur sind durchbrochen gearbeitet. Ge UHLQLJWLQWDNW u Provenienz: Ex Sammlung Dr. W. G., München; ex Hermann Historica, Auk tion 71, 2015, Los 3775; aus Bayerischem Privatbesitz, übernommen aus der 6DPPOXQJGHV(KHPDQQHV(UZRUEHQLP.XQVWKDQGHOLQGHQHU-DKUHQ Calima gold dipper. Long tapering shaft terminating in a banded neck sur mounted by a warrior holding a staff and a small shield. He wears a crested helmet and free hanging earrings. Projecting zoomorphic loop on the back. ,QWDFW$'

429 )LJXU HLQHV :©UGHQWU”JHUV 7DLURQD    Q &KU + FP7XPEDJD *ROGFD6LOEHUFD 6WDUNVWLOL sierte Figur eines beleibten Würdenträgers, die Hände auf den runden Bauch gelegt; auf dem breiten, rechteckigen Kopf sitzt HLQ~DFKHU+XWPLW]ZHLKRFKDXIUDJHQGHQ)O©JHOQ=ZHL2KU VSXOHQDOV]ZHL3HUOHQJHVWDOWHWH$XJHQVRZLH1DVHQXQG/LS SHQS~RFN VFKP©FNHQ GDV *HVLFKW (LQ EUHLWHU 6FKOLW] DQ GHU Unterseite. Gereinigt, intakt. 600,–

208

432

Provenienz: Ex Sammlung Dr. W. G., München; ex Hermann Historica, Auktion 71, 2015, Los 3777; aus Bayerischem Privatbesitz, übernommen DXVGHU6DPPOXQJGHV(KHPDQQHV(UZRUEHQLP.XQVWKDQGHOLQGHQHU Jahren. *ROGVWDWXHWWHRIDURXQGJRGGHVVZHDULQJD~DWKDWZLWKKLJK0LFNH\0RXVHw HDUVLQ}OLJUHHZRUN7KHIDFHDQGHDUVLVGHFRUDWHGZLWKVSRROVOLSSHJDQG QRVHRUQDPHQW:LGHVORWRQWKHXQGHUVLGH7DLURQD$'

430 6LW]HQGHU 0DQQ PLW .RUE J  4XLPED\D    Q &KU+FP7XPEDJD *ROGFD6LOEHUFD +RKO gearbeitetes Figürchen eines hockenden Mannes, bekleidet mit HLQHP*HZDQGPLW6FKDFKEUHWWPXVWHU'HNRUGLHDQJHZLQNHO ten Arme auf die Knie gestützt. Das Gesicht mit der Hakennase und dem halbgeöffneten Mund ist gut durchgearbeitet; auf dem Kopf trägt der Mann eine Kappe mit drei Längsrippen. Das Ge ~HFKWGHVUXQGHQ.RUEHVDXIGHP5©FNHQLVWGXUFKIHLQH=LVH OLHUXQJHQ DQJHJHEHQ =ZHL NOHLQH /¤FKHU LP .RUEJH~HFKW DXI dem Rücken, sonst intakt. 600,– Provenienz: Ex Hermann Historica, Auktion 71, 2015, Los 3773; ex Samm lung Dr. W. G., München; aus Bayerischem Privatbesitz, übernommen aus GHU6DPPOXQJGHV(KHPDQQHV(UZRUEHQLP.XQVWKDQGHOLQGHQHU Jahren. Quimbaya male basket carrier made from Tumbaga, hunchback leaning foward, both hands placed at the knees, wearing a chequerboard patterned JDUPHQWDQGDWULSDUWHGFDS7KHEDFNLVIRUPHGE\DVHPLFLUFXODU}OLJUHH crafted basket. Two minor holes in the basket, otherwise excellent condition. $'


431 Kleiner Hirsch. ,QND    Q &KU + FP / FP 7XPEDJD)LOLJUDQJHDUEHLWHWH0LQLDWXU}JXUHLQHVNOHLQHQ+LU schen, vermutlich Teil eines größeren Anhängers. Am Rücken kleines Loch zur Anbringung, ein Bein fehlt. 1.400,– Provenienz: Ex Sammlung E. S., Schweiz, erworben 1980. Seit Anfang der 2000er Jahre in Privatbesitz Deutschland 7XPEDJDPLQLDWXUH}JXUHRID}OLJUHHGHHURQHOHJPLVVLQJRWKHUZLVHLQWDFW 433

432 6WHKHQGHU0DQQ,QNDQ&KU+FP0DVVLYHV 6LOEHU0LQLDWXU}JXUHLQHVVWHKHQGHQQDFNWHQ0DQQHVPLWHUL JLHUWHP*OLHGGHUVHLQH+”QGH©EHUGHQ%DXFKJHOHJWKDW(U trägt Ohrringe und ein Kopfband. Intakt. 800,– Provenienz: Ex Christie`s Paris, vor 2010 erworben. Ex Privatbesitz C.C. 0LQLDWXUHVLOYHU}JXUHRIDVWDQGLQJQDNHGPDQZLWKHUHFWPDOHPHPEHU ,QWDFW,QFD$'

433 'UHL6LOEHUJHI”gHInka oder kolonial, 1535 n. Chr. oder später. a) Ø 10,5cm. Silber, gehämmert. Runde Schale mit gewölbtem Boden. Intakt. b) Ø 4,6cm. Silber, gehämmert. Kleines rundes 6FK”OFKHQ ,QWDNW F  + FP .OHLQHV $XIVDW]VW©FN PLW 5DV VHOIXQNWLRQ ~DFKH 6FKDOH DOV REHUHU $EVFKOXVV XQWHQ NOHLQHV Befestigungsloch. Intakt. 6W©FN 900,– Provenienz: Privatsammlung U. C.; 1988 gekauft. Seitdem in Deutschland. 7KUHHKDPPHUHGVLOYHUREMHFWVSRVVLEO\,QFDD 5RXQGHGERZOZLWK~DWWHQHG everted rim. Intact. b) Miniature bowl. Intact. c) Part of an attachment with rattle function. Intact. A.D. 1500 or later. 3 pieces!

434 Sammlung von silbernen Gewandnadeln. ,QND    Q Chr. a) L je 11,8cm. Silber. Zwei Gewandnadeln, am oberen (QGH MHZHLOV PLW HLQHP 9RJHO YHU]LHUW  6W©FN  ,QWDNW E  / FP6LOEHU'UHL*HZDQGQDGHOQPLW.Q”XIHQDPREH UHQ(QGH 6W©FN ,QWDNWF /XQGFP6LOEHU=ZHL *HZDQGQDGHOQ GLH DP REHUHQ (QGH O¤IIHOI¤UPLJ DXVODXIHQ  Stück). Intakt. d) 14,5 und 14cm. Silber. Zwei Gewandnadeln, eine mit sanduhrförmigem Aufsatz aus Tumbaga, die andere mit YHUGLFNWHP(QGH 6W©FN ,QWDNWH /FP.U”IWLJH1DGHO PLWEUHLWHPVFKHLEHQI¤UPLJHQ(QGH6W©FN 600,–

434

Provenienz: Privatsammlung U. C.; zwischen 1975 und 1985 erworben. Seitdem in Deutschland. Collection of silver robe pins with different shaped ends. All in excellent con GLWLRQ,QFDFD$'10 pieces!

435 (LQ3DDU$UPVSDQJHQ&DOLPD6WLOFLUFDQ&KU+ FP % FP .XSIHU JHK”PPHUW *HERJHQHU $UPVFKPXFN mit vertikal verlaufenden Reihen von Punktkreisen, die wohl Sonnen symbolisieren sollen. Zwei seltene Objekte! Jeweils zwei seitliche Löcher, Haltedraht neu, intakt. 800,– Provenienz: Privatsammlung U. C.; vom Sammler Leif Sjöberg, Stockholm, um 2005 erworben. 3DLURIKDPPHUHGFRSSHUEDQJOHV,QWDFWWZRVLGHKROHVHDFK&DOLPD6W\OH FD$'

435

209


438

436 Stockknauf. &KDQFD\ FLUFD    Q &KU + RKQH 6RN kel 25cm, H Sockel 12cm. Holz. Oberteil eines „Rasselstabes“ in Form eines langgeschwänzten Affen, der auf einer runden Scheibe sitzt und mit beiden Pfoten eine Frucht umklammert hält. Seltenes Objekt! Vertikal verlaufender Sprung im Holz, sonst intakt. 900,– Provenienz: Privatsammlung U. C.; 1975 vom Sammler erworben, seitdem in Deutschland. &DUYHGNQRERIDZRRGHQVWDIILQIRUPRIDORQJWDLOHGPRQNH\VLWWLQJRQD round disk. One vertical crack in the wood, otherwise intact. Chancay, circa $' 436

 'UHL .DON*HI”gH PLW 6SDWHO D  + FP %DOVD+RO] XQG Bindfaden. Kalkbehälter, in Form eines hockenden Mannes ge schnitzt, dessen Körper eine kleine Tonne bildet. Kopf, Hände und die nach außen gedrehten Fußsohlen sind fein ausgearbeitet. ,QWDNW+XDULQ&KUE +RKQH6SDWHOFP%DO VD+RO] 3HUOPXWW XQG %LQGIDGHQ .DONEHK”OWHU LQ )RUP HLQHU 6DQGXKUPLWUXQGHQ3HUOPXWW(LQODJHQ.DONVSDWHODXV.XSIHU 9LHU(LQODJHQIHKOHQVRQVWLQWDNW+XDULQ&KUF + PLW6SDWHOFP+HOOHV+RO]6FKPDOHUXQYHU]LHUWHU.DONEH K”OWHUPLWHLQHP.XSIHUVSDWHOGHUDPREHUHQ(QGHLQGLH)RUP eines pickenden Vogels ausläuft. Bindfaden neu, intakt. Chimu / /DPED\TXHQ&KUDrei seltene, sehr gut erhaltene Objekte! 600,– Provenienz: Privatsammlung U. C.; vom Sammler auf verschiedenen Reisen zwischen 1975 und 1990 erworben. Seitdem in Deutschland. 7KUHH H[WUDRUGLQDU\ DQG RULJLQDO VPDOO OLPHVFDOH YHVVHOV D  %DOVDZRRG container depicting a crouching man in form of a little barrel; intact. Huari, $'E 6DQGFORFNVKDSHGFRQWDLQHUPDGHIURP%DOVDZRRGDQG PRWKHURISHDUOLQOD\VZLWKFRSSHUVSDWXODVRPHSLHFHVRIWKHLQOD\PLVVLQJ RWKHUZLVHLQDYHU\JRRGFRQGLWLRQ+XDUL$'F 2EORQJZRRGHQ container with spatula topped by a seated bird. Tying threat modern, very well SUHVHUYHG&KLPX/DPED\HTXH$'3 pieces!

438 Keulenkopf. &KDYLQFLUFDY&KUkFDFP)HLQHU grauer Stein. Runder, fein bearbeiteter Keulenkopf mit breiter Öffnung, an den Seiten mit sechs spitz zulaufenden Zapfen be VHW]W,QWDNW u Provenienz: Privatsammlung U. C.; seit 2000 in Deutschland. Aus hartem Stein gearbeitete Keulenköpfe ersetzten Metallwaffen in der Früh ]HLWGHUDOWDPHULNDQLVFKHQ.XOWXUHQ(VLVWVHKUZDKUVFKHLQOLFKGDVVDXI wändiger gestaltete Objekte wie dieses nicht zum Kampf verwendet wurden, sondern als Zeremonialwaffen dienten. 

210

Fine carved Chavin stone mace head, the shaft with six spiky projections. ,QWDFW%&


439

439 *URgHUKRFNHQGHU0DQQ&ROLPDQ&KU+FDFP +RKO}JXUDXV7RQPLW5HVWHQU¤WOLFKHUXQGVFKZDU]HU%HPD OXQJ *URgH 7RQ}JXU PLW EUHLWHQ 6FKXOWHUQ XQG RYDOHP *H sicht, scharfer, vorspringender Nase und geschlitzten Augen. 'HU0DQQWU”JWHLQHYLHUJHWHLOWH~DFKH.DSSHGLH$UPHUXKHQ auf den Oberschenkeln. Hinten zwei Stützen. 0LW7/$QDO\VH Teile der Arme und des rechten Beines ergänzt. 500,– Provenienz: Ex Sammlung Dr. W. G., München; ex Gorny & Mosch, München Auktion 275, 2020, Los 544; ebenda, Auktion 248, 2017, Los  H[ 6DPPOXQJ 3URIHVVRU 'U *©QWKHU 0DUVFKDOO +DPEXUJ    HUZRUEHQ]ZLVFKHQXQG /DUJHKROORZFHUDPLF}JXULQHRIDVHDWHGPDQZLWKDSURPLQHQWVKDUSQRVH DQGEURDGVKRXOGHUV:LWKWUDFHVRIUHGEURZQDQGEODFNSDLQWRQWKHVXUIDFH 7ZRVXSSRUWVDWEDFN&ROLPD$'5LJKWOHJDQGULJKWDUPSDUWLDOO\ restored. :LWK7/DQDO\VLV

440

440 Kniende schwangere Frau. -DOLVFR3URWRNODVVLNFLUFDY Q&KU+FP6FKZHUH+RKO}JXUPLWHLQHP.DROLQEHU]XJ XQGVWUHL}JHU%HPDOXQJLQU¤WOLFKHPXQGGXQNOHP%UDXQ6WDWX ette einer knienden nackten Frau mit geschwellten Brüsten, die beide Hände auf ihren gewölbten Bauch gelegt hat. Sie ist am Oberkörper mit einem Streifenmuster tätowiert; an den Schul WHUQ VLQG KDOENXJHOLJH 7DWWRR1DUEHQ VLFKWEDU 8P GHQ +DOV trägt die Frau ein dreireihiges Band. Der langgezogene Kopf mit GHQ7DWWRR1DUEHQDXIGHQ:DQJHQVFKOLHgWPLWHLQHUVWU”KQL gen, nackenlangen Frisur ab. Selten in dieser Erhaltung! Intakt. 1.100,– Provenienz: Ex Sammlung A. R. W. -DOLVFRPDVVLYHFOD\IHPDOH}JXUHLQIRUPRIDSUHJQDQWNQHHOLQJQDNHGZRPDQ holding her belly. Her upper body and the elongated head are covered with WDWRRVFDUVJOREXODUUDLVHGDWKHUVKRXOGHUV,QWDFWFD%&$'

211


441

443

441 Stehende Frau. &ROLPDY&KU+FP7RQPLW Resten schwarzer Bemalung. Brettartige Figur einer stehenden nackten Frau mit zwei seitlich abstehenden Armstummeln, halbkugeligen Tätowiernarben an den Schultern, sehr langen Beinen und einem kurzen Körper. Der langgezogene Kopf mit den kaffeebohnenartigen Augen und der vorspringenden Nase ist von einer Art Turban bekrönt. Intakt. 800,– Provenienz: Ex Christie‘s, Paris Auktion am 14. Juni 2004, Los 384. &ROLPD IHPDOH FOD\ ERDUGOLNH }JXUH VWDQGLQJ ZLWK DUP VWXEV KHOG DZD\ IURPWKHVLGHV6KHZHDUVDWXUEDQOLNHVOXQJKHDGEDQGDQGHDUVSRROVKHU VKRXOGHUVDUHFRYHUHGZLWKUDLVHGWDWWRRV,QWDFW3URWRFODVVLFVW\OHFD 100 B.C.

442 6LW]HQGHU0DQQ4XLPED\DFLUFDQ&KUFP 5¤WOLFKHU 7RQ PLW 7DWWRRw%HPDOXQJ LQ VFKZDU]HQ /LQLHQ Massive Figur eines sitzenden Mannes in reduzierter, rechtek kiger Grundform, die Hände sind auf die Knie gelegt; nur die vorspringende Nase und das Geschlecht sind ausmodelliert, der Mund ist durch eine horizontale Ritzlinie angegeben. Das Kopfteil ist oben vierfach durchbohrt, wobei zwei Bohrungen GLH $XJHQ ELOGHQ %RKUXQJHQ }QGHQ VLFK DXFK DP 2EHUNRSI DP OLQNHQ 2EHUDUP XQG DP $QVDW] GHV OLQNHQ %HLQHV $UP .QLH XQG +DQGJHOHQNH VLQG GXUFK EUHLWH (LQULW]XQJHQ PDU kiert. Rechter Arm komplett restauriert, Restaurierungen auch LP%UXVWXQG%DXFKEHUHLFK u 442

212

Provenienz: Ex Privatbesitz A. H., München. Aus deutschem Auktionshaus, 1980er Jahre.


4XLPED\DVHDWHG}JXUHZLWKORQJOHJVDQGKDQGVSODFHGDWWKHNQHHVHDFK limb decorated by tightly constricted bands, the broad face with a hooked nose, pierced along the top of the head and left side of the body. Faint remains of linear tattoos, antique nosering. Right arm completely new replaced, restorations in WKHFKHVWDQGDEGRPLQDODUHD&LUFD$'

443 6LW]HQGHU 0DQQ PLW 3RQFKR Moche, mittlere Phase, circa 300 Q&KU+FP7RQPLWURWEUDXQHPEHU]XJXQG%H malung in Rotbraun und Beige. Steigbügelgefäß in Form eines Mannes, der einen ausgebreiteten Poncho vor seinen Körper hält. Das bemalte Stoffstück zeigt ein stilisiertes Augenwesen. Auf seiner linken Seite sind noch Reste schwarzer Bemalung zu erkennen. Der Mann trägt ein scheibenförmiges Ohrgehänge, auf der Rückseite sind noch Streifen seiner Bekleidung erhalten. Auf der Rückseite leicht restauriert, sonst intakt. 800,– 3URYHQLHQ] ([ +LUVFK 1DFKI 0©QFKHQ $XNWLRQ   /RV  H[ Ketterer Auktion 138, 1989, Los 200; ex Sammlung Dr. J. Ernst Fischer. 9JO)$QWRQ$OW3HUXXQGVHLQH.XQVW  $EE Mochica stirrup clay vessel in form of a seated man holding holding up a cloth with both hands. On the robe there is the representation of a stylized „eye creature“. Professional restoration at the back, otherwise intact. Middle 3HULRGFD$'

444 /”FKHOQGHU:©UGHQWU”JHU0RFKHPLWWOHUH3HULRGHQ Chr. H 25cm. Ton mit rotbrauner und beiger Bemalung. Steig E©JHOJHI”gLQ)RUPHLQHVVLW]HQGHQ:©UGHQWU”JHUV(UKDWGLH Hände auf die Knie gelegt und trägt als Kopfbedeckung eine hohe Mütze, die im Nacken als lange Lasche ausläuft. Das Ge sicht mit der vorspringenden Nase zeigt einen lächelnden Mund XQGHLQHQ]XIULHGHQHQ$XVGUXFN,QWDNW u

444

3URYHQLHQ]3ULYDWVDPPOXQJ8&JHNDXIWEHL*DOHULH$OW$PHULND8OULFK Hoffmann, Stuttgart, um 1990. 0LGGOH0RFKLFD}JXUDOYHVVHOLQIRUPRIDVHDWHGGLJQLWDU\ZHDULQJDFDSH DQGDKLJKFDS+LVVPLOLQJIDFHUDGLDWHVVDWLVIDFWLRQ,QWDFW$'

445 %OLQGHU0DQQ0RFKHPLWWOHUH3HULRGHFLUFDQ&KU +FDFP7RQPLWURWEUDXQHPEHU]XJXQGFUHPHIDUEHQHU Bemalung. Steigbügelgefäß in Form eines sitzenden Mannes mit leeren Augenhöhlen, der einen Umhang und eine Mütze mit hohem, runden Knauf trägt. Seine Mundwinkel sind nach unten gezogen; der Gesichtsausdruck wirkt resigniert. Intakt. 800,– Provenienz: Privatsammlung U. C.; erworben 2009 von Dr. Ernst J. Fischer, Geldern. 0LGGOH0RFKLFD}JXUDOYHVVHOLQIRUPRIDVHDWHGEOLQGPDQ+HZHDUVD wide cape and an extraordinary headgar consisting of a rounded cap and a YROXPLQRXVEREEOH,QWDFW$'

445

213




446

446 .RSIJHI”g0RFKHFLUFDQ&KU+FDFP7RQPLW Bemalung in Rotbraun, Creme und Schwarz. Steigbügelgefäß in Form eines menschlichen Kopfes mit gewölbten Augen, vor springender Nase und einem geöffneten breiten Mund, in dem die Zunge und eine Reihe großer, raubtierhafter Zähne sichtbar sind. Der Mann trägt plastisch modellierte runde Ohrringe und nackenlanges Haar, das unten eine Stütze für das Gefäß bildet. (LQEUHLWHV%DQGGDVPLWDEJHVFKODJHQHQ0HQVFKHQN¤SIHQYHU ziert ist, umläuft den Kopf. Selten in dieser Erhaltung! Minimaler $XVEUXFKDP1DFNHQKDDUKLQWHQVRQVWLQWDNW u Provenienz: Ex Privatbesitz A. H., München. Aus dem Besitz der bayerischen Finanzbehörden 2019. In Deutschland seit vor 1990. Moche stirrup vessel in form of a human head, painted in reddish brown, cream and black. Eyes, nose, ears and the wide mouth are plastically modelled; predatory teeth shown in the mouth. A broad band with human heads cut off LVFLUFXODWLQJWKHKHDGFD$'Excellent condition!

 (URWLVFKHV 3DDU DXI HLQHP 5RKU~Rg0RFKH    Q &KU / FP 7RQ PLW U¤WOLFKHP EHU]XJ XQG 5HVWHQ VFKZDU]HU Bemalung. Darstellung eines Paares in sexueller Vereinigung DXI HLQHP 5RKU~Rg OLHJHQG 6HOWHQHV 2EMHNW 0LW 2ULJLQDOEH VW”WLJXQJGHV9HUN”XIHUV GRUWE\]DQWLQLVFKw  Geklebte Brüche, 2EHU~”FKHWHLOVDEJHULHEHQ u Provenienz: Ex Sammlung A. R. W., Berlin; erworben bei Kaufmann‘s An tiques, Tel Aviv, am 9.3. 1971. Vgl. zu diesem Objekt: G. R. Willey, Das Alte Amerika. Propyläen Kunstge schichte Band 19, Abb. 391b und S. 333.

Provenienz: Privatsammlung U. C.; in Deutschland um 1995 gekauft. Early Mochica vessel of unusual form with a cylindrical shaped body sur PRXQWHGE\DVHDWHGSHOLFDQ,QWDFWFD%&

449 Liegendes Lama. 0RFKH 0LWWOHUH 3HULRGH FLUFD    Q &KU / FP 7RQ PLW EUDXQHP EHU]XJ XQG FUHPHIDUEHQHU Bemalung. Steigbügelgefäß in Form eines ruhenden Lamas, das auf seinem Rücken einen kleinen Sack trägt. Der Ausdruck des fein modellierten Kopfes mit den hochstehenden Ohren er scheint aufmerksam. Intakt. 800,– Provenienz: Privatsammlung U. C.; gekauft von Ulf Mietens, Bad Salzgitter, 1995. Middle Mochica Lama vessel, resting with goods, with perked ears, large ULPPHGH\HVDQGDQDOHUWH[SUHVVLRQ,QWDFWFD$'

450 =ZHL*HI”gHLQ0XVFKHOIRUPXQGHLQH6SRQG\OXV0XVFKHOa) H FP7RQPLWEHU]XJDXV.DROLQ6WHLJE©JHOJHI”gGHVVHQ .¤USHUDXVHLQHU6WURPEXVXQGHLQHU6SRQG\OXV0XVFKHOEH steht. Am Henkelansatz und Ausguss restauriert, sonst intakt. /DPED\HTXHFDQ&KUE +FP7RQPLWURW EUDXQHP EHU]XJ 6WHLJE©JHOJHI”g LQ )RUP YRQ ]ZHL JHJHQ HLQDQGHUVWHKHQGHQ6WURPEXV0XVFKHOQ5HVWDXULHUWDP$QVDW] GHV$XVJXVVHVXQGDQHLQHP+HQNHO0RFKHVS”WHUH(SRFKH FDQ&KUF /FP6SRQG\OXV0XVFKHOLQWDNW3 6W©FN 800,–

&RXSOHLQVH[XDOLQWHUFRXUVHO\LQJRQDSLSHUDIW0DVVLYHFOD\}JXUHWUDFHV of black painting, surface partly worn off and three glued breaks. Moche III 6W\OHFD$'

Provenienz: Privatsammlung U. C.; gekauft bei Herrn Kotalla, Haigerloch, um 1990 und von Leif Sjöberg, Stockholm, 2010, seit 1985 in seinem Besitz. 6WURPEXV E]Z 6SRQG\OXV0XVFKHOQ GLHQWHQ DOV :DVVHU XQG )UXFKWEDU keitssymbole.

448 *HI”g PLW VLW]HQGHP 3HOLNDQ Moche, frühe Periode, circa 300 Y&KU+FP7RQPLWURWEUDXQHPEHU]XJ6WHLJ bügelgefäß in Form eines Pelikans, der auf einem zylindrischen .¤USHUPLWVHQNUHFKWHQ5LHIHOXQJHQVLW]W,QWDNW u

Two vessels in form of Spondylus and Current Bus shells: a) Lambayeque, restored at spout and handle attachments, other in good condition. ca. A.D. E 0RFKH/DWH3HULRGUHVWRUHGDWVSRXWDQGKDQGOHDWWDFKPHQW RWKHUZLVHLQWDFWFD$',QDGGLWLRQDQRULJLQDO6SRQG\OXVVKHOO 3 pieces!

214


448

449

451 *URgH -DJXDU9DVH *XDQDFDVWH1LFR\D 3HULRGH ,9  9 FD    Q &KU + FP 3RO\FKURP EHPDOWHU 7RQ %LU nenförmiges Gefäß mit hohem, konischen Standfuß. Im oberen Bereich plastisch herausgearbeiteter Kopf eines Jaguars, darun ter die angedeutete Fellzeichnung des Tieres. 0LW*XWDFKWHQYRQ $QWRQ6FKQHOO$P$XVJXVVJHULQJI©JLJUHVWDXULHUWXQG2EHU~” che gereinigt. 600,– Provenienz: Ex Gorny & Mosch, München Auktion 275, 2020, Los 555; erworben bei Auktionshaus Metz, Heidelberg; Privatsammlung A. S. Large bulbous vase with plastically applied jaguar‘s head. Minor restauration DWULPDQGFOHDQLQJRWKHUZLVHLQYHU\JRRGFRQGLWLRQ*XDQDFDVWH1LFR\D FD$'

4500

451

215


452 )HLQ EHPDOWHV 6WHLJE©JHOJHI”g Moche, Mittlere Periode, circa Q&KU+FP7RQPLWKHOOEUDXQHPEHU]XJXQG %HPDOXQJLQIHLQHQURWEUDXQHQ/LQLHQGLHHLQJH~©JHOWHV)D belwesen (Dämon) mit Schlangenkopf und Felidenmaul zeigt, das menschliche Arme und Beine hat und sich um den ganzen Gefäßkörper windet. Kleiner Abbruch am Ausguss und zwei winzige Beschädigungen am Standring, sonst intakt. 900,– Provenienz: Privatsammlung U. C.; gekauft 1995 von Ulf Mietens, Bad Salz gitter. 0LGGOH0RFKLFDYHVVHOSDLQWHGZLWK}QHEUXVKLQFUHDPDQGUHGGLVKEURZQ The illustration shows a mythical snake with human limbs which stretches DURXQG WKH ZKROH YHVVHO 6RPH LQVLJQL}FDQW FUDFNV DW VSRXW DQG ERWWRP RWKHUZLVHYHU\JRRGFRQGLWLRQ&D$'

453 'UHL1DVFD*HI”gHa) H 14,5cm. Ton mit Bemalung in Orange, Rotbraun und Schwarz auf beigem Untergrund. Bügelkanne mit doppeltem Ausguss, der Körper bemalt mit Seevögeln und Fi VFKHQ,QWDNW)U©KH3KDVHFDQ&KUE +FDFP Material wie a. Schale mit Maskenwesen. Intakt. Mittlere Pha VHQ&KUF +FP0DWHULDOZLHD7DVVHLQ)RUP eines abgeschlagenen Menschenkopfes. Winzige Beschädigung DQ GHU 1DVH VRQVW LQWDNW 6S”WH 3HULRGH    Q &KU 3 6W©FN u

452

3URYHQLHQ]3ULYDWVDPPOXQJ8&JHNDXIWXPYRQ*DOHULH$OW$PH rika, Ulrich Hoffmann, Stuttgart. Three Nazca polychrome vessels: a) Two spouted jug decorated with birds DQG}VKHV,QWDFW(DUO\3HULRGFD$'E %RZOZLWKP\WKLFDO PRQVWHU,QWDFW0LGGOH3HULRGFD$'F &XSLQIRUPRIDVHYHUHG human head. Minute damage at nose tip, otherwise intact. Late Period, ca. $'3 pieces!

453

454 Kanne mit Götterbildern. Nasca, späte Periode (proliferer Stil), FDQ&KU+FP%DQGKHQNHONDQQHPLWKRKHP Ausguss. Ton mit Bemalung in Schwarz und Dunkelbraun auf beigem Grund mit drei Götterbildern in Mäandersymbo lik (Wassergötter?), aus deren geöffneten Mündern jeweils zwei lange Zungen heraushängen. Zwei Restaurierungen am Henkel, sonst intakt. 600,– Provenienz: Privatsammlung U. C.; 1978 vom Sammler bei J. P. Cabrera erworben. Seitdem in Deutschland. 3XEOL]LHUWLQ8&DUOVRQ'LH*¤WWHUELOGHUGHV$OWHQ3HUX,NRQRJUDSKLVFKH Interpretationen (2020) S. 50 und Abb. 80. Nazca polychrome vessel painted with three images in meander symbolism. 5HVWRUDWLRQDWVWUDSKDQGOHRWKHUZLVHLQWDFW/DWH3HULRG$'

455 Drei olmekische Keramikobjekte. a) H 10cm. Grauer schwerer Ton. Lächelnder Kopf mit schräggestellten Augen, stumpfer Nase und leicht geöffnetem Mund; das Haar voluminös. Intakt. =HQWUDO9HUDFUX]*ROIN©VWHY&KUE +FP+HOO brauner Ton. Schmaler, hoher Kopf mit schräggestellten Augen, DXIJHZRUIHQHQ/LSSHQXQGKDOEJH¤IIQHWHP0XQG(LQZXOVWDU WLJHV%DQGOLHJWXPVHLQHQ.RSI,QWDNWY&KUF + 9cm, Ø 10cm. Hellbrauner Ton. Napf mit hochgezogenem Griff und Ritzdekoration. Am Griff restauriert, sonst intakt. ca. 900 Y&KU6W©FN u 454

216

Provenienz: Ex Gorny & Mosch, München Auktion 275, 2020, Los 553; ex Sammlung Seitz, in Deutschland seit ca. 1975, danach Sammlung A. S.


Three early Olmec terracotta objects: a) Smiling head, 9HUDFUX] &HQWUDO &RDVW DUHD LQWDFW    %& E  6OHQGHUKHDGLQWDFW%&F 6PDOOGLVKZLWK raised grip, restauration at handle, otherwise intact. ca. 900 %&3 pieces!

456 Kleiner dekorierter Napf. 2OPHNLVFK v. Chr. H 5cm, Ø 11cm. Runde Schale mit ge rade hochgezogenem Rand, auf der Außenseite im unteren Bereich in Ritzdekor, mit rötlichem Zinnober bemalt. Die Verzierung weist typisch olmekische Motive wie das Andreaskreuz und die stilisierten Jaguarkrallen auf. Das Abschluss band sowie die Innenseite sind schwarz bemalt und poliert. 0LW*XWDFKWHQYRQ$QWRQ6FKQHOOXQG Kopie der Originalrechnung! Intakt. 650,–

455

Provenienz: Ex Gorny & Mosch, München Auktion 275, /RVLQ'HXWVFKODQGVHLWVHLW6DPP OXQJ$6HUZRUEHQEHL.HWWHUHU$XNWLRQ3U”NROXP bische Kunst, Juni 1988, Los 2. (DUO\ 2OPHF FDUYHG VPDOO ERZO RQ ~DWWHQHG EDVH ZLWK XSZDUG~DULQJULP,QWDFWFD%&

 Große Schale. 0D\D 6S”WNODVVLN    Q Chr. Ø 19,5cm, H 8,5cm. Ton mit rötlichem EHU]XJ XQG %HPDOXQJ LQ 6FKZDU] XQG 5RW Schale mit abgerundetem Boden, an der Au ßenseite mit einem umlaufenden Fries bemalt, der abwechselnd einen Gott mit aufwändigem Kopfputz und einen Feliden zeigt, den der Gott am Schwanz gepackt hält. Innenbemalung nicht mehr erkennbar. Mehrere restaurierte Brüche, Farbigkeit sehr gut erhalten. 600,–

456

Provenienz: Ex Sammlung E. P., Bergisches Land. Samm OXQJV]HLWUDXPHU-DKUHGDQDFKZHLWHUKLQLQ)D milienbesitz. In Deutschland seit vor 1980. 0D\DQ SRO\FKURPH ERZO ZLWK URXQGHG ERWWRP ~DULQJ slightly outwards, the outside decorated with a frieze showing alternated a god with a voluminous headgar and a big cat which he holds by the tail. Some restored breaks; interior painting barely discernable, outside colouring very ZHOOSUHVHUYHG$'

458 Kleine Schale. 0D\D 6S”WNODVVLN    Q &KUkFP+FP7RQPLWU¤WOLFKHPEHU zug und Bemalung in Schwarz und Rot. Klei ne, sich nach oben verbreiternde Schale, an der Außenseite mit der zweifachen Darstellung des 0XZDQw9RJHOJHVFKP©FNWGD]ZLVFKHQPRQR chrome Felder. Aus mehreren Fragmenten zu VDPPHQJHVHW]WDP5DQGNOHLQH(UJ”Q]XQJ 500,–



Provenienz: Ex Sammlung E. P., Bergisches Land. Samm OXQJV]HLWUDXPHU-DKUHGDQDFKZHLWHUKLQLQ)D milienbesitz. In Deutschland seit vor 1980. 3RO\FKURPH0D\DQERZOGHFRUDWHGZLWKWKH0XZDwELUG IUDPHGE\PRQRFKURPH}HOGV5HVWRUHGIURPVHYHUDOIUDJ PHQWV$' 458

217


459

0461

460 462

459 'UHL 6FKDPDQHQ RGHU 7”Q]HU 9HUDFUX]    Q &KU D  + FP +RKO}JXU PLW 5HVWHQ U¤WOLFKHU %HPDOXQJ 6WHKHQGHU Mann mit Vogelmaske und einem Hut mit vier Zacken. Nase JHEURFKHQXQGZLHGHUJHNOHEWVRQVWLQWDNWE +FP'HWDLO UHLFK JHIRUPWH +RKO}JXU HLQHV 0DQQHV PLW +XQGHPDVNH XQG breitem Kragen, die Arme vom Körper abstehend. Kleine Ab VFK©UIXQJHQVRQVWLQWDNWF +FP+RKO}JXUPLW5HVWHQU¤W OLFKHU%HPDOXQJ6WHKHQGHU0DQQPLW7UXWKDKQ0DVNH,QWDNW 6W©FN 600,– Provenienz: Ex Sammlung E. P., Bergisches Land. Sammlungszeitraum HU-DKUHGDQDFKZHLWHUKLQLQ)DPLOLHQEHVLW],Q'HXWVFKODQGVHLW vor 1980. 7KUHHGDQFHURUVKDPDQKROORZ}JXUHVPDGHIURPFOD\D 6WDQGLQJPDQ in the mask of a bird. Nose broken and glued, otherwise intact. b) Standing

218

man in the mask of a dog. Minor abrasions. c) Standing man in the mask of DWXUNH\,QWDFW9HUDFUX]FD$'

460 *URgHVWHKHQGH$GRUDQWLQ &XFKLPLOFRw Chancay, circa 1100 Q&KU+FP+HOOHU7RQPLWVFKZDU]HU%HPDOXQJ +RKO}JXUHLQHUVWHKHQGHQ)UDXDXIVW”PPLJHQ%HLQHQGLHNXU ]HQ$UPHPLWGHQQDFKDXgHQJHGUHKWHQ+DQG~”FKHQHUKREHQ auf dem Kopf trägt sie eine hohe, rechteckige Haube, im Ge sicht sind mit brauner Farbe angegebene Tätowierungen sicht bar. Spuren von Bemalung seitlich und am unteren Bereich des Körpers. Selten in dieser Erhaltung! Intakt. 1.500,– Provenienz: Privatsammlung U. C.; 1995 von Bertrand de Parseval, Frankreich, erworben, seitdem in Deutschland.


463

&KDQFD\KROORZFOD\}JXUHRIDZRPDQVXSSRUWHGRQWDOOF\OLQGULFDOOHJVZLWK diminutive arms raised and palms cupped, the face with cheeks tattoos wearing DUHFWDQJXODUKHDGGUHVV9HU\ZHOOSUHVHUYHG$'

461 Stehende Frau. 0RFKHVS”WH3KDVHFLUFDQ&KU+ FP7RQPLWEUDXQHUXQGVFKZDU]HU%HPDOXQJ+RKO}JXUHL ner nackten, stehenden Frau mit einem großen Kopf und einem EUHLW~”FKLJHQ *HVLFKW PLW 7DWWRR%HPDOXQJw DQ $XJHQ XQG Mund. Auf dem Kopf trägt sie eine hohe, halbrund abschlie ßende Kappe. Die kurzen Arme liegen auf der Brust. Winzige Bestoßungen, sonst intakt. 1.200,– 3URYHQLHQ]([3ULYDWEHVLW]$+0©QFKHQ$XV.HWWHUHU$XNWLRQHU Jahre. )HPDOHFOD\}JXUHSDLQWHGLQEODFNDQGEURZQZHDULQJDWDOOKHDGGUHVV6KH VWDQGVULJLGO\ZLWKDUPVIROGHGWRFKHVWWKHZLGHIDFHGHFRUDWHGZLWKWDWRR SDLQWLQJ0LQLPDOGHQWVRWKHUZLVHLQWDFW0RFKH9FD$'

462 (VWROLFD RGHU$WODWO XQG]RRPRUSKHU.QDXI0RFKH Y &KU D  .RPSHQGLXP EHVWHKHQG DXV GHU (VWROLFD / FP  XQGHLQHP3IHLO /FP $XIGHP+RO]VWDEVLW]WDQGHPHLQHQ (QGHHLQDXV.QRFKHQJHIHUWLJWHU.QDXIDQGHPDQGHUHQHLQH Halterung aus Knochen in der abstrahierten Gestalt eines Krie gers. Der Pfeil aus Bambusrohr (der im Original länger war) ist mit einer Spitze aus scharf zugeschliffenem Stein versehen. b) H RKQH6RFNHOFP+6RFNHOFP.QRFKHQ+DNHQHQGHHLQHU DQGHUHQ(VWROLFDLQ)RUPHLQHV7LHUHVPLW5HSWLOLHQNRSIGXUFK bohrt. Die Augen waren vermutlich eingelegt. Hinterer Teil ab gebrochen, auf schwarzen Holzsockel montiert. Moche, ca. 300 Y&KU6W©FN Holzstab und Bindfaden modern. 600,– Provenienz: Privatsammlung U. C.; auf einer Reise 1984 erworben, danach in Deutschland. a) Partly reconstructed „Estolica“ with the modern wood shaft and the ancient ERQH}QLDO7KHWLSRIWKHEDPERRFDQHDUURZLVDQWLTXH0RFKH B.C. b) Finial of a spearthrower made from bone in form of a small lizzard. The rear part broken off; the eyes were probably inlaid. Mounted on a black ZRRGHQEDVH(DUO\0RFKLFDFD%&2 pieces! The spear thrower is one of the most common weapons of the cultures of Ancient Latin America. Moche spear throwers often had a decorated end that might have had a talisman function that lent power to the projection.

464

463 =ZHL:DDJHEDONHQDXV+RO]PLW1HW]HQ&KDQFD\FLUFD 1400 n. Chr. a) L 15,5cm. Dunkles Holz. Waagebalken mit ge schnitztem Vogeldekor, daran zwei originale Netze, in der Mitte Faden zur Aufhängung. Intakt. b) L 12,5cm. Dunkles Holz. 6FKPDOHU:DDJHEDONHQPLW6FKQLW]ZHUNLP=LFN=DFN'HNRU daran zwei originale Netze, in der Mitte Faden zur Aufhängung. Intakt. 6W©FN 600,– Provenienz: Privatsammlung U. C.; vom Sammler bei einem Händler 1980 erworben, danach in Deutschland. Two wooden carved balance beams with the original cradle nets. Both in YHU\JRRGFRQGLWLRQ&KDQFD\FD$'Very rare objects in a remarkable good condition!

464 Sammlung von vier praekolumbischen Waagebalken. Chancay, ]HQWUDOH RGHU Q¤UGOLFKH .©VWH FLUFD    Q &KU D  / 5,8cm. Holz mit Resten von Bemalung in Pink. Rechteckiger Waagebalken mit offenem Schnitzwerk verziert, das zwei sich gegenüberstehende Seevögel darstellt. Intakt. b) L 11cm. Kno chen. Waagebalken mit offenem Schnitzwerk, das zwei sich ge genüberstehende Reihen von kleinen Affen zeigt, darunter ein Rankenmuster und ein mit schwarzen Kreispunkten verziertes Abschlussband. 6HKU IHLQH $UEHLW In der Mitte geklebt, sonst ausgezeichneter Zustand. c) L 9cm. Knochen. Schmaler Waa gebalken mit Dekor aus zwei Schlangen auf einer mit schwar zen Kreispunkten verzierten Leiste. Alter Aufhängefaden, in der 0LWWHJHNOHEWVRQVWLQWDNWH}OLJUDQH$UEHLWG /FP.OHLQHU schmaler Waagebalken mit offenem Schnitzwerk in einem geo metrischen Muster, darunter Band mit schwarzen Kreispunkten. In der Mitte zur Aufhängung durchbohrt, alter Aufhängefaden an der Seite. Intakt. 6W©FN6HKUVHOWHQH2EMHNWH 600,– 3URYHQLHQ]3ULYDWVDPPOXQJ8&YRP6DPPOHUHUZRUEHQ Seitdem in Deutschland. Collection of four delicately carved Precolumbian scale beams from the Chan cay culture: a) Wooden beam decorated with two seabirds in open carving. ,QWDFWE %RQHPDGHVFDOHEHDPGHFRUDWHGZLWKRSHQFDUYLQJGHSLFWLQJDURZ of monkeys on an ornamental bar with black circle points. Glued break in the PLGGOHRWKHUZLVHLQH[FHOOHQWFRQGLWLRQF %RQHPDGHEHDPZLWKWZRVQDNHV on a bar decorated with circle point. Original thread for hanging, glued break LQWKHPLGGOHLQWDFWG %RQHPDGHEHDPGHFRUDWHGZLWKRUQDPHQWDOSDWWHUQ and circle points. Original thread on one side. Intact. 4 pieces!

219


465 Drei Stirnbinden mit Götterbildern. +XDUL    Q &KU D  k FP % FP )DUELJ JHZHEWHV .RSIEDQG LQ 9HORXU Technik“ mit Darstellung zoomorpher Götterbilder in Form von Feliden in abgeteilten Feldern. Hinten verknotet. Intakt. E kFP%FP%UHLWHVLQKRUL]RQWDOHQ6WUHLIHQJHZHE tes Kopfband mit drei einzelnen frontalen Götterbildern, die ei nen Feliden mit großen Krallen zeigen. Winzige Fehlstellen am Rand, sonst intakt. c) Ø 19,2cm, B 6,5cm. Breites Kopfband aus Baumwolle mit der umlaufenden Darstellung verschiedener zoomorpher Götter auf tiefrotem Grund. Kleine Fehlstelle am Rand, sonst intakt. 6W©FN6HKUVHOWHQLQGLHVHU(UKDOWXQJ u Provenienz: Privatsammlung U. C.; vom Sammler um 1985 im Handel erworben, seitdem in Deutschland. &ROOHFWLRQRIWKUHH+XDULKHDGEDQGVD +HDGEDQGFRPSRVHGRINQRWWHG}EHUV overlaid with cut woolen pile („velour technique“) composed of quadrans with the depiction of zoomorphic gods in form of predatory cats. Extremely good condition, knotted on the back. b) Wide band, woven in horizontal stripes ZLWKWKUHHUHFWDQJXODUFRPSDUWPHQWVVKRZLQJIHOLGHV2QO\RQHPLQRU~DZ and one patching, otherwise intact. c) Wide band, woven in Bordeaux red with DVXUURXQGLQJIULH]HRIGLIIHUHQW]RRPRUSKLFGHLWLHV6PDOO~DZVRWKHUZLVH LQWDFW$'3 pieces! Very rare in this condition!

466 Großes Tuch. 6S”WH 1DVFD  +XDUL HWZD    Q &KU  [ FP *URgHV %DXPZROOWXFK LQ 3ODQJL7HFKQLN %D tik) bemalt mit kleinen beigen Kreisen auf zusammengenähten grünen und roten Quadraten; in der Mitte aneinander gereihte unbemalte Felder, die eine „Treppe“ bilden. Mehrere Fehlstel len, insgesamt sehr guter Zustand, auf grünes Tuch aufgelegt. 800,– Provenienz: Privatsammlung U. C.; in Deutschland 1985; vom Sammler von Carlos Sichra erworben, seit vor 1970. Vgl. dazu: F. Anton, Altindianische Textilkunst aus Peru (1984) Abb. 109. /DUJH1D]FDWH[WLOHIUDJPHQWSDLQWHGLQ%DWLN 7LHG\H WHFKQLTXHZLWKVPDOO beige circles on green and red alternating squares sewn together. In the middle a row of unpainted squares forming a „stair“. Few missing parts, otherwise in DYHU\JRRGFRQGLWLRQ/DWH3HULRGFD

 Großes Partialgewebe. 1DVFDQ&KU[FP$XV $OSDND:ROOHLQ*U©Q5RW%HLJHXQG%UDXQPLWXQWHUEURFKH QHU.HWWXQG6FKXVVI”GHQ7HFKQLNJHZHEW(LQLJHNOHLQH)HKO stellen, sonst sehr guter Zustand, auf braunen Filz aufgelegt. 900,– Provenienz: Privatsammlung U. C., vom Sammler erworben im Handel um 1990, seitdem in Deutschland. 9JO GD]X 8 +RIIPDQQ +UVJ  )UDXHQ GHV $OWHQ $PHULND *DOHULH $OW Amerika, Stuttgart (2001) Abb. auf S. 150. Large Nazca fabric woven in a warb and weft yarns technique. Few missing SDUWVRWKHUZLVHLQDYHU\JRRGFRQGLWLRQ(DUO\SHULRGFD$'

220

468 Baumwolltuch mit aufgestickten Strandkrabben. Chancay, 1000 Q&KU[FPRKQH5DKPHQ[FPPLW5DK men. Strandkrabben in Maschenstickerei aus brauner und roter Wolle, auf einem hellen Baumwolltuch. Sehr seltenes Objekt! Hervorragende Erhaltung! Mit einem schwarzen Textil unterlegt und gerahmt. 800,– Provenienz: Privatsammlung U. C.; 1995 erworben von Bertrand de Parseval, Frankreich, seitdem in Deutschland. Stitched embroidery of brown camelid wool shaping shore crabs. Excellent condition, mounted on a white cotton fabric, laid on a black fabric and framed. ,QWDFW&KDQFD\$'

469 %HPDOWHV7H[WLOIUDJPHQWPLW$IIHQ&KDQFD\Q&KU 68 x 35cm ohne Rahmen, 86,5 x 51cm mit Rahmen. Bemaltes %DXPZROOJHZHEH LQ %UDXQ XQG %HLJHW¤QHQ YHUPXWOLFK 7HLO eines Wandbehangs, mit Darstellungen von langgeschwänzten Affen in quadratischen Feldern alternierend mit einem Quadrat PLW ~RUDOHQ XQG 9RJHO0RWLYHQ LQ HLQHP 6FKDFKEUHWWPXVWHU eingerahmt von geometrisch gestalteten Borten. Seltenes Textilobjekt!(LQLJHNOHLQH)HKOVWHOOHQVRQVWLQWDNW u Provenienz: Privatsammlung U. C.; erworben 1973, seitdem in Deutschland. 5DUH SDLQWHG &KDQFD\ WH[WLOH IUDJPHQW SUREDEO\ SDUW RI D ZDOOKDQJLQJ GHSLFWLQJORQJWDLOHGPRQNH\VVHDWHGLQVTXDUH}HOGVDOWHUQDWLQJZLWKDELUGyV DQG~RZHUGHFRUDWLRQLQDFKHTXHUERDUGSDWWHUQ6RPHPLQRUPLVVLQJSDUWV otherwise in very good condition. Laid on a light coloured fabric and framed. $'

 *URgHV%RUWHQ)UDJPHQW&KDQFD\FLUFDQ&KU [FPRKQH5DKPHQ[FPPLW5DKPHQ*HI”UEWH.D PHOLGHQ:ROOHLQ3LQN2FNHU%UDXQXQG'XQNHOJU©Q,QHLQDQ dergreifendes geometrisches Band mit Vogelmotiven, oben und unten von hellen Streifen gerahmt, breiter Fransenbehang als Abschluss. Intakt; auf dunkelblaues Leinen aufgelegt und ge rahmt. 600,– Provenienz: Privatsammlung U. C.; erworben 1995 von Bertrand de Parseval, Frankreich, seit 1985. Chancay border fragment woven in camelid wool with a pattern of zigzags and DZLGHIULQJH,QWDFWODLGRQDEOXHIDEULFDQGIUDPHGFD$'


465

466



468

469



221


 Federgewebe. Inka, südliche Kü VWHFDQ&KU [FPRKQH5DKPHQ[FP mit Rahmen. Teil eines Feder ponchos mit Resten von blauen und orangen Vogelfedern. Feder besatz mit Fehlstellen, sonst gut erhalten, auf Leinen gelegt und gerahmt. 600,– Provenienz: Privatsammlung U. C.; erworben 1985 von Klaus Baumann, Hamburg, in Deutschland seit 1985. Part of a feather fabric. Trimming with feathers partly lost, otherwise in good condition; laid on a beige fabric and IUDPHG,QFD$'



 Teil eines Ponchos. Inka, circa    Q &KU  [ FP ohne Rahmen, 83 x 51,5cm mit Rahmen. Gefärbte Kameli GHQ:ROOH LQ URWHQ VFKZDU]HQ dunkelbraunen und beigen hori zontalen Streifen gewebt. Intakt; auf schwarzes Gewebe aufgelegt XQGJHUDKPW u Provenienz: Privatsammlung U. C.; er worben von Klaus Baumann, Hamburg, 1988.



Textile fragment, woven in camelid wool. Horizontal stripes in red, black, dark brown and cream. Intact, laid on a black fabric and framed. Inca, ca. A.D. 

 1HW]JHZHEHChancay, circa 1330 Q&KU[FPRKQH Rahmen, 61 x 61cm mit Rahmen. Baumwollgarn in gebrochenem Weiß. Großes Netzgewebe mit 5KRPEHQ0XVWHU XQG NOHLQHQ Quadraten. Intakt, auf dunklen Stoff aufgelegt und gerahmt. 600,– Provenienz: Privatsammlung U. C.; er worben 1975, seitdem in Deutschland. Fragment of Chancay gauze textile wo ven with rhomboid patterns and squares. Intact, laid on a black fabric and framed. FD$'



222


$6,(1



 Kopf des Buddha. .KPHUZRKO/RSEXUL-K+RKQH Sockel 26cm. Sandstein. Sehr fein gearbeitetes lebensgroßes Antlitz mit fast porträthaften Gesichtszügen. Breites Kinn, lä chelnder Mund, geschlossene, mandelförmige Augen und hohe, JHZ¤OEWH$XJHQEUDXHQGLHVLFKDP1DVHQU©FNHQWUHIIHQ'H} QLHUWH +DDUOLQLH (LQNHUEXQJ I©U GDV 8VKQLVKD )HKOIUDJPHQWH am Scheitel, ein nicht tiefer Riss, Reste der Bemalung, Inventar nummer am Hals; mit Ständer. 10.000,–

Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980; ex Sammlung Dr. Dachs, München. /LIHVL]HKHDGRI%XGGKD9HU\}QHO\FDUYHGFRXQWHQDQFHDOPRVWSRUWUD\DO IHDWXUHV:LGHFKLQVPLOLQJPRXWKFORVHGDOPRQGVKDSHGH\HVDQGKLJK DUFKHGH\HEURZVPHHWLQJDWWKHQRVHEULGJH'H}QHGKDLUOLQHQRWFKIRUWKH XVKQLVKD.KPHU/RSEXULWKWKFHQWXU\0LVVLQJIUDJPHQWVDWWKHWRS of the head, a crack in the face, rests of pigment, inventory number at the neck, mounted.

223






 Interessante Figur einer Gottheit, wohl Shiva. Khmer, Angkor Wat Stil, um 12. Jh. H ohne Ständer 13,4cm. Bronze. Stehend in samabhanga trägt er einen kurzen sampot mit nach vorne IDOOHQGHQ GRSSHOWHQ )LVFKVFKZDQ]7H[WLODEVFKQLWWHQ XQG HLQ schlichtes Diadem auf dem nach oben frisierten Haar, sowie 2KUULQJHHLQHJURgH+DOVNHWWH$UPXQG%HLQVFKPXFN6HLQH Hände sind vorgestreckt, wohl auch ursprünglich ohne Attribu te, in einer Variation der Vitarka Mudra. Füße nicht erhalten, Hände nicht vollständig, grüne und rote Patina, mit Ständer. 2.200,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. Vgl.: AN 1988.355a–c, Standing Shiva (?), 11th century, Cambodia (Angkor), The Metropolitan Museum, NY. ,QWHUHVWLQJ.KPHUEURQ]H}JXULQHRIDGHLW\SUREDEO\6KLYDZHDULQJDVKRUW sampot, a diadem, earrings, a necklace, as well as arm and leg bangles. Hands held to the front, probably also originally without attributes, in a variation of vitarka mudra. Angkor Wat style, about 12th century. Feet not preserved, hands not complete, green and red patina, with a stand.



224

 .OHLQHU +DXVDOWDU I©U 9LVKQX 1RUGZHVWLQGLHQ    -K + FP%FP.XSIHUEURQ]H$XIHLQHPUHFKWHFNLJHQ6RN kel die stehende Figur des Vishnu auf der Weltkugel. Die pri märe rechte Hand hält er in Varada Mudra (Mudra der Gabe und Barmherzigkeit), seine Linke erholt sich auf der kaumoda ki .HXOHLQGHQVHNXQG”UHQ+”QGHQEH}QGHQVLFKGLHsudar shana chakra  .ULHJV:XUIVFKHLEH  XQG GLH shankha (rituelle Trompetenschnecke). Hinter Vishnu ist eine große, mit Silber nägeln verzierte Aureole angebracht, die mit einem Makarakopf gekrönt ist; über den Kopf des Gottes wölbt sich der Adishesha, GHUI©QIN¤S}JH.¤QLJGHU1DJDV$XIGHU5©FNVHLWHGHU$XUHR le eine altindische Inschrift. Figur berieben, einige Silbernägel fehlen, leichte helle Patina, sonst intakt mit wunderschönen De WDLOV u


 

Provenienz: Ex Sammlung H. N., Franken; seit 1975 in Deutschland. 6PDOOFRSSHUEURQ]HDOWDUIRU9LVKQX2QDUHFWDQJXODUEDVHDZRUOGVSKHUH with the God standing on top of it with different symbols embraced by a big DXUHROHGHFRUDWHGZLWKVLOYHUQDLOVDQGFURZQHGE\D0DNDUDKHDGD}YH headed Adishesha is vaulting above him in protection. The backside with LQVFULSWLRQ1RUWK:HVWHUQ,QGLDWKWKFHQWXU\)LJXUHIURQWVWURQJO\ rubbed off in worshipping, some silver nails missing, light patina, otherwise intact with beautiful details.

 6WHLQVWHOHPLW0DQMXVKUL1HSDO-K+RKQH+RO]VRN kel 24cm. Schwarzer Stein. Der Bodhisattva der transzendenten Weisheit in seiner vierarmigen Form auf einer dünnen Platte in dhyanasana sitzend dargestellt, die von einem kauernden Lö wen unterstützt ist. Das Ganze auf einer großen Lotosbasis und von einer Flammenaureole gerahmt. Der Bodhisattva hebt sein Hauptattribut khadja mit seiner Rechten auf und hält das Buch der prajnaparamita mit seiner Linken vor sich; in seinen sekun dären Händen ein Bogen und ein Pfeil. Reste des rituellen Far benwurfs, alte Beschädigung am rechten Knie, sonst intakt. 3.000,– 3URYHQLHQ] ([ 6DPPOXQJ + 1 )UDQNHQ HUZRUEHQ  VHLWGHP LQ Deutschland. 9JO&KULVWLHyV1HZ<RUN/LYH$XFWLRQ/RV$EODFN stone stele of Manjushri, Nepal, 15th century (Variation ohne Löwe). 6WRQHVWHOHRI0DQMXVULLQKLVIRXUDUPHGIRUPVLWWLQJLQGK\DQDVDQDRQD plate, supported by a lion; the whole placed on a lotus base and framed by a ~DPLQJDXUHROH1HSDOWKWKFHQWXU\5HVWVRIULWXDOFRORUVPHDULQJ old damage at the right knee, otherwise intact.

 Seltene Stele mit Göttin Gauri. ,QGLHQXP-K+FP Schwarzer Chlorit. Die vierarmige, reich geschmückte Göttin, eine der Manifestationen der Göttin Parvati (Gemahlin des Shi va) steht auf einer kleinen Basis. Ihre primären Hände sind nach vorne in Varada und Vitarka Mudra vorgestreckt, wohl ein Ro senkranz und ein Gefäß tragend; in den sekundären Händen

zwei fackelartige Träger, auf denen sich ihre Söhne Karttikeya XQG *DQHVKD EH}QGHQ 6HLWOLFK YRQ GHU *¤WWLQ GUHL NQLHQGH )UDXHQ}JXUHQGLHZRKODOV6WLIWHULQQHQEHWUDFKWHWZHUGHQG©U IHQ2EHU~”FKHHWZDDEJHQXW]WYRQKLQWHQXQGYRQGHQ6HLWHQ abgebrochen, mit hölzernem Ständer. 3.500,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. 5DUHVWHOHZLWKJRGGHVV*DXUL%ODFNFKORULWHVWRQH7KHIRXUDUPHGJRGGHVV standing on a small base. Her primary hands in varada and vitarka mudras, carrying probably a rosary and a vessel; in her secondary hands holding a WRUFKOLNHFDUULHUVZLWKKHUSHUFKLQJVRQV.DUWLNH\DDQG*DQHVKDRQWKHP %HVLGHWKHJRGGHVVWKUHHNQHHOLQJIHPDOH}JXUHVZKRPLJKWEHUHDGDVGRQRUV ,QGLDDURXQGWKWKFHQWXU\6XUIDFHZRUQEURNHQIURPVLGHVDQGEDFN with a wooden stand.

 6HOWHQH)LJXUHLQHUWDQ]HQGHQ'DNLQLRGHUHLQHU<RJLQLSüdindi en, 19. Jh. oder früher. H 38cm. Kupferbronze, in drei Teilen gegossen, Details in Treibarbeit. Auf einer doppelten Lotosbasis im Tanzschritt stehende Frau, mit ihrer linken Hand den rech ten Fuß berührend. Der Körper ist bis auf einen Gürtel und PHKUHUH.HWWHQ$UPXQG)XgE”QGHUQDFNW'LHJURgHQ2KU ringe schmücken den feinen Kopf mit ruhigem, wonnevollen Gesichtsausdruck und das einfache, nach hinten zu einem Dutt gekämmte Haar. Die rechte Hand hält sie in Shuni Mudra (Mu dra der Geduld), wo sich früher wahrscheinlich auch eine Lo tosblüte befand. Attribut nicht komplett erhalten, sonst intakt. 2.500,– Provenienz: Ex Sammlung H. N., Franken; seit 1988 in Deutschland. 5DUHFRSSHUEURQ]H}JXUHRIDGDQFLQJ'DNLQLRUD<RJLQL6WDQGLQJZLWK her left leg on a lotus base, hips slightly on a side, touching her right foot with the left hand in a dance movement. The naked body is adorned only with a EHOWDURXQGKHUKLSVDQG}QHERG\MHZHOHU\+HUULJKWKDQGLQVKXQLPXGUD PXGUDRISDWLHQFH SUHYLRVO\SUREDEO\KROGLQJDORWXV~RZHU6RXWK,QGLD 19th century or earlier. Attribute not complete, otherwise intact.

225


480

481

480 )LJXUGHV$PLWDEKD%XGGKDPLW,QVFKULIW7LEHW-KRGHUHW was früher. H 22cm. Bronze feuervergoldet, blaue Bemalung am Haar, Reste der grünen und roten Bemalung im Gesicht (wohl jünger). Der Buddha des grenzenlosen Lichts auf einem dop SHOWHQ/RWRVWKURQLQ0HGLWDWLRQVKDOWXQJ(UWU”JWHLQHVFKOLFKWH samghati 5REHGLHVHLQHUHFKWH6FKXOWHUIUHLO”VVWVHLQH+”QGH ruhen auf den Beinen in Dhyana Mudra. Das Gesicht drückt Ruhe und Gelassenheit aus; das kurze, aus schneckenartig ge rollten Locken bestehende Haar mit Ushnisha, die mit einem Juwel bekrönt ist. Die große tibetische Inschrift auf dem Sockel YRU GHP %XGGKD ODXWHW 2P 0DQL 3DGPH +XPw  HLQHV GHU wichtigsten Mantras im Buddhismus. Der Deckel im Boden mit visvavajra (doppeltem Donnerkeil) Zeichen. Vergoldung teilwei se abgerieben, sonst intakt. 5.000,–

481 0DQMXVKUL 7LEHW    -K + FP %URQ]H IHXHUYHUJRO det. Der Bodhisattva der transzendenten Weisheit thront auf der GRSSHOWHQ/RWRVEDVLV(UWU”JWHLQVFKOLFKWHV'KRWLXQGLVWPLW zahlreichen Juwelen geschmückt. Das Haar ist in einem doppel ten Chignon gesammelt, auf dem Kopf eine prächtige Bodhi sattvakrone. In seiner Rechten hebt er das khadja (Schwert, das „die Unwissenheit abschlägt“), die Linke ist in einer Variation der Vitarka Mudra vor der Brust; an den Seiten von der Gottheit formen sich dekorative Ranken, die von rechts das Buch der transzendenten Weisheit prajnaparamita vorbringen. Die Un terseite mit kleinem visvavajra Zeichen. Vergoldung teilweise abgerieben, partiell leichte Patina, sonst intakt. 4.500,–

Provenienz: Ex Sammlung H. N., Franken, erworben 1983 in Hongkong, seitdem in Deutschland.

%URQ]HJLOGHG}JXUHRI0DQMXVKULHQWKURQHGRQDGRXEOHORWXVEDVH:HDULQJ a simple dhoti and adorned with jeweled bracelets and necklaces. The hair is tightened to a double chignon, the head bearing a splendid crown. He rises his sword khadja with his right and holds his left in Vitarka mudra; to his side the book of Transcendent Wisdom prajnaparamita is supported by a decorative WHQGULO2QWKHERWWRPOLGDVPDOOYLVYDYDMUDV\PERO7LEHWWKWKFHQWXU\ Some wear of the gold layer, partially light patina, otherwise intact.

%URQ]HJLOGHG}JXUHRI$PLWDEKD%XGGKDVLWWLQJRQDGRXEOHORWXVWKURQH in Padmasana. Wearing a simple samghati robe his right shoulder stays opened; his hands laying in Dhyana mudra. His face expresses calmness and serenity; the short, curly hair with Ushnisha is crowned by a jewel. Hair with blue pigment, rests of red and blue pigment on face (probably younger). Big tibetan inscription in front of the Buddha is a great mantra „Om Mani Padme Hum“. On the bottom lid visvavajra symbol. Tibet, 17th century or somewhat earlier. Some wear of the gold layer, otherwise intact.

226

Provenienz: Ex Sammlung H. N., Franken, seit 1987 in Deutschland.


482

482 6HOWHQH)LJXUGHV9DLVKUDYDQDSinotibetisch, 18. Jh. H 19,5cm. Bronze feuervergoldet. Der weltliche Wächter des buddhisti schen Glaubens und der „König des Nordens“ sitzt auf einem Schneelöwen. Angezogen mit einer Kriegsrüstung und Stiefeln, einem Schal um die Schultern und einer Krone. In seiner lin ken Hand hält er eine Manguste als Symbol des Reichtums, in der Rechten befand sich ursprünglich ein langer Stock mit einer Fahne (das beweist das Standloch im Boden), nun hält er HLQVS”WHU]XJHI©JWHV$WWULEXW'HU/RWRV6RFNHOLVWYRQXQWHQ durch eine mit vajra verzierte Plakette verschlossen. $XVJH]HLFK neter Stil, feine Bearbeitung! Vergoldung partiell abgerieben, At tribut in der rechten Hand ersetzt, winzige Delle auf der Nase, VRQVWVHKUJXWH(UKDOWXQJ u Provenienz: Ex Sammlung A. E. O., Rheinland; erworben im Rheinland RGHUH[*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV ]XJHVFKODJHQPLW€, aber nicht bezahlt!).

483

483 .OHLQH)LJXUGHV$PLWDEKD%XGGKD7LEHW-K+FP Bronze feuervergoldet, Reste der blauen und roten Bemalung am Haar und an den Lippen. Der Buddha sitzt auf einem dop pelten Lotosthron, angezogen mit einer samghati 5REHGLHVHL ne rechte Schulter frei lässt; seine Hände sind in Dhyana Mudra gelegt und halten eine Almosenschale. Die tiefen Halsfalten und langen Ohrläppchen rahmen das Gelassenheit ausdrückende Gesicht. Auf der Stirn liegt das Urna („Dritte Auge“); das kur ze Haar mit Ushnisha bekrönt mit einem Juwel. Schale ergänzt, Unterdeckel nicht erhalten, sonst intakt. 3.500,– Provenienz: Ex Sammlung H. N., Franken; seit 1987 in Deutschland. %URQ]HJLOGHG}JXUHRI$PLWDEKD%XGGKDVLWWLQJRQDGRXEOHORWXVWKURQH Wearing a samghati robe his right shoulder stays opened; his hands laying in Dhyana mudra, carrying the alms bowl. The short hair with Ushnisha is FURZQHGE\DMHZHO:LWKUHVWVRIUHGDQGEOXHSLJPHQW7LEHWWKWK century. Bowl replaced, lid not preserved, otherwise intact.

5DUHJLOGHGEURQ]H}JXUHRI9DLVKUDYDQD7KHSURWHFWRUGHLW\QDPHG.LQJRI the North“, depicted sitting on a snow lion (later tradition), wearing armor and a crown, holding a mongoose as a symbol of wealth and an attribute added in PRGHUQWLPHV RULJLQDOO\KROGLQJDEDQQHURQDORQJSROHFRQ}UPHGE\WKH KROHLQWKHJURXQGLQIURQWRIWKH}JXUH 7KHERWWRPFORVHGDQGLQFLVHGZLWK a vajra depiction. Sinotibetan, 18th century. ([FHOOHQWVW\OH}QHGHWDLOOHG work! Gilding partially rubbed off, attribute in the right hand modern, tiny dent on the nose, otherwise very good condition.

227


484

485

484 .OHLQH)LJXUGHV$PLWD\XV7LEHW-K+FP%URQ ze feuervergoldet, Haar mit blauem Pigment. Der Buddha Amitayus („Unermessliches Leben“) auf einem doppelten Lo tosthron. Seine Hände in Dhyana Mudra tragen ein prächtiges *HI”g (U WU”JW HLQ NXU]HV dhoti und einen leichten Umhang über seinen Schultern; der Körper ist mit mehreren Ketten und Bändern geschmückt und der Kopf mit großen Ohrringen und Krone. Das Haar ist in ein hohes, ausgearbeitetes Chignon ge kämmt; die leicht geöffneten Augen des Buddha und der Mund zeigen die Resten der Bemalung; an der Stirn das augenförmige Urna. Die Unterseite mit vergoldetem visvavajra Zeichen. Ver goldung teilweise abgerieben, partiell leichte Patina, Steine an den Ohrringen modern, sonst intakt. 3.500,–

485 $NVKREK\D %XGGKD Birma, Mandalay, 19. Jh. H 81,5cm. Bronze gegossen, Details mit roter Bemalung, mit Resten der Vergoldung. Akshobhya (sanskr. „Der Unbewegliche/Uner schütterliche“), einer der fünf Dhyani Buddhas, ist hier in seiner WUDGLWLRQHOOHQVS”WHUHQ,NRQRJUDSKLHGDUJHVWHOOW(UVLW]WLQ0HGL tationshaltung, seine Hände in bhumisparsa Mudra: die Rechte EHU©KUWGLH(UGHXQGGLH/LQNHDXIGHP6FKRgUXKHQGK”OWHLQ -XZHO(UWU”JWHLQODQJHVantaravasaka , sowie eine lange präch tige Kette und Armreife, die mit grünen und roten Glassteinen verziert sind; auf seinem Kopf ist ein siebenstrahliges Diadem PLW VHLWOLFKHQ VFKPHWWHUOLQJV~©JHODUWLJHQ $XIV”W]HQ XQG HLQH hohe Krone. Rückseite auch plastisch bearbeitet. Hellgrüne Pa tina, sonst intakt. 6.000,–

Provenienz: Ex Sammlung H. N., Franken, erworben 1992, seitdem in Deutschland.

Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980.

%URQ]HJLOGHG}JXUHRI$PLWD\XVRQDGRXEOHORWXVEDVHZLWKKLVKDQGVLQ Dhyana mudra holding an elaborate vessel. Wearing a short dhoti, a light cloak around shoulders and adorned with many bracelets, necklaces and a big crown. The hair is tightened to a high, elaborate chignon; on the slightly opened eyes and lips traces of color are still well preserved; on the forehead an H\HVKDSHG8UQD2QWKHERWWRPOLGDJLOGHGYLVYDYDMUDV\PERO7LEHWWK WKFHQWXU\6RPHZHDURIWKHJROGOD\HUSDUWLDOO\OLJKWSDWLQDVWRQHVLQ the earrings modern, otherwise intact.

/DUJHEURQ]H}JXUHRI$NVKREK\D%XGGKD'HWDLOVLQUHGUHVWVRIJLOGLQJ $NVKREK\D VDQVNU7KH,PPRYDEOH,PSHUWXUEDEOHw RQHRIWKH'K\DQL Buddhas, presented here in his traditional late iconography. Sitting in me ditation pose padmasana, his hands in bhumisparsa mudra: the right one touches the Earth and the left, resting on the laps, holding a jewel. He is wearing a long antaravasaka robe, as well as a long splendid necklace and KDQGFXIIVGHFRUDWHGZLWKUHGDQGJUHHQJODVVSHDUOVRQKLVKHDGDVHYHQ UD\HGGLDGHPZLWKVLGHSLHFHVLQIRUPRIEXWWHU~\ZLQJVDQGDKLJKFURZQ Backside also sculpted. Burma, Mandalay, 19th century. Light green patina, otherwise intact.

228


486

486 0HGLWLHUHQGHU$QDQGDThailand, Rattanakosin Periode, 19. Jh. H 44cm. Bronze gegossen, Lackfassung mit Vergoldung, teil weise bemalt. Der Primärschüler des Buddha auf einem ho hen Lotossockel in dhyanasana sitzend dargestellt. Gekleidet in ein langes sanghati , das seine rechte Schulter nackt lässt. Seine Rechte liegt in der bhumisparsa 0XGUDGLH(UGHEHU©KUHQGVHL ne Linke hielt ursprünglich ein Attribut (wohl Buchrolle). Kur zes Haar mit deutlicher Haarlinie, gelassener Gesichtsausdruck, halbgeschlossene Augen mit Pigment bemalt. Große Absplitte rungen der Lackschichten, Vergoldung teilweise retuschiert. 2.500,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. Ananda in meditation. Bronze, laquer and gilding, partially painted. The primary student of Buddha sitting in dhyanasana on a high lotus base. Wearing a long sandhati, that leaves his right shoulder naked. His right hand touches the Earth, his left hand probably held a book scroll. Short hair ZLWKGLVWLQFWKDLUOLQHVHUHQHIDFHH[SUHVVLRQVOLJKWO\RSHQHGH\HVGH}QHGZLWK pigment. Thailand, Rattakosin period, 19th century. Severe losses in laquer layer, some guilding touch up.

 $PLGD1\RUDL-DSDQ(GR=HLW-K+)LJXUFP+ gesamt 60cm. Zypressenholz, vergoldet. Meditierender Amitab



ha Buddha in padmasana sitzend, hebt seine Rechte in abhaya 0XGUD(ULVWLQHLQHEXGGKLVWLVFKH5REHJHNOHLGHWEHLQ”KHUHU Betrachtung sind die Reste der ornamentalen Verzierung des Stoffes sichtbar. Zwei Glassteine sind in die Stirn (Urna) und im Haar eingelegt. Die leicht geöffneten Augen sind eingelegt und wirken lebendig, die Augenbrauen und der Schnurrbart sind mit feinen Linien im schwarzen Lack angedeutet. Im Rücken ]ZHLNOHLQHIIQXQJHQI©UGHQQXQIHKOHQGHQ+DOR(UWKURQ te auf einem Lotus, darunter runde Basis mit zwei Registern auf vier Füßen und mit rückwärtiger Stütze. Vergoldung wei testgehend abgerieben, rechte Hand ergänzt, linke mit fehlen den Fingern, Stein an der Stirn ergänzt, kleine Fehlstellen im Haar, Figurenuntersetzer ergänzt, Lotusregister nicht erhalten. 4.800,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre, in Deutschland seit vor 1980. *LOGHGZRRGHQ}JXUHRI$PLGD1\RUDLVLWWLQJLQSDGPDVDQDKROGLQJKLV right hand in abhaya mudra; wearing a robe with rests of an ornamental decoration that covers his body; two stones in the forehead (urna) and hair; beautiful, realistically inlayed eyes, eyebrows and moustaches indicated in black laquer. Amida is throning on a lotus (not preserved), supported by a URXQGWZRUHJLVWHUHGEDVHRQIHHW-DSDQ(GRWKWKFHQWXU\*LOGLQJ PRVWO\UXEEHGRII5LJKWKDQGUHVWRUHGOHIWZLWKPLVVLQJ}QJHUVVWRQHLQWKH forehead modern, small chipping at hair; upper part of the base mostly lost and partially restored.

229


488 )HLQH $OWDU}JXU GHV -L]R %RVDWVX Ja SDQ(GR-K+)LJXUFP H Ständer 19cm. Zypressenholz in yosegi zukuri Technik lackiert, ver goldet und farbig gefasst. Der Bodhi sattva, als Mönch dargestellt, wird in Japan hauptsächlich als Beschützer der Kinder verehrt. Hier ist er gera de stehend dargestellt, der rechte Fuß ist leicht nach vorne gesetzt, seinen (LQWULWWLQGLH:HOWDQGHXWHQGLQVHL ner rechten Hand befand sich früher ein shakujo Stock, und in seiner Lin ken das wunscherfüllende Juwel (jap. Q\RLKRVKX). Der prächtige Stoff seiner buddhistischen Robe ist mit kunstvoll aufgetragenen, farbigen Mustern ver ziert. Gewölbte, dünne Augenbrauen betonen die mit Kristall eingelegten Augen, sowie sein Drittes Auge in Form eines Glassteins. Auf einem I©UGLH(GR=HLWW\SLVFKHQPHKUVW¤N kigen Ständer. Am Kopf abgeplatz te Farbschicht und ein Riss, kleine Kratzer, Hände wohl ergänzt, ein Fuß wiederangesetzt, ein Teil der Robe beschädigt; Ständer gut erhalten. 3.000,– Provenienz: Ex Butterscotch Gallery Auction 12.04.2015. )LQH DOWDU }JXULQH RI -L]R %RVDWVX &\SUHVV wood in yosegi zukuri technique, laquered, gilded and polychrome. The Bodhisattva, being depicted as a monk, is worshipped in Japan mainly as a protector of children. In his right hand a shakujo staff and in his left a ZLVKJUDQGLQJMHZHO ERWKPLVVLQJ 7KHULFK materials of his robes are attested through elaborately drawn colorfull patterns. Arched eyebrows accent the crystal inlayed eyes and the third eye marked with a glass stone. Stan GLQJRQDPXOWL~RRUHGVWDQGW\SLFDOIRUWKH (GRSHULRG-DSDQ(GRWKWKFHQWXU\ Laquer chipped off and a crack at vertex, some scratches, hands restored, one foot reattached, a damage at the robe; stand in good condition.

488

230

489 .DOHQGHU 7KDQJND RGHU GLH 6ULG3D +R 6FKXW]PDQGDOD Tibet, um 1900. 36,5 x 25cm. Gouache auf Baumwol le. In der Mitte, auf seinem Rücken liegend, die mythische Schildkröte Gigant Rubal; in ihren ausgestreck ten Gliedmaßen hält sie vier Frösche, GLHGLH(OHPHQWHGHU(UGHUHSU”VHQ tieren; ihr Schild ist in Flammen der Weisheit gehüllt. Auf ihrer Untersei te neun farbige Quadranten mit ma gischen Zahlen, umgeben von acht ,&KLQJ7ULJUDPPHQ ZHLWHUV PLW zwölf Tieren des chinesischen Zodi ak. Unter dem Rubal sieben Symbo le der Wochentage, Himmelskörper XQG(OHPHQWHVRZLH.RSIGHV5DKX als Finsternis. Links oben von der


489

Mandala Symbol der „Allmächtigen zehn Silben“ (tib. 1DPFKX :DQJGHQ), rechts neun Quadranten mit Gebeten; links unten ein weiterer Rubal mit Gebetsringen und Trigrammen mit magi VFKHQ=DKOHQUHFKWVHLQDFKWSDVVLJHU/RWRVPLW6FKXW]0DQWUDV An den Seiten zwei große Fahnen mit Trigrammen, gekrönt mit Triratna. Oben auf den Lotosblüten drei schützende Figuren der Bodhisattvas Vajrapani, Manjushri und Avalokiteshvara. Im un teren Bereich eine große Kartouche mit Inschrift. Rückseite mit Inschrift. Ränder beschädigt, Resten von alter Bindung, im obe ren Teil fünf Risse, partiell abgenutzte Stellen. 4.000,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. &DOHQGDU7KDQJNDRU6ULG3D+RSURWHFWLRQ0DQGDOD*RXDFKHRQFRWWRQ,Q the middle a mythical turtle laying on his spine; in his streched out limbs four GHPRQIURJVUHSUHVHQWLQJIRXUHOHPHQWVKLVVKHOOLQ~DPHVRIZLVGRP2QKLV underside nine magic numbers, encircled by eight I Ching trigramms, further with twelve animals of chinese zodiac. Under Rubal seven symbols of the seven days of the week, celestial bodies and elements, as well as a head of Rahu as an eclipse. To the upper left from the Mandala symbol of „All Powerful Ten“ WLE1DPFKX:DQJGHQ WRWKHULJKWQLQHSDQHOVZLWKSUD\HUVWRWKHORZHU OHIWDQRWKHU5XEDOZLWKULQJVRISUD\HUDQGWULJUDPPVWRWKHULJKWDQHLJKW petalled Lotus with mantras. On the sides two large banners with trigramms. Above all three Bodhisattvas: Vajrapani, Manjushri and Avalokiteshvara. In the bottom a cartouche with an inscription. Inscription also on the back. Tibet, around 1900. Edges damaged, rests of an old binding, in upper part }YH}VVXUHVSDUWLDOO\ZRUQSLJPHQW

490

490 7KDQJNDPLW$YDORNLWHVKYDUDTibet, 18. Jh. 60 x 24cm. Gouache auf Baumwolle. Im Zentrum auf einem großen Lotos thront in dhynasana der vierärmige Bodhisattva, seine Hände in manidha ra Mudra, mit blauem Juwel, die sekundären Hände mit einer /RWRVEO©WHXQG5RVHQNUDQ]EHULKPLQHLQHU:RONHQ$XUHROH der Buddha Amitabha, an den Seiten weitere sechs von „Den Sieben Buddhas der Vergangenheit“, mit verschiedenen Körper farben und Attributen. Unter dem Bodhisattva ein zornvoller Yidam (Schutzgottheit) in pratjalidhasana , mit einer Fahne und Lasso. Rechts von ihm ein Fenster mit einer knienden Stifter }JXUGHUZRKODOV/DGDNKLRGHU.LQQDXUL]XLGHQWL}]LHUHQLVW links eine Stupa. Das Ganze vor einem Landschaftshintergrund. Brandspuren oben rechts, partiell abgenutzte Stellen und Risse. 1.000,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. Thangka with Avalokiteshvara. Gouache on cotton. In the center, enthroned RQDODUJHORWXVIRXUDUPHG%RGKLVDWWYDKLVKDQGVLQPDQLGKDUDPXGUDZLWK the blue jewel, the secondary hands holding a lotus and a rosary. Above him LQWKHFORXGVD}JXUHRI$PLWDEKD%XGGKDDQGRQWKHVLGHVRWKHUVL[RI7KH Seven Buddhas of the Past“, with different body colors and attributes. Under the Bodhisattva a wrathful Yidam with a banner and a lasso. Next to him a window with a kneeling donor, probably a Ladakhi or Kinnauri; to the other side a stupa. All on a landscape background. Tibet, 18th century. Fire damages WRWKHXSSHUULJKWSDUWLDOO\ZRUQSLJPHQWOD\HUDQG}VVXUHV

231


491

491 *URgHU *DyX.DVWHQ PLW 7H[WLOK©OOH Tibet, VS”WHVIU©KHV-K+FP6LOEHU Kupfer, getrieben und ziseliert. Reich de korierter Deckel, gerahmtes „Fenster“ mit 'UHLEODWW%RJHQ XQG HLQHP =DXQ DXV VHFKV kleinen Vasen mit dharmachakra ; umgeben von Ashtamangala Symbolen (acht Haupt V\PEROH GHV 9DMUD\DQD%XGGKLVPXV  6\P bol der „Drei Juwelen des Buddhismus“ (Buddha, Dharma und Sangha) von oben und Kopf eines Kirtimukha von unten, der die Ranken (anstatt Schlangen) zerbeißt. An den Seiten des Kastens je zwei Henkel. Die dazugehörige Hülle aus rotem Samt mit Goldstickerei schützt den Kasten. Gott heitsdarstellung nicht erhalten, Hülle etwas abgenutzt, aber intakt. 500,– Provenienz: Ex Sammlung E. P.; in Deutschland seit 1985. Large Ga‘u reliquary shrine of silver and copper with original textile cover. Finely decorated, a trefoil window with a „fence“ made of six vases holding dharmacha kras, surround by ashtamangala symbols, a symbol of „Three Jewels“ and a head of kirtimukha. On each side of the shrine two handles. The case of red textile ZLWKJROGHQWKUHDGRUQDPHQWV7LEHWODWHWKHDUO\ 20th century. Plaquette with a deity missing, case with traces of use, but intact.

492 6FK¤QHV6LQR0RQJROLVFKHV*HI”gMongolei -K-DGH7HLOH4LQJ'\QDVWLH&KLQD H 23,5cm. Silber, Jade, verziert mit Türkis, Korallen, Lapislazuli und Achat. Apfelför mig, mit Standfuß und abnehmbarem Dek kel. Aufwändig getriebener Silberdekor mit Ranken und geometrischem Muster; an vier 6HLWHQJURgHUHFKWHFNLJJHIDVVWH(LQODJHQDXV Jade mit feiner Schnitzarbeit, jeweils gerahmt durch eine Reihe von Lotosblütenblättern. Am Fuß sowie an der Schulter eingelegte %”QGHU GDQHEHQ VRZLH ]ZLVFKHQ GHQ -DGH (LQV”W]HQ MHZHLOV YLHU IHLQH IDUELJ HLQJHOHJ te Blüten. Deckel aus großem fünfpassigen -DGHWHLO PLW HLQHP GRSSHOWHQ /RWRVEO©WHQ $XIVDW] JHNU¤QW PLW HLQHP 0XWWHU XQG .LQG7LJHU3DDUDXV-DGH(LQLJH6WHLQHZLH der angesetzt oder fehlend, Bekrönung wie der angesetzt, sonst sehr guter Zustand. 3.000,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980.

492

232

%HDXWLIXO VLQRPRQJROLDQ ULWXDO YHVVHO 6LOYHU MDGH coralls, turquoise, lapis lazuli, agate. Fine chased silver body, with geometrical and tendril motives; on four si des large rectangular inlays of carved jade, each framed by a row of lotus petals. On the foot and at shoulder inlaid bands, next to these, as well as in between the jade carvings in total sixteen inlaid blossoms. Lid of a ODUJH}YHSDVVMDGHSLHFHWRSSHGZLWKDQLQODLGVLOYHU holder and a carved couple of mother and child tigers. 0RQJROLDWKWKFHQWXU\MDGHSLHFHV4LQJG\QD sty, China. Some stones reattached or missing, top piece reattached, otherwise very good condition.


493

493 *URgH SRO\FKURPH .UDDN3ODWWH I©U GHQ ([SRUW QDFK +ROODQG &KLQD0LQJ'\QDVWLH-KkFP%HPDOXQJLQEODXXQ ter der Glasur, sowie in rot, mit Resten der kalten Vergoldung. /HLFKWQDFKDXgHQJH]RJHQH6HLWHQPLW~DFKHP5DQGLQ)RUP von Lotusblütenblättern. Im achtpassigen Medaillon eine Vase mit zwei Gegenständen und Blumen auf einer Basis in Form von Baumwurzeln. An den Seiten acht Felder mit vier verhei gXQJVYROOHQ6\PEROHQXQGYLHUIUXFKWWUDJHQGHQ3~DQ]HQ'D zwischen Felder mit geometrischen Mustern. Montierung zum Aufhängen (20. Jh.), Boden unsichtbar, Bemalung und Vergol GXQJWHLOZHLVHDEJHULHEHQ u

Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. Large polychrome „kraak“ plate for export to Holland. White and blue, pain ted with red as well as rests of gilding. Slightly curved outwards edges in form RI~DWORWXVSHWDOV,QWKHHLJKWSDVVPHGDOOLRQDYDVHZLWKWZRREMHFWVDQG ~RZHUVVWDQGLQJRQDEDVHLQIRUPRIWUHHURRWV2QWKHVLGHVHLJKWSDQHOV with four auspicious objects and four fruiting plants. Fields in between with geometrical patterns. China, Ming dynasty, 17th century. Mounting (20th century) eclipses the bottom, partially rubbed off pigment and gilding layer, otherwise intact.

233


494 *URgH EODXZHLgH 6ZDWRZ6FKDOH China, 0LQJ '\QDVWLH    -K k FP ,P Medaillon stehender Phoenix nach rechts sich umdrehend, von Obstbäumen und Blu PHQ XPJHEHQ $P 5DQG DXIJHWHLOWH S~DQ] liche Motive. An der Außenseite schlichter abstrakter Dekor. Intakt. 2.400,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. Large blue and white Swatow bowl. In the medallion SKRHQL[VXUURXQGHGE\WUHHVDQG~RZHUV%RUGHUZLWK divided vegetal motifs. Second side with simple abstract GHFRU &KLQD 0LQJ '\QDVW\ WK  WK FHQWXU\ Intact.

495 )HLQHUJHULSSWHU.UXJGHU&L]KRX:DUHChi QD 6RQJ '\QDVWLH    -K + FP +HOOHU EHU]XJ XQG VFKZDU]H *ODVXU %DX chiger, dicht gerippter Körper mit breitem Standfuß, einem Henkel und kleinem spitzen Ausguss, sowie tailliertem Hals mit trichter förmiger Mündung. 0LW7/$QDO\VH Intakt. 2.400,–

494

Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. Fine Cizhou ware ribbed ewer. Light slip with black glaze. Compressed globular, tightly ribbed body with a wide foot, a handle and a pointed spout, as well as a ZDLVWHGQHFNZLWKD~DWIXQQHOPRXWK&KLQD6RQJ'\ QDVW\WKWKFHQWXU\,QWDFW:LWKD7/DQDO\VLV

496 *URgHV 9RUUDWVJHI”g YRP 7\SXV +X China, LP6WLOGHU+DQ'\QDVWLH Y&KU Q&KU -K " +FP5¤WOLFKHU Ton mit dunkelgrüner Bleiglasur. Bauchiges *HI”gPLWEUHLWHU6WDQG~”FKHXQGPDVVLYHP Hals. Am Körper und an der Schulter je drei Rippen, an den Seiten zwei taotie Masken, die an die Ösen von Bronzegefäße erinnern. (LQJURgHV)UDJPHQWDP+DOVZHLGHUDQJH setzt und retuschiert, leichte silberne Patina. 500,– Provenienz: Ex Sammlung M. M., Südbayern; in Deutschland seit vor 1990. Large storage jar of Hu type. Reddish clay with dark green glaze. Body decorated with rings and two handles with taotie masks, reminding of bronze vessels. China, LQVW\OHRI+DQ'\QDVW\ %&$' WKWK century (?). Large fragment of the neck reattached and repaired, light silver patina.

495

234

 *URgH&ORLVRQQ˜9DVHChina oder Japan, 20. -K + FP %URQ]H PLW IDUELJHP (PDLO le. Hohe Vase mit breitem Fuß und breiter Schulter. Im unteren Bereich des Körpers, an der Schulter und am Rand Bänder mit geometrischen und vegetabilen Motiven; am Körper, auf dem blauen, ornamentalen Hin WHUJUXQG 'DUVWHOOXQJHQ GHU 0DJQROLHQ XQG


496



Päonienzweigen, sowie eines Vogels; am Hals ein breites Band mit Ranken und geschlossenen Chrysanthemenblüten. Boden nicht emailliert. Intakt. 850,– 3URYHQLHQ]([6DPPOXQJ+1)UDQNHQHUZRUEHQLP)ULHQGVKLS store in Shanghai, seitdem in Deutschland. Large Cloisonné vase. The lower part of the body, shoulder and the rim bands decorated with geometric and vegetal motives; body with an ornamental blue background, depicting magnolia and peonies, as well as a small bird in between; neck with a band of vines and closed chrysanthemum buds. Bottom without enamel. China or Japan, 20th century. Intact.

498 6FKQXSIWDEDN~”VFKFKHQLQ)UXFKWIRUPChina, späte Qing Dyna stie. H 6,9cm. Bernsteinfarbener Achat, Stöpsel aus rötlichem Achat, Löffel aus Bein. Körper in Form einer Frucht, von einer Seite eine im erhabenen Relief fein geschnitzte kleine Frucht mit einem Blatt und langen Ranken. Intakt. 650,–

498

Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. Snuff bottle in form of a fruit. Amber agate, stopper of reddish agate, spoon of bone. On a side smaller fruit with a leaf carved in high relief. China, late Qing Dynasty. Intact.

499 6FKQXSIWDEDN~”VFKFKHQ DXV /DSLVOD]XOL China, späte Qing Dynastie. H 6,8cm. Originalstöpsel aus Lapislazuli, Metallkragen und Löffel aus Bein. Mit breiten Schultern und ovalem Fuß. Intakt. 600,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. Snuff bottle of lapis lazuli, original stopper of same stone, metal collar and spoon of bone. With wide shoulders and oval foot. China, late Qing Dynasty. Intact.

499

235


500

501

502

503

500 =ZHL VHOWHQH 6FKQXSIWDEDN~”VFKFKHQ China, späte Qing Dy QDVWLH +  XQG FP (LQ O”QJOLFKHV )O”VFKFKHQ DXV JUDX bräunlichem Quarz mit dunklen Fasern, mit Stöpsel aus Jade und Kragen aus Stein, und ein Fläschchen mit ovalem Standfuß, ZRKODXV6HHLJHO)RVVLOLHPLW6W¤SVHODXV0DODFKLWXQG.UDJHQ DXV EODXHP 6WHLQ VRZLH HLQ /¤IIHO DXV %HLQ (LQ )O”VFKFKHQ etwa verkratzt in der unteren Partie und Löffel nicht mehr zum Rausnehmen, sonst intakt. 900,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. 7ZRUDUHVQXIIERWWOHVRQHHORQJDWHGERWWOHRIJUH\EURZQTXDUW]LWHZLWKGDUN }EHUVVWRSSHURIMDGHDQGVWRQHFROODUVHFRQGZLWKDQRYDOIRRWSUREDEO\RI a sea urchin fossil, with stopper of malachite, blue stone collar and a bone spoon. China, late Qing Dynasty. One bottle with some scratches at the lower part and the spoon not reachable, otherwise intact.

501 6DPPOXQJYRQVHFKV6FKQXSIWDEDN~”VFKFKHQChina, späte Qing '\QDVWLH+FPD =ZHL)ODVFKHQDXV0LOFKJODVVRZLH HLQH DXV NODUHP *ODV PLW URWHP EHUIDQJ PLW 'DUVWHOOXQJHQ von Ashtamangala, einem Reiter auf einem Wasserbüffel, so wie Glückssymbolen; Stöpsel aus rotem Glas und Stein, Löffel aus Bein. b) Flasche aus Achat mit ovalem Fuß, von einer Seite eine geschnitzte Darstellung des Buddha mit einem Fächer als Glückssymbol; Stöpsel und Kragen aus Stein, Löffel aus Bein. c) Flasche aus braunem opaken Glas von seltener Form, die an archaische Bronzen erinnert; Stöpsel aus leicht violettem Stein, Löffel aus Metall. d) Bauchige Flasche aus dunklem Rauch quarz, ohne Stöpsel. Intakt. 2.000,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre, in Deutschland seit vor 1980. Collection of six snuff bottles. a) Two bottles of milk glass and one of clear glass with red overlay, depicting Ashtamangala, a rider on a water bull and luck symbols; stoppers of red glass and stones, bone spoons. b) An agate bottle with a carved depiction of Buddha with a fan; stopper and collar of stone, bone spoon. c) Brown glass bottle in a rare form, reminding archaic bronzes, stopper, metal spoon. d) Bottle of dark quartzite, without stopper. China, late Qing Dynasty. Intact.

236

502 6DPPOXQJYRQQHXQ6FKQXSIWDEDN~”VFKFKHQChina, späte Qing '\QDVWLH+FP$FKDWPLWQDW©UOLFKHQKHOOHQXQGGXQN OHQ (LQVFKO©VVHQ D  *URgH )ODVFKH PLW ]ZHL taotie Masken und Ösen an den Seiten; Stöpsel aus Korallenstein, Kragen und Löffel aus Metall und Silber. b) Fläschchen mit eingeritztem %OXPHQGHNRU6W¤SVHODXVJU©QEODXHP6WHLQ.UDJHQXQG/¤I fel aus Silber, auf der Unterseite des Kragens ein Stempel. c) (LQHUHFKWHFNLJHXQGVHFKVEDXFKLJH)ODVFKHQGUHLPLWRYDOHQ 6WDQG~”FKHQYLHUPLW6W¤SVHO/¤IIHODXV%HLQXQG6LOEHU0HLVW intakt. 2.200,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. Collection of nine agate snuff bottles. a) Large bottle with two taotie masks on the sides, stopper of coral, metal collar, silver spoon. b) Bottle with carved ~RZHUGHFRUVWRSSHURIJUHHQLVKVWRQHVLOYHUFROODUDQGVSRRQERWWRPRIWKH collar with stamp. c) Seven simple bottles, three with an oval foot, four with stopper, spoons of bone and silver. China, late Qing Dynasty. Mostly intact.

503 6DPPOXQJYRQDFKW6FKQXSIWDEDN~”VFKFKHQChina, späte Qing '\QDVWLH+FPD =ZHLO”QJOLFKH)ODVFKHQPLW,QQHQ EHPDOXQJ HLQH PLW 7HLFK XQG /DQGVFKDIWVV]HQHQ GLH DQGHUH mit Vögeln und Schmetterlingen, dazu eine rechteckige Flasche DXV NODUHP *ODV ]ZHL -DGH XQG HLQ *ODVVW¤SVHO ]ZHL /¤IIHO DXV%HLQE =ZHL*ODV~DVFKHQ$FKDW,PLWDWLRQXQGHLQNOHLQHV )O”VFKFKHQDXVVFKZDU]HP*ODVPLW*ROG(LQVFKO©VVHQ6W¤S sel aus rotem Glas und Steinen, zwei Löffel aus Silber, einer PLW6WHPSHOF (LQH)ODVFKHDXVEHLJHP4XDU]LWXQGHLQHDXV +DDU.ULVWDOOw 6W¤SVHO DXV JU©QHP *ODV XQG -DGH 0HLVW LQ takt. 1.300,– Provenienz: Ex süddeutscher Schlossbesitz 1970er Jahre; in Deutschland seit vor 1980. &ROOHFWLRQRIHLJKWVQXIIERWWOHVD 7ZRHORQJDWHGERWWOHVZLWKLQVLGHSDLQWHG SRQG DQG ODQGVFDSHV DV ZHOO DV EXWWHU~LHV DQG ELUGV LQ DGGLWLRQ D FOHDU glass faceted bottle; two jade and glass stoppers, two bone spoons. b) Two JODVVERWWOHVLQDJDWHLPLWDWLRQDQGDVPDOOERWWOHRIEODFNJODVVZLWKJROGHQ splashes; stoppers of red glass and stones, two spoons of silver, one with a VWDPSF %HLJHTXDUW]LWHDQGDKDLUFU\VWDOwERWWOHVVWRSSHUVRIJUHHQJODVV and jade. China, late Qing Dynasty. Mostly intact.


0,77(/$/7(5

504

504 -©QJOLQJVNRSI (QJHO  Spätgotisch, spätes 15. Jh. n. Chr. H FPXQGPLW6RFNHOFP%FP7FP*UDXHU6DQG stein. 0LW +RO]VW”QGHU Im Hals und den langen Haaren ge brochen, Nase, Kinn und einige Locken bestoßen. 1.000,–

Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Head of youth (angel) made of grey sandstone. Late Gothic Period, late 15th century B.C. Broken at neck and long hair, splinters of the nose, chin and few curls are missing. With wooden stand!

237


$17,.,6,(5(1'(6u$)7(57+($17,48(

505

505 .RSIGHV$XJXVWXV19. Jh. n. Chr. H 38cm, mit Sockel 51cm. Weißer, feinkristalliner Marmor. Neuzeitliche Kopie im sog. 2FWDYLDQV7\SXV IU©KHU $FWLXP7\SXV  'LH %U©FKH LP +DOV XQG DP +LQWHUNRSI VLQG ZRKO DUWL}]LHOO 'HU 6RFNHO HLQPDO gebrochen und wieder zusammengesetzt. 1.500,– Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. Der Octavianstypus ist einer der ersten Bildnistypen des zur höchsten Macht im römischen Imperium greifenden Herrschers. Da er auch in der Münzprägung LQGHUVRJHQDQQWHQ$FWLXP6HULHwHUVFKHLQWZXUGHHUIU©KHUQDFKGLHVHU

238

historischen Entscheidungsschlacht benannt, war aber wohl schon früher in Verwendung. Im Gegensatz zu den späteren Bildnistypen, die den Herrscher auch noch im Greisenalter als jugendlichen Heroen präsentieren, zeigt der Octavianstypus doch etwas deutlichere Altersmerkmale, die den damals noch jungen Octavian als durchsetzungsfähigen, reifen Machthaber vorführen sollen. Die vorliegende, exzellente Arbeit des 19.Jhs. wurde wohl nach dem Porträt im Kapitolinischen Museum gefertigt. 19th century marble portrait of Augustus made probably after the portrait LQ WKH &DSLWROLQH 0XVHXP LQ WKH 2FWDYLDQXV7\SHw %DVH UHDVVHPEOHG Damages at the neck and in the hair seem to deliberate.


506 %URQ]HE©VWHGHV$JULSSD3RVWXPXV " Wahrschein lich 19. Jh. H ca. 18cm. Hohlguss. Neuzeitliche Kopie eines römischen Porträtkopfes des Agrippa Postumus (?). Intakt. 300,– Provenienz: Ex Sammlung G. Hauck., Süddeutschland. 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. 9JO.)LWWVFKHQ3=DQNHU.DWDORJGHUU¤PLVFKHQ3RUWU”WV in den Capitolinischen Museen und den anderen kommunalen 6DPPOXQJHQGHU6WDGW5RP,  6IPLW7DI Bei dem Dargestellten handelt es sich um einen Angehörigen des Herrscherhauses, wahrscheinlich um den 12 v.Chr gebo renen Agrippa Postumus, den Bruder von Gaius und Lucius Caesar. Er wurde schon zu Lebzeiten mit Statuen geehrt und rückte, nachdem er im Jahr 4. n. Chr. zusammen mit Tiberius von Augustus adoptiert wurde, ins Licht der Öffentlichtkeit. Die ŠKQOLFKNHLWGHU*HVLFKWV]©JHXQGGHVG©VWHUHQHUJLVFKHQ*H sichtsausdrucks von Agrippa mit seinem nachgeborenen Sohn VSULFKWI©UGLHVH,GHQWL}]LHUXQJ Bronze head of a member of the Roman Imperial Family, most probably of Agrippa Postumus, the brother of Gaius and Lucius Caesar, who was adopted by Augustus. The similarity of Agrippa‘s facial features and somber, energetic expression to KLVSRVWKXPRXVVRQVSHDNVWRWKLVLGHQWL}FDWLRQWKFHQWXU\ copy after a Roman original. Intact.

506

 .HQWDXUHQNRSIDXV%URQ]HWahrscheinlich 19. Jh. H 14,5cm. Hohlguss. Neuzeitliche Kopie eines römi schen Kentaurenkopfes, der sich heute im Histori schen Museum der Pfalz in Speyer (Inv. HMB 125) EH}QGHW 'HU .RSI LVW PLW HLQHP 6W”QGHU DXI GHP Steinsockel befestigt. Bärtiger Kopf mit wild gelock tem Haar, leicht geöffnetem Mund, buschigen, leicht zusammengezogenen Augenbrauen und Pferdeoh ren. Intakt. 500,– Provenienz: Ex Sammlung G. Hauck., Süddeutschland. 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. Bei dem originalen Vorbild handelt es sich um eine hellenisti sche Bronzestatuette aus der Zeit um 200 v. Chr. Diese wurde vermutlich im 1. Jh. v. Chr. für den römischen Kentaurenkopf in Speyer kopiert. Dieser Kopf gehörte ursprünglich zu einer Statu ette und war separat im Hohlgussverfahren gefertigt, wobei die Augen und Zähne in Silber eingelegt waren. Der Kopf in Speyer wurde noch in römischer Zeit zu einem Büstengewicht einer Schnellwaage umfunktioniert. Dafür wurde eine Aufhängeöse angebracht sowie der Hohlraum des Kopfes mit Blei verfüllt. Er hatte dann ein Gewicht, das in etwa 13 Librae = 4257g entsprach. Gefunden wurde der Kopf in Schwarzenacker im 6DDUODQGYHUPXWOLFKLQGHUGRUWLJHQ5¤PHUVWDGWGLHJHQDXHQ Fundumstände sind aber nicht geklärt. Der Kopf befand sich im -DKUKXQGHUWLQGHU&DUOVEHUJ6DPPOXQJGHV+HU]RJV.DUO August von Zweibrücken und gelangte hundert Jahre später in die Sammlung des Historischen Vereins. Bronze head of a centaur. 19th century copy after a Roman bronze head in the Historisches Museum der Pfalz in Speyer. The Roman centaur head was a copy of an Hellenistic statuette of 200 B.C. and has in silver inlaid eyes and tooth. The head in Speyer was converted into a bust weight for a running scale in the Roman Period. Intact.



239


508

509

510

511

508 $PHWK\VWJHPPH PLW +HUUVFKHUSRUWU”W (QJODQG XP  + FP*HZ¤OEWH*HPPHDXIGHU~DFKHQ6HLWHGHUKRFKRYDOH Intaglio mit dem Porträt des Kaisers Trajan mit Lorbeerkranz Q&KU :LQ]LJHV5DQGIUDJPHQWIHKOW u Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Amethyst domed gemstone with the portrait of the Roman emperor 7UDMDQ $' (QJODQGDERXW7LQ\IUDJPHQWRIWKHHGJH missing.

512

head and neck on cock‘s leg with the body built of a silenus mask, right and OHIWRIWKHGHSLFWLRQ5RPDQOHWWHUVWKWKFHQWXU\7LQ\IUDJPHQWRIWKH edge missing.

511 /DJHQDFKDWPLW3KLORVRSKHQSRUWU”W-K+FP0HKU schichtiger Langenachat, auf dem hochovalen Intaglio Porträt eines bärtigen Philosophen, wahrscheinlich Sokrates. Intakt. 500,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970.

509 €0DJLVFKH*HPPHyDXVEUDXQHP.DUQHRO-K+FP +RFKRYDOEHLGVHLWLJ,QWDJOLR$(LQQDFNWHU)UDXHQN¤USHUDXI HLQHUNOHLQH6”XOH~DQNLHUWYRQ=ZHLJHQLQ*HI”gHQVRZLHGLH Buchstaben P - U%(LQ%HZDIIQHWHUPLW6FKLOGXQG6WDQGDUWH auf einem Baum in einer Mondsichel, auf der vorne ein Hund steht, links ein Helioskopf und ein Monogramm, rechts ein Pentagramm. Am Rand etwas bestoßen. 500,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. ,PLWDWLRQRIDQFLHQWPDJLFDOJHPRIFRUQHOLDQGHSLFWHGRQERWKVLGHVWK 20th century. Tiny fragments of the edge missing.

510 6RJ +LSSDOHFWU\RQ DXV URWHP .DUQHRO    -K + FP Auf dem hochovalen Intaglio eine Kombination aus einem 3IHUGHNRSI XQG KDOV GHU DXI GHQ %HLQHQ HLQHV +DKQHV VWHKW der Körper wird aus einer Silensmaske gebildet. Rechts und OLQNV GLH %XFKVWDEHQ ,1/  $. :LQ]LJHV 5DQGIUDJPHQW fehlt. 500,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Vgl. M. Henig, Classical Gems. Ancient and modern intaglios and cameos in WKH)LW]ZLOOLDP0XVHXP&DPEULGJH  61U 6RFDOOHG+LSSDOHFWU\RQRIUHGFRUQHOLDQGHSLFWLQJDFRPELQDWLRQRIDKRUVH

240

Layered agate gemstone with a bearded philosopher portrait, probably 6RFUDWHVWKWKFHQWXU\,QWDFW

512 *ODVJHPPHPLWEXNROLVFKHU6]HQHKlassizistisch, Anfang 19. Jh. B 4cm. Transluzentes Glas. Auf dem querovalen Intaglio eine bukolische Szene mit einem Satyrn in einem Strauch, der seine Hand zu einer weiblichen Figur ausstreckt, zwischen beiden steht eine Amphore, links eine Mänade, die ihr Gewand über den Kopf gebauscht hat. Die Szene auf einer Standlinie, darunter die Künstlersignatur LIKOC, das Ganze in einem Rahmen. Intakt. u Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Die Künstlersignatur ‚Likos‘ ist von einigen Intaglien bekannt, die für die 6DPPOXQJGHVSROQLVFKHQ)©UVWHQ6WDQLVODXV3RQLDWRZVNL  HU stellt wurden. Dargestellt sind darauf in erster Linie neoklassische, mythologi sche Szenen. Ein Teil der Sammlung des Fürsten (1140 Stücke von insgesamt 1235) wurde nach seinem Tod von seinen Erben bei Christie‘s in London 1893 für 12.000 Pfund versteigert. Mehr zur Sammlung des Fürsten Ponia towski in: D. Berges, Höchste Schönheit und einfache Grazie. Klassizistische Gemmen und Kameen der Sammlung Maxwell Sommerville im University of Pennsylvania Museum of Archaeology and Anthropology, Philadelphia PA (2011) S. 99 ff.; besonders S. 109. Glass gem with bucolic scene and inscription of the artist LIKOC. 19th century. Intact.


LOTS Die folgenden Lots sind nicht in unserem gedruckten Katalog abgebildet! Bitte besichtigen Sie VLHLQXQVHUHU*DOHULH$EELOGXQJHQ}QGHQ6LHDXIXQVHUHU+RPHSDJH$OOH/RWVZHUGHQYHUNDXIW ZLHEHVHKHQ.HLQH5©FNJDEH 7KHIROORZLQJORWVDUHQRWLOOXVWUDWHGLQRXUSULQWHGFDWDORJXH3OHDVHYLHZDWRXURI}FH<RXPD\ DOVR}QGLOOXVWUDWLRQVRQRXUKRPHSDJH$OOORWVDUHVROGDVYLHZHG1RUHWXUQV ,ORWWLVHJXHQWLQRQVRQRLOOXVWUDWLQHOQRVWURFDWDORJRPDSRVVRQRHVVHUHSUHVLLQYLVLRQHQHO QRVWURXI}FLR,PPDJLQLWURYLVXOQRVWURVLWRZHE,ORWWLYHQJRQRYHQGXWLFRPHSUHVLLQYLVLRQHH SLDFLXWL1RQ™SRVVLEOHUHVWLWXLUOL /HVORWVVXLYDQWVQHVRQWSDVLOOXVWU˜VGDQVQRWUHFDWDORJXH,OHVWQ˜DQPRLQVSRVVLEOHGHOHV DGPLUHUGDQVQRWUHJDOHULH9RXVWURXYHUH]OHXUVSKRWRJUDSKLHVVXUQRWUHVLWHLQWHUQHW /HVORWVVRQWYHQGXVWHOVTXHOV/HVUHWRXUVQHVHURQWSDVDFFHSW˜V 513 Becher auf niedrigem Fuß. 5¤PLVFKH.DLVHU]HLW-KQ&KU H 8,63cm, Ø 8,3cm. Glockenförmiger Körper aus bläulichem Klarglas auf einem niedrigen Fuß. Intakt. 400,– 3URYHQLHQ]([6DPPOXQJ'U001RUGUKHLQ:HVWIDOHQ,Q'HXWVFKODQG seit vor 1972. Elegant glass goblet on low stem made from bluish clear glass. Roman ,PSHULDO3HULRGQGWKFHQWXU\$',QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

514 =ZHLU¤PLVFKH*O”VHU-KQ&KU%DXFKLJH)ODVFKHXQG Topf, H 10,2 und 8,5cm. 6W©FN Intakt mit schöner Iris. 300,– Provenienz: Ex Privatsammlung W. F., München, seit vor 2000. 7ZR5RPDQJODVVHVVWQGFHQWXU\$',QWDFWZLWKQLFHLULGHVFHQFH2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

516 .OHLQH6DPPOXQJ*O”VHU-KQ&KU7U”QHQ~”VFKFKHQ+ 11cm, geklebter Bruch an der Lippe; ein Sprinkler mit feinem, diagonalen Rippendekor, H 10,5cm, intakt; Fläschchen mit lan gem Hals und konischem Corpus, H 14,5cm (kleine Repara tur am Corpus); Becher mit diagonalen Rippen, restauriert, H 8,5cm. 6W©FN 300,– 3URYHQLHQ]([6DPPOXQJ'U001RUGUKHLQ:HVWIDOHQ,Q'HXWVFKODQG seit vor 1972. 6PDOOFROOHFWLRQRI5RPDQJODVVFRPSULVLQJDQXQJXHQWDULXPDYHU\}QH VSULQNOHUD~DVNZLWKORQJQHFNDQGFRQLFDOERG\DQGDEHDNHUZLWKGLDJRQDO ribs. The beaker restored, the unguentarium with a small piece at the rim reattached, otherwise intact. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Zwei Glasarmreife. %\]DQWLQLVFK RGHU LVODPLVFK    -K Q &KUDkFP*HOEHJU©QHXQGURWH6WUHLIHQDXIEHLJHEUDX QHP*ODVDP5DQGJHOEURWHV.RUGHOw%DQG:LQ]LJHV)UDJ PHQW LP 5HL}QQHUHQ IHKOW E k FP 5RWH JHOEH ZHLgH XQG schwarze Streifen auf transluzentem, grünlichen Glas, am Rand VFKZDU]ZHLgHV.RUGHOw%DQG:LQ]LJHV5DQGIUDJPHQWIHKOW2 6W©FN7UDJEDU 250,–

515 .OHLQH 6DPPOXQJ U¤PLVFKHU *O”VHU +  ELV FP (LQ kleiner kugeliger Becher aus grünlichem Klarglas, ein konischer und ein zylindrischer Becher aus blauen Klarglas sowie ein hoher Faltenbecher aus farblosem Klarglas. 6W©FN Intakt, der NXJHOLJH%HFKHUPLW6LQWHUUHVWHQ u

Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970.

3URYHQLHQ]$XVGHP1DFKODVV0%LQ'HXWVFKODQGVHLWYRU

518 Goldfolie. Hellenistisch, 3. Jh. v. Chr. L 8,4cm, max. B 3cm J  $P\JGDORLGH )RUP PLW YLHU %HIHVWLJXQJVO¤FKHUQ 0LW geprägten Punkten. Wahrscheinlich Gewandapplike. Winziges Randfragment fehlt. 225,–

Small collection of Roman beakers of different types made of greenish, bluish or colorless glass. All intact, the smallest one with remains of sinter. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

7ZRJODVVEUDFHOHWVZLWKPXOLWFRORXUHGVWULSHV%\]DQWLQHRU,VODPLFWK 12th century A.D. Tiny fragment of each bracelet missing. 2 pieces! Wearable! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997, in Deutschland seit 1997. Gold foil embossed with circles, probably a garment applique. Hellenistic, 3rd century B.C. Tiny fragment missing. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

241


519 *ROGHQHU$QK”QJHUPLW$PXOHWW3K¤QL]LVFK-KY&KU/ 6,3cm. Anhänger aus drei Goldelementen, die zur Stabilisierung verfüllt sind und mit einem Draht innen miteinander verbunden VLQG $P REHUVWHQ (OHPHQW HLQH VH DP XQWHUVWHQ HLQ O”QJV und quer durchbohrtes, rechteckiges Amulett aus gelblichem 6WHLQ(WZDV]HUGU©FNWLQWDNW u Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997, in Deutschland seit 1997. 7ULSDUWLWHJROGSHQGDQWZLWKVPDOODPXOHW3KRHQLFLDQWKWKFHQWXU\%& Slightly scratched, intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

520 Goldohrring in Bootsform. 5¤PLVFK  -K Q &KU J / 2,5cm. Bügelohrring mit bootsförmigem Corpus. Gold. Intakt. 400,– Provenienz: Ex Gorny & Mosch, München Auktion 275, 2020, Los 193; ex 6DPPOXQJ9/5KHLQODQG *ROGHQERDWVKDSHGHDUULQJ5RPDQWKFHQWXU\$',QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

521 Goldohrring in Bootsform. Griechisch, östlicher Mittelmeerraum, 6. Jh. v. Chr. 1,54g, L 2,3cm. Bügelohrring mit bootsförmigem Corpus, der mit Golddraht und Granulat dekoriert ist. Gold. Intakt. 400,–

523 Sammlung Goldschmuck. 5¤PLVFK-KQ&KUDJ 5LQJJU¤gH  6FKPDOH QDFK DXgHQ NRQYH[H KRKOH QDFK oben breiter werdende Schiene, auf der Platte eine Gemme aus rotem Karneol mit der Inschrift YUXH. In der Schiene ein kleines Loch. b. 3,14g, Ringgröße 42. Schmale, nach oben breiter werdende Schiene aus Goldblech, auf der Platte eine Gemme aus Nicolo. Auf dem Intaglio ein Stern, eine Mondsichel und ein Monogramm. c. 0,55g, hohle Schiene eines islamischen Ringes mit Gravuren. Ringstein fehlt. d. 2,03g, L 3cm. Bügelohrring mit Schild und Anhänger in Form einer Muschel mit Dreieck. Intakt. *ROG6W©FN 500,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Collection of gold jewellery: a. Fingerring with a gemstone of red cornelian with the inscription YUXH. In the hoop a tiny hole. b. Fingerring with a gemstone of nicolo. On the intaglio a star, a crescent moon and a monogram. c. Islamic hoop with graved patterns without ringstone. d. Bow earring with pendant. ,QWDFW5RPDQQGUGFHQWXU\$'4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

524 *ROG}QJHUULQJPLW*ODVJHPPH+HOOHQLVWLVFK-KY-KQ &KUJ5LQJJU¤gH6FKPDOHEDQGDUWLJH6FKLHQHGLHLQ eine hohe Fassung übergeht. Darin eingelassen eine Gemme aus schwarzem, opaken Glas. Auf dem längsovalen Intaglio Merkur mit Caduceus und Geldbörse. Schiene zwei Mal gebrochen und wiederangesetzt, etwas zerdrückt. 450,– 3URYHQLHQ]([6DPPOXQJ65RVHQEDXP.URHEHU$VFRQD seit 1988 im Familienerbe Deutschland.

Provenienz: Ex Gorny & Mosch, München Auktion 275, 2020, Los 207; ex 6DPPOXQJ9/5KHLQODQG

*ROG}QJHUULQJZLWKEODFNJODVVJHPVWRQHGHSLFWLQJ0HUFXU\ZLWKFDGXFHXV DQGSXUVH+HOOHQLVWLFVWFHQWXU\%&VWFHQWXU\$'+RRSWZRWLPHV broken and reattached, slightly crushed.

*ROGHQERDWVKDSHGHDUULQJZLWKZLUHDQGJUDQXOHGHFRUDWLRQ*UHHNHDVWHUQ 0HGLWHUUDQHDQWKFHQWXU\%&,QWDFW

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

525 *ROGULQJ PLW +HOLRWURS*HPPH 5¤PLVFK    -K Q &KU 1,90g. Ringgröße 44. Kinderring. Schmale, nach oben breiter werdende Schiene aus verfülltem Goldblech und Schulterknick. Auf der Platte in einer kelchartigen Fassung eine querovale Gemme aus Heliotrop, auf dem Intaglio ein Stier unter einem Zweig. Schiene teilweise zerdrückt, mit Rissen. 180,–

522 Sammlung Goldobjekte. (WUXVNLVFK XQG U¤PLVFK  -K Y   -K Q &KU J 'DUXQWHU GUHL 2KUULQJH *ROGSHUOHQ XQG DQK”QJHU VHFKV 0LQLDWXUSHUOHQ DXI 1\ORQVFKQXU DXIJH]RJHQ u.a.m. 6W©FN Größtenteils intakt. 300,– Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997, in Deutschland seit 1997. Collection of gold objects including earrings, beads and further more. Etruscan DQG5RPDQWKFHQWXU\%&QGFHQWXU\$'0RVWO\LQWDFW16 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

242

Provenienz: Ex Französische Privatsammlung E. G., erworben auf dem französischen und englischen Kunstmarkt. In Deutschland vor 2001. *ROGHQ}QJHUULQJZLWKJHPVWRQHRIKHOLRWURSHGHSLFWLQJDEXOOXQGHUDEUDQFK 5RPDQVWUGFHQWXU\$'/RRSSDUWLDOO\VFUDWFKHGDQGZLWK}VVXUHV VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


526 9HUJROGHWHU %URQ]HULQJ PLW EODXHP *ODVVWHLQ Hellenistisch, 2.   -K Y &KU 5LQJJU¤gH  6FKPDOH QDFK REHQ EUHLWHU werdende Schiene, auf der Platte ein gewölbter Ringstein aus blauem Glas mit einer weiblichen Figur. Intakt. 400,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ Sammlung Manfred Schwarz, München; erworben im deutschen Kunsthandel. *LOGHG EURQ]H }QJHUULQJ ZLWK EOXH JODVV VWRQH GHSLFWLQJ D IHPDOH }JXUH +HOOHQLVWLFQGVWFHQWXU\%&,QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 %URQ]HXQG6LOEHUULQJPLW*HPPH-KQ&KUD5LQJ größe 53. Schmale, nach außen konvexe, nach oben breiter werdende Schiene aus Silber mit Schulterknick. Auf der Platte oktogonale Gemme aus Achat, auf dem Intaglio Ameise. Ring intakt, Gemme modern wieder angeklebt, mit Sprüngen. Erwor ben 09.08.2013 bei London Ancient Coin Art Ltd. b. Ringgröße  6FKPDOH QDFK DXgHQ NRQYH[H QDFK REHQ EUHLWHU ZHU dende Schiene aus Bronze mit Riefen, oben auf der Platte hoch ovale Gemme aus rotem Karneol, auf dem Intaglio thronender Jupiter mit Zepter. Intakt. Erworben bei Gorny & Mosch, Mün FKHQ$XNWLRQ/RV H[6DPPOXQJ(0'HXWVFK land, erworben in den 1990er Jahren). 6W©FN$OOHPLW.RSLHGHU Rechnung! 300,– Provenienz: Aus der bayerischen Privatsammlung H. W.

530 *HPPHDXV6DUGRQ\[5¤PLVFK-KQ&KU%FP$XI dem querovalen Intaglio ein Pfau. Intakt. 225,– Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997, in Deutschland seit 1997. *HPVWRQHRIVDUGRQ\[GHSLFWLQJDSHDFRFN5RPDQVWQGFHQWXU\$' Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

531 Gemme aus Karneol. 5¤PLVFK    -K Q &KU % FP Gewölbte Gemme mit einem Hund vor einem Strauch. Winzige Fragmente fehlen. 225,– Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997, in Deutschland seit 1997. Gemstone of cornelian depicting a running dog in front of a tree. Roman, VWQGFHQWXU\$'7LQ\IUDJPHQWVPLVVLQJ VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

532 *ODVJHPPH PLW )UDXHQE©VWH 5¤PLVFK    -K Q &KU + 1,2cm. Aus transluzentem Klarglas mit einem Frauenkopf. Intakt. 200,–

$ VLOYHU }QJHUULQJ ZLWK DFKDW JHPVWRQH GHSLFWLQJ DQ DQW DQG D EURQ]H }QJHUULQJZLWKFRUQHOLDQJHPVWRQHGHSLFWLQJHQWKURQHG-XSLWHUZLWKVFHSWUH 5RPDQ,PSHULDO3HULRGQGUGFHQWXU\$'2 pieces! Both with copy of the invoice!

Provenienz: Ex Sammlung C. S., München, erworben im Münchner .XQVWKDQGHO

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

528 Gemme aus Lagenachat. 5¤PLVFK-KQ&KU+FP Lagenachat, auf dem längsovalen Intaglio Venus Victrix, die einen Fuß auf einen Schemel gestellt hat und einen Helm in ihrer Hand betrachtet, zu ihren Füßen ein Schild. Reste der Metallfassung am Rand, intakt. 450,–

533 Sammlung römischer Gemmen.    -K Q &KU D + FP Aus rotem Jaspis. Auf dem oktogonalen Intaglio Sol mit Strahlenkrone, erhobener Rechten und Peitsche in der Linken, davor Keule. Fragmente auf der Rückseite fehlen (ehemals gefasst). Erworben am 01.10.2015 beim Münzzentrum Rheinland, Solingen. b. Ø 1,1cm. Aus orangem Karneol. Auf dem runden Intaglio sitzender Merkur mit Caduceus und Geldbeutel. Größeres Fragment der Rückseite fehlt. Erworben bei Gerhard +LUVFK1DFKI0©QFKHQ$XNWLRQ/RV c. H 2,1cm. Aus rotem Jaspis. Auf dem hochovalen Intaglio auf Widder reitender Merkur mit Caduceus. Am oberen und unteren Rand fehlende Fragmente (ehemals gefasst). Erworben bei Gerhard +LUVFK1DFKI0©QFKHQ$XNWLRQ/RV 6W©FN$OOH mit Kopie der Rechnung! 250,–

Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997, in Deutschland seit 1997. Gemstone of layered agate depicting Venus Victrix looking at a helmet in her KDQG5RPDQVWQGFHQWXU\$'7UDFHVRIWKHPHWDOOPRXQWLQJLQWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

529 Gemme aus Lagenachat. 5¤PLVFK-KQ&KU%FP Zweischichtiger Lagenachat, auf dem querovalen Intaglio eine stehende Kuh. Intakt. 450,– Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997, in Deutschland seit 1997. *HPVWRQHRIOD\HUHGDJDWHGHSLFWLQJDFRZ5RPDQVWQGFHQWXU\$' Intact.

*ODVVJHPVWRQHZLWKDIHPDOHEXVW5RPDQQGUGFHQWXU\$',QWDFW

Provenienz: Aus der bayerischen Privatsammlung H. W. Collection of Roman gemstones of red jasper and red cornelian depicting Sol with whip, sitting Mercury with caduceus and purse and riding Mercury with FDGXFHXV5RPDQ,PSHULDO3HULRGQGUGFHQWXU\$'$OOZLWKPLVVLQJ fragments and formerly mounted. 3 pieces! All with copy of the invoice! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

243


534 Sammlung Gemmen. 5¤PLVFK    -K Q &KU D % FP Aus Karneol. Achteckige Gemme, auf dem querovalen Intaglio bukolische Szene mit Hirte, Ziege und Zweig. Winzige Fragmente fehlen. b. H 1,5cm. Aus Karneol. Ovale Gemme, auf dem hochovalen Intaglio zwei sitzende Figuren und zwei Sterne. Intakt. c. H 1,1cm. Aus Nicolo. Ovale Gemme, auf dem hochovalen Intaglio eine männliche Figur vor zwei Zweigen. Winziges Fragment fehlt. d. B 1cm. Aus Karneol. Achteckige Gemme mit griechischer Inschrift in zwei Zeilen: HLIOD/WRAS. Intakt. e. B 0,9cm. Aus Jaspis. Ovale Gemme mit griechischer Inschrift in zwei Zeilen: ISID/WROU. Winziges Fragment fehlt. 5 6W©FN 500,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Collection of Roman gemstones of cornelian and jasper depicting a bucolic VFHQHDPDQLQIURQWRIEUDQFKHVWZRVLWWLQJ}JXUHVDQGWZR*UHHNLQVFULSWLRQV HLIOD/WRAS and ISID/WROUVWUGFHQWXU\$'3DUWLDOO\ZLWKWLQ\ missing fragments. 5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

535 6DPPOXQJHQ QHX]HLWOLFKHU *HPPHQ    -K $XV verschiedenfarbigem Glas und Karneol. Darunter vier Stück mit arabischer Inschrift, eine gewölbte Glasgemme mit dem Porträt eines byzantinischen Kaisers mit Kreuzstab, eine mit einem Vogel, ein Glascameo mit einem Athleten und einem Greif, eine Blume mit Inschrift u.a.m. 6W©FN Größtenteils intakt. 300,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970.

 6WHPSHOVLHJHODXV$FKDW6DVDQLGLVFK-KQ&KU/FP +FP(OOLSVRLGPLW%RKUXQJDXIGHUTXHURYDOHQ6LHJHO~”FKH ein Pferd. Intakt. 120,– Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997, in Deutschland seit 1997. Stamp seal of agate with drilling, on the sealing surface a horse. Sasanian, WKWKFHQWXU\$',QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

538 6WHPSHOVLHJHODXV$FKDW6DVDQLGLVFK-KQ&KU/FP +FP(OOLSVRLGPLW%RKUXQJDXIGHUTXHURYDOHQ6LHJHO~”FKH HLQ3HJDVRV(WZDVEHVWRgHQ u Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997, in Deutschland seit 1997. Stamp seal of agate with drilling, on the sealing surface a pegasos. Sasanian, WKWKFHQWXU\$'6XUIDFHVOLJKWO\ZRUQ VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

539 %URQ]HDQK”QJHU PLW *HPPH 6DVDQLGLVFK    -K Q &KU % FP %URQ]HIDVVXQJ PLW VH GDULQ HLQH TXHURYDOH *HPPH aus Hämatit mit zwei springenden Steinböcken rechts und links YRQHLQHP%DXP,QWDNW u

Collection of modern gemstones of differently coloured glass or cornelian including four pieces with Arabic inscription, one domed glass gem with the portrait of a Byzantine emperor, one with a bird, a glass cameo with an athlete DQGDJULI}QD~RZHUZLWKLQVFULSWLRQDQGIXUWKHUPRUHWKWKFHQWXU\ Mostly intact. 13 pieces!

Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997, in Deutschland seit 1997.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

536 6DPPOXQJHQQHX]HLWOLFKHU*HPPHQ-K$XVYHUVFKLHGHQ farbigem Glas, Amethyst, Karneol, Achat, Lagenachat. Darunter eine Glasgemme mit Löwe, eine mit drei männlichen, gestaffelten Porträts, eine mit Herakles und dem Nemeischen Löwen, eine Achatgemme mit vier Pfauen, eine Amethystgemme mit Hirsch, eine Karneolgemme mit Strauß, eine Gemme mit Dionysos XQG(URVHLQ.ULHJHUPLW/DQ]HXQG6FKLOGGHUVHLQHQ+HOP EHWUDFKWHWXQGHLQH3KLORVRSKHQSRUWU”WPLWSVHXGRJULHFKLVFKHU Inschrift. 6W©FN Größtenteils intakt. 300,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Collection of modern gemstones of differently coloured glass or cornelian including four pieces with Arabic inscription, one domed glass gem with the portrait of a Byzantine emperor, one with a bird, a glass cameo with an athlete DQGDJULI}QD~RZHUZLWKLQVFULSWLRQDQGIXUWKHUPRUHWKWKFHQWXU\ Mostly intact. 13 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

244

Bronze pendant with eyelet and gemstone of haematite depicting two jumping LEH[HVEHWZHHQWKHPDWUHH6DVDQLDQWKWKFHQWXU\$',QWDFW


540 Sammlung Stempelsiegel. 6DVDQLGLVFK-KQ&KUD+FP +DOERYRLGHV$FKDWVLHJHOPLW%RKUXQJDXIGHU6LHJHO~”FKH]ZHL sich gegenüber stehende Figuren, die einen Gegenstand halten, GDKLQWHU XPJHGUHKWH /DQ]H ,QWDNW E + FP +DOERYRLGHV $FKDWVLHJHO PLW %RKUXQJ DXI GHU 6LHJHO~”FKH HLQH VWHKHQGH Figur mit erhobenen Armen. Winzige Fragmente fehlen. c. H 1,3cm. Halbkugeliges Chalzedonsiegel mit Bohrung, auf GHU 6LHJHO~”FKH HLQ +DKQ ,QWDNW G k FP +DOENXJHOLJHV 6LHJHOPLW%RKUXQJDXVJU©QHP-DVSLVDXIGHU6LHJHO~”FKHHLQ JH~©JHOWHU 6WLHU ,QWDNW H k FP +DOENXJHOLJHV 6LHJHO DXV VFKZDU]HP$FKDWPLW%RKUXQJDXIGHU6LHJHO~”FKHHLQ=HEX 5LQG (WZDV EHVWRgHQ I k FP +DOENXJHOLJHV .DUQHRO 6LHJHO PLW %RKUXQJ DXI GHU 6LHJHO~”FKH HLQ +LUVFK :LQ]LJHV )UDJPHQW IHKOW J k FP +DOENXJHOLJHV .DUQHRO6LHJHO PLW %RKUXQJDXIGHU6LHJHO~”FKHHLQ=HEX5LQG,QWDNWKkFP +DOENXJHOLJHV.DUQHRO6LHJHOPLW%RKUXQJDXIGHU6LHJHO~”FKH HLQHP”QQOLFKH%©VWH(WZDVEHVWRgHQL%FP6NDUDERLGH Gemme aus verbrannten Karneol, darauf eine Antilope. Intakt. 6W©FN 300,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Collection of Sasanian stamp seal, mostly hemispherical of agate, chalcedony, MDVSLVDQGFRUQHOLDQGHSLFWLQJKXPDQ}JXUHVDQGDQLPDOVOLNHELUGFHEXEXOO DQWHORSHDQGRQHVFDUDERLGJHPVWRQHWKWKFHQWXU\$',QWDFWRUZLWK tiny fragments missing. 9 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

541 6DPPOXQJYHUVFKLHGHQH6LHJHOW\SHQa. H 2,9cm. Zylindersiegel aus grünem Stein. Die Abrollung zeigt zwei Figuren zwischen =ZHLJHQ 0HVRSRWDPLVFK  -W Y&KU (WZDV EHVWRgHQ E % 2,4cm. Fast rechteckiges Siegel mit Öse aus schwarzem Stein, DXI GHU 6LHJHO~”FKH /LQLHQ (WZDV EHVWRgHQ 0HVRSRWDPLHQ    -W Y &KU F / FP 6LHJHO LQ )RUP HLQHU (QWH PLW zurückgewandtem Kopf und Bohrung, aus schwarzem Stein, DXI GHU 6LHJHO~”FKH RUQDPHQWDOH /LQLHQ ,QWDNW %D\ORQLVFK DVV\ULVFK  -W Y &KU G / FP 7LHU}JXU DXV 6WHDWLW PLW %RKUXQJ,QWDNW-HPGHW1DVU3HULRGHY&KUH% FP/HQWRLGPLW%RKUXQJDXIGHU6LHJHO~”FKHHLQHVLW]HQGH )LJXU,QWDNW/HYDQWH-WY&KUIkFP5XQGH6FKHLEH PLW%RKUXQJDXVJU©QHP6WHLQ$XIHLQHU6HLWHHLQJH~©JHOWHU Stier, auf der anderen Seite ein Stier, der von einem anderen Tier DQJHJULIIHQZLUG)HKOHQGH)UDJPHQWH%DE\ORQLVFKDVV\ULVFK Jt. v. Chr. 6W©FN 200,–

542 Silberapplike mit Frauenkopf. 5¤PLVFK-KQ&KUkFD 3cm. Medaillonartige, aus Silberfolie geprägte Applike, auf der Rückseite ein Haken und mit Blei verfüllt. Wahrscheinlich ein Kästchenbeschlag. Reste von Sinter, feine Risse. 300,– Provenienz: Ex Gorny & Mosch, München Auktion 275, 2020, Los 181; ex 6DPPOXQJ9/5KHLQODQG $SSOLTXHPHGDOOLRQOLNHDQGHPERVVHGLQVLOYHUIRLOZLWKDKRRNRQWKHEDFN DQG}OOHGZLWKOHDG3UREDEO\DER[}WWLQJ5RPDQVWQGFHQWXU\$' 7UDFHVRIVLQWHUWLQ\}VVXUHV VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

543 %URQ]HDUPUHLI%\]DQWLQLVFK-KQ&KUkFP6FKPDOHU nach außen konvexer Reif mit stilisiertem Schlangenkopf und YROXWHQI¤UPLJHP(QGHVSLUDODUWLJDXIJHZLFNHOW,QWDNW u Provenienz: Aus deutscher Privatsammlung U. R., erworben vor 2003. Bronze bracelet terminating in a stylized snake head and a volute. Byzantine, WKWKFHQWXU\$',QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

544 Silberner Pantherohrring. +HOOHQLVWLVFK    -K Y &KU k 3,2cm. Bügelohrring mit einem plastischen Pantherkopf. Dunkle Tönung, intakt. 120,– Provenienz: Ex Privatsammlung S., Niederlande, erworben vor 1997. 6LOYHUHDUULQJZLWKSDQWKHUKHDG+HOOHQLVWLFQGVWFHQWXU\%&'DUN toning, intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

545 %URQ]HDSSOLNH5¤PLVFK-KQ&KU+FP%FP Bronzeguss. Teil einer Möbelapplike, die einen auf den rechten Arm gestützten Männerkopf zeigt, wahrscheinlich ein Flussgott. Grünbraune Patina, fragmentarisch. 300,– Provenienz: Ex deutsche Privatsammlung M. L., erworben vor 1992.

Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970.

Bronze furniture applique depicting a male head, probably a river god. Roman, QGUGFHQWXU\$'*UHHQEURZQSDWLQDIUDJPHQW

Collection of different seal types of the Ancient Near East including a cylinder seal, a rectangluar seal with eyelet, a seal in shape of a duck, an animal amulet, DOHQWRLGVHDODQGDURXQGGRXEOHVLGHGVHDOWKPLOOHQLXPVWPLOOHQLXP B.C. Mostly intact. 6 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

546 %URQ]HVWDWXHWWH0HUNXU5¤PLVFK-KQ&KU+FP'HU Götterbote mit Geldbeutel und Caduceus. Dunkelgrüne Patina, intakt. 350,– Provenienz: Aus der Sammlung M. S., in Deutaschland seit vor 1990. %URQ]H VWDWXHWWH RI 0HUFXU\ 5RPDQ VW  QG FHQWXU\ $' 'DUN JUHHQ patina, intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

245


 0\WKRORJLVFKH*UXSSH5¤PLVFKH.DLVHU]HLW-KQ&KU H 3,5cm. Bronzevollguss. Miniaturskulptur, die auf der einen Seite einen sitzenden Hund mit erhobener Vorderpfote und auf der anderen Seite einen Adler, der eine noch kleinere Frau in langem Gewand schützend unter seinen rechten Flügel nimmt, zeigt. Dunkelgrüne und rotbraune Patina, intakt. 250,–

551 :©UIHOLQ)UDXHQJHVWDOW5¤PLVFK-KQ&KU+FP Bronzevollguss. Nackte Frauengestalt mit angewinkelten Armen und Beinen. Augen und Brüste sind durch gepunzte, konzentrische Kreise wiedergegeben. Zwischen den Beinen eindeutige Geschlechtsangabe. Dunkelgrüne Patina, intakt. 250,–

Provenienz: Aus der Sammlung von Bernhard Wicki. In Deutschland seit vor 1977.

Provenienz: Ex Gorny & Mosch, München Auktion 272, 2020, Los 715 (verkauft für 550 €, blieb aber unbezahlt); ex Gorny & Mosch, München $XNWLRQ/RV 9JO0)LWW’6SLHOHXQG6SLHO]HXJLQGHU$QWLNH  6$EE

Mythological Roman bronze sculptural group showing back to back a sitting dog with raised paw and a tiny woman in long clothes protected by an eagle ZKRFRYHUVKHUZLWKKLVULJKWZLQJ5RPDQ,PSHULDOSHULRGVWWKFHQWXU\ A.D. Green and auburn patina, intact.

5RPDQEURQ]HGLHLQIRUPRIDQDNHGZRPDQ5RPDQVWQGFHQWXU\ A.D. Dark green patina, intact.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

548 %URQ]HQHU 6WLHU 5¤PLVFK    -K Q &KU / FP $XI +RO]VRFNHOPRQWLHUW Dunkle Patina, intakt. 250,–

552 0HGXVD$SSOLNDXV%OHL5¤PLVFK-KQ&KU+HUKDOWHQ 9,5cm. Fehlstellen am linken Rand, auf der rechten Seite umgebördelt. 450,–

Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. 5RPDQEURQ]HEXOOVWUGFHQWXU\$''DUNSDWLQDLQWDFWMounted on wooden base! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

549 %URQ]HQHU:LGGHUNRSI5¤PLVFKH.DLVHU]HLW-KQ&KU/ 3,3cm. Hohlguss. Dunkelgrüne Patina, intakt. 400,– Provenienz: Ex Sammlung M. G., München seit den 1990er Jahren, erworben in der Antikengalerie W. Schmidt, München. %URQ]HKHDGRIDUDP5RPDQQGUGFHQWXU\$''DUNJUHHQSDWLQD intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

550 Entenkopf. *ULHFKHQODQG    -K Y &KU %URQ]HYROOJXVV / 5,3cm. Wohl von einem größeren Bronzegerät. Grüne Patina, gesockelt, fragmentarisch. 240,– Provenienz: Ex Gorny & Mosch, Auktion 275, 2020, Los 93; ex Sammlung -(%D\HUQHUZRUEHQHUELV$QIDQJHU,Q'HXWVFKODQGVHLWYRU 2000. $ EURQ]H KHDG RI D GXFN SUREDEO\ IURP D ODUJH YHVVHO *UHHN WK  UG century B.C. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Ehemals in einer deutschen Sammlung der 1980er Jahre. 5RPDQOHDGDSSOLTXHLQIRUPRIWKHIURQWDOIDFHRI0HGXVDQGUGFHQWXU\ A.D. Missing parts at the left side, at the right side folded. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

553 Statuette der Isis. 5¤PLVFK-KQ&KU+ RKQH6RFNHO  FP 6RFNHOFP 5¤WOLFKHU7RQDXVHLQHP0RGHOJHSUHVVW Isis mit hoher Krone und langen gedrehten Locken. Sie trägt einen Chiton, der die linke Brust freilässt und ein Tuch, das über der Brust mit einem sog. Isisknoten zusammen geschlungen ist. Kleine Abplatzungen im Ton, sonst intakt, auf modernen Holzsockel montiert. 650,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. 7HUUDFRWWDVWDWXHWWHRIWKHJRGGHVV,VLVPDGHRIUHGGLVKFOD\5RPDQVW QGFHQWXU\$'7LQ\VSOLQWHUVDUH~DNHGRIIRWKHUZLVHLQWDFWPRXQWHGRQ a wooden stand. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

554 Frau mit Becher. VWOLFKHU 0LWWHOPHHUUDXP    -K Y &KU H 23,5cm. Beiger Ton mit zahlreichen Bemalungsresten. Die Frau trägt ein langes Gewand und Raupenohrringe. Geklebter %UXFKDQGHU+©IWHUHFKWHU)XgZLHGHUDQJHVHW]W2EHU~”FKH im unteren Bereich teilweise abgeplatzt. 500,– Provenienz: Ex Sammlung H. J. S., Hessen; ex Gorny & Mosch, München $XNWLRQ/RVH[6DPPOXQJ(+6©GGHXWVFKODQGHUZRUEHQ vor 1977. 7HUUDFRWWD }JXULQH RI D ZRPDQ LQ ORQJ GUHVV KROGLQJ D EHDNHU (DVWHUQ 0HGLWHUUDQHDQ $UFKDLF 3HULRG WK  WK FHQWXU\ %& 7UDFHV RI FRORU reassembled at belly, right foot reattached, part of the surface at the lower part rubbed off. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

246


555 %©VWH GHU 'HPHWHU Magna Graecia, 5. Jh. v. Chr. H 11,5cm. $XVU¤WOLFKHP7RQ+DOESODVWLVFKDXIGHU5©FNVHLWH~DFKREHQ offen, matrizengeformt. Auf dem Kopf trägt die Figur einen Polos aus Blättern und Früchten (?), an der rechten Seite Reste des Mantels. Gebrochen unterhalb der Brust, linker Oberkörper fehlt, Reste von Sinter. 450,– Provenienz: Ex deutsche Privatsammlung der 1980er Jahre. Clay bust of Demeter with polos. Magna Graecia, 5th century B.C. Surface worn, traces of sinter, broken below the breast, left part of the upper body missing. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

556 .RSIHLQHV0”GFKHQVPLW3RORV0DJQD*UDHFLDY&KU +FP+HOOHU7RQPLWEHLJHU(QJREH,P+DOVJHEURFKHQ 300,– Provenienz: Ex österreichische Privatsammlung M. S., seit 1970er Jahren. +HDGRIDJLUOZLWKSRORV0DJQD*UDHFLD%&7HUUDFRWWDZLWK beige engobe. Broken at the neck. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Protome einer Frau. 0DJQD*UDHFLDXPY&KU+FP B 8,9cm. Beiger Ton. Matrizengeformt. Kopf einer jungen Frau mit Schleier. Oben eine Bohrung als Aufhängevorrichtung. Stellenweise Verkrustungen, sonst intakt. 500,– 3URYHQLHQ]([6DPPOXQJ()5KHLQODQG3IDO]DP2NWREHUDXI der Münzbörse Karlsruhe erworben. Terracotta protome depicting the head of a young veiled woman. Magna Graecia, about 500 B.C. Beige terracotta. Partially with incrustations, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

558 7HUUDNRWWD )UDXHQNRSI PLW .UDQ] Magna Graecia, 2. Jh. v. Chr. H 8,4cm. Rötlicher Ton. Massive Terrakotta mit Details in Kaltarbeit. Kopf einer jungen Frau mit Mittelscheitelfrisur XQG JURgHP (IHXNUDQ] 7HLOH GHV .UDQ]HV IHKOHQ LP +DOV gebrochen. 300,– Provenienz: Aus der Sammlung R. K., Hessen, erworben vor 1980. Terracotta head of a young woman with large ivy wreath. Magna Graecia, 2nd century B.C. Reddish terracotta. Part of the wreath is missing, broken at the neck. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

559 Fragment eines archaischen Terrakottaköpfchens. H 8,1cm. Montiert auf eine Unterlage und mit der Beschriftung „Gefunden beim Tempel der Hekate bei Selinunt April 1896“. 150,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. )UDJPHQWRID*UHHNDUFKDLFWHUUDFRWWDKHDGIRXQGLQ6HOLQXQW0RXQWHG on a support. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

560 6DPPOXQJ JULHFKLVFKHU 7HUUDNRWWD}JXUHQ EHUZLHJHQG 0DJQD *UDHFLDXQG-KY&KU.RSIHLQHVE”UWLJHQ0DQQHV PLW .UDQ] + FP LP +DOV JHEURFKHQ  -©QJOLQJ PLW Schultermantel und Kranz (H 14,8cm, in der Hüfte gebrochen), thronende Göttin mit Polos (H 12,5cm, intakt), junge Frau mit Polos (H 9,2cm, in der Hüfte gebrochen), Frau trägt einen Knaben auf den Schultern, sehr interessantes Stück (H 10,8cm, Kopf des Knaben sowie der Unterkörper der Frau fehlen), in einer Wiege liegender Knabe, sehr interessantes Stück (L 11cm, kleine Fehlstelle), hockender Knabe mit Kranz (H 9,4cm, NOHLQH $EVSOLWWHUXQJHQ  VWHKHQGHU (URV + FP NOHLQH Absplitterungen), Fragment einer Applike mit Gorgoneion (Ø 5,4cm). Dazu eine Pfeife in Form eines Hahns nach römischem Vorbild (L 5,6cm, Kopf fehlt) und ein antikisierender Frauenkopf mit Isislocken (H 9,9cm, im Hals gebrochen). 11 6W©FN 1.000,– Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. =X GHP .QDEHQ LQ HLQHU :LHJH YJO ) : +DPGRUI  ) /HLWPHLU 'LH }J©UOLFKHQ7HUUDNRWWHQGHU6WDDWOLFKHQ$QWLNHQVDPPOXQJHQ0©QFKHQ%DQG   6( Collection Greek terracotta statuettes. Mostly Magna Graecia, 5th and 3rd VWFHQWXU\%&+HDGRIDEHDUGHGPDQZLWKZUHDWK EURNHQDWWKHQHFN  youth with drapery and wreath (broken at the hip), enthroned goddess with polos (intact), young woman with polos (broken at the hip), woman carrying a boy on her shoulders, very interesting piece (head of the boy and lower part of the corpus of the woman are missing), boy in a cradle, very interesting piece (little fragment is missing), crouching boy with wreath (tiny splinters are missing), standing Eros (tiny splinters are missing), fragment of an applique with gorgoneion. Plus a whistle shaped like a rooster after Roman models KHDGLVPLVVLQJ DQGDQFLHQWOLNHKHDGRIDZRPDQZLWKFXUOVRIWKHJRGGHVV Isis (broken at the neck). 11 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

561 (WUXVNLVFKHU 9RWLYIXg    -K Y &KU + FP / FP Hellbraune Terrakotta. Linker Fuß mit Sandale. Oberer Teil des Beinansatzes sowie der dicke Zeh gebrochen. 200,– Provenienz: Aus der Sammlung U. S., München, erworben zwischen 1972 XQG%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV 9JO]XP%HLVSLHO)6.QDXg-*HEDXHU +UVJ 'LH(WUXVNHUYRQ9LOODQRYD ELV5RP$XVVWHOOXQJ0©QFKHQ  $EEDXI6XQG6.DW (WUXVFDQYRWLYHIRRWZLWKVDQGDOHPDGHRIEULJKWEURZQWHUUDFRWWDUGQG century B.C. Hallux and upper part of the leg are broken. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

247


562 Sammlung Tonlampen. a) Vier punische Schalenlampen unterschiedlicher Größe mit zwei oder drei Schnauzen. Aus EHLJHPJUDXHPXQGU¤WOLFKHP7RQ-KY&KUE 7RQODPSH aus rötlichem Ton (L ca. 9cm) mit schwarzgrauem Firnis mit zylindrischem Corpus und ausschwingender Schnauze sowie VHLWOLFKHP +RUQw    -K Y&KU 6FKQDX]H DXV PHKUHUHQ Fragmenten wieder zusammengesetzt. c) Tonlampe (L 8,5cm) mit linsenförmigem Corpus und ausschwingender Schnauze mit %UHQQORFKVRZLH~DFKHP%RGHQ$XIGHU2EHUVHLWHHLQJURgHV UXQGHV/RFK/HYDQWH-KY-KQ&KU,QWDNWG 5¤PLVFKH Tonlampe (L 8,5cm) aus rötlichem Ton vom Typ Loeschcke IV mit gerundeter Volutenschnauze mit Brennloch und ohne Dekor auf dem Spiegel. 1. Jh. n.Chr. Ringgriff gebrochen. e) =ZHLVFKQ”X]LJH /DPSH / FP  PLW ~DFKHP %RGHQ XQG *ULII]DSIHQ DXV EHLJHP 7RQ PLW EHLJHP EHU]XJ *ULII]DSIHQ gebrochen, eine Schnauze wieder angesetzt. 6W©FN 850,– Provenienz: Ex Sammlung A. Weber, 1972 und ex Sammlung Kluger, 1975. D )RXU3XQLFFOD\€FRFNKDWyVDXFHUODPSVRIGLIIHUHQWVL]HVZLWKWZRRUWKUHH QR]]OHV0DGHRIEHLJHJUD\DQGUHGGLVKFOD\WKQGFHQWXU\%&E &OD\ ODPSPDGHRIUHGGLVKFOD\ZLWKEODFNJUH\VOLSZLWKF\OLQGULFDOFRUSXVDQGRXW VZLQJLQJQR]]OHDQGODWHUDOKRUQwUGQGFHQWXU\%&1R]]OHUHDVVHPEOHG IURPVHYHUDOIUDJPHQWVF &OD\ODPSZLWKOHQWLFXODUFRUSXVDQGRXWVZLQJLQJ QR]]OHZLWKEXUQLQJKROHDVZHOODV~DWEDVH2QWKHWRSDODUJHURXQGKROH /HYDQWVWFHQWXU\%&VWFHQWXU\$',QWDFWG 5RPDQFOD\ODPSPDGH RIUHGGLVKFOD\RI/RHVFKFNH,9W\SHZLWKURXQGHGYROXWHQR]]OHZLWK}ULQJ hole and no decoration on the mirror. 1st century A.D. Ring handle broken. H 7ZRQR]]OHGODPSZLWK~DWEDVHPDGHRIEHLJHFOD\ZLWKEHLJHVOLS+DQGOH broken, one nozzle reattached. 8 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

563 Schalenlampe aus Ton. 3K¤QL]LVFK-KY&KU/FP+ FP6FKDOHQDUWLJHV~DFKHV%HFNHQRKQH6WDQG~”FKHYRUQH zu einem Dochtlager zusammengedrückt. Außen Dekoration in Form einer Schnurleiste. Reste von Sinter, wieder zusammenge setzt. 225,– Provenienz: Aus deutscher Privatsammlung H. D. K., erworben in den 1970er bis 1980er Jahren. &OD\€FRFNHGKDWyVDXFHUODPS3KRHQLFLDQWKUGFHQWXU\%&5HDWWDFKHG traces of sinter. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

564 Tonlampe mit Laren. Römisch, 1. Jh. n. Chr. L 8,3cm, H 2,8cm. Wohl Loeschcke Typ Ic, Schulter Typ I. Aus rötlichem Ton PLWU¤WOLFKEUDXQHPEHU]XJ5XQGHU&RUSXVXUVSU©QJOLFKPLW Volutenschnauze. Auf dem Spiegel zwei sich gegenüberstehende Lare in Tunika mit erhobenem rechten Arm und ein Brennloch. Aus mehreren Fragmenten wieder zusammengesetzt mit Fehlstellen, Schnauze fehlt komplett. 225,– 3URYHQLHQ]$XV3ULYDWVDPPOXQJ1RUGGHXWVFKODQGHUZRUEHQ]ZLVFKHQ und 1970. Terracotta lamp of reddish clay with redbrown slip depicting two lares. Reassembled of several fragments with missing parts, nozzle completely missing. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

248

565 Zwei Tonlampen mit bildlicher Darstellung. a. Loeschcke Typ VIII, Schulter Typ IIIb. L 10,5cm, H ca. 2,5cm. Aus rötlichem 7RQPLWU¤WOLFKHPEHU]XJ5XQGHU&RUSXVPLWKHU]I¤UPLJHU Schnauze und Ringhenkel. Auf dem Spiegel ein Symplegma. Römisch, 2. Jh. n. Chr. Unterer Teil und Teil der rechten Seite fehlen, wiederzusammengesetzt. b. Loeschcke Typ VI, Schulter Typ IIIa. L 9,5cm, H 2,5cm. Aus hellrotem Ton mit JUDXHP EHU]XJ 5XQGHU &RUSXV PLW 9ROXWHQVFKQDX]H $XI dem Spiegel ein Greif. Römisch, 1. Jh. n. Chr. Aus mehreren Fragmenten zusammengesetzt, hinterer Teil fehlt. 6W©FN u 3URYHQLHQ]$XV3ULYDWVDPPOXQJ1RUGGHXWVFKODQGHUZRUEHQ]ZLVFKHQ und 1970. 7ZRWHUUDFRWWDODPSVGHSLFWLQJDV\PSOHJPDDQGDJULI}Q5RPDQQGDQG 1st century A.D. Reassembled of several fragments with missing parts, one lamp with missing lower part and one with missing back part. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

566 6S”WDQWLNH /DPSH PLW %©VWH 1RUGDIULND    -K Q &KU / 11,5cm, H ca. 3cm. Hellroter Ton. Type Hayes II. Flacher Boden, zapfenförmiger Griff, eiförmiger Corpus und gerundete 6FKQDX]H PLW %UHQQORFK =ZHL (LQI©OOO¤FKHU LP 6SLHJHO $XI dem Spiegel eine weibliche Büste mit Halskette. Auf der Schulter 5DXWHQPLW5DQNHQ2EHU~”FKHHWZDVDEJHULHEHQLQWDNW 300,– Provenienz: Ex Sammlung A. Weber (Inv. 282), 1972. Late Roman terracotta lamp depicting a female bust with necklace. North $IULFDWKWKFHQWXU\$'6XUIDFHVOLJKWO\ZRUQLQWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


 6DPPOXQJVS”WDQWLNHU/DPSHQ1RUGDIULND-KQ&KUD  L ca 10cm, H ca. 3cm. Hellroter Ton. Typ Hayes II. Flacher Boden, zapfenförmiger Griff, eiförmiger Corpus und gerundete 6FKQDX]H PLW %UHQQORFK =ZHL (LQI©OOO¤FKHU LP 6SLHJHO $XI dem Spiegel eine behelmte Kaiserbüste. Auf der Schulter Rauten mit Ranken und Palmetten im Wechsel. Schnauze gebrochen. b) L ca. 10cm, H ca. 3cm. Hellroter Ton. Typ Hayes II. Flacher Boden, zapfenförmiger Griff, eiförmiger Corpus XQG JHUXQGHWH 6FKQDX]H PLW %UHQQORFK =ZHL (LQI©OOO¤FKHU im Spiegel. Auf dem Spiegel eine weibliche Büste. Auf der Schulter gefüllte Dreiecke und Rosetten im Wechsel. Schnauze gebrochen. c) L ca. 12cm, H ca. 3cm. Hellroter Ton. Typ Hayes II. Flacher Boden, zapfenförmiger Griff, eiförmiger Corpus XQG JHUXQGHWH 6FKQDX]H PLW %UHQQORFK =ZHL (LQI©OOO¤FKHU im Spiegel. Auf dem Spiegel in einem quadratischen Rahmen ein Pan mit Syrinx. Auf der Schulter rechts und links jeweils ein Fisch, oben und unten Voluten. Schnauze gebrochen. d) L ca. 11cm, H ca. 3,5cm. Hellroter Ton. Typ Hayes II. Flacher Boden, zapfenförmiger Griff, eiförmiger Corpus und gerundete 6FKQDX]H PLW %UHQQORFK =ZHL (LQI©OOO¤FKHU LP 6SLHJHO Auf dem Spiegel ein springendes Pferd. Auf der Schulter 3DOPZHGHOGHNRU $XI GHP %RGHQ *UDI}WR LQ )RUP HLQHV VWLOLVLHUWHQ$QNHUV DQWHFRFWXUDP 2EHU~”FKHEHULHEHQLQWDNW e) L ca. 11cm, H ca. 3,5cm. Hellroter Ton. Typ Hayes II. Flacher Boden, zapfenförmiger Griff, eiförmiger Corpus und gerundete 6FKQDX]HPLW%UHQQORFK=ZHL(LQI©OOO¤FKHULP6SLHJHO$XIGHP Spiegel Hirsch. Auf der Schulter Palmwedeldekor. Schnauze gebrochen. f) L 13cm, H ca. 4cm. Hellroter Ton. Typ Hayes II. Flacher Boden, zapfenförmiger Griff, eiförmiger Corpus und JHUXQGHWH6FKQDX]HPLW%UHQQORFK(LQ(LQI©OOORFKLP6SLHJHO Auf dem Spiegel eine Rosette. Griff gebrochen. 6W©FN 850,–

569 Levantinische Keramik. Drei phönizische Gefäße aus rötlichem Ton inkl. einer kleinen einhenkeligen Amphora (H 19,6cm, kleine Sprünge, sonst intakt), kleine Kanne mit Tüllenausguss und Resten von violettem Liniendekor (H 12,3cm, intakt) und kleiner bikonischer Topf (H 10,1cm, intakt), 1. Hälfte 1. Jt. v. Chr. Dazu eine phönizische Dreispitzlampe (L 14,3cm, NOHLQH$EVSOLWWHUXQJDQGHU6FKQDX]HVRQVWLQWDNW FD-KY Chr., eine hellenistische Lampe mit breiter Schnauze (L 8,4cm, 6FKQDX]H JHEURFKHQ XQG ZLHGHU DQJHVHW]W     -K Y &KU und eine spätantike Lampe mit Zweigen und Rippen auf der 6FKXOWHU /FPLQWDNW -KQ&KU6W©FN 500,– Provenienz: Aus dem Nachlass der Sammlung F. W. Bayern, erworben wohl im israelischen Kunsthandel vor 2015. /HYDQWLQHSRWWHU\LQFOWKUHH3KRHQLFLDQYHVVHOV RQHKDQGOHDPSKRUDZLWKWZR little cracks, small jug with long spout and violett decor, little biconical pot), 1st half 1st millenium B.C., a Phoenician „cocked hat“ lamp (tiny splinter at the nozzle is missing), about 7th century B.C., a Hellenistic lamp with EURDGQR]]OH QR]]OHLVEURNHQDQGUHDWWDFKHG QGVWFHQWXU\%&DQG /DWH$QWLTXHODPSZLWKGHFRULQIRUPRIEUDQFKHVRQWKHVKRXOGHUWKWK century A.D. 7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 )U©KJULHFKLVFKHU $VNRV PLW 6LHEIXQNWLRQ LQ 7LHUIRUP Östlicher 0LWWHOPHHUUDXPVS”WH%URQ]H]HLWY&KU+FP L 11,3cm. Bichrome Ware mit dunkelbrauner Bemalung auf hellbraunem Ton. Auf der Unterseite alter Aufkleber „Collection du Dr. P. Hamonic“. Kleine Absplitterung am Ausguss, sonst intakt. 150,–

Provenienz: Ex Sammlung A. Weber, 1972. Collection of late antique lamps of the Type Hayes II depicting a helmeted emperor‘s bust, a female bust, Pan with syrinx, a jumping horse, a stag and DURVHWWH1RUWK$IULFDWKWKFHQWXU\$'2QHLQWDFWIRXUODPSVZLWK broken nozzle and one with broken handle. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

568 Froschlampe aus Ton. 1RUGDIULND NRSWLVFK    -K Q &KU / FP % FP + FP $XV U¤WOLFKHP 7RQ PLW EHLJHP EHU]XJ (LI¤UPLJHU ELNRQLVFKHU &RUSXV PLW %UHQQORFK LQ GHU 6SLW]H XQG (LQI©OOORFK LP =HQWUXP $XI GHU 2EHUVHLWH ein Frosch im Relief mit plastischem Kopf. Auf der glatten Unterseite ein stilisiertes Blatt. 0LW%HVFKUHLEXQJYRQ.DUO+HLQ] =©KOVGRUI2EHU~”FKHHWZDVEHVWRgHQLQWDNW u

Provenienz: Ehemals in der Sammlung von Pierre und Claude Vérité, Paris, HUZRUEHQ]ZLVFKHQXQGLQ'HXWVFKODQGVHLW Early Greek askos with sieve in the spout in form of an animal of the Bichrome ZDUH (DVWHUQ 0HGLWHUUDQHDQ ODWH %URQ]H $JH    %& /LWWOH fragment of the spout is missing, otherwise intact. From an old French Collection! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 $WWLVFKH6FKXOWHUOHN\WKRVGHU.ODVVH$WKHQY&KU H 20,4cm, Ø Körper 8,8cm, Ø Mündung 5,1cm, Ø Fuß 5,4cm. 6FKZDU]}JXULJ 'LRQ\VRV ]ZLVFKHQ ]ZHL 0”QDGHQ ZLUG YRQ Hermes nach rechts geführt. Bemalung stellenweise verrieben, sonst intakt. 300,–

Provenienz: Ex Sammlung R. M., Rheinland, erworben 1975 bei Karl Heinz Zühlsdorf, Köln. 9JO%URRNO\Q0XVHXP1HZ<RUN$FFHVVLRQ1XPEHU

Provenienz: Ehemals in der Schweizer Privatsammlung T., für diese in den HU -DKUHQ LP 6FKZHL]HU .XQVWKDQGHO HUZRUEHQ LQ 'HXWVFKODQG VHLW 2010.

&OD\ODPSRIWKHW\SHIURJZLWKHJJVKDSHGFRUSXVDQGDSODVWLFDOIURJRQWKH XSSHUVLGH1RUWK$IULND&RSWLFWKWKFHQWXU\$'6XUIDFHSDUWLDOO\ZRUQ intact. With description of Karl Heinz Zühlsdorf!

$WWLFEODFN}JXUHVKRXOGHUOHN\WKRVRIWKH&ODVV$WKHQ%& Dionysos between two maenads is leading by Hermes to the left. Color is partially rubbed off, otherwise intact.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

249


 $WWLVFKH 6FKXOWHUOHN\WKRV Um 500 v. Chr. H 19,4cm, Ø FP6FKZDU]}JXULJ'HWDLOVLQ5RWXQG:HLg6HLWOLFKHLQHV thronenden Herrschers mit Zepter stehen links und rechts je ein Jüngling und ein Hoplit. Restauriert, ca. ein Drittel ergänzt, zahlreiche kleine Bestoßungen, Fehlstellen an der Mündung. 300,– Provenienz: Aus dem Nachlass der westdeutschen Privatsammlung F. J. J., erworben Anfang der 1970er Jahre; ex Gorny & Mosch, München Auktion /RV YHUNDXIWI©U€, aber blieb unbezahlt). $WWLFEODFN}JXUHVKRXOGHUOHN\WKRVZLWKDQHQWKURQHG.LQJEHWZHHQD\RXWK and a warrior. About 500 B.C. Restored, about one third is modern, several VPDOOVSOLWRIIVRQWKHVXUIDFH/LWWOHSDUWVRIWKHPRXWKDUHPLVVLQJ VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 .DPSDQLVFKH%DXFKOHN\WKRV+”OIWH-KY&KU+FP k .¤USHU FP k 0©QGXQJ FP k )Xg FP 0LW VFKZDU]}JXULJHP (LHUVWDE XQG 1HW]GHNRU EHLGHV PLW ZHLgHQ Details, unten Wellenband auf rotem Grund. Retuschierte Fehlstellen an der Mündung, Absplitterung am Fuß, Bemalung stellenweise verrieben. 300,– Provenienz: Ehemals in deutscher Sammlung, erworben in den 1970er bis 1980er Jahren. &DPSDQLDQVTXDWOHN\WKRVQGKDOIWKFHQWXU\%&:LWKEODFN}JXUHHJJ and dart and net decor, both with white details, below a band of waves on red ground. Retouched missing parts at the mouth, fragment of the foot is missing, color is partially rubbed off. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Zwei griechische Trinkschalen. a) Ionische Schale mit Liniendekor. Y&KU+FP%FPkFPk)XgFP Aus großen Fragmenten zusammengesetzt, kleine Fehlstellen an den Bruchkanten sind retuschiert, kleine Absplitterungen am Fuß. b) Niedrige Schale der attischen Glanztonware mit Ringfuß XQGVFK¤QHP5ROOXQG6WHPSHOGHNRULP,QQHUHQ+”OIWH Jh. v. Chr. H ohne Henkel 4,6cm, B 20,5cm, Ø 15cm, Ø Fuß FP(LQ+HQNHOJHEURFKHQXQGZLHGHUDQJHVHW]W6W©FN 250,– Provenienz: Aus der Sammlung R. K., Hessen, erworben vor 1980. 7ZR *UHHN GULQNLQJ FXSV LQFO D ,RQLDQ FXS ZLWK OLQH GHFRU    B.C. (reassembled from large fragments, little missing parts at the cracks are retouched, few little splinters at the foot are missing), and an Attic stemless EODFNJOD]HFXSZLWKEHDXWLIXOOVFUROOHGDQGVWDPSHGGHFRULQVLGHVWKDOIWK century B.C. (one handle broken and reattached). 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 .OHLQH6DPPOXQJNDPSDQLVFKHU9DVHQ(QGHIU©KHV-KY Chr. Drei Gefäße der Gnathiaware inklusive einer Oinochoe mit geripptem Körper (H 16,5cm, intakt), eines Chous (H 10,4cm, Mündung restauriert, kleine Retuschen) und einer niedrigen Schale mit Ringfuß (Ø 16,2cm, ein gebrochenes Fragment wieder angesetzt, Sinterreste). Dazu drei Schalen der Glanztonware inklusive einer henkellose Schale mit Stempeldekor (Ø 15,5cm, kleiner Farbabrieb am Rand, sonst intakt), einer kleiner einhenkeligen Schale (L 11,9cm, Glanzton stellenweise abgeplatzt, sonst intakt) sowie eines kleinen, wohl attischen 1”SIFKHQV k FP NOHLQH REHU~”FKLJH $EVSOLWWHUXQJHQ  6 6W©FN 500,– Provenienz: Aus der Sammlung R. K., Hessen, erworben vor 1980.

 $WWLVFKH%DXFKOHN\WKRV(QGH-KY&KU+FPk.¤USHU FPk0©QGXQJFPk)XgFP*ODQ]WRQZDUHZREHL der Glanzton durch Fehlbrand eine rötliche Farbe hat. Intakt. 150,– Provenienz: Ehemals in der Schweizer Privatsammlung Y. W., erworben in GHQHU-DKUHQLQ'HXWVFKODQGVHLW

1LFHVPDOOFROOHFWLRQRI&DPSDQLDQYDVHV/DWHWKHDUO\UGFHQWXU\%& Three vases of the Gnathia ware incl. an oinochoe with ribbed corpus (intact), a chous (mouth restored, little retouched areas) and a stemless cup (one broken fragment is reattached, remains of sinter). Plus three vessels of the EODFNJOD]HZDUHLQFODERZOZLWKVWDPSHGGHFRULQVLGH FRORXUDWWKHULP VOLJKWO\UXEEHGRIIRWKHUZLVHLQWDFW DVPDOORQHKDQGOHGFXS SDUWRIWKH EODFNJOD]HLV~DNHGRIIRWKHUZLVHLQWDFW DQGDVPDOOSUREDEO\$WWLFGLVK (little splinters are missing). 6 pieces!

$WWLFEODFNJOD]HVTXDWOHN\WKRV/DWHWKFHQWXU\%&%ODFNJOD]HGXHWR IDLOHG}ULQJUHGFRORUHG,QWDFW

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 ,WDORNRULQWKLVFKHU .RORQHWWHQNUDWHU    Y &KU + FP%FPk.¤USHUFPk0©QGXQJFPk )Xg FP 0LW *ODQ]WRQGHNRU XQG SUR}OLHUWHQ +HQNHO PLW angedeuteten Rotellen. 6HOWHQHV6W©FN Kleine Absplitterungen an Mündung, Körper und Fuß, Glanzton teilweise etwas verrieben, sonst intakt mit Sinterresten. 500,–

 $SXOLVFKHU(XOHQVN\SKRV+”OIWH-KY&KU+FP%PLW +HQNHOQFPk0©QGXQJFPk)XgFP5RW}JXULJ Beidseitig ein nach rechts stehender Steinkauz zwischen Lorbeerzweigen. Zusammengesetzt, dabei mehrere kleine und eine größere Fehlstelle retuschiert. 500,– Provenienz: Ehemals in der deutschen Privatsammlung Dr. F. K., erworben 1985 auf dem deutschen Kunstmarkt. $SXOLDQUHG}JXUHRZOVN\SKRVVWKDOIWKFHQWXU\%&5HDVVHPEOHGIURP fragments, one large and few small missing parts are retouched. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

250

3URYHQLHQ]$XVGHP1DFKODVV0%LQ'HXWVFKODQGVHLWYRU 5DUH ,WDOR&RULQWKLDQ EODFNJOD]H FROXPQ NUDWHU    %& /LWWOH splinters are missing, black glaze partially rubbed off, otherwise intact with remains of sinter. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


Provenienz: Aus der Sammlung R. K., Hessen, erworben vor 1980.

582 Etruskischer Kantharos. (QGH-KY&KU+FP%FP Bucchero pesante. Konischer Kelch mit zwei Schlaufenhenkeln XQG 7URPSHWHQIXg (LQ +HQNHO JHEURFKHQ XQG UHVWDXULHUW kleine Fehlstellen am Rand retuschiert, partiell mit Sinterresten XQGURWEUDXQHQ$X~DJHQ u

Early Etruscan holmos made of brown impasto with impressed line decor. 2nd half of 8th to early 7th century B.C. Large part of the foot is modern.

3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ 6DPPOXQJ59LOOLQJHU6FKPHOOHU%D\HUQHUZRUEHQYRU

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Etruscan bucchero kantharos. End of 7th century B.C. One handle broken and reattached, tiny missing parts of the rim are retouched, partially with rest of sinter and reddish brown covering.

 )U©KHWUXVNLVFKHU+ROPRV+”OIWHELVIU©KHV-KY&KU+ 26cm, Ø Körper 22,2cm. Braunes Impasto mit eingedrücktem Schnurdekor. Größerer Teil des Fußes ergänzt. 400,–

580 9LHU HWUXVNLVFKH *HI”gH Drei Gefäße aus dunkelbraunem ,PSDVWR  +”OIWH ELV 0LWWH  -K Y &KU D  $PSKRUD PLW ELNRQLVFKHP +DOV XQG 5LSSHQ + FP k .¤USHU FP Kleine Fehlstellen an der Mündung, sonst intakt. b) Amphora PLW .HJHOKDOV XQG 5LSSHQ + FP k .¤USHU FP Zusammengesetzt, größere Fehlstelle am Boden. c) Kernos mit YLHU+HQNHOQ+FPkFP,PXQWHUHQ%HUHLFK5LVVHXQG kleine Fehlstellen. Dazu d) eine Kleeblattoinochoe aus Bucchero SHVDQWH IU©KHV  -K Y &KU + FP k .¤USHU FP Teilweise retuschierte Fehlstellen an der Mündung. 6W©FN 1.100,– Provenienz: Aus der Sammlung R. K., Hessen, erworben vor 1980. Three Early Etruscan pottery made of dark brown impasto, 1st half to middle of the 7th century B.C.: a) Amphora with biconical neck and ribs. Little fragments of the mouth are missing, otherwise intact. b) Amphora with conical neck and ribs. Reassembled, part of the bottom is missing. c) Kernos with four handles. Lower part with cracks, little fragments are missing. Plus d) a %XFFKHURWUHHIRLORLQRFKRHHDUO\WKFHQWXU\%&3DUWRIWKHPRXWKLVPLVVLQJ few retouchings at this. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

581 *URgHU HWUXVNLVFKHU .\DWKRV 2. Hälfte 6. Jh. v. Chr. H mit XQG RKQH +HQNHO  XQG FP k FP %XFFKHUR pesante mit plastischen Verzierungen, abgedrehten Rillen auf der Schale und schönem Ritzdekor auf dem Henkel. Aus zahlreichen Fragmenten zusammengesetzt, kleine Fehlstellen sind retuschiert. 225,– Provenienz: Ehemals in der deutschen Privatsammlung Dr. F. K., für diese 1981 von W. W. erworben.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

583 Etruskische Kleeblattkanne. 6. Jh. v. Chr. H 28,2cm, Ø Körper 18,4cm. Bucchero, durch Fehlbrand mit leicht brauner bis grünlichgrauer Färbung. Zusammengesetzt, Fehlstellen modern HUJ”Q]W u Provenienz: Ehemals in der deutschen Privatsammlung Dr. F. K., für diese 1981 von W. W. erworben. (WUXVFDQEXFFKHURWUHHIRLOMXJWKFHQWXU\%&%HFDXVHRIIDLOHG}ULQJZLWK a light brownish and greenish color. Reassembled from fragments, missing SDUWVDUHPRGHUQ}OOHGXSDQGUHWRXFKHG VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

584 Etruskische Kleeblattkanne. (QGH  -K Y &KU + FP Ø Körper 12,8cm. Bucchero. Aus großen Fragmenten zusammengesetzt, kleine Fehlstellen sind retuschiert, Fuß modern ergänzt. 300,– 3URYHQLHQ]$XVHLQHUIUDQ]¤VLVFKHQ3ULYDWVDPPOXQJGHUHU-DKUHLQ Deutschland seit 2000. 3XEOL]LHUW.XQVWGHU$QWLNH$QFLHQW$UW*DOHULH*©QWHU3XK]H.DWDORJ 28, 2014, Nr. 71. Etruscan bucchero treefoil jug. Late 7th century B.C. Reassembled from large fragments, little missing parts are retouched, foot is modern. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Large Etruscan bucchero kyathos with nice engraved decor on the handle. 2nd KDOIWKFHQWXU\%&5HDVVHPEOHGIURPQXPHURXVIUDJPHQWVOLWWOHPLVVLQJ parts are retouched. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

251


585 6FK¤QH6DPPOXQJYRQ%XFFKHURXQG*ODQ]WRQYDVHQBucchero: D  (WUXVNLVFKHU .\DWKRV PLW 5LOOHQGHNRU DXV %XFFKHUR VRWWLOH (QGH$QIDQJ-KY&KU+FP.OHLQH$EVSOLWWHUXQJ an der Mündung, sonst intakt. Glanzton: b) Korinthische .RW\OH  -K Y &KU + FP FP k FP *ODQ]WRQ stellenweise verrieben, sonst intakt. c) Attischer Schalenskyphos mit Stempeldekor (drei Palmetten) im Inneren. Anfang 4. Jh. v. &KU+FP%FPkFP:LQ]LJH$EVSOLWWHUXQJDP Rand, sonst intakt. d) Apulischer Schalenskyphos. 4. Jh. v. Chr. H 6,1cm, B 19cm, Ø 13,8cm. Winzige Bestoßungen und drei 6SU©QJHVRQVWLQWDNWHI =ZHLNOHLQH1”SIH0DJQD*UDHFLD -KY&KU%HLGHPJU¤gHUHQ([HPSODUGHU+HQNHOJHEURFKHQ 6W©FN 600,– Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. 1LFH&ROOHFWLRQRIEXFFKHURDQGEODFNJOD]HYDVHVBucchero: a) Etruscan N\DWKRVZLWKJURRYHVEXFFKHURVRWWLOH(QGWKHDUO\WKFHQWXU\%&/LWWOH splinter at the rim is missing, otherwise intact. Black Glaze: b) Corinthian NRW\OHWKFHQWXU\%&*OD]HSDUWLDOO\UXEEHGRIIRWKHUZLVHLQWDFWF $WWLF FXSVN\SKRVZLWKVWDPSHGGHFRULQVLGH WKUHHSDOPHWWHV (DUO\WKFHQWXU\ %&7LQ\VSOLQWHUDWWKHULPLVPLVVLQJRWKHUZLVHLQWDFWG $SXOLDQFXS VN\SKRVWKFHQWXU\%&7LQ\VSOLQWHUVDUH~DNHGRIIWKUHHFUDFNVRWKHUZLVH LQWDFWHI 7ZROLWWOHFXSV0DJQD*UDHFLDWKFHQWXU\%&7KHKDQGOHRI the larger piece is missing. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

586 7HUUDNRWWD~DVFKHLQ)RUPHLQHV$IULNDQHUNRSIHVHellenistisch, 2. -KY&KU+FP+HOOELVGXQNHOEUDXQHU7RQ+HQNHO XQG HLQ NOHLQHV 6W©FN GHU 2EHU~”FKH DXI GHU UHFKWHQ 6HLWH fehlen. 250,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. )LJXUDO~DVNLQIRUPRIWKHKHDGRIDQ$IULFDQPDGHRIOLJKWWRGDUNEURZQ WHUUDFRWWD+HOOHQLVWLFQGVWFHQWXU\%& VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL 7HUUD 1LJUD%HFKHU 5¤PLVFK    -K Q &KU D  Kegelhalsbecher mit Rillendekor. H 15cm, Ø 8,9cm. Sprung im Hals. b) Bauchiger Becher mit Rädchendekor. H 9,6cm, Ø 9,4cm. Kleine Ausbrüche an der Lippe. 6W©FN 400,– Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. 7ZR5RPDQ7HUUD1LJUDEHDNHUQGUGFHQWXU\$'2QHZLWKJURRYHV (little crack at the neck), one with scrolled decor (Little missing parts at the lip). 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

588 7HUUD 6LJLOODWD5HOLHINHOFK *DOOLHQ  -K Q &KU + FP Ø 25,8cm. Mit tordierten Henkeln und appliziertem Dekor, GHU XQWHQ 9HQXV XQG (URV ]ZLVFKHQ $NDQWKXV LQ GHU 0LWWH Manteltänzerinnen und oben Lorbeerzweige darstellt. Aus Fragmenten zusammengesetzt, kleinere Fehlstellen retuschiert. 400,– Provenienz: Ex Privatsammlung W. F., München, seit vor 2000. Terra Sigillata stemmed chalice with twisted handles and applied decor GHSLFWLQJ9HQXVDQG&XSLGEHWZHHQDFDQWKXVIHPDOHGDQFHUVDQGODXUHO branches. Gaul, 1st century A.D. Reassembled from fragments, few missing parts are retouched. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

589 Terra Sigillata Schale und Teller. Römisch, ca. 1. Jh. n. Chr. Ware aus Rheinzabern. a) Konische Schale mit Steilrand. H FPkFPE )ODFKHU7HOOHUPLWSUR}OLHUWHP5DQGXQG Rädchendekor. H 2,4cm, Ø 16,2cm. Beide mit Werkstattmarke. 6W©FN Teller mit einem Sprung und Kratzern, sonst intakt. 400,– 3URYHQLHQ]([6DPPOXQJ()5KHLQODQG3IDO]GDYRUVHLWLQHLQHU Wiesbadener Privatsammlung. Roman Terra Sigillata plate with scrolled decor and conical bowl from Rheinzabern, both with mark of the workshop. About 1st century A.D. Plate with few scratches and a crack, otherwise intact. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

590 Interessante Sammlung römische Feinkeramik. -KQ&KU a) Großes Terra Sigillata Mortarium mit Ausguss in Form eines Tierkopfes. H 12,9cm, Ø 29,9cm. Zusammengesetzt mit PRGHUQHQ (UJ”Q]XQJHQ LQQHQ *HEUDXFKVVSXUHQ E  )ODFKHU NRQLVFKHU 7HUUD 6LJLOODWD 7HOOHU PLW /LQLHQGHNRU + FP k FP.OHLQHV5DQGIUDJPHQWJHEURFKHQXQGZLHGHUDQJHVHW]W URWHU EHU]XJ DQ HLQHU 6WHOOH YHUULHEHQ VRQVW LQWDNW 1992 in Mainz erworben.  F  (LQKHQNHO~DVFKH GHU )RUP  DXV EHLJHP 7RQ + FP k FP G  (LQKHQNHO~DVFKH GHU )RUP  aus orangem Ton. H 19,8cm, Ø 16,1cm. Beide Flaschen mit kleiner Absplitterung an der Mündung, sonst intakt. Beide 1982 bei Antiquitäten G. Zumer, Wolfsheim erworben. 6W©FN 650,– 3URYHQLHQ]([6DPPOXQJ()5KHLQODQG3IDO] ,QWHUHVWLQJ&ROOHFWLRQRI5RPDQ3RWWHU\VWUGFHQWXU\$'D /DUJH7HUUD 6LJLOODWDPRUWDULXPVSRXWIRUPHGOLNHDQDQLPDOKHDG5HDVVHPEOHGZLWK modern retouched areas, inside traces of use. b) Flat conical Terra Sigillata plate with grooves. Small fragment of the rim is reattached, red slip partially UXEEHGRIIRWKHUZLVHLQWDFW7ZRRQHKDQGOHGERWWOHVRQHF RIW\SHPDGH of beige clay and d) of type 10 made of orange clay. Both with little missing fragment at the rim, otherwise intact. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

252


591 Große tongrundige Kanne. 5¤PLVFK-KQ&KU+FP Ø Körper 24,8cm, Ø Mündung 8,6cm. Kanne der Form 4 aus beigem, leicht gelblichen Ton mit lentoidem Körper und vierfach geripptem Henkel. Winzige Absplitterung am Ringfuß, sonst intakt. 500,–

595 7HUUD6LJLOODWDXQG0RVDLNIUDJPHQWH5¤PLVFKH.DLVHU]HLW 3. Jh. n. Chr. a) 36 Fragmente überwiegend von formgetöpferter Terra Sigillata aus Noricum. 2 bis 10cm. Mit Vergleichsliteratur der Töpferei in Westerndorf. E )UDJPHQWHHLQHVVFKZDU]ZHLgHQ Mosaiks aus Kampanien. 37 Stück! 150,–

3URYHQLHQ] ([ 6DPPOXQJ ( ) 5KHLQODQG3IDO] HUZRUEHQ  EHL Antiquitäten G. Zumer, Wolfsheim.

Provenienz: Erbe vom Vater des Einlieferers, in Deutschland seit vor 1970.

/DUJH5RPDQMXJRIW\SHQGUGFHQWXU\$'7LQ\VSOLQWHURIWKHIRRW is missing, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

592 5¤PLVFKH)ODVFKHPLW$XVJXVVFrühe Kaiserzeit, 1. Jh. n. Chr. H 20,1cm, Ø 16,5cm. Amphoriskes Gefäß mit spitzem Ausguss aus hellem, leicht rötlichen Ton. Drei winzige Absplitterungen, sonst intakt. 225,– Provenienz: Ehemals in der Schweizer Privatsammlung S. C., erworben in den 1970er bis 1980er Jahre; in Deutschland seit 2005. 5RPDQWZRKDQGOHERWWOHZLWKVSRXWPDGHRIOLJKWUHGGLVKFOD\(DUO\,PSHULDO Period, 1st century A.D. Three little splinters are missing, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

593 Sammlung römischer Feinkeramik. Darunter zwei intakte Terra 6LJLOODWD7HOOHU k  XQG FP  HLQH UHVWDXULHUWH 6FKDOH PLW %DUERWLQH'HNRU k FP  XQG HLQH NOHLQH )ODVFKH )RUP  aus beigem Ton (H 10,1cm, winzige Abplatzungen) sowie vier 7HUUD 6LJLOODWD)UDJPHQWH YRQ IRUPJHW¤SIHUWHQ 6FK©VVHOQ XQG ]ZHL7HUUD6LJLOODWD*HI”gI©gHPLW:HUNVWDWWPDUNHQ6W©FN 300,– Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. Collection of Roman Pottery. Including two intact Terra Sigillata plates, a restored bowl with Barbotine decor, and a small jug of type 8 made of beige clay (tiny splinters are missing) as well as four mouldmade Terra Sigillata fragments from bowls with plastic decor and two Terra Sigillata feet with the mark of the workshop. 14 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

594 Sammlung römischer Gebrauchskeramik. Darunter ein Ampho ULVNRVPHKUHUH(LQKHQNHONDQQHQHLQNOHLQHU5LOOHQEHFKHUXQG PHKUHUH6FKDOHQ(LQ)UDJPHQWPLW*ODVXU'D]X]ZHL:HEJH wichte. 6W©FNWHLOZHLVHPLW6DPPOXQJV]HWWHOQDXVGHPXQG IU©KHQ-K Teilweise mit Fehlstellen oder restauriert. 300,– Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs.

&ROOHFWLRQV RI 5RPDQ IUDJPHQWV LQFO  IUDJPHQWV RI PRVWO\ PRXOG formed terra sigillata from Noricum (with references to the workshop in Westerndorf) . Plus little fragments of a black and white mosaic from Campania. 37 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

596 Statuetten und Fragmente römischer Keramik. a) Zwei Terrakot tafragmente von vorderasiatischen Idolen mit Kopfbedeckung XQG DXVJHEUHLWHWHQ $UPHQ  +”OIWH  -W Y &KU +  XQG FP %HLGH JHVRFNHOW E  (URV SU”VHQWLHUW )U©FKWH LQ VHLQHP 6FKXU]0DUPRUIUDJPHQWHLQHUU¤PLVFKHQ6WDWXHWWH+FP Kopf und in den Oberschenkeln gebrochen. c) Terrakotta ei nes Priesters mit Polos und Phiale. Hellenistisch, 3. Jh. v. Chr. H 14,8cm. Winzige Absplitterung an der Basis, sonst intakt. d) =ZHLU¤PLVFKH7RQODPSHQ/XQGFP2EHU~”FKHQEH rieben, sonst intakt. e) 36 Fragmente von hellenistischen und rö mischen Tongefäßen, teilweise mit Bemalung, aus dem östlichen Mittelmeerraum (überwiegend nabatäisch) (mit Vergleichslitera tur) . 6W©FN 500,– 3URYHQLHQ](UEHYRP9DWHUGHV(LQOLHIHUHUVLQ'HXWVFKODQGVHLWYRU Collections of ancient objects and fragments. a) Two terracotta fragments of Western Asiatic idols with headdress and spread arms. 2nd half 1st millenium B.C. Both with base. b) Roman marble fragment of an Eros holding fruits in his drapery. b) Hellenistic terracotta statuette of a priest with polos and SKLDOH7LQ\VSOLQWHURIWKHEDVHLVPLVVLQJRWKHUZLVHLQWDFWF IUDJPHQWVRI Hellenistic and Roman pottery, partially with painted decor, from the Eastern Mediterranean, mainly Nabataean (with references for the painted pottery). 42 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 /RW.HUDPLNDXVGHP0HHUa) Spätrömische Transportampho UDVWOLFKHU0LWWHOPHHUUDXP-KQ&KU+FP$XV rötlichem Ton. Benghazi LRA 13. Gebrochen und geklebt. b) Italische Kanne mit hohem und geripptem Henkel mit kleinen 5RWHOOHQDP+HQNHODQVDW]$XVURWHP7RQ-KY&KU+ 28,6cm. Mehrere Ausbrüche am Gefäßrand. Und c) bauchiger, QHX]HLWOLFKHU 7RSI PLW NXU]HQ VHQKHQNHOQ + FP 5LVVH im Corpus. 6W©FN$PSKRUDPLWPRGHUQHP6W”QGHU Alle mit Meeresbewuchs. 400,– Provenienz: Ehemals in der norddeutschen Privatsammlung O. B., in den 1950er Jahren erworben. Bei Gorny & Mosch, München Auktion 275, 2020, Los 50.

&ROOHFWLRQRI5RPDQ3RWWHU\,QFOXGLQJDQDPSKRULVNRVVHYHUDORQHKDQGOH MXJV D VPDOO EHDNHU ZLWK JURRYHGHFRU DQG VHYHUDO ERZOV 2QH IUDJPHQW with glaze. Plus two loom weights. Partially with missing parts or restored. 16 pieces, in parts with Collectors notices from the 19th and early 20th century A.D.!

Lot ceramics from the sea. Among them: a) Late Roman transport amphora IURPWKH(DVWHUQPHGLWHUUDQHDQ/DWHWKWKFHQWXU\$'%URNHQDQG reattached; b) Undecorated Italic jug with handle with small rotelles, red FOD\(WUXVFDQWKWKFHQWXU\%&6HYHUDOPLVVLQJSDUWVDWULP$QGF  *OREXODUPRGHUQDJH}VKHUSRWZLWKVKRUWKDQGOHV6RPHFUDFNV$OOZLWK VHDLQFUXVWDWLRQV3 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

253


598 5¤PLVFKH%URQ]HNDQQH1. Jh. n. Chr. H 20,9cm. Henkel mit ve JHWDELOHP'HNRU'XQNOH3DWLQDUHVWDXULHUWPLW(UJ”Q]XQJHQ 300,–

602 %URQ]HQHV 6LPSXOXP Frühes 1. Jh. v. Chr. L 31,8cm. Typ Pescate A. Grüne Patina, kleine Fehlstellen, sonst aber in guter (UKDOWXQJ u

Provenienz: Ehemals in der deutschen Privatsammlung Dr. F. K., erworben auf dem europäischen Kunstmarkt.

Provenienz: Aus der Sammlung R. K., Hessen, erworben vor 1980.

5RPDQRQHKDQGOHEURQ]HMXJZLWKGHFRUDWHGKDQGOHVWFHQWXU\$''DUN patina, restored with modern retouched parts. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

599 Große Kasserole. Römisch, ca. 2. Jh. n. Chr. H 15,5cm, Ø 23,2cm, L 43,4cm. Getriebene Bronze mit Kaltarbeit. Grüne Pa tina, Boden wegkorrodiert, in der Wandung ein Riss und kleines Loch. 600,– Provenienz: Ex Sammlung E. U., Bayern; in Deutschland seit vor 1990. Large bronze casserole. Roman Imperial Period, about 2nd century A.D. Green patina, bottom lost because of corrosion, at the side a crack and a little hole. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

600 5¤PLVFKH%URQ]HVFK©VVHO-KQ&KUkFP+FP)OD FKH6FK©VVHOPLWVWHLOHU:DQGXQJXQGHLQHP2PHJDI¤UPLJHQ Henkel an blattförmigen Attaschen. Am Boden Lötreste von ei nem Standring. Umfangreich restauriert, zweiter Henkel fehlt. 350,– Provenienz: Ex Sammlung Dr. Eberhard Schenk zu Schweinsberg (gest.  HUZRUEHQFD 6KDOORZURPDQERZOZLWKRPHJDVKDSHGKDQGOHV RQHPLVVLQJ VWUG century A.D. Restored. At bottom traces of solder for a stand. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

601 %URQ]HQHU *ULII HLQHV :HLQVLHEV (WUXVNLVFK  -K Y &KU / 16,3cm. Vollguss mit Kaltarbeit. Auf der Oberseite sind ein Jüng lingskopf und ein Schlaufenornament eingraviert. Dunkelgrüne Patina, minimale Korrosionsspuren, am Ansatz gebrochen. 400,– Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. Bronze handle of a wine strainer. Etruscan, 5th century B.C. Engraved the head of a youth above an ornament. Dark green patina, slightly corrosion, broken at the edge. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Bronze simpulum type Pescate A. Early 1st century B.C. Green patina, little splinters are missing but otherwise in good condition. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

603 6DPPOXQJJULHFKLVFKHUXQGU¤PLVFKHU%URQ]HJHJHQVW”QGHZwei griechische Schöpfkellen: ein klassisches Simpulum, ca. 4. Jh. v. Chr. (H 29,9cm, Griffende gebrochen), ein hellenistisches Sim SXOXPPLW7LHUNRSIFD-KY&KU +FPLQWDNW  =ZHL6SLHJHOPLWSUR}OLHUWHP'HNRUU¤PLVFKH.DLVHU]HLW Jh. n. Chr. (Ø 12,3 und 12,5cm, beim größeren kleine Fehlstel len am Rand). Kleiner Weihrauchtopf mit Bügelhenkel, frühby ]DQWLQLVFK-KQ&KU +JHVDPWFPLQWDNW 6W©FN $OOHPLWGXQNHOJU©QHU3DWLQD u Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. Collection of Greek and Roman bronze objetcs. Two Greek simpula, one with broken ending from the 4th century B.C., and one with ending in form of an DQLPDOKHDGIURPWKHUGQGFHQWXU\%&7ZR5RPDQPLUURUVZLWKQLFH GHFRULQIRUPRIFLUFOHVVWUGFHQWXU\$'/LWWOHIUDJPHQWVDWWKHULPRIRQH SLHFHDUHPLVVLQJ(DUO\%\]DQWLQHFHQVHUZLWKVWLUUXSKDQGOHWKWKFHQWXU\ A.D. All with dark green patina and except of one simpulum intact. 5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

604 5¤PLVFKH6FKLIIVQ”JHO1. Jh. n. Chr. Kupfer. Vier geschmiedete 9LHUNDQWQ”JHO FP FP FP  PLW ~DFKHQ OHLFKW NR nischen Köpfen und zwei Ziernägel (L je ca. 8cm) mit großen, SUR}OLHUWHQ VFKHLEHQI¤UPLJHQ .¤SIHQ 1DFK )DPLOLHQ©EHU OLHIHUXQJ JHIXQGHQ  LP 1HPL6HH  6W©FN Größtenteils RULJLQDOH2EHU~”FKHHLQ6W©FNYHUERJHQ u Provenienz: Ex Gorny & Mosch, München Auktion 275, 2020, Los 109; H[ 6DPPOXQJ - ( %D\HUQ HUZRUEHQ HU ELV $QIDQJ HU ,Q Deutschland seit vor 2000. Ein Parallelstück für die unverzierten Nägel mit gleichem Fundort in: Christie´s /RQGRQ$XNWLRQYRP'H]HPEHU/RV =XVFKODJ*%3  A collection of Roman bronze ship nails comprising four simple, long nails DQGWZRGHFRUDWLYHQDLOVZLWKSUR}OHGGLVNV3XUSRUWDOO\IURPWKH1HPL/DNH 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

605 6FKO©VVHOXQG=LUNHO5¤PLVFKH.DLVHU]HLW-KQ&KU/ 6FKO©VVHOFP/=LUNHOFP%URQ]H6W©FN Dunkle Pa WLQDLQWDNW u Provenienz: Ex österreichische Privatsammlung M. S., seit 1970er Jahren. Roman key and compass made of bronze. Dark patina, intact. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

254


606 .OHLQH 6DPPOXQJ DQWLNHU 6LOEHUJHJHQVW”QGH Darunter aus Sil EHUXQGDXVU¤PLVFKHU=HLWHLQH%©JHO}EHO /FP XQGHLQ 6FKODQJHQDUPUHLI kFP VRZLHHLQ/¤IIHO OLJXOD  /FP  :HLWHUKLQ]ZHLVLOEHUQH1DGHOQ XQGFP XQGHLQHDXV Bronze (14,5cm). 6W©FN 500,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. &ROOHFWLRQRIVLOYHUREMHFWVLQFODERZ}EXODDEUDFHOHWZLWKHQGLQJVLQIRUP RIVQDNHKHDGVDVSRRQ OLJXOD DOOIURP5RPDQSHULRG3OXVWZRVLOYHUDQG one bronze needle. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 %URQ]HJORFNH5¤PLVFK-KQ&KU+FDFP+RKOJXVV Birnenförmiger Corpus mit Aufhängeöse. Braungrüne Patina, intakt. 300,– Provenienz: Ex Schweizer Privatsammlung A. W., in Deutschland seit 2002. %URQ]HFDVWEHOO5RPDQQGWKFHQWXU\$'*UHHQEURZQSDWLQDLQWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

608 *ULHFKLVFKHV$ODEDVWURQDXV0DUPRU-KY&KU+FP $XI HLQHU 6HLWH DQJHJULIIHQH 2EHU~”FKH ZRKO 0HHUHVIXQG  sonst intakt. 450,–

610 6DW]0©Q]JHZLFKWH*UDHFREDNWULVFK-KY&KUD (LQ*H ZLFKWLQ+XIHLVHQIRUPDXV.XSIHU1LFNHO9V%©VWHGHV+HUU schers mit böotischem Reiterhelm, Rs. Herakles mit Keule zwischen Inschrift. H 1,5cm, 8,55g. b) Vier Steingewichte, Vs. mit Büste des Herrschers mit böotischen Reiterhelm, darun WHU.UHLVHDOV=DKODQJDEHXQG,QVFKULIW+FPJ+ 2,6cm, 15,34g / H3cm, 9,65g / H2,4cm, 8,81g.  6W©FN (LQ 6WHLQJHZLFKWHWZDVQDFKJUDYLHUWVRQVWLQWDNW u Provenienz: Ex Sammlung K. G., Rheinland, erworben im deutschen .XQVWKDQGHOHU-DKUHELV Set of weights for coins. Graecobactrian, 1st century B.C. a) Cu/Ni, bust of the ruler with boeotian helmet above inscription. b) Four weights made of stone, all with bust of the ruler with boeotian helmet above circles and inscriptions. One stone weight slightly modern engraved, otherwise intact 5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

611 6DPPOXQJ6LHJHODEGU©FNHRömische Kaiserzeit, Doliche(?), 1. -KQ&KUkPP6DPPOXQJYRQPHLVWJU¤gHUHQ 6LHJHODEGU©FNHQDXV7RQ=XPHLVWZRKOYRQRI}]LHOOHQ6WHOOHQ Bildmotive: Jupiter Dolichenus und gerüsteter, bärtiger römi scher Kaiser (oder Mars) reichen sich die Hände, Tyche, ge genständige Büsten der Dioskuren, Büste der Juno u.a.m. 36 6W©FN 300,–

Provenienz: Ehemals in der Schweizer Privatsammlung Y. W., erworben vor 1970; in Deutschland seit 2010

3URYHQLHQ]$XVGHU6DPPOXQJ3HWHU:HLg.LHOHUZRUEHQ]ZLVFKHQ und 2015. Lit.: P. Weiß, Tonsiegel aus Doliche. Neue Befunde und alte Aspekte, in: J. Wagner (Hrsg.), Gottkönige am Euphrat. Neue Ausgrabungen und )RUVFKXQJHQLQ.RPPDJHQH  II

*UHHNDODEDVWURQPDGHRI}QHZKLWHPDUEOHWKWKFHQWXU\%&6XUIDFH on one side strong chipped off, otherwise intact.

&ROOHFWLRQRIWHUUDFRWWDVHDOLQJVSUREDEO\IURP'ROLFKHVWQGFHQWXU\ A.D. Mainly large pieces! 36 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

609 $ODEDVWURQ*ULHFKLVFK-KY&KU+FP4XHUJHVWUHLIWHU Alabaster. Intakt. 300,–

612 6DPPOXQJ6LHJHODEGU©FNHRömische Kaiserzeit, Doliche(?), 1. -KQ&KUkPP6DPPOXQJYRQPHLVWJU¤gHUHQ 6LHJHODEGU©FNHQDXV7RQ=XPHLVWZRKOYRQRI}]LHOOHQ6WHOOHQ Bildmotive: Jupiter Dolichenus und gerüsteter, bärtiger römi scher Kaiser (oder Mars) reichen sich die Hände, Tyche, ge genständige Büsten der Dioskuren, Büste der Juno, Kopf des Augustus(?) und des Jupiter Dolichenus u.a.m. 6W©FN 250,–

Provenienz: Ex österreichische Privatsammlung M. S., seit 1970er Jahren. *UHHNDODEDVWURQPDGHRIIDVFLDWHGDODEDVWHUWKWKFHQWXU\%&,QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]$XVGHU6DPPOXQJ3HWHU:HLg.LHOHUZRUEHQ]ZLVFKHQ und 2015. Lit.: P. Weiß, Tonsiegel aus Doliche. Neue Befunde und alte Aspekte, in: J. Wagner (Hrsg.), Gottkönige am Euphrat. Neue Ausgrabungen und )RUVFKXQJHQLQ.RPPDJHQH  II &ROOHFWLRQRIWHUUDFRWWDVHDOLQJVSUREDEO\IURP'ROLFKHVWQGFHQWXU\ A.D. Mainly large pieces! 36 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

255


613 *URgH 6DPPOXQJ 6LHJHODEGU©FNH Römische Kaiserzeit, Doli FKH " -KQ&KUkPP6DPPOXQJYRQZRKO überwiegend privaten Siegelabdrücken aus Ton. Verschiede ne Motive, darunter Grylloi, diverse Götter, Büsten usw. 258 6W©FN 250,– 3URYHQLHQ]$XVGHU6DPPOXQJ3HWHU:HLg.LHOHUZRUEHQ]ZLVFKHQ und 2015. Lit.: P. Weiß, Tonsiegel aus Doliche. Neue Befunde und alte Aspekte, in: J. Wagner (Hrsg.), Gottkönige am Euphrat. Neue Ausgrabungen und )RUVFKXQJHQLQ.RPPDJHQH  II /DUJHFROOHFWLRQRIWHUUDFRWWDVHDOLQJVSUREDEO\IURP'ROLFKHVWQGFHQWXU\ A.D. Mainly private pieces! 258 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

614 Sammlung Schleuderbleie.    -K Y &KU /   PP Darunter einige mit Inschriften: EQE/LONTOS, YDD, [...]AR/ MANHS, BAYPTA / Lanzenspitze, LUSIA, EUBOULIAS VLF   +HXJDEHO XQG 0RQRJUDPP GUHL PLW DFKWVWUDKOLJHQ Sternen und eines mit Doppelaxt. 6W©FN 150,– 3URYHQLHQ]$XVGHU6DPPOXQJ3HWHU:HLg.LHOHUZRUEHQ]ZLVFKHQ und 2015. Die Namen bezeichnen offenbar einzelne Söldner, die in hellenistischer Zeit LQ .OHLQDVLHQ RSHULHUWHQ V 3 :HLVV  1 'UDVNRZVNL 1HXH JULHFKLVFKH Schleuderbleie. Tissaphernes und weitere Kommandeure, Chiron 40, 2010, 6 *URXS RI OHDG VOLQJ EXOOHWV PDQ\ ZLWK QDPHV RI PHUFHQDULHV WK  QG century B.C. 12 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

615 Sammlung Spinnwirteln. 5¤PLVFK-KQ&KU6W©FNDXI HLQHU.HWWHPRGHUQDXIJHI”GHOW6W©FNORVHkFP Aus Bein. Fast alle sehr schön verziert mit Punktkreisen und JHRPHWULVFKHP'HNRU(LQLJHPLW5HVWHQYRQU¤WOLFKHU)DUEH 6W©FN Winzige Fragmente fehlen. 500,–

 =LHJHOIUDJPHQWGHU/HJLR9,,&/1. Jh. n. Chr. L 34cm, B 16cm, T 8cm. Großes Ziegelfragment mit Mörtelauftrag, darin sauber DXVJHSU”JWHU 6WHPSHO /(* LR  9,, &/ DXGLD w R! Unten sauber abgeschnitten, oben Bruchkante. 300,– Provenienz: Ex Sammlung R. B., seit 2000. Die Legio VII Claudia (7. claudische Legion) wurde wohl vor dem Jahr 59 v. Chr. aufgestellt und durch Octavian im Jahr 44 v. Chr. neu formiert. Sie bestand bis ins frühe 5. Jh. n. Chr. Inschriften aus dem 3. Jahrhundert weisen die Teilnahme an Feldzügen im Osten nach. Vermutlich nahm die Legion an Septimius‘ Partherfeldzug teil, der 198 n. Chr. mit der Einnahme der Hauptstadt Ktesiphon endete. In den Auseinandersetzung zwischen Gallienus und dem Usurpator Postumus stand die Legion auf Seiten des Gallienus und ZXUGHPLWGHQ7LWHOQ3LD9,)LGHOLV9, VHFKVPDOS~LFKWEHZXVVWXQGWUHX XQG 3LD9,,)LGHOLV9,,DXVJH]HLFKQHW,P-DKUQ&KUJHK¤UWHGLH/HJLRQ]XP Heer des Kaisers Claudius Gothicus, mit dem er die Goten in der Schlacht bei Naissus besiegte. Fragment of a brick with stamp of Legio VII C L; well preserved, 1st century A.D. Legio VII was one of the two legions used in Caesar‘s invasions of Britain, and played a crucial role in the Battle of Pharsalus in 48 BC. As we learn from inscriptions the Legio VII Claudia was ordered back to Moesia following Vespasian‘s victory over Vitellius. An inscription from the reign of Antoninus Pius attests that it remained in this station, although Moesia had been divided into Moesia Superior (where the legion had its headquarters), and Moesia Inferior. The legion existed at least until the end of the 4th century, guarding the middle Danube. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

618 Fragment eines Ziegels mit Stempel der Legio XXI Rapax. 19,5cm x 11,5cm. Rötlicher Ton. Fragment mit rechteckigem Stempel XXI in Tabula ansata. Intakt. 300,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ Sammlung Piscator, 1959. Die unter Augustus um das Jahr 8 v. Chr. ausgehobene Legio XXI Rapax hatte nur eine kurze Wirkungsgeschichte, in der sie bis in die 80er Jahre des 1. Jhs. n. Chr. hauptsächlich zur Sicherung der Rheingrenze eingesetzt wurde. Nach der Niederschlagung des Aufstands des Saturninus 89 n. Chr. wurde die Legion an die Donau strafversetzt, wo sie vermutlich bei Kämpfen gegen die sarmatischen Iazygen aufgerieben wurde.

Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970.

Fragment of a brick with rectangular, only partly preserved stamp of Legio ;;,5DSD[ZHOOSUHVHUYHGEHWZHHQ$'

Collection of bone spindle whorls: 33 pieces threaded modernly, 31 pieces loose. Almost all very nicely decorated with dotted circles and geometric decor. 6RPHZLWKUHPQDQWVRIUHGGLVKFRORU5RPDQVWUGFHQWXU\$'7LQ\ fragments missing. 64 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

616 Großer Ziegel mit Stempel. 4. Jh. n. Chr. 41 x 41 x 4cm. Quadratischer Ziegel aus rötlichem Ton, darin Stempel mit $XIVFKULIW$',9'7(w$XVEUXFKDQGHUUHFKWHQ6HLWHVRQVW intakt. 200,– Provenienz: Ex Privatbesitz A. H.; ex Hirsch Nachf. Auktion 274, September 2011, 991; ex Hirsch Nachf. Auktion 257, 2008, Los 857. Dort aus deutscher Sammlung. Vgl. U. Brandl, Untersuchungen zu den Ziegelstempeln römischer Legionen (1999) Kat. 728 („Privater Hersteller aus Trier“). Large Roman tile with the stamp of a private producer. 4th century A.D. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

256


619 =LHJHOIUDJPHQW PLW 6WHPSHO GHU /HJLR ;;; 8OSLD 9LFWUL[ Nach 193 bis 5. Jh. n. Chr., Colonia Ulpia Traiana (Xanthen) L ca. FP%FDFP7RQ5XQGHU6WHPSHOPLW,QVFKULIW/(* XXX V(lpia) V(ictrix) P(ia) F(idelis)“. Intakt. 250,– Provenienz: Ex Sammlung Kluger. 'LH/HJLR;;;ZXUGHXQWHU.DLVHU7UDMDQZ”KUHQGGHV'DNHU)HOG]XJHV im Jahr 100 n. Chr aufgestellt. Teile von ihr dienten unter Trajan wohl bei den Auseinandersetzungen mit den Parthern. Im Jahr 122 n. Chr. wurde die Legion nach Xanthen verlegt, wo ihr Hauptstandort bis zum Zusammenbruch der Rheingrenze am Beginn des 5. Jhs. n. Chr. blieb. Die Legion hatte eine bewegte Geschichte: Während des Bürgerkrieges im Jahr 193 n. Chr. schlug sie sich auf die Seite des Septimius Severus, der sie mit dem Titel „Pia Fidelis“ belohnte. Während des 2. und am Beginn des 3. Jhs. wurden Vexillationes der Legion, angesichts der ruhigen Lage an der Rheingrenze, von Alexander Severus gegen die Sassaniden eingesetzt. Die Legion unterstützte das Gallische Reich des Posthumus und erlitt zweifellos schwere Verluste, als Aurelian in der Schlacht auf den Katalaunischen Feldern (274 n. Chr.) Tetricus I. besiegte. Fragment of a brick with stamp of Legio XXX Ulpia Victrix; well preserved, after 193 to 5th century A.D. The Legio XXX V V was founded in AD 100 by the emperor Trajan for service in the Dacian Wars. In A.D. 122 they were moved to Colonia Ulpia Traiana (modern Xanten in Germania Inferior), where they remained for the following centuries. The Legio had an eventful history: In the civil war of A.D. 193, XXX Ulpia Victrix supported Septimius Severus, who granted them the title of Pia Fidelis („faithful and loyal“). Parts of the legion were used by Emperor Alexander Severus in his campaign against the Sassanids. Later the legion would be involved in Alexander Severus‘ campaign on the Rhine Frontier. It supported the Gallic Empire RI 3RVWXPXV u  DQG QR GRXEW VXIIHUHG VXIIHUHG JUHDW ORVVHV ZKHQ Aurelian overthrew Tetricus I in the bloody battle at the Catalaunian Fields &K“ORQVHQ&KDPSDJQH LQ$' VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

620 .RSIIUDJPHQWYRQHLQHP+RO]VDUNRSKDJ6S”W]HLWFD v. Chr. H 24cm, B 13cm. Holz, stuckiert und bemalt. Mumien maske mit Spuren einer beigen Grundierung aus hellbraunem Stuck, die schwarz und rot umrandeten, plastisch vorgewölbten Augen mit den schwarze Pupillen sind weiß unterlegt. Das mit Streifen verzierte Kopftuch und der über der Stirn aufgemal te Skarabäus sind im Ansatz zu erkennen. Trockensprünge im Holz, mehrere Löcher zur Befestigung von Zapfverbindungen, moderne Ringschraube. 400,– Provenienz: Ex Privatsammlung W. F., München, seit vor 2000. Wood mummy mask with small remnants of gesso and painting. Late period, FD%&6HYHUDOFUDFNVDQGLQOHWRSHQLQJVLQWKHZRRG VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

621 )UDJPHQW HLQHU 0XPLHQNDUWRQDJH 3WROHP”LVFKH =HLW    v. Chr. H 16,3cm, Rahmen 20 x 15cm. Leinen stuckiert und bemalt. Darstellung eines Verstorbenen im rostrot gemalten Mumiennetz mit dreigeteilter, blauer Perücke. Der Körper und das Gesicht sind ockerfarben. Farbabsplitterungen besonders im unteren Bereich; auf Karton aufgelegt und unter Glas gerahmt. 300,– Provenienz: Aus der Sammlung H. J., Moers, erworben im Kölner Kunsthandel in den 1980er Jahren. Gessoed and painted linen fragments of a mummy wrapping depicting a male }JXUHZKRZHDUVDEOXHZLJDQGLVZUDSSHGXSLQDUXVWUHGPXPP\QHW 3WROHPDLF3HULRGFD%&6RPHVSDOOLQJVODLGRQEHLJHFDUWERDUG and framed. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

622 Sammlung von verschiedenen Objekten. Nordafrika, 3. Jh. v. Chr.   -K Q &KU D  / FP .HWWH DXV )D\HQFH5¤KUHQSHUOHQ Intakt, neu aufgezogen (Deutsche Privatsammlung vor 1985; IADAA Mitglied Galerie Günter Puhze, 1991). b) Sammlung von Glasperlen unterschiedlicher Farbe, Größe und Form (44 Stück). c) Sammlung von Kettengliedern und einem Amulett IUDJPHQWDXV)D\HQFH 6W©FN LQWDNWG 3DS\UXV)UDJPHQWH mit Resten demotischer Schrift (12 Stück); gerahmt (Deutsche 3ULYDWVDPPOXQJHU-DKUH H 6DPPOXQJJUDHFR”J\SWL VFKH7HUUDNRWWDIUDJPHQWH .¤SIH 6W©FN+FP$XgHU GHP]ZHLV©GRVWDVLDWLVFKH " %URQ]H}JXUHQ -K +MH 8cm. FD6W©FN 250,– Provenienz: In Deutschland seit vor 1983. Collection of different objects from the Late Period to the Roman era: a) String of faince barrel beads, modern stringing; intact. b) Lot of glass beads; intact. c) Faience chain links and a fragment of an amulet. d) Collection of 3DS\UXVIUDJPHQWVIUDPHGH }YHKHDGVIURQPJUDHFRHJ\SWLDQWHUUDFRWWD heads. Also comprising two Southeast Asian(?) bronze frigurines from 19th WKFHQWXU\About 60 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

623 0LQLDWXUVDUNRSKDJ PLW 6FKODQJHQ 6S”W]HLW    '\QDVWLH Y&KU/FP%URQ]H'XQNOH3DWLQDHLQ6HLWHQWHLO fehlt. 300,– Provenienz: Ex Sammlung M. G., München, erworben in der Antikengalerie W. Schmidt, München; in Deutschland seit vor 1983. 0LQLDWXUHVDUFRSKDJXVZLWKVQDNHVPDGHRIEURQ]H/DWH3HULRGH B.C. Dark patina, one side part is missing. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

257


624 7HLO HLQHV *HJHQJHZLFKWV ]X HLQHP )D\HQFH+DOVNUDJHQ Dritte =ZLVFKHQ]HLWFDY&KUkFP'XQNHOJU©QH)D \HQFH.RQYH[HV7HLOHLQHV*HJHQJHZLFKWHV]XHLQHP0HQDWw Pektoral aus Fayence. In sechs Registern angeordnetes Muster aus ovalen Blüten, Rückseite mit eingeritzter Rosette. Intakt. 300,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Fragment of a faience „Menat“ counterpoise amulet. 3rd Intermediate Period, FD%&,QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

625 6DPPOXQJNOHLQHU)D\HQFH$PXOHWWHa) H 3,5cm. Hellgrün gla sierte Fayence. Rechteckiges Plättchen mit Darstellung der Urä usschlange mit Sonnenscheibe rechts und der Kartusche mit dem Thronnamen Thutmoses‘ III.; Glasur weitgehend abgerie EHQOLQNVREHQDEJHEURFKHQ1HXHV5HLFKQDFK n. Chr. b) H 3,1cm. Hellgrün glasierte Fayence. Amulett der VFKUHLWHQGHQ ,VLV RGHU 1HSKW\V 2EHU XQG 8QWHUWHLO DEJHEUR chen, Glasur an manchen Stellen abgeplatzt. Spätzeit, 26. Dy QDVWLHFDY&KU H[HQJOLVFKH6DPPOXQJIU©KHV Jh.). c) H mit Sockel 3,9cm. Grün glasierte Fayence. Patäke. Be schädigung am Kopf, rechte Seite abgebrochen, auf Holzplinthe H[6DPPOXQJ9RLJW '\QDVWLHY&KU d) H 3,2cm. Dunkelgrün glasierte Fayence. Patäke. Intakt; 3. =ZLVFKHQ]HLWFDY&KU ([IUDQ]¤VLVFKH6DPPOXQJ des frühen 20. Jhs.). e) H 3,4cm. Hellgrün glasierte Fayence. Figur des Bes. Federkrone abgebrochen, Glasur teilweise ab JHULHEHQ=ZLVFKHQ]HLWFDY&KU H[%RQKDPyV London). Dazu f) eine sog. Froschlampe aus grünlichem Ton mit Ritzdekor, auf der Unterseite Marke „B“. ca. 4. Jh. v. Chr. L FP2EHU~”FKHVWHOOHQZHLVHYHUULHEHQ6W©FN 500,– Provenienz: In deutschem Privatbesitz seit mindestens 2015. Collection of green and blue glazed faience amulets: a) Amulet with the cartouche of Thutmosis III. b) Isis or Nephtys. c) und d) Pataikos. e) Bes. All in fairly good condition; New Kingdom to 3rd Intermediate Period and 3WROHPDLF7LPHVFD%&3OXVI DIURJODPSwPDGHRIJUHHQLVK terracotta with engraved decor, below the mark „B“. About 4th century B.C. Surface partially rubbed off. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

626 6DPPOXQJ HURWLVFKH 2EMHNWH XQG 9RWLYDQK”QJHU 3WROHP”LVFK  U¤PLVFK-KY&KU-KQ&KU'DUXQWHUGUHLVLW]HQGH*H stalten, die jeweils einen überdimensional großen Phallos stützen +FPHLQH)LJXUJHEURFKHQ 5HVWHHLQHU)LJXUHQJUXS pe mit einer sitzenden Gestalt aus blauer Fayence, die einen 3KDOORV XPIDVVW + FP JHEURFKHQ  HLQ 9RWLY$QK”QJHU LQ Form eines männlichen Genitals aus grüner Fayence (L 1,5cm, LQWDNW ]ZHL€PDQX}FDy$QK”QJHUDXV%HLQ /FPZLQ ]LJH)UDJPHQWHIHKOHQHLQHUXUVSU©QJOLFKPLWJU©QHPEHU]XJ  einer mit Öse, der andere eine Kombination aus Phallos und PDQR}FDPLW%RKUXQJVRZLHGUHL0LQLDWXU9RWLY$QK”QJHU / FPLQWDNW LQ)RUPHLQHVP”QQOLFKHQ*HQLWDOVDXVEODXHU und türkiser Fayence mit Öse. 6W©FN Größenteils intakt. 600,– Provenienz: Ex Gorny & Mosch, München Auktion 272, 2020, Los 717 und 718; ex Collection Nancy Mallen, London 1988; ex G. H. Collection, London, vor 1988. &ROOHFWLRQRIHURWLFREMHFWVLQFOXGLQJWKUHHVHDWHG}JXUHVHDFKVXSSRUWLQJDQ RYHUVL]HGSKDOOXVUHPDLQVRIDJURXSRI}JXUHVZLWKDVHDWHG}JXUHLQEOXH faience enclosing a phallus; miniature votive pendant in shape of a male JHQLWDOLDPDGHRIJUHHQIDLHQFHWZRPDQX}FDSHQGDQWVRIERQHDQGWKUHH miniature votive pendants in shape of a male genitalia made of blue and WXUTRLVHIDLHQFH3WROHPDLF5RPDQUGFHQWXU\%&UGFHQWXU\$' 7KHIDLHQFH}JXUHEURNHQDQGRQHRIWKHIULW}JXUHVDOVREURNHQ10 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ NOHLQHQ )D\HQFHQ XQG $PXOHWWHQ Ptolemäische XQG U¤PLVFKH =HLW FD  Y &KU   -K Q &KU D  /   FP6DPPOXQJYRQVLHEHQNOHLQHQ)D\HQFH2EMHNWHQDXIHL nen dünnen Golddraht aufgereiht, dazwischen kleine gedrehte *ROGRUQDPHQWH,QWDNWE /FP6DPPOXQJYRQGUHL NOHLQHQ 3DS\UXV=HSWHUQ ,QWDNW F  =ZHL 0LQLDWXU8GMDG$X gen: grüne Fayence (L 1,4cm), Achat (12,3cm). Intakt. d) L 1,2 FP6DPPOXQJYRQI©QI0LQLDWXU)U¤VFKHQDXVEODXHUXQG JU©QHU)D\HQFHI /FP6DPPOXQJYRQI©QI6NDUDE”HQ DXV)D\HQFHXQG6WHDWLWWHLOZHLVHOHLFKWEHVFK”GLJWJ /FP +HOOH)D\HQFH+DVH,QWDNWK /FP*UXSSHYRQVLH EHQ %HV)LJXUHQ RGHU YHUZDQGWHQ *RWWKHLWHQ DXV JU©QHU XQG EODXHU)D\HQFH,QWDNWL /FP*UXSSHYRQGUHL*¤W WHU}JXUHQDXV)D\HQFH,QWDNWM /FP6DPPOXQJYRQ VLHEHQ0LQLDWXU9DVHQDXVYHUVFKLHGHQIDUEHQHU)D\HQFH,QWDNW k) H 3,5cm. Tiefblau glasierte Fayence. Fragment eines Gegen JHZLFKWHV]XP0HQDW.UDJHQPLW'DUVWHOOXQJGHV%HVO  2,1cm. Sammlung von unterschiedlichen Objekten: Lotusblüte DXV .RUDOOH )OLHJH DXV .DUQHRO 0LQLDWXU.RUE 8U”XVVFKODQ ge und Symbol „Re im Horizont“ aus Fayence. Intakt. m) Ø 2,3cm. Blau glasierte Fayence. Kleines Ornament, durchbohrt. 6W©FN 500,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Several collections of Egyptian glazed miniature scarabs and composition amulets of deities, vases, symbols and animals. Ptolemaic Period to Roman WLPHVFDVWFHQWXU\%&$OOLQYHU\JRRGFRQGLWLRQ39 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

258


628 =ZHL)D\HQFH.HWWHQ-KY&KUD /FP.HWWHDXV Röhrenperlen aus grün und türkis glasierter Fayence, in der Mitte kleiner Skarabäus, auf der Unterseite Kartusche von Thutmosis III. Intakt, neu aufgezogen. b) 36,5cm. Kette aus 0LQLDWXU6FKHLEHQSHUOHQ DXV JU©QHU XQG EODXHU )D\HQFH XQG glasiertem Steatit. Intakt; neu aufgezogen. 6W©FN 400,– 3URYHQLHQ],Q'HXWVFKODQGVHLWHU-DKUHDOWHGHXWVFKH3ULYDWVDPPOXQJ eines Doktors in Hamburg.

Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Collection of Coptic textiles from the 3rd to the 7th century A.D. comprising pieces of tunicae for the most part. All very well preserved and in good condition. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Two bead necklaces with scarab pendants, faience and glazed steatite barrel DQGF\OLQGHUEHDGVQGVWFHQWXU\%&,QWDFWPRGHUQVWULQJLQJ2 pieces!

631 Sammlung koptischer Stoffe. FD-KQ&KU)UDJPHQWHLQ 5DKPHQ'LHJU¤gWHQEHLGHQFD[FP0LWYHUVFKLHGHQHQ LQWHUHVVDQWHQ0RWLYHQ Fragmentarisch. 250,–

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Ex Sammlung Gerd und Mareidi Stoll, Berchtesgaden, seit vor LQ'HXWVFKODQGVHLWYRU

629 5XQGHU (LQVDW] HLQHV NRSWLVFKHQ 7H[WLOV  -K Q &KU  [ 15cm, Ø Medaillon 9,5cm. Wolle auf Leinen in den Farben Tür kis, Rot und Weiß auf beigem Grund, Grundstoff dunkelbraun. ,Q HLQHP 0HGDLOORQ LVW HLQ ~LHJHQGHU (QJHO DXI URWHP *UXQG GDUJHVWHOOW GDUXP HLQ %DQG PLW PHQVFKHQN¤S}JHQ XQG }VFK OHLELJHQ )DEHOWLHUHQ ]ZLVFKHQ (IHXEO”WWHUQ Selten! Am linken Rand des Medaillons moderne Naht, rechts minimale Beschädi gung. 500,–

&ROOHFWLRQRI&RSWLFWH[WLOHVZLWKLQWHUHVWLQJPRWLIVWKWKFHQWXU\$' Fragmentry.

Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. 0LGGOH PHGDOOLRQ RI D FRORXUIXO &RSWLF KDQJLQJ GHSLFWLQJ D ~\LQJ DQJHO VXUURXQGHGE\DEDQGRIKXPDQIDFHGP\WKLFDOFUHDWXUHVDQGLY\OHDYHVWK century. Modern seam on the left side of the medallion, otherwise intact. Rare! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

630 Sammlung koptischer Stoffe. a) 31,5 x 14cm, mit Passepartout L 40,5 x 23,5cm. Leinengewebe in Braun und Rot auf beigem *UXQG%RUWHPLW0HGDLOORQVXQG5HFKWHFNHQLQGHQHQ}J©U liche Szenen wie zum Beispiel eine männliche Figur, die neben einer Säule steht, eingewebt sind. Kleine Fehlstellen, sonst in WDNW$XI/HLQHQDXIJHOHJWPLW3DVVHSDUWRXW-KQ&KU b) 26 x 11,5cm, mit Glas 31,5 x 16,5cm. Wollgewebe in Grün XQG +HOOEUDXQ %RUWH HLQHU 7XQLND " PLW ~RUDOHQ 0XVWHUQ LQ Medaillons und verziertem Seitenstreifen, unten drei stehende nackte männliche Figuren. Zwei Fehlstellen am Rand, sonst VHKU JXWHU =XVWDQG XQWHU *ODV JHUDKPW    -K Q &KU F  33 x 22cm, Glas 41 x 29cm. Wolle auf Leinen in Rotbraun und %HLJH%RUWHQVW©FN 9RUKDQJ%HVDW]" PLW'DUVWHOOXQJYRQ9¤ geln, Fischen und Kleintieren in einem rechteckigen Feld, von einer Bordüre mit Medaillons eingefasst. Darunter rechteckiges Feld mit drei stehenden nackten Männern. Intakt; unter Glas JHUDKPW    -K Q &KU G   [ FP :ROOH DXI /HLQHQ LQ%HLJHXQG%UDXQ4XDGUDWLVFKHU(LQVDW]PLW}J©UOLFKHQ'DU stellungen von Fabeltieren, Büsten und einem Mann mit zwei Schwertern in fünf Medaillons und in den Zwickeln. Fehlstellen am Rand, kleine Beschädigung in der Mitte, sonst sehr guter Zu VWDQG$XIKHOOEUDXQHV/HLQHQVW©FNJHOHJW-KQ&KUH  [FP:ROOHDXI/HLQHQLQ6FKZDU]XQG%HLJH4XDGUD WLVFKHU(LQVDW]PLWRYDOHP0HGDLOORQPLWHLQHUPXVL]LHUHQGHQ und einer tanzenden Figur, umgeben von Tieren und Blumen, in den Zwickeln vier rennende Hasen. Fehlstellen am Rand und LP0HGDLOORQ$XIKHOOEUDXQHV/HLQHQVW©FNJHOHJW-KQ &KUI /MHZHLOVFP%FP=ZHLUHFKWHFNLJH(LQV”W]H YHU PXWOLFKYRQHLQHU7XQLND PLW~RUDOHQ0XVWHUQLP)HOGXQGLQ Medaillons in Dunkelgrün, Rot und Beige mit breiter roter Um UDQGXQJ-KQ&KU6W©FN 400,–

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

632 6DPPOXQJ.LOL\D,GRON¤SIH:HVWDVLDWLVFKFD Y&KU+FP%FP7FP:HLgHU IHLQNULVWDOOLQHU0DUPRU%UHLWHU.RSIPLW~DFKHUG©QQHU1DVH und plastischer Angabe der Ohren.  6W©FN Alle am Hals gebrochen, winzige Fragmente fehlen, Reste von Sinter. 500,– Provenienz: Ex Privatbesitz M. T., in München seit den 1980er Jahren. Collection of marble heads of the Kiliya idol type. Western Asiatic, about    %& $OO EURNHQ DW WKH QHFN WLQ\ IUDJPHQWV PLVVLQJ traces of sinter. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

633 Idol aus Ton. Babylonisch, 2. Jt. v. Chr. H 13,8cm. Hellbeiger Ton. Männliche, bärtige Figur mit pfeilerförmigem Körper, die +”QGH KDOWHQ YRU GHP %DXFK HLQHQ *HJHQVWDQG 2EHU~”FKH berieben, im unteren Bereich wieder zusammengesetzt. 450,– Provenienz: Ex deutsche Privatsammlung Professor H. G. (verstorben 1978), erworben vor 1970. Male clay idol. Babylonian, 2nd millenium B.C. Surface worn, reassembled in the lower part. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

634 ,GRODXV%URQ]H6\URKHWKLWLVFK-WY&KU+FP6WLOLVLHUWH pfeilerartige Figur, die einen Arm erhoben und den anderen LQ GLH +©IWH JHVWHPPW KDW PLW ~DFKHP UXQGHP .RSI PLW hervortretender Nase und Scheibenaugen. Teilweise korrodiert, grünbraune Patina, im unteren Bereich gebrochen. 450,– Provenienz: Aus deutscher Privatsammlung E., erworben 1989 auf dem deutschen Kunstmarkt. %URQ]H VW\OL]HG LGRO 6\URKLWWLWH QG PLOOHQLXP %& 3DUWLDOO\ FRUURGHG greenbrown patina, broken in the lower part. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

259


635 %URQ]HQHU6WLHU$PODVFK  -KY&KU/FP9ROOJXVV Dunkle Patina, intakt. 400,– Provenienz: Ex Sammlung M. G., München, erworben in der Antikengalerie W. Schmidt, München; in Deutschland seit vor 2000. %URQ]HEXOO$PODVKWKWKFHQWXU\$''DUNSDWLQDLQWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

636 .OHLQH6DPPOXQJ%URQ]HJHJHQVW”QGHLuristan, 2. Jt. bis 1. Hälfte  -W Y &KU 'DUXQWHU YLHU 1DGHOQ PLW }J©UOLFKHQ $XIV”W]HQ (11,1cm bis 21,5cm), eine Fibel (Nadel fehlt, L 6,3cm) und HLQNOHLQHV3IHUGFKHQ FP

6W©FN Alle mit dunkelgrüner Patina. 250,– Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. &ROOHFWLRQRI/XULVWDQEURQ]HREMHFWVLQFOIRXUQHHGOHVDOOZLWKD}JXUDOWRSD }EXOD QHHGOHLVPLVVLQJ DQGDVPDOOKRUVHQGWRVWKDOIRIVWPLOOHQLXP B.C. All with dark green patina. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 %URQ]HQHV .RPSDUWLPHQWVLHJHO PLW 5RVHWWH Baktrien, 2. Jt. v. Chr. Ø 8cm. Runder, am Rand gewellter Stempel mit Grifföse. Florales Motiv in Form einer vielblättrigen Rosette. $XgHUJH Z¤KQOLFKNRPSOH[HV0RWLY Intakt. 600,– Provenienz: Ex Sammlung K. G., Rheinland, erworben im deutschen .XQVWKDQGHOHU-DKUHELV%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ 275, 2020, Los 320. %URQ]HFRPSDUWPHQWHGVWDPSVHDOZLWKD~RUDOPRWLILQVKDSHRIDURVHWWH Bactria, 2nd millenium B.C. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

638 %URQ]HQHV.RPSDUWLPHQWVLHJHOPLW%O©WHBaktrien, 2. Jt. v. Chr. Ø 6,1cm. Runder Stempel mit Grifföse. Glatter Rand mit einer vierblättrigen Blüte, dazwischen Schuppenmuster. Auf der Oberseite Ritzdekor in Form von Schraffurbändern und Bögen. Intakt. 400,– Provenienz: Ex Sammlung K. G., Rheinland, erworben im deutschen .XQVWKDQGHOHU-DKUHELV%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ 275, 2020, Los 322. %URQ]HFRPSDUWPHQWHGVWDPSVHDOZLWKDIRXUSHWDOOHG~RZHUVFDOHSDWWHUQ inbetween, encarved decoration on the upper side. Bactria, 2nd millenium B.C. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

260

639 %URQ]HQHV.RPSDUWLPHQWVLHJHOPLW5DGBaktrien, 2. Jt. v. Chr. Ø 5,5cm. Runder Stempel mit Grifföse. Glatter Rand mit einem sechsspeichigen Rad. Auf der Oberseite Ritzdekor in Form von Schraffurbändern. Intakt. 350,– Provenienz: Ex Sammlung K. G., Rheinland, erworben im deutschen .XQVWKDQGHOHU-DKUHELV%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ 275, 2019, Los 324. Bronze compartmented stamp seal with a wheel, encarved decoration on the upper side. Bactria, 2nd millenium B.C. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

640 %URQ]HQHV.RPSDUWLPHQWVLHJHOPLW9RJHOBaktrien, 2. Jt. v. Chr. Ø 4,4cm. Vollguss. Runder Stempel mit Grifföse. Glatter Rand mit einem Vogel mit ausgebreiteten Schwingen. Intakt. 400,– Provenienz: Ex Sammlung K. G., Rheinland, erworben im deutschen .XQVWKDQGHOHU-DKUHELV%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ /RV 9JO6%DJKHVWDQL0HWDOOHQH&RPSDUWLPHQWVLHJHODXV2VW,UDQ=HQWUDODVLHQ XQG1RUG&KLQD  6 Bronze cast compartmented seal, with a bird with spread wings. Bactria, 2nd millenium B.C. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

641 %URQ]HQHV.RPSDUWLPHQWVLHJHOPLW%O©WHBaktrien, 2. Jt. v. Chr. Ø 4,8cm. Runder Stempel mit Grifföse. Glatter Rand mit einer vierblättrigen Blüte, dazwischen Zacken. Auf der Oberseite Ritzdekor in Form von Schraffurbändern und Bögen. Intakt. 350,– Provenienz: Ex Sammlung K. G., Rheinland, erworben im deutschen .XQVWKDQGHOHU-DKUHELV%HL*RUQ\ 0RVFK0©QFKHQ$XNWLRQ 275, 2020, Los 327. %URQ]H FRPSDUWPHQWHG VWDPS VHDO ZLWK D IRXUSHWDOOHG ~RZHU VSLNHV inbetween, encarved decoration on the upper side. Bactria, 2nd millenium B.C. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


642 6DPPOXQJ+DOVXQG$UPVFKPXFN%DNWULHQ-W$QIDQJ-W Y&KUXQG(QGH-KY-KQ&KU'DUXQWHUD HLQ+DOVUHLI kFP DXVWRUGLHUWHP5XQGVWDEPLWRIIHQHQ(QGHQ /XUL stan, 1. Jt. v. Chr., vielleicht später), b) ein Armreif (Ø 12,2cm) DXVDQHLQDQGHUJHI©JWHQUXQGHQXQGVFKHLEHQI¤UPLJHQ3HUOHQ F  ]ZHL $UPUHLIH k  XQG FP  PLW JHULSSWHU 2EHU~”FKH und rundem oder rechteckigem Querschnitt, d) ein Armreif (Ø FP PLW(QGHQLQ)RUPYRQVWLOLVLHUWHQ6FKODQJHQN¤SIHQH  eine Halskette (L ca. 46cm) aus kugeligen, ovoiden, facettier ten und scheibenförmige Perlen aus verschiedenfarbigem Glas, schwarzem Stein, grünem und braunem Achat, f) zwei Halsket WHQ / FD  XQG FP  DXV ELNRQLVFKHQ U¤KUHQ SRO\HGHU würfelförmigen Perlen sowie Melonenperlen aus türkiser, grü ner und blauer Fritte sowie weißem Kalkstein, die meisten mit unterschiedlichem Ritzdekor, im Zentrum jeweils ein Anhän JHUXQGJ YLHU+DOVNHWWHQ /XQGFP-W$QIDQJ 2. Jt. v. Chr.) aus scheibenförmigen, bikonischen, rhombenför migen, doppelkegelförmigen und blattartigen Perlen, bei einer Kette zusätzlich scheibenförmige Bronzeperlen. 6W©FN Bron zeschmuck: bis auf ein Stück gereinigt und restauriert; Ketten: Modern aufgefädelt, intakt, teils verwittert. 400,– Provenienz: Ex Gorny & Mosch, München Auktion 248, 2017, Los 720; aus der rheinischen Privatsammlung W. D. Vom Vater des jetzigen Besitzers in den 1970er und 1980er Jahren erworben. Collection of a twisted bronze torques (Luristan, 1st millenium B.C. or later), DEUDFHOHWPDGHRIURXQGDQGGLVFVKDSHGEHDGVWZREUDFHOHWVZLWKULEEHG surface and one bracelet with endings in shape of stylized snake heads, a QHFNODFHPDGHRIELFRQLFDOVSKHULFDOGLVFVKDSHGIDFHWHGDQGRYRLGEHDGV of glass in different colours and of black stone and green and brown agate, two necklaces made of biconical, tubular, polyhedral, cubic and melon beads made of turquoise, green and blue frit and white limestone with pendant in the FHQWHUDQGIRXUQHFNODFHVPDGHRIELFRQLFDOGLVFDQGUKRPEXVVKDSHGEHDGV DQGEHDGVLQVKDSHRIVW\OL]HGOHDYHVRQHRIWKHPZLWKGLVFVKDSHGEHDGVRI EURQ]H%DFWULDUGHDUO\QGPLOOHQLXP%&DQGHQGRIVWFHQWXU\%& QGFHQWXU\$'%URQ]HMHZHOOHU\([FHSWRQHSLHFHFOHDQHGDQGUHVWRUHG necklaces: modern stringing, intact. 12 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

643 Kugeltopf. <RUWDQ.XOWXU    Y &KU + FP k 15,8cm. Topf aus dunkelbraunem Ton mit vier Schnurösen. (LQHVHIHKOW7HLOHGHU0©QGXQJIHKOHQXQGVLQGHUJ”Q]W 400,– Provenienz: Ex Privatsammlung W. F., München, seit vor 2000.

645 6DPPOXQJ 0LQLDWXUJHI”gH Yortan, 3. Jt. v. Chr. Vierösentopf PLW 'HFNHO + FP LQWDNW  =ZHL¤VHQWRSI PLW 'HFNHO + 5,5cm, intakt), Schnabelkanne (H 6,4cm, Mündung gebrochen und wieder angesetzt) und Webgewicht (Ø 4,1cm), alle aus dunkelbraunem Ton und mit Ritzdekor. Dazu eine Deckelpyxis DXVURWHP7RQ +FP'HFNHO]XVDPPHQJHVHW]WGDEHLHLQH PRGHUQH(UJ”Q]XQJ VRZLHGUHLNHJHOI¤UPLJH:HEJHZLFKWHDXV grauem Ton (H 3cm, intakt). 6W©FN 450,– Provenienz: Ehemals in der Privatsammlung Dr. G. A., Deutschland, HUZRUEHQLQGHQHU-DKUHQ &ROOHFWLRQ RI }YH PLQLDWXUH YHVVHOV RI WKH <RUWDQ &XOWXUH LQFO D IRXU DQG a two looped pot (both intact), a beaked jug (neck and mouth broken and reattached) and a loom weight, all made of dark brown clay and with engraved decor. Plus a pyxis with lid made of reddish clay (lid restored with a modern retouched part) and three loom weights of grey clay (intact). 3rd millenium B.C. 8 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

646 =ZHL 3DDU EURQ]H]HLWOLFKHU 6FKPXFNJHJHQVW”QGH a) Paar 6SLUDOEULOOHQDQK”QJHU    Y &KU %  XQG FP 6FK¤QHVFKZDU]JU©QH3DWLQDE 3DDUPDVVLYHU$UPUHLIH Y&KUkXQGFP:XQGHUEDUHW©UNLVH3DWLQD6W©FN Intakt. 600,– Provenienz: Aus einer süddeutschen Privatsammlung, erworben in den 1970er bis 1980er Jahren im Kunsthandel und anderen deutschen Privatsammlung. Small Collection of objects from the Bronze Age incl. a pair of double bronze VSLUDOV %& ZLWKQLFHGDUNSDWLQDDQGSDLURIEUDFHOHWV  %& ZLWKIDQWDVWLFWXUTXRLVHSDWLQD$OOPDGHRIEURQ]HXQGLQWDFW 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ %URQ]HDUPUHLIH PLW 5LW]GHNRU Mittlere bis späte %URQ]H]HLWFDY&KUkFP(LQHUJHVFKORVVHQ XQGUXQGGLHDQGHUHQRIIHQRYDOPLWOHLFKWDXVNUDJHQGHQ(QGHQ Alle Armreife mit reichem, geometrischem Ritzdekor. 6W©FN Alle mit schöner grüne Patina, intakt. 480,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ 6DPPOXQJ-(%D\HUQHUZRUEHQHUELV$QIDQJHU

6SKHULFDOSRWZLWKIRXUH\HOHWVPDGHRIGDUNEURZQFOD\<RUWDQFXOWXUH 2500 B.C. One eyelet is missing, parts of the lip is also missing and retouched.

Collection of massive bronze bracelets with engraved, geometric decoration. )RXU ZLWK RSHQ HQGLQJV RQH FORVHG %URQ]H $JH DERXW    %& Attractive green patina, intact. 9 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

644 Ein Paar kleiner Töpfe. Luristan, 3. Jt. v. Chr. Heller Ton, H 8cm bzw. 8,5cm. 6W©FN Intakt. 250,–

648 %URQ]HQHU $UPUHLI 6S”WH %URQ]H]HLW    Y &KU k FP 9ROOJXVV PLW JUDYLHUWHQ XQG JHVWLFKHOWHQ 9HU]LHUXQJHQ XQGSUR}OLHUWHQ(QGHQ'XQNHOJU©QH3DWLQDLQWDNW u

Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Pair of small painted pots. 3rd millenium B.C. Intact. 2 pieces!

Provenienz: Ex Sammlung M. G., München, erworben in der Antikengalerie W. Schmidt, München; in Deutschland seit vor 1990.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

%URQ]H EUDFHOHW ZLWK HQJUDYHG GHFRU /DWH %URQ]H $JH    %& Dark green patina, intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

261


Provenienz: Aus deutscher Sammlung der 1980er Jahre.

654 =ZHLEURQ]HQH7LHUDSSOLNHQSkythisch, ca. 4. Jh. v. Chr. Liegende Hirschkuh (L 4,1cm) und hundeähnlicher Kopf (L 3,1cm). Beide mit Befestigungsöse auf der Rückseite. 6W©FN Dunkelgrüne bis grüne Patina, intakt. 400,–

Bronze bracelet with open endings and engraved decoration. Geometric Period, 8th century B.C. Attractive green patina, intact.

Provenienz: Ex Sammlung M. G., München, erworben in der Antikengalerie W. Schmidt, München; in Deutschland seit vor 1990.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Two Scythian bronze appliques: lying hind and head of a doglike animal. On he backside each a loop. About 4th century B.C. Green and dark green patina, intact. 2 pieces!

649 %URQ]HDUPUHLIGeometrisch, 8. Jh. v. Chr. Ø 6,2cm. Mit offenen (QGHQXQG5LW]GHNRU6FK¤QHJU©QH3DWLQDLQWDNW u

650 6DPPOXQJ%URQ]HREMHNWH,WDOLVFK-KY&KU=ZHL%URQ zearmreife (Ø ca. 6cm, intakt), ein Spiralring mit Volute (Ø FPLQWDNW HLQH6SLUDOH kFDFPLQWDNW HLQSVHXGRWRU dierter Ring (Ø ca. 3cm, grüne Patina), ein Bronzeknopf mit Rosette (Ø 2,5cm, winzige Fragmente fehlen) und eine Gürtel schnalle (?, L 4,5cm, grüne Patina). 6W©FN Intakt. 150,– Provenienz: Aus österreichischer Privatsammlung A. B., erworben vor 2003, in Deutschland seit 2003.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

655 %URQ]HQH /DQ]HVSLW]H 0HLgHO XQG %HLWHO Späte Bronzezeit, ca.    Y &KU / /DQ]HQVSLW]H FP / 0HLgHO FP XQG/%HLWHOFP6W©FN Dunkle bis grüne Patina, kleine Fehlstelle bei der Lanzenspitze. 250,– Provenienz: Ex österreichische Privatsammlung M. S., seit 1970er Jahren.

Collection of bronze objects including bracelets, rings and spirals. Italic, 7th WKFHQWXU\%&0RVWO\LQWDFW7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

651 $QK”QJHUDXV%URQ]HGeometrisch, 8. Jh. v. Chr. L 11,6cm. Ke gelförmiger, hohler Corpus mit Aufhängeöse, an dem an drei Ösen am unteren Rand jeweils zwei weitere keulenartige Anhän ger befestigt sind. Dunkelgrüne Patina, intakt. 225,– Provenienz: Aus deutscher Sammlung der 1980er Jahre. Bronze conical pendant with six club shaped pendants at the lower bottom. Geometric, 8th century B.C. Darkgreen patina, intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

652 9RJHODQK”QJHUDXV%URQ]H*HRPHWULVFK-KY&KU+FP Stilisierter Vogel mit Öse und zwei runden Öffnungen im Kör per. Hellgrüne Patina, intakt. 225,– Provenienz: Aus deutscher Sammlung der 1980er Jahre. Bronze bird pendant. Geometric Period, 8th century B.C. Light green patina, intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

653 %URQ]HQHU %HVFKODJ .HOWLVFK  -K Y &KU k FP =HQWUDO ein frontaler Kopf zwischen Torques. Dazu ein spätkeltischer Reitersporn. 6W©FN'XQNHOJU©QH3DWLQDU©FNZ”UWLJ(LVHQUHVWH intakt. 500,–

6SHDUKHDGDQGWZRFKLVHOVPDGHRIEURQ]H/DWH%URQ]H$JHDERXW B.C. Dark to green patina, little fragment of the spearhead is missing. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

656 Rundnackige Steinaxt. 1HROLWKLVFK    Y &KU / 12,1cm. Aus schwarzem Serpentin. Intakt. 150,– Provenienz: Ex Privatbesitz F. S., Bayern; aus einem süddeutschen Nachlass vor 2015. 1HROLWKLFD[HPDGHRIEODFNVHUSHQWLQH%&,QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Westslawische Kanne. FD    -K Q &KU + FP k FP 6FKZDU]H .HUDPLN PLW 5LOOHQ XQG :HOOHQGHNRU Zusammengesetzt mit retuschierten Fehlstellen. 200,– Provenienz: Ex Privatsammlung W. F., München, seit vor 2000. %ODFNWHUUDFRWWDERWWOHZLWKOLQHDQGZDYHGHFRU:HVW6ODYVWKWK century A.D. Reassembled, small missing parts are modern retouched. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

658 Kanne mit Buckeldekor. 7KUDNLHQVS”WH%URQ]H]HLW v. Chr. H 11,3cm. Dunkelbrauner Ton mit geritztem Dekor. Winzige Absplitterungen an der Mündung, sonst intakt. 225,– Provenienz: Aus einer deutschen Sammlung der 1980er Jahre.

Provenienz: Ex österreichische Privatsammlung M. S., seit 1970er Jahren.

7KUDFLDQMXJZLWKNQREVDQGHQJUDYHGGHFRU/DWH%URQ]H$JH B.C. Tiny splinters of the mouth are missing, otherwise intact.

Disk made of chased bronze with head between torques. Celtic, 1st century B.C. Dark green patina, remains of iron on the backside, intact. Plus a Late Celtic bronze horseman spur. 2 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

262


659 .OHLQH 6DPPOXQJ SU”KLVWRULVFKHU .HUDPLN Süditalien, frühes 2. -WY&KUkFP%UDXQHU7RQ'UHLKDQGJHIRUPWH6FKDOHQ 6W©FN Winzige Ausbrüche an den Rändern, sonst intakt. 250,– Provenienz: Aus der Sammlung Krüger, erworben 1974. Prehistoric ceramic from South Italy. Brown clay, handmolded. Tiny splinters are missing. Early 2nd millenium B.C. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

660 $UP HLQHV .UHX]HV 0LWWHOE\]DQWLQLVFK    -K Q &KU / 14,6cm. Bronze mit Gravur. Auf dem Rundel ein Medaillon mit GHU +DOE}JXU 0DULHQV DXI GHP .UHX]DUP 0+3 QV und IC [XC]. Grüne Patina, Kratzer. 300,– Provenienz: Ex österreichische Privatsammlung M. S., seit 1970er Jahren. Bronze arm of a Middle Byzantine cross with engraved decor depicting the Theotokos and the inscription MHP QV and IC [XC]. Green patina, few scratches. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

661 6DPPOXQJ .UHX]H +   FP 6LOEHU %URQ]H 0HVVLQJ Perlmutt, Glas und Holz. Darunter mehrere spätantike Anhänger DXV 6LOEHU ]ZHL E\]DQWLQLVFKH (QNROSLD DXV %URQ]H DXV Äthiopien ein altes Messingkreuz, ein großes Segenskreuz aus Holz und kleine Silberkreuze in Durchbruchsarbeit, weiterhin HLQV©GGHXWVFKHV+RO]NUHX]PLW}J©UOLFKHQ%OHLDSSOLNHQDXVGHU 2. Hälfte des 19. Jhs. 6W©FNXQWHU*ODVPRQWLHUW Alle in guten =XVWDQG u Provenienz: Ex Sammlung M. L., Schweiz, seit mindestens 1970; in Deutschland seit 2015. Collection of Christian crosses incl. several Late Antique silver pendants, two Byzantine bronze enkolpia with engraved decor, from Ethiopia an antique brass cross, a large wooden benediction cross and two small silver crosses LQRSHQZRUNIXUWKHUPRUHD6RXWK*HUPDQZRRGHQFURVVZLWK}JXUDOOHDG appliques from the 2nd half of the 19th century A.D. All in good condition! 20 pieces mounted under glass! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

662 Tonkachel mit Hirsch. %\]DQWLQLVFK    -K Q &KU  [ FP5¤WOLFKHU7RQPLWEHLJHPEHU]XJ4XDGUDWLVFKHUOHLFKW erhabener dünner Rahmen mit zwei Leisten rechts und links am Rand der Kachel, darin ein nach rechts laufender Hirsch, dahinter zwei Zweige. Abrieb an verschiedenen Stellen, oben am Rand fragmentiert. 400,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV,Q Deutschland seit April 2019. Ex Sammlung T. S., London, erworben in den 1970/80er Jahren in London. Terracotta tile with beige slip depicting a deer and two branches behind it. %\]DQWLQHWKWKFHQWXU\$'6RPHDEUDLVRQVDQGWKHWRSRIWKHIUDPH is fragmented. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

663 Tonkachel mit Pferd. %\]DQWLQLVFK1RUGDIULND-KQ&KU [FP5¤WOLFKHU7RQPLWEHLJHPEHU]XJ4XDGUDWLVFKHU leicht erhabener dünner Rahmen mit zwei Leisten rechts und links am Rand der Kachel, darin ein nach links laufendes Pferd, dahinter zwei Palmzweige. Abrieb an verschiedenen Stellen. 400,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV,Q Deutschland seit April 2019. Ex Sammlung T. S., London, erworben in den 1970/80er Jahren in London. Terracotta tile with beige slip depicting a horse and palm branches. Byzantine, WKWKFHQWXU\$'6RPHDEUDLVRQV VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

664 Tonkachel mit Ziegenbock. Byzantinisch, 6. Jh. n. Chr. 21 x FP5¤WOLFKHU7RQPLWEHLJHPEHU]XJ4XDGUDWLVFKHUOHLFKW erhabener Rahmen mit zwei Leisten rechts und links, darin ein nach rechts springender Ziegenbock, darüber ein sechsstrahliger 6WHUQXQGGDUXQWHUHLQUXQGHVYLHUSDVVDUWLJHV~RUDOHV(OHPHQW Winzige Splitter fehlen. 500,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RV ex Privatbesitz London. In Deutschland seit April 2019. Davor ex Gorny & Mosch Auktion 235, 2015, Los 251, aus dem Besitz von V. P., erworben zwischen 1995 und 2005. 7HUUDFRWWDWLOHZLWKEHLJHVOLSGHSLFWLQJDMXPSLQJJRDWDQG~RUDOHOHPHQWV %\]DQWLQHWKFHQWXU\$'7LQ\VSOLQWHUVPLVVLQJ VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

665 *URgH,NRQHPLWGHP*URgP”UW\UHU+O'HPHWULRVYRQ7KHVVDORQLNL 5XVVODQGZDKUVFKHLQOLFK(QGHGHV-KV+FP%FP (LWHPSHUDDXI.UHLGHJUXQGDXI+RO]WDIHOPLW.RZWVFKHJ'HU Hl. Demetrius zu Pferd ersticht den Bulgarenkönig Kalojan. Restauriert. 1.600,– Provenienz: Ex Sammlung K. H. S., Bayern. 'LHVH $UW YRQ ,NRQHQ KDEHQ UXVVLVFKH 2I}]LHUVIDPLOLHQ DP (QGH GHV  Jahrhunderts bei Ikonenmalern als Schutz für die Männer, die in den Krieg ziehen mussten, und ihre Familien bestellt. Large icon showing the Great Martyr Demetrios of Thessaloniki killing the Tsar Kaloyan of Zagora. Tempera on wood panel. This type of icon was RUGHUHGE\5XVVLDQRI}FHUIDPLOLHVDWWKHHQGRIWKHWKFHQWXU\DVSURWHFWLRQ for the men going to war and their families. Russian, probably end of 19th century. Restored. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

666 ,NRQHPLWGHP+O6HUJLXVYRQ5DGRQHVFKXQG6]HQHQDXVVHLQHP Leben. 5XVVODQG-K+FP%FP+RO]WDIHOPLW]ZHL Sponki. Tempera über Kreidegrund auf Holz, auf Goldgrund. Kleine Retuschen, sonst intakt. 600,– Provenienz: Ex Sammlung K. H. S., Bayern. Icon showing St. Sergei of Radonezh with scenes from his life. Russian,19th century.Tempera on wood panel, with golden background. Little retouchings, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

263


 Festtagsikone. Russland, 19. Jh. H 35,5cm, B 31,5cm. Holztafel PLW ]ZHL 6SRQNL (LWHPSHUD DXI .UHLGHJUXQG PLW *ROGJUXQG Rahmung reich graviert und farbig bemalt. Im Mittelfeld das Ostergeschehen mit Höllenfahrt und der Auferstehung Christi dargestellt, umgeben von sechs Heiligen und von 16 Festtagsthe PHQ 9RQ REHQ OLQNV *HEXUW GHU *RWWHVPXWWHU (LQI©KUXQJ Mariens in den Tempel, alttestamentliche Hl. Dreifaltigkeit, Ver kündigung, Geburt Christi, Christus im Tempel, Taufe Christi, (LQ]XJLQ-HUXVDOHP9HUNO”UXQJ&KULVWLGLH+HUDENXQIWGHV+O *HLVWHV 0DULHQV (QWVFKODIXQJ *RWWHVPXWWHU YRQ .DVDQ *RW WHVPXWWHU GHU )UHXGH DOOHU /HLGHQGHQ +LPPHOIDKUW GHV (OLDV Hll. Boris und Gleb, Aufrichtung des Wahren Kreuzes. Intakt. 600,– Provenienz: Ex Sammlung K. H. S., Bayern. ,FRQVKRZLQJWKH5HVXUUHFWLRQDQGWKH$QDVWDVLVVL[6DLQWVDQGVFHQHV of the festival cycle and the Old and New Testament. Russian,19th century. Tempera on wood panel, with golden background. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

668 ,NRQH PLW GHP +O -RKDQQHV GHU 7”XIHU DOV (QJHO GHU :©VWH 5XVVODQG-K+FP%FP(LWHPSHUDDXI.UHLGHJUXQG mit Kowtscheg. Die schlanke Gestalt des Täufers mit großen Flügeln schaut vor einem hellen Hintergrund auf den Betrachter. Seine Rechte ist im Segensgestus erhoben, in der Linken hält er eine herabhängende Schriftrolle. Unten links liegt der Korb mit VHLQHP DEJHVFKODJHQHQ +DXSW EHU VHLQHU $XUHROH HUVFKHLQW DP REHUHQ %LOGUDQG GDV &KULVWXVELOG PLW ]ZHL (QJHOQ 8QWHQ sieht man noch einen Baum, der die Jordangegend andeutet, sowie eine Axt. Restauriert. 500,– Provenienz: Ex Sammlung K. H. S., Bayern. Icon showing St. John the Baptist as Angel of the Desert. Russian, 19th century. Tempera on wood panel with kovcheg. Restored. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Ikone mit Christus Pantokrator. 5XVVODQG-K+FP% 39cm. Tempera über Kreidegrund auf Holz. Im Mittelfeld Dar stellung von Christus Pantokrator, die Rechte im Segensgestus HUKREHQXQGPLWGHUYHUK©OOWHQOLQNHQ+DQGGDVRIIHQH(YDQJH lium haltend. Intakt. 450,– Provenienz: Ex Sammlung K. H. S., Bayern. Icon showing Christ Pantocrator. Russian,19th century. Tempera on wood panel. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Ikone mit der Gottesmutter „Lindere meinen Kummer“. Russland, -K+FP%FP7HPSHUD©EHU.UHLGHJUXQGDXI+RO] auf Goldgrund. Darstellung der Gottesmutter, die rechte Hand an die Wange gelegt, mit dem Christuskind, das eine offene Schriftrolle hält. Kleine Retuschen, sonst intakt. 450,– Provenienz: Ex Sammlung K. H. S., Bayern. Icon showing the Mother of God Soothe my Sorrow, Russian,19th century. Tempera on wood panel, with golden background. Little retouchings, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Ikone mit Erweiteter Deesis. Russland, 19. Jh. H 38,5cm, B 30cm. Tempera über Kreidegrund auf Holz. Darstellungen auf Goldgrund. Im Zentrum des leicht vertieften Mittelfelds thro QHQGHU &KULVWXV ~DQNLHUW YRQ GHU *RWWHVPXWWHU XQG GHP +O -RKDQQHV+LQWHUGHP7KURQVWHKHQGLH(U]HQJHO0LFKDHOXQG Gabriel sowie links der Hl. Grigorij, Hl. Johannes der Theolo ge, Hl. Johannes und Hl. Wassilij Petrus sowie rechts der Hl. Nikolaus Paulus, Fürst Michael, Hl. Georg und Hl. Feodosij. Im Vordergrund knien die Klostergründer Sossima und Sawati. Umrandung ornamental graviert. Restauriert. 400,– Provenienz: Ex Sammlung K. H. S., Bayern.

669 Ikone mit dem Hl. Panteleimon. Russland, um 1900. H 31cm, B 26,4cm. Tempera über Kreidegrund auf Holz, auf Goldgrund. Hl. Panteleimon mit Arzneikästchen und Spatel. Hintergrund, Nimbus und Umrandung punziert und teilweise farbig bemalt XQG (PDLODX~DJHQ LPLWLHUHQG *ROGJUXQG PLW %URQ]HIDUEH restauriert. 500,– Provenienz: Ex Sammlung K. H. S., Bayern. Icon showing St. Panteleimon. Russian, about 1900. Tempera on wood panel, with golden background. Golden background with bronze color restored. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Icon showing the Extended Deisis. Russian,19th century. Tempera on wood panel, with golden background. Restored. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 9LHU RUWKRGR[H ,NRQHQ Russland, 19. Jh, Griechenland 19. Jh. a) Gottesmutter von Tichwin, H 18,5cm, B 16,5cm. Russland, 19. Jh. Tempera über Kreidegrund auf Holz. b) Hl. Panteleimon PLW&ORLVRQQ˜(PDLO2NODG+FP%FP5XVVODQG Jh. c) Hl. Georg, H 22,9cm, B 16,8cm. Griechenland, 19. Jh. d) *RWWHVPXWWHUYRQ:ODGLPLU+FP%FP5XVVODQG Jh. 6W©FN Alterungsspuren. 400,– Provenienz: Ex Sammlung K. H. S., Bayern. Four Orthodox icons incl. The Tikhvinskaya Mother of God (Russian,19th century), St. Panteleimon overlaid with a silver plated brass oklad enamelled in sapphire blue, sky blue, white, green and red (Russian,19th century), St. George (Greece, 19th century) and Vladimirskaya Mother of God (Russian,19th century). Tempera on wood panel. With signs of aging. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

264


 *URgHV HUZHLWHUWHV +DXVNUHX] Russland, 19. Jh. H 39cm, B FP%URQ]HJXVVPLWEODXHPXQGZHLgHP(PDLO,QGHU0LW te die große Kreuzigung, links davon die Gottesmutter und die Hl. Martha, rechts Hl. Johannes und Longinus. Im oberen Teil Gott Sabaoth mit Heiligem Geist in Form der Taube und zwei (QJHOQEHUGHP.UHX]]ZHL(U]HQJHOPLW+O3HWUXVXQG+O Paulus sowie die Panagia von Novgorod. Weiter oben noch mals die Gottesmutter, die von vier Medallions umgegeben ist, in denen der Pantokrator und drei Heilige dargestellt sind. Auf fast quadratischen Feldern, die die Kreuzigungsgruppe rahmen, in chronologischer Reihenfolge die 14 Feste des Kirchenjahres. Die zwei zwiebelförmigen Felder zeigen die Heilige Dreifaltig keit und die Aufrichtung des Kreuzes. Den Abschluss bildet ein Chor von 21 halbkreisförmig gruppierten Seraphim. Von hinten DEJHVFKOLIIHQ (PDLO DQ ZHQLJHQ 6WHOOHQ DEJHVSOLWWHUW VRQVW LQ takt. 450,–

 6DPPOXQJ YRQ .UX]L}[HQ 0HWDOOLNRQHQ XQG 0HVVLQJ2NODG 5XVVODQG-K6DPPOXQJYRQ]ZHL.UX]L}[HQHLQHP7HWUD ptychon mit Festtagen und zwei Metallikonen mit der Gottes PXWWHUYRQ.DVDQXQGGHP+O*HRUJ5HOLH}HUWHU%URQ]HJXVV teilweise mehrfarbig emailliert. H 14 bis 22,5cm. Dazu Mes VLQJ2NODGPLW5HVWHQYRQ9HUJROGXQJ+FP%FP6 6W©FN(PDLOPLQLPDOEHVWRgHQ u Provenienz: Ex Sammlung K. H. S., Bayern. &ROOHFWLRQRIWZR&UXFL}[HVD4XDGULSW\FKVKRZLQJWKHPDLQ)HDVWVRIWKH Orthodox Church and two brass icons with the Kazanskaya Mother of God and St. George. Russian, 19th century. Enameled with blue, light blue and white. Enamel minimally chipped, otherwise intact. Plus brass oklad with remains of gold. Russian, 19th century. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Ex Sammlung K. H. S., Bayern. /DUJHEURQ]HKRXVHFURVVZLWKEOXHDQGZKLWHHQDPHOGHSLFWLQJDFUXFL}[LRQ and fourteen religious feast days. Russian, 19th century. Tiny chipping of enamel, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQ.UX]L}[HQRussland, 19. Jh. Zwei massive Kreuze sowie weitere 5 kleinere Stücke. H 13 bis 38cm. Bronzeguss, teilweise blau, hellblau und weiß emailliert. Kreuzigungen in traditioneller Ikonographie.  6W©FN (PDLO DQ ZHQLJHQ 6WHOOHQ abgesplittert, sonst intakt. 500,– Provenienz: Ex Sammlung K. H. S., Bayern. &ROOHFWLRQRI&UXFL}[HVHQDPHOHGZLWKEOXHOLJKWEOXHDQGZKLWH5XVVLDQ 19th century. Enamel minimally chipped, otherwise intact. 7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ0HWDOOLNRQHQRussland, 19. Jh. Vier Tetraptychonen mit Festtagen, ein Triptychon mit Deesis und zwei einzelne Flügel von Triptycha mit Gottesmutter und Hl. Johannes. %URQ]H UHOLH}HUW JHJRVVHQ WHLOZHLVH PHKUIDUELJ HPDLOOLHUW 7 6W©FN(PDLOPLQLPDOEHVWRgHQ u Provenienz: Aus einem Privatbesitz, Bayern.

 3UHVWLJH0HVVHU2PDQRGHU-HPHQ/FP(LVHQ+RO]6LO ber. Krummdolch Jambia (Jamya) mit eiserner gebogener Klin ge und hölzernem, bemaltem und mit Silber belegten und mit gepunzter Manschette versehenem Griff; Scheide aus Silber blech, zum größten Teil auf der Vorderseite mit gepunzten Or namenten geschmückt und mit einer Halterung zum Tragen am Gürtel versehen; Rückseite der Scheide mit rotem Samt bezo gen. Intakt, Roststellen an der Spitze des Dolches. 300,– Provenienz: Ex Sammlung F. X. M., Oberbayern, 1930er bis 1940er Jahre. Oman or Jemen prestige knife Jambia (Jambya) with curved iron blade and wooden handle painted black, partly covered with punched silver sheet; the sheath on the front side almost completely covered with punched silver sheet, the rear side covered with red velvet; elaborate device for fastening the knife on the belt; some rust on tip of knife. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Biçak. Osmanisch, 19. Jh. L 51cm. Bronze, Leder, Bein und Koralle. Gebrauchsspuren. 200,– Provenienz: Aus der Sammlung R. K., Hessen, erworben vor 1980. Ottoman Biçak. 19th century A.D. Bronze, leather, bone and coral. Traces of use. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Collection of brass icons incl. four quadriptych showing the main feasts of the Orthodox Church, a triptych with Deisis, and two parts from triptycha with Mary and John. Russian, 19th century. Enamelled in blue, light blue, white, yellow and green. Enamel minimal chipped or damaged. 7pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

265


680 6DPPOXQJLVODPLVFKHU%URQ]HJHJHQVW”QGHa) Gerippter Mörser, RVPDQLVFK-K+FPE .OHLQHUNXJHOLJHU0¤VHU+ 5,8cm. d) Kalligraphieset „Hakka“ bestehend aus einer langen 6FKDWXOOH  GDUDXI NOHLQH 3XQ]H  I©U GLH )HGHUQ XQG NOHLQHP 7LQWHQIDVV/FP-KG 'UHLRVPDQLVFKH6FKHLEHQ JHZLFKWHPLW3XQ]HQFP-K6W©FN Alle mit dunkler Patina. 400,– 3URYHQLHQ]([*RUQ\ 0RVFK0©QFKHQ$XNWLRQ/RVH[ 6DPPOXQJ.*5KHLQODQGHUZRUEHQLPGHXWVFKHQ.XQVWKDQGHOHU Jahre bis 2003. &ROOHFWLRQRI,VODPLFEURQ]HREMHFWVD %URQ]HPRUWDU+LVSDQLDWKWK century A.D. b) Small spherical bronze mortar. c) „Hakka“ (calligraphy SHQ KROGHU ZLWK LQN ER[  ZLWK SXQFK WK  WK FHQWXU\ $' G  7KUHH 2WWRPDQWUDGHZHLJKWVWZRZLWKSXQFKHVWKWKFHQWXU\$'$OOZLWK dark patina. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

681 Konvolut islamischer Stempel. a) Stempel aus Holz (L 39,5cm), grau und weißlich bemalt mit arabischer Schrift. b) Dazu sieben schöne arabische Siegel des 19. Jhs. aus Messing. H 1,8 bis 3,1cm. 6W©FN Intakt. 150,– Provenienz: Ex Sammlung F. X. M., Oberbayern. Lot of Islamic seals incl. a wooden stamp with arabic writing and seven nice Arabic seals from the 19th century made of brass. 8 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

682 Eisenvotiv. 1LHGHUED\HUQ 3HUND EHL .HOKHLP    -K + 10cm. Stilisierte, menschliche Figur mit Armen vor dem Kör per. Inv. 839. Winzige Fragmente fehlen. 680,– 3URYHQLHQ]([3ULYDWVDPPOXQJ.)6FK”GOHU0©QFKHQ ,URQYRWLYHLQVKDSHRIDKXPDQ}JXUHZLWKUDLVHGDUPV/RZHU%DYDULDWK WKFHQWXU\7LQ\IUDJPHQWVPLVVLQJ VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

683 Eisenvotive. 1LHGHUED\HUQ3HUNDEHL.HOKHLP-KD + FP0HQVFKOLFKH)LJXU,QY*HUHLQLJWHLQ8QWHUVFKHQ NHO IHKOW E  + FP +DQG ,QY 3  (WZDV NRUURGLHUW 2 6W©FN0LW6RFNHOQ u

684 Sammlung Eisenvotive in Form von stilisierten Tieren. Nieder ED\HUQ $LJHQ DP ,QQ    -K D  / FP ,QY  E  L 12cm. Inv. 4303. 6W©FN0LW6RFNHOQ Teilweise korrodiert, winzige Fragmente fehlen. 650,– 3URYHQLHQ]([3ULYDWVDPPOXQJ.)6FK”GOHU0©QFKHQ ,URQYRWLYHVLQVKDSHRIVW\OL]HGDQLPDOV/RZHU%DYDULDWKWKFHQWXU\ Partially corroded, tiny fragments missing. 2 pieces! All with stands! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

685 Sammlung Eisenvotive in Form von stilisierten Tieren. Nieder ED\HUQ$LJHQDP,QQ-KD /FP,QYE / 15cm. Inv. 3866. c) L 13,5cm. Inv. 4319. 6W©FN0LW6RFNHOQ 7HLOZHLVHNRUURGLHUWZLQ]LJH)UDJPHQWHIHKOHQ u 3URYHQLHQ]([3ULYDWVDPPOXQJ.)6FK”GOHU0©QFKHQ 'HU.XOWGHU(LVHQYRWLYHVWDPPWDXVGHU=HLWGHV-DKUKXQGHUWVLQ Niederbayern. Katholische Christen in Bayern und auch Österreich opferten dem Heiligen Leonhard, der für Krieg und Eisen steht und der Schutzpatron der Kraftfahrer, Schmiede und Soldaten ist. Darüber hinaus gilt er als Schutzpatron GHU7LHUHDEHUDXFKDOV.UDQNKHLWVKHOIHU)LQGHXQG)HXHUSDWURQ'HU.XOW eiserner Votive geht nach heutigem Forschungsstand auf vorchristliche Zeiten ]XU©FN'DPLWZXUGHGHUEHUHLWVYRONVW©POLFKH%UDXFKYRP/HRQKDUG.XOW DGDSWLHUW(VJLEW]ZHLJURgH*HELHWHGHU9HUEUHLWXQJXQGGHUVSH]L}VFKHQ )RUPHQDXVELOGXQJGHU(LVHQYRWLYHGHQED\HULVFKVFKZ”ELVFKHQ5DXPI©U den die hier angebotenen Stücke aus der Sammlung Schaedler stehen sowie Gebiete in Kärnten und der Steiermark. Von den Formen her gibt es sowohl 7LHUHDOVDXFKPHQVFKOLFKH)LJXUHQGLH”OWHUDOVGLH7LHU}JXUHQVLQG$OV Datierungskriterium dient auch die Herstellungstechnik aus einem Stück. Der %UDXFKLVWELVLQVVS”WH-DKUKXQGHUWLQHLQLJHQ*HJHQGHQDXFKQRFK VS”WHUQDFKZHLVEDU'LH.LUFKHQYHUPLHWHWHQGLHHLQJHVDPPHOWHQ9RWLYJDEHQ an die Bittsteller und sicherten sich so ein zusätzliches Einkommen. Der Adorant ging mit dem Votiv zum Bittgang und gab es danach wieder dem MHZHLOLJHQ3ULHVWHU]XU©FN9JO.)6FKDHGOHU.XOW0DJLHXQG5HOLJLRQ 9HUVXFKHLQHU$QDO\VH  6 ,URQYRWLYHVLQVKDSHRIVW\OL]HGDQLPDOV/RZHU%DYDULDWKWKFHQWXU\ Partially corroded, tiny fragments missing. 3 pieces! All with stands! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

686 3DDU0DUPRUN¤SIHca. 19. Jh. n. Chr. Die als Appliken geferti gen Köpfe zeigen ein frontales Gesicht mit Mittelscheitelfrisur, Diadem und orientalischem Kinntuch. In der Stirn jeweils ein Rest von einem Metallstift. Kleine Absplitterungen. 150,– Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs.

3URYHQLHQ]([3ULYDWVDPPOXQJ.)6FK”GOHU0©QFKHQ

Pair of marble appliques in form of heads in oriental style. About 19th century A.D. Little fragments are missing.

,URQYRWLYHVLQVKDSHRIDVW\OL]HGKXPDQ}JXUHDQGDKDQG/RZHU%DYDULD WKWKFHQWXU\7KHKXPDQ}JXUHFOHDQHGWKHKDQGSDUWLDOO\FRUURGHG 2 pieces! With stands!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

266


 6DPPOXQJYRQ$QWLNHQ-KY&KU-KQ&KU'DUXQWHU eine sehr schöne Gemme aus Jaspis mit Darstellung des Sol Ø 13mm (gerahmt), ein Terrakottakopf des Harpokrates (H FP HLQHU¤PLVFKH$GOHU}JXUDXV%URQ]H +FP ]ZHLU¤ PLVFKH.QLH}EHOQHLQEURQ]HQHU.”QQFKHQJULIILQ)RUPHLQHV Ziegenkopfes mit den Hörnern als Henkel (H 6cm), ein durch brochener Riemenbeschlag mit Pelten (L 4,3cm) und eine große 2PHJD}EHO PLW YHJHWDELOHP 'HNRU / FP   6W©FN Meist intakt. 300,–

690 6DPPOXQJ VWHLQ]HLWOLFKHU JULHFKLVFKHU XQG U¤PLVFKHU 2EMHN te. Darunter ein Steinbeil aus der jüngeren Steinzeit, gefunden LP (OVDVV / FP  HLQH JULHFKLVFKH .RW\OH DXV .RULQWK  Jh. v. Chr. (H 5cm), zwei schöne römische Glasteller (Ø 8,3 XQGFP JHIXQGHQLQ.¤OQVRZLHHLQU¤PLVFKHU3KDO lusanhänger aus Bronze (B 6,3cm). Dazu noch ein Stilett mit 'UHLNDQWNOLQJHDXV(LVHQ0HVVLQJXQG%HLQLQU¤KUHQI¤UPLJHU 6FKHLGHFD-KQ&KU /FP 6W©FN Wenige Stücke mit Fehlstellen. 250,–

Provenienz: Aus dem Nachlass der bayrischen Sammlung K. H., in Deutschland seit vor 1990.

Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs.

Small collection of antiquities comprising a green jasper gem depicting Sol, a KHOOHQLVWLFWHUUDFRWWDKHDGRI+DUSRFUDWHVWZRURPDQEURQ]H}EXODHDKDQGOH LQIRUPRIDJRDWVKHDGDQGDURPDQ2PHJD)LEXODUGFHQWXU\%&UG century A.D. Mostly intact. 8 pieces!

Collection of Stone Age, Greek and Roman objects. Enclosed a Neolithic stone axe, found in Alsace, a Greek kotyle from Corinth, 5th century B.C., two nice Roman glass plates, found 1904 in Cologne, as well as a Roman bronze pendant shaped as a double phallos. Plus a stiletto with triangular blade with tubular sheath made of iron, brass and bone, about 19th century A.D. Few pieces with missing parts. 25 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

688 Sammlung antiker Kleinkunst. Darunter kleines blaues Glasun guentarium der römischen Kaiserzeit (H 4,3cm), phönizische und römische Perlen aus buntem Glas und wahrscheinlich hel lenistische Kettenglieder in Form von Amphoren aus Bronze. FD6W©FN 300,– Provenienz: Ex Sammlung G. Hauck, Süddeutschland, 2002 erworben aus einer deutschen Altsammlung des 19. und frühen 20. Jhs. Collection of Ancient minor art objects incl. a Roman unguentarium made of blue glass, Phoenician and Roman beads made of different colored glass, and several probably Hellenistic pendants in form of amphoras made of bronze. About 20 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

689 Kleine Sammlung antiker und mittelalterlicher Objekte. Darunter zwei neolithische Messerfragmente aus Stein (L 3,4 und 4,8cm), ein geometrischer Anhänger mit Pferdchen aus Bronze (H FP HLQVRJHWUXVNLVFKHU*HQXFLOOD7HOOHUDXVGHP-KY &KU kFP VRZLHGLH+”OIWHHLQHVPLWWHOE\]DQWLQLVFKHQ(Q kolpions mit gravierter Mariendarstellung (H 8,4cm). 6W©FN 250,–

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

691 6DPPOXQJ YRQ $QWLNHQ XQG $QWLNLVLHUHQGHP Darunter ein gie belförmiges Stempelsiegel mit einem Hirsch, 3. Jt. v. Chr., (L FP HLQU¤PLVFKHV6WDWXHQIUDJPHQW .LQGHUIXg/FP HLQ sehr schönes Alabastergefäß (H 5cm), zwei Schleuderbleie, zwei 0LQLDWXUVFK”OFKHQXQGGLYHUVH*ODV7HUUDNRWWDXQG6LOEHUSHU len verschiedener Zeitstellung (zum Teil wikingisch?). Außer dem drei antikisierende Model aus Terracotta, wohl 19. Jh., mit verschieden Motiven (jagende Diana, Hirsch, zwei Voluten, L 22,5, 14 und 9,5cm). 6W©FN 350,– Provenienz: Ex Sammlung Dr. Eberhard Schenk zu Schweinsberg (gest.  HUZRUEHQFD Collection of antiquities and „after the antique“ comprising an early near eastern stone seal with a deer (3rd millennium B.C.), a roman marble fragment (foot of a child), a very nice miniature ovoid alabaster vessel, two sling bullets (one with inscription), and several glass, terracotta and silver beads (some probably viking?). Also comrising three terracotta moulds with antique motifs (probably 19th century). 23 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Ex Sammlung M. B., Hessen, seit vor 1970. Interesting Collection of ancient and medieval objects incl. of two fragments of 1HROLWKLFVWRQHEODGHVD*HRPHWULFEURQ]HSHQGDQWZLWKKRUVHDQ(WUXVFDQ UHG}JXUH SODWH RI WKH VRFDOOHG *HQXFLOOD W\SH DQG WKH KDOI RI D 0LGGOH Byzantine enkolpion with engraved St. Mary. 26 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

267


692 6DPPOXQJ©EHUZLHJHQGDQWLNHU2EMHNWH12 Keramikgefäße, dar XQWHUHLQ'UHLIXgWRSIGHU<RUWDQ.XOWXU +FP HLQJURgHU messapischer Lebes Gamikos des 4. Jhs. v. Chr. mit Tropfende kor (H 22,6cm, Deckel und ein Henkel fehlen) und weitere vor derasiatische, römische, byzantinische und islamische Schalen, 7¤SIH XQG )ODVFKHQ 9LHU }J©UOLFKH JULHFKLVFKH XQG U¤PLVFKH Terrakotten, dabei ein Kopf mit ergänztem Körper. Zwei römi sche Tonlampen, eine mit Adler (L 10,9cm), eine mit Rosette (L FP 'D]XHLQHLVODPLVFKH%URQ]H~DVFKH +FP XQGHLQ restauriertes Noppenglas, ca. 15. Jh. n. Chr., mit Fehlstellen (H 11,6cm). 6W©FN Wenige Stücke mit Fehlstellen oder restau riert, mehrheitlich intakt. 550,– 3URYHQLHQ]$XVGHP1DFKODVV0%LQ'HXWVFKODQGVHLWYRU Collection of mostly ancient objects. 12 ceramic vessels incl. a tripodal pot of the Yortan culture, a large Messapian lebes gamikos ot the 4th century B.C. (lid and one handle are missing) and several bowls, pots and bottles of Western Asiatic, Roman, Byzantine and Islamic Period. Four Greek and 5RPDQWHUUDFRWWD}JXULQHVWKHUHE\DZRPDQKHDGZLWKPRGHUQFRUSXV7ZR Roman clay lamps. Plus a Islamic bronze bottle and a restored glass with knobs, about 15th century A.D. 20 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

693 .HOFKGHUDQWLNHQWKDLO”QGLVFKHQ%DQ&KLDQJ.XOWXUH 19,8cm. 5HGRQEXII:DUH.OHLQH$EVSOLWWHUXQJDP)XgVRQVWLQWDNW 150,– Provenienz: Ehemals in der deutschen Privatsammlung E., erworben in den 1980er Jahren auf dem deutschen Kunstmarkt. *REOHWRIWKH5HGRQEXIIZDUH7KDLODQG$QFLHQW%DQ&KLDQJ&XOWXUH7LQ\ splinter of the foot is missing, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

694 7DNDPDNXUD .RSIVW©W]H -DSDQ XP  + FD FP % 22,5cm. Auf dem hölzernen, schwarz lackierten Ständer Dar stellungen von Kiefern und Kranichen (Symbol der ewigen Lie EH LQ0DNLH7HFKQLN0LWHLQHP)DGHQLVWGD]XHLQ.LVVHQDXV rotem Samt angebunden, das mit einer feiner Hülle vor Ver schmutzung geschützt wird. Kissen repariert und ergänzt, Fäden neu, Holzständer intakt. 600,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990. Takamakura headset of a geisha. Wooden, black laquered stand with GHSLFWLRQ RI SLQH WUHHV DQG FUDQHV LQ PDNLH WHFKQLTXH 7KH SLOORZ RI UHG velvet with a cover against pollution. Japan, around 1900. Pillow repaired and partially renewed, new threads, the stand intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

268

695 ,QWHUHVVDQWH6DPPOXQJ$VLDWLFDa) B 16cm. Kleines Schieferfrag PHQWHLQHV6WXSD5HOLHIVPLWHLQHU6”XOHXQGHLQHU0”QQHU}JXU DXIHLQHP%DONRQw*DQGKDUD-KQ&KU0LWK¤O]HUQHP 6RFNHO JXWH (UKDOWXQJ E  + RKQH 6W”QGHU    FP 9LHU %XGGKD.¤SIHXQGHLQH%©VWHDXV%URQ]HWHLOZHLVHPLW5HVWHQ der Vergoldung. Dazu zwei Hände des Buddha. Thailand, Suk KRWKDL-K(LQLJH)HKOIUDJPHQWHVRQVWJXWHUKDOWHQF  .RSIGHV%XGGKDDXV(LVHQ +FP XQG%URQ]H}JXULQHHLQHU Dakini (H 14,5cm). Wohl Indien. Kopf: kleine Fehlstellen an GHQ2KUHQXQG+LQWHUNRSI)LJXULQHLQWDNWG (LQH-DGH)LJX rine des Buddha in einer Schachtel (H 10cm) und ein Stempel aus Bronze mit Longgui. China, 20. Jh. Intakt. e) Neun Anhän ger mit Buddha und anderen Gottheiten aud unterschiedlichen Materialien, ein Ansatz mit Kirtimukha, sechs kleine Figurinen. Indien, China, Tibet, meist 20. Jh. Dazu eine neuzeitliche Applik mit Kopf des Hermes. 6W©FN 1.000,– Provenienz: Nachlass aus bayerischer Sammlung K. H.; in Deutschland seit vor 1990. Interesting collection of Asiatica. a) Small grey schist fragment of a stupa relief with a worshipper in a „balcony“. Gandhara, 4th/5th century. With a wooden stand. b) Four Buddha heads and one bust of bronze, partially with rests of gilding; in addition two Buddha hands. Thailand, Sukhotai, 18th/19th century. Some missing fragments, mostly well preserved. c) Head of Buddha RI,URQDQGDEURQ]H}JXULQHRID'DNLQL3UREDEO\,QGLD+HDGZLWKVPDOO GDPDJHVG $MDGH}JXULQHRI%XGGKDDQGDEURQ]HVWDPSZLWK/RQJJXL China, 20th century. Intact. e) Nine pendants with deities of diff. materials, DQDWWDFKPHQWZLWK.LUWLPXNKDDQGVL[VPDOO}JXULQHV,QGLD&KLQD7LEHW mostly 20th century. In addition an attachment with Hermes head, probably 18th century. 29 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

696 Kleine Sammlung Köpfe. +RKQH6W”QGHUFP9LHU%XG dha Köpfe und eine Büste aus Bronze. Thailand, Sukhothai und $\XWWKD\D    -K )UDJPHQWH HLQ 6W©FN PLW 5HVWHQ GHU Vergoldung und Bemalung. Dazu ein römisches Terrakotta N¤SIFKHQ-KQ&KUDP+DOVJHNOHEW6W©FN 500,– Provenienz: Nachlass aus bayerischer Sammlung K. H.; in Deutschland seit vor 1990. Four Buddha heads and one bust of bronze; fragments, one with rests of JLOGLQJ7KDLODQG6XNKRWDLDQG$\XWWKD\DWKWKFHQWXU\,QDGGLWLRQ DURPDQWHUUDFRWWDIHPDOHKHDGQGUGFHQWXU\$'UHDWWDFKPHQWDWWKH neck. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


 $VLDWLFD GHU 6DPPOXQJ %HUQKDUG :LFNL D  $QWLNHU *DQGKDUD Kopf aus Stuck. Fragment, H 9,4cm. b) Kleiner thailändischer Buddhakopf aus Bronze. Fragment, H 9cm. c) Thronender Bud GKDDXV%URQ]H7LEHW-K+FPG .OHLQHUFKLQHVL scher Bronzevogel mit quadratischer Öffnung, wohl ein Aufsatz I©UHLQHQ*HKVWRFN/FPH .OHLQHUFKLQHVLVFKHU%URQ]HYR gel. L 4,4cm. f) Großes chinesisches Siegel aus Speckstein. H FPJ 6WHLQPRGHOPLW2UQDPHQWHQ,QGLHQ " [FP Dazu h) ein präkolumbischer Spinnwirtel aus grauem Stein mit VFK¤QHP5LW]GHNRU&KLP¦FDQ&KUkFP Kleine Absplitterungen. 6W©FN 120,–

699 Interessante Sammlung Steinamulette im archaischen Stil. Chi na, wohl 19. Jh. und früher. Hauptsächlich Jade, Achat und 1HSKULWD /FP6HFKV]HKQJHVFKQLW]WH$PXOHWWHLQ Form von Zikaden und anderen Fliegen, sowie eines mit dop SHOWHQ)OLHJHQE /FP)©QI6W©FNLQ)RUPYRQ0DGHQ XQG HLQHP 7DXVHQGI©gOHU F  /   FP 'UHL 'UDFKHQ XQG eine Fledermaus. 6W©FN Intakt, zusammen mit einem feinem Aufbewahrungskasten aus Holz. 600,–

Provenienz: Ex Gorny & Mosch, München Auktion 275, 2020, Los 809; aus der Sammlung von Bernhard Wicki. In Deutschland seit vor 1977.

Interesting collection of amulets in archaic style. Mainly jade, agate and QHSKULWH6L[WHHQLQIRUPRIFLFDGDVDQGRWKHU~LHVDVZHOODVRQHZLWKWZR ~LHV}YHLQIRUPRIPDJJRWVDQGDFHQWLSHGHWKUHHGUDJRQVDQGDEDW&KLQD SUREDEO\WKFHQWXU\DQGHDUOLHU,QWDFWZLWKD}QHZRRGHQVWRUDJHFDVH 26 pieces!

Asiatica from the Collection Bernhard Wicki. a) Ancient stucco head, Gandhara. Fragment. b) Small Thai bronze head of buddha. Fragment. c) Small enthroned bronze buddha from Tibet. d) Little Chinese bronze bird, SUREDEO\WKH}QDORIFDQHH /LWWOH&KLQHVHEURQ]HELUGZLWKWKUHHIHDWKHUV on the head. f) Large Chinese seal made of soapstone. g) Stone model with RUQDPHQWVSUREDEO\,QGLD3OXVK D3UH&ROXQELDQVSLQGOHZKRUOPDGHRI JUH\SROLVKHGVWRQHZLWKHQJUDYHGGHFRU&KLP¦DERXW%&/LWWOH splinters below are missing. 8 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

698 Schöne Sammlung Tibetica. 7LEHW   IU©KHV  -K D  / FP(LQIHLQHU)UDXHQJ©UWHODXV/HGHUXQGSXUSXUIDUELJHP Textil, mit einer Schnalle aus Silber. Dekoriert mit neun klei neren und größeren geschnitzten Plaketten aus Bein mit Blu PHQXQG5DQNHQ(WZDDEJHWUDJHQVRQVWLQWDNWE /FP(LQ +RUQDXVPHQVFKOLFKHQ2EHUVFKHQNHONQRFKHQ UNDQJOLQ YHU ziert mit Silber und Korallen und mit Lederhülle von einer Sei WH(LQH1DKWEHLP/HGHUWHLOEHVFK”GLJWVRQVWLQWDNWF /FP (LQH*HEHWVP©KOHDXV.XSIHUXQG6LOEHUPLWK¤O]HUQHP*ULII facettiertes Schwunggewicht auf einer Lederkordel; Deckel mit Pinienkernknauf. Manuskript mit dem Gebet im Inneren gut er KDOWHQG /FDFP5RVHQNUDQ]PLW3HUOHQDXV+RO]VRZLH Korallen, Muschel und Stein. Intakt. 6W©FN 600,– Provenienz: Ex Sammlung E. P., in Deutschland seit 1985. Beautiful Collection of Tibetica. a) Female belt of leather and purple textile, with silver buckle, decorated with ornamental bone plaquettes. b) Trumpet of human thigh bone with leather cover and silver mount with coral stones. One seam of the leather piece damaged. c) Prayer mill of copper and silver with a wooden handle, lid with a pinecone. Manuscript with a prayer within. d) 5RVDU\RIZRRGHQDVZHOODVFRUDOVKHOODQGVWRQHEHDGV7LEHWWKHDUO\ 20th century. Mostly intact, with traces of wear. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Nachlass aus bayerischer Sammlung K. H., davor Sammlung eines Münchner Arztes, in Deutschland seit vor 1990.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6HOWHQH5LWXDOSODNHWWHPLW6UL9LVKQX3DGDPIndien. 11,5 x 9cm. Heller Stein. Rechteckige Plakette mit Ausguss; dargestellt ist der Abdruck der Füße des Gottes Vishnu auf dem Lotusblumensitz umgeben von vier Symbolen. Während des Rituals wurden auf die Darstellung „reine Substanzen“ wie Milch, Honig und Öl DXVJHJRVVHQ.OHLQH)HKOVWHOOHQ2EHU~”FKHHWZDVJHJO”WWHW 400,– Provenienz: Ex Gorny & Mosch, München Auktion 275, 2020, Los 808; ex 6DPPOXQJ.*5KHLQODQGHUZRUEHQLPGHXWVFKHQ.XQVWKDQGHOHU Jahre bis 2003. Rare ritual stone plaquette with Sri Vishnu Padam. India. Light chipping, slightly rubbed surface. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6LW]HQGHU0DQQ1D\DULWYQ&KU+FP5¤WOLFKHU Ton. Sitzende männliche Figur mit helmartiger Kopfbedeckung, die Arme auf die Oberschenkel aufgestützt. Im Gesicht, am Hals und rechten Knie restauriert, Brandspuren am linken Arm und Bein. 150,– Provenienz: Ex Sammlung W. G., Bayern; ex Gorny & Mosch, München $XNWLRQ/RVHEHQGD$XNWLRQ/RVDXVDOWHU Süddeutscher Sammlung A. S.; ex Sammlung Himmelein, Frankfurt a.M. In Deutschland seit vor 2010. 1D\DULWVHDWHG}JXUH&OD\GHHSUHGGLVKEURZQ+HZHDUVDFORVH}WWLQJFDS KLVKDQGVUHVWLQJRQWKHWKLJKV%&$'5HVWRUHGDWQHFNDUHD and legs, burn marks at right side. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

269


 6LW]HQGHU0DQQPLW*HZDQG0RFKHPLWWOHUH3HULRGHFD Q&KU+FP5¤WOLFKHU7RQPLW%HPDOXQJLQ%HLJHXQG Dunkelbraun. Steigbügelgefäß in Form eines sitzenden Mannes der mit beiden Händen ein Gewand hochhält. Das Gewand zeigt ein abstrahiertes Bild des obersten Gottes in der Maske. 8QWHQXQGLQGHQ(FNHQ}QGHQVLFKGLH6\PEROH0”DQGHUXQG Stufensymbol. Der Mann trägt eine Haube, die im Nacken lang ausläuft. Seltene Darstellung! 400,– Provenienz: Privatsammlung U. C., gekauft von Bertrand de Parseval, Frankreich, um 1995, seitdem in Deutschland.

 Drei praekolumbische Schalen. a) H 9,5cm, Ø 14,5cm. Ton PLW U¤WOLFKHP EHU]XJ XQG VFKZDU]HU %HPDOXQJ PLW .UHLVHQ Kringeln und Strichen sowie stilisierten Köpfen. Restaurierter 6SUXQJLQ*HI”gZDQGXQG%RGHQDP5DQGNOHLQH(UJ”Q]XQJ 0D\DQ&KUE kFP+FP7RQPLWU¤WOL FKHPEHU]XJXQG%HPDOXQJLQ6FKZDU]XQG5RW'LFNZDQGL ge Schale mit stark abstrahiertem Fabelwesen dekoriert. Sprung in der Wand, kleine Restaurierung am Rand; Frühklassik, ca.    Q &KU F  k FP + FD FP *UDXHU 7RQ PLW VFKZDU]HPEHU]XJ7ULQNVFKDOHLQ)RUPHLQHVKDOEH.©UELV VHV&KLP¦Q&KU6W©FN 450,–

Mochica stirrup clay vessel in form of a seated man holding holding up a cloth with both hands. On the robe there is the representation of the supreme JRGZLWKPDVN0LGGOH3HULRGFD$'*OXHGEUHDNRQKDQGOH otherwise intact.

Provenienz: Ex Sammlung E. P., Bergisches Land. Sammlungszeitraum HU-DKUHGDQDFKZHLWHUKLQLQ)DPLOLHQEHVLW],Q'HXWVFKODQGVHLW vor 1980.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Three Precolumbian bowls: a) Maya, restored crack in the wall. ca. A.D. E 0DVVLYHFOD\PLQRUFUDFNDQGUHVWRUHGDWULP0D\D(DUO\ 3HULRGFD$'F %ODFNZDUHGULQNLQJERZOLQWKHVKDSHRID KDOYHGSXPSNLQLQWDFW&KLP¦FD$'3 pieces!

 +RFNHQGHU0DQQ4XLPED\DFDQ&KU+FP Rötlicher Ton mit Resten schwarzer Bemalung. Massive Figur eines sitzenden Mannes in reduzierter, rechteckiger Grundform, die Hände sind auf die Knie gelegt; nur die vorspringende Nase in dem quadratischen Kopf und das Geschlecht sind ausmodel liert; die Augen und der Mund sind durch horizontale Ritzlinien angegeben. Das Kopfteil ist oben siebenfach durchbohrt, wobei die zwei äußeren Bohrungen die Ohren mit zwei Ringen aus Kupfer bilden. Durch die Nase ist ebenfalls ein Kupferring ge ]RJHQ2EHU~”FKHVWDUNDEJHULHEHQVRQVWLQWDNW u Provenienz: Ex Sammlung A. R. W., Berlin. 4XLPED\DVHDWHG}JXUHZLWKORQJOHJVDQGKDQGVSODFHGDWWKHNQHHVWKH broad face with a hooked nose, pierced by a copper nosering; the square head is also decorated with two copper earrings at each side. Faint remains RIEODFNSDLQWLQJ&LUFD$'6XUIDFHZRUQRIIIRUWKHPRVW part, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =RRPRUSKHV *HI”g &KLP¦    Q &KU / FP 6FKZDU] JHVFKPDXFKWHU 7RQ (LI¤UPLJHV *HI”g PLW KRKHP Ausguss, vorne in einen menschlichen Kopf mit Raubkatzen zügen auslaufend, zwei anmodellierte Arme und Beine, hinten DXIJHUROOWHU5DXENDW]HQVFKZDQ]2EHU~”FKHHWZDVEHULHEHQLQ takt. 400,– Provenienz: Ex Sammlung E. K., Franken, ca. 1998 auf der Numismata München erworben. Ovoid zoomorphic vessel with high spout and a feline predator‘s head with KXPDQIHDWXUHVPRGHOHGRQ&KLP¦DERXW$',QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ NOHLQHQ 0D\D XQG D]WHNLVFKHQ 2EMHNWHQ a) Ø 13,5cm, H 8,5cm. Ton mit Bemalung in Schwarz und Rot auf hellbraunem Grund. Rasselschale auf drei kugeligen Standfü ßen, die mit Gesichtern bemalt sind; der übrige Dekor besteht aus von Bändern unterbrochenen Scheinglyphen. Intakt; Maya, FD    Q &KU E  k FP + FP .OHLQH GUHLEHLQLJH Räucherschale aus grünem, schwarz geäderten Stein. An den Außenseiten skulpierte, stilisierte Totenköpfe. Intakt, innen 5©FNVW”QGH$]WHNLVFKFDQ&KUF /FP5RW gesprenkelter Basalt. Glyphe in Form eines liegenden Jaguars. 0D\DFDQ&KUG FP%U”XQOLFKHU-DGHLW5XQ der, horizontal durchbohrter Anhänger mit Darstellung einer 3\UDPLGH ~DQNLHUW YRQ *HVWLUQHQ GDU©EHU HLQH +RUL]RQWOLQLH ,QWDNW0D\DQ&KU6W©FN 400,– Provenienz: Ex Sammlung Dr. R. N. D., Norddeutschland, erworben aus der Privatsammlung eines Forschers zwischen den 1970er Jahren und 1985. In 'HXWVFKODQGVHLWPLQGHVWHQV Collection of small Mayan and Aztec objects: a) Polychrome Mayan tripod ERZOZLWKUDWWOHIXQFWLRQ,QWDFWFD$'E 6PDOO$]WHFLQFHQVH bowl made from green stone with sculpted sculls on the outer side. Leftovers LQVLGHLQWDFWFD$'F 0D\DQJO\SKLQWKHIRUPRIDFURXFKLQJ MDJXDU UHG PRWWOHG EDVDOW LQWDFW $'    G  0D\DQ SHQGDQW PDGHIURPOLJKWEURZQMDGHLWHGHSLFWLQJDS\UDPLGH~DQNHGE\VWDUVDQGD KRUL]RQWDOOLQHDERYHSLHUFLQJLQWDFWFD$'4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Fußschale. &DMDPDUFD Q¤UGOLFKH .©VWH    Q &KU + 9cm, 19,5cm. Rötlicher Ton mit feiner dunkelbrauner Bema OXQJLQ~RUDOHPXQGJHRPHWULVFKHQ'HNRUDQGHU$XgHQXQG Innenseite. Selten! Farbe etwas abgerieben, winziger Ausbruch am Rand, sonst intakt. 300,– Provenienz: Privatsammlung U. C., 1985 von Jürgen Tretter erworben, seitdem in Deutschland. %RZOZLWKVWDQGULQJIURPWKH&DMDPDUFDFXOWXUH$'0LQRU chip at rim, painting partly rubbed off, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

270


 Halbrunde Schale. 6S”W1DVFDFDQ&KU+FP kFP7RQPLWGXQNHOEUDXQHPEHU]XJXQG%HPDOXQJLQ Beige, Rotbraun und Schwarz, an der Außenwand ein halbrun des Feld mit einer Götterdarstellung, innen monochrom braun bemalt. Winziger Ausbruch am Rand, sonst sehr gut erhalten. 300,– Provenienz: Privatsammlung U. C., gekauft 1975, seitdem in Deutschland. Late Nasca semicicular bowl with dark brown slip, on the outside the UHSUHVHQWDWLRQRIDJRG$'2QO\RQHPLQLPDOFKLSDWWKHULP otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Kleine bemalte Schale. &DUFKLFDQ&KUkFP + FP 7RQ PLW EHLJHP EHU]XJ DXgHQ XQG KHOOEUDXQHU Grundierung innen. Im Innenbild Darstellung von vier großen menschlichen Figuren, dazwischen zwei übereinander liegen de Reihen von vierfüßigen Tieren (Lamas?). Am oberen Rand =LFN=DFN%DQGDOV$EVFKOXVV:LQ]LJH%HVWRgXQJDP”XgHUHQ Rand, sonst intakt. 400,– Provenienz: Ex Sammlung E. S., Schweiz, erworben 1979 von A. Geiser. Seit Anfang der 2000er Jahre in Privatbesitz Deutschland.

 .HUX%HFKHU Koloniale Zeit, nach 1532 n. Chr. H 14,2cm, Ø 13cm. Massives Holz mit Bemalung in Hellrot, Grün und Bei JH.RQLVFKHU%HFKHUPLW~DFKHP%RGHQLQGHUREHUHQ=RQH mit geometrischen Mustern und einer stilisierten Landschaft mit Häusern, Booten und Fischern auf dunkelbraunem Grund bemalt, in der unteren Zone Blüten. Abnutzungsspuren innen, großer Sprung in der Wand mit alter Flickung. 400,– Provenienz: Ex Sammlung E. K., Franken, seit circa 2005; davor Wiener Privatsammlung. :RRGHQ.HUXEHDNHUSDLQWHGLQOLJKWUHGJUHHQDQGEHLJHRQDGDUNEURZQ JURXQG$VFHQHZLWKVW\OL]HGKRXVHVDQG}VKHUPHQLVGHSLFWHGLQWKHXSSHU SDUWZKHUHDVWKHORZHUSDUWLVGHFRUDWHGE\~RUDOPRWLIV&RORQLDOWLPHVDIWHU 1532 A.D. Deep crack in the wall with ancient restoration, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL *HI”gH &KDQFD\ PLWWOHUH .©VWH    Q &KU D  H 10,5cm. Ton mit Bemalung in Beige und Dunkelbraun auf rostrotem Grund. Kugeliger Topf mit abgerundetem Boden und kleinem Standring, zwei Strickhenkeln und breitem, abgesetz WHQ5DQG,QWDNWE +FP0DWHULDOZLHD)ODVFKHQI¤UPLJH 0LQLDWXU.DQQH,QWDNW6W©FN6HOWHQHURWH&KDQFD\.HUDPLN 350,–

Small polychrome bowl, painted in orange, red and black. In the interior GHSLFWLRQRIIRXUKLJKO\VW\OL]HGKXPDQ}JXUHVVWDQGLQJDOWHUQDWLQJEHWZHHQ WZRURZVRITXDGUXSHGDQLPDOVRQHDERYHWKHRWKHU&DUFKLFD$' 1535. Tiny crack at outer rim, otherwise intact.

Provenienz: Sammlung U. C., seit 1983 in Deutschland.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Fußschale. &DUFKLFDQ&KU+FPkFP 7RQPLWHLQHPURWEUDXQHQEHU]XJXQG%HPDOXQJLQ6FKZDU] Fußschale, die aus zwei zusammengesetzten konischen Tei len besteht; außen mit geometrischen Mustern bemalt, wobei Dreiecke dominieren. Sinterspuren und kleine Sprünge in der oberen Schale, sonst intakt. 450,–

 9LHUNOHLQH1DVFD*HI”gH0LWWOHUH3KDVHFDQ&KU a) H ca. 12cm. Ton mit Bemalung in Beige, Brauntönen und Schwarz. Becher mit gerundetem Boden und einer Dekoration aus kleinen Vierfüßlern in vier abgetrennten Feldern. Intakt. b) +FP0DWHULDOZLHD.OHLQH6FKDOHGHNRULHUWPLWP\WKLVFKHP 0DVNHQZHVHQ F  + FP 0DWHULDO ZLH D .OHLQH 6FKDOH PLW der Darstellung von drei anthropomorphen mythischen Wesen. Boden aus mehreren Scherben zusammengesetzt. d) H 5,5cm. Material wie a. Kleine ovale Schale mit monochromer brauner Bemalung und Randverzierung in Form eines dekorativen Ban des. Intakt. 6W©FN 500,–

Provenienz: Ex Privatbesitz A. H., München. Aus süddeutscher Privatsammlung ca. 1980er Jahre. Bowl with conical base, reassembled from two conical parts and covered with DEURZQLVKUHGVOLS7KHH[WHULRULVGHFRUDWHGZLWKDEODFNSDLQWHGJHRPHWULF SDWWHUQPDGHXSPRVWO\RIWULDQJOHV&DUFKLFD$'7UDFHVRI sintering and small cracks inside the bowl, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Two vessels made of the rare red Chancay ceramic. Middle coast area, ca. $',QWDFW2 pieces!

Provenienz: Privatsammlung U. C., gekauft bei Herrn Kotalla in Haigerloch, um 1990 und von Leif Sjöberg, ehemaliger Sammler in Stockholm, um 2000, in seinem Besitz seit etwa 1985. )RXUVPDOO1D]FDSRO\FKURPHYHVVHOV0LGGOHSHULRGFD$'$OO in very good condition, only c) restored. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

271


 Sammlung von sechs feinen kleinen Schalen. Chancay, ca. 900 Q&KUD +FPkFP'©QQHU7RQPLW%HPD lung in Beige und Dunkelbraun. Halbovale Schale, dekoriert in nen und außen mit abwechselnd dunklen und hellen Feldern, an den Seiten zwei noppenförmige Tierköpfe als Handhabe. Intakt. b) H 8cm, Ø 10,3cm. Material wie a. Runde Schale, Dekorati RQDXgHQPLW=LFN]DFN0XVWHU%DQG7LHUNRSI1RSSHQ,QWDNW c) H 6,5cm, Ø 9,2cm. Material wie a. Dekoration mit Gitter PXVWHU)HOGDXgHQLQQHQPRQRFKURPEUDXQ7LHUNRSIQRSSHQ ,QWDNWG +FPkFP'UHLNOHLQH6FKDOHQ0D terial wie a, Bemalung mit dunkelbraunem Liniendekor. Alle intakt. 6HOWHQLQGLHVHU(UKDOWXQJ6W©FN 500,– Provenienz: Privatsammlung U. C., gekauft von Dr. Günther Hartmann, Berlin, um 1988. &ROOHFWLRQRIVL[H[WUHPHO\ZHOOSUHVHUYHG&KDQFD\ERZOVPDGHRI}QHWKLQ ZDOOHGFOD\SDLQWHGZLWKFUHDPDQGGDUNEURZQFD$' 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL/DPD*HI”gHa) L 13cm, H 10cm. Rötlicher Ton mit Spu ren von schwarzer Bemalung. Gefäß mit breitem Ausguss in )RUPHLQHV/DPD.RSIHVPLWJHEO”KWHQ1©VWHUQXQGDEVWHKHQ den Ohren. Farbe abgerieben, kleine Ausbrüche am Ausguss; ,QNDFDE /FDFP+FP.OHLQHV*HI”gLQ Form eines liegenden Lamas, auf dem Rücken Ausguss. Kleiner Ausbruch am Ausguss, sonst intakt, am Rücken zwei Durch ERKUXQJHQ&KLP¦Q&KU6W©FN 300,– 3URYHQLHQ]3ULYDWVDPPOXQJ8&©EHUQRPPHQYRQ-©UJHQ7UHWWHU bis 1980, danach in Deutschland. Two Lama vessels: a) Head of a Lama with distended nostrils, reddish clay ZLWKWUDFHVRIEODFNSDLQWLQJFKLSDWVSRXW,QFDFD$'E  Small rounded vessel in form of a resting Lama; minor chip at rim of spout, RWKHUZLVHLQWDFW&KLP¦$'2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL SUDHNROXPELVFKH *HI”gH PLW 5LSSHQGHNRU a) 12cm, Ø FP%DXFKLJHU7RSIDXV7RQPLWGXQNHOEUDXQHU(QJREHXQG 5LSSHQGHNRU GHU 5DQG DEJHVHW]W 2EHU~”FKH HWZDV EHULHEHQ minimale Bestoßungen am Rand, zwei kleine Sprünge in der Außenwand. Maya, nördliches Yucatan Gebiet, spätklassisch, FDQ&KUE FPkFP*HI”gDXVJUDXHP7RQ PLWVFKZDU]HPEHU]XJXQGHLQHP'HNRUDXVJOHLFKP”gLJDQ geordneten, horizontal verlaufenden Rillen. Kleinere Ausbrüche am Rand und Sprung in der Wandung, sonst intakt. Yucatan, VS”WNODVVLVFKH=HLWFDQ&KU6W©FN 300,– 3URYHQLHQ]([6DPPOXQJ(3%HUJKHLPHU-DKUHGDQDFKLP Familienbesitz. Bei Gorny & Mosch, München Auktion 275, 2020, Los 759. 7ZR 0D\DQ YHVVHOV IURP WKH /DWH &ODVVLF 3HULRG FD    $' D  Brownware bellied bowl with ribbed decoration in relief; minor chips at edge, otherwise intact. b) Blackware steep sided vessel decorated with horizontal grooves. Chip at rim and two cracks in the wall, otherwise good condition. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

272

 Schwimmender Kaiman aus Stein. Mittelamerika, praekolumbisch, FDQ&KU/FP*U©QEUDXQHU6WHLQ.OHLQHV2EMHNW in Form eines stilisiert gearbeiteten schwimmenden Kaimans, DQGHU8QWHUVHLWHUHOLH}HUWH$PSKLELH *ROGJHZLFKW" ,QWDNW 300,– Provenienz: Ex Sammlung E. S., Schweiz, erworben 1980. Seit Anfang der 2000er Jahre in Privatbesitz Deutschland. Precolumbian small stone object in the form of a swimming cayman. Possibly LWLVDJROGZHLJKWFD$',QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHLSUDHNROXPELVFKH6WHLQ”[WHa) H 11,3cm. Grauer, grünge sprenkelter Stein, poliert. Axtförmiger Stein, die Schneide scharf zugeschlagen. Gebrauchsspuren, intakt. b) H 9,1cm. Material wie a. Schneide etwas abgearbeitet, sonst intakt. 6W©FN 400,– Provenienz: Privatsammlung U. C., erworben von Jürgen Tretter, dort seit ca. 1970, seit 1990 in Deutschland. Solche Steinäxte wurden an Holzstielen montiert, die am oberen Ende gespalten waren und etwas dafür hergerichtet wurden. Die Befestigung erfolgte mit Schnüren. Two stone celts made from green and grey speckled stone. Traces of use, intact. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Drei Keulenköpfe. /DPED\HTXH FD    Q &KU D  k 15cm. Graugrüner Serpentin. Breiter, ringförmiger Keulenkopf. Gebrauchsspuren, intakt. b) Ø 10,6cm. Material wie a. Ovaler .HXOHQNRSI*HEUDXFKVVSXUHQLQWDNWF +FP0DWHULDOZLH a. Zylinderförmiger Keulenkopf, Gebrauchsspuren; intakt. 3 6W©FN 400,– Provenienz: Privatsammlung U. C., seit 1989 in Deutschland. 7KUHH&KDYLQULQJVKDSHGPDFHKHDGVPDGHIURPWKH&KDYLQFXOWXUH 400 B.C. Signs of use, intact. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Köpfe von kupfernen Handwaffen. ,QNDQ&KUD  Ø 12,2cm. Bronze. Sternförmiger Keulenaufsatz. Intakt. b) H 9cm. Bronzeaxt. An der Schneide Gebrauchsspuren, oben alte Öffnung zur Befestigung. 6W©FN 300,– Provenienz: Privatsammlung U. C., zwischen 1975 und 1985 erworben, seitdem in Deutschland. Two Inca metal weapons: a) Star shaped mace attachment; green patina, intact. b) Axe blade, strong traces of use on the cutting edge, otherwise intact DQGQLFHSDWLQD$'2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


 Sammlung von Tumis. /DPED\HTXH FD     Q &KU /FP.XSIHU6DPPOXQJYRQ7XPLVLQYHUVFKLHGHQHQ Größen.  6W©FN Schöne grüne Patina, teilweise mit Struktur, intakt. 400,– Provenienz: Privatsammlung U. C., von Jürgen Tretter erworben, seit 1975 in Deutscland. Collection of bronze Tumis in various sizes. Green Patina, partly with structure. /DPED\HTXH$',QWDFW7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ NOHLQHQ 9RWLY}JXUHQ DXV 6WHLQ Frühkoloniale =HLWQDFKQ&KUD /FP*U©QOLFKHU6WHLQSR OLHUW9LHUXQGH}QLHUEDUH7LHUHPLWYLHU%HLQHQ 6W©FN ,QWDNW E FP6FKZDU]HUXQGJUDXHUYXONDQLVFKHU6WHLQ6HH hund und zwei Robben auf einer Sandbank (2 Stück). Intakt. 6 6W©FN 300,– Provenienz: Privatsammlung U. C., vom Sammler 1975 und 1990 auf Reisen erworben, danach in Deutschland. 6WHLQ}J©UFKHQGLHVHU$UWZXUGHQDQ$FNHUU”QGHUQLQGLH(UGHJHJHEHQXP )UXFKWEDUNHLW]XHU~HKHQ

 )©QI.HWWHQ&KDQFD\Q&KU/FP.HWWHQ aus Scheibchen von hellem Muschelkalk und schwarzem Stein. 6W©FN Neu aufgezogen, intakt. 200,– Provenienz: Ex Sammlung E. S., Schweiz, 1970/80er Jahre. Seit Anfang der 2000er Jahre in Privatbesitz Deutschland. Five Precolumbian shell and black stone spacer bead necklaces. Chancay, ca. $',QWDFWUHWUDLQHG5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJNOHLQHU}J©UOLFKHU*HZDQGDSSOLNDWLRQHQVerschiede QHDOWDPHULNDQLVFKH.XOWXUHQFDQ&KU/ 1cm. Sammlung von kleinen Applikationen aus Silber, Perlmutt, Bronze, Knochen, bearbeiteten Tierzähnen und Muschelkalk in Form von Tieren wie Fledermäusen, Vögeln, Hunden oder Fi schen. 6W©FN Alle intakt. 400,– Provenienz: Privatsammlung U. C., vom Sammler zwischen 1973 und 2005 erworben, seitdem in Deutschland. Collection of assorted silver, copper, shell, bone and stone robe applications LQDQLPDOIRUPFD$'$OOLQYHU\JRRGFRQGLWLRQ44 pieces!

&ROOHFWLRQRIVL[VPDOO]RRPRUSKLFVWRQH}JXUHVLQIRUPRIIRXUOHJJHGDQLPDOV and seals or sealions. Early Colonial Period, after A.D. 1530. Intact. 6 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ 0LQLDWXU6FKPXFNHOHPHQWHQ 9HUVFKLHGHQH DOW DPHULNDQLVFKH.XOWXUHQFDQ&KU/FP Verschiedenartige Kettenglieder oder Gewandapplikationen aus 3HUOPXWW6SRQG\OXVXQGDQGHUHQ0XVFKHOQVRZLHXQWHUVFKLHG lichen Steinsorten. 6W©FN 300,–

 6DPPOXQJ YRQ 2KUS~¤FNHQ a) Ø 12,8cm. Holz und Vogelfe dern. Große Ohrspule in Form einer runden Holzscheibe, dar auf montiert aus Leder geschnittene Applikationen, mit dünnen, türkisfarbenen Vogelfedern beklebt. Hinten runde Aussparung ]XP $QEULQJHQ GHV 3~RFNHV )HGHUVFKPXFN ]XPHLVW DEJHULH ben, eine Applikation fehlt, sonst intakt. b) Ø 2,6cm. Leichtes %DOVD+RO] 2KUVSXOH DXI EHLGHQ 6HLWHQ PLW IHLQ JHVFKQLW]WHP 6FKDFKEUHWW0XVWHU YHU]LHUW DXI GHU HLQHQ 6HLWH %O©WHQIHOGHU DXIGHUDQGHUHQ6HHY¤JHO,QWDNW&KLPXFDQ&KU F  k FP 6LOEHU (LQ 3DDU VFKHLEHQI¤UPLJH 2KUVSXOHQ DXI der Vorderseite ziseliert mit der Darstellung zweier großer Vö JHO3~RFNYRQHLQHP6W©FNKLQWHQDEJHEURFKHQHLQH2KUVSXOH JHUHLQLJW6LQX6WLOFDQ&KUG kMHFP.XS IHU(LQ3DDU2KUVSXOHQDXIGHU9VGXUFKEURFKHQJHDUEHLWHWLQ einem Dekor aus geometrischen Mustern. Grüne Patina, etwas NRUURGLHUWHLQ6W©FNHWZDVEHVFK”GLJW&KLPXQ &KUH kMHFP+RO]XQG3HUOPXWW(LQ3DDU2KUS~¤FNHDXV +RO]DXIGHU9VPLW3HUOPXWWHLQODJHQYHU]LHUWGLH9¤JHOXQG6 2UQDPHQWHGDUVWHOOHQ&KDQFD\FDQ&KUSeltene 2EMHNWH6W©FN 400,– Provenienz: Privatsammlung U. C., vom Sammler auf verschiedenen Reisen zwischen 1975 und 1985 erworben, danach in Deutschland. Collection of Precolumbian earspools: a) Large wooden earspool with applications made from leather and bird feathers. One piece missing, otherwise ZHOOSUHVHUYHGE (DUVSRROPDGHIURP}QHO\FDUYHGOLJKW%DOVDZRRG,QWDFW &KLPX FD $'    F  3DLU RI VLOYHU HDUVSRROV FKLVVHOHG ZLWK GHSLFWLRQVRIELUGVRQHFOHDQHGPLQLPDOEUHDNRXWV6LQXVW\OH$' G 3DLURIFRSSHUHDUVSRROVZLWKRSHQZRUNGHVLJQJUHHQSDWLQDRQH VOLJKWO\GDPDJHGRWKHUZLVHJRRGFRQGLWLRQ&KLPXFD$' H 3DLURIZRRGHQHDUVSRROVZLWKPRWKHURISHDUOLQOD\VLQIRUPRIELUGVDQG 6VKDSHGRUQDPHQWV,QWDFW&KDQFD\$'8 pieces!

Provenienz: Privatsammlung U. C., auf zwischen 1973 und 2005 erworben, seitdem in Deutschland. Collection of assorted shell, bone and stone ornaments from different cultures. FD$'$OOLQYHU\JRRGFRQGLWLRQ65 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ 0LQLDWXU6WHLQREMHNWHQ 9HUVFKLHGHQH DOWDPH ULNDQLVFKH .XOWXUHQ FD    Q &KU /   FP 6DPPOXQJ NOHLQHU 6WHLQ XQG 7RQREMHNWH ZLH ULQJI¤UPLJH Webgewichte, Köpfe von Statuetten, Teile von Gefäßen oder Vogelstatuetten. 6W©FN$OOHVHKUJXWHUKDOWHQ 250,– Provenienz: Privatsammlung U. C., vom Sammler zwischen 1973 und 2005 erworben, seitdem in Deutschland. Assorted small pieces of metal, stone and clay, in form of animals (birds), KXPDQKHDGVRUZHDYLQJZHLJKWVFD$'$OOLQYHU\JRRG condition. 15 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

273


 6DPPOXQJYRQVLOEHUQHQXQGNXSIHUQHQ%DUW]XSIHUQXQG*HZDQG YHU]LHUXQJHQ ,QND RGHU NRORQLDO XP  Q &KU D  /   2,9cm. Silber, korrodiert. Drei Bartzupfer (3 Stück). b) L 3,9  FP .XSIHU JU©Q SDWLQLHUW 'UHL %DUW]XSIHU GDYRQ HLQHU rund (3 Stück). c) Ø 1,6cm. Runde Silberscheibchen zur Ge wandverzierung (35 Stück); intakt. 6W©FN 400,– Provenienz: Privatsammlung U. C.; seit 2000 in Deutschland. Collection of six tweezers made from silver and copper and small silver discs IRUJDUPHQWGHFRUDWLRQ,QFDRUSRVWFRORQLDODERXW$'$OOLQJRRG condition. 42 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6SRQG\OXV3HNWRUDO XQG 0XVFKHO Chavin, nördliche Küste, ca. Q&KUD /FP6SRQG\OXV0XVFKHODP$QVDW] durchbohrt und mit einem gewebten Band als Kette zu tragen. ,QWDNWE /FP+”OIWHHLQHUVHKUJXWHUKDOWHQHQ6SRQG\OXV Muschel. 6W©FN 200,– Provenienz: Privatsammlung U. C., erworben von einem Sammler 1995, seitdem in Deutschland 6SRQG\OXVVKHOOZLWKWKURXJKSXOOHGULEERQDQGDVSRQG\OXVVKHOO&KDYLQ 1RUWKHUQFRDVWFD$'2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Interessante Sammlung von verschiedenen Schmuckobjekten. &KDYLQ FD    Q &KU D  / FP =Z¤OI 3HUOPXWW $QK”QJHU LQ (QWHQ RGHU .DQLQFKHQIRUP FD FP KRFK  LQWDNW DXI HLQH 6FKQXU DXIJHI”GHOW E  / FP 6LHEHQ 3HUO PXWW$QK”QJHULQ6FKODQJHQRGHU.UHLVIRUP FDFPKRFK  GXUFKEURFKHQYRQNOHLQHQ6WHLQSHUOHQDQGHQ(QGHQ6SRQG\ OXV0XVFKHO6FKHLEFKHQLQWDNWDXIHLQH6FKQXUDXIJH]RJHQF  L 15,5cm. Kleine Kette oder Armband aus Perlmuttgliedern, 6SRQG\OXV0XVFKHO6FKHLEFKHQ XQG U¤KUHQI¤UPLJ JHVFKQLWWH nen blauen Steinen; intakt, auf Schnur aufgezogen. d) L 22cm. Armband aus Knochenperlen, auf eine alte Schnur aufgezogen. Intakt. d) L 16cm. Kleines Armband aus sehr dünnen Muschel SO”WWFKHQ,QWDNWH kFP'UHLLQGHU0LWWHGXUFKERKU WH ~DFKH 3HUOPXWWVFKHLEHQ *HZDQGDSSOLNDWLRQHQ  LQWDNW 6W©FN 400,– Provenienz: Privatsammlung U. C.; seit vor 1990 in Deutschland.

 'UHL 6SRQG\OXV.HWWHQ $OW$PHULND    Q &KU D  / FP (LQUHLKLJH .HWWH DXV YHUVFKLHGHQIDUEHQHQ 6SRQG\OXV .DON*OLHGHUQ LQ 6FKHLEFKHQ XQG 5¤KUHQIRUP ,QWDNW E  / FP =ZHLUHLKLJH .HWWH DXV 6SRQG\OXV.DON*OLHGHUQ LQ Scheibchenform. Intakt. c) L 90cm. Dreireihige Kette aus Spon G\OXV.DON*OLHGHUQ LQ 6FKHLEFKHQIRUP $OWH $XII”GHOXQJ Intakt. 6W©FN 300,– 3URYHQLHQ]3ULYDWVDPPOXQJ8&JHNDXIWHWZD]ZLVFKHQDXI verschiedenen Reisen, seitdem in Deutschland. Three spondylus spacer bead necklaces, two of them multistranded. Ca. A.D. $OOLQWDFW3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 9LHU6SRQG\OXV.HWWHQPLW$QK”QJHUQ$OW$PHULND Q&KUD /FP/DQJH.HWWHDXV6SRQG\OXV0XVFKHO6FKHLE FKHQ XQG EUHLWHQ 0XVFKHONDON3O”WWFKHQ DOV $QK”QJHU HLQH 6SLQQZLUWHO ,QWDNW E  / FP /DQJH .HWWH DXV 6SRQG\OXV 0XVFKHO6FKHLEFKHQDOV$QK”QJHUHLQHKHOOEUDXQH6WHLQNXJHO ,QWDNWF /FP/DQJH.HWWHDXV6SRQG\OXV0XVFKHO6FKHLE FKHQDOV$QK”QJHU0XVFKHONDONXQG*U©QVWHLQSHUOH,QWDNWG  /FP.HWWHDXV6SRQG\OXV0XVFKHO6FKHLEFKHQLPXQWHUHQ Teil mit viereckigen Plättchen aus Grünstein verziert. Intakt. 4 6W©FN Alle neu aufgezogen. 350,– 3URYHQLHQ]3ULYDWVDPPOXQJ8&JHNDXIWHWZD]ZLVFKHQDXI verschiedenen Reisen, seitdem in Deutschland. Collection of four spondylus spacer bead necklaces, one with a spindle whorl. &D$'$OOLQWDFWDQGQHZO\PRXQWHG4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 9LHUDOWDPHULNDQLVFKH.HWWHQFDQ&KUD /FP Kette aus sich verjüngenden kleinen Silberscheibchen mit drei dazwischengesetzten größeren Perlen. Intakt. b) L 66cm. Kette DXVZLQ]LJHQ7©UNLV6FKHLEFKHQPLWUXQGHPGXUFKERKUWHQ$Q hänger, intakt. c) L 42cm. Kette aus schwarzem Muschelkalk XQG6SRQG\OXV0XVFKHOLQWDNWG /FP.HWWHDXVU¤KUHQ förmigen Gliedern aus Kupfer und Scheibchen aus verschie denfarbenen Muscheln und Steinen, intakt.  6W©FN Alle neu aufgezogen, zum Teil mit neuen Verschlüssen. 400,– Provenienz: Privatsammlung U. C., vom Sammler erworben zwischen 1975 VHLWGHPLQ'HXWVFKODQG

6RPHGLIIHUHQWRUQDPHQWVPDGHIURPPRWKHURISHDUOERQHDQGVSRQG\OXV shells comprising a charming collection of small dugs and rabbits or snakes, DOVRWKUHHSHDUOEXWWRQVFD$'$OOLQYHU\JRRGFRQGLWLRQ 8 pieces!

)RXU QHFNODFHV PDGH IURP VLOYHU VKHOOOLPHVWRQH DQG WXUTXRLVH FD $' $OOLQYHU\JRRGFRQGLWLRQQHZO\PRXQWHGDQGSDUWO\}WWHGZLWK new fasteners. 4 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

274


 9HUVFKLHGHQH SUDHNROXPELVFKH .OHLQREMHNWH DXV +RO] XQG .QR chen. D /FP%LUQHQI¤UPLJHV.DONJHI”gDXVHLQHPS~DQ] OLFKHQ 6DPHQEHK”OWHU ,QWDNW +XDUL    Q &KU  E  / FP%FP)ODFKH+RO]VFKDOHDQHLQHP(QGHRIIHQ]XP Anreiben von Halluzinogenen. Gebrauchsspuren, intakt. c) L FP/DQJHU+RO]O¤IIHOPLWUXQGHU9HUWLHIXQJDQHLQHP(QGH ,QWDNW +XDUL    Q &KU G  / FP (LQH 3IHLIH XQG]ZHL1DVHQS~¤FNHDXV.QRFKHQPLWJHVFKQLW]WHPJHRPH WULVFKHQ0XVWHU6©GDPHULNDFDQ&KU6W©FN 400,–

 Sammlung von großen Gewandnadeln. ,QNDQ&KU a) L 29cm. Kupfer. Zwei große, dünne Gewandnadeln mit VFKHLEHQI¤UPLJHQ(QGHQ 6W©FN 3DWLQDLQWDNWE /FP .XSIHU =ZHL ODQJH *HZDQGQDGHOQ GHUHQ (QGHQ O¤IIHOI¤UPLJ auslaufen (2 Stück); Patina, intakt. c) L 22cm. Zwei lange Ge ZDQGQDGHOQGHUHQ(QGHQLQYDVHQI¤UPLJHQ.Q”XIHQDXVODXIHQ (2 Stück); Patina, intakt. 6W©FN 300,–

Provenienz: Privatsammlung U. C., von Klaus Baumann 1985 erworben.

&ROOHFWLRQRIORQJFRSSHUUREHSLQVZLWKGLIIHUHQWHQGV,QFDFD$' 1535. Patina, intact. 6 pieces!

Lime calabash, wooden driving tray and spoon, made for preparation of hallucinogenic substances and one whistle and two nose ornaments made IURPERQH+XDULFD$',QWDFW6 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung kleiner praekolumbischer Steinschalen. kFP Kleine Schalen aus grauem Stein oder brauner Keramik für medizinische Zwecke oder zum Anreiben von Farben, darunter eine Doppelschale und eine kleine Platte. Alle intakt und in sehr gutem Zustand. 6W©FN 300,– Provenienz: Privatsammlung U. C., vom Sammler auf Reisen zwischen 1985 und 1990 erworben, seitdem Deutschland. Collection of small Precolumbian stone bowls comprising a double vessel and a plate for rubbing. All well preserved. 7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 7UDJVWXKO XQG %DKUH DOV .LQGHUVSLHO]HXJ &KDQFD\ FD   1400 n. Chr. a) L 12,5cm, B 9cm. Gelblicher Ton mit Bemalung in Schwarz. Tragbahre, auf der eine entweder kranke oder tote nackte weibliche Figur mit übergroßem Kopf und einer breiten Mütze liegt. Intakt. b) L 8cm, B 5,5cm. Gelblicher Ton mit dun kelbrauner Bemalung. Menschliche Figur, die nur auf einen gro ßen Kopf und davorgelegte dünne Arme reduziert ist, auf einem Tragstuhl. Freie Flächen mit Punktkreisen und Blüten bemalt. Intakt. Zwei seltene Objekte! 400,–

Provenienz: Privatsammlung U. C., auf verschieden Reisen zwischen 1975 und 1995 erworben, seitdem in Deutschland.

 Praekolumbische Sammlung von Spinnwirteln aus Kupfer. Ø 1,8  FP 6SLQQZLUWHOQ DXV .XSIHU XQWHUVFKLHGOLFKHU *U¤gH 35 6W©FN Grüne Patina, teilweise etwas korrodiert, sonst intakt. 200,– Provenienz: Privatsammlung U. C., erworben 1975 von Jürgen Tretter, seitdem in Deutschland. Precolumbian collection of spindle whorls made from copper. From different ancient American cultures. Green patina, partly corroded, otherwise intact. 35 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Praekolumbische Sammlung von Spinnwirteln. 9HUVFKLHGHQHDOW DPHULNDQLVFKH .XOWXUHQ k   FP 6SLQQZLUWHOQ DXV 6WHLQ Knochen oder Ton, mit Ritzdekor verziert. 6W©FN 200,– Provenienz: Privatsammlung U. C., erworben 2000 vom Sammler Leif Sjöberg, Stockholm, dort seit 1975. Large collection of spindle whorls made from stone, bone and clay with incised decoration. From different ancient American cultures. All in very good condition. 52 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Privatsammlung U. C.; seit 1983 in Deutschland. Two exceptional clay objects from the Chancay Culture, possibly children‘s WR\V$'D +XPDQ}JXUHO\LQJRQDVWUHWFKHULQWDFWE +XPDQ }JXUHUHGXFHGWRWKHIDFHRQDVXSSRUWFKDLU,QWDFW2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

275


 9LHU IU©KH SUDHNROXPELVFKH .RSIEHGHFNXQJHQ +XDUL7LDKXDQD FR    Q &KU  [ FP 4XDGUDWLVFKH YLHU]LS~LJH .RSIEHGHFNXQJHQLQ9HORXU7HFKQLNwHLQHQJPDVFKLJHV1HW] gewebe aus symmetrischen Knoten, durch die beim Knüpfen GLHIDUELJHQ~RUELOGHQGHQ:ROOI”GHQJH]RJHQZXUGHQ'LH6WLN NHUHLHQ]HLJHQ}J©UOLFKHXQGJHRPHWULVFKH0RWLYH6W©FN 600,– Provenienz: Privatsammlung U. C., 1994 von Bertrand de Parseval, Frankreich, erworben, seitdem in Deutschland. Mützen (gorros) der alten peruanische Kulturen gibt es in vielfältiger Form. 9RQEHVRQGHUHP5HL]VLQGGLHGHU+XDUL.XOWXU HWZDQ&KU  )DVWZ©UIHOI¤UPLJXQGPLWYLHU=LSIHOQYHUVHKHQ=XPHLVWVLQGVLHLQ9HORXUV Technik hergestellt und zeigen entweder mehrfarbige geometrische oder abstrakte Kompositionen, oder aber Götterbilder. Die Zipfel zeigen Varianten, wohl ganz nach Bevorzugung ihrer Hersteller oder Träger. Die Symbolik auf den gorros folgen der Regel aller Götterbilder des alten Peru, indem sie das %LOGGHVREHUVWHQ*RWWHV)HOLGHRGHU+DUS\LHNRPELQLHUWPLWGHP6WXIHQ und Mäandersymbol als Sinnbilder für Erdgöttin und Wassergut darstellen. )RXU+XDUL7LDKXDQDFRVTXDUHGSLOHKDWVFRPSRVHGRINQRWWHG}EHUVRYHUODLG ZLWKFXWZRROHQSLOHGHSLFWLQJ}JXUDWLYHDQGJHRPHWULFPRWLIV$' 1000. Two well preserved, the two others have missing parts. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQ:HEVW”EHQXQG6SLQGHOQ&KDQFD\ Q &KU D    FP +RO] .HUDPLN XQG 6WHLQ 6SLQGHOQ PLW glatten und verzierten Wirteln aus Stein und Keramik (12 Stück). b) Je ca. 29,5cm. Holz. Webgeräte zum Anschlagen oder Heben GHU 6FKXVVI”GHQ PLW DOV NOHLQH .Q”XIH JHVFKQLW]WHQ (QGHQ  Stück). 6W©FN Intakt. 300,– Provenienz: Privatsammlung U. C., vom Sammler 1975 bis 1985 erworben, seitdem in Deutschland. Collection of spindles with whorls made from stone and clay. In addition a ORWRIZHDYLQJVWLFNVZLWKWKLFNHQHGHQGV&KDQFD\$'$OO very well preserved. 18 pieces!

 1DGHOQXQG1DGHOEHK”OWHU&KDQFD\Q&KUD   FP 1”KQDGHOQ DXV G©QQHP +RO] RGHU .XSIHU REHQ JH locht, teilweise mit kugeligen Knäufen versehen oder mit Bind IDGHQXPZLFNHOW 6W©FN E FP1DGHO%HK”OWHUDXVPLW IDUELJHP*DUQXPZLFNHOWHQ6W”EHQGDULQGUHL:HERGHU1”K JHU”WHDXV.XSIHU,QWDNWF /FP1DGHO%HK”OWHUDXVEH PDOWHP7RQ,QWDNWG /FP1DGHO%HK”OWHUDXVEHPDOWHP +RO],QWDNWH /FP1DGHO%HK”OWHUDXV5RKUPLWG©QQHP %DVWJH~HFKWLP6FKDFKEUHWWPXVWHUXQGIDUELJHP*DUQXPZLN kelt. Oben kleine Fehlstelle, sonst intakt. 6W©FN 300,– Provenienz: Privatsammlung U. C., vom Sammler zwischen 1990 und 2000 erworben, seitdem in Deutschland. 1HHGOHVDQGER[HVPDGHRIZRRGDQGFRSSHU&KDQFD\$' Mostly intact. 17 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 *HZHEHVW©FNH&KDQFD\Q&KUD [FP Baumwolle und Kamelidenwolle in Braun, Beige und Schwarz mit einem Dekor von Vögeln und Felidenköpfen. Intakt. b) 32 x 24,5cm. Material wie a. Dekor mit Hasen, Felidenköpfen, 6FKDFKEUHWWPXVWHUXQG9¤JHO,QWDNWF [FP0DWHULDOZLH a. Gewebefragment, Mittelteil fehlt, nur die Ränder mit Dekor von Vögeln und geometrischen Mustern erhalten. 6W©FN 200,– Provenienz: Privatsammlung U. C., vom Sammler von 1975 bis 1985 erworben, seitdem in Deutschland. Collection of three pieces of cotton and camelid fabric from the Chancay &XOWXUH$'7ZRYHU\ZHOOSUHVHUYHGRIWKHWKLUGWKHPLGGOH part is missing. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung von Spindeln. 3DUDFDV    Y &KU / MH FD 30cm. Stachelpalme und Bambusstückchen. 6HOWHQ  6W©FN ,QWDNW u

 Zwei Puppen. &KDQFD\Q&KUD /FP*HZHE ter Baumwollstoff in Beige, Rot und Dunkelbraun, darunter ge ~RFKWHQH%LQVHQ]XU6WDELOLVLHUXQJEHZHJOLFKH$UPHDXV+RO] mit Garn umwickelt; lange Wollfäden bilden das Haar. Aus al WHQ7H[WLOLHQ]XVDPPHQJHVHW]WLQWDNWE /FP0DWHULDOZLH a, Baumwollstoff in Pink, Rot, Beige und Braun, in breiten Strei fen gewebt. Intakt. 6W©FN 200,–

Provenienz: Privatsammlung U. C., vom Sammler von 1975 bis 1985 erworben, seitdem in Deutschland.

Provenienz: Privatsammlung U. C., um 1980 erworben, seitdem in Deutschland.

Collection of spindles consisting of prickly palms and pieces of bamboo. 3DUDFDVFD%&,QWDFW25 pieces! Rare!

Two Chancay dolls made from fabric remnants lined with rush braid for VWDELOLVDWLRQ$',QWDFW2 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

276


 Sammlung von Stirnbinden. &KDQFD\Q&KUD / FP % FP %DXPZROOELQGH PLW HLQHP 5HFKWHFN0XVWHU LQ 6FKZDU] 'XQNHOEUDXQ XQG +HOOEUDXQ $Q HLQHP (QGH %HIH stigungsschlaufe; intakt. b) Ø 34cm. Kinderstirnband aus Wol le und Baumwolle in Ocker, Pink und Blau. Kleine Fehlstelle, VRQVWLQWDNWF /FP%FP6WLUQEDQGDXV:ROOHPLWHLQHP Muster von Felidenköpfen in Pink, Braun und Ocker; mehrere )HKOVWHOOHQG /FP%FP6WLUQEDQGDXVEUDXQHUXQGEHL ger Wolle mit Rhombenmuster; intakt. L 81,5cm, B 3cm. Stirn band mit einem Muster aus hellblauer und ockerfarbener Wolle; intakt. 6W©FN 250,– Provenienz: Sammlung U. C., 1980 erworben, seitdem in Deutschland. Collection of headbands woven in different colours from the Chancay culture. FD$'$OOZHOOSUHVHUYHG6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 'UHL0XVWHUZHEVW©FNH&KDQFD\XQGV©GOLFKH.©VWHFD 1400 n. Chr. a) L 22cm, B 10cm. Baumwolle und Wolle. Kleines *HZHEHVW©FNPLWJHRPHWULVFKHQXQG}J©UOLFKHQ0XVWHUQXD 9¤JHOXQG$PSKLELHQLQWDNWE /FPFP%LQGHDXVKHOOHU %DXPZROOHDQHLQHP(QGHEUHLWHU6WUHLIHQPLW6FKDFKEUHWWPX ster in Pink, Grün und Ocker; intakt. c) L 41,5cm. Gewebestrei fen mit Schachbrettmuster in Pink, Grün und Ocker mit langer Quaste; intakt. 6W©FN 150,– 3URYHQLHQ] 3ULYDWVDPPOXQJ 8 & YRP 6DPPOHU    DQ verschiedenen Orten erworben, seitdem in Deutschland. 7KUHHVDPSOHVRIZHDYLQJIURPWKH&KDQFD\FXOWXUHFD$' Very well preserved. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung plastischer Textilobjekte. 1D]FDFDQ&KU a) L ca. 16cm. Dreidimensionale Maschenstickerei aus farbiger .DPHOLGHQZROOH.DUWRIIHOS~DQ]HE /FDFP6DPP OXQJ WH[WLOHU 7LHUH GDUXQWHU ]ZHL (LGHFKVHQ ]ZHL +XQGH HLQ Papagei, ein Truthahn, eine Krabbe, ein Hirsch und zwei Papa JHLHQY¤JHODXIHLQHP:HEVW©FN 6W©FN F /FDFP 'UHLWH[WLOH5DQNHQS~DQ]HQ 6W©FN 6W©FN Alle in sehr gu WHU(UKDOWXQJ u Provenienz: Privatsammlung U. C., 1973 erworben, seitdem in Deutschland. &ROOHFWLRQRIWH[WLOHDQLPDOVDQGSODQWVWKUHHGLPHQVLRQDOO\ZRYHQLQFDPHOLG wool, comprising among others dogs, birds, lizzards or a potato plant and FUHHSHUV1DVFDFD$'$OOLQYHU\JRRGFRQGLWLRQ15 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Korb. ,QNDV©GOLFKHV+RFKODQGQ&KUkFP %LQVHQJH~HFKW)HLQJH~RFKWHQHURYDOHU.RUEPLW7UDJULHPHQ vermutlich für Nähutensilien. Kleine, partieller Abrieb, sonst intakt. 300,– Provenienz: Privatsammlung U. C., vom Sammler von 1975 bis 1985 erworben, seitdem in Deutschland. 9HU\}QHO\ZRYHQEDVNHWZLWKFDUU\LQJVWUDS,QFD6RXWKHUQ+LJKODQGV$' ,QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ %”QGHUQ YHUVFKLHGHQHU DOWDPHULNDQLVFKHU .XO turen. a) L 340cm, B 2cm. Baumwolle. Langes hellbraunes Zierband als Kantenabschluss mit eingewebtem pinkfarbenem =LFN]DFN0XVWHU &KDQFD\ FD    Q &KU ,QWDNW E  L 250cm, B 2cm. Material wie a, mit Darstellungen von Tieren 9¤JHO" LQ3LQNXQG:HLg&KDQFD\FDQ&KU ,QWDNW F  / FP % FP 0DWHULDO ZLH D PLW 'DUVWHOOXQJHQ YRQYLHUI©gLJHQ7LHUHQLQ3LQN&KDQFD\FDQ&KU Intakt. d) L 200cm, B 3cm und L 130cm, B 3cm. Baumwolle. Zwei doppelseitige Bänder in Braun und Hellbraun, zum Ver VFKQ©UHQYRQ0XPLHQE©QGHOQ3DUDFDVFDY&KU 6W©FN H /FP%FP%DXPZROOH%UHLWHV%DQGPLW VFKZDU]EUDXQHP0XVWHUXQG)UDQVHQEHVDW]DQGHQ(QGHQI  L 550cm, B 1,5cm. Baumwolle mit schachbrettartigen Mustern LQ%HLJH3LQN7©UNLVXQG%UDXQ)UDQVHQEHDW]DQGHQ(QGHQ 1DVFDQ&KUJ /FP%FP%DXPZROOEDQG mit alternierenden Feldern in monochrom Braun und geome trischen Figuren in Hellgrün, Pink und Ocker. Huari, ca. 800 Q&KU6W©FN6HOWHQLQGLHVHU(UKDOWXQJ Alle in ausge zeichnetem Zustand. 500,– Provenienz: Privatsammlung U. C., Norddeutschland, teilweise 1980 vom Sammler erworben, teilweise 1988 von Dr. Günther Hartmann in Berlin erworben. Bänder dieser Art wurden zum Schnüren von Mumienbündeln oder als Zierbesatz verwendet. Collection of woven bands or border fragments comprising objects from the &KDQFD\FXOWXUH DF$' 3DUDFDV G%& DQG +XDUL H$' DQGDOVR1DVFD I$' 8 pieces! All in an excellent condition! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Federkopfschmuck. 1DVFD "     Q &KU  [ FP )HGHUNRSIVFKPXFN DXV PLW EUDXQHQ XQG EHLJHQ :ROO E]Z Baumwollfäden umwickelten Holzstäbchen, in die kurze oran gefarbene Federn gesteckt wurden. Seltenes Objekt! Intakt. 200,– Provenienz: Privatsammlung U. C., 1982 von Klaus Baumann, Hamburg, erworben. )HDWKHUKHDGGUHVVPDGHRIRUDQJHIHDWKHUV1D]FD " FD$' Very good preserved. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

277


 *URgH 5LWXDO3UXQNVFKOHXGHU ,QND    Q &KU / 242cm. Farbige Kamelidenwolle, gewebt. Große Schleuder aus langen, gedrehten Wollfäden in Beige und Dunkelbraun, die an HLQHP(QGHLQ7URGGHOQPLW)UDQVHQDXVODXIHQGLH*HVFKRVV Mulde ist mit eingewebten Bildern von doppelten Vogelköpfen GHNRULHUW .OHLQH )HKOVWHOOH HLQ (QGH DXVJHIUDQVW VRQVW VHKU JXWH(UKDOWXQJ u Provenienz: Privatsammlung U. C., 1974 von einem Händler erworben, seitdem in Deutschland. /DUJH5LWXDO+RQGDZRYHQLQFDPHOLG}EHUVLQEHLJHEURZQUHGDQGRFKUH WKHFHQWUHSDUWGHSLFWLQJDPRWLIZLWKGRXEOHELUGV,QFD$' Miminal defections, otherwise in a very good condition. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Drei Hondas. &KDQFD\Q&KU/FP.D melidenwolle, gewebt und gedreht, die Schlingen in Dunkel EUDXQWHLOZHLVHPLWIUDQVLJHQ(QGHQGLH*HVFKRVV0XOGHQPLW geometrischen Mustern dekoriert. 6W©FN 250,– Provenienz: Privatsammlung U. C., 1984 erworben, seitdem in Deutschland. Collection of Hondas woven from camelid wool in shades of dark brown, red DQGEHLJH,QFD$'3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung von praekolumbischen Steinschleudern. Chancay, 300   Q &KU /   FP .DPHOLGHQZROOH JHZHEW XQG JHGUHKW LQ %HLJH XQG %UDXQW¤QHQ GLH *HVFKRVV0XOGHQ PLW geometrischen Mustern verziert. 6W©FN 300,– Provenienz: Privatsammlung U. C., von einem Händler 1984 erworben, seitdem in Deutschland. Collection of Hondas woven from camelid wool in shades of beige and brown. ,QFD$'6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQSUDHNROXPELVFKHQ6WHLQHQI©U6FKOHXGHUQL 12,2 FP6FKZDU]HU6WHLQSROLHUW6WHLQHI©U6FKOHXGHUQLQGHU Mitte zur Befestigung eingezogen, an einem Stein Lederriemen erhalten. 6W©FN 300,– Provenienz: Privatsammlung U. C., zwischen 1973 und 2000 erworben, seitdem in Deutschland. Interesting collection of six Precolumbian sling stones retracted in the middle for fastening, one strap preserved. All in good condition. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ 7H[WLO RGHU .¤USHUVWHPSHOQ -DPD&RDTXH FD Q&KUD %FP+FP*UDXHU7RQ6WHPSHOLQ Form einer „Volute“und mit Blüten gefülltes Feld. Intakt. b) H FP5¤WOLFKHU7RQ6WHPSHOPLW6FKOHLIHQGHNRUw+DQGKDEH JHNOHEWVRQVWLQWDNWF /FP5¤WOLFKHU7RQ/DQJUHFKWHFNL ger Stempel mit Blütendekor zwischen zwei Mäanderbändern. Intakt. d) H 4,2cm. Rötlicher Ton. Rechteckiger Stempel in Form von zwei Vögeln. Winzige Absplitterungen, sonst intakt. e) /FP6FKZDU]HU6WHLQ6WHPSHOLQ)RUPHLQHVPHQVFKOLFKHQ Fußes. Intakt. f) L 5,1cm. Dunkelbrauner Ton, an der Unter seite Dekor aus gekurvten Linien. Handhabe leicht beschädigt, sonst intakt. g) L 4,5cm. Grauer Ton. Stempel mit Liniendekor in Form eines Frosches. Intakt. h) L 3,5cm. Grauer Ton. Stem SHO PLW ]ZHL :DVVHUY¤JHOQ ,QWDNW L  / FP 5¤WOLFKHU 7RQ Stempel mit geometrischem Dekor im Rahmen. Intakt. 6W©FN 4XDOLW”WYROOH6DPPOXQJ 500,– Provenienz: Privatsammlung U. C., erworben 2000 vom Sammler Leif Sjöberg, Stockholm, dort seit 1975. Seit 2000 in Deutschland. Qualitiy collection of Jama Coaque clay stamps for textile and body painting LQYHU\JRRGFRQGLWLRQ&LUFD$'9 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung praekolumbischer Terrakotten verschiedener mittela merikanischer Kulturen. D +FP+RKO}JXUDXV7RQPLWU¤W licher Bemalung. Sitzender Mann mit großen Ohrspulen und YROXPLQ¤VHU +DOVNHWWH 0D\D FD    Q &KU ,QWDNW E  H 8cm. Material wie a. Stillende Frau mit lang herabgezogenen Ohrläppchen. Am linken Arm zweifach gebrochen und geklebt, VRQVW LQWDNW F  + FP 0DWHULDO ZLH D 6LW]HQGHU 0DQQ PLW JURgHQ2KUVSXOHQXQG+DDUWROOHDP2EHUNRSI0D\DFD 600 n. Chr. Intakt. d) H 12,5cm. Material wie a. Stehende Figur ohne Geschlecht mit abgespreizten Armen, im geöffneten Mund =”KQHVLFKWEDU'LTXLVQ&KU,QWDNW6W©FN 400,– Provenienz: Ex Sammlung E. P., Bergisches Land. Sammlungszeitraum HU-DKUHGDQDFKZHLWHUKLQLQ)DPLOLHQEHVLW],Q'HXWVFKODQGVHLW vor 1980. &ROOHFWLRQ RI IRXU KROORZ FOD\ }JXULQHV IURP GLIIHUHQW 0LGGOH $PHULFDQ FXOWXUHVD F 0D\DFD$'G *XHUUR " FD%& All in very good condition. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung von kleinen Figurinen. &KDQFD\ FD    Q &KU +   FP 7RQ PLW %HPDOXQJ LQ 6FKZDU] XQG 5RW DXIEHLJHPEHU]XJ,Q0RGHOQJHSUHVVWHXQGVFKHPDWLVFKEH malte weibliche Statuetten, teilweise mit hohen, spitzen Kopf bedeckungen und Krummrücken. 6W©FN Alle in sehr gutem Zustand. 300,– Provenienz: Privatsammlung U. C., 1973 erworben, seitdem in Deutschland. Collection of different small clay statuettes, partly with crooked backs, painted LQUHGDQGEODFNRQDZKLWHVOLSIURPWKH&KDQFD\FXOWXUHFD$' 1400. All in very good condition. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

278


 Sammlung von verschiedenen kleinen praekolumbischen Objek ten aus Ton. 0LWWHODPHULNDFDQ&KUD FP Vier kleine, aus Modeln geformte Köpfe, drei von Affen, ein PHQVFKOLFKHU0D\DQ&KU*XWHU=XVWDQG 6W©FN  b) H 11cm. Stehender Mann mit Lendenschurz und Hundemas NH0D\DQ&KU5HFKWHU$UPXQG%HLQIHKOHQF  L 11cm. Fragment eines Mannes mit Hundemaske und hohem .RSISXW]5HVWHEODXHU%HPDOXQJ0D\DQ&KUG  Oberteil einer menschlichen Statuette. e) 9 und 8,5cm. Zwei Ge I”gIUDJPHQWHPLW*HVLFKWHUQ0D\DQ&KU 6W©FN  I /FP6WHPSHOI©U.¤USHUEHPDOXQJ0D\DQ&KU J +FP$QK”QJHUDXVEUDXQJU©QHU6WHLQPLWGHUJHVFKQLW] ten Darstellung eines knienden Menschen, zwei seitliche Durch ERKUXQJHQ*XDQDFDVWHFDQ&KU,QWDNWK + XQGFP=ZHL0RGHOI©U.¤SIH9HUDFUX]Q&KU13 6W©FN 500,– Provenienz: Ex Sammlung E. P., Bergisches Land, Sammlungszeitraum HU-DKUHGDQDFKZHLWHUKLQLQ)DPLOLHQEHVLW],Q'HXWVFKODQGVHLW vor 1980. Collection of different Precolumbian clay objects from Central American Cultures, including little monkey heads, a stone pendant, fragments of statuettes, a body stamp, facial shaped fragments of vessels and two models IRUWKHKHDGVRIFOD\}JXUHV&LUFD$'$OOLQJRRGFRQGLWLRQ 13 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQSUDHNROXPELVFKHQ7HUUDNRWWD}JXUHQXQG3IHLIHQ a) H 11cm. Rötlicher Ton. Statuette eines Mischwesens. Ver DFUX]FDQ&KU,QWDNWE /FDFP+HOOEUDXQHU Ton, Fragment eines drachenähnlichen Fabeltieres. Mittelame ULNDFDQ&KU%HLQHDEJHEURFKHQVRQVWLQJXWHP =XVWDQG F  'UHL $IIHQ}JXULQHQ DXV JHOEOLFKHP 7RQ $IIH PLW erigiertem Glied (H 8cm), sitzender Affe mit Halskragen (H FP XQGVFKZDQJHUHV$IIHQZHLEFKHQ +FP 0LWWHODPHULND FDQ&KU$OOHGUHLIUDJPHQWDULVFKHUKDOWHQG +FD 9cm. Heller Ton mit Spuren von rötlicher Bemalung. Fragment HLQHU+RKO}JXUHLQHUVFKZDQJHUHQ)UDXPLWJURgHQ2KUVSXOHQ 0LWWHODPHULNDQ&KUH +HOOHU7RQPLW5HVWHQYRQ rötlicher und schwarzer Bemalung. Tonpfeife mit vier Löchern in Form eines Vogelkopfes mit hohem Kamm. Mittelamerika, FDQ&KU.OHLQHUH%HVFK”GLJXQJHQXQG5HVWDXULH rungen am Kopf. f) L ca. 9,5cm. Ton mit Resten oranger Bema OXQJ 6SLHO]HXJ+XQG PLW JURgHQ 2KUHQ 8QEHVWLPPW .OHLQH %HVFK”GLJXQJHQJ =ZHL.RSIIUDJPHQWH~DFKHU7RQVWDWXHWWHQ mit Resten von Bemalung: Breites Gesicht mit halbgeöffnetem Mund, eingesenkten Pupillen und drei Stirnlocken (H 9,5cm) XQG VFKPDOHU .RSI PLW +DDUNUDQ] FP  9HUDFUX] FD   900 n. Chr. 6W©FN 200,– Provenienz: Ex Gorny & Mosch, München Auktion 275, 2020, Los 744; ex 6DPPOXQJ(3%HUJKHLPHU-DKUHGDQDFKLP)DPLOLHQEHVLW] &ROOHFWLRQRIQLQHFOD\}JXULQHVDQG~XWHVIURP0LGGOH$PHULFDFD 700 AD. Partly in fragmentary form. 10 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQSUDHNROXPELVFKHQ0RGHOQXQG6WHPSHOQDXV7RQ D /FDFP*HVLFKWVPRGHO0RFKHFDQ&KU Intakt. b) Fragment eines Models (B 6,5cm) und Tierkopf, ver mutlich eines Nackthundes, (H 4,5cm). Vermutlich Chancay, Q&KU 6W©FN F /FP6DPPOXQJYRQNOHL QHQ6WHPSHOQXQG0RGHOQ 6W©FN -DPD&RDTXH n. Chr. Intakt. 6W©FN 150,– Provenienz: Privatsammlung U. C., zwischen 1985 und 1990 erworben, seitdem in Deutschland. Collection of clay models and clay stamps for textile or body painting. Tairona DQG-DPD&RDTXHFD$'$OOZHOOSUHVHUYHG10 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQDFKWSUDHNROXPELVFKHQ7”VFKFKHQZentrale Kü VWH FD    Q &KU D   [ FP ELV  [ FP 'UHL NOHLQH .DON7”VFKFKHQ WHLOZHLVH PLW 7UDJH.RUGHO LQ 6WUHLIHQ gewebt oder mit geometrischen Mustern. Intakt (3 Stück). b) 23 x 14,3cm bis 16 x 12cm. Fünf kleine Taschen mit Streifendekor, DXV:ROOHRGHU%DXPZROOHJHZHEWWHLOZHLVHPLW.RUGHOQ(LQL JHJH~LFNWVRQVWJXWHUKDOWHQ 6W©FN 6W©FN 200,– Provenienz: Privatsammlung U. C., 1980 erworben, seitdem in Deutschland. Collection of small Precolumbian bags for different uses. Woven from wool DQGFRWWRQLQVWULSHGGHFRUV&HQWUDOFRDVWFD$'6RPHRI them are mended, otherwise very good condition. 8 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Drei Taschen. 6©GOLFKH.©VWHFDQ&KUD [ 26,5cm. Aus brauner Wolle mit feinen weißen Streifen geweb WHEUHLWH7DVFKHLQ*REHOLQ7HFKQLNPLW6HLWHQERUWH,QWDNWE   [ FP .OHLQHV .RND7”VFKFKHQ PLW 6WUHLIHQGHNRU XQG Bordüre in Dunkelbraun, Beige, Pink und Schwarz, oben zu VDPPHQJH]RJHQPLW7UDJHNRUGHO,QWDNWF [FP.RND 7”VFKFKHQDXVVWUHL}JJHZHEWHU:ROOHLQ%UDXQ5RWXQG%HLJH PLW%RUG©UHDPREHUHQ(QGH(LQVDW]DXVGXQNHOEUDXQHU:ROOH mit Tragekordeln. Intakt. 6W©FN 200,– Provenienz: Privatsammlung U. C., Norddeutschland. &ROOHFWLRQRIWKUHHZRYHQEDJVWZRRIWKHPIRUXVHDVFRFDEDJ6RXWKHUQ FRDVWFD$'9HU\ZHOOSUHVHUYHG3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Große Basttasche. Südliche Küste, späte Zwischenzeit, um 1200 n. Chr. 23 x 19,5cm. Tasche aus horizontal vernähten dunkel braunen und naturfarbenen Baststäben, die zu einem Muster zusammengefügt sind. Oben vernähte Borte mit Trageschlaufe. Intakt. 200,– Provenienz: Privatsammlung U. C., vom Sammler um 1985 erworben, seitdem in Deutschland. /DUJHUDI}DEDJWKHVLQJOHURGVDUHKRUL]RQWDOO\VWLWFKHG7RJHWKHUWKH\IRUP a pattern. Southern Coast, Late Intermediate Period, ca. A.D. 1200. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

279


 Drei praekolumbische Troddelgewebe. a) L 26cm, B 2,5cm. Strei }JHV %DXPZROOJHZHEH LQ %UDXQ 3LQN XQG 7©UNLV PLW :ROOH bestickt, unten rote Borte mit Fransen, rechts gesäumt mit Trod GHO ,FD FD    Q &KU ,QWDNW E  / FP % FP Aus Baumwolle gewebtes bordeauxrotes, fransenbesetztes Bor WHQWHLOPLW]RRPRUSKHQ*¤WWHU}JXUHQLQ2FNHUXQG:HLgGLH einen hohen Kopfschmuck und einen Schwanz mit drei Qua VWHQ WUDJHQ &KLPX    Q &KU YJO GD]X 8 &DUO VRQ'LH*¤WWHUELOGHUGHV$OWHQ3HUX%UDXQVFKZHLJ6 Nr. 249). Intakt. c) L 225cm, B 4cm. Hellbraune Baumwollbin GHPLW:ROOVWLFNHUHLLQ3LQN%HLJHXQG2FNHUDQHLQHP(QGH )UDQVHQEHVDW]PLW7URGGHOQ&KDQFD\Q&KU(L nige Fehlstellen, sonst guter Zustand. 6W©FN 300,–

 Kleiner Kopf aus Terrakotta. 1RN1LJHULDYQ&KU+ FP5¤WOLFKEUDXQJHVFKO”PPW$XJHQXQG1DVHGXUFKERKUW ein Bandeau über die Stirn bis zu den Ohren hält die Frisur. Kleiner Teil der Frisur abgebrochen. 500,–

Provenienz: Privatsammlung U. C., zwischen 1975 bis 1985 an verschiedenen Orten erworben, seitdem in Deutschland. 7KUHH 3UHFROXPELDQ IDEULFV ZLWK IULQJHV DQG WDVVHOV D  ,FD $'    ,QWDFW  E  =RRPRUSKLF UHSUHVHQWDWLRQV RI JRGV ,FD    ,QWDFWF 5LEERQZLWKZRROHPEURLGHU\&KDQFD\$'6RPH ~DZV3 pieces!

 .OHLQHU1RN.RSI1LJHULDYQ&KU+FP%UDXQ geschlämmte Terrakotta. Kleiner Kopf mit großen, durchbohr ten Augen, geschlossenem Mund und durchbohrter Nase und Ohren; Frisur in kleinen Schöpfen. 0LW7/$QDO\VHGHV/DERUV Kotalla von 1999! Abreibungen am rückwärtigen Teil. 400,–

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Ex süddeutsche Privatsammlung U. H. In Deutschland seit vor 1999.

 Drei große praekolumbische Webarbeiten. a) 55 x 49cm. Grob gewebtes Partialgewebe. Dunkelbraune und ockerfarbene Qua drate im „Schachbrettmuster“ aneinandergenäht. Paracas / In LWLDOH 1DVFD3KDVH FD    Y &KU ,QWDNW E   [ FP ,QEUDXQEHLJH6WUHLIHQJHZHEWH%DXPZROOHPLW)UXFKWEDUNHLWV V\PEROHQ,QNDQ&KU'UHL/¤FKHUXQG)HKOVWHO OHQDQGHQ5”QGHUQF [FP)HVWJHZHEWHV%DXPZROOWXFK PLW JODWWHQ XQG JHPXVWHUWHQ EODXHQ 6WUHLIHQ &KDQFD\   1400 n. Chr. Intakt. 6W©FN 600,–

7HUUDFRWWDVPDOOKHDG1RN1LJHULD%&$'6XUIDFHZRUQDWWKH back. :LWK7/$QDO\VLVRIWKH/DERUDWRU\.RWDOODIURP

Provenienz: Privatsammlung U. C., a) erworben 1990, b und c) erworben 1985 von Klaus Baumann, Hamburg. Three Precolumbian weaving works: a) Checkerboard pattern in brown and RFKUH3DUDFDV(DUO\1D]FDFD%&,QWDFWE 6WULSHGZRYHQ FRWWRQFORWKLQEURZQDQGEHLJH,QFD$'7KUHHKROHVLQWKH IDEULFDQG~DZVRQWKHHGJHVF 6ROLGFRWWRQIDEULFLQEHLJHZLWKEOXHVWULSHV &KDQFD\$',QWDFW3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 .OHLQH1RN)LJXU1LJHULDYQ&KU+FP%UDXQ geschlämmte Terrakotta. Kleine stehende Figur, mit gebeug ten Armen, großem Halsschmuck und Lendenschurz. 0LW7/ $QDO\VH GHV /DERUV .RWDOOD YRQ  Hinterer Teil der Figur abgebrochen, Abreibungen. 600,– Provenienz: Ex süddeutsche Privatsammlung U. H. In Deutschland seit vor 1999. 7HUUDFRWWDVPDOOVWDQGLQJ}JXUHZLWKODUJHSLHUFHGH\HVDQGSLHUFHGQRVH 1RN1LJHULD%&$'5HDUSDUWRI}JXUHEURNHQRII:LWK7/ Analysis of the Laboratory Kotalla from 1997! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

280

Provenienz: Ex alte deutsche Sammlung, Krefeld. In Deutschland seit vor 1945. 6PDOO WHUUDFRWWD KHDG ZLWK UHGGLVKEURZQ VOLS H\HV DQG QRVWULOV SLHUFHG Bandeau over the forhead to the ears keeps the headgear in shape. Small part of coiffure broken off. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL)LJXUHQYRQ:©UGHQWU”JHUQDXV7HUUDNRWWD.RPD%XLOVD .RPDODQG*KDQD-KD +FP0”QQOLFKH)LJXUDXI pfahlförmiger Basis sitzend, mit Lendenschurz und doppelreihi gem Schulterband bekleidet, beide Hände auf die Knie legend. Typisches Gesicht mit hervorquellenden Augen, großer Nase und breitem Mund und dem schalenförmigen, wohl für Opfe rungen ausgehöhlten Kopf. b) H 23cm. Fragment einer ganz ähnlichen Figur ohne Lendenschurz, aber mit Halskette, Arm reifen und Oberarmreifen. Beiden Figuren fehlen teilweise die Beine, der kleineren Figur der Kopf. Beide Figuren mit Versin WHUXQJV XQG $OWHUVVSXUHQ 'HU JU¤gHUHQ )LJXU IHKOW GHU 1D bel, die kleinere weist minimale Brüche an den Armreifen auf. 2 6W©FN0LW*XWDFKWHQYRQ'U.DUO)HUGLQDQG6FK”GOHUYRQ 500,– 3URYHQLHQ]([6DPPOXQJ&.%UDQGHQEXUJHUZRUEHQXQGEHL Galerie Dogon, Berlin. In Deutschland seit mindestens 2004. 7ZR WHUUDFRWWD }JXUHV RQH VHDWHG RQ D F\OLQGULFDO EDVH ZLWK WZR URZV RI shoulder band and loincloth, with arms placed on the thighs, the other of similar design, fragmentary with necklace and armlets and bracelets, missing LWVKHDG.RPD%XLOVD.RPDODQG*KDQDWKWKFHQWXU\/DUJHU}JXUH QDYHOEURNHQRIIVPDOOHU}JXUHZLWKEUHDNDJHVRQEUDFHOHWV2 pieces! With H[SHUWLVHE\'U.DUO)HUGLQDQG6FK”GOHU VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


 6WHOHQ”KQOLFKH DEVWUDNWH P”QQOLFKH )LJXU %XUD$VLQGD6LNND 1LJHU-KQ&KU+FP=\OLQGULVFKHDQWKURSRPRU phe Stele aus beige geschlämmter Terrakotta mit mandelförmi gen Augen, schmaler, gerader Nase, kleinen Ohren, kleinem, vorstehendem Mund und angedeutetem Penis, Frisur aus paral lel geformten Löckchen. Intakt. 450,– Provenienz: Ex Sammlung Hans van Drumpt, Maastricht. In Deutschland seit vor 2000.

 Kopf aus Terrakotta. 'MHQQ˜1LJHU%LQQHQGHOWD0DOL -K Q &KU + FP 7HUUDNRWWD JUDXEHLJH JHVFKO”PPW 0LW hervortretenden Augen, vollkommen mit Pusteln bedeckt, auf antikem Bilderrahmen befestigt. Linke Gesichtshälfte hinter dem Auge abgebrochen. 300,– Provenienz: Aus alter deutscher Sammlung, Krefeld. In Deutschland seit vor 1945.

$QWKURSRPRUSKLFVWHODZLWKDOPRQGVKDSHGH\HVWKLQQRVHVPDOOHDUVVPDOO SURWUXGLQJPRXWKDQGLQGLFDWHGSHQLV%XUD$VLQGD6LNND1LJHUUGWK century A.D. Intact.

6PDOO WHUUDFRWWD KHDG ZLWK JUH\LVKEHLJH VOLS DQG SURWUXGLQJ H\HV DQG FRPSOHWHO\FRYHUHGZLWKEXUOV'MHQQ˜1LJHULQODQGGHOWD0DOLWKWK century A.D. Fastened on an antique picture frame, left part of face behind the eye broken off.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Zwei kleine Köpfe aus Terrakotta. 'MHQQ˜ 1LJHU%LQQHQGHOWD 0DOL-KQ&KU+FP0LWW\SLVFKZHLWDXVODGHQGHP .LQQXQGNQRSIDUWLJHQ$XJHQ*UDXZHLgJHVFKO”PPW6W©FN Intakt, minimale Abreibungen. 400,–

 6DPPOXQJ 7HUUDNRWWD}JXUHQ Kamerun, wohl Westafrika oder .RQJR+FP0RGHUQH6NXOSWXUHQDXVEHPDOWHU7HUUD kotta einen Häuptling aus dem Kameruner Grasland und vier, wohl belgische Soldaten in Uniform in verschiedenen Situatio nen darstellend. 6W©FN Intakt. 450,–

Provenienz: Ex alte deutsche Sammlung, Krefeld. In Deutschland seit vor 1945. 7ZRVPDOOKHDGVZLWKW\SLFDOO\SURWUXGLQJFKLQVDQGVPDOOEDOOVKDSHGH\HV Minimal abrations. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Zwei kleine Köpfe aus Terrakotta. .RPD%XLOVD.RPDODQG*KD na. H 10,5 und 11,5cm. Zwei bärtige Köpfe mit brillenartigen Augenpartien und den typischen, schüsselförmig ausgehöhlten Köpfen, die auf spitz zulaufenden Hälsen sitzen.  6W©FN In takt. 400,– Provenienz: Ex alte deutsche Sammlung, Krefeld. In Deutschland seit vor 1945. Two small terracotta bearded heads with brownish slip sitting on tapering QHFNV %RWK ZLWK WKH W\SLFDO H\H FRQFHSWLRQ UHPLQGLQJ RQH RI H\HJODVVHV DOVRERWKZLWKWKHERZOVKDSHGLQGHQWDWLRQVLQWKHFUDQHVSUREDEO\XVHGIRU RIIHULQJV.RPD%XLOVD.RPDODQG*KDQD,QWDFW2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Zwei kleine Köpfe aus Terrakotta. a) H 9cm. Kopf mit hoher 6WLUQ XQG YRUVSULQJHQGHP .LQQ 'MHQQ˜ 1LJHU%LQQHQGHOWD 0DOL-KQ&KUE +FP.RSIYRQQDWXUDOLVWLVFKHU .RQ]HSWLRQ9HUPXWOLFK%DQNRQL0DOL-KQ&KU2 6W©FN Intakt, minimale Abreibungen. 300,– Provenienz: Ex alte deutsche Sammlung, Krefeld. In Deutschland seit vor 1945. Two small teracotta heads, one from Djenné, Niger inland delta, Mali, 11th WKFHQWXU\$'WKHRWKHUSUREDEO\%DQNRQL0DOLWKWKFHQWXU\ A.D. Some small abrations. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ *URXS RI }YH PRGHUQ WHUUDFRWWD VFXOSWXUHV SDLQWHG LQ YDULRXV FRORXUV representing a seated Cameroon Grasslands chief and four supposedly Belgian soldiers in uniform in different positions. Intact. 5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Große Terrakottaschale. Kameruner Grasland, vermutlich Ba PXPkFP%HLJHEUDXQJHVFKO”PPWGHUOHLFKWDXVODGHQGH Rand mit umlaufendem Hochrelief dekoriert. Intakt. 650,– 3URYHQLHQ]([3ULYDWVDPPOXQJ.)6FK”GOHU0©QFKHQ /DUJHWHUUDFRWWDERZOZLWKEHLJHEURZQVOLSWKHVOLJKWO\~DULQJULPGHFRUDWHG ZLWKKLJKUHOLHI&DPHURRQ*UDVV}HOGVSUREDEO\%DPXP VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 7HUUDNRWWDEHK”OWHU%XUD$VLQGD6LNND1LJHU-KQ&KU H 68cm. Konisch zulaufender, länglicher Behälter aus einer Grabanlage nordwestlich von Niamey, Niger. Die Außenwand völlig von geometrisch angeordneten Noppen bedeckt. Solche Behälter wurden mit der Öffnung nach unten eingesetzt und ent hielten vermutlich Kleider der Verstorbenen. Drei Bruchstellen geklebt, restauriert am unteren Rand. 600,– 3URYHQLHQ]$XV.XQVWJDOHULH0©QFKHQ,Q'HXWVFKODQGVHLWHU-DKUH %XUD$VLQGD6LNNDFRQLFDOFRQFHLYHGHORQJDWHGWHUUDFRWWDUHFHSWDFOHIURPDQ excavation to the northwest of Niamey, Niger. The body completely covered with geometrically arranged burls. These containers were buried with the opening to the ground and supposedly made to contain garments oft the deceased. Three breakages, glued, restaurations on rim. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

281


 0DVNHXQG1DFNHQVW©W]HDXV+RO]Ibibio, Nigeria und Chokwe, Angola. a) H 20,5cm. Kleine Gesichtsmaske der Ibibio, mit Resten roter und schwarzer Farbe und asymmetrischer Frisur aus angedeuteten kleinen Zöpfen. b) L 15,5cm. Nackenstütze der Chokwe mit rechteckiger Basis und brettartiger Stütze, auf EHLGHQ 6HLWHQ PLW HLQHU UHOLH}HUWHQ 0DVNH JHVFKQLW]W %UDXQH glänzende Patina (Inv. 2 und 3). 6W©FN Intakt, Gebrauchsspuren bei der Maske. 650,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990.

 0DVNHXQG]ZHL3KDOOLD /FP%©IIHOPDVNHDXVVFKZDU]JH färbtem Holz mit weit geöffnetem, die Zähne zeigenden Maul, ellipsenförmigen Augen und Frisur aus parallelen Zopfreihen, die über die Stirn hängen. Bamum, Kamerun. Teilweise glänzen GH3DWLQDE /XQGFP=ZHL+RO]3KDOOL ,QYXQG  Fon, Benin. Teilweise durch Termitenfraß beschädigt. 6W©FN Intakt. 600,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990.

Small face mask with relics of red and black painting and with asymmetric coiffure formed by small plaits. Ibibio, Nigeria. Plus a neck support with masks by the Chokwe, Angola. 2 pieces!

Bamum, Cameroon buffalo mask painted black with wide open snout, showing the teeth, ellipsoid formed eyes and coiffure composed of parallel arranged rows of plaits hanging over the forehead. Glossy patina on places. Included in the lot are two wooden phalli by the Fon, Benin. Damages by termite bite. 3 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 +RO]PDVNH Mossi, Burkina Faso. L 58cm. Antilopenmaske ‚wansilga‘ mit langen, geschwungenen Hörnern, kammartiger )ULVXUVSLW]HP6FKQDEHOXQG5HVWHQHLQHUVFKZDU]ZHLgURWHQ Dreiecksbemalung. Intakt. 600,–

 =ZHL+RO]PDVNHQSonge, D. R. Kongo. L 21 und 21,5cm. Zwei 0LQLDWXURGHU+DXVPDVNHQVFKZDU]XQGZHLgEHPDOWHLQHPLW gerader Nase, konisch verlaufendem, viereckigen Mund, kanti ger Stirn und dreieckigen, schwarzen Motiven auf den Wangen und am Kinn, die andere mit gewölbter Stirn und rechteckig vorspringendem Mund und mit großen, schwarz umrandeten Schlitzaugen (Inv. 6 und 34). 6W©FN Intakt. 600,–

Provenienz: Privatsammlung U. C., Norddeutschland. Wooden antelope mask ‚wansilga‘. Mossi, Burkina Faso. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 +RO]PDVNHMarka, Mali / Burkina Faso. L 40cm. Holz, Mes singblech, Baumwollstoff. Längliche Gesichtsmaske fast gänz lich mit Messingblech beschlagen. Das Baumwolltuch ist Teil des Maskengewandes. Intakt. 600,– Provenienz: Ex Privatsammlung U. C., Norddeutschland. Marka face mask of elongated type almost completely covered with brass sheet. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Ex Sammlung K. W., Bayern, vor 1990. Two D. R. of Congo miniature or house masks painted black and white, one with straight nose, protruding conical conceived rectangular mouth, edged forehead and triangular black motifs on cheeks and on chin, the other with rounded forhead and large, black surrounded slit eyes. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Helmmaske ‚gelede‘. Yoruba, Benin / Nigeria. H 25cm. Holz, blau, weiß und rötlich bemalt mit kammartiger Frisur aus par allel angeordneten Zopfreihen, ellipsenförmigen Narbentatauie rungen an den Wangen und großem, gestreiften Kopftuch (Inv. 14). Intakt. 580,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990.

 +RO]PDVNHBwa, Burkina Faso. L 52cm. Büffelmaske mit langen JHERJHQHQ +¤UQHUQ VFKZDU]ZHLg EHPDOW PLW JURgHQ UXQGHQ Augen, vorstehendem, dreieckigen Maul und spitz zulaufenden Ohren. Verschiedene eingeschnittene Motive. Rechtes Horn mit alter indigener Reparatur. 600,– Provenienz: Ex Privatsammlung U. C., Norddeutschland. Bwa, Burkina Faso wooden buffalo mask with curved horns, large round eyes, protruding rectangular mouth and long tapering ears. Decorated with various carved motifs. Right horn with old indigenous repair. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

282

Yoruba, Benin / Nigeria helmet mask gelede painted blue, red and white with FUHVWHGFRLIIXUHIRUPHGE\SDUDOOHODUUDQJHGSODLWVHOOLSVRLGVNLQVFDUL}FDWLRQ marks on the cheeks, and wearing a large striped headband. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


 6FKQDEHOPDVNH €J”JRQy Dan / Diomande, Liberia. H 24cm. Holz, Metall, Tierhaare, Stoff, aus schwarz gefärbtem Holz mit UXQGHQ%OHFKEHVFKODJHQHQ$XJHQVFKQDEHODUWLJYRUVSULQJHQ dem Nasenmaul, besetzt mit langen Tierhaaren und belegt mit URWHP6WRIIEHUGHU6WLUQHLVHUQHU+DNHQ]XP%HIHVWLJHQYRQ magischem Material oder Schmuck (Inv. 21). Intakt mit glän zender Patina. 550,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990. Dan / Diomande, Liberia beak mask gägon, the black painted wood with round eyes, surrounded by sheet metal, long black animal hair hanging down from the protruding snout, covered with red fabric, and iron hook on upper forehead for fastening magic items or ornaments. Intact with glossy patina. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 +RO]PDVNHBobo, Burkina Faso. L 150cm. Große Helmmaske mit leicht geschwungenen Hörnern, rechteckigen Augen, lan ger gerader Nase und konisch vorspringendem Mund, schwarz, weiß und rot mit Dreiecksmustern und Punkten bemalt. Nach $QJDEHQGHV(LQOLHIHUHUVGHUGLH0DVNHQDFKGHUHQWVSUHFKHQ den Zeremonie erwerben konnte, tritt die Maske als Camou ~DJHGHV0HGLDWRUVDXIGHUVLHVLW]HQGYRUVLFKK”OW,QWDNW 500,– Provenienz: Ex Privatsammlung U. C., Norddeutschland. Bobo, Burkina Faso large helmet mask with slightly curved horns, painted black, white and red with triangular and dotted motifs, with rectangular eyes, long straight nose and conical protruding mouth. According to he consigner who was able to acquire the mask after the performance, it serves as a kind FDPRX~DJHIRUDPHGLDWRUZKRKROGVWKHPDVNLQIURQWRIKLP,QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Helmmaske. Anyang, Nigeria. H 36,5cm. Holz mit (vermutlich) Antilopenhaut überzogen und bekrönt von vier kleinen Köpfen mit geöffneten Mündern sowie mit mandelförmigen Augen und geöffnetem, die Zähne (nur einer erhalten) zeigenden Mund. Intakt, Haut teilweise abgerissen. 400,– Provenienz: Ex Privatsammlung Josef Späth, Windach. Wooden Anyang, Nigeria helmet mask covered with (probably) antelope skin DQGVXUPRXQWHGE\IRXUVPDOOKHDGVZLWKRSHQPRXWKVDOPRQGVKDSHGH\HV and open mouth showing the teeth (only one left). VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Helmmaske ‚Giphogo‘. 2VW3HQGH ' 5 .RQJR + FP Holz. Hutförmige Maske mit hervorstehendem, breiten Rand, weiß, schwarz und rot bemalt mit horizontal vorstehender Nase und großen, weiß umrandeten Augen. Intakt, Farben vermutlich aufgefrischt. 350,– Provenienz: Aus dem österreichischen Kunsthandel. +HDGVKDSHG:HVWHUQ3HQGH'5RI&RQEJRPDVNSDLQWHGUHGZKLWHDQG black with horizontal protruding nose and horizontally protruding rim, and with large eyes, sourrounded with white paint. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Feuerspeiermaske ‚korubla‘. 6HQXIR (OIHQEHLQN©VWH / FP Holz, rötlich und weiß mit Punkten bemalt. Mit gebogenen Hörnern und weit geöffnetem, die Zähne zeigenden Maul. Durchgehender Riss auf der Längsseite, Kopf des Chamäleons abgebrochen. 300,– 3URYHQLHQ]$XVGHU$IULND6DPPOXQJ%HUQGW6DDUODQG 6HQXIR,YRU\&RDVW}UHVSLWWHUPDVNNRUXEODSDLQWHGZLWKUHGGLVKDQGZKLWH dots with curved horns and open mouth showing the teeth. Crack alongside the mask, head of chameleon on top broken off. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 0DVNHDXV+RO]Bwa, Burkina Faso. Ø 42cm. Abstrakt gestal tete sog. Sonnenmaske aus altem Holz, schwarz, rot und weiß bemalt, die punktförmigen Augen sind von konzentrischen .UHLVHQ XPUDQGHW JURgHU NUHLVI¤UPLJHU 0XQG (LQH VS”WHUH (QWZLFNOXQJGHVGRUWLJHQ0DVNHQZHVHQV'HU(LQOLHIHUHUNRQQ te dem entsprechenden Tanz beiwohnen und die Maske nach der Aufführung erwerben. Kleinere Fraßstellen. 200,– Provenienz: Ex Sammlung U. C., Norddeutschland. %ZD%XUNLQD)DVRVRFDOOHGVXQPDVNPDGHRIROGZRRGSDLQWHGEODFN white and red. The dotted eyes are surrounded by concentric circles, large open round mouth. The mask represents a later development of he Bwa masking tradition. The consigner of this mask could assist a dance performance with this mask and was able to acquire it after the dance. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 .URQH HLQHV 2ED +”XSWOLQJ  Yoruba, Nigeria. H 45,5cm RKQH 6FKQ©UH .RUEJH~HFKW *ODVSHUOHQ ,QQHQ JHI©WWHUW PLW handgewebtem, gestreiften Baumwollstoff, außen vollkommen besetzt mit bunten Glasperlen, auf zwei Seiten das Gesicht von (6+8GDUVWHOOHQG,Q]ZHL5HLKHQXPGLH.URQHVLW]HQGH9¤JHO mit ausgebreiteten Flügeln und einer an der Spitze. Am unteren Rand eine Reihe perlenbesetzter Schnüre (Inv. 16). Intakt. 600,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990. Yoruba, Nigeria crown of an Oba (chief) on a wickerwork base, the inside lined with handwoven striped cotton, the outside completely covered with coloured glass beads, on two sides showing the face of ESHU, and with two URZVRIVHDWHGELUGVFLUFOLQJWKHPDVNZLWKRQHVLWWLQJRQWRSDOOZLWKVSUHDG out wings. The rim encircled with strings of beads. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL $PXOHWW}JXUHQ %DPXP  %DPLOHNH .DPHUXQ / FP (OIHQEHLQ XQG/FP +RO] 'LHK¤O]HUQHWU”JWHLQPDJLVFKHV Paket auf dem Kopf verschlossen mit einer Abrusbohne (abrus SUHFDWRULXV  XQG PLW JO”Q]HQGHU VFKZDU]EUDXQHU 3DWLQD 2 6W©FN6HOWHQ Intakt. 650,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ 7ZRDPXOHW}JXUHVIURPWKH&DPHURRQ*UDVV}HOGVRQHRILYRU\WKHRWKHU of wood wearing a magical package above the head, sealed with an abrus precatorius seed. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN! KEIN VERKAUF AUSSERHALB DER E.U.! / NO DELIVER OUTSIDE THE E.U.!

283


 $PXOHWW)LJXUHQSDDUDXV+RO]Bamum / Bamileke, Kamerun. L 8cm. Figurenpaar Rücken an Rücken stehend und die Hände vor dem Leib haltend mit brauner, glänzender Patina. Selten! Intakt. 600,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ

 3IRVWHQ}JXU€ERFFKLRyFon, Benin. H 93cm. Auf einem Pfosten stehende männliche Figur aus Holz, die Hände vor dem Leib haltend mit mandelförmigen Augen und kleinem, geöffneten Mund. 6FKZ”U]OLFKH 3DWLQD PLW %HRSIHUXQJVVSXUHQ EHVRQGHUV am unteren Teil der Figur! Pfosten durch Insektenfraß teilweise stark beschädigt. 400,–

%DPXP%DPLOHNH&DPHURRQDPXOHW}JXUHRIDPDOHIHPDOHSDLUVWDQGLQJ back to back with hands placed on the abdumen.

Provenienz: Aus dem Berliner Kunsthandel.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

6WDQGLQJ )RQ %HQLQ PDOH SROH }JXUH ZLWK KDQGV WRXFKLQJ WKH DEGRPHQ DOPRQGVKDSHGH\HVDQGVPDOORSHQPRXWK%ODFNLVKEURZQSDWLQDZLWK FUXVW\VDFUL}FLDOSDWLQDHVSHFLDOO\RQORZHUSDUWRI}JXUH Pole with heavy insect bite on places.

 Kultobjekt. <RUXED 1LJHULD + FP .RUEJH~HFKW .DXUL schnecken, Baumwollstoff. Kultobjekt, „Haus des Kopfes“, ile ori. Zylindrischer Behälter mit konisch konzipiertem Deckel. %DVLV DXV .RUEJH~HFKW LQQHQ PLW KDQGJHZHEWHP %DXPZROO stoff gefüttert. Mit Ausnahme von vier dreieckigen, mit Leder besetzten Segmenten und Amuletten vollständig mit Kauri schnecken besetzt. Mit Leder überzogener Knauf an der Spitze. Intakt. 400,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  Yoruba, Nigeria ritual object „house of head“ ile ori. Cylindrical conceived container with conical lid, on a wickerwork base, the inside lined with handwoven cotton fabric, the outside completely covered with cowry shells and with triangular segments on four sides, covered with leather and amulets. /HDWKHUFRYHUHGNQRERQWRS,QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZLOOLQJV}JXUYoruba, Nigeria. H 26cm. Holz. Weibliche Zwil OLQJV}JXULEHGMLwPLWKRKHUEODXJHI”UEWHU]ZHLJHWHLOWHU)ULVXU Narbentatauierungen auf den Wangen und Schmuckketten um Beine, rechten Arm und Hals. Intakt mit brauner Patina. 450,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  <RUXED1LJHULDIHPDOHWZLQ}JXUHLEHGMLwZLWKEOXHG\HGWZRSDUWLWHWRZHULQJ FRLIIXUHVNLQVFDUL}FDWLRQPDUNVRQWKHFKHHNVDQGYDULRXVVWULQJVRIJODVV beads around neck, feet and right arm. Brown patina, intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 )LJ©UOLFKHU 3IRVWHQ DXV +RO] Yaka, D. R. Kongo. H 85,5cm. Dorfwächterpfosten mit pfahlförmigem Körper und plastisch ausgearbeitetem Kopf mit winkelförmigem Kopfputz, blau, weiß und rötlich bemalt mit typischer nach oben gebogener Nase, IDVWGLH6WLUQEHU©KUHQGJURgHQ.DVWDJQHWWHQI¤UPLJHQ$XJHQ mit schmalen Schlitzen und leicht nach oben gebogenem Mund. Risse vorne, Kante am Kopfputz abgebrochen, unterer Teil teil weise von Insektenfraß beschädigt. 600,– Provenienz: Aus dem Bremer Kunsthandel.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 3IRVWHQ}JXUDXV+RO]Konso, Äthiopien. H 110cm. Gedenkpfo VWHQ}JXUPLWSIDKOI¤UPLJHP.¤USHUXQGSODVWLVFKDXVJHDUEHLWH tem Kopf mit länglichem Gesicht, spitz zulaufendem Kopfputz, runden, hervortretenden Augen, gerader Nase und nur rudi mentär vorhandenen kleinen Ohren. Kleine Fehlstellen auf Nase XQG.RSISXW]DP3IRVWHQ,QVHNWHQXQG6FKQHFNHQ " )UDg 400,– 3URYHQLHQ]$XV7ULEDO$UW$XNWLRQ=HPDQHN:©U]EXUJ .RQVR(WKLRSLDPHPRULDOSRVWZLWKSROHVKDSHGERG\DQGZHOOFDUYHGKHDG with elongated face and tapering headgear, round protruding eyes, straight nose and rudimentary small ears. Small missing parts on nose and headgear, insect and snail (?) bite on pole. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

800 3IRVWHQ}JXU€ERFFKLRyDXV+RO])RQ%HQLQ+FP3IRVWHQ} gur mit walzenförmigem Körper, bei dem nur der obere Teil mit Armen angedeutet ist, und rundlichem Kopf. Durch die lange Beopferung sind die Gesichtszüge nur schlecht erkennbar. Risse und etwas Insektenfraß im Oberkörper, unterer Teil durch star ken Insektenfraß teilweise zerstört. 350,– Provenienz: Aus Berliner Sammlung. )RQ %HQLQ SRVW }JXUH ZLWK F\OLQGULF ERG\ WKH XSSHU SDUW DQG DUPV RQO\ LQGLFDWHGEDOOVKDSHGKHDG/RQJWLPHVDFUL}FDWLRQVPDGHWUDLWVRIIDFHKDUGO\ YLVLEOH/RZHUSDUWRI}JXUHSDUWO\GHVWUR\HGE\LQVHFWELWH VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

801 6WHKHQGHZHLEOLFKH+RO]}JXUMossi, Burkina Faso. H 69,5cm. Mit rechteckigen Augen und ebensolchem kleinen Mund und mit nach hinten ausladender Kammfrisur und vertikal gestalte ten ovalen Ohren. Die Figur stand auf einem Pfosten. Zahlreiche kleinere und größere Risse, kleinere Teile der Brüste und Arme abgebrochen, Füße und Teile des Sockels nur noch fragmenta risch erhalten. 400,–

<DND'5RI&RQJRSROHVKDSHGYLOODJHJXDUGLDQ}JXUHZLWKF\OLQGULFERG\ DQGZHOOFDUYHGKHDGZLWKFKHYURQVKDSHGKHDGJHDUSDLQWHGEOXHUHGDQG white, and with typical upturned nose, its tip almost touching the forehead. /DUJHFDVWDJQHWWHVKDSHGH\HVZLWKVOLWVDQGVOLJKWO\XSWXUQHGPRXWK&UDFNV RQIURQWRQHHGJHRIKHDGJHDUEURNHQRIIORZHUSDUWRI}JXUHSDUWO\GDPDJHG by insect bite.

3URYHQLHQ]$XV6DPPOXQJ7KRPDV:DLJHO3}Q]WDO

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

284

6WDQGLQJ 0RVVL %XUNLQD )DVR IHPDOH SROH }JXUH ZLWK EDOOVKDSHG KHDG UHFWDQJXODUH\HVDQGUHFWDQJXODUVPDOOPRXWKDQGZLWKFUHVWHGFRLIIXUH~DULQJ on rear. Numerous small and large cracks, small parts of breast and arms broken off, feet and pole only in fragmentary parts existing.


802 .XOW}JXUI©U(VKXDXV+RO]Yoruba, Nigeria. H 43cm. Stehen GH )LJXU GHV 7ULFNVWHUJRWWHV (VKX VFKZDU] JHI”UEW PLW ©EHU JURgHP DXVODGHQGHQ =RSI DP (QGH PLW HLQHU JHVFKQLW]WHQ knienden weiblichen Figur, um den Hals geschmückt mit Kauri schnecken an Lederband mit Schneckengehäuse und Kette mit NOHLQHQURWHQXQGDQGHUHQ3HUOHQ(OLSVHQI¤UPLJH1DUEHQWDWDX ierungen an den Wangen und aus parallelen Zopfreihen geord QHWH)ULVXU(VKXWU”JWHLQJURgHV0HVVHU©EHUGHU6FKXOWHUXQG kleine an den Beinen in geschnitzten Scheiden. $OWH(WLNHWWHQDP +RO]VRFNHO Intakt. 350,– Provenienz: Ex Sammlung R. C. Krell, München. <RUXED 1LJHULD VWDQGLQJ }JXUH RI WKH EODFNHQHG WULFNVWHU JRG (VKX ZLWK RYHUVL]HG~DULQJSODLWFDUYHGDWWKHHQGZLWKDNQHHOLQJIHPDOH}JXUHDURXQG the neck a string of cowrys on leather band and a string of red and other glass EHDGV(OOLSVRLGVNLQVFDUL}FDWLRQPDUNVRQFKHHNVFRLIIXUHIRUPHGE\SDUDOOHO rows of plaits, and wearing a large knife over his right shoulder and smaller knives with carved sheaths on his legs. Intact. Old labels on wooden base! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

803 =ZHL +RO]}JXUHQ Westafrika. H 21 und 28cm. Zwei bunt be PDOWH&RORQ)LJXUHQHLQHDP6FKUHLEWLVFKVLW]HQGXQGWHOHIR nierend, die andere mit Krawatte und ein Buch unter dem Arm haltend, beide mit Tropenhelm. Vermutlich jüngere Arbeiten für GHQ.XQVWPDUNW'D]XZHLEOLFKH3XSSHXQEHNDQQWHU(WKQLHPLW ausgebreiteten Armen, gänzlich umwickelt mit verschiedenen Stoffen (L 18cm). 6W©FN Intakt. 350,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ

805 =HUHPRQLDOVWDE DXV +RO] Wohl Kundu, Kamerun. L 28,5cm, PLW6RFNHO/FP9HUPXWOLFK2EHUWHLOHLQHV=HUHPRQLDOVWD bes, geschnitzt mit zwei Rücken an Rücken stehenden Figu ren, mit einem Lendenschurz bekleidet und einen Stab vor sich KDOWHQG (LQH GHU )LJXUHQ PLW DEJHZHQGHWHP .RSI 9HUZLWWH rungsspuren. 350,– Provenienz: Privatsammlung U. C., Norddeutschland. Probably Kundu, Cameroon supposedly upper part of a ceremonial staff, FDUYHGZLWKWZRVWDQGLQJ}JXUHVZHDULQJORLQFORWKVHDFKKROGLQJDF\OLQGULFDO VWDII LQ IURQW 2QH RI WKH }JXUHV ZLWK KHDG WXUQHG WR WKH VLGH 7UDFHV RI weathering. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

806 =HUHPRQLDOVWDEDXV+RO]Yoruba, Nigeria. H 34cm. Janusförmi ger, teilweise wohl mit „Rickett‘s washing blue“ gefärbter Zere monialstab für den Donnergott Shango, oshe shango. Reichlich geschnitzt mit dem doppelten Donnerkeil, den auch ein Ja nuskopf in der Mitte schmückt, sowie an den Seiten, ebenfalls beschnitzt das islamische Amulett ‚tirah‘. Risse und etwas Insek tenfraß im Oberkörper, unterer Teil durch starken Insektenfraß teilweise zerstört. 200,– Provenienz: Ex Sammlung Rudolf Indlekofer, Basel, erworben bei Auktion Lempertz, Brüssel. Yoruba, Nigeria ceremonial janiform staff for the thunder god Shango, oshe shango. Partly painted with „Rickett‘s washing blue“ and richly carved with WKHGRXEOHD[HV\PEROLQWKHFHQWHUFDUYHGZLWKDQRWKHUMDQLIRUPKHDGDQG with the Islamic amulet tirah on either side.

7ZR:HVW$IULFDQ&RORQ}JXUHVRQHVHDWHGRQDGHVNDQGKROGLQJDSKRQH the other wearing a tie and holding a book under his arm. Probably later works fort the art market. Included in the lot is a doll of unknown ethnic group with spread out arms and completely covered with various fabrics. Intact. 3 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL)XgVFKDOHQDXV+RO]Wohl Amhara, Äthiopien. Ø 56,5 und 25cm. Zwei Präsentierschalen aus schwarzbraun patiniertem Holz. 6W©FN Intakt. 350,–

804 +RO]}JXU/REL%XUND)DVR(OIHQEHLQN©VWH+FP6WHKHQGH Figur, vermutlich männlich, den rechten Arm an den Leib ge legt, den linken an das Kinn führend. Am ganzen Körper kleine Risse, Füße fehlen, starker Insektenfraß an der linken Seite. 250,– Provenienz: Aus alter französischer Privatsammlung. 6WDQGLQJ/REL%XUNLQD)DVR,YRU\&RDVW}JXUHRIXQGH}QHGVH[LWVULJKW arm touching the abdomen, the left arm touching the skin. Small cracks on the whole body, left side with heavy insect bite. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ 7ZRSUHVHQWLQJERZOVUHVWLQJRQFRQLFDOIHHWRQHZLWK~DWWDEOHOLNHSODWHDQG VPDOOULPWKHRWKHUVPDOOHURQHZLWKVOLJKWO\~DULQJVPDOOULPDQGLQFLVHG with rows of lines. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

808 =ZHL .RSIVW©W]HQ DXV +RO] Gurage und Burdji, Äthiopien. H  XQG FP *XUDJH *UDYLHUW XQG GXUFKEURFKHQ JHDUEHLWHW Burdji: ovale Platte mit blockartiger Stütze. 6W©FN Intakt. 250,– Provenienz: Privatsammlung U. C., Norddeutschland. Two wooden headrests, one Gurage, Ethiopia, the other Burdj, Ethiopia. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

285


809 Baumleiter. Dogon, Mali. H 193cm. Charakteristisch konzipierte Baumleiter aus braun patiniertem Holz (Inv. 1). Intakt. 520,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990. Dogon, Mali ladder. Brown patinated wood. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

810 +RO]EHWW 6HQXIR (OIHQEHLQN©VWH / FP 6FKPDOHV %HWW DXI vier Beinen ruhend mit geschnitztem Kopfteil (Inv. 28). Braune Gebrauchspatina, teilweise starker Insektenfraß an den Beinen. 520,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990. 6HQXIRQDUURZVL]HGZRRGHQEHGZLWKFDUYHGKHDGSLHFHUHVWLQJRQIRXUOHJV Traces of wear and tear, partly heavy insect bite on legs. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

811 6DPPOXQJ +RO]W©UULHJHO %DPEDUD %DPDQD  0DOL (LQ 6W©FN mit einem Krokodil, eines mit einer anthropomorphen Figur und eines mit einem abstrakten Kopf (Inv. 38). 6W©FN Intakt. 280,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990. Three Bambara (Bamana ), Mali door locks, one carved with a crocodile, RQHZLWKDQDQWKURSRPRUSKLF}JXUHDQGRQHZLWKDQDEVWUDFWKHDG,QWDFW 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

812 =ZHL+RO]KRFNHUNyamwezi, Tansania und Yoruba, Nigeria. a) H 36,5cm, Ø 45cm. Großer Hocker (Nyamwezi) auf vier Bei nen ruhend mit runder Platte, am Rand mit zwei Reihen ein JUDYLHUWHQ =LFN]DFN0XVWHUV $XVJHSU”JWH *HEUDXFKVVSXUHQ kleine Risse und Beschädigungen. b) H 23cm, Ø 23,5cm. Klei ner Hocker (Yoruba) auf vier, männlich und weiblich alternie renden, sitzenden Figuren ruhend mit runder Platte und runder 6LW]~”FKH)DUEVSXUHQXQGDXVJHSU”JWH*HEUDXFKVVSXUHQ]ZHL große Risse jeweils an oberer und unterer Platte (Inv. 18 und 19). 6W©FN 650,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990. Two stools, one Nyamwezi, Tanzania resting on four slightly bent feet and a round base with zigzag ornaments in two rows on rim, and a Yoruba small VWRROUHVWLQJRQIRXUIHPDOHDQGPDOHDOWHUQDWLQJVHDWHG}JXUHVZLWKURXQG bas and round seat, and with relics of various colours. Small cracks and minor damages on Nyamwezi stoll, two large cracks on the upper and lower plate. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

286

813 6DPPOXQJ +RO]KRFNHU %DPLOHNH  %DPXP .DPHUXQ +   31,5cm. Zwei runde Hocker aus dunkelbraun patiniertem Holz JHVW©W]WDXIULQJI¤UPLJH(OHPHQWH6S”WHUH$UEHLW=ZHLZHLWHUH Hocker mit hellbraunem und gelblichen Holz auf rechteckigen Stützen ruhend. Die beiden letzteren Hocker mit Gebrauchs spuren. 6W©FN Der größere runde Hocker mit kleinem Riss, der kleine runde Hocker mit Restaurierungen. 650,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ Four Bamileke/Bamum, Cameroon stools. Two of circular form and with ULQJVKDSHGEDVHVZLWKGDUNEURZQSDWLQDWKHRWKHUWZRRIOLJKWEURZQZRRG and rectangular shape, resting on square bases. Only the latter two with traces of tear and wear. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

814 6DPPOXQJ+RO]KRFNHUBamileke / Bamum, Kamerun. H 40cm, Ø 43cm und H 23cm, Ø 23,5cm. Großer runder Hocker, durch brochen gearbeitet mit Tierköpfen. Neuere Arbeit, keine Ge brauchspuren. Dazu kleiner runder Hocker, durchbrochen mit DEVWUDNWHP6SLQQHQPRWLYJHDUEHLWHW6LW]~”FKHU¤WOLFKJHI”UEW2 6W©FN Kleiner Riss am kleinen Hocker. 650,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ Two Bamum / Bamileke, Kamerun circular stools, the larger one with openwork showing rows of animal heads, the smaller one also with openwork showing arranged abstract spider patterns, the seat dyed reddish and with crack. Later works, no traces of usage. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

815 6DPPOXQJ +RO]KRFNHU Bamum / Bamileke, Kamerun und 1\DPZH]L8VDPEDUD%HUJH7DQVDQLDVRZLH%DPEDUD %DPD QD  0DOL +   FP D  =ZHL +RFNHU DXV .DPHUXQ EHLGH auf rechteckigen Stützen ruhend, der größere mit Rautenmu ster auf den Stützen und winkelförmigem Muster am Sitzrand geschnitzt. Beide mit bräunlicher Patina. b) Hocker mit runder 6LW]~”FKHYRQGHQ1\DPZH]LRGHUDXVGHQ8VDPEDUD%HUJHQ auf drei Beinen ruhend, mit dunkelbrauner Patina. c) Hocker PLWYLHUHFNLJHU6LW]~”FKHDXIYLHUUHFKWHFNLJHQPLW.DQQHOXUHQ und kreuzförmigen Motiven geschnitzten Beinen ruhend und mit einem Haltegriff versehen, der eine Maske zeigt.  6W©FN Alle Hocker mit Gebrauchsspuren. 650,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ Four stools thereof two from Cameroon resting on square posts, one stool from Tanzania resting on three legs with circular seat, and one from Mali carved with a handle showing a mask. All stools with traces of tear and wear. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


816 +RO]KRFNHU%DPLOHNH%DPXP.DPHUXQ+FPkFP Runder Hocker, die Basis durchbrochen mit dem Spinnenmo WLYJHDUEHLWHW%UDXQHDXIGHU6LW]~”FKHJO”Q]HQGH3DWLQD*H EUDXFKVVSXUHQ5HVWDXULHUXQJDQGHU6LW]~”FKH%UDQGVWHOOHXQG Schaden am Standring. 580,–

820 0DULRQHWWH Bambara (Bamana) oder Bozo, Mali. H 66cm. :HLEOLFKH 0DULRQHWWHQ}JXU DXV +RO] JHOE ZHLg XQG VFKZDU] bemalt. Mit Frisur aus vier großen Zopfreihen, die rückwärts über den langen Hals fallen. Sie ist mit einem bunten Stoff mit Bordüre bekleidet. Intakt. 350,–

3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ

3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ

Bamileke / Bamum, Cameroon circular stool, carved in openwork with the spider motif. Brown glossy patina on seat, restaurations on seat and on circular base with smaller damages, traces of wear and tear.

Bambara (Bamana) or Bozo female puppet, painted white, yellow and black with elaborate coiffure, arranged in four large plaits falling back behind the long neck. She is wearing a coloured fabric lined by a fabric bord.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ +RO]SXSSHQ 0RVVL %XUNLQD )DVR /   FP Gruppe von vier Fruchtbarkeitspuppen in abstrakter Gestalt mit geschnitzten oder angedeuteten Brüsten, teilweise ziseliert. 4 6W©FN Braune, glänzende Gebrauchspatina und Gebrauchsspu ren. 600,–

821 Paar Fußreife aus Kupferblech. Ibo, Nigeria. Ø 40cm. Zwei gro gHVFKHLEHQI¤UPLJH)XgUHLIHPLWU¤KUHQI¤UPLJHP(LQVWLHJXQG zahlreichen, geweißten Punzierungen mit verschiedenen Moti ven (Inv. 26). Spuren von Grünspan. 600,–

Provenienz: Privatsammlung U. C., Norddeutschland. Mossi, Burkina Faso group of four fertility dolls in abstract form with carved or indicated breasts, partly incised. Brown glossy patina on places. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

818 6DPPOXQJ+RO]SXSSHQMossi und Kurumba, Burkina Faso. L FP'UHLNOHLQHUH)UXFKWEDUNHLWVSXSSHQGHU0RVVL teilweise ziseliert und mit geschnitzten Brüsten. Braune, glänzende *HEUDXFKVSDWLQD8QGHLQH3XSSHGHU.XUXPEDPLWVFKZDU] brauner, glänzender Patina. 6W©FN Gebrauchsspuren. 600,– Provenienz: Privatsammlung U. C., Norddeutschland. Mossi, Burkina Faso group of three small Mossi fertility dolls in abstract form with carved breasts, partly incised, brown glossy patina on places, and one .XUXPEDIHUWLOLW\GROOZLWKEODFNLVKEURZQJORVV\SDWLQD4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

819 0DWWH XQG 3XSSH D   [ FP 5LQGHQVWRII ,WXUL0DWWH RGHU ZDQGEHKDQJ DXV VFKZDU] JHOE XQG U¤WOLFK JHI”UEWHP Rindenstoff bemalt mit dreieckigen und oktogonalen Motiven, HLQJHIDVVWPLWHLQHPQDWXUIDUEHQHQ5DI}DJHZHEHXQG3RPSRQV ,QY  E  + FP 1GHEHOH 3XSSH YHUPXWOLFK DXV +RO] gänzlich mit bunten Glasperlen bedeckt (Inv. 13). Sie trägt eine 7LDUD”KQOLFKH .RSIEHGHFNXQJ XQG YHUVFKLHGHQH $FFHVVRLUHV Die Puppe wurde vor Ort von dem dort über 50 Jahre tätigen Missionar Josef Metz erworben. 6W©FN Intakt. 590,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990. Collection of a mat and a doll: a) Ituri rain forest area bark cloth mat, painted black, yellow and reddish in triangular and octogonal motifs, lined on the sides with raphia weave and small pompons. b) Doll, probably made of wood, HQWLUHO\FRYHUHGZLWKFRORUHGJODVVEHDGV6KHZHDUVDWLDUDOLNHKHDGGUHVV and various accessories. The doll was acquired locally from the missionary Josef Metz, who worked there for over 50 years. 2 pieces!

Provenienz: Ex Sammlung K. W., Bayern, vor 1990. 7ZR,ER1LJHULDODUJHGLVFVKDSHGDQNOHWVZLWKWXEHVLQWKHFHQWHUIRU}WWLQJ and with numerous punched and whitened motifs. Traces of verdigris. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

822 %HLQPDQVFKHWWH DXV %URQ]H (NRQGD '5 .RQJR + FP Beinspange mit drei umlaufenden Ringen geschmückt. Bräun liche Patina, intakt. 300,– Provenienz: Aus alter belgischer Sammlung. (NRQGD'5RI&RQJREURQ]HOHJFXI~LQJGHFRUDWHGZLWKWKUHHFLUFOLQJULQJV Brownish patina, intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

823 )XgUHLIH DXV 0HVVLQJ Peulh, Nigeria. H 9cm, Ø 12,5cm. Mit verschiedenen Motiven ziseliert. Intakt. 200,– Provenienz: Ex Sammlung U. C., Norddeutschland. Large Peulh, Nigeria anklet incised with various motifs. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

824 %HLQVWXOSH DXV 0HVVLQJ 6HQXIR (OIHQEHLQN©VWH + FP Ø 12cm. Aufklappbarer Fußreif mit halben konzentrischen Kreisen und anderen Motiven geschmückt. Intakt. 200,– Provenienz: Privatsammlung U. C., Norddeutschland. Senufo, Ivory Coast brass anklet. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

287


825 Oberarmreif und Flöte. Gurunsi oder Tamberma, Burkina Faso XQG0RVVL+”OIWH-K2EHUDUPVFKPXFNDXV(OIHQEHLQDXV %XUNLQD)DVR/FP3OXVHLQH0RVVL)O¤WHLQDQWKURSRPRU pher Gestalt mit schwarzbrauner, glänzender Patina, L 33cm. 2 6W©FN9HUVDQGQXULQQHUKDOEGHU(8 Intakt. 350,–

829 Sammlung Silberschmuck. Peulh u.a., Kamerun / Nigeria. Ø 3,5 FP9HUVFKLHGHQH$UPUHLIHXQGVSDQJHQDXV6LOEHUOHJLH rungen sowie ein Ring, teilweise gepunzt. 6W©FN Intakt. 250,–

Provenienz: Privatsammlung U. C., Norddeutschland.

Group of silvery seven bracelets, bangles and a ring, partly punched. 7 pieces!

Gurunsi or Tamberma, Burkina Faso upper armlet. Included in the lot is a 0RVVL~XWHZLWKEODFNLVKEURZQJORVV\SDWLQDVWKDOIWKFHQWXU\$'2 pieces! Shipment only inside E.U.!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ

826 $UPVSDQJH DXV %URQ]H %DXOH (OIHQEHLQN©VWH k FP *H schmückt mit Kannelüren und halben konzentrischen Kreisen. Kleine Ausbrüche. 250,–

830 6DPPOXQJ0HVVLQJVFKPXFN:HVWXQG1RUGZHVWDIULND/DQJH .HWWHPLWJHSXQ]WHQ6LOEHUXQG%HLQSHUOHQFD/FPZRKO Marokko. Dazu kleiner Armreif aus Bronze, aufklappbar und geschmückt mit konzentrischen Kreisen, wohl Bobo, Burkina Faso, und eine Spange aus Bronze, Peulh, Nigeria sowie eine UHOLH}HUWH0HVVLQJVSDQJHHEHQIDOOV3HXOK6W©FN Intakt. 400,–

3URYHQLHQ]([3ULYDWVDPPOXQJ.)6FK”GOHU0©QFKHQ

Provenienz: Ex Sammlung U. C., Norddeutschland.

Baule, Ivory Coast bronze bangle. Small chips.

Marocco necklace with punched silver beads and bone beads. Included in the lot is a Peulh, Nigeria, bronze bangle, and another Peulh reliefed brass bangle. Intact. 4 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL3UHVWLJHKDOVUHLIHDXV%URQ]HYoruba, Nigeria und Teke, D. 5.RQJRkFP <RUXED XQGFP 7HNH EHUGLPHQVLR QLHUWHU+DOVUHLIPLWVFKHLEHQI¤UPLJHQ(QGHQXQGNUHLVI¤UPLJH 3ODWWHQPLW]HQWUDOHP'RUQ <RUXED XQG~DFKHU+DOVUHLIGLH Oberseite vollkommen ziseliert mit geometrischen und kurvili nearen Motiven (Teke). 6W©FN Intakt. 500,–

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

831 6DPPOXQJ $UPUHLIH .DPHUXQ  1LJHULD k   FP )©QI $UPUHLIH DXV 0HVVLQJ GDYRQ ]ZHL PLW UHOLH}HUWHQ 0RWLYHQ geschmückt, einer gepunzt und zwei durchbrochen mit ge ~RFKWHQHP0XVWHUJHDUEHLWHW6W©FN Intakt. 350,–

3URYHQLHQ]([$IULND*DOHULH:LHQ

3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ

Two Yoruba, Nigeria and Teke D. R. of Congo prestige necklaces, thereof RQHZLWKRYHUVL]HGPHDVXUHPHQWVGLVFVKDSHGHQGVZLWKSRLQWHGSURWUXVLRQV <RUXED WKHRWKHU~DWRQHHQJUDYHGZLWKYDULRXVJHRPHWULFDQGFXUYLOLQHDU motifs (Teke). Intact. 2 pieces!

*URXSRI}YH&DPHURRQDQG1LJHULDQEUDVVEUDFHOHWVWKHUHRIWZRZLWKUHOLHI RQHSXQFKHGDQGWZRZLWKRSHQZRUNQHWVKDSHGPRWLIV,QWDFW5 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

828 Ringe, Goldgewichte, Schellen aus Westafrika. Senufo, Peulh, $VKDQWLXQG%RERD =ZHL0HVVLQJ*HZLFKWH]XP:LHJHQYRQ Goldstaub (Währung bis ca. 1912 in Ghana), sitzender Truthahn " XQG6FKLOGE 'UHL5LQJHDXVWHLOZHLVH]LVHOLHUWHU6LOEHUXQG Messinglegierung, Peulh, Nigeria / Mali. c) Ring aus Bronze mit HLQHP&KDP”OHRQ6HQXIR(OIHQEHLQN©VWHG =ZHL6FKHOOHQDXV Bronze, Bobo, Burkina Faso. 6W©FN Intakt. 250,– Provenienz: Ex Sammlung U. C., Norddeutschland. Collection of jewellry and other items: a) Two Ashanti, Ghana „gold weights“, bird and shield. b) Three Peulh, Nigeria / Mali silver rings, partly incised. c) Senufo, Ivory Coast bronze ring with chameleon. d) Two bobo, Burkina Faso bronze bells. 8 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

288

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

832 Sammlung Schmuck. :HVWDIULNDkFP6LHEHQ$UPUHLIH XQGVSDQJHQDXV0HVVLQJWHLOZHLVHJUDYLHUWDOV6SLUDOHJHDUEHLWHW oder mit Noppen versehen. Dabei drei kleine Schlüssel, wohl als magische Utensilien verwendet, und eine abstrakte eiserne 9RJHO}JXU6W©FN Intakt. 300,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ Group of seven West African brass bracelets and bangles, some engraved, one worked as a spiral and some decorated with burls. Included in the lot are three small keys supposedly used as magical utensils and an iron abstract ELUG}JXUH,QWDFW11 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


833 6DPPOXQJ0HVVLQJVFKPXFN6HQXIR(OIHQEHLQN©VWH3HXOKXD )©QI$UPUHLIHXQGVSDQJHQWHLOZHLVH]LVHOLHUW6W©FN Intakt. 200,– Provenienz: Ex Sammlung U. C., Norddeutschland. Five brass bracelets and bangles, partly incised. Senufo, Ivory Coast, Peulh and others. Intact. 5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

834 6DPPOXQJ 0HVVLQJVFKPXFN 6HQXIR (OIHQEHLQN©VWH 3HXOK XD$UPUHLIHXQGVSDQJHQWHLOZHLVH]LVHOLHUWGDYRQ]ZHLDXV Silberlegierung, zwei aus Messing und einer aus Messing mit Beineinlagen. 6W©FN Intakt. 200,– Provenienz: Ex Sammlung U. C., Norddeutschland. Five silver and brass bracelets and bangles, thereof two of silver, two of brass and one of brass with bone inlays. Senufo, Ivory Coast and Peulh and others. Intact. 5 pieces!

 (OIHQEHLQN”PPH $VKDQWL *KDQD  +”OIWH  -K / FP Zwei kleine Kämme, ziseliert und durchbrochen gearbeitet. 2 6W©FN 6HKU VHOWHQ 9HUNDXI QXU LQQHUKDOE GHU (8 Bei einem Kamm kleine Teile der Zähne abgebrochen. 300,– Provenienz: Privatsammlung U. C., Norddeutschland. Two Ashanti, Ghana, Ivory Coast combs, incised and carved with openwork. 1st half 20th century! 2 pieces! Shipment inside E.U. only! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

838 +RO]N”PPH :HVWDIULND YHUPXWOLFK $NDQ (OIHQEHLQN©VWH  *KDQD /   FP 9LHU .”PPH EUHWWDUWLJ JHVWDOWHW ]L seliert und durchbrochen gearbeitet. 6W©FN Unterer Teil einer Spitze abgebrochen. 200,– Provenienz: Ex Sammlung U. C., Norddeutschland. Four wooden West African combs, incised and carved with openwork, probably Akan. 4 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

835 6DPPOXQJ0HVVLQJVFKPXFN6HQXIR(OIHQEHLQN©VWH3HXOKXD )©QI$UPUHLIHXQGVSDQJHQWHLOZHLVH]LVHOLHUW6W©FN Intakt. 200,–

839 %URQ]HJORFNHQ Tschadsee, vermutlich Sao. H 22cm, 5cm und FP 5HOLH}HUW PLW YHUVFKLHGHQHQ JHRPHWULVFKHQ 0RWLYHQ 2 6W©FN6HKUVHOWHQ Intakt. 400,–

Provenienz: Ex Sammlung U. C., Norddeutschland.

Provenienz: Privatsammlung U. C., Norddeutschland.

Five brass bracelets and bangles, partly incised. Senufo, Ivory Coast, Peulh and others. Intact. 5 pieces!

Two Lake Tchad bronze bells, decorated with various geometric motifs. 2 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

836 +RO]N”PPH%HWHXQG*XUR(OIHQEHLQN©VWH$VKDQWL*KDQD /FP9LHU.”PPHGDYRQ]ZHL}J©UOLFK]ZHLDEVWUDNW gestaltet: a) Gehörnter Kopf, Oberkörper mit Dreiecksmoti YHQJHVFKQLW]W*XUR(OIHQEHLQN©VWHE .RSIDXIODQJHP+DOV 2EHUN¤USHU PLW 'UHLHFNVPRWLYHQ XQG (QWHQ U©FNZ”UWV  JH VFKQLW]W%HWH(OIHQEHLQN©VWHF XQGG %HLGHEUHWWDUWLJNRQ]L piert, durchbrochen gearbeitet und mit verschiedenen Motiven geschnitzt, Ashanti, Ghana.  6W©FN Kleine Teile der Spitzen abgebrochen (Ashanti und Bete). 400,–

840 Zwei Flöten. .DPHUXQHU*UDVODQG/FPXQG/FP(LQ 6W©FNDXV+RO]GDVDQGHUHDXV(OIHQEHLQ6W©FN 9HUNDXIQXU innerhalb der E.U.! Intakt. 350,–

Provenienz: Ex Sammlung U. C., Norddeutschland.

3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ 7ZR&DPHURRQ*UDVV}HOG~XWHVRQHRILYRU\WKHRWKHUPDGHRIZRRG 2 pieces! Shipment inside E.U. only! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Four wooden combs, therof two carved anthropomorphic (Guro and Bete), the other two abstract conceived, incised and carved with openwork (Ashanti). 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

289


841 Trommel. Yoruba, Nigeria. H 58cm. Holz, Leder. Große Trom mel, bunt bemalt und getragen von einer knienden weiblichen Figur mit großen Augen, großer Nase und geöffnetem, die Zäh ne zeigenden Mund. Die Trommel ist beschnitzt mit Dreiecks PRWLYHQ(LQLJHJU¤gHUH5LVVHXQG%HVFK”GLJXQJHQEHVRQGHUV am linken Teil der Figur und am rückwärtigen Teil der Trom mel. 600,– 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ*HUWXQG0DUHLGL6WROO  Yoruba, Nigeria large drum painted in various colours and supported by a NQHHOLQJIHPDOH}JXUHZLWKODUJHH\HVODUJHQRVHDQGRSHQPRXWKVKRZLQJ the teeth, the drum itself carved with triangular motifs. Some wear and tear DQGPDMRUFUDFNVRQOHIWVLGHRI}JXUHDQGUHDUVLGHRQGUXP VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

842 Trommel. .DPHUXQ+FP+RO]/HGHU*URgH7URPPHOPLW /HGHUEH]RJHQXQGPLWJH~RFKWHQHQ3~DQ]HQIDVHUQXPZLFNHOW Dazu Geldketten aus Samenperlen. Intakt, keine Gebrauchsspu ren. 300,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ &DPHURRQGUXPFRYHUHGZLWKOHDWKHUDQGZRXQGZLWKSODLWHGSODQW}EHU Intact, no traces of use. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

843 =ZHL0HVVHUHadendoa (Beni Amer), Sudan. L 30 und 34,5cm. +RO](LVHQ/HGHU=ZHL0HVVHUPLWHLVHUQHUJHNU©PPWHU.OLQ ge und hölzernem, mit Silberdraht eingelegtem Griff. Beide mit Lederscheide, eine davon mit verschiedenen Motiven gepunzt. 2 6W©FN Gebrauchsspuren. 500,– Provenienz: Ex Sammlung F. X. M., Oberbayern, 1930er bis 1940er Jahre. Two Hadendoa, Sudan knives with iron curved blades, wooden handles inlaid with silver wire, and with leather sheaths, one punched with various motifs. Traces of usage. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

844 =ZHL0HVVHUHadendoa, Sudan. Krummdolch (L 39cm) mit ei VHUQHU .OLQJH XQG *ULII DXV (EHQKRO] HLQJHOHJW PLW VLOEHUQHQ runden, gepunzten Plättchen und mit Silberdraht umwunden. Mit gepunzter und bemalter Lederscheide, Spitze und Ober teil mit Silber beschlagen und mit aufgelegten Ornamenten ver VHKHQ 'D]X 0HVVHU PLW HLVHUQHU .OLQJH XQG (EHQKRO]JULII / 34cm). 6W©FN Gebrauchsspuren. 300,– Provenienz: Ex Sammlung F. X. M., Oberbayern, 1930er bis 1940er Jahre. Two Hadendoa, Sudan knives: Knife with curved iron blade, the ebony handle with silver punched dotted inlay and wound with silver wire, and with punched and painted leather sheath, protected by silver plates with ornaments in relief. Traces of wear and tear. Included in the lot is a knife with iron blade and ebony handle. Blade with rust, no traces of usage. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

290

845 6WHLQVFKORVVJHZHKUXQGVHFKV/DQ]HQKamerun. L 103cm und FP+RO]0HWDOO6WHLQVFKORVVJHZHKUYHUPXWOLFKHQJ lischer Bauart mit gravierter Messingplatte. Dazu sechs Lanzen, lediglich die Spitzen teilweise gebraucht. 6W©FN Intakt. 300,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ 3UREDEO\%ULWLVKUL~HZLWKDQHQJUDYHGEUDVVSODTXHRQWKHOHIWVLGH,QFOXGHG in the lot are six lances, only the points partly show traces of tear and wear. 7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

846 /DQ]H PLW *UDYXUHQ 1RUGDIULNDQLVFK    -K / FP Langgezogenes, eisernes Blatt, an der Wurzel mit beidseitigen, bandförmigen Gravuren und Messingtauschierungen, ober halb der Tülle beidseitig herausgeschmiedete Haken senkrecht zum Blatt, offen geschmiedete Tülle, Schaft aus dunkelbraunem Hartholz unterhalb der Tülle balusterförmig beschnitzt, eiserner Lanzenschuh in vierkantiger Spitze ausgeschmiedet. Gebrauchs VSXUHQ XQG VFK¤QH 3DWLQD %ODWW XQG 6FKXK HWZDV ~XJURVWLJ LQWDNW u Provenienz: Ex Gorny & Mosch, Auktion 272, 2020, Los 895; ex Sammlung Dr. Günter Wiedner, Bayern, 1980er Jahre bis 2015. Lance from North Africa of the 19th or 20th century. Elongated iron blade ZLWKGRXEOHVLGHGEDQGVKDSHGHQJUDYLQJVDQGEUDVVLQOD\VKRRNVIRUJHG RQERWKVLGHVVKDIWPDGHRIGDUNEURZQKDUGZRRGFDUYHGEDOXVWHUVKDSHG iron lance shoe forged in square tip. Signs of wear and nice patina, blade and lance shoe a bit rusty, intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL5DI}D*HZHEH.XED%XVKRRQJ'5.RQJR[FP 5DI}D XQG[FP 5DI}D3O©VFKJHZHEH 5DI}D*HZHEH teilweise schwarz gefärbt mit verschiedenen geometrischen 0RWLYHQ XQG 5DI}D3O©VFKJHZHEH WHLOZHLVH VFKZDU] JHI”UEW PLW6FKOLQJEDQGPRWLY5DXWHQXQGDQGHUHQ0RWLYHQJHZHEW2 6W©FN Intakt. 200,– 3URYHQLHQ]([$IULND*DOHULH:LHQ 7ZRUDSKLD.XED%XVKRRQJ'5RI&RQJRWH[WLOHV2QHZLWKSOXVKSDUWV woven with various motifs, the other with geometric motifs. Intact. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

848 =ZHL*HEHWVUROOHQXQGHLQHVLOEHUQH3ULHVWHUNU©FNHWohl Am hara, Äthiopien. a) Zwei Gebetsrollen (8,3 x 150cm und 11,5 [FP LQGHUUHOLJL¤VHQ6FKULIW*HyH]YHUIDVVWXQGPLW0D lereien versehen auf Pergament und in Lederhülle, 20. Jh. b) 6LOEHUQH0LQLDWXU3ULHVWHUNU©FNH +FP PLWYHUVFKLHGHQHQ Motiven graviert. 6W©FN Intakt. 150,– Provenienz: Ex Sammlung F. X. M., Oberbayern, 1930er bis 1940er Jahre. Lot of two Ethiopian praying stripes written in Ge‘ez and painted with various religious motifs, and an Ethiopian silver priest miniature crochet. Intact. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


849 =ZHL6W©FN3ULPLWLYJHOGXQG]ZHL=HUHPRQLDOVW”EHD /FP Holz. Zeremonialstab der Bobo (Burkina Faso), geschnitzt mit einer stehenden weiblichen Figur, die Hände an den Leib hal tend, mit zahlreichen Narbentatauierungen auf Gesicht, Körper und Armen, einer Lederumhüllung der Beine und oberem Teil des Stabes; über dem Kopf eine zylindrische Projektion; dunkel EUDXQH3DWLQD ,QY E /FP+RO]=HUHPRQLDOVWDEGHU (NHW1LJHULD " PLWGHP.RSIHLQHV0DQQHVPLWJH~RFKWHQHP langen Bart; verschiedene Schnitzereien am Stab (Inv. 31). c) [FP.XSIHU3ULPLWLYJHOG.DWDQJD.UHX]w ,QY G  /FP0HVVLQJ3ULPLWLYJHOGLQ)RUPHLQHV+w ,QY 4 6W©FN Gebrauchsspuren an beiden Stäben. 680,– Provenienz: Ex Sammlung K. W., Bayern, vor 1990. Collection of two ceremonial staffs and primitive money: a) Bobo ceremonial VWDIIFDUYHGZLWKDVWDQGLQJIHPDOH}JXUHZLWKKDQGVSODFHGRQWKHDEGRPHQ QXPHURXVVNLQVFDUL}FDWLRQPDUNVRQIDFHERG\DQGDUPVOHDWKHUZRXQGLQJ on legs and upper part of staff, and a cylindrical projection over the head. b) Eket (?) ceremonial staff, carved with the head of a man with long plaited beard; various carvings on the staff. c) Copper primitive money in the form of a cross, called („Katanga cross“). d) Brass primitive money in the form of an „H“. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

850 3ULPLWLYXQG6SHHUJHOG/RNHOHXD.RQJR/FP 3UL PLWLYJHOG  XQG FP 6SHHUJHOG  (LVHQ 9HUVFKLHGHQHQ )RU men; Speergeld liganda wurde außer von den Lokele auch von GHQ(VRXQG7XUXPEXLPQRUG¤VWOLFKHQ*HELHWGHU'HPRNUDWL schen Republik Kongo bis etwa um 1930 zum Kauf einer Braut, eines Sklaven oder eines Kanus verwendet (Inv. 20 und 22). 5 6W©FN Roststellen. 630,–

852 Wurfeisengeld ‚woshele‘. Nkutshu / Ndengese, D. R. Kongo. H FP)ODFKHLVHQPLWGUHLKDNHQI¤UPLJHQŠVWHQ,QWDNW 350,– Provenienz: Ex Sammlung Dr. Wolfgang Nerlich, München, aus alter Sammlung, Belgien. Nkutshu / Ndengese primitive money throwig knife. Intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

853 OJHP”OGHOnitsha, Nigeria. 51 x 43cm mit Rahmen. Ölgemäl GHDXI.DUWRQYRQ0LGGOH$UW6HOEVWSRUWU”WLP$Q]XJPLW(LQ stecktuch und goldenem Amulett um den Hals mit der Inschrift: „The Manager Middle Art 35 New Mkt. Rd. Onitsha Anambra 6WDWH1LJw,QWDNW u 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ Painting oil on cardboard, showing Middle Art in his black suit and with the inscription: „The Manager Middle Art 35 New Mkt. Rd. Onitsha Anambra State Nig.“ VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

854 OJHP”OGH:HVWDIULND[FP+RO])ULVHXUVFKLOGI©UHLQHQ +HUUHQ6DORQODXI6SHUUKRO]SODWWH(V]HLJWGHQ0HLVWHUEHL der Arbeit an einem Kunden, umrahmt von neun verschiedenen Frisurmodellen. Intakt. 450,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ

Provenienz: Ex Sammlung K. W., Bayern, vor 1990.

Advertisement poster for a gentlemen‘s barber shop, oil on wood, showing the master at work with a client, surrounded by nine different hairdo models.

Kongo primitive iron money in various forms; Lokele spear money liganda has also been used by the neighbouring Turumbu and Eso in the northeastern part of Democratic Republic of Congo around up the 1930s to buy brides, slaves or canoes. 5 pieces!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

851 Speergeld aus Eisen. /RNHOH ' 5 .RQJR + FP 6SHHU I¤UPLJHV(LVHQJHOGOLJDQGDYHUZHQGHWHEHQIDOOVYRQGHQQDFK EDUOLFKHQ (VR XQG 7XUXPEX LP QRUG¤VWOLFKHQ *HELHW GHU Demokratischen Republik Kongo. Bis etwa zum ersten Drittel des zwanzigsten Jahrhunderts zum Kauf einer Braut, eines Skla ven oder Kanus verwendet. Intakt. 400,– Provenienz: Aus dem Bayerischen Kunsthandel. Lokele, D. R. of Congo, blade of iron spear money liganda, used also by the neighbouring Eso and Turumbu in the Northeastern part of the Democratic Republic of Congo; up to the 30s of 20th century to buy brides, slaves or canoes. Intact.

855 =ZHLOJHP”OGHHU-DKUH%HLGH[FPRKQH5DKPHQ 0DVRQLW=ZHL*HP”OGHGHU7LQJDWLQJD6FKXOHD 9RQ0NXP ba, der eine Familie bei der Heimkehr vom Wald zeigt und b) YRQ&KDULQGDGHUGLH0$+2.$=HUHPRQLHLOOXVWULHUWDabei .DWDORJGHU5RVHQIHOG6DPPOXQJ'LH7LQJDWLQJD6FKXOH7KH Tingatinga School“. 6W©FN Intakt. 450,– Two paintings from the Tingatinga School, one by Mkumba, showing a family on return from the woods, and one from Charinda, illustrating the MAHOKA ceremony. Including in the lot is a catalogue of the Rosenfeld Collection „Die 7LQJDWLQJD6FKXOH7KH7LQJDWLQJD6FKRROw,QWDFW2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

291


856 =ZHLOJHP”OGHHU-DKUH%HLGH[FPRKQH5DKPHQ 0DVRQLW =ZHL *HP”OGH GHU 7LQJDWLQJD6FKXOH D  9RQ 3HWHU der drei Männer nach der Jagd mit einer erlegten Antilope zeigt und b) von A.A. Mkura, der eine magische Handlung mit einem hypnotisierten (?) Mann in einer Schale darstellt. Dabei .DWDORJ GHU 5RVHQIHOG6DPPOXQJ 'LH 7LQJDWLQJD6FKXOH 7KH Tingatinga School“. 6W©FN Intakt. 450,–

859 Zwei Reklameschilder. 2NX .DPHUXQ 5HNODPHVFKLOG /  [ FP  I©U HLQHQ +HUUHQ)ULVLHUVDORQ O DXI 6SHUUKRO] +RO] rahmen mit Inschrift: „Director of Barbing. Studio Oku“, rechts XQWHQ VLJQLHUW ',1$576 0%9(w 'DEHL 5HNODPHVFKLOG (68 x 50cm) für einen Heiler, ebenfalls aus Oku, Kameruner Grasland, Öl auf Sperrholz mit Illustration und roter Schrift auf gelbem Grund. 6W©FN Intakt. 380,–

Two paintings from the Tingatinga School, one by Peter, showing three men after hunt with a killed antelope, and one from A.A. Mkura, illustrating a magical ceremony with a hypnotized(?) man, lying in a bowl. Including in WKHORWLVDFDWDORJXHRIWKH5RVHQIHOG&ROOHFWLRQ'LH7LQJDWLQJD6FKXOH The Tingatinga School“. Intact. 2 pieces!

3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Gerahmte Karte.   [ FP RKQH 5DKPHQ 3DSLHU XQG Holz. Altkolorierte Karte von Afrika von Johannes Mathias +DVHGDWLHUWDXI'LHQLFKWNRORULHUWH7LWHONDUWXVFKHHQWK”OW auch noch einen Text zur Skalierung und eine Umrechnungsta belle in verschiedene europäische Längenmaße, beides in lateini scher Sprache, umgeben von einem dekorativen Szenarium von 0HQVFKHQ7LHUHQXQG3~DQ]HQ$IULNDVQDFKGHP*HVFKPDFN der Zeit. Intakt. 400,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ -0+DVH DXFKODWDOV+DVLXVEH]HLFKQHW ZDUHLQGHXWVFKHU Mathematiker, Astronom und Geograf, gebürtig aus Augsburg, gestorben in Wittenberg. Er fertigte auch eine Karte von Asien und Karten von diversen Ländern, wie z. B, Russland. Hase studierte in Helmstedt und Leipzig, lehrte 0DWKHPDWLN LQ +DOOH XQG :LWWHQEHUJ ZR HU VLFK DXFK GHU .DUWRJUD}H widmete. Map of Africa, dated 1737, made by Johannes Mathias Hase (also called +DVLXV     +DVH D *HUPDQ PDWKHPDWLFLDQ DVWURQRPH DQG geographer, was born in Augsburg, died in Wittenberg, also made maps of Asia and different countries, like Russia. He studied in Helmstedt and Leipzig, taught mathematics in Halle and Wittenberg where he developed his interest LQWKHFDUWRJUDSKLF}HOG,QWDFW VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

858 Friseurschild. Westafrika, vermutlich Bamenda, Kamerun. 122 [FPPLW5DKPHQODXI6SHUUKRO]SODWWHJHUDKPWI©UHLQHQ Damensalon mit 15 verschiedenen Frisurmodellen. Intakt. 450,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ West African advertisement poster for a ladies‘ barber shop, oil on wood, framed, and showing 15 different hairstyle models. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

292

Two Oku, Cameroon, advertisement paintings, one for a men‘s barber shop, oil on wood, the other for a healer, also oil on wood. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

860 =ZHL )RWRJUD}HQ .DPHUXQ XQG .HQLD D  6:)RWR HLQHV Häuptlings (54 x 44cm, gerahmt) aus dem Kameruner Grasland, DXI VHLQHP 7KURQ PLW W\SLVFKHP 6SLQQHQPRWLY YRU GHP (LQ gangstor seines Palastes sitzend, das von mit Glasperlen besetz ten Figuren gerahmt ist; links und rechts davon große, ebenfalls }J©UOLFK JHVFKQLW]WH 7©USIRVWHQ YRU VLFK GLH ,QVLJQLHQ VHLQHU 0DFKW HLQ /HRSDUGHQIHOO XQG HLQ (OHIDQWHQ]DKQ HEHQIDOOV HLQ Zeichen seiner Würde: eine große Kette aus Leopardenzähnen, die er um den Hals trägt. Fotograf unbekannt, vermutlich Dr. .RORVV E  )DUEIRWRJUD}H  [ FP JHUDKPW  YRQ  aus den Loita Hills in Kenia, die einen Heiler bei der Arbeit mit seinen Instrumenten zeigt. 6W©FN Intakt. 250,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ 7ZRSKRWRJUDSKV2QHIURPWKH&DPHURRQJUDVV}HOGVVKRZLQJDFKLHIVHDWHG on his throne in front of his palace, framed behind him by two statues, covered with coloured glass beads, to he left and right palace posts, carved with tall }JXUHVLQIURQWRIKLPWKHLQVLJQLDRIKLVSRZHUDOHRSDUGVNLQDQGDQHOHSKDQW tusk; around his neck a large string of leopard theeth. Photographer unknown, probably Dr. Koloss. The second photograph shows the landscape from the /RLWD+LOOVLQ.HQ\DWDNHQLQZLWKDKHDOHUGXULQJKLVFHUHPRQ\ZLWK his devices. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


861 Sammlung afrikanische Objekte. a) Kleiner Gedenkkopf aus Ter UDNRWWD + FP 0LW JUDXEUDXQHU (QJREH KRKHU )ULVXU XQG linearer Narbentätowierung auf der Stirn. Akan, vermutlich aus +HPDQJ7ZLIR*KDQD-K)ULVXUEHVFK”GLJWOLQNHV2KU DEJHEURFKHQ 0LW DOWHQ $XNWLRQVDXINOHEHUQ YRP  %HL *RUQ\  0RVFK $XNWLRQ   /RV  E  *URgHV 7HUUDNRWWDJHI”g%XUNLQD)DVRRGHU0DOL+FP0LWUHOLH}HU ten Schnurverzierungen um das Gefäß im obersten Drittel. Am Rand schlaufenförmige Dekoration. Intakt. Bei Gorny & Mosch $XNWLRQ/RVF .XJHOI¤UPLJHV*HI”gDXV7HU rakotta. Chewa (?), Mosambik. H 25,5cm. Mit kurzem, offenen Hals und linearen Ritzungen um den Hals. Intakt. Bei Gorny 0RVFK$XNWLRQ/RVG *HWUHLGHVSHLFKHUW©U schloss mit Riegel. Bambara, Mali. H 41,5cm. Holz. Mit einem Kopf mit brettartiger Frisur beschnitzt und mit eingeritzten line aren Motiven geschmückt. Intakt mit Gebrauchsspuren, teilwei VHNUXVWLJH3DWLQD%HL*RUQ\ 0RVFK$XNWLRQ/RV 481. e) Bettenfuß aus weißlicher Terrakotta, grauschwarz be malt mit verschiedenen Motiven (H 32cm) und f) zwei Gefäße PLWVFKZDU]HU(QJREHGDUXQWHUNOHLQHVUXQGHV'HFNHOJHI”g k FP XQG~DVFKHQI¤UPLJHV*HI”gPLW+HQNHO +FP EHLGH JHVFKP©FNWPLW3XQNWXQGDQGHUHP'HNRU*HI”gHPLWPLQL malen Ausbrüchen an den Rändern, sonst intakt. Bei Gorny & 0RVFK$XNWLRQ/RV6W©FN 650,– Provenienz: Ex Sammlung Dr. Günter Wiedner, Bayern, 1980er Jahre bis 2015. &ROOHFWLRQRI$IULFDQREMHFWVD 6PDOO$NDQGLVFVKDSHGWHUUDFRWWDPHPRULDO KHDGZLWKJUH\EURZQVOLSWRZHULQJIRUHKHDGZLWKOLQHDUVNLQVFDUL}FDWLRQ PDUNSUREDEO\IURP+HPDQJ7ZLIR*KDQDWKWKFHQWXU\3DUWRI coiffure broken off, left ear missing. b) Burkina Faso or Mali large terracotta VWRUDJHYHVVHOZLWKUHGGLVKEURZQVOLSVWULQJGHFRUDWLRQVLQKLJKUHOLHIDURXQG XSSHUWKLUGSDUWRIYHVVHODQGZLWKOHDVKVKDSHGGHFRUDWLRQVDURXQGWKHULP ,QWDFWF &KHZD " ERZOVKDSHGWHUUDFRWWDYHVVHOIURP0R]DPELTXHZLWK dark brown slip, short neck and linear incised motifs. Intact. d) Bambara JUDQDU\GRRUORFNIURP0DOLFDUYHGZLWKDKXPDQKHDGZLWKERDUGVKDSHG coiffure. In good condition with incised geometric design. Traces of long use, crusty dark brown patina. e) Bed post, of whitish colored terracotta, painted in black with various motifs and two small receptacles with black slip, a circular ERZOZLWKOLGDQGDERWWOHVKDSHGYHVVHOZLWKKDQGOHERWKGHFRUDWHGZLWKGRW and other motifs. Vessels with minor chips on rims, otherwise intact. 7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

862 Sammlung diverse Objekte. Togo / Benin / Ghana. a) Auf ei QHP$VKDQWL+RFNHUVLW]HQGHQDFNWH)LJXU +FP GHU0DPL Wata, schwarz, weiß, silbern und rot bemalt, von einer Schlange XPJHEHQXQGVLFKGLH%U©VWHKDOWHQGE EHUODQJH&RORQ)L gur (H 102cm, Holz), bunt bemalt, mit Tropenhelm und Kra watte bekleidet. c) Lange Halskette aus Samenperlen mit einem Amulett aus Kalebasse; dabei zwei geometrische Ashanti Mes VLQJ*ROGJHZLFKWH6W©FN Risse, vor allem rückwärts. 450,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ &ROOHFWLRQRIGLIIHUHQWREMHFWV0DPL:DWD}JXUHVHDWHGRQDQ$VKDQWLVWRRO painted red, white, silvery and red, wound by a snake and holding her breasts; $QHQODUJHG&RORQ}JXUHSDLQWHGLQYDULRXVFRORXUVDQGZHDULQJDWLHDQG tropical helmet, and an oversized necklace with seed beads and with a calabash amulet. Included in the lot are two Ashanti geometrical brass goldweights. 5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

863 Sammlung Kleinobjekte. Bamum / Bamileke, Kamerun. a) L 4,5 und 2cm. Zwei Goldgewichte aus Messing: ein sitzender Jäger nach der Jagd und ein „geometrisches“. b) Halskette aus Mille }RUL*ODVSHUOHQ 9HQHGLJ PLWHLQHP/HRSDUGHQ]DKQXQG]ZHL Imitaten. c) Halskette aus rosaroten und gelben Glasperlen, ei QHU &KHYURQ3HUOH 9HQHGLJ  XQG HLQHP $QWLORSHQKRUQ G  Kleiner kugeliger Medizinbehälter aus Kalebasse (?), mit Leder bezogen und einer Schnur versehen. e) Dabei: Rote Lackscha tulle. 6W©FN Intakt. 350,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ Group of various items, including two brass goldweights, one representing a hunter after his hunt and a geometric weight, a necklace with Venetian glass beads, including a leopard tooth and two imitations, a necklace of pink and \HOORZJODVVEHDGVLQFOXGLQJDFKHYURQEHDGDQGDQDQWHORSHKRUQDQGDEDOO shaped medicine receptacle, covered with leather, including stopper and leash for holding. Including in the lot is a red laquer box. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

864 Sammlung diverser Objekte. .DPHUXQ1LJHULDD 0HGL]LQ.D lebasse mit eiserner Kette und Spatel. b) Kamm aus eisernen 'U”KWHQ F  0HVVLQJ3IHLIH ]ZHL 7HLOH PLW &RORQ.RSI )UDQ zose mit Käppi). d) Vier Tierhörner, eines mit Blütenmotiven JUDYLHUWXQGPLW5RWKRO]PHKOJHI”UEWXQGHLQHVPLWJH~RFKWH nen Lederbändern umwunden (die drei kleinen Hörner an der Spitze zum Umhängen durchbohrt). e) Zwei gehäkelte Mützen aus dem Kameruner Grasland. 6W©FN Intakt. 350,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ Group of various items including a medicine calabash container with iron FKDLQDQGVSDWXODDQLURQZLUHFRPEDEUDVVSLSHZLWK&RORQKHDGIRXU animal horns, one incised and dyed with camwood powder, one wound with braided leather stripes (the three small ones pierced at the end for suspension), DQGWZRFURFKHWHGFDSVIURPWKH&DPHURRQ*UDVV}HOGV,QWDFW9 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

865 6DPPOXQJ YHUVFKLHGHQH +RO]REMHNWH Bamum / Bamileke, Ka PHUXQ7XDUHJ0DOL+DXVD1LJHULDD *URgHUUXQGHUPLW dem Spinnenmotiv durchbrochen geschnitzter Hocker (Kame run, H 35cm, Ø 34cm). b) Zwei Keulen auf braunem Holz (L 52cm und 43cm), Riss auf der Sitzplatte des Hockers, teilweise UHVWDXULHUWF (LVHQPHVVHUPLWEHPDOWHUXQGJHSXQ]WHU/HGHU scheide (Tuareg, L 34cm). d) Trommel aus Holz, Bespannung aus Schlangenhaut, geschnitzt mit winkelförmigen Motiven (L FP H /DQ]HQVSLW]HDXV(LVHQ]LVHOLHUWXQGPLW:LGHUKDNHQ .DPHUXQ/FP I =ZHLK¤O]HUQH+HQNHOVFKDOHQJHVFKQLW]W mit verschiedenen Motiven (Kamerun, Ø 46 und 39cm). g) Ka lebasse mit verschiedenen eingeschnittenen Motiven (Nigeria, H 36,5cm). 6W©FN 300,– 3URYHQLHQ]([6DPPOXQJ'U+DQV-RDFKLP.RORVV%HUOLQ Group of nine different utility devices, including a circular stool (Cameroon), two knobkerries, a knife with sheath (Tuareg), a drum covered with snake skin, iron pointed top of lance (Cameroon), two wooden bowls with handles, and an incised calabash (Hausa, Nigeria). Only the two bowls with handles and the calabash with traces of usage. 9 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

293


866 6DPPOXQJGLYHUVH2EMHNWHDXV$IULNDBurkina Faso. Drei Geld ketten aus bunten Plastikscheiben, eine davon mit weißen Perlen, und eine Halskette aus Lederschnüren; dabei Hauer HLQHV :DU]HQVFKZHLQV XQG %DXPZROO:HEJHU”W PLW /LW]HQ schaft, Webkamm und einem Streifen weißen Bauwollgewebes. 6W©FN Intakt. 300,– Provenienz: Privatsammlung U. C., Norddeutschland. Collection lot with three primitive money strings of coloured plastic discs, a necklace made of black leather strings, a wharthug tusk, and weaving implements including. 7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 .RSIVFKPXFNI©U)UDXHQVRJ)H]'HFNHO'DPDVNXV(QGH -KkFP+FDFP/$QK”QJHUFP$XV6LOEHU getrieben. Bestehend aus zwei schalenartigen Teilen, die mit einer Niete verbunden sind. Das innere Stück ist glatt, das Äußere ist durchbrochen gearbeitet, reich dekoriert mit Rosetten XQGEO©WHQDUWLJHQ(OHPHQWHQXQGPLWXUVSU©QJOLFKGUHLJU©QHQ und drei roten konischen, gefassten Glassteinen versehen. Am unteren Rand sind 28 Anhänger, die aus einer Kette mit einer GXUFKORFKWHQ 6FKHLEH DP (QGH EHVWHKHQ EHIHVWLJW 2EHQ LP =HQWUXPLVWHLQZHLWHUHVNOHLQHVJHZ¤OEWHV(OHPHQWDQJHEUDFKW mit zwei kleinen Anhängern, an denen man den Kopfschmuck halten kann. Zwischen den beiden Schalen wurde ein Tuch gehalten. Scheibe eines Anhängers und ein Glasstein fehlt. 500,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck (1977) S. 104. 7UDGLWLRQDOIHPDOHKHDGGUHVVVRFDOOHG)H]FRYHUPDGHRIVLOYHUZLWKJUHHQ and red faceted glass inlays, served to hold a cloth. Damaskus, end of 19th century. One disc of a pendant and one glass stone missing. Published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

868 Sammlung islamischer Silberschmuck. Afghanistan, Turkmeni stan, Türkei. Darunter Ketten (9) mit Melonenperlen aus Holz mit Silberüberzug, mit Münzanhängern, mit bootsförmigem An hänger, mit mondsichelartigem Anhänger, mit einem Verschluss LQ)RUPHLQHU+DQGPLWHLQHP$QK”QJHUPLWNX}VFKHU6FKULIW mit einem kugeligen Anhänger, mit blauen Steinen, mit einem UHFKWHFNLJHQ3HNWRUDOPLW*ODVHLQODJHQ$UPUHLIHRGHUE”QGHU (4), davon einer mit fünf Fingerringen und Fingerhut, ein Dop pelring mit Fingerhut (1), ein Kosmetikbesteck mit Ohrlöffel und Nagelreiniger (1), ein Flakon an einer Kette (1), eine Kette RGHUHLQ*©UWHO  PLW6LOEHUSXQ]HYRQ0XUDG9  XQG ]ZHL*©UWHOVFKQDOOHQLQ0LULERWD)RUP6W©FN'UHL6W©FNH SXEOL]LHUW Intakt. 1.500,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Gürtel oder Kette und Gürtelschnallen publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck (1977) S. 110 u. 142. Collection of islamic silver jewellery from Afghanistan, Turkmenistan and 7XUNH\LQFOXGLQJQHFNODFHV  EUDFHOHWV  DGRXEOH}QJHUULQJZLWKWKLPEOH DFRVPHWLFVHWD~DFRQZLWKQHFNODFHDQHFNODFHRIEHOWZLWKKDOOPDUNSXQFK RI0XUDG9DQGDEHOW}WWLQJLQPLULERWDVKSDH,QWDFW17 pieces! Belt or QHFNODFHZLWKKDOOPDUNSXQFKDQGEHOW}WWLQJLQPLULERWDVKDSHSXEOLVKHG VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

294

869 Brautschmuck mit Hand der Fatima. Tunesien. L 40cm. Auf ein 6WRIIEDQG DXIJHQ”KW VLQG  ODQ]HWWI¤UPLJH (OHPHQWH DQ GH nen Anhänger befestigt sind, die aus einer Mondsichel, einem WURSIHQ XQG HLQHP ODQ]HWWI¤UPLJHQ $QK”QJHU EHVWHKHQ 'UHL dieser Anhänger stechen hervor durch eine große Mondsichel an der jeweils eine Hand der Fatima hängt. Auf den lanzettför PLJHQ (OHPHQWHQ GHQ JURgHQ 0RQGVLFKHOQ XQG GHQ +”QGHQ der Fatima grüne, rote oder gelbe facettierte Glassteine. Intakt, *ODVVWHLQHIHKOHQ]XP7HLO u Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck (1977) S. 93. Die Hand der Fatima ist ein kulturelles Symbol des islamischen Volksglaubens Nordafrikas und des Nahen Ostens und dient dem Schutz und der Abwehr GHU'VFKLQQXQGGHV%¤VHQ%OLFNV'HU1DPHJHKWDXI)DWLPD Q Chr.), die jüngste Tocher des Propheten Mohammed, zurück. %ULGDOMHZHOOHU\ZLWKKDQGRI)DWLPD6HZQRQWRDIDEULFULEERQDUHODQFHW shaped, elements to which are attached pendants consisting of a crescent moon, DGURSVKDSHGDQGDODQFHWVKDSHGSHQGDQW7KUHHRIWKHVHSHQGDQWVVWDQG out by a large crescent moon from each of which hangs a hand of Fatima. 2QWKHODQFHWVKDSHGHOHPHQWVWKHODUJHFUHVFHQWPRRQVDQGWKHKDQGVRI Fatima green, red or yellow faceted glass stones. Tunisia. Intact, some glass stones missing. Published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ+DOVXQG2KUVFKPXFNNordafrika und Kasachstan. a. Haarschmuck kasachischer Nomaden (L 66cm, ein Anhänger abgebrochen) aus schwarzer Kordel, Silberblechelementen und Perlen sowie Münzen, an den untersten Quasten hängen euro S”LVFKH .RIIHUVFKO©VVHO E 0©Q]NHWWH GHU 1HJHY%HGXLQHQ / ca. 45cm, intakt) mit türkischen und russischen Münzen, die vor dem Gesicht getragen wurde. c. Silberohrring (L 21cm, intakt) PLW GHU OLE\VFKHQ .URQHQ6LOEHUSXQ]H DXI GHQ +”QGFKHQ$Q hängern (Hand der Fatima). d. Paar kasachische Silberohrringe (L der Kette 45cm, intakt), die mit einer Kette verbunden sind. e. Silberne Zopfspange (Ø 4cm, intakt) aus Ägypten. f. Paar Sil EHURKUULQJH /FPLQWDNW PLWODQJHQ$QK”QJHUQXQGGXUFK brochener Platte aus Tunesien. g. Paar Silberohrringe (L 35cm, intakt) mit roten Perlen und Anhängern in Form der Hand der Fatima aus Libyen. h. Drei Lederketten mit Amulettanhängern DXV0HVVLQJEOHFKGHU7XDUHJ /FPFPXQGFPLQ WDNW  L 6LOEHUDQK”QJHU PLW HLQHP 0DULD7KHUHVLD7KDOHU DXV Äthiopien. 6W©FN u Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Teilweise publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck (1977) 6=XGHQ$PXOHWWHQGHU7XDUHJYJOHEHQGD6 Collection of necklaces and earrings, North Africa and Kazakhstan: a. Hair ornaments of Kazakh nomads (One pendant broken off) made of black cord, silver plate elements and beads as well as coins, European suitcase keys hanging from the lowest tassels. b. Coin necklace of the Negev Bedouins with Turkish and Russian coins, worn in front of the face. c. Silver earring with the Libyan crown silver hallmark on the hand pendants (Hand of Fatima). d. Pair of Kazakh silver earrings connected with a chain. e. Silver braid clasp from Egypt. f. Pair of silver earrings with long pendants and openwork plate from Tunisia. g. Pair of silver earrings with red beads and pendants in the shape of the hand of Fatima from Libya. h. Three leather necklaces with amulet pendants made of brass plate from Tuareg. i. Silver pendant with a Maria Theresa thaler from Ethiopia. Mostly intact. 13 pieces! Partially published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


 Sammlung Fingerringe unterschiedlicher Kulturen. Vorwiegend aus Silber sowie einzelne Stücke aus Kupfer, Gelbguss und 6WHLQ'DUXQWHUHLQLQGLVFKHU6SLHJHOULQJ kFP5LQJJU¤gH 55), ein kasachischer Ring mit tropfenförmiger Platte (Ringgrö ße 51), ein Silberring der Tuareg mit durchbrochen gearbeiteter Schiene und einem würfelförmigen, durchbrochen gearbeiteten Aufsatz mit blauen und roten Glaseinlagen, ein Ring der Ber EHU PLW HLQHU JURgHQ .XQVWVWRIISHUOH 5LQJJU¤gH   HLQ Steinring der Tuareg aus rotem Karneol, der ursprünglich als Anhänger getragen wurde, ebenso wie der Silberring mit ke JHOI¤UPLJHP.DUQHRO$XIVDW]HLQ=ZHL}QJHUULQJDXV6LOEHUPLW Münzanhängern aus dem Maghreb. 6W©FN,QWDNW u Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Etwa zur Hälfte publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck  6 &ROOHFWLRQ}QJHUULQJVRIGLIIHUHQWFXOWXUHV0DLQO\VLOYHUDVZHOODVLQGLYLGXDO pieces of copper, brass and stone. Among them an Indian mirror ring, a Kazakh ULQJZLWKGURSVKDSHGSODWHDVLOYHUULQJRIWKH7XDUHJZLWKRSHQZRUNHGKRRS DQGDFXEHVKDSHGRSHQZRUNHGDWWDFKPHQWZLWKEOXHDQGUHGJODVVLQOD\VD ring of the Berbers with a large plastic bead, a Tuareg stone ring made of red FRUQHOLDQRULJLQDOO\ZRUQDVDSHQGDQWDVZHOODVWKHVLOYHUULQJZLWKFRQH VKDSHGFRUQHOLDQDWWDFKPHQWDVLOYHUWZR}QJHUULQJZLWKFRLQSHQGDQWVIURP the Maghreb. Intact. 54 pieces! About half of them published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ 2KU XQG $UPVFKPXFN Turkmenistan, Luristan, Nordafrika. Vorwiegend aus Silber, teilweise Messing und *ROGEOHFK PHKUHUH 3DDUH VRZLH (LQ]HOVW©FNH 'DUXQWHU GUHL spatelförmige Silberohrringe mit Punzdekor aus Turkmenistan /FP HLQ%©JHORKUULQJPLW9RJHODXV/XULVWDQ k 5,8cm), zwei Ohrringe mit einem Anhänger in Form der Hand der Fatima, drei massive Silberarmreife mit unterschiedlichen Silberpunzen u.a.m. 6W©FN Intakt. 800,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Teilweise publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck (1977) 6 Collection of earrings and bracelets. Mostly silver, partially of brass and gold IRLOVHYHUDOVSDLUVDVZHOODVVLQJOHSLHFHV$PRQJWKHPWKUHHVSDWXODVKDSHG silver earrings with hallmark decoration from Turkemistan, one hoop earring with bird from Luristan, two earrings with a pendant in the shape of the Hand of Fatima, three solid silver bangles with different silver hallmarks and others. Intact. 31 pieces! Partially published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Nomadenschmuck aus Silber. Zentralasien. a. Massive Silberket te (L ca. 80cm) aus zwei Strängen von Fuchsschwanzketten, die durch Rosetten zusammengehalten werden, zentral ein geome trisches Schmuckelement. b. Massive Silberkette (L ca. 85cm) aus zwei Strängen von Fuchsschwanzketten, die durch Roset WHQ ]XVDPPHQJHKDOWHQ ZHUGHQ ]HQWUDO I©QI (OHPHQWH GLH PLW Scharnieren miteinander verbunden und reich dekoriert sind. F(LQ3DDU%©JHORKUULQJHPLWGUHLHFNLJHP(OHPHQWPLWW©UNL sem Glasperle (ursprüngliche Steine verloren), an dem mittels Fuchsschwanzketten trapezförmige Anhänger mit Blattanhän gern befestigt sind. 6W©FN Intakt. 600,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren.

Collection of Central Asia Nomadic silver jewellery: a. Massive silver necklace made of two strands of foxtail chains held together by rosettes, centrally a geometric jewelry element. b. Massive silver necklace made of two strands RIIR[WDLOFKDLQVKHOGWRJHWKHUE\URVHWWHVFHQWUDO}YHHOHPHQWVFRQQHFWHGE\ hinges and richly decorated. c. A pair of hoop earrings with triangular element with turquoise glass bead (original stones lost), from which hang by means of foxtail chains trapezoidal pendants with leaf pendants. Intact. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung Kosmetikutensilien. Äthiopien, Marokko, Afghani stan, China. Aus Silber mit Punzdekor. Darunter Ohrlöffel, Na JHOUHLQLJHU6FKPLQNVW”EH  HLQ'XIW~DNRQDQHLQHU.HWWH   HLQ O”QJOLFKHU 'RSSHO~DNRQ PLW 'HFNHO XQG 6WDE   DQ HLQHU .HWWHHLQH0LQLDWXU3\[LVPLW6WDEDQHLQHU.HWWH  HLQYHU VFKOLHgEDUHU3DUI©P~DNRQDQHLQHU+DOVNHWWHPLW6WDE  HLQ länglicher Flakon mit Stab an einer langen Kette (1), ein Set mit Ohrlöffel und Nagelreiniger (1), ein Set mit fünf verschiedenen Kosmetikbestecken (1), Stäbe aus Messing oder Kupfer (5) so wie drei Ohrringe mit einem Set aus Ohrlöffel und Nagelreiniger als Anhänger (3). 6W©FN7HLOZHLVHSXEOL]LHUW,QWDNW u Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Teilweise publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck (1977) 6 Collection of silver ear spoons, nail cleaners, makeup sticks, perfume bottles in different shapes. Ethiopia, Morocco, Afghanistan, China. Intact. 37 pieces! Partially published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung Korallenketten. Vorwiegend Nordafrika. a. Kette mit zwei Doppelsträngen aus vorwiegend Korallenperlen (L 55cm, beide Doppelstränge nicht ganz vollständig bzw. unterbrochen) mit islamischen und europäischen Silbermünzen als Anhängern, dazwischen eine Hand der Fatima, ein Sternanhänger und zwei rautenförmige Anhänger. b. Kette aus länglichen Korallenper len (L 58cm, intakt) mit drei Rautenanhängern aus Silber. c. Ketten aus sechs Strängen (L 94cm, intakt) mit Korallenperlen, durchbrochen gearbeiteten Silberelementen und Scheiben aus geschliffenem Muschelplatt. Aus Kasachstan. d. Kette aus läng OLFKHQ .RUDOOHQSHUOHQ / FP LQWDNW  XQG NOHLQHQ 6LOEHUSHU len mit einem zentralen Anhänger mit tropfenförmiger Koralle XQG*ODVHLQODJHQH.HWWHQDXV.RUDOOHQXQG0HWDOOSHUOHQ / FP LQWDNW  PLW  O”QJOLFKHQ .RUDOOHQDQK”QJHUQ I©QI GDYRQ PLW)DVVXQJI.HWWH /FPLQWDNW DXVO”QJOLFKHQQDWXUEHODV senen Korallenperlen und drei Silberanhängern in Blattform. g. Kette (L 38cm, intakt) aus sieben Strängen mit Korallenperlen, die durch drei kugelige Silberperlen unterteilt sind. 6W©FN7\ pischer Berberschmuck! 1.000,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. .HWWHQ D  H SXEOL]LHUW LQ .DWULQ XQG 8OULFK .OHYHU ([RWLVFKHU 6FKPXFN  6 Collection of coral necklaces: a. Necklace with two double strands of mainly coral beads (both double strands not quite complete or interrupted) with Islamic and European coins as pendants, in between a hand of Fatima, a star SHQGDQWDQGWZRGLDPRQGVKDSHGSHQGDQWVE1HFNODFHRIHORQJDWHGFRUDO beads (Intact) with three silver rhombic pendants. c. Necklace of six strands (Intact) with coral beads, openwork silver elements, and discs of polished shell. From Kazakhstan. d. Necklace of elongated coral beads (Intact) and VPDOOVLOYHUEHDGVZLWKDFHQWUDOSHQGDQWRIWHDUGURSVKDSHGFRUDODQGJODVV inlays. e. Necklace of coral and metal beads (Intact) with 7 elongated coral SHQGDQWV}YHRIWKHPZLWKVHWWLQJI1HFNODFHV ,QWDFW RIHORQJDWHGQDWXUDO coral beads and three silver pendants in leaf shape. g. Necklace (Intact) of

295


seven strands of coral beads divided by three spherical silver beads. 7 pieces! DHSXEOLVKHG7\SLFDO%HUEHUMHZHOU\ VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ +”QGH GHU )DWLPD Nordafrika und Naher Osten. 'DUXQWHU$QK”QJHU /FP DXV6LOEHULQ+DQGIRUPPLW gepunztem Dekor, zwei scheibenartige, durchbrochen gearbeite te Silberanhänger (Ø 5,2 und 6,5cm) mit Davidstern und ‚Hand GHU)DWLPDyLP=HQWUXPHLQHUGDYRQPLW.HWWH /FP DXV ~DFKHQ5LQJHQHLQUHFKWHFNLJHU$QK”QJHUPLWNOHLQHU+DQG / 8,5cm) sowie eine Kette (L 44cm, ein Handanhänger lose) aus Karneolperlen mit drei Mondsichelanhängern, an denen Hän GH GHU )DWLPD EHIHVWLJW VLQG GLH $QK”QJHU MHZHLOV }OLJUDQ DXV Draht gearbeitet. 6W©FN Intakt, mit Gebrauchsspuren. 500,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Die Hand der Fatima ist ein kulturelles Symbol des islamischen Volksglaubens Nordafrikas und des Nahen Ostens und dient dem Schutz und der Abwehr GHU'VFKLQQXQGGHV%¤VHQ%OLFNV'HU1DPHJHKWDXI)DWLPD u n.Chr.), die jüngste Tocher des Propheten Mohammed, zurück. Collection ‚Hands of Fatima‘: Among them 9 pendants of silver in the shape of DKDQGZLWKSXQFKHGGHFRUDWLRQWZRGLVFOLNHRSHQZRUNVLOYHUSHQGDQWVZLWK Star of David and Hand of Fatima in the center, one of them with chain of ~DWULQJVDUHFWDQJXODUSHQGDQWZLWKDVPDOOKDQGDQGDQHFNODFH RQHKDQG pendant loose) made of cornelian beads with three crescent moon pendants ZLWK+DQGVRI)DWLPDDWWDFKHGWKHSHQGDQWVHDFK}OLJUHHZRUNHGIURPZLUH North Africa and Levante. Intact, with traces of use. 14 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ .DE\OHQ6FKPXFN $OJHULHQ    -K 6LOEHU (PDLOHLQODJHQ LQ JHOERUDQJH EODX XQG JU©Q URWH *ODVVWHLQH a. Gewandschmuck (L 45cm, Ø Reife 12cm, ein kegelförmi ger Anhänger lose, Sterne etwas verbogen) bestehend aus ei nem dreieckigen Aufhänger mit Haken, an dem mit Ketten zwei prächtig gestaltete offene Reife mit Kugelenden befestigt sind. An den Reifen ein mondsichelartiger Fortsatz mit sechs kegel förmigen Anhängern mit Kugeln, ein Stern und nach innen ge richtet ein durchbrochen gearbeiteter, herzförmiger Fortsatz. E )LEHO /FPLQWDNW PLWHLQHUODQJHQ1DGHOHLQHPRPH gaförmigen Bügel und einer vorwiegend dreieckigen Platte. c. 3DDU%©JHORKUULQJH kFP PLWHLQHU%OXPHDXIGHP%©JHO und fünf kegelförmigen Anhängern. Die Ohrringe sind mit einer Kette (L gesamt 34cm) verbunden, die in einem Haken endet. 4 6W©FN 500,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Vgl. Katrin und Ulrich Klever, Exotischer Schmuck (1977) S. 80 (Fibel) XQG6 Typisch für den Schmuck der Kabylen, einem Berberstamm aus der Kabylei im Nordosten Algeriens, ist das Material Silber sowie Email in den Farben gelborange, grün und blau zur Dekoration der Zierelemente. Collection of Kabyle jewellery including a garment jewellery, a brooch and a pair of earrings connected with a chain. All made of silber with enamel LQOD\VLQ\HOORZRUDQJHJUHHQDQGEOXH$OJHULDWKWKFHQWXU\0RVWO\ intact. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

296

 6DPPOXQJ]HQWUDODVLDWLVFKHU6FKPXFNAfghanistan, Kasachstan, Mongolei. a. Pfeilförmiger Kleidereinsatz (L 45cm, Stoff ver blichen, intakt) aus ursprünglich rotem Cordsamt mit grüner Borte eingefasst, aufgenäht Schmuckelemente aus Metall mit Glassteinen. Kasachstan. b. Kette (L 64cm) aus einem Stoffband mit Rosetten und Anhängern, zum Teil mit gefasstem, farbigen Glas. Kasachstan. c. Paar silberne Ohrringe (L 18cm, intakt) mit UHFKWHFNLJHP (OHPHQW XQG $QK”QJHUQ PLW .HWWHQ XQG 5DX WHQ$IJKDQLVWDQG6LOEHUQH2KUULQJH /FPLQWDNW PLW amulettartigem Corpus mit Anhängern, die Korallenperlen und UDXWHQI¤UPLJH(QGHQDXV6LOEHUEOHFKDXIZHLVHQ$IJKDQLVWDQH Haarschmuck (L 34cm, intakt) mit Silberelementen und Glas perlen auf Kordel aufgezogen. Afghanistan, wahrscheinlich Kut schi. f. Kette (L 35cm, intakt) aus Korallenperlen und verzierten Silberelementen. Mongolei. g. Paar silberne, mondsichelförmige Scheibenohrringe (Ø 9,5cm, intakt) mit Punzdekor. Thailand, Meo. 6W©FN7HLOZHLVHSXEOL]LHUW 500,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Vgl. Katrin und Ulrich Klever, Exotischer Schmuck (1977) S. 129 .OHLGHUHLQVDW].HWWH.DVDFKVWDQ 6 +DDUVFKPXFN$IJKDQLVWDQ  Collection of Central Asia jewellery from Afghanistan, Kazakhstan, Mongolia LQFOXGLQJ D $UURZVKDSHG GUHVV LQVHUW RULJLQDOO\ PDGH RI UHG FRUGXUR\ trimmed with green braid, sewn on it decorative elements of metal with glass stones. Kazakhstan. b. Necklace made of its fabric ribbon with rosettes and pendants, partly with set colored glass. Kazakhstan. c. Pair of silver earrings with rectangular elements and pendants with chains and rhombic silver sheets. $IJKDQLVWDQG3DLURIVLOYHUHDUULQJVZLWKDPXOHWOLNHFRUSXVZLWKSHQGDQWV IHDWXULQJFRUDOEHDGVDQGUKRPELFVKDSHGHQGVRIVLOYHUVKHHW$IJKDQLVWDQ e. Hair ornaments with silver elements and glass beads strung on cord. Afghanistan, probably Kuchi. f. Necklace of coral beads and decorated silver HOHPHQWV0RQJROLDJ3DLURIVLOYHUPRRQVKDSHGGLVFHDUULQJVZLWKSXQFKHG decoration. Thailand, Meo. Intact. 10 pieces! Three pieces published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung folkloristischer Schmuck unterschiedlicher Herkunft. 'DUXQWHUHLQ3DDU2KUULQJHGHU0DVVDLDXV.XSIHUXQG(LVHQ HLQ 3DDU VLOEHUQH 2KUVW¤SVHO GHU 0HR ZHLWHUH 2KUULQJ3DDUH einzelne Ohrringe, Fibeln und ein Anhänger mit hebräischer Schrift u.a.m. 6W©FN3DDU2KUULQJHSXEOL]LHUW Intakt. 500,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck (1977) S. 71. Collection of traditional jewellery from different regions including a pair of Massai earrings, ear plugs of the Meo, Thailand, further pairs of earings, single earrings, brooches and a pendant with Hebraic inscription. Intact. 33 pieces! Two pair of earrings published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

880 6DPPOXQJ.UHX]DQK”QJHUŠWKLRSLHQXQG0DXUHWDQLHQ -K'DUXQWHUVLOEHUQH7XDUHJ.UHX]H /FP PLW'HNRU in Form von Punzierungen aus Agadez, ‚Tahua‘, sog. Kreuze des Südens, in dieser kleinen Form wahrscheinlich für Kinder, WUDGLWLRQHOOH+DQGDUEHLWPLWLP'HWDLOXQLNDW”UHP&KDUDNWHU ein .UHX]DQK”QJHU /FP GHUDXVHLQHP~DFKJHK”PPHUWHQ0D ULD7KHUHVLD7DOHUKHUJHVWHOOWZXUGHHLQ+RO]NUHX]DQK”QJHU / 4,5cm) mit Metallapplikationen aus Mauretanien und 13 An K”QJHUNUHX]H /FP DXVŠWKLRSLHQGLHWHLOZHLVHGXUFKEUR chen gearbeitet sind. Für den Guss der Silberkreuze sind meist alte Silbermünzen europäischer Herkunft verwendet worden. 21


6W©FN=XP7HLOSXEOL]LHUW Intakt, mit Gebrauchsspuren. 500,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Teilweise publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck (1977) 6 &ROOHFWLRQFURVVSHQGDQWVDPRQJWKHPVLOYHU7XDUHJFURVVHVZLWKSXQFKHG GHFRUDWLRQIURP$JDGH]€7DKXDyVRFDOOHGFURVVHVRIWKH6RXWKLQWKLVVPDOO form probably for children, traditional handwork with unique character, a FURVVSHQGDQWPDGHIURPD~DWKDPPHUHG0DULD7KHUHVDWKDOHUDZRRGHQ cross pendant with metal applications from Mauritania and 13 pendant crosses from Ethiopia, some of which are openwork. For the casting of the silver crosses mostly old silver coins of European origin have been used. Intact. 21 pieces! Partially published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

881 Sammlung folkloristischer Schmuck unterschiedlicher Herkunft. Darunter die Gebetskette eines mauretanischen Scheichs (L 121cm, intakt) aus Holzperlen mit Silberdrahteinlagen und einer 4XDVWHDP(QGHHLQQRUGDIULNDQLVFKH6LOEHUNHWWH /FP PLW Korallenanhänger, eine irakische Kette (L 45cm) mit Korallen SHUOHQXQG6LOEHUHOHPHQWHQPLW7©UNLV(LQODJHQHLQ%DWDN2KU ULQJ kFP DXV*ROGHLQ3DDUPDURNNDQLVFKH6LOEHU}EHOQ (Gesamtlänge ca. 115cm) mit dreieckiger Platte, die mit einer Kette verbunden sind sowie anderes mehr. 6W©FN*HEHWVNHW WHSXEOL]LHUW Intakt. 500,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Vgl. Katrin und Ulrich Klever, Exotischer Schmuck (1977) S. 101 (Gebetskette). Collection of traditional jewellery from different regions including a prayer chain, necklaces, earrings, brooches and so on. 18 pieces! One piece published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

882 6DPPOXQJ$UPUHLIHXQWHUVFKLHGOLFKHU.XOWXUHQ(WZD]XU+”OIWH aus Silber sowie aus Kupfer, Messing, Bronze, Holz und Horn. Darunter ein Silberarmband aus Indien (L 18cm), ein Paar hoh ler Silberarmreife der Bisaya aus Laos (Ø 9cm), ein Silberarm UHLIPLW~DFKHQ(QGHQDXV7KDLODQG kFDFP HLQVFKPDOHU +RO]DUPUHLI PLW 6LOEHUDSSOLNDWLRQHQ XQG (LQODJHQ YRQ 6LOEHU GUDKW XQG 6FKDUQLHU DXV 0DXUHWDQLHQ k FP  ]ZHL 6LOEHU DUPUHLIH DXV 0DURNNR k  XQG FP  ]ZHL $PUHLIH DXV +RUQPLWIHLQHQ0HVVLQJGUDKW(LQODJHQ kXQGFP VRZLH weitere Stücke. 6W©FN7HLOZHLVHSXEOL]LHUW,QWDNW u Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Acht Exemplare publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck  6 Collection of bracelets: About half of silver as well as copper, brass, bronze, wood and horn. Among them a silver bracelet from India, a pair of hollow VLOYHUEDQJOHV%LVD\DIURP/DRVDVLOYHUEDQJOHZLWK~DWHQGVIURP7KDLODQG a narrow wooden bangle with silver applications and inlays of silver wire and hinge from Mauritania, two silver bangles from Morocco, two horn EDQJOHV ZLWK }QH EUDVV ZLUH LQOD\V DQG RWKHU SLHFHV ,QWDFW 32 pieces! 8 pieces published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

883 Nomadenschmuck. Afrika und Asien. Darunter ein Gürtel aus acht rechteckigen braunen und ockerfarbenen Lederelementen PLW.DXUL0XVFKHOLQGHU0LWWH /FP HLQHPHKUVWU”QJLQJH

tibetanische Kette aus Miniaturglasperlen mit gehäkeltem Ver schluss (L 55cm), zwei Ketten aus einer Kordel (ca. L 82 und 66cm) mit Anhängern aus indischen und islamischen Münzen, 7LHU]”KQHQXQGNQRFKHQ0XVFKHOQ)U©FKWHQ (LFKHO1©VVH  und bunten Glasperlen, ein silberner Ohrring mit rechteckigem, GHNRULHUWHP (OHPHQW PLW $QK”QJHUQ HLQH QRUGDIULNDQLVFKH Kette mit gravierten, rautenförmigen Glasperlen (Mondsichel, Stern, Hand der Fatima) und silbernem Fischanhänger (L ca. 46cm), eine Kette (L ca. 90cm) mit einem druchbrochen gear beiteten Anhänger mit Schlüssel, Mond, Herz, Frosch, Vögeln und Fischen, eine kleine Kette mit bootsförmigem Anhänger mit weiteren Anhängern sowie 12 unterschiedliche Anhänger in Form von u.a. Kreuzen (2), einem Stern, Händen der Fatima (3) und Amuletten mit arabischer Schrift (3). Außerdem ein Löffel aus Bein (L 20cm) und ein runder Ständer aus Alabaster mit geriefelter, zweifach konischer Außenwand (Ø 8cm). 6W©FN ,QWDNW u Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Collection of Nomadic jewellery, Africa and Asia: Among them a leather belt ZLWKDFRZU\VKHOOVDPXOWLVWUDQG7LEHWDQQHFNODFHPDGHRIPLQLDWXUHJODVV beads, two cord necklaces with pendants of Indian and Islamic coins, animal teeth and bones, shells, fruits (acorn, nuts) and colored glass beads, a silver earring with rectangular decorated element with pendants, a North African QHFNODFHZLWKHQJUDYHGGLDPRQGVKDSHGJODVVEHDGVDQGVLOYHU}VKSHQGDQW DQHFNODFHZLWKDQRSHQZRUNSHQGDQWDVPDOOQHFNODFHZLWKERDWVKDSHG pendants with further pendants as well as 12 different pendants in the form of, among others, crosses (2), a star, hands of Fatima (3) and amulets with Arabic script (3). Also, a spoon made of bone and a round stand made of alabaster with grooved, double conical outer wall. Intact. 21 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

884 Sammlung asiatischer Ohrschmuck. Thailand, 20. Jh. Traditionel ler Silberschmuck der thailändischen Bergvölker (Meo, Hmong): Darunter fünf Paare und fünf einzelne Ohrringe unterschied licher Form. Zwei Paare mit spindelförmigen Anhängern und ein hakenförmiges Paar aus Silberblech mit Punzdekor (Meo), HLQ VLFKHOI¤UPLJHV 3DDU PLW 'UHLHFNV$QK”QJHUQ +PRQJ  15 6W©FN,QWDNW u Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Teilweise publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck (1977) 6 Collection of Asiatic earrings. Traditional silver jewelry of Thai hill tribes 0HR+PRQJ LQFOXGLQJ}YHSDLUVDQG}YHVLQJOHHDUULQJVRIGLIIHUHQWVKDSHV 7ZR SDLUV ZLWK VSLQGOHVKDSHG SHQGDQWV DQG RQH KRRNVKDSHG SDLU PDGH RIVLOYHUVKHHWZLWKSXQFKGHFRUDWLRQ 0HR RQHFUHVFHQWVKDSHGSDLUZLWK triangle pendants (Hmong). Intact. 15 pieces! Partially published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

885 +RFK]HLWVVFKPXFN GHU %DWDN Indonesien. Bestehend aus einer .HWWH /FPHLQLJH*ROGEOHFKDQK”QJHUIHKOHQ GHUHQ.HWWHQ strang aus Schnur mit roter Wolle umwickelt ist. Daran hängen VLHEHQ(OHPHQWHDXVG©QQHP*ROGEOHFKGLHDXVHLQHP'UHLHFN und einem Kegel bestehen und mit feinem, tordiertem Draht de koriert sind. An den Kegeln hängen sieben Anhänger mit einem WUDSH]I¤UPLJHQ *ROGEOHFK =ZLVFKHQ GLHVHQ (OHPHQWHQ 'RS pelperlen mit Granulatdekor. Außerdem ein Paar Ohrringe (L 13cm, 149g) mit einem großen Ring, an dem ein blütenartiger Corpus mit Dekor aus Granulat und trodiertem Draht hängt. *ROG6W©FN Intakt. 1.000,–

297


Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Kette publiziert in: Katrin und Ulrich Klever, Exotischer Schmuck (1977) S. 133. Zu den Ohrringen vgl. ebenda, S. 132. Die Batak sind ein indogenes Volk im Norden der indonesischen Insel Sumatra. Bridal jewellery made of gold sheet comprising a necklace with seven elements of a triangle and a cone with dekor of twisted wire and a pair of earrings with DKXJHEORVVRPOLNHHOHPHQWGHFRUDWHGE\JUDQXOHVDQGWZLVWHGZLUH,QWDFW 3 pieces! Necklace published! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

886 6W©FNH1HXVHHO”QGLVFKHU9RONVNXQVWD*©UWHO /FP DXV Perlensträngen, die mit schmalen Holzelementen zusammenge halten werden, mit einer Schließe aus einem Stück Muschel platt. b. Halsschmuck (L ca. 95cm) aus acht Perlensträngen mit röhrenförmigen Perlen aus Glas, Muschelplatt und Karneol, die mit schmalen Holzelementen zusammengehalten werden. An GHQ (QGHQ ]ZHL 0XVFKHOK¤UQHUK”OIWHQ GLH PLW 3XQNWUHLKHQ GHNRULHUWVLQG%HLOLHJHQGHLQHJH~LFNWH*©UWHOVSDQJHDXV0X schelplatt (B 10,2cm). 6W©FN Intakt. 500,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Objects from New Zealand: a. Belt made of 23 strands of beads held together with narrow wooden elements, with a clasp made of a piece of shell. b. Necklace made of eight strands of tubular beads of glass, shell and cornelian, held together with narrow wooden elements. At the ends two shell horn halves decorated with rows of dots. Enclosed is a patched belt clasp made of shell. Intact. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJDIULNDQLVFKHU6FKPXFNXQG$OOWDJVJHJHQVW”QGHDar unter ein Stofftäschchen, eine Kette mit Miniaturperlen der 0DVVDLHLQHZHLWHUH3HUOHQNHWWHPLW*ODVXQG6WHLQSHUOHQHLQH Kette aus Holzperlen und Messingdraht mit Hand der Fatima, HLQH ODQJH .HWWH PLW HLQHU 0DVVDL6FKQXSIWDEDNGRVH DXV +RO] und Metallspatel, drei Pfeifen aus Holz und Messing, eine Mes VLQJ*ORFNH]ZHL0HVVLQJEHK”OWHUGHUHLQHPLW6WRSIHQHLQVLO EHUQHU$PXOHWW%HK”OWHUHLQVLOEHUQHV$UPEDQGPLW.UHX]HLQH 0HWDOOUDVVHOHLQ+DNHQ]ZHL0”QQHU$QK”QJHUGHU0DVVDLDXV Leder, ein Werkzeug aus Metall u.a.m.  6W©FN Vorwiegend intakt. 500,– Provenienz: Ex Sammlung Klever, Bayern, seit 1980er Jahren. Collection of African jewelry and everyday objects: Among them a cloth bag, a necklace with miniature Massai beads, another necklace with glass and stone beads, a necklace of wooden beads and brass wire with hand of Fatima, a long necklace with a snuff box of wood and metal spatula, three pipes made of wood and brass, a brass bell, two brass vessels, one with stopper, a silver amulet vessel, a silver bracelet with cross, a metal rattle, a hook, two Masai men‘s pendants made of leather, a metal tool etc. Mostly intact. 21 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

888 Sammlung Geldketten. a) 10 Geldketten aus bikonischen, weiß OLFKJUDXHQ $FKDWSHUOHQ ]XVDPPHQJHEXQGHQ LQ HLQHU .RUGHO E kFP.XOWULQJPLW6FKHOOHQDXV(LVHQ&KDPED1LJHULD 6W©FN Intakt. 450,– 10 primitive money chains of biconical agate beads and one iron cult ring with bells (Chamba, Nigeria). Intact. 11 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

298

889 Sammlung Heilerketten. D /FP$XVKHOOURWHQVFKHLEHQI¤U PLJHQ*ODV3HUOHQGLHGDV0DWHULDO.RUDOOHLPLWLHUHQXQGXQ terschiedlichen Messingelementen. China, 19. Jh. b) L 51cm. Aus rechteckigen, braunen Achatperlen und silbernen Amulett EHK”OWHUQXQGJOLHGHUQ:RKO3HUVLHQ-KF /FP$XV JHVWUHLIWHQ ]\OLQGHUI¤UPLJHQ .URER3HUOHQ *KDQD  ELNRQL schen, weißen Achatperlen und einem Bronzestempel. 6W©FN Tragbar!0RGHUQDXIJHI”GHOW]ZHL.HWWHQPLW6LOEHU9HUVFKOXVV (925). 300,– Collection of different healing chains with beads of China, Persia and Ghana. 19th century. Modern stringing, two of them with silver closure (Punched 925). 3 pieces! Wearable! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

890 Sammlung Heilerketten. a) L 51,5cm. Aus weißlichen, bikonischen Achtperlen, kugeligen, metallisierenden Perlen und silbernen Amulettstäbchen. b) L 54cm. Aus scheibenförmigen, KHOOURWHQ*ODVSHUOHQGLH.RUDOOHLPLWLHUWHQXQGGUHL&KHYURQ 3HUOHQ&KLQD-KF /FP$XVNXJHOLJHQVFKZDU]HQ Glasperlen, schwarzen Kokosnussscheiben, unregelmäßigen Korallenstücken, weißlichen, bikonischen Achatperlen. 6W©FN Tragbar! Modern aufgefädelt, mit silbernen Verschlüssen (925). 300,– Collection of different healing chains including one from China with chevron EHDGVWKWKFHQWXU\0RGHUQVWULQJLQJZLWKVLOYHUFORVXUH 3XQFKHG ‚925‘) 3 pieces! Wearable! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

891 Sammlung Heilerketten. D  / FP $XV VFKHLEHQI¤UPLJHQ Perlen aus Straußenei und Malachit, dazwischen drei gestreif te, kugelige Spinnwirtel aus Terrakotta. Mali. b) L 54cm. Aus leicht, bikonischen Kirschperlen, polierten Kokosnussscheiben und lanzettförmigen Silberelementen. c) L 52cm. Aus rechtek kigen, polierten Achatperlen und silbernen Schellen.  6W©FN Tragbar! Modern aufgefädelt, mit silbernen Verschlüssen (925). 300,– Collection of different healing chains including one from Mali and one with silber bells and rectangular agate beads. Modern stringing, with silver closure (Punched ‚925‘) 3 pieces! Wearable! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

892 Sammlung Heilerketten. D /FDFP$XVYHUVFKLHGHQJHIRUP ten einfarbigen und gemusterten Glasperlen und einem lanzett förmigen Amulett aus graviertem Krokodilsknochen. Oromo, Äthiopien. b) L 50cm. Aus schwarzen Kokosnussscheiben, zy lindrischen Bronzeperlen (Bobo, Burkina Faso), bikonischen Glasperlen und drei Fruchtbarkeitsringen aus Bronze (Senufo, (OIHQEHLQN©VWH  0LW 0HVVLQJYHUVFKOXVV F  / FP $XV gräulichen, scheibenförmigen Steinperlen, kugeligen Lapislazu OLSHUOHQ XQG HLQHU NXJHOLJHQ 6DKDUD%HUQVWHLQw3HUOH .RSDO Imitat?). Mit Goldverschluss (925er, 18 Karat). d) L ca. 14cm. Graviertes Amulett aus Krokodilsknochen. Oromo, Äthiopien. Intakt. 6W©FN.HWWHQWUDJEDU Ketten modern aufgefädelt, mit Verschlüssen. 300,–


Collection of different healing chains and one engraved amulet of crocodile bone. Chains modern stringing, with closures, amulet intact. 4 pieces! Chains wearable! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

893 Sammlung Heilerketten. DF  /   XQG FP $XV XQWHU VFKLHGOLFK JHIRUPWHQ *ODV 6WHLQ XQG 0HWDOOSHUOHQ G  / FD FP $XV $QWLORSHQ.Q¤FKHOFKHQ XQG URWHQ XQG JU©QHQ kugeligen Perlen. Turkana, Kenia. 6W©FN.HWWHQWUDJEDU 3 .HWWHQPRGHUQDXIJHI”GHOWPLW6LOEHU9HUVFKO©VVHQ   300,– Collection of three healing chains of differently shaped beads of glass, stone and metal and one chain of antelop bones and green and red beads from Kenia. 3 chains modern stringing, with silver closures (Punched 925). 4 pieces! 3 chains wearable! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

894 Sammlung Geldketten. D  / FD FP 6WUDQJ DXV YLHU .HWWHQ DXVZHLgHQXQGURWHQ0LQLDWXU*ODVSHUOHQE /FDFP$XV ]\OLQGULVFKHQ0LOOH}RUL3HUOHQF /FDFP$XVELNRQLVFKHQ EODXHQ*ODVSHUOHQPLWZHLgURWHQ(LQVFKO©VVHQG /FDFP $XVNXJHOLJHQXQG]\OLQGULVFKHQURWHQ.LUVFKw3HUOHQH /FD 60cm. Aus recheckigen, polierten Achatperlen. f) L ca. 68cm. $XVELNRQLVFKHQIDFHWWLHUWHQ$FKDWSHUOHQ(LQH3HUOHHWZDVDE gesplittert. 6W©FN Intakt. 300,– Six primitive money chains of differently shaped beads of glass, cornelian, agate etc. Mostly intact. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

895 Sammlung Geldketten. D /FDFP$XVURWHQ.LUVFKSHUOHQE  /FDFP$XVELNRQLVFKHQZHLgOLFKJUDXHQ$FKDWSHUOHQF  /FDFP$XV]\OLQGULVFKHQ0LOOH}RUL3HUOHQG /FDFP $XV IDFHWWLHUWHQ .DUQHRO3HUOHQ H  / FD FP $XV ELNRQL VFKHQEODXHQ*ODVSHUOHQPLWZHLgURWHQ(LQVFKO©VVHQI /FD 130cm. Aus kugeligen, braunen und schwarzen Glasperlen. 6 6W©FN Intakt. 300,– Six primitive money chains of differently shaped beads of glass, cornelian, agate etc. Intact. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

896 Sammlung Heilerketten. a) L 63cm. Aus schwarzen Kokos nussscheiben, scheibenförmigen Kopalperlen (Sahara), bikoni schen Silberperlen und drei silbernen Amulettbehältern. b) L FP $XV ELNRQLVFKHQ ZHLgOLFKHQ $FKDWSHUOHQ ]ZHL EODXHQ 6WHLQSHUOHQ XQG HLQHU ]\OLQGHUI¤UPLJHQ 0LOOH}RUL3HUOH F  / 51cm. Aus kugeligen Lapislazuliperlen, zwei Silberperlen und einem silbernen Amulettbehälter. 6W©FN7UDJEDU Ketten mo GHUQDXIJHI”GHOWPLW6LOEHU9HUVFKO©VVHQ   u Collection of different healing chains. Modern stringing, with closures. 3 pieces! Wearable!

/,7(5$785$17,.( $)5,.$ 898 L. Mair, 0DJLH LP 6FKZDU]HQ (UGWHLO Kindlers Universitätsbi bliothek, München/Verona 1969, 256 S. mit zahlreichen, teilw. farbigen Abbildungen. Leinenstruktur mit Schutzumschlag. B. de Rachewiltz, 6FKZDU]HU (URV Afrikanische Sexualbräuche von der Vorgeschichte bis heute. Stuttgart 1965, 334 S. mit zahlreichen, teilw. farbigen Abbildungen. Leinen im Schuber. A. Reikat, 1LRPERGHU7RWHLQGHU3XSSH Begräbnisrituale in =HQWUDODIULND$XVVWHOOXQJVNDWDORJGHV5DXWHQVWUDXFK-RHVW0X VHXPV.¤OQ6ODPLQLHUWHU.DUWRQ/3RO~LHW$Q WKURSRPRUSKH *HI”gNHUDPLNHQ DXV =DLUH Ausstellungskatalog *DOHULH)UHG-DKQ0©QFKHQ2NWREHU1RYHPEHU  6  .DWDORJ1U LQ 6: DEJHELOGHW EURVFKLHUW 0 7UR ZHOO  + 1HYHUPDQQ $IULNDXQG2]HDQLHQ  $X~DJH :HLQ heim 1982, 264 S., mit zahlreichen, teilw. farbigen Abbildungen. Lederimitat mit Schutzumschlag. G. Chesi, :RRGRR  $IULNDV JHKHLPH0DFKW,QQVEUXFN6PLW]DKOUHLFKHQWHLOZ farbigen Abbildungen. Leinen mit Schutzumschlag. Kulturelle 0RQDWVVFKULIWGXw-DKUJDQJ-DQXDU.RQJR.XQVWw +HIWIRUPDW $XNWLRQHQ 'URXRW5LFKHOLHX .DWDORJ GHU $XNWLRQ YRP  1RYHPEHU  LQ 3DULV $UWV 3ULPLWLIV  .DWDORJ Nrn.; Heftformat. $XNWLRQVKDXV/HPSHUW]$IULFDQDQG2FHDQLF $UW.DWDORJGHU$XNWLRQYRP-DQXDULQ%U©VVHO .DWDORJ1U +HIWIRUPDW 'LHVHOEHQ .DWDORJ GHU $XNWLRQ $IUL FDQDQG2FHDQLF$UW-XQLLQ%U©VVHO.DWDORJ1U Heftformat. Autionshaus Dorotheum, .DWDORJGHU$XNWLRQ6WDP PHVNXQVW7ULEDO$UWYRP$SULOLQ:LHQ.DWDORJ1U Heftformat. 6W©FN$OOHLQJXWHP=XVWDQG 100,– 899 .RQYROXW $XNWLRQVNDWDORJH 1HXPHLVWHUV 0RGHUQH 0©QFKHQ: Auktion 33, 15. Mai 2003 (6SH]LDO$XNWLRQ 6DPPOXQJ :RO ters!  $XNWLRQ   1RYHPEHU  $XNWLRQ   0DL 2005; Auktion 38, 10. November 2005 und Auktion 11, ebenda, (Sammlung Bareis! ); Auktion 39, 18. Mai 2006. 6W©FN6HKU JXWHUJHS~HJWHU=XVWDQG 40,– 900 .RQYROXW$XNWLRQVNDWDORJHXQG%©FKHU3LDVD Art Africain, Coll HFWLRQ'XUDQG%DUU™UH3DULV'H]HPEHU$XNWLRQVKDXV =HPDQHN0©QVWHU:©U]EXUJ7ULEDO$UW$XNWLRQ6HS tember 2003. 6RWKHE\yV 1HZ <RUN 25. Mai 1999 (Sammlung 'U .DUO)HUGLQDQG 6FK”GOHU ). Galerie Wolfgang Ketterer, 116. $XNWLRQ $IULND $VLDWLFD 2]HDQLHQ  HWF  -XQL  $XNWLRQ3ULYDWVDPPOXQJ$IULND2]HDQLHQ$SULO   $XNWLRQ $IULND  2]HDQLHQ  'H]HPEHU  $XNWLRQ$IULND2]HDQLHQ'H]HPEHUF. Dör OLQJ%XFKXQG.XQVWDQWLTXDULDW+DPEXUJ 150. Auktion: Afrika und Ozeanien, 23. Oktober 1993. $XNWLRQVKDXV8UVXOD1XVVHU 0©QFKHQ Auktion außereuropäische Kunst, 23. November  .) 6FKDHGOHU (UGH XQG (U] 2500 Jahre afrikanische .XQVW DXV 7HUUDNRWWD XQG 0HWDOO 0©QFKHQ   6 PLW zahlreichen Abb.; Leinen mit Schutzumschlag, neuwertig. P. Stepan, ,NRQHQ GHU :HOWNXQVW $IULND München/London/New <RUN6PLW]DKOUHLFKHQ$EEJHSU”JWHU.DUWRQPLW Schutzumschlag, neuwertig. 6W©FN Sehr guter Zustand. 40,–

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

299


901 .RQYROXW$XNWLRQVNDWDORJH.HWWHUHU.XQVW0©QFKHQ Auktions kataloge Afrika und Ozeanien : Nr. 23, 26, 34, 38, 41, 45, 49, 55,  ,,,XQG6W©FN Alle in gutem Zustand. 40,– 902 .RQYROXW $XNWLRQVNDWDORJH 1HXPHLVWHUV 0RGHUQH XQG $IULND 0©QFKHQ$IULND0©QFKHQ6RQGHUDXNWLRQ0DL Auktion M 50, 10. November 2011; Auktion M 49, 26. Mai 2011; Auktion 48, 11. November 2010 (aus einer Münchner Privatsammlung, 3 Teile); Auktion 908, Teil I und II, Samm OXQJ'U.DUO)HUGLQDQG6FKDHGOHU $XNWLRQ 45, 14.5. 2009; Auktion 903 (Sammlung Walter Bareiss), 13.11. $XNWLRQ0DL6W©FN 40,–

35$(.2/80%,6&+ 903 .RQYROXW$XNWLRQVNDWDORJH&KULVWLHyV3UH&ROXPELDQ$UW1HZ <RUN  3UH&ROXPELDQ DQG 1HZ *XLQHD 7ULEDO $UW /RV $QJHOHV   &KULVWLHyV 3UH&ROXPELDQ $UW Sale High lights, 21. November 2006. 6RWKHE\yV)LQH3UH&ROXPELDQ$UW and Colonial Paintings of Latin America, New York, 12. Mai  &RORQLDO 3DLQWLQJV RI /DWLQ $PHULFD 3DUNH %HUQHW ,QF 1HZ<RUN0DL3UH&ROXPELDQ$UW1HZ<RUN*DO OHULHV  'H]HPEHU  $QWLTXLWLHV 3UH&ROXPELDQ (WKQR graphic, and Later works of Art, York Avenue Galleries, 26. 0DL$QWLTXLWLHV3UH&ROXPELDQ(WKQRJUDSKLFDQG/DWHU works of Art, York Avenue Galleries, 24. Februar 1982; Fine 3UH&ROXPELDQ$UW<RUN$YHQXH*DOOHULHV0DL3UH Columbian Art, York Avenue Galleries, 25. Februar 1981; Fine 3UH&ROXPELDQ $UW 3DUNH %HUQHW ,QF  1RYHPEHU  3UH&ROXPELDQ$PHULFDQ,QGLDQ$IULFDQ 2FHDQLF$UW 'H]HPEHU  *DOHULH :ROIJDQJ .HWWHUHU 0©QFKHQ Präco lumbische Kunst, 9. Mai 1981; Präcolumbische Kunst, 29. Auk WLRQ1RYHPEHU3U”FROXPELVFKH.XQVW$XNWLRQ 0DL3U”FROXPELVFKH.XQVW$XNWLRQ0DL G. Baer, )LJXUHQXQG*HI”gHDXV$OW0H[LFR Ausstellungskata ORJ0XVHXPI©U9¤ONHUNXQGH%DVHO)$QWRQ$OWLQGLD QLVFKH.XQVWLQ0H[LFR Leipzig 1986, 280 S. mit Zahlr. Abb.; Leinen. 6W©FN Gebraucht, aber guter Zustand. 40,–

$8.7,216.$7$/2*( 904 .RQYROXW.XQVWGHU$QWLNH*DOHULH*©QWHU3XK]H Kataloge 9;  ([HPSODUH  ([HPSODUH  ([ HPSODUH XQG6W©FN$OOHLQVHKUJXWHP=XVWDQG u

300

Folgende Losnummern in diesem Katalog befinden sich in der Vorübergehenden Verwendung (gekennzeichnet mit •) The following lot numbers in this catalogue are subject to temporary admission (marked with •): 1, 4, 7, 17, 20, 24, 25, 30, 32, 33, 39, 50 ,80, 83, 84, 88, 90, 93, 102, 109, 111, 128, 132, 143, 173, 202, 241, 248, 251, 253, 260, 261, 304, 345 Das auf den Zuschlag zu zahlende Aufgeld beträgt einheitlich 20%. Zusätzlich werden Einfuhrumsatzsteuer und Versandkosten nach folgenden Maßgaben erhoben: Für Käufer aus EU Ländern gilt: Nach der endgültigen Zollabwicklung, die erst nach dem erfolgten Zuschlag erledigt werden kann, wird die gesetzliche Einfuhrumsatzsteuer auf den Gesamtbetrag von Zuschlag und Aufgeld in einer separaten Rechnung berechnet. Die Nebenkosten (z.B. Versandkosten) zzgl. gesetzlicher Ust werden separat in Rechnung gestellt. Für Käufer mit Wohnsitz außerhalb der EU (Drittland) gilt: Wird die Ware vom Käufer selbst oder durch Dritte ins Drittland ausgeführt, wird die gesetzliche Einfuhrumsatzsteuer berechnet, später bei Vorlage des gesetzlich geforderten Ausfuhrnachweises erstattet. Wird die Ware von uns selbst in Drittländer ausgeführt, wird die gesetzliche Einfuhrumsatzsteuer nicht berechnet. The buyer´s premium on the hammer price is 20%. Additionally, importation VAT and shipping fees will be dealt with as follows: EU citizens: After finalization of the custom procedure, which can only be concluded after the goods have been sold in auction, the relevant importation VAT on the entire amount of hammer price and buyer’s premium will be charged by a separate invoice. Additional costs (f.e. shipping costs) plus the relevant VAT will be charged separately. Non EU citizens: As far as these buyers export the goods in person or by a third party the relevant VAT will be charged but refunded after receiving the legal proof of exportation. In case that we export the goods the relevant VAT will not be charged.


Versteigerungsbedingungen I. Beteiligte 1. Versteigerer Wir versteigern im eigenen Namen für Rechnung der Einlieferer als Kommissionär nach Handelsgesetzbuch. 2. Einlieferer Unsere Rechtsbeziehung zu diesen gestaltet sich nach dem mit diesen geschlossenen Verkaufskommissionsvertrag nebst Anlagen. Die Einlieferer bleiben unbenannt; es sei denn, Behörden, Gerichte oder Erwerber machen von ihrem Offenlegungsrecht nach dem Kulturgutschutzgesetz (KGSG) Gebrauch. 3. Erwerber Wir sind nach dem KGSG verpflichtet, die Identität der Erwerber festzuhalten. Wenn der Erwerber für Dritte bietet, muss er seine Vertreterstellung vor Beginn der Versteigerung offenlegen und uns die Daten des von ihm Vertretenen zur Verfügung stellen. II. Regeln der Versteigerung 1. Die Versteigerung regelt sich nach den nachfolgenden Bedingungen. 2. Mit der Teilnahme an der Versteigerung erkennt der Erwerber diese Versteigerungsbedingungen an. Von unseren Versteigerungsbedingungen abweichende Allgemeine Geschäftsbedingungen des Erwerbers erkennen wir nicht an und widersprechen diesen hiermit ausdrücklich. III. Vertragsschluss 1. Erwerber a. Erwerber ist sowohl der Verbraucher als auch der Unternehmer oder Kaufmann. Sofern aus Vereinfachungsgründen vom Erwerber in männlicher Form die Rede ist, ist hiermit auch die weibliche Erwerberin gemeint. a.1. Verbraucher Verbraucher ist jede natürliche Person, die ein Rechtsgeschäft zu einem Zwecke abschließt, der weder ihrer gewerblichen noch ihrer selbständigen beruflichen Tätigkeit zugerechnet werden kann (§ 13 BGB). a.2. Unternehmer Wenn der Erwerber in unseren Bedingungen als Unternehmer oder Kaufmann bezeichnet wird, gilt dies nur für den Fall, dass er bei Abschluss des Vertrages mit uns in Ausübung seiner gewerblichen oder selbständigen beruflichen Tätigkeit handelt (§ 14 BGB). a.3. Kaufmann Kaufmann ist, wer ein Handelsgewerbe betreibt, also einen Gewerbebetrieb, der nach Art und Umfang einen in kaufmännischer Weise eingerichteten Geschäftsbetrieb erfordert (§ 1 HGB) oder dessen Firma im Handelsregister eingetragen ist (§§ 2, 19 HGB). b. Als Erwerber können Sie Ihr Gebot im Versteigerungssaal, schriftlich, telefonisch oder im Internet abgeben. 2. Gebot a. Jedes Gebot des Erwerbers stellt ein verbindliches Angebot zum Abschluss eines Kaufvertrages dar und ist wirksam bis zur Abgabe eines höheren Gebotes (Übergebot). b. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Bezahlung. c. Bei Zweifeln, ob oder an wen ein Zuschlag erfolgt ist, ob ein Übergebot übersehen worden ist, sowie bei sonstigen unklaren Fällen wird die Versteigerungsnummer nochmals ausgerufen. Bei mehreren gleich hohen Angeboten mehrerer Bieter entscheiden wir nach freiem Ermessen. Bei ausschließlichen Internetgeboten erfolgt der Zuschlag virtuell. d. Der Zuschlagspreis bildet die Berechnungsgrundlage für das vom Erwerber zu zahlende Aufgeld. IV. Gebote 1. Die Mindest-Steigerungsstufen betragen gerundete 5 % des Ausrufes bzw. des letzten Gebotes, d. h.

bis

100,00 Euro 200,00 Euro 500,00 Euro 1.000,00 Euro 2.000,00 Euro 5.000,00 Euro 10.000,00 Euro 20.000,00 Euro 50.000,00 Euro 100.000,00 Euro 500.000,00 Euro

5,00 Euro 10,00 Euro 25,00 Euro 50,00 Euro 100,00 Euro 200,00 Euro 500,00 Euro 1.000,00 Euro 2.000,00 Euro 5.000,00 Euro 10.000,00 Euro

2. Schriftliche Aufträge führen wir ohne zusätzliche Auftragsprovision durch. Im Bedarfsfalle erklären Sie sich damit einverstanden, dass wir die Limits der eingesandten Gebote bis zu 5 % überziehen. Schriftliche Gebote müssen bis 24 Stunden vor Auktionsbeginn bei uns vorliegen. Bei schriftlichen Geboten erhält unter mehreren gleich hohen Geboten das zuerst eingegangene den Vorzug. 3. Telefonische Bieter können wir nur berücksichtigen, wenn sie sich spätestens zwei Werktage vor der Auktion bei uns angemeldet haben. 4. Für die Teilnahme an der Auktion über Internet benötigen Sie einen Zugang zu unserem Internetportal, in dem Sie sich als Neukunde rechtzeitig zu registrieren haben. Mit der Registrierung erkennen sie an, die „Versteigerungsbedingungen“, die „Datenschutzerklärung“ und die „Wichtigen Informationen“ zur Kenntnis genommen zu haben und damit einverstanden zu sein. Als Verbraucher bestätigen Sie mit der Registrierung zusätzlich, die Widerrufsbelehrung und das Widerrufsformular sowie das Impressum mit dem Hinweis auf die Online-Streitbeilegung eingesehen zu haben. 5. Gebote von uns unbekannten Bietern können wir nur ausführen, wenn rechtzeitig ein Depot hinterlegt und diese Hinterlegung bestätigt oder über nachprüfbare Referenzen eine Bonitätsprüfung erfolgreich durchgeführt und rückbestätigt wurde. 6. Aufträge, die unter 80 % des Schätzpreises liegen, werden nicht ausgeführt. 7. Saalbieter kaufen „wie besehen“. Schriftliche-, telefonischeoder Internet-Erwerber haben die Möglichkeit, sich über den Zustand des Versteigerungsstückes während der Besichtigungstage vor der Versteigerung persönlich oder durch einen Vertreter in unseren Geschäftsräumen zu informieren; deren Missverständnisse zu Katalogangaben gehen infolge dessen zu deren Lasten. Bei Telefon- und Internet-Bietern übernehmen wir keine Haftung für die Risiken, die in der Nutzung elektronischer Kommunikationsmittel für die Gebotsabgabe des Erwerbers begründet sind, etwa für das Zustandekommen des Leitungsaufbaus, Leitungszusammenbrüche, Übermittlungsfehler, Ausfall- und Verzögerungszeiten und andere mit diesen Kommunikationswegen verbundene, typische, derartige Risiken mehr, die nicht in unserem Einflussbereich liegen; allerdings nur für den Fall, dass uns hieran der Vorwurf grober Fahrlässigkeit oder des Vorsatzes nicht trifft. V. Preis und Nebenkosten 1. a. Der Erwerber hat den Zuschlagspreis zu zahlen. b. Das Versteigerungsgut wird differenzbesteuert verkauft, es sei denn, einzelne Versteigerungsgüter unterliegen der Vollversteuerung oder befinden sich in der vorübergehenden Verwendung; diese sind sodann auf einer Liste im gedruckten Katalog speziell gekennzeichnet. Bei differenzbesteuerter Ware wird keine Umsatzsteuer ausgewiesen. 2. a. Wir berechnen dem Erwerber zusätzlich bei Auslandsschecks und -überweisungen bis 24.999 € Geldtransferkosten in Höhe von 15,00 € und ab 25.000 € Geldtransferkosten in Höhe von 50,00 €.

301


Wir bieten für Verbraucher, Unternehmer und Kaufmänner als kostenlose Zahlungsart Mitnahme gegen Barzahlung und im Inland Banküberweisung auch ohne Vorkasse gegen rückbestätigte Referenzen an. b. Eigene Kosten seines eigenen Zahlungs-Providers (Bank, Kreditkartenunternehmen u.s.w.) hat der Erwerber gegebenenfalls selbst zu tragen. 3. a. Wenn wir auf Wunsch des Erwerbers versenden, hat der Erwerber auch die Nebenkosten des Versandes zu tragen. Es handelt sich hierbei um Versandkosten, Verpackungskosten, gegebenenfalls Versicherungskosten, gegebenenfalls Export -Lizenzkosten. Diese sind erst nach Zuschlag bezifferbar, da sie individuell vom jeweiligen Versteigerungsgut abhängen. b. Handelt es sich bei dem Erwerber um einen Verbraucher und hat er an der Versteigerung per Brief, Telefon oder Internet teilgenommen, erhält er mit der vorläufigen Rechnung über den Zuschlagspreis auch die Nebenkosten des Versandes mitgeteilt. Diese sind wegen der unterschiedlichen Versteigerungsgüter, der jeweils angemessenen Verpackungs-/ Versandart und des Zielortes nur im Einzelfall und nicht generell im Vorfeld bestimmbar. Der Erwerber als Verbraucher hat die Möglichkeit, bei Nichtakzeptanz der Nebenkosten des Versandes, von dem Versteigerungsvertrag binnen zehn Tagen nach Zugang der vorläufigen Rechnung, mit Eingang bei uns, schriftlich zurückzutreten, ohne dass Kosten für ihn anfallen. Sein Widerrufsrecht wird davon nicht berührt. 4. Bei der Ausfuhr des Versteigerungsgutes aus der Bundesrepublik Deutschland entstehen dem Erwerber gegebenenfalls weitere Kosten für Steuern und Zölle sowie behördliche Aus-/Einfuhrgenehmigungen. Diese sind ebenfalls vom Erwerber zu tragen und im Preis nicht enthalten. 5. Der Erwerber kann seine Zahlung bar gegen Mitnahme erbringen oder durch Überweisung auf eines unserer nachstehenden Konten: Postbank BIC (SWIFT) : PBNKDEFF / IBAN : DE 28700100800150384802 Commerzbank München: BIC (SWIFT) : COBADEFFXXX / IBAN : DE 73700400410666711700 HypoVereinsbank München: BIC (SWIFT) : HYVEDEMMXXX / IBAN : DE 36700202700002860120 6. Die Zahlung hat in der Währung € zu erfolgen. Auslandserwerber sind für die Einhaltung der geltenden Devisen- und Einfuhrbestimmungen allein verantwortlich. VI. Aufgeld und Umsatzsteuern 1. Der Erwerber hat zu dem Zuschlagspreis ein aus diesem berechnetes Aufgeld zu zahlen. 2. Das Aufgeld beträgt bei Erwerbern aus EU-Mitgliedstaaten: a. bei differenzbesteuerter Ware aa. bei Münzauktionen: 25 % ab. bei Auktionen Kunst der Antike: 25 % b. bei vollbesteuerter Ware b.a. bei Münzauktionen: 20 % b.b .bei Auktionen Kunst der Antike: 20 % jeweils zuzüglich der jeweils geltenden gesetzlichen Umsatzsteuer auf die Summe aus Zuschlag, Aufgeld und Nebenkosten (Geldtransferkosten und Nebenkosten des Versandes). c. bei Ware in der vorübergehenden Verwendung c.a. bei Münzauktionen: 20% c.b. bei Auktionen Kunst der Antike: 20 % jeweils zuzüglich Einfuhrumsatzsteuer auf den Gesamtbetrag von Zuschlag und Aufgeld auf einer separaten Rechnung. Die Nebenkosten (Geldtransferkosten und Nebenkosten des Versandes) zuzüglich jeweils geltender gesetzlicher Umsatzsteuer werden separat in Rechnung gestellt. 3. Erwerber mit Wohnsitz außerhalb der EU, sofern die Ware exportiert wird: Das Aufgeld beträgt a.a. bei Münzauktionen: 20% b.b. bei Auktionen Kunst der Antike: 20 % Die jeweilige Umsatzsteuer ist geregelt in Ziffer VII. 1. 4. Bei umsatzsteuerbefreiten Goldmünzen gilt generell ein Aufgeld von 15 %.

302

VII. Umsatzsteuerliche Sonderbehandlungen 1. Bei Erwerbern mit Wohnsitz in Drittländern, außerhalb der EU-Mitgliedsstaaten, wird auf den Zuschlagspreis, die Nebenkosten und das Aufgeld die gesetzliche Umsatzsteuer berechnet, jedoch bei Vorlage der gesetzlich geforderten Ausfuhrnachweise in der gesetzlich zulässigen Höhe erstattet. Sofern wir diese Ware für die Erwerber in diese Drittländer ausführen, wird die Rechnung umsatzsteuerfrei gestellt. Im Drittland anfallende Importsteuern oder Zölle trägt in jedem Fall der Erwerber. 2. Gewerbliche Erwerber mit Eintragung in einem EU-Mitgliedsstaat, mit gültiger UmsatzsteuerIdentifikationsnummer, können sich die Umsatzsteuer erstatten lassen; wir benötigen hierfür die gesetzlich erforderlichen Dokumente. Letztere bestehen aus der Umsatzsteuer-Identifikationsnummer und der Gelangensbestätigung des EU-Mitgliedsstaates, in dem die Umsatzsteueridentifikationsnummer erteilt wurde. Auch hier berechnen wir für den Fall, dass wir die Ware ausführen, und eine gültige Umsatzsteuer-Identifikationsnummer vor dem Erwerb vorgelegt wurde und wir die Gelangensbestätigung erhalten, keine Umsatzsteuer. VIII. Zahlung durch den Erwerber 1. Bei in der Versteigerung persönlich anwesenden Erwerbern (Saalauktion) ist der Kaufpreis zuzüglich des Aufgeldes und eventuell anfallender Nebenkosten sofort fällig. 2. Bei schriftlichen Erwerbern, telefonischen Erwerbern oder Internet Erwerbern versenden wir eine Vertragsbestätigung/ Vorläufige Rechnung, bei Verbrauchern nebst Versteigerungsbedingungen und Widerrufsbelehrung nebst Widerrufsformular, sowie eine Rechnung. Diese Rechnung ist fällig zehn Tage nach Erhalt. IX. Lieferung 1. Die Lieferung an Saalerwerber setzt sofortige Zahlung voraus und erfolgt an schriftliche, telefonische oder Internetkunden in der Regel gegen Vorkasse. Es sei denn, es wurde ein ausreichendes, angefordertes, Deposit hinterlegt oder die Bonität durch Referenz rückbestätigt. 2. Bei Münzauktionen mit Inlandslieferung: a. Verbraucher Wir liefern bei Verbrauchern das Versteigerungsgut – in der Regel – gegen Vorkasse; mit den kostenlosen Zahlungsmöglichkeiten nach Ziffer V,2.a.,Satz2 dieser Versteigerungsbedingungen. Nach Mitteilung des Zahlungsauftrages durch Sie an Ihre Bank werden wir die Versteigerungsobjekte spätestens innerhalb von 14 Arbeitstagen (ohne Samstage, Sonn- und Feiertage) an Sie übersenden. Im Falle der Kreditkartenzahlung oder PayPalZahlung erfolgt die Lieferung der Versteigerungsobjekte spätestens innerhalb von 14 Arbeitstagen (ohne Samstage, Sonn- und Feiertage) an Sie nach Auslösung des Zahlungsvorganges. b. Unternehmer und Kaufmann Wir liefern bei Unternehmern und Kaufmännern die Versteigerungsobjekte – in der Regel – gegen Vorkasse. Die Lieferung der Versteigerungsobjekte erfolgt spätestens innerhalb von 14 Arbeitstagen nach Zahlungseingang. 3. Bei Münzauktionen mit Auslandslieferung und bei Auktionen Kunst der Antike: Die Lieferfrist bestimmt sich nach der nach dem individuellen Versteigerungsgut erforderlichen speziell angefertigten Verpackung, der speziell erforderlichen Versandart und der behördlichen Dauer zur Erstellung etwaig erforderlicher Exportlizenzen/ Genehmigungen. Wir leiten die erforderlichen Maßnahmen unverzüglich in die Wege und führen die Lieferung unverzüglich nach Erstellung der Verpackung, Annahmebestätigung des Speditionsvertrages und Vorlage der behördlichen Urkunden durch. 4. Teillieferungen sind zulässig, soweit es für den Erwerber zumutbar ist. 5. Das Wiedereintreffen der Versteigerungsobjekte bei uns aufgrund Unzustellbarkeit oder verweigerter Annahme werten wir bei Unternehmern und Kaufmännern als Rücktritt und bei Verbrauchern als Widerruf.


6. Bei Rücksendungen muss aus versicherungstechnischen Gründen der Versand vorab mit uns abgestimmt werden. X. Eigentumsvorbehalt Wir behalten uns, soweit wir Kommissionär sind für den Einlieferer, bis zur vollständigen Zahlung des Kaufpreises nebst Nebenkosten, Aufgeld und Steuern durch den Erwerber, das Eigentum an den Versteigerungsobjekten vor. Solange der Kaufpreis noch nicht vollständig bezahlt ist, ist der Erwerber, aufgrund dieses Eigentumsvorbehaltes, ohne dass dadurch, soweit er Verbraucher ist, seine Rechte auf Prüfung der Objekte nach dem Widerrufsrecht eingeschränkt werden, verpflichtet, insbesondere Münzen, nicht zu reinigen und diese sowie wie andere Objekte nicht mit chemischen Mitteln oder anderen Gegenständen zu behandeln, nicht zu restaurieren, Slabs nicht aufzubrechen und den Zugriff Dritter auf die Objekte, etwa im Falle einer Pfändung oder einem Besitzwechsel der Objekte, sowie den eigenen Wohnsitzwechsel, uns unverzüglich anzuzeigen. Der Erwerber tritt uns bereits jetzt alle Forderungen in Höhe des Rechnungsbetrages ab, die ihm durch die Weiterveräußerung gegen einen Dritten erwachsen. Wir nehmen, soweit wir Kommissionär sind für den Einlieferer, die Abtretung bereits jetzt an. Nach der Abtretung behalten wir uns vor, gegebenenfalls für den Einlieferer, die Forderung selbst, gegebenenfalls als Kommissionär, einzuziehen, sofern und soweit der Erwerber in Zahlungsverzug ist. XI. Gefahrübergang 1. Verbraucher Ist der Erwerber privathandelnder Verbraucher, geht die Gefahr des zufälligen Untergangs und der zufälligen Verschlechterung des Versteigerungsobjektes erst mit Übergabe des Versteigerungsobjektes an den Erwerber auf den Erwerber über. 2. Unternehmer und Kaufmann Ist der Erwerber Unternehmer oder Kaufmann, geht mit der Auslieferung des Versteigerungsobjektes an das mit der Übersendung beauftragte Transportunternehmen, die Gefahr des zufälligen Untergangs oder zufälligen Verschlechterung des Versteigerungsobjektes auf den Erwerber über. 3. Annahmeverzug Im Falle des Annahmeverzuges des Erwerbers geht die Gefahr mit dem Annahmeverzug auf den Erwerber über. 4. Sofern wir haften und der Schaden durch eine vom Erwerber oder für den Erwerber abgeschlossene Versicherung gedeckt ist, hat der Erwerber diese außergerichtlich bevorzugt in Anspruch zu nehmen. Soweit erforderlich, treten wir bereits an dieser Stelle entsprechende Schadensersatzforderungen gegen Dritte an den Erwerber ab. Soweit der Erwerber hierbei Zahlungen erlangt, bleibt unsere Haftung nur für etwaig damit verbundene Nachteile, wie Prämienrückstufungen oder Zinsverluste, bestehen; andernfalls bleibt eine bestehende Haftung von uns unberührt. XII. Mängelhaftung 1. Der Erwerber hat die Möglichkeit, sich vom Erhaltungszustand des Versteigerungsgutes, dessen Qualität und dessen Eigenschaften durch Vorbesichtigung persönlich zu überzeugen. 2. Beschreibungen und Erhaltungsangaben im Katalog und auf unseren Internetseiten zur Versteigerung sind persönliche Einschätzungen unserer qualifizierten Mitarbeiter, die mit Sorgfalt und nach bestem Wissen und Gewissen nach branchenüblichen Maßstäben durchgeführt und formuliert werden. Sie dienen allerdings nur der Erläuterung und Einordnung, ebenso wie die beigefügten Abbildungen. Dies stellt keine Beschaffenheitsvereinbarung im Sinne des § 434 BGB und auch nicht die Übernahme einer Garantie im Rechtssinne dar. 3. Die Echtheit der Stücke wird gewährleistet, allerdings ohne Übernahme einer Garantie. Bei einer, ohne grob fahrlässige oder vorsätzliche Pflichtverletzung durch uns, nachträglich erkannten, Fälschung beschränken wir unsere Gewährleistung der Höhe nach auf den Zuschlagspreis einschließlich der Nebenkosten (Nebenkosten des Versandes, Geldtransferkosten)

sowie das Aufgeld und gegebenenfalls Steuer. 4. Wir übernehmen keine Verantwortung dafür, dass die durch uns versteigerte Ware von den sogenannten GradingUnternehmen angenommen oder die Erhaltungsqualität in einer ähnlichen Form eingeschätzt wird, wie durch uns. Reklamationen, die daraus resultieren, dass ein GradingUnternehmen zu einer abweichenden Qualitätsbewertung gekommen ist, berechtigen nicht zu einer Rückabwicklung des Kaufes. Bei Stücken, die von uns in den sogenannten „Slabs“, (Münzen sind eingeschweißt in Plastikholder, ausgegeben von den Grading-Unternehmen) verkauft werden, entfällt die oben genannte Gewährleistung der Echtheit. Auch für versteckte Mängel, z.B. Randfehler, Henkelspuren, Schleifspuren, etc., die durch den Plastikholder verdeckt werden, übernehmen wir keine Mängelhaftung. 5. Wir übernehmen als Kommissionäre die uns obliegenden Verpflichtungen nach dem Kulturgutschutzgesetz (KGSG). Wir sind hier verpflichtet, bei archäologischen Kulturgütern älter als 100 Jahre und mit einem Wert ab null Euro und bei sonstigen Kulturgütern, also Münzen, ab einem Wert von 2.500,00 Euro unseren besonderen Sorgfaltspflichten nachzukommen. Dazu sind wir allerdings nur verpflichtet im Rahmen des Zumutbaren, insbesondere einer wirtschaftlichen Zumutbarkeit. Wir erfüllen dies durch Prüfung des Versteigerungsgutes durch unsere in der Regel akademisch archäologisch qualifizierten Mitarbeiter. Die Angaben der Einlieferer zu Provenienz, Herkunft, Rechtmäßigkeit und Echtheit der Urkunden lassen wir uns von diesen bestätigen und prüfen dies gegen in den öffentlichen Verzeichnissen und Datenbanken (InterpolDatei of stolen works of art und ICOM Red Lists, Art-LossRegister, Internetportal des BKM nach § 4 KGSG). Darüber hinausgehende Garantien, Gewährleistungen, Zusicherungen oder Verantwortlichkeiten können wir nicht übernehmen, insbesondere auch nicht bei Rückgabeersuchen fremder Staaten oder behördlichen oder gerichtlichen Maßnahmen. Nach dem Hintergrundpapier Münzsammler, der Beauftragten der Bundesregierung für Kultur und Medien (BKM) vom Juli 2016, wird bei Münzen und anderen Kulturgütern eine lückenlose Provenienz durch das neue Kulturgutschutzgesetz nicht gefordert. Es gelten insbesondere Münzen, wenn es sie in großer Stückzahl gibt, diese für die Archäologie keinen relevanten Erkenntniswert haben und nicht von einem EUMitgliedstaat als individualisierbare Einzelobjekte unter Schutz gestellt sind, als keine archäologischen Gegenstände. Dabei können, nach einer Entscheidung des Bundesfinanzhofes, nur Münzen, die keine Massenware sind, von archäologischem Interesse sein. Münzen fallen deshalb als archäologisches Massenprodukt im Regelfall nicht unter die Regelungen des Kulturgutschutzgesetzes (Bayerisches Kunstministerium, Ministerialrat von Urff, BSZ, 15.07.2016). Wir gehen bei der Erfüllung unserer (Sorgfalts-) Verpflichtungen nach dem Kulturgutschutzgesetz von diesen eigenen Einschätzungen des Gesetzgebers und der zuständigen Obersten Bayerischen Landesbehörde aus. 6. Bei Lots und Serien kauft der Erwerber eine nicht näher beschriebene Gesamteinheit einfachen Zuschnitts. Es handelt sich hier bei den Angaben nur um Etwa-Angaben, wobei irrtümliche Zuschreibungen im Rahmen des Möglichen liegen. Versteigerungsstücke in Form von Lots sind nach erfolgtem Zuschlag daher von der Gewährleistung in branchenüblicher Weise ausgeschlossen, es sei denn, wir hätten bei der Beschreibung, der Zuordnung oder der Versteigerung arglistig gehandelt. 7. Als Kaufmann hat der Erwerber uns etwaige Mängel unverzüglich anzuzeigen. Ansonsten verliert er seine Gewährleistungsrechte. 8. Bei einem Sachmangel hat der Erwerber uns zunächst angemessene Gelegenheit zur Reparatur oder Ersatzlieferung, nach unserer Wahl, zu geben. Soweit uns dies nicht gelingt, stehen dem Erwerber die weitergehenden Rechte nach dem Gesetz zu. 9. Die Ansprüche der Erwerber wegen Sachmängeln an unseren gebrauchten Versteigerungsgütern verjähren in einem Jahr ab Erhalt des Versteigerungsgutes. Die besondere Klassifikation unserer Versteigerungsgüter in Form von alten numismatischen und antiken Gütern erfordert aber

303


im Interesse des Erwerbers eine unverzügliche Klärung von Abweichungsrügen zur Sicherung des Übergabezustandes binnen sieben Tagen. XIII. Haftung auf Schadensersatz neben der Gewährleistung 1. Maßstab Wir haften für die Verletzung von Vertragspflichten und aus Delikt nur bei Vorsatz oder grober Fahrlässigkeit. Diese Einschränkung gilt nicht bei der Verletzung von Leben, Körper und Gesundheit oder bei der Verletzung von Hauptpflichten. Hier haften wir für jedes Verschulden. 2. Betroffene Soweit diese Haftungseinschränkung reicht, gilt sie auch für unsere Erfüllungsgehilfen und die persönliche Haftung unserer Angestellten. 3. Weitere Beschränkungen gegenüber Unternehmern und Kaufmännern Sofern der Erwerber beim Zuschlag als Unternehmer und/ oder als Kaufmann für sein Unternehmen gehandelt hat, beschränken wir unsere Haftung darüber hinaus auf den vorhersehbaren und typischerweise eintretenden Schaden. Diese weitergehende Haftungsbeschränkung gilt wiederum dann nicht, wenn wir arglistig gehandelt haben sowie für Ansprüche nach dem Produkthaftungsgesetz und für Schäden aus der Verletzung von Leben, Körper und Gesundheit. XIV. Widerrufsrecht für Verbraucher Verbrauchern steht ein Widerrufsrecht nach der folgenden Maßgabe zu. Verbraucher ist jede natürliche Person, die ein Rechtsgeschäft zu einem Zweck abschließt, der weder ihrer gewerblichen noch ihrer selbstständigen beruflichen Tätigkeit zugerechnet werden kann (§ 13 BGB). Beginn der Widerrufsbelehrung: Widerrufsrecht Als Verbraucher haben Sie das Recht, binnen vierzehn Tagen ohne Angabe von Gründen diesen Vertrag zu widerrufen. Die Widerrufsfrist beträgt vierzehn Tage ab dem Tag, an dem Sie oder ein von Ihnen benannter Dritter, der nicht Beförderer ist, die Ware (oder die letzte Ware, letzte Teilsendung oder das letzte Stück im Fall eines Vertrages über mehrere Waren mit einer einheitlichen Bestellung oder die Lieferung einer Ware in mehreren Teilsendungen oder –stücken) in Besitz genommen haben bzw. hat. Um Ihr Widerrufsrecht auszuüben, müssen Sie uns Gorny & Mosch Giessener Münzhandlung GmbH Maximiliansplatz 20, D-80333 München Telefon: +49 89 2422643-0, Telefax: +49 89 2285513 E-Mail: info@gmcoinart.de mittels einer eindeutigen Erklärung (zum Beispiel ein mit der Post versandter Brief, Telefax oder E-Mail) über Ihren Entschluss, diesen Vertrag zu widerrufen, informieren. Sie können dafür das beigefügte Widerrufsformular verwenden, das jedoch nicht vorgeschrieben ist. Zur Wahrung der Widerrufsfrist reicht es aus, dass Sie die Mitteilung über die Ausübung des Widerrufsrechts vor Ablauf der Widerrufsfrist absetzen. Folgen des Widerrufs Wenn Sie diesen Vertrag widerrufen, haben wir Ihnen alle Zahlungen, die wir von Ihnen erhalten haben, einschließlich der Lieferkosten (mit Ausnahme der zusätzlichen Kosten, die sich daraus ergeben, da Sie eine andere Art der Lieferung als die von uns angebotene günstige Standard-Lieferung gewählt haben), unverzüglich und spätestens binnen vierzehn Tagen ab dem Tag zurückzuzahlen, an dem die Mitteilung über Ihren Widerruf dieses Vertrages bei uns eingegangen ist. Für diese Rückzahlung verwenden wird dasselbe Zahlungsmittel, das Sie bei der ursprünglichen Transaktion eingesetzt haben, es sei denn, mit Ihnen wurde ausdrücklich etwas anderes vereinbart; in keinem Fall werden Ihnen wegen dieser Rückzahlung Entgelte berechnet. Wir können die Rückzahlung verweigern, bis wir die Waren wieder zurückerhalten haben oder bis Sie den Nachweis erbracht haben, dass Sie die Waren zurückgesandt haben, je

304

nachdem, welches der frühere Zeitpunkt ist. Sie haben die Waren unverzüglich und in jedem Fall spätestens binnen vierzehn Tagen ab dem Tag, an dem Sie uns über den Widerruf dieses Vertrages unterrichten, an uns zurückzusenden oder zu übergeben. Die Frist ist gewahrt, wenn Sie die Waren vor Ablauf der Frist von vierzehn Tagen absenden. Sie tragen die Kosten der unmittelbaren Rücksendung der Waren. Sie müssen für einen etwaigen Wertverlust der Waren nur aufkommen, wenn dieser Wertverlust auf einen zur Prüfung der Beschaffenheit, Eigenschaften und Funktionsweise der Waren nicht notwendigen Umgang mit Ihnen zurückzuführen ist. Ende der Widerrufsbelehrung. Das Widerrufsformular halten wir auf unserer Web-Site für die Erwerber als Verbraucher bereit. XV. Verweigerung von Zahlung und Abnahme 1. Bei nicht fristgerechter Zahlung der Rechnung verliert der Erwerber bei Belehrung hierüber in der Rechnung seine Rechte aus dem Zuschlag und das Versteigerungsgut kann auf seine Kosten erneut versteigert oder, nach unserem freien Ermessen, freihändig verkauft werden. In diesem Fall haftet der Erwerber für den Mindererlös. 2. Als Erwerber haben Sie zusätzlich einen pauschalierten Schadenersatz in Höhe von 15 % des ersten Zuschlagspreises zu bezahlen. Ihnen bleibt jedoch das Recht vorbehalten, den Eintritt eines geringeren oder das Fehlen eines Schadens nachzuweisen. In diesem Fall schulden Sie geringeren oder keinen Schadenersatz. Uns bleibt die Geltendmachung eines höheren Schadens ausdrücklich vorbehalten. 3. Bei Verzug des Erwerbers mit der Zahlung der Rechnung schuldet dieser auch Zinsen. XVI. Aufrechnung Eine Aufrechnung gegen unsere Forderungen ist ausgeschlossen, es sei denn, die Forderung ist unbestritten oder rechtskräftig festgestellt. XVII. Schlussbestimmungen 1. Salvatorische Klausel Sollte eine Bestimmung der Versteigerungsbedingungen ganz oder teilweise unwirksam sein oder ihre Rechtswirksamkeit später verlieren, so soll hierdurch die Gültigkeit der übrigen Bestimmungen nicht berührt werden. Anstelle der unwirksamen Bestimmung gilt die gesetzliche Vorschrift. 2. Gerichtsstand bei Kaufmann als Erwerber Ist der Erwerber Kaufmann, juristische Person des öffentlichen Rechts oder öffentlich-rechtlichen Sondervermögens, ist ausschließlicher Gerichtsstand für alle Streitigkeiten aus diesem Vertrag der Geschäftssitz der Gorny & Mosch Giessener Münzhandlung GmbH, also München. Dasselbe gilt, wenn der Erwerber keinen allgemeinen Gerichtsstand in der Bundesrepublik Deutschland hat oder Wohnsitz oder gewöhnlicher Aufenthalt im Zeitpunkt der Klageerhebung nicht bekannt ist. 3. Grenzüberschreitende Versteigerung Wenn wir grenzüberschreitend versteigern, bedeutet das keine entsprechende Geschäftsausrichtung. Es gelten deutsches Recht und deutsche Gerichtsbarkeit. Die Geltung der CISG wird ausgeschlossen. Ist der Erwerber Verbraucher, gelten für ihn auch die verbraucherschützenden Vorschriften seines Wohnsitzstaates; er hat bei Rechtsstreitigkeiten darüber hinaus die Wahl des Gerichtsstandes unseres Firmensitzes oder seines Wohnsitzes. Wir müssen ihn stets an seinem Wohnsitz verklagen. Wenn Sie unsere Kataloge künftig nicht mehr erhalten möchten, können Sie der Verwendung Ihrer Daten für den Versand jederzeit widersprechen.

Gorny & Mosch Giessener Münzhandlung GmbH Auktionatoren: Dieter Gorny, Dr. Hans-Christoph von Mosch Geschäftsführer: Dieter Gorny, Dr. Hans-Christoph von Mosch Handelsregister München HRB Nr. 75528 Sitz der Gesellschaft: München


Terminvorschau

Impressum

Auktion 280

11./12. Oktober 2021 Münzen der Antike Einlieferungsschluss 30. Juli 2021

Auktion 281

13. Oktober 2021 Mittelalter und Neuzeit Einlieferungsschluss 30. Juli 2021

E-Auktion 282

14./15. Oktober 2021 Münzen aus Antike und Neuzeit Einlieferungsschluss 30. Juli 2021

Auktion 283

Dezember 2021 Kunst der Antike Einlieferungsschluss September 2021

Auktion 284-285

7./8. März 2022 Münzen Antike und Neuzeit Einlieferungsschluss 23. Dezember 2021

E-Auktion 286

9. März 2022 Münzen Antike und Neuzeit Einlieferungsschluss 23. Dezember 2021

Herausgeber GORNY & MOSCH Giessener Münzhandlung GmbH München Bearbeitung Dr. Georg Morawietz Dr. Martin Schulz Irene Rulka, M. A. Dr. Margret Nollé Dr. Dr. Karl-Ferdinand Schaedler (Afrikanische Kunst) Maria Borshchevska Dace Tretjaka Gestaltung GORNY & MOSCH Digitale Fotografie Michael Girschick, Starnberg Satz & Montage Hartmut Baier Druck Meister Print & Media GmbH, Kassel

Alle Rechte vorbehalten, insbesondere die der Übersetzung und der fotomechanischen Wiedergabe. Nachdruck, auch auszugsweise, nur mit schriftlicher Genehmigung des Herausgebers. Printed in Germany

GORNY & MOSCH Giessener Münzhandlung GmbH Maximiliansplatz 20, D-80333 München Tel. +49 (0)89 24226430 · Fax +49 (0)89 2285513 E-Mail: info@gmcoinart.de www.gmcoinart.de Amtsgericht München HRB Nr. 75528 Geschäftsführer: Dieter Gorny, Dr. Hans-Christoph von Mosch


GORNY & MOSCH Giessener Münzhandlung GmbH Maximiliansplatz 20 · D-80333 München Tel. +49 (0)89 24226430 · Fax +49 (0)89 2285513 E-Mail: info@gmcoinart.de · www.gmcoinart.de

Profile for Gorny & Mosch Giessener Münzhandlung GmbH

Gorny & Mosch Auktionskatalog 279 Kunst der Antike, Afrika, Asiatika, Präkolumbische Kunst  

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded