Page 1

rivista trimestrale, Anno V - Numero 1

marzo 2014

ArcheomaticA Tecnologie per i Beni Culturali

R EALTÀ A UMENTATA E P ARCHI A RCHEOLOGICI

VALORIZZAZIONE DIGITALE DEI MUSEI RILIEVO E VISUALIZZAZIONE 3D CON OPEN SOURCE SPETTROMETRI MINIATURIZZATI PER IDENTIFICAZIONE DI PIGMENTI INTERVISTA AL PRESIDENTE DEL DISTRETTO AD ALTA TECNOLOGIA DEI BENI CULTURALI


EDITORIALE

LA

CULTURA AL TEMPO DEL FYBORG

Bio-�ipermedia ovvero l’ambiente peculiare cui tutti noi ogni giorno diamo luogo interagendo nello spazio-�tempo, attraverso i corpi, con macchine, reti, algoritmi, dati, territori reali e sintetici (Giorgio Griziotti). Secondo modalità di crescente intensità e pervasività, con le interfacce, estensioni meccaniche ed elettroniche, che tendono a integrarsi sempre piÚ intimamente nei corpi, HVWHQGHQGRHSRWHQ]LDQGROHFDSDFLWjXPDQHÀQHQGRSHUPRGLÀFDUHODVWHVVDFRVFLHQ]D E’ recente la notizia che Google, dopo la commercializzazione degli occhiali, ha già depositato diversi brevetti di lenti a contatto hi-�tech, con fotocamera, controllabili attraverso i movimenti dell’occhio e con possibilità di collegamento wireless ad altri dispositivi. Coniando il neologismo Giorgio Griziotti ne ha certamente individuato, tra l'altro, le componenti strutturanti fondamentali: la ELRSROLWLFDHO¡LSHUPHGLDOLWj1HOFRQWHPSRKDLQWURGRWWRQHOGLEDWWLWR²XQLQVHUWRUHFHQWHQHOODULYLVWD$OIDEHWDXQDHIÀFDFH griglia concettuale con cui tentare l’esplorazione di queste nuove dimensioni. Contraddizioni e pericoli di sfruttamento e di VRWWRPLVVLRQHSLVRÀVWLFDWLreal-�time6LFXUDPHQWHXQDURWWXUDGHÀQLWLYDGLRJQLGHOLPLWD]LRQHVSD]LDOHHWHPSRUDOHWUDLOWHPSR GHOODYLWDHTXHOORGHOODYRUR$QFKHSHUzRSSRUWXQLWjLQHGLWHGLSURGX]LRQHGHOFRPXQHHFHUWDPHQWHOXRJRGLFRQà LWWRFRQFKL vuole imporre nuove enclosures3URGRWWRGLWHFQRORJLHHGLLQGXVWULD%LRLSHUPHGLDVWDULGHÀQHQGRYHORFHPHQWHLOPRQGROH dinamiche produttive, le relazioni personali, la conoscenza. Dischiusa dall’invenzione dell’iPhone nel 2007, che ha reso pienamente fruibile il mondo delle reti con un dispositivo mobile, tascabile e dotato di una interfaccia utilizzabile con immediatezza, accompagnata dallo sviluppo dell’internet mobile e dalla diffusione e sviluppo di nuovi dispositivi, always connected everywhere, a elevato grado di integrazione, ibridazione e accessibilità, Bio-�ipermedia si rivela come una nuova, potente fase della storia dell’automazione, a oltre due secoli dalla FRPSDUVDGLTXHVWDQHLSULPLSURFHVVLGLSURGX]LRQHLQGXVWULDOHFDSLWDOLVWLFD5LGHÀQLVFHLQIDWWLVHJQDQGRXQDGLVFRQWLQXLWj ontologica rilevante, a pochissimi decenni dai suoi primi passi, la stessa automazione digitale, a sua volta scaturita da quella termo-�meccanica delle catene di montaggio, e lo fa innanzitutto superando le sue recenti architetture imperniate sull’internet ÀVVRHVXO3&8QVDOWRDQDORJRDTXHOORUHDOL]]DWRGD0DUFRQLQHOODWUDVPLVVLRQLVHQ]DÀORGHOOHLQIRUPD]LRQL6LPXOWDQHLWj ubiquità, universalità, tre parole chiave del weareable computing. Anche in questo caso lo scambio d’informazione viene infatti HPDQFLSDWRGDOOXRJRHWHPSRULVWUHWWRHÀVVRTXLQGLGLSLIRUWHFRQWUROORHGLSLREEOLJDWDHVFRQWDWDVRWWRPLVVLRQHDOSRWHUH FKHFDUDWWHUL]]DO¡RUL]]RQWH3&LQWHUQHWÀVVR Rispetto alla funzione strutturante e ordinatrice di tipo gerarchico, specializzata per i processi sequenziali di cui il PC, gestito da XQ¡8QLWjGLHODERUD]LRQHFHQWUDOH &38 qSRUWDWRUHULVSHWWRDOO¡DUFKLWHWWXUDWHFQRORJLFDclient-�server, la prospettiva in cui i GLVSRVLWLYLPRELOLVRQRLQVHULWLWHQWDGLDSSURVVLPDUHDQFKHVHLQPDQLHUDDQFRUDGHOWXWWRà HELOHLSURFHVVLGLULRUJDQL]]D]LRQH e di reinterpretazione dell’informazione propria del pensiero umano, gestendoli in modo reticolare, abbracciando e percorrendo contemporaneamente le informazioni in modo multisequenziale, secondo un sistema non lineare di percezione. &RQORVWDGLRGLDXWRPD]LRQHGLJLWDOHGHO3&HGHOO¡LQWHUQHWÀVVRODQXRYDIDVHFRQGLYLGHDVSHWWLFRPHYLUWXDOLWjVLPXOD]LRQH astrazione, riscontro ma se ne distanzia quanto a possibilità di processi autonomi di elaborazione, resi possibili dalle nuove tecnologie. Attraverso le infrastrutture reticolari possono emergere, proliferare e diramarsi in processi cooperativi, al di là di tecno-�entusiasmi o feticismi delle reti, energie autonome e non sottomesse d’informazione, di creazione, di cooperazione, di VFDPELRHGLFRVWUX]LRQHGLVLJQLÀFDWRQXRYLSURFHVVLVRFLDOLFXOWXUDOLHHFRQRPLFL Sono già tante le esperienze straordinarie di questi ultimi anni, per tutte DIYbio (do-�it-�yourself biology, o biologia fai-�da-�te), rete JOREDOHGLVFLHQ]DIDWWDGDFLWWDGLQLDOGLIXRULGDOFRQWUROORGHOOHLVWLWX]LRQLWUDGL]LRQDOLGHOODULFHUFDVFLHQWLÀFDHSRLOHPROWHSOLFL nuove forme della cooperazione della peer-�production (Yochai Benchler). 1RQqVRODPHQWHTXHVWLRQHGLUDFFROWDHODERUD]LRQHVLPXOWDQHDQHOOHUHWLWUDPROWHSOLFLXQLWjHGLGLVWULEX]LRQHHFRQGLYLVLRQH in tempo reale di tutte le informazioni secondo i dettami di una qualsiasi scuola net-�centrica, militare o commerciale che sia. Le connessioni sensoriali umane esplicano nei nuovi scenari relazioni in modo estremamente piÚ evoluto e potente di quanto potrebbe allo stato attuale qualsiasi capacità computazionale della machina. 6RQRJOLVWHVVLXWLOL]]DWRULGHLQXRYLGLVSRVLWLYLDFRVWLWXLUVLLQIDWWLDOO¡LQWHUQRGHOOHUHWLTXDOLFROOHJDPHQWLDIÀDQFDQGRÀVLFDPHQWH alle connessioni elettroniche quelle dei propri tessuti biologici specializzati nel ricevere, trasmettere ed elaborare gli stimoli interni ed esterni del corpo. Ciò permette inaudite e potenti sinapsi tecno-�sensoriali, conformando in maniera diversa il nostro cervello, innescando relazioni nella nostra mente sempre piÚ lontane dalla geometria euclidea, e quindi possibilità accresciute di azioni creative. Pur rimanendo per la scienza e l'abilità delle forze produttive la sottimissione alle legge del valore si dilata lo spazio tempo e insieme la possibilità percettiva, deterritorializzata e ubiqua, enormemente, e si arricchisce al pari del territorio con cui LQWHUDJLVFHGLLQIRUPD]LRQLGLRJQLJHQHUHGLYLHQHFROOHWWLYDHWXWWDYLDVLFRQFHQWUDDWWUDYHUVRLGLVSRVLWLYL,QGHÀQLWLYDIDVuFKHLO PRQGRVLSUHVHQWLDQRLFRVuFRPHHVVRqUHDOPHQWH(QWUDGHÀQLWLYDPHQWHTXLQGLLQFULVLODFRHUFL]LRQHDOO¡LQWHUSUHWD]LRQHXQLYRFD della realtà. 6HOHFRQVHJXHQ]HVRQRLPPHGLDWDPHQWHDSSUH]]DELOLLQXQDPELWRFRPHTXHOORGHOODUDSSUHVHQWD]LRQHJHRJUDÀFDGRYHGD VHPSUHULVDOWDQRHYLGHQWLLUDSSRUWLGHOVDSHUHJHRJUDÀFRFRQO¡HVHUFL]LRGHOSRWHUHSROLWLFR &ODXGH5DIIHVWLQ DOWUHWWDQWR dobbiamo pensare accadrà nel settore del patrimonio culturale con la proliferazione di punti di osservazione, di linguaggi, di temi, di sperimentazioni, di pratiche creative altrimenti non possibili, forse nuove forme di arte, e ancora di governance partecipata del patrimonio culturale che saranno resi possibili dalla cooperazione cognitiva attraverso i dispositivi, la loro integrazione nei corpi, le potenzialità accentuate che essi offrono alla capacità interpretativa.

MICHELE FASOLO @ARCHEOMATICA.IT

MICHELE.FASOLO


IN QUESTO NUMERO DOCUMENTAZIONE 6 La valorizzazione digitale del Museo Geologico Giovanni Capellini di Bologna DI

DANTE ABATE, FEDERICO FANTI

10 Rilievo e Visualizzazione 3D di dati diagnostici con strumenti Open Source Il caso della Tomba della Scimmia a Chiusi DI CRISTINA GIANCRISTOFARO, LUCIANO MARRAS, VINCENZO PALLESCHI

RIVELAZIONI

In copertina un'immagine in realtà aumen-� tantata del Parco Archeologico dell'Alto $GULDWLFR SURJHWWR ÀQDQ]LDWR GDO 3URJUDP-� ma per la Cooperazione Transfrontaliera Italo-�Slovena 2007-�2013.

16)256)LEHU2SWLFV5Hà HFWDQFH Spectroscopy con gli spettrometri PLQLDWXUL]]DWLSHUO¡LGHQWLÀFD]LRQHGHL pigmenti DI ANTONINO COSENTINO

MUSEI E FRUIZIONE 24 PARSJAD, il Parco Archeologico dell’Alto Adriatico: un luogo diffuso, unito dalla tecnologia DI

SEGUICI

EMILIA BUNIOTTO, CLAUDIA ALECCE

SU TWITTER:

TWITTER.COM/ARCHEOMATICA

SEGUICI SU FACEBOOK FACEBOOK.COM/ARCHEOMATICA

ArcheomaticA

Tecnologie per i Beni Culturali Anno V, N° 1 - marzo 2014

Archeomatica, trimestrale pubblicata dal 2009, è la prima rivi-� sta italiana interamente dedicata alla divulgazione, promozio-� ne e interscambio di conoscenze sulle tecnologie per la tutela, la conservazione, la valorizzazione e la fruizione del patrimo-� nio culturale italiano ed internazionale. Pubblica argomenti su tecnologie per il rilievo e la documentazione, per l'analisi e la diagnosi, per l'intervento di restauro o per la manutenzione e, in ultimo, per la fruizione legata all'indotto dei musei e dei parchi archeologici, senza tralasciare le modalità di fruizione avanzata del web con il suo social networking e le periferiche "smart". Collabora con tutti i riferimenti del settore sia italia-� ni che stranieri, tra i quali professionisti, istituzioni, accade-� mia, enti di ricerca e pubbliche amministrazioni.

DIRETTORE RENZO CARLUCCI DIRETTORE@ARCHEOMATICA.IT DIRETTORE RESPONSABILE MICHELE FASOLO MICHELE.FASOLO@ARCHEOMATICA.IT COMITATO SCIENTIFICO MAURIZIO FORTE, BERNARD FRISCHER SANDRO MASSA, MAURA MEDRI MARIO MICHELI, STEFANO MONTI FRANCESCO PROSPERETTI MARCO RAMAZZOTTI, ANTONINO SAGGIO FRANCESCA SALVEMINI

REDAZIONE

REDAZIONE@ARCHEOMATICA.IT

GIOVANNA CASTELLI GIOVANNA.CASTELLI@ARCHEOMATICA.IT ELENA LATINI ELENA.LATINI@ARCHEOMATICA.IT SANDRA LEONARDI SANDRA.LEONARDI@ARCHEOMATICA.IT DANIELE PIPITONE DANIELE.PIPITONE@ARCHEOMATICA.IT DOMENICO SANTARSIERO DOMENICO.SANTARSIERO@ARCHEOMATICA.IT LUCA PAPI LUCA.PAPI@ARCHEOMATICA.IT


SCHEDE TECNICHE

RUBRICHE

32 Touchwindow soluzioni e sistemi immersivi per i Beni Culturali. Sistemi e tecnologie per creare spazi dinamici, per coinvolgere, approfondire ed emozionare DI TOUCHWINDOW 33 Unocad, tecnologie per l'arte in sicurezza DI

UNOCAD

29 AZIENDE E

PRODOTTI Soluzioni allo Stato dell'Arte

40 AGORÀ Notizie dal mondo delle Tecnologie dei Beni Culturali

44 FORUM

GUEST PAPER

47 RECENSIONE

34 A systematic approach to Bronze corrosion products and the methods of treatment, applied on three bronze anklets from Dhamar Museum, Yemen BY MOHAMED M. MEGAHED

0HVRSRWDPLD$QWLFD Archeologia del pensiero creatore di miti nel paese di Sumer e di Accad

48 OPEN SOURCE

intervista 42 Intervista al prof. Angelo Chianese, Presidente del Distretto ad Alta Tecnologia dei Beni Culturali A CURA DI

LUCA PAPI

MARKETING E DISTRIBUZIONE ALFONSO QUAGLIONE A.QUAGLIONE@ARCHEOMATICA.IT

PROGETTO GRAFICO E IMPAGINAZIONE DANIELE CARLUCCI DANIELE@ARCHEOMATICA.IT

DIFFUSIONE E AMMINISTRAZIONE TATIANA IASILLO DIFFUSIONE@ARCHEOMATICA.IT

EDITORE MEDIAGEO SOC. COOP. Archeomatica è una testata registrata al Tribunale di Roma con il numero 395/2009 del 19 novembre 2009 ISSN 2037-‐2485

MEDIAGEO SOC. COOP. VIA PALESTRO, 95 00185 ROMA TEL. 06.62.27.96.12 FAX. 06.62.20.95.10 WWW.ARCHEOMATICA.IT

STAMPA SPADAMEDIA S.R.L. VIALE DEL LAVORO 31 -‐ 0043 CIAMPINO (ROMA)

50 EVENTI

INSERZIONISTI 3DFLOW ALTERNATIVA ARTE CODEVINTEC ECOX ESSETECH GEOGRÀ MADATEC MENCI NOREAL SMART3K TECHNOLOGYFORALL TOUCHWINDOW UNOCAD

46 49 30 50 39 52 28 23 45 21 2 31 51

CONDIZIONI DI ABBONAMENTO La quota annuale di abbonamento alla rivista è di € 45,00. Il prezzo di ciascun fascicolo compreso nell’abbonamento è di € 12,00. Il prezzo di ciascun fascicolo arretrato è di € 15,00. I prezzi indicati si intendono Iva inclusa. Per abbonarsi: www.archeomatica.it *OLDUWLFROLÀUPDWLLPSHJQDQRVROROD responsabilità dell’autore. È vietata la riproduzione anche parziale del contenuto di questo numero della Rivista in qualsiasi forma e con qualsiasi procedimento elettronico o meccanico, ivi inclusi i sistemi di archiviazione e prelievo dati, senza il consenso scritto dell’editore.


DOCUMENTAZIONE

LA VALORIZZAZIONE DIGITALE DEL MUSEO GEOLOGICO GIOVANNI CAPELLINI DI BOLOGNA di Dante Abate, Federico Fanti

Le tecnologie digitali vengono sempre piÚ utilizzate per la condivisione, la promozione e la valorizzazione del patrimonio culturale, motivo per cui un numero crescente di musei se ne serve per aumentare la propria visibilità e la propria offerta culturale. Questo studio è parte di un progetto pilota ancora in corso condotto dal 3D GraphLab del Centro Ricerche ENEA di Bologna (Unità Tecnica SHUO¡,QIRUPDWLRQDQG&RPXQLFDWLRQ7HFKQRORJ\ LQFROODERUD]LRQHFRQLO0XVHR*HRORJLFR*LRYDQQL&DSHOOLQLDOÀQHGLVYLOXSSDUHGHL contenuti multimediali online sfruttando gli standard WebGL e JavaScript.

9,68$/,==$=,21('68:(%%52:6(5 Lo sviluppo di tecnologie di visualizzazione Web-�based e di strumenti per la condivisione di dati tridimensionali on-�line, sebbene sia da considerare tuttora un processo in continua evoluzione, ha compiuto decisi passi in avanti nell’ultima decade. &Lz PDOJUDGR  OD SUHVHQ]D GL PRGHOOL ' VFLHQWLÀFL VXOOD UHWHQRQqPROWRGLIIXVDDFDXVDSULQFLSDOPHQWHGHOODSRV-� sibile compromissione dei diritti d’autore (IPR – Intellectual Property Rights), legati al download libero dei modelli, ed DOOHGLIÀFROWjFKHSRVVRQRGHULYDUHGDOO¡LQVWDOOD]LRQHHGDO-� OD FRQÀJXUD]LRQH GL VRIWZDUH WHU]L GD SDUWH GL XWHQWL QRQ esperti. Si deve a Behr [1] un’estensiva ed esauriente rassegna delle WHFQRORJLHGLYLVXDOL]]D]LRQHGLPRGHOOL'VX:HE,GLYHU-� si approcci sono stati suddivisi dall’autore principalmente in due categorie: plug-�in e plug-�in free. Per questo studio qVWDWDDGRWWDWDODVHFRQGDRS]LRQHFKHSUHYHGHO¡XWLOL]]R GHOOHOLEUHULHJUDÀFKH:HE*/HVFOXGHQGRTXLQGLODQHFHVVL-� tà di installare plug-�in aggiuntivi. :HE*/ :HE%DVHG *UDSKLF /LEUDU\  q XQ$3, ' Applica-� tion Programming Interface) di cui oggi sono dotati i piÚ FRPXQL EURZVHU 0R]LOOD )LUHIR[ *RRJOH &KURPH 2SHUD Safari, IE) che permette di creare e visualizzare animazioni 'VHQ]DO¡XWLOL]]RGLSOXJLQHGLDSSOLFD]LRQLHVWHUQHFRPH DGHVHPSLRà DVKPDFKHVLEDVDXQLFDPHQWHVXOOLQJXDJJLR -DYD6FULSW >@ 4XHVWH OLEUHULH JUDÀFKH VRQR VWDWH LPSOH-� PHQWDWHSHUODYRUDUHGLUHWWDPHQWHFRQOHVFKHGHJUDÀFKH XWLOL]]DQGROHULVRUVHGHOOD*38 Graphics Processing Units). /¡$3,qEDVDWDVX23(1*/(6FKHSHUPHWWHGLHVHJXLUH OHIXQ]LRQLGLUHQGHULQJLQXQFRQWHVWR+70/DSUHVFLQGHUH dal dispositivo su cui si stanno visualizzando i dati (desktop pc, smartphone, tablets, smart TV). 2OWUHDFLzODGLVSRQLELOLWjGLQXPHURVLVWDQGDUGHGLOFUH-� VFHQWHVYLOXSSRGLOLEUHULHJUDÀFKH &'/2SHQ6FHQH*UDSK ;'20HWF $3, :HE*/2'HWF SOXJLQ 26*:(%-D-�

YD'HWF JDPHHQJLQHV 8QLW\''9LDHWF OLQJXDJJLH IRUPDWL ;'3')'HWF FRPLQFLDDIDYRULUHTXHVWRSUR-â€? FHVVRGLFRQGLYLVLRQHGLGDWLWULGLPHQVLRQDOL>@ 8QDGHOOHSULPHDSSOLFD]LRQLFRVLGGHWWHSOXJLQIUHHGLJUD-â€? Ă€FDWULGLPHQVLRQDOHRQOLQHqVWDWDUDSSUHVHQWDWDGD*RRJOH 2' XQ$3, JUDĂ€FD VYLOXSSDWD SHU FUHDUH DSSOLFD]LRQL ' LQWHUDWWLYHDOO¡LQWHUQRGLXQFRPXQH:HEEURZVHU,QXQSUL-â€? mo momento concepito come un plug-â€?in, successivamente q VWDWR FRPPXWDWR LQ XQD OLEUHULD -DYD6FULSW EDVDWD VXOOD WHFQRORJLD:HE*/>@ 8Q¡DOWUDVROX]LRQHqUDSSUHVHQWDWDGD;'20XQ¡LQWHUIDF-â€? FLDJUDĂ€FDEDVDWDVX-DYD6FULSWFKHSHUPHWWHGLLQFRUSRUDUH Ă€OH LQ IRUPDWR ;' DOO¡LQWHUQR GL SDJLQH +70/ VHPSOLFH-â€? PHQWH PRGLĂ€FDQGR JOL HOHPHQWL GHO '20 Domain Object Model ;'20qXQDVLQWDVVLGLSURJUDPPD]LRQHEDVDWDVX :HE*/FKHQRQQHFHVVLWDO¡LQVWDOOD]LRQHGLDOFXQSOXJLQ>@ 3UHVVRLO&15,7$%&qLQFRUVRXQSURJHWWRGLULFRQYHUVLRQH del modello della Villa di Livia di prima porta (Roma), in origine concepita come un’istallazione interattiva presso il museo delle terme di Diocleziano a Roma. L’attivitĂ di por-â€? ting prevede la pubblicazione dell’intera scena tridimensio-â€? QDOHVXO:HEXWLOL]]DQGROHVSHFLĂ€FKH;'20>@ A tal proposito sono sempre piĂš diffusi gli esempi di istitu-â€? zioni pubbliche e private attive nel campo dei beni culturali FKHFUHDQRPXVHLYLUWXDOLVIUXWWDQGROHWHFQRORJLH:HEFRQ OD Ă€QDOLWj GL UDJJLXQJHUH O¡DXGLHQFH SL DPSLD SRVVLELOH cercando al tempo stesso di evitare l’installazione di sof-â€? WZDUHWHU]LRVSHFLĂ€FKHVROX]LRQLFRPPHUFLDOL8QHVHPSLR LQWHUHVVDQWHqUDSSUHVHQWDWRGDO'($ 'LJLWDO(SLJUDSK\DQG $UFKDHRORJ\  9LUWXDO 0XVHXP RI :RUOG +HULWDJH FKH RIIUH l’opportunitĂ  di visualizzare una ricca collezione di inscri-â€? ]LRQL'RPDQXIDWWLDUFKHRORJLFLDFFHGHQGRDGXQGDWDEDVH RQOLQHDWWUDYHUVRVWDQGDUG:HEEURZVHULPSOHPHQWDWL FRQ OHOLEUHULH:HE*/>@ $QFKH FRQVXOWDQGR LO VLWR :HE GHO SURJHWWR '&2)250 q SRVVLELOHYLVXDOL]]DUHPRGHOOL'UHDOL]]DWLXWLOL]]DQGRWHF-â€?

6

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

nologie range-�based e resi disponibili online sfruttando la WHFQRORJLD;'20>@ Lo Smithsonian Institution, a supporto del progetto di di-� gitalizzazione delle sue collezioni, ha recentemente pub-� EOLFDWR RQOLQH LO VHUYL]LR 6PLWKVRQLDQ ; ' XQ ' YLHZHU browser-�based sviluppato in collaborazione con Autodesk che permette di visualizzare ed analizzare modelli tridi-� PHQVLRQDOLVX:HE>@

7 02'(//$=,21(5$1*(%$6('(9,68$/,==$=,21(:(%*/ ,QDFFRUGRFRQLOFRRUGLQDPHQWRVFLHQWLÀFRGHOPXVHRHFRQ OHÀQDOLWjGHOSURJHWWRVRQRVWDWLGLJLWDOL]]DWLDOFXQLRJJHWWL scelti in base al materiale, alla tipologia ed alle dimensioni. I sei oggetti selezionati dai ricercatori sono: „)UDPPHQWRIRVVLOHGL0RVRVDXUR GLQRVDXUR

„Testa

di Tomistoma Calaritanus (coccodrillo)

„0XUH[ PROOXVFR

„)UDPPHQWRGL&\FDGHRLGHD SDOPDIRVVLOH

„Plastico

di zona costale del diciannovesimo secolo.

„0RGHOORLQVFDODGLLJXDQRGRQWH

Fig. 1 -� Scansione a luce strutturata di plastico di area costale del XIXo secolo.

,/086(2*(2/2*,&2*&$3(//,1,',%2/2*1$(',/352-� *(772',9,68$/,==$=,21( ,O0**&qLOSLJUDQGHHULFFRPXVHRJHRORJLFRHSDOHRQ-� tologico del diciannovesimo secolo in Europa con oltre un PLOLRQHGLFDPSLRQLFRQVHUYDWLDOVXRLQWHUQR>@8QDGHOOH qualità intrinseche piÚ importanti, che lo rende unico nel VXRJHQHUHULVLHGHQHOO¡DOOHVWLPHQWR,OVXRGHVLJQqLQIDWWL ORVWHVVRVWXGLDWRHUHDOL]]DWRGD&DSHOOLQLQHODQQR in cui il museo venne completato, riunendo collezioni, do-� nazioni e nuove acquisizioni provenienti da tutto il mondo. La sua missionSULQFLSDOHqTXHOODGLSUHVHUYDUHHYDORUL]]DUH le ricche collezioni, promuovendo la comunicazione e l’edu-� cazione della storia della scienza della terra e della vita. $O ÀQH GL VDOYDJXDUGDUH OD VXD LGHQWLWj H SUHVHUYDUH LO PXVHR VWHVVR OD GLUH]LRQH VFLHQWLÀFD KD GHFLVR GL RIIULUH e promuovere la fruizione delle collezioni musealizzate at-� traverso tecniche non invasive, sfruttando le potenzialità RIIHUWHGDOOH PRGHUQH WHFQRORJLH GLJLWDOL FRQOD ÀQDOLWj GL arricchire l’esperienza degli utenti prima, durante e dopo la visita del museo. 3HUYDORUL]]DUHOHFROOH]LRQLFRQVHUYDWHDO0**&VRQRVWDWH utilizzate e messe a punto principalmente tre tecniche di visualizzazione:

3HU OD PRGHOOD]LRQH q VWDWR XWLOL]]DWR XQR VFDQQHU D OXFH VWUXWWXUDWD%UHXFNPDQQ6PDUW6FDQ'+(0S[ )LJ DF-� TXLVWDWRGDOO¡(1($'*UDSK/DEDOO¡LQWHUQRGHOSURJHWWRGL ricerca It@cha (Tecnologie Italiane per Applicazioni Avan-� zate nei Beni Culturali). Sebbene modelli costituiti da un elevato numero di poligoni non siano utilizzabili per la vi-� VXDOL]]D]LRQH :HE EURZVHU SOXJLQ IUHH D FDXVD GHOOH ORUR dimensioni, la tecnica range based adottata ha permesso di ottenere modelli ad alta risoluzione utilizzabili dai ri-� FHUFDWRULROWUHFKHSHUVFRSLGLYXOJDWLYLDQFKHSHUÀQDOL-� WjGLVWXGLRSXUDPHQWHVFLHQWLÀFKHQRQFKpSHUUHDOL]]DUH UHSOLFKH ÀVLFKH GHOOH RSHUH PXVHDOL]]DWH FKH VHFRQGR OH normative vigenti, non possono essere riprodotte attraverso tecniche a contatto. Lo scanner impiegato ha assicurato: „una

rapidissima acquisizione dei dati  VLDJHRPHWULFLFKH5*% 

„GHÀQL]LRQHHGDFFXUDWH]]DPHWULFD  þPSHUVLQJRODrange map).

Dopo le note fasi di post processing, eseguite con i software 2SWRFDWH0HVKODE DOOLQHDPHQWRrange maps, merge, sur-� face reconstruction HWF  )LJ  L VHL PRGHOOL VRQR VWDWL ottimizzati per la visualizzazione on-�line riducendo il nume-� ro di poligoni da diversi milioni a circa 100 mila facce, ed esportati in formato PLY. E’ stato infatti testato che l’appli-� FDWLYR:HE*/VYLOXSSDWRSHUODIUXL]LRQHYLDEURZVHUQRQq in grado di processare piÚ di questo quantitativo di poligoni. /DOLEUHULDJUDÀFDXWLOL]]DWDqVWDWD7KUHHMVQDWDSULQFLSDO-� PHQWHSHUODYRUDUHFRQOHSRWHQWL$3,:HE*/HGLVSRQLELOH JUDWXLWDPHQWH DWWUDYHUVR LO VHUYL]LR :HE GL KRVWLQJ SHU OR sviluppo di progetti GitHub [12]. Essa permette di esplorare PRGHOOL ' VIUXWWDQGR OD *38 GHL 3& HG LO OLQJXDJJLR -D-� YD6FULSW&LzRYYLDPHQWHSUHVXSSRQHFKHODVFKHGDJUDÀFD XWLOL]]DWD VLD DJJLRUQDWD 8QD GHOOH FDUDWWHULVWLFKH FKH OD UHQGHSDUWLFRODUPHQWHDFFHVVLELOHqLOEDVVROLYHOORGLFRP-�

„PRGHOOL'GLJLWDOL]]DWLWUDPLWH

scanner a luce strutturata, fru-� LELOL GDJOL XWHQWL VXO :HE VHQ]D la necessità di installare nuovi VRIWZDUHRFRQÀJXUDUHLOSURSULR VLVWHPD „dati multimediali, metadati e PRGHOOL ' FUHDWL FRQ WHFQLFKH GL FRPSXWHU JUDÀFD DFFHVVLELOL direttamente durante la visita museale utilizzando smartpho-� QHVRWDEOHWV „documenti digitali ed interattivi LQIRUPDWR'3')GDFRQVXOWDUH per approfondire lo studio. Fig. 2 -� Modello tridimensionale di Murex visualizzato in Meshlab.


plessità della sintassi. ri, data anche la mole di oggetti 7KUHHMV PHWWH D GLVSRVL]LRQH DOFXQH IRUPH JHRPHWULFKH conservati, sono spesso limitate SUHGHÀQLWHFRVuFRPHODSRVVLELOLWjGLLPSRUWDUHRJJHWWLGDL alle etichette originali del di-� SLSRSRODULSURJUDPPLGLPRGHOOD]LRQH',PRGHOOLGLJLWD-� ciannovesimo secolo che recano OL]]DWLSUHVVRLO0XVHR&DSHOOLQLVRQRVWDWLTXLQGLFRQYHUWLWL nomi in latino secondo la nomen-� in formato Js in modo tale da poter essere interpretati dalle FODWXUDVFLHQWLÀFD OLEUHULHJUDÀFKHDSSHQDPHQ]LRQDWH3HUIDUHFLzVLqXWLOL]-� Lo scopo di questa seconda ap-� ]DWRXQSOXJLQ OLQJXDJJLRS\WRQ SHULOVRIWZDUHGLJUDÀFD SOLFD]LRQH q TXHOOR GL IRUQLUH DL Blender che permette di esportare sia la geometria che i YLVLWDWRULFKHÀVLFDPHQWHVLWUR-� valori RGB associati a ciascun vertice del modello. vano all’interno del museo, la Fig. 4 -� QR Code. 3HU OH OLEUHULH :HE*/ FRVL FRPH SHU FLz FKH ULJXDUGD OD possibilità di accedere a dei me-� pipelineJUDÀFDGLUHQGHULQJLOWULDQJRORFRVWLWXLVFHO¡HOH-� dia (testi, video, immagini) collegati all’oggetto che stanno PHQWRGLEDVHSHUGLVHJQDUHRJJHWWL'H',QXQDPELHQ-� osservando tramite metadati, e, dove necessario, l’opzio-� WH :HE*/ OH IXQ]LRQL GL GLVHJQR H GL YLVXDOL]]D]LRQH GHJOL ne di visualizzare su smartphone o tablet la ricostruzione oggetti consistono nell’utilizzo di JavaScript per generare dell’aspetto originale, senza lasciare questa al caso o dover OHLQIRUPD]LRQLVSHFLÀFDUHGRYHHFRPHTXHVWLWULDQJROLVD-� compiere voli pindarici di fantasia. ranno creati e come essi appariranno. Questi dati sono poi É stato deciso di utilizzare una tecnica di visualizzazione WUDVIHULWLDOOD*38FKHOLHODERUDHFUHDODVFHQD&LzSUHVXS-� che funziona con i browser installati di default su telefoni pone che sulla macchina su cui vengono visualizzati i dati e tablet e che, allo stesso tempo, permette l’interazione VLD LQVWDOODWD XQD VFKHGD JUDÀFD DJJLRUQDWD , WHVW LQL]LDOL attraverso input touch-�screen7DOHGHFLVLRQHqVWDWDFRQVL-� sono stati eseguiti su workstation equipaggiate con schede gliata dal fatto che non tutti i browser per apparecchi mo-� JUDÀFKHGLDOWRSURÀOR 1YLGLD);4XDGUR 7XWWDYLDVL bileVXSSRUWDQROHOLEUHULH:HE*/SHUODYLVXDOL]]D]LRQHGL sono osservate risposte modelli tridimensio-� comparabili nell’inte-� QDOL q VWDWR ULVFRQ-� UD]LRQH H QHOOD à XLGLWj trato un esito positivo della navigazione an-� solo con il browser che utilizzando PC con PRELOH 2SHUD  HG LO VFKHGHJUDÀFKHGLOLYHO-� download di applica-� lo standard. zioni terze può essere Il tempo di download avvertito come limi-� QRQqGDFRQVLGHUDUHXQ tante e scoraggiante SDUDPHWUR VLJQLÀFDWLYR per i visitatori duran-� in termini di visualiz-� te la visita. ]D]LRQH 8WLOL]]DQGR 3HU TXHVWR VFRSR q infatti una connessione stato utilizzato il ADSL tradizionale, poi-� plug-�in JavaScript FKp OD GLPHQVLRQH PH-� 5HHO KWWSMTXHU\ dia di ciascun oggetto vostrel.cz/reel). Fig. 3 -� Visualizzazione di Iguanodonte attraverso librerie Three.js. dopo la conversione in (VVRqFDSDFHGLFD-� IRUPDWR-VYDULDWUD0%H0%LPRGHOOLYHQJRQRYLVXD-� ricare una serie di immagini all’interno di una pagina html lizzati in un lasso temporale trascurabile. DGLIIHUHQ]DGHO4XLFN7LPH9LUWXDO5HDOLW\REMHFWFKHQH-� I diversi JavaScript utilizzati permettono di controllare gli FHVVLWDGHOSOD\HU4XLFN7LPH HVLPXODUHO¡LQWHUD]LRQHFRQ input forniti dall’utente cosi come la posizione della camera XQRJJHWWR'PRVWUDQGRO¡LPPDJLQHDSSURSULDWDLQDFFRU-� e le caratteristiche delle luci. do con il movimento d’input fornito dall’utente. Invece del-� Tutti questi elementi sono stati quindi integrati nel codice la geometria (triangoli) l’apparato mobile deve processare GLXQDSDJLQD+70/HFULSWDWLDOÀQHGLLPSHGLUQHODPRGL-� unicamente una serie di immagini renderizzate a priori, in ÀFDHODFRUUX]LRQH )LJ  formato JPEG e di ridotta dimensione. Grazie quindi alle potenzialità offerte dalle funzionalità /DVHTXHQ]DGLLPPDJLQLqVWDWDFUHDWDXWLOL]]DQGRXQRVFULSW GHOOH OLEUHULH 7KUHHMV H GL :HE*/ O¡XWHQWH ÀQDOH FROOH-� 3\WKRQSHULOVRIWZDUHGLopen-�source Blender (http://www. JDQGRVL DO VLWR :HE GHGLFDWR DOO¡DWWLYLWj SXz YLVXDOL]]DUH WKRURGHSDJHGQSLQWURGXFWLRQHQ  ,O YHUR PRGHOOR ' HGLQWHUDJLUHFRQLPRGHOOL'DFRORULRUDGLVSRQLELOLVHQ-� in questo caso creato con software tradizionali di compu-� ]D OD QHFHVVLWj GL LQVWDOODUH H FRQÀJXUDUH DOFXQ VRIWZDUH WHUJUDÀFDYLHQHFROORFDWRYLUWXDOPHQWHDOO¡LQWHUQRGLXQD VSHFLÀFRPDXWLOL]]DQGRXQLFDPHQWHLEURZVHUWUDGL]LRQDOL sfera i cui vertici rappresentano i punti dalla quale verrà KWWSZZZDIVHQHDLWSURMHFWJUDSKODEVOVVKWPO  FUHDWDO¡LPPDJLQHÀQDOH Le immagini ottenute sono quindi incorporate con il Reel '&20387(5*5$3+,&02'(/6$1'9,68$/,=$7,21216,7( -DYD6FULSW3OXJLQLQXQDSDJLQD+70/DFXLVLSXzDFFHGHUH Considerata la peculiarità degli oggetti conservati presso il in maniera tradizionale. 0**&qVWDWRGHFLVRGLVYLOXSSDUHXQ¡DOWUDWLSRORJLDGLDS-� Per velocizzare il processo di connessione all’applicazione plicazione per smartphone e tablet, con lo scopo di fornire 'HSHUHYLWDUHGLGRYHULQVHULUHXQLQGLUL]]R:HEDWWUD-� un valore aggiunto al visitatore, e non solamente realizzare verso la tastiera del dispositivo con il rischio di commettere un mero esercizio pedissequo di creazione e visualizzazione EDQDOL HUURUL GL GLJLWD]LRQH q VWDWR GHFLVR GL SRVL]LRQDUH di oggetti tridimensionali, specialmente quando l’originale XQFRGLFH45 'HQVR:DYHHVXFFHVVLYLVWDQGDUG  qÀVLFDPHQWHSUHVHQWHHIUXLELOHLQVLWX YLFLQRDJOLRJJHWWLGHÀQLWLVHQVLELOL )LJ  0ROWLRJJHWWLHVSRVWLQHOPXVHRVRQRUHVWLGLFUHDWXUHSUHL-� 8QFRGLFH45FRQVLVWHLQXQPRGXORQHURFRPSRVWRGDXQD storiche o fossili, le cui forme originali sono ovviamente JULJOLDDIRUPDTXDGUDQJRODUHVXGLXQRVIRQGRELDQFR>@ SHUGXWH2OWUHWXWWRLOPXVHRHVVHQGRHVVRVWHVVRXQRJJHWWR che può essere letto da un apposita applicazione gratuita GDFRQVHUYDUHQRQqHTXLSDJJLDWRFRQPROWLDSSDUDWLLQIRU-� LQVWDOODWD VX GLVSRVLWLYL PRELOL TXHVWD q O¡XQLFR GRZQORDG mativi e didattici nelle sale, e le informazioni per i visitato-� richiesto ai visitatori).

8

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

9

Fig. 5 -� 3D PDF di Tomistoma Calaritanus.

Le informazioni vengono lette dai pattern presenti sia nelle zone orizzontali che in quelle verticali del code e l’utente viene automaticamente reindirizzato alla pagina collegata. Grazie a questa applicazione, in assenza di una reale ri-� FRVWUX]LRQH ÀVLFD GHOO¡RJJHWWR R GL LPPDJLQL HVSOLFDWLYH presenti in loco, l’utente avrà la possibilità di visualizzare l’aspetto del campione in esame e comprenderne le forme originali. '3') $OÀQHGLIRUQLUHPDWHULDOHGLJLWDOHGLDSSURIRQGLPHQWRHG al tempo stesso di facile consultazione, sono stati creati LQÀQHSHUFLDVFXQPRGHOORWULGLPHQVLRQDOHDFTXLVLWRDWWUD-� YHUVRVFDQQHUDOXFHVWUXWWXUDWDGHOOHVFKHGHLQIRUPDWR' 3') GL FXL q SRVVLELOH HVHJXLUH LO GRZQORDG KWWSZZZ DIVHQHDLWSURMHFWJUDSKODEGSGIVKWPO  Ciascuna scheda presenta, oltre che una sezione di appro-� fondimento relativa all’oggetto, la possibilità di interagire con il modello tridimensionale, eseguendo una serie di ope-� UD]LRQLGLUHWWDPHQWHVXOÀOH3')FRPHDJJLXQJHUHFRPPHQ-� ti, eseguire misure e sezioni lungo i diversi assi, visualizzare il modello secondo diverse tecniche di rendering e di illumi-� nazione, acquisire screen-�shot )LJ  &21&/86,21, In questo articolo sono state descritte tre modalità di vi-� sualizzazione, studiate per arricchire l’esperienza degli XWHQWLPXVHDOLSUHVVRLO0XVHR*HRORJLFR*LRYDQQL&DSHO-� lini di Bologna. Esse consentono: „ GL VIUXWWDUH OH WHFQRORJLH -DYD6FULSW +70/ H 3') SHU

YLVXDOL]]DUHPRGHOOL'UHDOL]]DWLFRQGLYHUVHWHFQLFKH VHQ]D OD FUHD]LRQH GL DOFXQD VSHFLÀFD DSSOLFD]LRQH H con un’attenzione particolare alla salvaguardia dei di-� ULWWLG¡DXWRUH „ GLOLEHUDUHO¡XWHQWHÀQDOHGDOODQHFHVVLWjGLFRQIURQWDUVL FRQSURFHGXUHGLLQVWDOOD]LRQHRFRQÀJXUD]LRQHGHLSUR-� pri dispositivi, siano questi pc, smartphone o tablets E’ stato anche mostrato come utilizzare modelli tridimen-� VLRQDOLLQPDQLHUDHIÀFDFHVRORTXDQGRVWUHWWDPHQWHQHFHV-� VDULRHQRQFRPHHVHUFL]LRVXSHUà XR,QIDWWLJUD]LHDOODORUR peculiarità , i musei geologici e paleontologici ben si presta-� no a queste attività laddove l’aspetto degli oggetti conser-� YDWLqSHUORURVWHVVDQDWXUDFRPSURPHVVRSHUVHPSUH

ABSTRACT The Geological Museum G. Capellini (MGGC) is one of the most important Ita-� lian and European geological and paleontological institution. The mission of the Museum is represented by the conservation and the preservation of ancient paleontological specimens like vertebrates, mollusks, stones and much more. 7RGD\LVZHOONQRZQWKDWFXOWXUDOKHULWDJHVWXGLHVFDQEHQHÀWE\WKHQHZGLJL-� tal web technologies for haring, promoting and valorizing values of knowledge. This study is part of an ongoing project led by the 3D GraphLab of the ENEA Re-� search Centre in collaboration with the MGCC with the aim to develop an online digital content using WebGL and Java Script standards.

PAROLE

CHIAVE

VISUALIZZAZIONE 3D; JAVASCRIPT; WEBGL; 3DPDF; SMARTPHONES, TABLETS.

SPINNING IMAGES;

AUTORE DANTE ABATE, dante.abate@enea.it

CENTRO RICERCHE ENEA, UTICT UNITÀ TECNICA PER L’INFORMATION AND COMMUNICATION TECHNOLOGY, BOLOGNA, ITALIA FEDERICO FANTI federico.fanti@unibo.it

ALMA MATER STUDIORUM, UNIVERSITĂ€

DI

BOLOGNA, ITALIA

BIBLIOGRAFIA >@%HKU-(VFKOHU3-XQJ<=RHOOQHU0  ;'20²$'20EDVHG +70/;'LQWHJUDWLRQPRGHO:HE'3URFHHGLQJVRIWKHWK,QWHUQDWLRQDO &RQIHUHQFHRQ':HE7HFKQRORJ\ >@73DULVL:HE*/8SDQG5XQQLQJ2 5HLOO\0HGLD >@ 0DQIHUGLQL$0 5HPRQGLQR )   5HDOLW\%DVHG ' 0RGHOLQJ 6HJ-â&#x20AC;? PHQWDWLRQDQG:HE%DVHG9LVXDOL]DWLRQ(XUR0HG/1&6 >@*RRJOH'KWWSFRGHJRRJOHFRPSRG >@KWWSZZZ[GRPRUJ >@ /XFFL %DOGDVVDUUL * 'HPHWUHVFX ( 3HVFDULQ 6 (ULNVVRQ - *UDI +   %HKLQG /LYLD V 9LOOD$ &DVH 6WXG\ IRU WKH 'HYROXWLRQ RI /DUJH 6FDOH ,QWHUDFWLYHLQVLWHWRRQOLQH$SSOLFDWLRQLQ3URFHHGLQJVRIWKHWK,QWHU-â&#x20AC;? QDWLRQDO FRQIHUHQFH RQ +XPDQ&RPSXWHU ,QWHUDFWLRQ  -XO\  /DV 9HJDV >@ %DUPSRXWLV$ %R]LD ( :DJPDQ 5 6  $ QRYHO IUDPHZRUN IRU HIĂ&#x20AC;FLHQW'UHFRQVWUXFWLRQDQGDQDO\VLVRIDQFLHQWLQVFULSWLRQV-RXUQDORI0D-â&#x20AC;? FKLQH9LVLRQDQG$SSOLFDWLRQV9RO  6SULQJHU >@KWWSZZZGLJLWDOHSLJUDSK\RUJPXVHXPLQGH[KWPO >@'&2)2503URMHFWZZZGFRIRUPHX >@KWWSZZZGVLHGX >@ 9DL *%   *HRORJLFDO 0XVHXP *LRYDQQL &DSHOOLQL 6KRUW 3LFWXUH *XLGH0XVHR*HRORJLFR*LRYDQQL&DSHOOLQL*XLGD%UHYHSHU,PPDJLQL$OPD 0DWHU6WXGLRUXP%RORJQD >@KWWSVJLWKXEFRPPUGRREWKUHHMV >@/LX<<DQJ-/LX0  5HFRJQLWLRQRI45&RGHZLWKPRELOHSKRQHV 3URFHHGLQJVRIWKH&RQWURODQG'HFLVLRQ&RQIHUHQFH&&'&-XO\ <DQWDL


DOCUMENTAZIONE

RILIEVO E VISUALIZZAZIONE 3D DI DATI DIAGNOSTICI CON STRUMENTI

OPEN SOURCE IL

CASO DELLA

TOMBA

DELLA

SCIMMIA

A

CHIUSI

di Cristina Giancristofaro, Luciano Marras, Vincenzo Palleschi

Il rilievo digitale e la creazione

Fig. 1 -â&#x20AC;? Ricostruzione 3D dell'atrio principale della Tomba della Scimmia.

di modelli tridimensionali si stanno affermando come supporto fondamentale alla documentazione del patrimonio culturale. Ancora poco implementato è invece il valore aggiunto che tali ricostruzioni possono apportare alle indagini diagnostiche eseguite nell'ambito della conservazione dei beni culturali. L'integrazione tra 3D e Imaging diagnostico mira a proporre una nuova metodologia di visualizzazione delle LQGDJLQLVFLHQWLĂ&#x20AC;FKHFKHVHSURSRVWD all'interno di un percorso di visita, renda piĂš coinvolgente e intuitiva la fruizione al pubblico di contenuti e analisi spesso fondamentali per la comprensione delle opere d'arte.

D

urante le attivitĂ di rilievo svolte in campo archeologico, architettonico o piĂš in generale nel settore dei beni culturali, le condizioni di lavoro spesso impongono che il tempo dedicato alle fasi di acquisizione ed elaborazione dei dati sia breve e che venga ridotta al minimo lâ&#x20AC;&#x2122;interazione con lâ&#x20AC;&#x2122;opera dâ&#x20AC;&#x2122;arte. Per questo da diversi anni le tecnologie digitali si sono sostituite alle metodolo-â&#x20AC;? JLHGLULOLHYRWUDGL]LRQDOHRIIUHQGRODSRVVLELOLWjGLRWWHQHUHSURGRWWLĂ&#x20AC;QDOLSR-â&#x20AC;? tenziati nelle capacitĂ  di rappresentazione, descrizione metrica e accuratezza, molto utili anche a supporto delle attivitĂ  di ricostruzione e restauro. 7UDOHGLYHUVHVROX]LRQLGLVSRQLELOLSHULOULOLHYR'ORVYLOXSSRGLVLVWHPLDXWR-â&#x20AC;? matizzati di ricostruzione sta recentemente determinando un rapido e crescen-â&#x20AC;? te utilizzo delle metodologie basate sui principi della Computer Vision, quali le tecniche di Image-â&#x20AC;?Based Modeling. Il metodo image-â&#x20AC;?based impiega sensori passivi di acquisizione e algoritmi automatizzati di dense stereo matching per ULFRVWUXLUHXQDQXYRODGLSXQWLDGDOWDGHQVLWjGDOODFXLHODERUD]LRQHJUDĂ&#x20AC;FDq SRVVLELOHHVWUDUUHXQPRGHOOR'GHOO¡RJJHWWRLQGDJDWR

Il presente lavoro è stato realizzato durante lo stage formativo del Master in "Tecnologie Open Source per i Beni Culturali" (Master Open TĂŠchne), organizzato dallâ&#x20AC;&#x2122;Istituto di Formazione e Ricerca della Federazione Italiana Club e Centi UNESCO, ed è stato premiato con il Best Paper Open TĂŠchne 2013 come PLJOLRUWHVLGLĂ&#x20AC;QH0DVWHU

10

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

Tra i principali vantaggi di queste tecniche troviamo rapidi-â&#x20AC;? WjGLHVHFX]LRQHEDVVRFRVWRULSHWLELOLWjGHOOHPLVXUHĂ HV-â&#x20AC;? sibilitĂ , trasportabilitĂ  dei sensori, non invasivitĂ  e ampio spettro di soggetti investigabili, tutti parametri fondamen-â&#x20AC;? tali per lâ&#x20AC;&#x2122;applicazione nel campo dei beni culturali. ,PRGHOOLĂ&#x20AC;QDOLSUHVHQWDQRXQ¡DOWDTXDOLWjGLGHWWDJOLRHSRV-â&#x20AC;? sono essere scalati alle dimensioni reali. Ciò consente il loro impiego non solo a scopo di documentazione digitale, ma DQFKH SHU VWXGL VWUXWWXUDOL H GLPHQVLRQDOL GL DUHH GLIĂ&#x20AC;FLO-â&#x20AC;? mente accessibili per esigenze di varia natura (logistiche, museali, di precarietĂ  del sito documentato, ecc.). 6XWDOLSUHPHVVHqVWDWRGHFLVRGLLPSLHJDUHWDOHPHWRGR-â&#x20AC;? logia di rilievo allâ&#x20AC;&#x2122;interno di un progetto di studi nellâ&#x20AC;&#x2122;area archeologica della Necropoli etrusca di Poggio Renzo (Chiu-â&#x20AC;? si). Tale sito fu realizzato entro un complesso litologico di sabbie plioceniche altamente precario a cui viene attribuito il crollo di alcune tombe di cui ad oggi si sono perse com-â&#x20AC;? pletamente le tracce, e insieme il precario stato di conser-â&#x20AC;? vazione degli ipogei ancora esistenti. Tra di essi troviamo la Tomba della Scimmia, fra le piĂš note per la presenza di pitture murali ancora leggibili, ma interessata da proble-â&#x20AC;? matiche conservative che in passato ne hanno imposto la chiusura al pubblico. Attualmente, nonostante gli interventi di restauro eseguiti, lâ&#x20AC;&#x2122;accessibilitĂ  del sito resta limitata ed qDSSDUVRTXLQGLLPSRUWDQWHHVHJXLUHXQPRGHOORWULGLPHQ-â&#x20AC;? sionale della struttura, in grado di favorirne la documenta-â&#x20AC;? zione e la fruizione ad un pubblico piĂš ampio. Allâ&#x20AC;&#x2122;interno di una campagna diagnostica, svoltasi per lo studio delle SLWWXUH SUHVHQWL QHOOD WRPED q VWDWR DQFKH LQWUDSUHVR XQ tentativo dâ&#x20AC;&#x2122;integrazione tra imaging multispettrale e rilievo '2ELHWWLYLSULQFLSDOLGLWDOHLQWHJUD]LRQHVRQRVWDWLTXHOOL di associare i dati diagnostici alla componente spaziale dei substrati analizzati, rendere piĂš realistica la loro visualizza-â&#x20AC;? zione e insieme incrementare la valenza delle ricostruzioni virtuali nel campo della conservazione dei beni culturali. /$720%$'(//$6&,00,$ La Tomba della Scimmia si trova nella Necropoli di Poggio Ren-â&#x20AC;? ]R D SRFKL FKLORPHWUL GDOOD FLWWj GL &KLXVL )X VFRSHUWD QHO GDOO¡DUFKHRORJR Ă&#x20AC;RUHQWLQR$OHVVDQGUR )UDQoRLVHGqGD-â&#x20AC;? WDWDWUDLOHGLOD&/¡LSRJHRSUHVHQWDXQDSLDQWDD FURFLHUDHGqFRPSRVWRGDTXDWWURFDPHUHXQJUDQGHDWULRH WUHVWDQ]HODWHUDOLVLWXDWHDGXQDSURIRQGLWjGLFLUFDPHWUL rispetto alla quota dellâ&#x20AC;&#x2122;ingresso principale. /DWRPEDqFXUDWDQHOOHSDUWLWX-â&#x20AC;? re architettoniche e si contrad-â&#x20AC;? distingue per la serie di pitture che decorano le pareti dellâ&#x20AC;&#x2122;atrio e della stanza di fondo, rappre-â&#x20AC;? sentando scene di lotta, gare tra atleti, acrobati e danzatori che si esibiscono in onore della de-â&#x20AC;? funta. In uno dei fregi compare DQFKH OD Ă&#x20AC;JXUD GL XQD VFLPPLD da cui prende il nome lâ&#x20AC;&#x2122;ipogeo stesso. Tutte le pitture sono state eseguite con pigmenti di natura minerale e vegetale stesi su un sottile rivestimento argilloso ot-â&#x20AC;? tenuto per lisciatura della parete arenacea. 'RSRODVXDVFRSHUWDODWRPEDq ULPDVWDDSHUWDDOSXEEOLFRĂ&#x20AC;QRDO  TXDQGR OD 6RSULQWHQGHQ]D ai Beni Archeologici ne ha deciso la chiusura, per motivi di tutela e FRQVHUYD]LRQH 3DOOHFFKL  Fig. 3 â&#x20AC;&#x201C; Ricostruzione 3D della Tomba della Scim-â&#x20AC;? mia: vista prospettica di una sezione verticale del modello (a); particolari interni dellâ&#x20AC;&#x2122;atrio (c) e delle camere laterali (b).

11 Nel tempo, infatti, furono notate diminuzioni di coesione delle sabbie, microdistacchi, variazioni cromatiche e forti colonizzazioni batteriche delle pitture (Diaz-â&#x20AC;?Herraiz et al.,  Ă&#x20AC;QRDSLFFROLFUROOLGLSRU]LRQLGHOVRIĂ&#x20AC;WWR/DFDXVD principale di tale stato di conservazione fu individuata nelle variazioni microclimatiche registrate in presenza dei visita-â&#x20AC;? tori e ha indotto ad una serie di interventi mirati al moni-â&#x20AC;? toraggio termoigrometrico costante dellâ&#x20AC;&#x2122;ipogeo. Al termine GHJOL LQWHUYHQWL OD WRPED q VWDWD ULDSHUWD DO SXEEOLFR PD la sua accessibilitĂ resta ancora oggi limitata ad un nume-â&#x20AC;? ro ridotto di visitatori e per periodi di tempo tali da non PRGLĂ&#x20AC;FDUHLQPRGRSHUPDQHQWHOHFRQGL]LRQLDPELHQWDOL dellâ&#x20AC;&#x2122;ipogeo.

Fig. 2 -â&#x20AC;? Tomba della Scimmia: ingresso attuale.

,/5,/,(92'&2167580(17,23(16285&( /D ULFRVWUX]LRQH IRWRJUDPPHWULFD ' GHOOD 7RPED GHOOD 6FLPPLDqVWDWDUHDOL]]DWDXWLOL]]DQGRHVFOXVLYDPHQWHsof-â&#x20AC;? tware open source, capaci di offrire soluzioni paragonabili ai piĂš diffusi software proprietari e 3D scanning devices per il rilievo tridimensionale. Nel corso della campagna di misure allâ&#x20AC;&#x2122;interno della tomba VRQRVWDWHDFTXLVLWHLPPDJLQLDGDOWDULVROX]LRQHXWL-â&#x20AC;? OL]]DQGRXQDIRWRFDPHUDUHĂ H[GLJLWDOH&DQRQ(26'GD 0HJDSL[HOFRQRELHWWLYRPP


Fig. 4 -â&#x20AC;? Operazioni di post-â&#x20AC;?processing in MeshLab (v.1.3.3) sulle nuvole di punti ottenute mediante Python Photogrammetry ToolBox.

Per eseguire una corretta ricostruzione fotogrammetrica RJQLDUHDqVWDWDULSUHVDGDSLDQJROD]LRQLPDQWHQHQGROH opportune sovrapposizioni tra aree adiacenti. La modalitĂ GLDFTXLVL]LRQHqVWDWDIRUWHPHQWHLQĂ XHQ]DWDDQFKHGDOOH dimensioni dellâ&#x20AC;&#x2122;ipogeo, dalle caratteristiche del sito e delle condizioni di illuminazione, che sono state ottimizzate, con un opportuno sistema di lampade, per cercare di evitare zone dâ&#x20AC;&#x2122;ombra ed elevate disomogeneitĂ  cromatiche. I fotogrammi acquisiti sono stati elaborati con Python Pho-â&#x20AC;? togrammetry ToolBox (PPT), suite open source dotata di in-â&#x20AC;? WHUIDFFLDJUDĂ&#x20AC;FDFDSDFHGLGHWHUPLQDUHLSDUDPHWULGHOOD camera di ripresa e ricostruire una nuvola di punti a partire GDXQVHWGLLPPDJLQLQRQFDOLEUDWH 0RXORQ%H]]L  Il software si basa su script di Python per la gestione di Bundler&096H3096DOJRULWPLGLFDOFRORULODVFLDWLFRQ codice aperto che consentono di automatizzare lâ&#x20AC;&#x2122;intero pro-â&#x20AC;? FHVVRGLULFRVWUX]LRQH',QL]LDOPHQWHPHGLDQWHO¡DOJRULWPR 6,)7 Scale Invariant Feature Transform) vengono estratti i punti locali caratteristici di ogni immagine (feature de-â&#x20AC;? tection). In seguito, basandosi sul principio per cui oggetti vicini al punto di osservazione si spostano nello spazio piĂš velocemente rispetto agli elementi lontani, Bundler individua e traccia lo spostamento di corrispondenze di punti omologhi tra le immagini (matching feature), esegue la calibrazione dei pa-â&#x20AC;? rametri interni delle camere (bundle adjustment) e determina lâ&#x20AC;&#x2122;orientamento esterno delle posizioni di ripresa. Il software package 3096 SUHFHGXWR dallâ&#x20AC;&#x2122;algoritmo di clustering&096HVSDQGHO¡DQDOLVL delle corrispondenze nelle aree prossime ai punti individuati da Bundler (expand DSSOLFDXQĂ&#x20AC;OWURGL correzione per rimuovere eventuali corrisponden-â&#x20AC;? ze errate (Ă&#x20AC;OWHU) e ricostruisce una nuvola di punti ad alta densitĂ , capace di restituire in un sistema GLFRRUGLQDWHVSD]LDOL[\]ODWULGLPHQVLRQDOLWjH lâ&#x20AC;&#x2122;informazione colore dellâ&#x20AC;&#x2122;oggetto indagato. Per il processamento delle immagini acquisite nella Tom-â&#x20AC;? ED GHOOD 6FLPPLD q VWDWR SRVVLELOH HODERUDUH LQ XQ singolo processo ciascuna delle tre stanze laterali, mentre per lâ&#x20AC;&#x2122;atrio, a causa delle elevate dimensioni GHOODFDPHUDqVWDWRQHFHVVDULRGLYLGHUHHSURFHV-â&#x20AC;? sare le foto in 7 gruppi, distinti a seconda dellâ&#x20AC;&#x2122;an-â&#x20AC;? golazione di ripresa. Le nuvole di punti ottenute sono state elaborate mediante i software open source CloudCompare e MeshLab &LJQRQL HW DO   SHU RWWHQHUH XQD UHVWL-â&#x20AC;? tuzione virtuale quanto piĂš possibile prossima al reale. Le principali operazioni hanno previsto Cleaning, Alignment e Sampling delle nuvole iniziali, Poisson Reconstruction, Cleaning e Colour Transformation GHOOHVXSHUĂ&#x20AC;FLJHQHUDWH

,QĂ&#x20AC;QHLOĂ&#x20AC;OWURScale ha permesso di scalare il modello alle di-â&#x20AC;? mensioni reali dal rapporto tra distanze di riferimento note HOHFRUULVSRQGHQWLPLVXUHLQ0HVK/DE /D ULFRVWUX]LRQH UHDOL]]DWD )LJXUD   SXz HVVHUH LPSLHJD-â&#x20AC;? ta non solo a scopo di documentazione digitale, ma anche per eseguire studi sulla struttura dellâ&#x20AC;&#x2122;ipogeo e sui metodi costruttivi impiegati per realizzarlo. Analisi archeologiche e architettoniche piĂš approfondite possono essere esegui-â&#x20AC;? te attraverso piante, sezioni longitudinali e trasversali del modello, che consentono di osservare con facilitĂ le parti interne ed esterne della tomba, le geometrie, le forme e L SURĂ&#x20AC;OLGHL VRIĂ&#x20AC;WWL GHOOH PXUDWXUH GHL OHWWL IXQHEUL 8QD vista ortogonale mostra chiaramente che le camere presen-â&#x20AC;? WDQRJHRPHWULHLUUHJRODULHODORURSRVL]LRQHqLQGLSHQGHQWH rispetto alle stanze adiacenti. La tomba non ha unâ&#x20AC;&#x2122;andamento simmetrico, e questo vĂ  a smentire una vecchia pianta archeologica (Steingraber,  FKHDOFRQWUDULRODUDSSUHVHQWDYDFRQXQDJHRPHWULD SLUHJRODUHFRQOHFDPHUHODWHUDOLVLPPHWULFKH )LJXUD 

12

Fig. 5 -â&#x20AC;? Confron-â&#x20AC;? to tra la vista ortogonale del modello 3D (a) e un'antica pianta archeologica (b).

/$5,&26758=,21(''(//(683(5),&,',3,17( Le aree dei dipinti murali presenti nella tomba sono state ricostruite sia con Python Photogrammetry ToolBox che me-â&#x20AC;? diante un sistema digitale microfotogrammetrico commer-â&#x20AC;? ciale, sviluppato da ICVBC-â&#x20AC;?Firenze e Menci Software (Tiano HW DO   7DOH VWUXPHQWR JHQHUD XQD QXYROD GL SXQWL RGB dallâ&#x20AC;&#x2122;acquisizione di tre immagini (tripletta) riprese da

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

13

Fig. 7 -â&#x20AC;? Sistema microfotogrammetrico 3D (a); Fluorescenza a raggi X a dispersione di energia (b).

ULWjGHOOHULFRVWUX]LRQLUHQGHQGRSRVVLELOHXQ¡HIĂ&#x20AC;FDFHFRP-â&#x20AC;? parazione qualitativa. Il calcolo della distanza di Hausdorff stima la deviazione geometrica tra i due modelli, mostran-â&#x20AC;? GRFKHLOGHOODVXSHUĂ&#x20AC;FLHKDXQDGHYLD]LRQHPLQRUHGL FPHLOqPLQRUHGLFP,OUHODWLYRLVWRJUDPPD riporta lâ&#x20AC;&#x2122;intera distribuzione dei valori calcolati, in funzio-â&#x20AC;? ne della scala colore di riferimento. I risultati ottenuti con i software open source appaiono quindi competitivi e con un buon livello di dettaglio nel confronto con le scansioni del sistema micro-â&#x20AC;?fotogrammetrico commerciale, di cui la documentazione di riferimento riporta unâ&#x20AC;&#x2122;accuratezza sti-â&#x20AC;? PDWDGLFLUFDÂ&#x2014;P

Fig. 6 -â&#x20AC;? Confronto dei modelli 3D di due aree dipinte ottenuti con PPT (a, c) e col sistema microfotogrammetrico commerciale (b, d). Confronto metrico WUDOHPHVK F H G WUDPLWHLOFDOFRORGHOODGLVWDQ]DGL+DXVGRUIIHHODFRGLĂ&#x20AC;-â&#x20AC;? ca della deviazione con scala colore RGB (unitĂ di misura in cm).

angolazioni diverse utilizzando una fotocamera digitale Ca-â&#x20AC;? QRQ (26 ' 0 SL[HO  RSSRUWXQDPHQWH FDOLEUDWD FKH VFRUUHOXQJRXQDEDUUDPRWRUL]]DWDGLPP Per poter confrontare i dati ottenuti con le due metodolo-â&#x20AC;? gie di acquisizione sulle medesime aree dipinte, i rispetti-â&#x20AC;? YLPRGHOOL'VRQRVWDWLVFDODWLHDOOLQHDWLWUDPLWHDSSRVLWL markersGLULIHULPHQWR,Q)LJXUDLOFRQIURQWRWUDLGDWDVHW ottenuti per le stesse pitture mostra lâ&#x20AC;&#x2122;alto grado di simila-â&#x20AC;?

/(,1'$*,1,',$*1267,&+( Gli studi sui dipinti murali sono proseguiti con indagini di Imaging PXOWLVSHWWUDOH H )OXRUHVFHQ]D D UDJJL ; XRF) su aree preventivamente selezionate delle pitture dellâ&#x20AC;&#x2122;atrio e della stanza frontale. Lâ&#x20AC;&#x2122;imaging multispettrale consente la visualizzazione di immagini nel visibile (Imaging Tricro-â&#x20AC;? matico RGB), nel vicino infrarosso (IR) e nellâ&#x20AC;&#x2122;ultravioletto (ImagingGL)OXRUHVFHQ]D89 GDFXLqSRVVLELOHHVWUDSRODUH numerose informazioni ottiche strettamente correlate alle proprietĂ composizionali e allo stato di degrado della su-â&#x20AC;? SHUĂ&#x20AC;FLHLQGDJDWD /¡DQDOLVLqVWDWDHVHJXLWDXWLOL]]DQGRXQDFDPHUDPXOWLVSHW-â&#x20AC;? WUDOH&KURPD&GHOODGLWWD'7$VUOGL&DVFLQD 3LVD FRQ XQ LQWHUYDOOR GL DFTXLVL]LRQH PROWR DPSLR FLUFD  QP GRWDWDGLRELHWWLYR1,.21PPĂ&#x20AC;OWULRWWLFLLQWHUIH-â&#x20AC;? UHQ]LDOLULVROX]LRQHGLPHJDSL[HO/¡LOOXPLQD]LRQHqVWDWD UHDOL]]DWDFRQGXHODPSDGHDORJHQH :WHPSHUDWXUDGL FRORUH  .  SRVWH D FLUFD  PHWUL GDOOH SLWWXUH DG XQ DQJRORFRQODVXSHUĂ&#x20AC;FLHGLJUDGL

)LJ,PPDJLQH5*% D ,5 E HĂ XRUHVFHQ]D89 F GLXQDGHOOHĂ&#x20AC;JXUHURVVHQHOODFDPHUDIURQWDOH


Mini-â&#x20AC;?XGLHQHUJLDPDVVLPD.H9HLQ-â&#x20AC;? Il tempo di esposizione nelle varie bande tensitĂ massima di corrente pari a 200 VSHWWUDOL q VWDWR GHWHUPLQDWR LQ PDQLHUD Č?A e da un rivelatore silicon-â&#x20AC;?drift X123. tale da ottenere un buon bilanciamento ,OVLVWHPDqLQJUDGRGLFDUDWWHUL]]DUHJOL del bianco su un bersaglio SpectralonÂŽ HOHPHQWLFKLPLFLFRQ=! di riferimento. Le immagini IR acquisi-â&#x20AC;? ,Q)LJXUDqULSRUWDWDODPDSSDGLFRP-â&#x20AC;? te mostrano un elevato recupero di in-â&#x20AC;? posizione ricavata dallâ&#x20AC;&#x2122;analisi di una formazioni, consentendo un aumento di delle pitture monocromatiche della leggibilitĂ  del disegno rispetto alle cor-â&#x20AC;? stanza frontale. Risulta evidente una ULVSRQGHQWL LPPDJLQL 5*% )LJXUD   8Q differenza di comportamento ottico tra successivo processo di interpolazione del O¡LQFDUQDWR OD FDSLJOLDWXUD GHOOD Ă&#x20AC;JXUD VHWPXOWLVSHWWUDOHUDFFROWRqVWDWRHVHJXL-â&#x20AC;? H LO IRQGR GHOOD SDUHWH *OL VSHWWUL ;5) to utilizzando un metodo di recente svi-â&#x20AC;? confermano tale differenza composi-â&#x20AC;? luppo, noto come Chromatic Derivative zionale. Lo spettro acquisito sulla capi-â&#x20AC;? Imaging (ChromaDI). Tale metodo include gliatura mostra picchi tipici del ferro, OHLQIRUPD]LRQLGHLFDQDOLPXOWLVSHWWUDOL H SXz HVVHUH LGHQWLĂ&#x20AC;FDWR FRPH WHUUD (RGB+IR) raccolti, basandosi su immagini rossa (ematite). Dal punto di vista della in falsi colori correlate alla derivata prima Ă XRUHVFHQ]DDUDJJL;LOFRPSRUWDPHQ-â&#x20AC;? GHOODFXUYDGLULĂ HWWLYLWj /HJQDLROLHWDO WR GL TXHVWR SLJPHQWR q LQGLVWLQJXLELOH  /HLPPDJLQLULVXOWDQWLSHUPHWWRQR dallâ&#x20AC;&#x2122;argilla del fondo. Il diverso com-â&#x20AC;? di ottenere un ulteriore aumento di leg-â&#x20AC;? portamento evidenziato nellâ&#x20AC;&#x2122;infrarosso JLELOLWjSHUGLYHUVHĂ&#x20AC;JXUHGHJUDGDWHUHQ-â&#x20AC;? potrebbe far supporre lâ&#x20AC;&#x2122;aggiunta di un dendo visibili tracce esecutive, incisioni e dettagli del substrato, fondamentali per Fig. 9 -â&#x20AC;? Mappa di composizione correlata alla di-â&#x20AC;? pigmento nero a base di carbonio, che ricostruire le scene rappresentate e favo-â&#x20AC;? stribuzione delle bande multispettrali RGB -â&#x20AC;? IR QRQVLHYLGHQ]LDQHOORVSHWWURGLĂ XRUH-â&#x20AC;? UDFFROWHVXXQDGHOOHĂ&#x20AC;JXUHURVVHQHOODFDPHUD rire la loro comprensione sia nellâ&#x20AC;&#x2122;ambito frontale. I diversi colori corrispondono a mate-â&#x20AC;? VFHQ]D ; LQ TXDQWR OD WHFQLFD ;5) QRQ qVHQVLELOHDJOLHOHPHQWLOHJJHULFRPHLO della ricerca che della fruizione al pubblico. riali con caratteristiche spettrali differenti. FDUERQLR /¡RJJHWWR FKH OD Ă&#x20AC;JXUD WLHQH Le bande multispettrali raccolte nel visibile e nellâ&#x20AC;&#x2122;IR consentono anche di estrapolare delle mappe com-â&#x20AC;? nella mano destra aveva probabilmente, in origine, lo stesso posizionali, correlate al diverso comportamento ottico dei colore nero della capigliatura. Nello spettro dellâ&#x20AC;&#x2122;incarnato si materiali indagati. Per ciascun materiale, infatti, vengono UHJLVWUDQRLQYHFHSLFFKLFDUDWWHULVWLFLGL)HH3EDWWULEXLELOL UHJLVWUDWHFDUDWWHULVWLFKHFXUYHGLULĂ HWWDQ]DHGLĂ XRUHVFHQ-â&#x20AC;? alla presenza di ocre rosse e minio (ossido di piombo). La ]D89FKHFRQVHQWRQRXQ¡DQDOLVLPXOWLVSHWWUDOHTXDOLWDWLYD presenza del minio nellâ&#x20AC;&#x2122;incarnato costituisce unâ&#x20AC;&#x2122;informazio-â&#x20AC;? DVXDYROWDFRUUHODELOHDJOLVSHWWUL;5)DFTXLVLWLQHOOHPHGH-â&#x20AC;? ne rilevante nellâ&#x20AC;&#x2122;analisi dei pigmenti utilizzati nelle pitture della Tomba della Scimmia, in quanto mai individuato nelle sime aree. /HPLVXUHGL)OXRUHVFHQ]DDUDJJL;DGLVSHUVLRQHGLHQHU-â&#x20AC;? precedenti campagne di indagine diagnostica (Colombini et gia sono state eseguite con uno strumento portatile del-â&#x20AC;? DO FKHVLHUDQROLPLWDWHDOORVWXGLRGHOOHĂ&#x20AC;JXUHGLSLQWH la Amptek Inc. GL%HGIRUG0$ 86$ FRPSRVWRGDXQWXER dellâ&#x20AC;&#x2122;atrio.

Fig. 10 -â&#x20AC;? Integrazione del modello 3D di una pittura della camera frontale con i risultati dell'imaging multispettrale: immagine ChromaD D Ă XRUHVFHQ]D89 9LVLELOH E PDSSDFRPSRVL]LRQDOH F / LGHQWLĂ&#x20AC;FD]LRQHGHOOHDUHHFRQGLYHUVRVHJQDOHPXOWLVSHWWUDOHqVXSSRUWDWDGDLUHODWLYLVSHWWUL;5)

14

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

/$9,68$/,==$=,21(''(,'$7,',$*1267,&, /HULFRVWUX]LRQL'GHLGLSLQWLPXUDOLVRQRVWDWHWH[WXUL]]DWH con le proiezioni dellâ&#x20AC;&#x2122;ImagingPXOWLVSHWWUDOHDOĂ&#x20AC;QHGLLQWHJUD-â&#x20AC;? re i dati diagnostici alla modalitĂ di visualizzazione tridimen-â&#x20AC;? sionale. La mappaturaGHLPRGHOOLqVWDWDHVHJXLWDLQMeshLab con opportune operazioni di post-â&#x20AC;?processing capaci di deter-â&#x20AC;? PLQDUHOHVSHFLĂ&#x20AC;FKHGLRJQLFDPHUDGLULSUHVDLQPRGRGDSR-â&#x20AC;? ter allineare e posizionare ogni immagine sulla corrispondente DUHDGHOODVXSHUĂ&#x20AC;FLH' 3RLFKpODPDJJLRUSDUWHGHLGDWLGLDJQRVWLFLDFTXLVLWLVXXQDVX-â&#x20AC;? SHUĂ&#x20AC;FLHSLWWRULFDqGLUHWWDPHQWHFRUUHODWDDOODFRQIRUPD]LRQH e alle caratteristiche spaziali del suo supporto, le ricostruzioni 'VLULYHODQRXWLOLPH]]LSHULQGLFL]]DUHPHPRUL]]DUHFRUUH-â&#x20AC;? lare e, naturalmente, visualizzare tutte queste informazioni. 8QHVHPSLRUHODWLYRDJOLVWXGLHVHJXLWLVXOGLSLQWRGHOODVWDQ]D IURQWDOH q ULSRUWDWR LQ )LJXUD  3HU WDOH SLWWXUD FKH IRUVH rappresenta un giovane schiavo con in mano un oggetto non EHQLGHQWLĂ&#x20AC;FDELOHODPHVK'YLHQHLQWHJUDWDDLVHJXHQWLUL-â&#x20AC;? sultati diagnostici: Â&#x192; O¡LPPDJLQHGLĂ XRUHVFHQ]D899LVLELOHFKHSURLHWWDVXO modello una mappatura dellâ&#x20AC;&#x2122;attacco biologico in atto VXOOD VXSHUĂ&#x20AC;FLH spot bianchi), evidenziando anche una zona centrale meno colpita, dovuta a recenti prove di SXOLWXUDHIIHWWXDWHFRQDJHQWLIXQJLFLGL Â&#x192; lâ&#x20AC;&#x2122;immagine ChromaD: che rivela in maniera molto vivida GHWWDJOLGHOODĂ&#x20AC;JXUD RFFKLFDSHOOL VFRPSDUVLDOODYLVWD GHOO¡RFFKLRXPDQR Â&#x192;la mappa composizionale e i corrispondenti spettri XRF: che FRQVHQWRQRXQ¡LGHQWLĂ&#x20AC;FD]LRQHGHLPDWHULDOLFRVWLWXHQWL Anche se effettuati in momenti e con strumentazioni diverse, i risultati diagnostici sembrano integrarsi completamente ai SURĂ&#x20AC;OLVXSHUĂ&#x20AC;FLDOLGHOOHDFTXLVL]LRQL'SURSRQHQGRXQDQXR-â&#x20AC;? va metodologia di digitalizzazione e vettorializzazione dei dati acquisiti per la caratterizzazione delle aree dipinte e del loro stato di degrado. &21&/86,21, Gli studi eseguiti nella Tomba della Scimmia hanno permes-â&#x20AC;? so di giungere a importanti valutazioni sulle potenzialitĂ  delle tecniche di Image-â&#x20AC;?Based Modeling per il rilievo tridi-â&#x20AC;? mensionale e per lâ&#x20AC;&#x2122;integrazione delle indagini diagnostiche a questa nuova metodologia di rappresentazione. Rispetto ai tradizionali metodi di rilievo diretto, la tecnica fotogrammetrica digitale presenta un livello di complessitĂ  operativa superiore, ma arriva ad estrapolare dati spaziali e colorimetrici molto piĂš accurati, con tempistiche ridotte e strumentazioni del tutto esigue e facilmente trasportabi-â&#x20AC;? li. Nonostante le dimensioni dellâ&#x20AC;&#x2122;ipogeo, i ridotti tempi di acquisizione hanno consentito di effettuare il rilievo in una sola giornata, concentrando la maggior parte dellâ&#x20AC;&#x2122;elabora-â&#x20AC;? zione alla successiva fase di post-â&#x20AC;?processing e riducendo quindi al minimo lâ&#x20AC;&#x2122;interazione in situ con le opere. Python Photogrammetry Toolbox, integrato a software open source di mesh editing e processing, permette di ottenere XQD ULFRVWUX]LRQH ' IRWRUHDOLVWLFD LPSLHJDELOH SHU VFRSL di documentazione digitale del sito archeologico e del suo stato di conservazione. Il modello metrico generato consen-â&#x20AC;? te anche analisi strutturali piĂš complesse, grazie alla facile possibilitĂ  di visualizzare piante e sezioni sia dellâ&#x20AC;&#x2122;interno che dellâ&#x20AC;&#x2122;esterno della tomba. Lâ&#x20AC;&#x2122;accuratezza e la ripetibilitĂ  GHLULVXOWDWLRWWHQXWLGLPRVWUDQRO¡DIĂ&#x20AC;GDELOLWjGHLsoftware open source come concreta e valida alternativa alle note so-â&#x20AC;? OX]LRQLGLVSRQLELOLLQFRPPHUFLRSHULOULOLHYR' laser scan-â&#x20AC;? ner devices, software SURSULHWDUL VSHVVRGLGLIĂ&#x20AC;FLOHLPSLH-â&#x20AC;? go a causa dei costi elevati da sostenere, delle complesse strumentazioni e dei lunghi tempi di elaborazione dei dati.

15 Anche nel confronto con le acquisizioni del sistema micro-â&#x20AC;? fotogrammetrico i software open source riescono a proporre ULFRVWUX]LRQLGHOOHVXSHUĂ&#x20AC;FLGLSLQWHDOWDPHQWHFRPSHWLWLYH caratterizzate da un elevato livello di dettaglio. Su queste SUHPHVVHqSRVVLELOHVRVWHQHUHXQIXWXURLPSLHJRGLWDOLWHF-â&#x20AC;? niche anche per scopi conservativi, nelle fasi di monitorag-â&#x20AC;? JLR H UHVWDXUR GL VXSHUĂ&#x20AC;FL G¡LQWHUHVVH VWRULFRDUWLVWLFR /D WH[WXUL]]D]LRQHGHLPRGHOOLFRQLULVXOWDWLGHOOHLQGDJLQLGLD-â&#x20AC;? gnostiche confermano tali potenzialitĂ : la documentazione standard acquisita nellâ&#x20AC;&#x2122;ambito di un progetto di restauro SXzHVVHUHLQWHJUDWDDOOHULFRVWUX]LRQL'HLQVLHPHLPSOH-â&#x20AC;? mentata delle informazioni spaziali dellâ&#x20AC;&#x2122;oggetto, proponen-â&#x20AC;? do una piĂš completa e realistica visualizzazione dei dati. /HĂ&#x20AC;QDOLWjGLIUXL]LRQHGHOULOLHYR'SRWUDQQRLQROWUHVXSH-â&#x20AC;? rare la semplice esplorazione in remoto del modello, pun-â&#x20AC;? tando in futuro alla creazione di visite virtuali o esposizioni multimediali in situ. Tali contenuti digitali potranno in piĂš avvalersi dei risultati dellâ&#x20AC;&#x2122;imaging multispettrale e degli studi composizionali (XRF) per fornire al pubblico una piĂš facile metodologia di accesso e interpretazione a indagini VFLHQWLĂ&#x20AC;FKHIRQGDPHQWDOLSHUXQDSLDPSLDFRPSUHQVLRQH del patrimonio culturale e archeologico. 5,1*5$=,$0(17,

,OSUHVHQWHODYRURqVWDWRUHDOL]]DWRGXUDQWHORVWDJHIRUPDWLYRGHO0DVWHULQ´7HFQRORJLH 2SHQ6RXUFHSHUL%HQL&XOWXUDOLÂľ 0DVWHU2SHQ7pFKQH RUJDQL]]DWRGDOO¡,VWLWXWR),&/8 LQFROODERUD]LRQHFRQLO&HQWURGL*HR7HFQRORJLHGHOO¡8QLYHUVLWjGHJOL6WXGLGL6LHQD8Q ULQJUD]LDPHQWRSDUWLFRODUHYDTXLQGLDLFRRUGLQDWRULGHO0DVWHU'RWW*%LJOLDUGLH'RWW VD6&DSSHOOLHDWXWWLLGRFHQWLGHOFRUVR5LQJUD]LRDQFKHLO'RWW0'HOOH3LDQH ,67, CNR) e la Soprintendenza per i Beni Archeologici della Toscana, nelle persone dei Dott.i 33DOOHFFKL H **LDFKL FKH KD SHUPHVVR OD UHDOL]]D]LRQH GHOOH DFTXLVL]LRQL IRWRJUDĂ&#x20AC;FKH allâ&#x20AC;&#x2122;interno dellâ&#x20AC;&#x2122;area archeologica.

BIBLIOGRAFIA

&LJQRQL 3 &DOOLHUL 0 &RUVLQL 0 'HOOHSLDQH 0 *DQRYHOOL ) 5DQ]XJOLD *   Meshlab: an open-â&#x20AC;?source mesh processing tool. Eurographics Italian Chapter Confe-â&#x20AC;? UHQFH3URFHHGLQJVSS²6FDUDQR9'H&KLDUD5(UUD8 HGV 7KH(XUR-â&#x20AC;? graphics Association. &RORPELQL03*LDFKL*3DOOHFKL35LEHFKLQL(  Tecniche pittoriche utilizza-â&#x20AC;? te nelle tombe etrusche di Chiusi e Sarteano. Pittura etrusca: problemi e prospettive. $0LQHWWL HG 0XVHLVHQHVL6LHQD 'LD]+HUUDL]0-XUDGR9&XH]YD6/DL]/3DOOHFFKL37LDQR36DQFKH]0RUDO6 6DL]-LPHQH]&  The actinobacterial colonization of Etruscan paintings. Scien-â&#x20AC;? WLĂ&#x20AC;F5HSRUWV$UWLFOHQXPEHU /HJQDLROL6/RUHQ]HWWL*&DYDOFDQWL*+*ULIRQL(0DUUDV/7RQD]]LQL$6DOHUQR (3DOOHFFKL3*LDFKL*3DOOHVFKL9  Recovery of Archaeological Wall Paintings using Novel Multispectral Imaging Approache+HULWDJH6FLHQFH 0RXORQ3%H]]L$  Python photogrammetry toolbox: a free solution for th-â&#x20AC;? ree-â&#x20AC;?dimensional documentation&DQWRQH) HG $5&+(2)2662SHQ6RXUFH)UHH 6RIWZDUHH2SHQ)RUPDWQHLSURFHVVLGLULFHUFDDUFKHRORJLFD$WWLGHO9,:RUNVKRS 1DSROLJLXJQR3R]]XROL 3DOOHFFKL3  Le tombe dipinte di chiusi: diagnostica e interventi conservativi. 3LWWXUDHWUXVFDSUREOHPLHSURVSHWWLYH0XVHLVHQHVL6LHQD 6WHLQJUDEHU6  Catalogo ragionato della pittura Etrusca-DFD%RRN,6%1  7LDQR36DOYR3&HFFDURQL)  The Microphotogrammetry as a Portable Diagno-â&#x20AC;? stic Tool for Monumental Surface Monitoring3URFRIWKH'*D26,2)-RLQW0HHWLQJ 'HXWVFKH*HVHOOVFKDIWIXUDQJHZDQGWH2SWLNH9%UHVFLD

ABSTRACT

THIS PAPER AIMS TO DEMONSTRATE THE USEFULNESS OF DIGITAL RECONSTRUCTIONS IN THE VISUALIZATION AND INTERPRETATION OF ANALYTICAL DATA OBTAINED IN SCIENCE CONSERVATION PROJECTS. THE STUDY WAS CARRIED OUT IN THE TOMB OF THE MONKEY, ONE OF THE MOST IMPORTANT TOMB OF THE ETRUSCAN NECROPOLIS OF POGGIO RENZO, NEAR CHIUSI, DATED AROUND 480-â&#x20AC;? 470 BC. PHOTOGRAMMETRY SURVEY METHOD WAS USED TO GENERATE A 3D MODEL OF THE WHOLE UNDERGROUND GRAVE. THE MAIN ADVANTAGE OF THIS METHOD, WHICH IS BASED ON DENSE STEREO MATCHING TOOLS, IS THE POSSIBILITY TO GENERATE 3D RECONSTRUCTION STARTING FROM A SET OF UNCALIBRATED IMAGES, WITH NON-â&#x20AC;?INVASIVE AND EASY TRANSPORTABLE HARDWARE. OPEN SOURCE SOFTWARE IS ALSO USED TO INTEGRATE 3D WALL PAINTING DATA TO THE DIAGNOSTIC RESEARCHES: (I) MULTISPEC-â&#x20AC;? TRAL ANALYSIS, ABLE TO IMPROVE THE READABILITY OF THE PAINTED SCENES, DETECTING DETAILS OTHERWISE INVISIBLE TO THE HUMAN EYE, AND (II) X-â&#x20AC;?RAY FLUORESCENCE DATA THAT GIVE INFORMATION ON THE ELEMENTAL COMPOSITION OF MATERIALS AND CONFIRMS THE BEHAVIOR OF THE MULTISPECTRAL SIGNALS COLLECTED ON THE WALL PAINTING SURFACES

PAROLE CHIAVE TOMBA DELLA SCIMMIA; RILIEVO 3D; SISTEMA FOTOGRAMMETRICO IMAGE-â&#x20AC;?BASED; SOFTWARE OPEN SOURCE; DIAGNOSTICA; IMAGING MULTISPETTRALE; XRF

AUTORI CRISTINA GIANCRISTOFARO DOTT.SSA IN SCIENZE PER I BENI CULTURALI c.giancristofaro@gmail.com

LUCIANO MARRAS marras@art-â&#x20AC;?test.eu

ART-â&#x20AC;?TEST DI L. MARRAS E C. SAS, PISA VINCENZO PALLESCHI vincenzo.palleschi@cnr.it

LABORATORIO DI SPETTROSCOPIA LASER APPLICATA, CNR, PISA


RIVELAZIONI

FORS, FIBER OPTICS REFLECTANCE SPECTROSCOPY CON GLI SPETTROMETRI MINIATURIZZATI PER Lâ&#x20AC;&#x2122;IDENTIFICAZIONE DEI PIGMENTI

di Antonino Cosentino

Questo articolo riporta i risultati dei test di un sistema FORS (Fiber Optics 5HĂ HFWDQFH6SHFWURVFRS\) assemblato con componenti Ocean Optics. Questa ditta ha sviluppato una linea di spettrometri miniaturizzati e dal costo estremamente contenuto. Le trascurabili dimensioni e peso di questo sistema FORS lo rendono uno strumento assolutamente adatto alle indagini dellâ&#x20AC;&#x2122;arte in cantiere. Sono stati testati 54 pigmenti storici in polvere e stesi con gomma arabica, tempera allâ&#x20AC;&#x2122;uovo, olio e affresco. Il sistema è stato provato su un quadro dellâ&#x20AC;&#x2122;800 e su opere murali del barocco siciliano. )LJ6LVWHPD)256)LEHU2SWLFV5HĂ HFWDQFH6SHFWURVFRS\ sviluppato dalla GHT Photonics srl con componenti Ocean Op-â&#x20AC;? tics: da sinistra a destra, lampada ad incandescenza, spettro-â&#x20AC;? metro modello USB4000 e sfera integratrice.

L

D)256qVWDWDXWLOL]]DWDSHUOHLQGDJLQLGHOO¡DUWHSHUDO-â&#x20AC;? PHQRGHFHQQL1HOIXSXEEOLFDWRXQDUWLFRORFKH LQWURGXFHYD O¡DSSOLFD]LRQH GHOOD )256 DOOH LQGDJLQL SHU O¡DUWH>@HQHOXQ¡DOWUDSXEEOLFD]LRQHPRVWUDYDLULVXO-â&#x20AC;? WDWLGHOO¡LQGDJLQHWUDPLWH)256GHJOLDIIUHVFKLGHOODFDSSHOOD %UDQFDFFL>@/DULFHUFD)256FRQWLQXDFRQXQGDWDEDVHGL VSHWWUL)256RQOLQH>@HUHFHQWLVWXGLSHUO¡LGHQWLĂ&#x20AC;FD]LRQHGHL SLJPHQWLLQSROYHUHHVWHVLFRQGLYHUVHWHFQLFKH> @HVSHFLĂ&#x20AC;FDWDPHQWHVXSLWWXUHPXUDOL>@HPDQRVFULWWL>@ QRQFKH¡O¡LGHQWLĂ&#x20AC;FD]LRQHGHOOHWLQWXUH>@SHUODGLDJQRVWLFD del degrado delle plastiche utilizzate in arte moderna [12] e ODVHOH]LRQHGHLSLJPHQWLSHULOUHVWDXUR>@ Il vantaggio di questa tecnica rispetto ad altre spettroscopie, FRPH OD 5DPDQ H OD )OXRUHVFHQ]D D UDJJL ; q FKH OH FRP-â&#x20AC;? ponenti strumentali richieste possono essere relativamente economiche: una sorgente luminosa, uno spettrometro e due Ă&#x20AC;EUHRWWLFKHXQDSHULOOXPLQDUHLOFDPSLRQHHO¡DOWUDSHUUDF-â&#x20AC;? FRJOLHUHODOXFHULĂ HVVD6HVLVFHJOLHGLODYRUDUHVSHFLĂ&#x20AC;FDPHQ-â&#x20AC;? te nello spettro visibile, includendo solo una piccola porzione GHOYLFLQRLQIUDURVVRHGHOYLFLQRXOWUDYLROHWWRWUDFLUFD nm e 1000 nm, la strumentazione ha davvero costi contenuti. Dâ&#x20AC;&#x2122;altra parte molti gruppi di ricerca che fanno spettroscopia )256 QHOOH UHJLRQL VSHWWUDOL 899LV1,5 FRQ VWUXPHQWD]LRQH SRUWDWLOHXVDQRDSSDUHFFKLDWXUHSLX¡VRĂ&#x20AC;VWLFDWHHFRQVHJXHQ-â&#x20AC;? temente piuâ&#x20AC;&#x2122; costose per raggiungere maggiore accuratezza, sensibilitaâ&#x20AC;&#x2122; e riproducibilitaâ&#x20AC;&#x2122; delle misure. Questo articolo si SURSRQHGLPRVWUDUHFRVDqSRVVLELOHIDUHVSHFLĂ&#x20AC;FDPHQWHFRQ un sistema di tipo economico. $QFKH LO VLJQLĂ&#x20AC;FDWR GL XQR VSHWWUR )256 q PROWR VHPSOLFH mostra per ogni lunghezza dâ&#x20AC;&#x2122;onda, il rapporto tra lâ&#x20AC;&#x2122;intensitĂ GHOODOXFHULĂ HVVDHO¡LQWHQVLWjGHOODOXFHLQFLGHQWHPLVXUD-â&#x20AC;? to rispetto allo standard usato per tarare il sistema. Questo UDSSRUWRVLFKLDPDULĂ HWWDQ]DHVLHVSULPHLQSHUFHQWXDOH  

16

8QRVSHWWURGLULĂ HWWDQ]DSXR¡GDUHLQGLFD]LRQLVXOO¡LGHQWLĂ&#x20AC;FD-â&#x20AC;? ]LRQHGHLSLJPHQWLGDOPRPHQWRFKHODOXFHFKHQRQqULĂ HVVD qDVVRUELWDRWUDVPHVVDLQEDVHDOODFRPSRVL]LRQHFKLPLFDGHO PDWHULDOHDQDOL]]DWR'DWHPSR2FHDQ2SWLFVKDSHUVHJXLWR ODPLQLDWXUL]]D]LRQHGHOODVXDOLQHDGLVSHWWURPHWULLQĂ&#x20AC;JXUD 2. Le piccole dimensioni ed il peso contenuto sono qualitĂ estremamente importanti per chi si occupa di diagnostica nei cantieri di restauro. Infatti, fuori dallo studio di conservazio-â&#x20AC;? QH R GDO ODERUDWRULR VFLHQWLĂ&#x20AC;FR OD SRVVLELOLWj GL WUDVSRUWDUH DJHYROPHQWH JOL VWUXPHQWL q VSHVVR O¡HOHPHQWR GHFLVLYR FKH ne determina il loro effettivo utilizzo. Le indagini in cantiere si fanno salendo su alte impalcature per raggiungere gli ele-â&#x20AC;? menti di interesse e spesso in ambienti angusti. La portabilitĂ  GHJOLVWUXPHQWLqSHUFLzGHWHUPLQDQWHSHUFXLODPLQLDWXUL]-â&#x20AC;? ]D]LRQHGHOORVSHWWURPHWUR86%qSDUWLFRODUPHQWHXWLOH per questâ&#x20AC;&#x2122;applicazione dove lâ&#x20AC;&#x2122;oggetto dâ&#x20AC;&#x2122;interesse devâ&#x20AC;&#x2122;es-â&#x20AC;? VHUH UDJJLXQWR WUDPLWH LPSDOFDWXUD /D OHJJHUH]]D q LQROWUH apprezzabile anche per chi come lâ&#x20AC;&#x2122;autore, fornisce indagini diagnostiche viaggiando con i propri strumenti.

Fig. 2 -â&#x20AC;? Lo spettrometro USB4000, parte del sistema FORS testato in questo articolo, sta tutto in una mano e pesa meno di 200 gr.

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

8QDOWURYDQWDJJLRGHOODOLQHDGLSURGRWWL2FHDQ2SWLFVqOD modularitĂ . Si acquista uno spettrometro e completandolo con le opportune sonde e sorgenti, lo si può utilizzare per UHDOL]]DUHGLYHUVLWLSLGLVSHWWURVFRSLHGLULĂ HWWDQ]DGLWUD-â&#x20AC;? VPLWWDQ]DHGLĂ XRUHVFHQ]DQRQFKpFRORULPHWULD 67580(17$=,21( &RPHPRVWUDODĂ&#x20AC;JXUDLOVLVWHPD)256qFRPSRVWRGDVROL HOHPHQWLODVRUJHQWHOXPLQRVDORVSHWWURPHWURODVRQGD HOHĂ&#x20AC;EEUHRWWLFKHFKHKDQQRORVFRSRSUDWLFRGLYHLFRODUH la luce della sorgente sul campione e raccoglierne la luce ULĂ HVVDSHUHVVHUHDQDOL]]DWDGDOORVSHWWURPHWUR/¡XVRGHOOH Ă&#x20AC;EUHKDDQFKHDOWULLPSRUWDQWLYDQWDJJLYHLFRODQRVXOFDP-â&#x20AC;? pione solo la luce della sorgente, senza trasportarne il ca-â&#x20AC;? lore che nel caso della lampada ad incandescenza utilizzata SHU OD )256 q QRWHYROH H SRWUHEEH GDQQHJJLDUH O¡RJJHWWR essendo maneggevoli e leggere consentono di raggiungere IDFLOPHQWHSRVL]LRQLSRFRDFFHVVLELOL/RVSHWWURPHWURqJH-â&#x20AC;? VWLWRGDOVRIWZDUH2FHDQYLHZGHOOD2FHDQ2SWLFVFKHULVSHW-â&#x20AC;? to al precedente SpectraSuite, risulta molto piĂš intuitivo e permette in pochi passaggi, con il suo wizard, di mettere a punto il tipo di spettroscopia desiderata.

17 La tabella 1 riporta i nomi dei pigmenti ed il loro codice SURGRWWRSHUO¡XQLYRFDLGHQWLĂ&#x20AC;FD]LRQHVXOVLWRGHOOD.UHPHU I pigmenti sono stati analizzati in polvere e stesi con gomma arabica, tempera allâ&#x20AC;&#x2122;uovo e olio di lino su carta per acque-â&#x20AC;? UHOORGLFHOOXORVDHFRWRQHSURGRWWDGD)DEULDQRJUP2, SULYDGLOLJQLQDHGLDFLGLWj,OVXRVSHWWURGLUHĂ HWWDQ]Dq SLDWWRĂ&#x20AC;JXUD>@VHQ]DFDUDWWHULVWLFKHGRPLQDQWL4XHVWH VWHVXUHFKLDPDWHGDOO¡DXWRUH´SLJPHQWVFKHFNHUÂľVRQRYL-â&#x20AC;? VLELOLLQĂ&#x20AC;JXUD>@,SLJPHQWLVRQRVWDWLVWHVLDQFKHFRQOD tecnica dellâ&#x20AC;&#x2122;affresco su un supporto di intonachino prepara-â&#x20AC;? to con una miscela di polvere di marmo e grassello di calce in proporzione 2:1.

Sorgente luminosa 6LqXWLOL]]DWDXQDODPSDGDWXQJVWHQRDORJHQD+/)+6$ GL2FHDQ2SWLFVFRQXQRVSHWWURGLHPLVVLRQHWUDH QPSRWHQ]D:HWHPSHUDWXUDGLFRORUHGL./DODP-â&#x20AC;? SDGDqGRWDWDGLHOHWWURQLFDLQWHUQDFKHQHVWDELOL]]DODOXFH GRSRPLQXWLGDOO¡DFFHQVLRQHSURSULHWjPROWRLPSRUWDQWH SHUODTXDOLWjGHOODPLVXUD)256 Spettrometro /¡86%qFRVWLWXLWRGDXQDUUD\OLQHDUH&&'GLSL[HO XQUHWLFRORGLGLIIUD]LRQHFKHRSHUDWUD QPHKD XQDULVROX]LRQHGLGLQP ):+0 *OLVSHWWULVRQR VWDWLDFTXLVLWLFRQLVHJXHQWLSDUDPHWULLQWHJUDWLRQWLPH VHFVFDQVWRDYHUDJHER[FDUZLGWK0HQWUHODPLVXUD qGHFLVDPHQWHEXRQDQHOUDQJHYLVLELOHLOUXPRUHDXPHQWD DLPDUJLQLGHJOLVSHWWUL4XHVWRHIIHWWRqGRYXWRDOODPDQ-â&#x20AC;? canza di responsivitĂ da parte del detector nellâ&#x20AC;&#x2122;infrarosso e alla mancanza di potenza dellâ&#x20AC;&#x2122;illuminatore nellâ&#x20AC;&#x2122;ultravio-â&#x20AC;? letto. Esistono ovviamente altri strumenti che rendono piĂš precisa la misura anche in queste bande, ma i costi aumen-â&#x20AC;? WDQRHQRQqFRPXQTXHQHFHVVDULDXQDPDJJLRUHSUHVWD]LR-â&#x20AC;? ne in queste bande in quanto le informazioni necessarie alla LGHQWLĂ&#x20AC;FD]LRQHGHLSLJPHQWLVRQRFRQWHQXWLSHUODPDJJLRU parte nel range del visibile. Sonda 6RQRVWDWHSURYDWHGXHVRQGHODVRQGDGLULĂ HWWDQ]D5 899,6HODVIHUDLQWHJUDWULFH,635HQWUDPEHGHOOD2FH-â&#x20AC;? DQ2SWLFV/DVRQGD5899,6qXQDĂ&#x20AC;EUDRWWLFDELIRU-â&#x20AC;? FDWDHSURYYLVWDGLXQDIHUUXODĂ&#x20AC;JXUD6LXVDVHPSOLFH-â&#x20AC;? mente collegando un capo alla sorgente luminosa e lâ&#x20AC;&#x2122;altro DOOR VSHWWURPHWUR /D OXFH GLIIXVD q UDFFROWD VXOOR VWHVVR DQJRORGLTXHOODLQFLGHQWHWXWWDYLDODIHUUXODqRULHQWDELOH dallâ&#x20AC;&#x2122;operatore e si possono effettuare letture sia a 0/0 che DPLQLPL]]DQGRODFRPSRQHQWHULĂ HVVDRDGDQJROL DUELWUDUL3HUOHLQGDJLQL)256SUHVHQWDWHLQTXHVWRODYRUR VLqSUHIHULWDODVIHUDLQWHJUDWULFHFKHPHGLDOHFRPSRQHQWL ULĂ HVVDHGLIIXVDUHVWLWXHQGRXQRVSHWWURFKHqFDUDWWHULVWL-â&#x20AC;? FRGHOPDWHULDOHLQVpHQRQGLSHQGHGDOORVSHFLĂ&#x20AC;FRRULHQWD-â&#x20AC;? mento con cui si esegue la misura. &$03,21, ,SLJPHQWLVWRULFLVRQRSURGRWWLGDOOD.UHPHU3LJPHQWHH tutte le informazioni sulla loro preparazione e composizione sono disponibili sul sito della Kremer.

Tab. 1 -â&#x20AC;? I 54 pigmenti storici analizzati in questo lavoro sono prodotti dalla Kremer Pigmente. Le informazioni sulla loro com-â&#x20AC;? posizione e metodo di produzione si trovano sul sito della ditta.

5,68/7$7, Pigmenti Bianchi *OL VSHWWUL GL ULĂ HWWDQ]D GHL  SLJPHQWL ELDQFKL DQDOL]]D-â&#x20AC;? WL VRQR ULSRUWDWL LQ Ă&#x20AC;JXUD >@ , SLJPHQWL ELDQFR GL WLWDQLR H ELDQFR GL ]LQFR VL FDUDWWHUL]]DQR SHU LO QRWR >@ IRUWH DVVRUELPHQWRGHOODFRPSRQHQWHXOWUDYLROHWWD,OOLWRSRQHq XQDPLVFHODGLVROIDWRGLEDULRFKHqXQRWWLPRULĂ HWWRUH > @ H KD XQR VSHWWUR SLDWWR H VROIXUR GL ]LQFR FKH q responsabile delle bande di assorbimento nellâ&#x20AC;&#x2122;ultravioletto HWUDHQP/DELDFFDHGLOJHVVRKDQQRVSHWWULSLDWWL PHQWUHODFDOFHqFDUDWWHUL]]DWDGDOODFUHVFHQWHULĂ HWWDQ]D allâ&#x20AC;&#x2122;aumentare della lunghezza dâ&#x20AC;&#x2122;onda.

)LJ   6SHWWUL GL ULĂ HWWDQ]D GL  SLJPHQWL ELDQFKL H GHOOD FDUWD per acquarello.


)LJ6SHWWULGLULĂ HWWDQ]DGLSLJPHQWLQHUL

Pigmenti Neri *OLVSHWWULGLULĂ HWWDQ]DGHLSLJPHQWLQHULDQDOL]]DWLVRQR ULSRUWDWLLQĂ&#x20AC;JXUD>@,SLJPHQWLQRQPRVWUDQRQHVVXQDFD-â&#x20AC;? UDWWHULVWLFDXWLOHDGLGHQWLĂ&#x20AC;FDUOL,OORURVSHWWURqSLDWWRHOD ULĂ HWWDQ]DEDVVD Pigmenti Blu *OL VSHWWUL GL ULĂ HWWDQ]D GHJOL  SLJPHQWL EOX DQDOL]]DWL VRQR ULSRUWDWL QHOOH Ă&#x20AC;JXUH >@ H >@$]]XUULWH H D]]XUULWH DUWLĂ&#x20AC;FLDOHPRVWUDQRLOFDUDWWHULVWLFRSLFFRLQWRUQRDQP Lo smalto eâ&#x20AC;&#x2122; caratterizzato da una banda di assorbimento DVXDYROWDGLYLVDLQWUHVRWWREDQGH>@FRQPLQLPLD QPQPHQP,OYLROHWWRGLFREDOWRKDXQDEDQGD di assorbimento che invece si divide in due sotto bande con PLQLPLDFLUFDQPHQP,OEOXFREDOWRPRVWUDXQD ULĂ HWWDQ]DFRVWDQWHQHOO¡LQIUDURVVRĂ&#x20AC;JXUD>@,QGLJRHEOX 0D\DHVLELVFRQRVSHWWULVLPLOLFRPHFLVLDVSHWWDDYHQGROR stesso cromoforo, lâ&#x20AC;&#x2122;indigotina, e mostrano la caratteristica EDQGDGLDVVRUELPHQWRWUDFLUFDQPHQP>@HOD UDSLGDFUHVFLWDGHOODULĂ HWWDQ]DQHOO¡LQIUDURVVRFRQLOĂ HVVR WUDQPHQP,OEOXHJL]LDQRKDXQSLFFRDQP FKHSXR¡DVVHJQDUVLDOODĂ XRUHVFHQ]DLQIUDURVVD>@,OEOX GL3UXVVLDqFDUDWWHUL]]DWRGDOVXRVSHWWURTXDVLWRWDOPHQWH SLDWWRPHQWUHLOEOXSKWKDORGDOĂ HVVRDQPHO¡XOWUDPD-â&#x20AC;? ULQRGDOODVXDFDUDWWHULVWLFDIRUPD>@

Pigmenti Verdi *OL VSHWWUL GL ULĂ HWWDQ]D GHJOL  SLJPHQWL YHUGL DQDOL]]DWL VRQRULSRUWDWLQHOODĂ&#x20AC;JXUD>@,SLJPHQWLYHUGLSUHVHQWDQR PROWHFDUDWWHULVWLFKHXWLOLDOODORURLGHQWLĂ&#x20AC;FD]LRQH,OYHUGH di cromo idrato e il verde cromo sono caratterizzati dallâ&#x20AC;&#x2122;in-â&#x20AC;? WHQVDULĂ HWWDQ]DQHOO¡LQIUDURVVRHGDLORURGXHSLFFKLD QPHQPSHULOYHUGHGLFURPRHQPHQPSHU il verde cromo idrato. Solo per questi due pigmenti ver-â&#x20AC;? GL XQ VLVWHPD )256 SL SUHFLVR QHOO¡XOWUDYLROHWWR VDUHEEH DSSUH]]DELOH SHU RWWHQHUH GHJOL VSHWWUL PHJOLR GHĂ&#x20AC;QLWL GHO picco nellâ&#x20AC;&#x2122;ultravioletto. ll verde di cobalto ha la stessa in-â&#x20AC;? WHQVDULĂ HWWDQ]DPDDGLIIHUHQ]DGHLSULPLGXHSLJPHQWL KDXQVRORSLFFRDQP,OYHUGHGLFDGPLRKDXQSLFFR QHOO¡LQIUDURVVRDQP,OYHUGHSKWKDORKDXQSLFFRD QPHGqLOSLJPHQWRYHUGHFRQODULĂ HWWDQ]DQHOO¡LQIUDURVVR che cresce alle lunghezze dâ&#x20AC;&#x2122;onda maggiori. Il verderame si ULFRQRVFHSHULOVXRSLFFRDQPHODEDVVDULĂ HWWDQ]DSHU WXWWRORVSHWWUR,QĂ&#x20AC;QHODPDODFKLWHVLGLVWLQJXHSHUODVXD ODUJDEDQGDGLDVVRUELPHQWRWUDQPHQP>@HOD WHUUDYHUGHSHULGXHSLFFKLDFLUFDQPHQPFDUDW-â&#x20AC;? WHULVWLFLGHOODFHODGRQLWH>@

)LJ6SHWWULGLULĂ HWWDQ]DGLSLJPHQWLYHUGL

Pigmenti Gialli *OL VSHWWUL GL ULĂ HWWDQ]D GHJOL  SLJPHQWL JLDOOL DQDOL]]DWL VRQRULSRUWDWLQHOODĂ&#x20AC;JXUD>@,JLDOOLSUHVHQWDQRSRFKHFD-â&#x20AC;? UDWWHULVWLFKH,OJLDOORGLFDGPLRKDO¡DVVRUELPHQWRWUDH QPULVFRQWUDWRQHOOLWRSRQHHGRYXWRDOVROIXURGL]LQFR Lâ&#x20AC;&#x2122;ocra gialla si riconosce per la caratteristica forma ad S >@,OJLDOORGLSLRPERKDXQDVSDOODFDUDWWHUL]]DQWHD nm. Gli altri gialli si caratterizzano solo per la diversa posi-â&#x20AC;? ]LRQHGHOĂ HVVRGRSRODUHJLRQHGHOEOXĂ&#x20AC;JXUH>@

)LJ6SHWWULGLULĂ HWWDQ]DGLSLJPHQWLEOX

)LJ6SHWWULGLULĂ HWWDQ]DGLSLJPHQWLJLDOOL

)LJ6SHWWULGLULĂ HWWDQ]DGLSLJPHQWLEOX

18

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

)LJ6SHWWULGLULĂ HWWDQ]DGLSLJPHQWLJLDOOL

Pigmenti Rossi *OLVSHWWULGLULĂ HWWDQ]DGHLSLJPHQWLURVVLDQDOL]]DWLVRQR ULSRUWDWLQHOOHĂ&#x20AC;JXUH>@H>@$QFKHLSLJPHQWLURVVLKDQ-â&#x20AC;? QRVSHWWULGLULĂ HWWDQ]DPROWRVLPLOL6LGLVWLQJXHLOUHDOJDU SHUXQĂ HVVRDQPHO¡RFUDURVVDSHUODWLSLFDIRUPDDG 6>@/DODFFDGLJDUDQ]DH¡FDUDWWHUL]]DWDGDOODEDQGDGL DVVRUELPHQWRDFLUFDQP>@,OYHUPLJOLRQHKDXQFD-â&#x20AC;? UDWWHULVWLFRHUDSLGRDXPHQWRGHOODULĂ HWWDQ]DFRQLOĂ HVVR DQP>@

19

)LJ6SHWWULGLULĂ HWWDQ]DGLSLJPHQWLEUXQL

duare aree dâ&#x20AC;&#x2122;interesse da analizzare con le tecniche spet-â&#x20AC;? WURVFRSLFKHFKHVRQRLQYHFHSXQWXDOL/DĂ&#x20AC;JXUH>@PRVWUD le immagini multispettrali dellâ&#x20AC;&#x2122;area corrispondente allâ&#x20AC;&#x2122;an-â&#x20AC;? gelo in alto a sinistra.

)LJ,OGLSLQWR´0DGRQQDHTXDWWUR$QJHOLÂľROLRVXWHODĂ&#x20AC;QH immagini multispettrali del drappo rosso dellâ&#x20AC;&#x2122;angelo in alto a sinistra. Nella foto del visibile i numeri indicano le posizioni testate con la FORS. )LJ6SHWWULGLULĂ HWWDQ]DGLSLJPHQWLURVVL

1HOODIRWRGLĂ XRUHVFHQ]DXOWUDYLROHWWDVLYHGHODSUHVHQ]D GLGLYHUVLLQWHUYHQWLGLUHVWDXURFKHDSSDLRQRVFXUL6LqFHU-â&#x20AC;? FDWRGLLGHQWLĂ&#x20AC;FDUHFRQOD)256Ă&#x20AC;JXUH>@H>@QHOO¡DUHD del drappo rosso dellâ&#x20AC;&#x2122;angelo in alto a sinistra, il pigmento URVVR RULJLQDOH H TXHOOR GHO ULWRFFR *OL VSHWWUL  )256 GHL SXQWL DUHDULWRFFDWD H DUHDRULJLQDOH PRVWUDQR spettri non distinguibili. Questo non sorprende, infatti lâ&#x20AC;&#x2122;in-â&#x20AC;? dagine multispettrale suggerisce il vermiglione per lâ&#x20AC;&#x2122;area originale ed il rosso di cadmio per il ritocco. Infatti, il rosso GL FDGPLR q LGHQWLĂ&#x20AC;FDWR FRQ FHUWH]]D JUD]LH DOOD VXD Ă XR-â&#x20AC;? UHVFHQ]DLQIUDURVVD>@$OFRQWUDULRQHJOLVSHWWUL)256 questi due pigmenti hanno spettri non distinguibili, come discusso nella sezione relativa ai rossi. )LJ6SHWWULGLULĂ HWWDQ]DGLSLJPHQWLURVVL

Pigmenti Bruni *OL VSHWWUL GL ULĂ HWWDQ]D GHL  SLJPHQWL EUXQL DQDOL]]DWL VRQRULSRUWDWLQHOODĂ&#x20AC;JXUD>@7UDLSLJPHQWLEUXQLDQD-â&#x20AC;? lizzati si distinguono solo la terra di Siena e la terra di Siena EUXFLDWDSHUODFDUDWWHULVWLFIRUPDDG6>@ &$6,678',2 0DGRQQDHTXDWWUR$QJHOLROLRVXWHODĂ&#x20AC;QH/HLPPD-â&#x20AC;? gini multispettrali di questo dipinto sono state giĂ pubblica-â&#x20AC;? WHHGLVFXVVH>@/¡LQGDJLQHPXOWLVSHWWUDOHqSUHOLPLQDUH DGRJQLLQGDJLQHVSHWWURVFRSLFDSHUFKpSHUPHWWHGLLQGLYL-â&#x20AC;?

Fig. 14 -â&#x20AC;? Il dipinto â&#x20AC;&#x153;Madonna e quattro Angeliâ&#x20AC;?, olio su WHODĂ&#x20AC;QHÂśYLHQHHVDPLQDWRQHOODERUDWRULR´&XOWXUDO Heritage Science Open Sourceâ&#x20AC;? dallâ&#x20AC;&#x2122;autore con il sistema FORS della Ocean Optics. In primo piano la sorgente alogena e lo spettrometro miniaturizzato USB4000.


XOWUDYLROHWWRULĂ HVVRFKHODSDWLQDELDQFDDSSHQDSHUFHWWL-â&#x20AC;? bile nella foto visibile, risulta molto piĂš distinta nellâ&#x20AC;&#x2122;ultra-â&#x20AC;? YLROHWWR ULĂ HVVR 3HUFXL XWLOL]]DQGR TXHVW¡XOWLPD IRWR VL q potuto selezionare tre punti non affetti da questa patina.

Fig.15 -â&#x20AC;? Spettri FORS dei punti 2, 4, 6 (area ritoccata) e 3 (area originale) sullâ&#x20AC;&#x2122;ala dellâ&#x20AC;&#x2122;angelo in alto a sinistra.

&+,(6$',6$17$0$5,$'(*/,$1*(/,$662526,&,/,$ $VVRURqXQSDHVHGDOO¡LPSLDQWRPHGLHYDOHVXLPRQWL(UHL situati al centro della Sicilia. Nel passato ebbe un ruolo importante nella storia siciliana. Cicerone nelle sue Verrine GHĂ&#x20AC;QLVFHJOL$VVRULQL´YLULIRUWHVHWĂ&#x20AC;GHOHVÂľSHUFKpULXVFLUR-â&#x20AC;? no ad impedire a Verre, il pretore della Sicilia, che aveva depredato molti dei tesori artistici delle cittĂ dellâ&#x20AC;&#x2122;isola, di impadronirsi anche della statua del tempio di Crisa in Asso-â&#x20AC;? rium. Lo storico Diodoro Siculo scrisse che Assoro fu lâ&#x20AC;&#x2122;unica cittĂ  sicula che sostenne la potente Siracusa contro la spe-â&#x20AC;? dizione cartaginese guidata da Imilicone. La chiesa di Santa 0DULDGHJOL$QJHOLIXHUHWWDQHOGDL3DGUL5LIRUPDWLHVL distingue per lo sfarzoso barocco dipinto che ricopre tutto O¡LQWHUQRĂ&#x20AC;JXUD>@

)LJ)RWRJUDĂ&#x20AC;DPXOWLVSHWWUDOHGHOSDUWLFRODUHDQDOL]]DWRGHOODGHFRUD]LR-â&#x20AC;? ne murale barocca della chiesa di Santa Maria degli Angeli in Assoro, Sicilia.

/DĂ&#x20AC;JXUD>@PRVWUDORVSHWWURGHOSXQWREOX6LSRWUHE-â&#x20AC;? EHDWWULEXLUHDOORVPDOWRFRPHVXJJHULVFHLOSLFFRDQP 4XHVWDLSRWHVLqVXJJHULWDDQFKHGDOO¡LQGDJLQHPXOWLVSHWWUD-â&#x20AC;? le, infatti lo smalto assorbe moderatamente lâ&#x20AC;&#x2122;ultravioletto QHOODIRWRJUDĂ&#x20AC;DGLXOWUDYLROHWWRULĂ HVVRHULĂ HWWHO¡LQIUDURVVR

Fig. 16 -â&#x20AC;? Chiesa di Santa Maria degli Angeli in Assoro, Sicilia. Sinistra, det-â&#x20AC;? taglio della decorazione tra la navata e la cappella. Destra, gli affreschi della parete sinistra.

La semplicitĂ originaria dellâ&#x20AC;&#x2122;organismo architettonico, le-â&#x20AC;? gata ai precetti dellâ&#x20AC;&#x2122;ordine fondatore, venne decisamen-â&#x20AC;? te trasformata nel corso del XVIII secolo da un intervento SLWWRULFRFKHQHDUULFFKuO¡LQWHUQR,QSDUWLFRODUHO¡LQWHUQR GHOODFKLHVDGDOSDYLPHQWRDOOHVXSHUĂ&#x20AC;FLYROWDWHIXLQWHUD-â&#x20AC;? mente ricoperto da pitture a trompe lâ&#x20AC;&#x2122;oeil, con motivi ge-â&#x20AC;? RPHWULFLHĂ RUHDOLFKHVLPXODYDQRSURIRQGLWjSURVSHWWLFKH ricostruivano dettagli architettonici e reggevano le immagi-â&#x20AC;? QDULHFRUQLFLHQWURFXLHUDQRUDIĂ&#x20AC;JXUDWHVFHQHGHOODYLWDGHL santi. Le pitture presenti, realizzate a tempera e a fresco, esprimono la volontĂ  di costruire una architettura di colo-â&#x20AC;? ULHIRUPHVRYUDSSRVWDDOOHVHPSOLFLVXSHUĂ&#x20AC;FLGHOODFKLHVD e capace di rappresentare la nuova sensibilitĂ  manierista. 8QDGDWDUDSSUHVHQWDWDDOO¡LQWHUQRGLXQFDUWLJOLRUDIĂ&#x20AC;JXUD-â&#x20AC;? WRQHOODOXQHWWDVRYUDVWDQWHLOSRUWRQHSULQFLSDOHĂ&#x20AC;VVDO¡DQ-â&#x20AC;? QRGHOFRPSOHWDPHQWRGHOO¡DSSDUDWRGHFRUDWLYRQHO Sono state scelte due porzioni della decorazione a tempe-â&#x20AC;? UDGHOO¡LQWHUQR/DSULPDVH]LRQHPRVWUDSLJPHQWLURVVR EOXHHJLDOORĂ&#x20AC;JXUD>@/DIRWRQHOYLVLELOHULSRUWDLSXQWL VFHOWLSHUWHVWDUHLOVLVWHPD)2566LHUDQRWDWRGDOODIRWRLQ

20

)LJ6SHWWUL)256GHOSXQWRLQĂ&#x20AC;JXUD>@HUHODWLYLVWDQGDUGGL riferimento dello smalto applicato con diverse tecniche e in polvere.

/D Ă&#x20AC;JXUD >@ PRVWUD OR VSHWWUR GHO SXQWR  URVVR FRQ-â&#x20AC;? frontato con lâ&#x20AC;&#x2122;ocra rossa in polvere e applicato a fresco e a tempera. Si tratta inequivocabilmente di ocra rossa e come PRVWUDODĂ&#x20AC;JXUDJOLVSHWWULYHQJRQRVRORPRGHVWDPHQWHPR-â&#x20AC;? GLĂ&#x20AC;FDWL GDO OHJDQWH /¡LSRWHVL q FRQIHUPDWD GDOO¡LQGDJLQH multispettrale, infatti lâ&#x20AC;&#x2122;ocra rossa come gli altri pigmenti rossi assorbe lâ&#x20AC;&#x2122;ultravioletto e appare scura nella immagine GL XOWUDYLROHWWR ULĂ HVVR PD GLYHUVDPHQWH GDJOL DOWUL URVVL ULĂ HWWH PROWR PHQR O¡LQIUDURVVR PRVWUDQGRVL VFXUD QHOOD IRWRJUDĂ&#x20AC;DLQIUDURVVD /DĂ&#x20AC;JXUD>@PRVWUDORVSHWWURGHOSXQWRJLDOORDQDORJD-â&#x20AC;? mente confrontato con lo spettro dellâ&#x20AC;&#x2122;ocra gialla stesa con GLYHUVH WHFQLFKH$QFKH LQ TXHVWR FDVR O¡LGHQWLĂ&#x20AC;FD]LRQH q LQHTXLYRFDELOH HG q FRQIHUPDWD GDOOH LPPDJLQL PXOWLVSHW-â&#x20AC;? trali. Lâ&#x20AC;&#x2122;ocra gialla infatti ha un comportamento analogo allâ&#x20AC;&#x2122;ocra rossa.

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

21

8Q¡DOWUDDUHDqVWDWDDQDOL]]DWDĂ&#x20AC;JXUD>@SHULOVXRSLJ-â&#x20AC;? PHQWRYHUGH/RVSHWWUR)256LQGLFDXQSLJPHQWRYHUGHD EDVH GL UDPH FRPH OD PDODFKLWH R LO YHUGH UDPH Ă&#x20AC;JXUD [22]. Il caratteristico colore blu dellâ&#x20AC;&#x2122;infrarosso falso colore, suggerisce malachite [22].

)LJ6SHWWUL)256GHOSXQWRLQĂ&#x20AC;JXUD>@HUHODWLYLVWDQGDUGGLULIHUL-â&#x20AC;? mento dellâ&#x20AC;&#x2122;ocra rossa applicata con diverse tecniche e in polvere.

)LJ6SHWWUL)256GHOSXQWRLQĂ&#x20AC;JXUD>@HUHODWLYLVWDQGDUGGLULIHUL-â&#x20AC;? mento dellâ&#x20AC;&#x2122;ocra gialla applicata con diverse tecniche e in polvere.

)LJ)RWRJUDĂ&#x20AC;DPXOWLVSHWWUDOHGLXQDOWURSDUWLFRODUHGHOODGHFRUD]LRQH murale barocca della chiesa di Santa Maria degli Angeli in Assoro.

www.smart3k.it

Photogrammetry & Laser scanning Photo-realistic 3D modeling Monitoring and deformation analyses Multi-spectral analyses Hardware and Software development


BIBLIOGRAFIA >@0%DFFL9&DSSHOOLQLDQG5&DUODµ'LIIXVHUHÁHFWDQFHVSHFWURVFRS\ DQDSSOLFDWLRQWRWKHDQDO\VLVRIDUWZRUNVµ-3KRWRFKHP3KRWRELRO%  >@0%DFFL)%DOGLQL5&DUOj5/LQDUL´$FRORUDQDO\VLVRIWKH%UDQFDF-‐ FL&KDSHO)UHVFRHVµ$SSOLHG6SHFWURVFRS\   >@'DWDEDVH,)$&&15RQOLQHGLVSHWWUL)256GLSLJPHQWLVXGLYHUVHVWHVXUH pittoriche. http://fors.ifac.cnr.it >@0$FHWR$$JRVWLQR*)HQRJOLR03LFROOR´1RQLQYDVLYHGLIIHUHQ-‐ WLDWLRQEHWZHHQQDWXUDODQGV\QWKHWLFXOWUDPDULQHEOXHSLJPHQWVE\PHDQV RI²QP)256DQDO\VLVµ$QDO0HWKRGVSS >@7 &DYDOHUL$ *LRYDJQROL 0 1HUYR 3LJPHQWV DQG PL[WXUHV LGHQWLÀ-‐ FDWLRQE\9LVLEOH5HÁHFWDQFH6SHFWURVFRS\3URFHGLD&KHPLVWU\SS ² >@03LFROOR0%DFFL$&DVLQL)/RWWL63RUFLQDL%5DGLFDWL/6WH-‐ IDQL)LEHU2SWLFV5HÁHFWDQFH6SHFWURVFRS\DQRQGHVWUXFWLYHWHFKQLTXH IRU WKH DQDO\VLV RI ZRUNV RI DUW 2SWLFDO 6HQVRUV DQG 0LFURV\VWHPV 1HZ FRQFHSWV0DWHULDOV7HFKQRORJLHVHGLWHGE\0DUWHOOXFFLHWDO.OXZHU$FD-‐ demic / Plenum Publishers, New York, 2000 >@´6FLHQWLÀFH[DPLQDWLRQIRUWKHLQYHVWLJDWLRQRISDLQWLQJVµ$$99(GL-‐ WHGE\'3LQQD0*DOHRWWL50D]]HR >@*'HSXLV0(OLDV/6LPRQRW´3LJPHQW,GHQWLÀFDWLRQE\)LEHU2SWLFV 'LIIXVH5HÁHFWDQFH6SHFWURVFRS\µ$SSOLHG6SHFWURVFRS\YROQXPEHU 10, 2002. >@ ( &KHLODNRX 0 7URXOOLQRV 0 .RXL ,GHQWLÀFDWLRQ RI SLJPHQWV RQ %\]DQWLQHZDOOSDLQWLQJVIURP&UHWH WKFHQWXU\$' XVLQJQRQLQYDVLYH )LEHU2SWLFV'LIIXVH5HÁHFWDQFH6SHFWURVFRS\ )256 -RXUQDORI$UFKDHR-‐ ORJLFDO6FLHQFH   >@-.'HODQH\35LFFLDUGL/'HPLQJ*OLQVPDQ0)DFLQL07KRXU\ 053DOPHUDQG(5GHOD5LH8VHRI,PDJLQJ6SHFWURVFRS\)LEHU2SWLF 5HÁHFWDQFH6SHFWURVFRS\DQG;UD\)OXRUHVFHQFHWR0DSDQG,GHQWLI\3LJ-‐ PHQWVLQ,OOXPLQDWHG0DQXVFULSWV6WXGLHVLQ&RQVHUYDWLRQ'2, <  >@ 0 *XOPLQL$ ,GRQH ( 'LDQD ' *DVWDOGL ' 9DXGDQF 0$FHWR ,GHQWLÀFDWLRQRIG\HVWXIIVLQKLVWRULFDOWH[WLOHV6WURQJDQGZHDNSRLQWVRI DQRQLQYDVLYHDSSURDFK'\HVDQG3LJPHQWVSS >@&XFFL/%LJD]]L03LFROOR´)LEUH2SWLF5HÁHFWDQFH6SHFWURVFRS\DV DQRQLQYDVLYHWRROIRULQYHVWLJDWLQJSODVWLFVGHJUDGDWLRQLQFRQWHPSRUDU\ DUWFROOHFWLRQV$PHWKRGRORJLFDOVWXG\RQDQH[SDQGHGSRO\VW\UHQHDUW-‐ ZRUNµ-&XOW+HU   >@ 5 6 %HUQV - .UXHJHU 0 6ZLFNOLN ´0XOWLSOH 3LJPHQW 6HOHFWLRQ IRU ,QSDLQWLQJ8VLQJ9LVLEOH5HÁHFWDQFH6SHFWURSKRWRPHWU\µ6WXGLHVLQ&RQVHU-‐ YDWLRQ9RO1RSS >@$&RVHQWLQR´,SDGHWDEOHWSHUO·LQGDJLQHPXOWLVSHWWUDOHGLRSHUDG·DU-‐ WHµ$UFKHRPDWLFDSSKWWSZZZPHGLDJHRLWRMVLQGH[ SKSDUFKHRPDWLFDDUWLFOHYLHZ >@1.QLJKWRQ%%XJEHH$PL[WXUHRI%DULXP6XOIDWHDQG:KLWH3DLQW LVD/RZ&RVW6XEVWLWXWH5HÁHFWDQFH6WDQGDUGIRU6SHFWUDORQVWXG\8WDK 6WDWH8QLYHUVLW\FLWHGE\RWKHU >@,'6DQFKHV037XRK\0-+HGOH\05%UHWKHUWRQ/DUJHGX-‐ UDEOHDQGORZFRVWUHÁHFWDQFHVWDQGDUGIRUÀHOGUHPRWHVHQVLQJDSSOLFD-‐ WLRQV,QWHUQDWLRQDO-RXUQDORI5HPRWH6HQVLQJ9RO,VV >@*$FFRUVL*9HUUL0%RORJQHVL1$UPDUROL&&OHPHQWL&0LOLDQL $5RPDQL´7KHH[FHSWLRQDOQHDULQIUDUHGOXPLQHVFHQFHSURSHUWLHVRIFX-‐ SURULYDLWH (J\SWLDQEOXH µ&KHP&RPPXQ² >@51&ODUN´5HÁHFWDQFHVSHFWUDURFNSK\VLFVDQGSKDVHUHODWLRQV,Q +DQGERRNRI3K\VLFDO&RQVWDQWV3XEOLVKHGE\WKH$PHULFDQ*HRSK\VLFDO 8QLRQµSS >@$&RVHQWLQR´$SUDFWLFDOJXLGHWRSDQRUDPLFPXOWLVSHFWUDOLPDJLQJµH &RQVHUYDWLRQ0DJD]LQHSSKWWSZZZHFRQVHUYDWLRQOL-‐ ne.com/content/view/1100/ >@07KRXU\-.'HODQH\(5'HOD5LH03DOPHU.0RUDOHV- .UXHJHU ´1HDU,QIUDUHG /XPLQHVFHQFH RI &DGPLXP 3LJPHQWV ,Q 6LWX ,GHQWLÀFDWLRQDQG0DSSLQJLQ3DLQWLQJVµ$SSOLHG6SHFWURVFRS\9ROXPH 1XPEHU² >@&)%ULGJPDQDQG+/*LEVRQ,QIUDUHG/XPLQHVFHQFHLQWKH3KRWR-‐ JUDSKLF([DPLQDWLRQRI3DLQWLQJVDQG2WKHU$UW2EMHFWV6WXGLHVLQ&RQVHU-‐ YDWLRQ9RO1RSS >@ @ 7 0RRQ 0 5 6FKLOOLQJ 6 7KLU¤NHW¤WOH ´$ 1RWH RQ WKH 8VH RI )DOVH&RORU ,QIUDUHG 3KRWRJ¤UDSK\ LQ &RQ¤VHU¤YD¤WLRQµ 6WXG¤LHV LQ &RQ¤VHU¤YD¤WLRQ9RO1R )HE SS²

)LJ6SHWWUL)256GHOSXQWRGHOODDUHDLQÀJXUD>@HUHODWLYLVWDQGDUG di riferimento della malachite applicato con diverse tecniche e in polvere.

&21&/86,21, /D)256VLFDUDWWHUL]]DFRPHXQYDOLGLVVLPRVWUXPHQWRSHU O·LGHQWLÀFD]LRQHGHLSLJPHQWLLQDPELHQWLHVWHUQLDOODERUD-‐ torio, come i cantieri di restauro, grazie alla leggerezza e alle contenute dimensioni della sua strumentazione. Solo i GXHSLJPHQWLYHUGHGLFURPRHYHUGHFURPRLGUDWREHQHÀFH-‐ rebbero di un sistema più preciso nell’ultravioletto per otte-‐ QHUHXQRVSHWWURPHJOLRGHÀQLWRGHOORURSLFFRQHOO·XOWUDYLR-‐ letto. Per gli altri pigmenti l’ottima qualità dello spettro nel YLVLELOH DSSDUH VXIÀFLHQWH D ULFRQRVFHUH OH FDUDWWHULVWLFKH di molti pigmenti storici. Per quanto riguarda la sonda, si prevede di fare ulteriori test con diverse sfere integratrici. 4XHVWHVRQRSUHIHULWHDOOHVRQGHGLULÁHWWDQ]DFRVWLWXLWHGD GXH ÀEUH DFFRSSLDWH SHUFKp IRUQLVFRQR XQ GDWR GL ULÁHW-‐ tanza non dipendente dall’angolo di illuminazione. In par-‐ WLFRODUHVLYRUUjSURYDUHODVIHUDLQWHJUDWULFH,635()GHOOD 2FHDQ 2SWLFV FRQ ´JORVV WUDSµ XQD VH]LRQH LQWHUQD GHOOD VIHUDSRVL]LRQDWDLQFRUULVSRQGHQ]DGHOO·DQJRORGLULÁHVVLR-‐ QHGLUHWWD ƒYLVWRFKHO·LOOXPLQD]LRQHDYYLHQHDƒ FKH SXzHVVHUHUHVDQHUDSHUULPXRYHUHODFRPSRQHQWHULÁHVVD 5,1*5$=,$0(17, 6LULQJUD]LDO·DUFKLWHWWR5DIIDHOORGL0DXURFKHKDFXUDWRLO restauro di diversi monumenti della città di Assoro ed ha RUJDQL]]DWRO·LQGDJLQHDOODFKLHVD6DQWD0DULDGHJOL$QJHOL fornendo le informazioni storiche e tecniche sull’opera. Si ULQJUD]LDDQFKH0XJH8FNDQUHVWDXUDWULFHGL,VWDQEXOFKH durante il suo training sulle tecniche multispettrali pres-‐ VR LO ODERUDWRULR ´Cultural Heritage Science Open Sourceµ dell’autore ha partecipato all’esecuzione delle misure in Assoro. Si ringrazia GHT Photonics srl per il prestito del si-‐ VWHPD)256

ABSTRACT THIS PAPER SHOWS THE RESULTS OF THE TESTING OF A FORS (FIBER OPTICS REFLECTANCE SPECTRO-‐ SCOPY) SYSTEM ASSEMBLED WITH OCEAN OPTICS COMPONENTS AND FEATURING A USB4000 MINIATURIZED AND LOW COST SPECTROMETER. THE SMALL DIMENSIONS AND LITTLE WEIGHT OF THIS FORS SYSTEM MAKE IT ADAPT FOR THE SPECIFIC NEEDS OF ART EXAMINATION IN THE FIELD. 54 HISTORICAL PIGMENTS HAVE BEEN TESTED BOTH IN POWDER AND LAID WITH GUM ARABIC, EGG TEMPERA, LINSEED OIL AND FRESCO. THE FORS SYSTEM WAS ALSO TESTED ON A 1800S OIL PAINTING AND ON 1700S SICILIAN BAROQUE MURALS AND THE RESULTS COMPARED WITH MULTISPECTRAL IMAGING ANALYSIS.

PAROLE

CHIAVE

%(1,&8/785$/,)256,'(17,),&$=,21,',3,*0(17,

AUTORI ANTONINO CONSENTINO CONSERVATION SCIENTIST -‐ PRIVATE ART EXAMINATION PIAZZA CANTARELLA 12 ACI SANT'ANTONIO, 95025

AND

DOCUMENTATION SERVICE

antoninocose@gmail.com WWW.ANTONINOCOSENTINO.IT

BLOGGER

AT

"CULTURAL HERITAGE SCIENCE OPEN SOURCE"

CHSOPENSOURCE.ORG

22

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

23


MUSEI E FRUIZIONE

PARSJAD, IL PARCO ARCHEOLOGICO DELLâ&#x20AC;&#x2122;ALTO ADRIATICO: UN LUOGO DIFFUSO, UNITO DALLA TECNOLOGIA di Emilia Buniotto, Claudia Alecce

1DVFHFRVuLO3DUFR$UFKHRORJLFRGHOO¡$OWR$GULDWLFRSURJHWWRĂ&#x20AC;QDQ]LDWRGDO3URJUDPPDSHUOD&RRSHUD]LRQH Transfrontaliera Italia-â&#x20AC;?Slovenia 2007-â&#x20AC;?2013, con lâ&#x20AC;&#x2122;obiettivo di tracciare un percorso di conoscenza che parte dal litorale emiliano per arrivare a quello sloveno, in unâ&#x20AC;&#x2122;ottica unitaria e transfrontaliera.

FIG. 1 â&#x20AC;&#x201C; REALTĂ&#x20AC;

AUMENTATA.

I

OSURJHWWR3DUVMDGFRLQYROJHXQ¡DUHDYDVWLVVLPDVWRULFDPHQWHFDUDWWHUL]]DWDGDXQ¡LQWHQVDFRPXQLFD]LRQHFRP-â&#x20AC;? PHUFLDOH H FXOWXUDOH H VQRGR FUXFLDOH SHU OH UHOD]LRQL HFRQRPLFKH H VRFLDOL WUD 2FFLGHQWH H 2ULHQWH /R ID LQ modo nuovo, attraverso unâ&#x20AC;&#x2122;analisi e unâ&#x20AC;&#x2122;azione congiunta, che ha coinvolto e coinvolge vari enti (Regioni, Comuni, 8QLYHUVLWj0XVHL6RSULQWHQGHQ]H FRQFRPSHWHQ]HHFRPSLWLLVWLWX]LRQDOLGLYHUVLULXVFHQGRDRWWHQHUHLOULVXOWDWR straordinario di moltiplicare lâ&#x20AC;&#x2122;attrattivitĂ e la competitivitĂ  dei territori coinvolti. I numeri dellâ&#x20AC;&#x2122;operazione non fanno che validare la portata eccezionale del progetto. Lâ&#x20AC;&#x2122;ambizione progettuale e la VXD GLVWULEX]LRQH VSD]LDOH FRQ  FRPXQL FRLQYROWL WUD 9HQHWR (PLOLD 5RPDJQD )ULXOL 9HQH]LD *LXOLD H 6ORYHQLD hanno comportato una pluralitĂ  di interventi infrastrutturali, di azioni e strumenti formativi e informativi che si sono intersecati e integrati per trasformare un luogo diffuso in unâ&#x20AC;&#x2122;unica grande e avvolgente esperienza senza tempo.

24

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

9,6,21,',$17,&+(&,77­$'5,$7,&+( &21*/,2&&+,'(/35(6(17( Le radici del Progetto PArSJAd partono da lontano. Dal rap-â&#x20AC;? porto dellâ&#x20AC;&#x2122;uomo con lâ&#x20AC;&#x2122;acqua, che da sempre ha visto il sor-â&#x20AC;? gere di antiche civiltĂ lungo le coste dei mari e le rive dei Ă&#x20AC;XPL Anche le antiche cittĂ  dellâ&#x20AC;&#x2122;Alto Adriatico si svilupparono lungo i corsi dâ&#x20AC;&#x2122;acqua e il litorale, dando vita a importan-â&#x20AC;? ti centri abitati in posizioni strategiche e assumendo una QRWHYROHLPSRUWDQ]DSHULWUDIĂ&#x20AC;FLFRPPHUFLDOLHGLFRQVH-â&#x20AC;? guenza, per gli scambi culturali. Il Parco Archeologico dellâ&#x20AC;&#x2122;Alto Adriatico rimette insieme la memoria frammentata di un territorio ricco di eccellenze, riportando alla luce il suo straordinario patrimonio. Per riuscire nellâ&#x20AC;&#x2122;obiettivo e trasformare in risorsa la vastitĂ  dellâ&#x20AC;&#x2122;area interessata, il Progetto fa leva sulle conoscenze del passato, grazie alla collaborazione con la Soprinten-â&#x20AC;? denza per i Beni Archeologici del Veneto che ha messo a disposizione i risultati di pluriennali ricerche sul territorio, e sugli strumenti del presente: nuove tecnologie e nuovi mezzi di comunicazione che consentono di compiere una HIĂ&#x20AC;FDFH RSHUD GL SURPR]LRQH H GLYXOJD]LRQH GHO SDVVDWR trasferendolo virtualmente nel presente. /¡XWLOL]]RGHL1HZ0HGLDQHOODYDORUL]]D]LRQHGHOSDWULPRQLR storico e ambientale risulta di particolare interesse soprat-â&#x20AC;? tutto in considerazione degli importanti contributi che le nuove tecnologie possono offrire in termini di conoscenza e IUXL]LRQHGLGDWLOHJDWLDXQRVSHFLĂ&#x20AC;FRDPELHQWH Soprattutto qui, in presenza di un luogo diffuso, la tecnolo-â&#x20AC;? gia unisce, e fornisce al visitatore lâ&#x20AC;&#x2122;occasione di affrontare in modo diverso e innovativo lâ&#x20AC;&#x2122;esperienza della conoscenza, del viaggio, della visita turistica e dellâ&#x20AC;&#x2122;esplorazione di una ´QXRYDÂľFLWWjHGHOOHVXHULFFKH]]HDUFKLWHWWRQLFKHVWRUL-â&#x20AC;? che e culturali. Allâ&#x20AC;&#x2122;interno della grande operazione PArSJAd ha particola-â&#x20AC;? UHULOLHYRLQTXHVWRVHQVRLO3URJHWWR´3$U6-$G²9LVLRQLGL $QWLFKH FLWWj $GULDWLFKH LQ 9HQHWRÂľ VYLOXSSDWR GD ETT in collaborazione con Cultour Active. Qui le nuove tecnologie diventano veri e propri strumenti archeologici, permettendo di ricostruire virtualmente i resti e i reperti di antiche cittĂ , domus e basiliche paleocristiane H FRQWULEXHQGR DOWUHVu D GLIIRQGHUH OD FXOWXUD OD EHOOH]]D antica e a valorizzare il lavoro e lo studio dellâ&#x20AC;&#x2122;archeologo. Liberano le scoperte, le ricostruzioni e le visioni degli stu-â&#x20AC;? diosi dai libri e dagli archivi mettendoli in circolo e renden-â&#x20AC;? doli accessibili a tutti attraverso ambienti virtuali tridimen-â&#x20AC;? sionali e realtĂ  aumentata, per trasformarli in patrimonio della collettivitĂ . ,OSXEEOLFRSXzFRVuFRPSLHUHXQYHURHSURSULRYLDJJLRQHO tempo e immergersi virtualmente nei luoghi e nelle atmo-â&#x20AC;? sfere del passato. 0DLOOLQJXDJJLRGHL1HZ0HGLDQRQVLIHUPDDTXHVWR/¡H-â&#x20AC;? splorazione virtuale, tramite i dispositivi e le tecnologie di ultima generazione, innesca un dialogo continuo con il vi-â&#x20AC;? sitatore e chiama la sua partecipazione attiva ed emotiva. 2IIUHODSRVVLELOLWjGLSHUVRQDOL]]DUHODYLVLWDDSSURIRQGHQ-â&#x20AC;? do le schede e i contenuti che maggiormente suscitano il personale interesse e curiositĂ  rendendo lâ&#x20AC;&#x2122;esperienza piĂš completa e appagante. 67580(17,08/7,0(',$/,$/6(59,=,2'(//¡$5&+(2/2*,$ /D ULFHUFD LQ DPELWR WHFQLFR VFLHQWLĂ&#x20AC;FR SHU WURYDUH XQD VHPSUHSLHIĂ&#x20AC;FDFHVLQHUJLDWUDIUXL]LRQHGHLEHQLFXOWXUDOL e nuove tecnologie attraverso lâ&#x20AC;&#x2122;introduzione di innovativi metodi di comunicazione e di strumenti di ultima genera-â&#x20AC;? ]LRQHqXQDPELWRGLLQWHUYHQWRVXFXL(776S$FRQOD VXDGLYLVLRQH1HZ0HGLDLQYHVWHGDWHPSRULVRUVHHSURIHV-â&#x20AC;? sionalitĂ .

25 Nei diversi settori in cui opera ETT, che abbracciano Smart *RYHUQPHQWULFHUFDHLQQRYD]LRQHHQHZWHFKQRORJ\WXWWR qSHQVDWRHUHDOL]]DWRQHOVHJQRGHOO¡LQQRYD]LRQH ,OSURJHWWR´3$U6-$Gâ&#x20AC;&#x201C; Visioni di antiche cittĂ adriatiche in 9HQHWRÂľqHVSUHVVLRQHGL questa continua ricerca di innova-â&#x20AC;? ]LRQHLQDPELWR1HZ0HGLD In partnership con Cultour Active, ETT ha curato la realizza-â&#x20AC;? zione di un set organico di prodotti multimediali coordinati WUDORURIUXLELOLVLDGDXQD:HE$SSFKHGDXQ¡DSSOLFD]LRQH per dispositivi mobile. /D:HE$SSFRQVHQWHGLDSSURIRQGLUHHFRQRVFHUHLSULQFL-â&#x20AC;? pali aspetti del progetto PArSJAd attraverso unâ&#x20AC;&#x2122;applicazio-â&#x20AC;? ne basata sulla tecnologia responsiva, nella quale le pagine DGDWWDQRDXWRPDWLFDPHQWHLOOD\RXWLQIXQ]LRQHGHOGLVSRVL-â&#x20AC;? tivo nel quale vengono visualizzate. /D0RELOH$SSULSURSRQHOHLQIRUPD]LRQLSUHVHQWLQHOOD:HE App, ma costituisce soprattutto una guida pratica ed affa-â&#x20AC;? scinante per la visita dei siti, arricchita da ricostruzioni in $5 $XJPHQWHG5HDOLW\  '(1752,/352*(772'(1752/$7(&12/2*,$:(%$33

Fig. 2 â&#x20AC;&#x201C; WebApp, HomePage su PC.

Fig. 3 -â&#x20AC;? WebApp, HomePage su tablet e smartphone.

La pagina iniziale della Web App mette a disposizione de-â&#x20AC;? JOL XWHQWL WXWWH OH LQIRUPD]LRQL ULJXDUGR DO 0DFUR3URJHWWR PArSJAd e alle partnership coinvolte e illustra i contenuti GHOSURJHWWR´9LVLRQLGLDQWLFKH&LWWj$GULDWLFKHLQ9HQHWRÂľ Altino, Concordia Sagittaria, Adria e San Basilio di Ariano nel Polesine sono i quattro siti archeologici che, sia per lâ&#x20AC;&#x2122;impor-â&#x20AC;? tanza rivestita in tempi lontani nellâ&#x20AC;&#x2122;area costiera dellâ&#x20AC;&#x2122;Alto Adriatico sia per la bellezza dei reperti e degli elementi architettonici ritrovati, sono visitabili virtualmente nella SDUWHFHQWUDOHGHOOD:HE$SS$IDUFRPSLHUHTXHVWRYLDJJLR contribuiscono un Virtual Tour di sei elementi ricostruiti tra-â&#x20AC;? PLWHODWHFQLFDGLPRGHOOD]LRQH'PDWHULDOHPXOWLPHGLDOH e video documentaristico-â&#x20AC;?promozionali.


Fig. 6 â&#x20AC;&#x201C; MobileApp i siti.

Fig. 5 â&#x20AC;&#x201C; MobileApp HomePage.

Fig. 4 â&#x20AC;&#x201C; MobileApp SplashPage.

Le varie fasi di sviluppo delle applicazioni multimediali sono ULSURSRVWH QHOOD VH]LRQH GHGLFDWD DOOD ´5HDOL]]D]LRQHÂľ H UDF-â&#x20AC;? contate attraverso una serie di backstage che testimoniano e valorizzano non solo il lavoro dellâ&#x20AC;&#x2122;archeologo e dello storico, ma DQFKHTXHOORGHOOHĂ&#x20AC;JXUHSURIHVVLRQDOLVSHFLDOL]]DWHLQDPELWR 1HZ0HGLDFKHUHQGRQRO¡RSHUDDUFKHRORJLFDDFFHVVLELOHDXQ SXEEOLFRSLDPSLRHGLYHUVLĂ&#x20AC;FDWR 02%,/($33 Lâ&#x20AC;&#x2122;Applicazione per dispositivi mobile, realizzata per Smartphone H7DEOHWQHLVLVWHPLL26H$QGURLGFRVWLWXLVFHXQDJXLGDRUJD-â&#x20AC;? nica che permette allâ&#x20AC;&#x2122;utente di orientarsi con maggiore facilitĂ durante la visita nei siti interessati dal progetto e di approfon-â&#x20AC;? dirne i contenuti in maniera dinamica e personalizzata. La Mobile App propone la descrizione del progetto PArSJAd, del-â&#x20AC;? OHVXHĂ&#x20AC;QDOLWjHGHLSDUWQHUWUDQVIURQWDOLHULFKHYLKDQQRFROOD-â&#x20AC;? ERUDWRHFRQVHQWHDOWUHVuGLDFFHGHUHDOOHLQIRUPD]LRQLGHLVLWL archeologici di Altino, Concordia Sagittaria, Adria e San Basilio GL$ULDQR QHO 3ROHVLQH QRQFKp D GRFXPHQWL H DOWUR PDWHULDOH multimediale. 0D q DWWUDYHUVR OD 5HDOWj$XPHQWDWD FKH OD 0RELOH$SS RIIUH un ulteriore valore aggiunto, che ne fa una guida unica nel suo genere, suggestiva e affascinante.

Fig. 7 â&#x20AC;&#x201C; WebApp, Altino Banchina Virtual Tour.

5($/7­$80(17$7$ /D5HDOWj$XPHQWDWDqXQDWHFQRORJLDFKHDPSOLĂ&#x20AC;FDODSHUFH-â&#x20AC;? zione visiva delle immagini catturate da una videocamera, inte-â&#x20AC;? grata nello Smartphone o nel Tablet, facendo comparire oggetti tridimensionali, immagini e suoni, in tempo reale, sovrapposti alle immagini reali. In questo modo si crea una fusione tra mon-â&#x20AC;? GR UHDOH HG HOHPHQWL YLUWXDOL SHUPHWWHQGR FRVu DOO¡XWHQWH GL visualizzare informazioni aggiuntive e contenuti multimediali del punto di interesse, oppure esplorare ambienti virtuali e le ULFRVWUX]LRQL'GLDQWLFKHURYLQHHUHSHUWL Lâ&#x20AC;&#x2122;utilizzo di ricostruzioni in RealtĂ Aumentata che arricchiscono OD0RELOH$SSVRQREDVDWLVXOOHPRGHOOD]LRQL'GHLVLWLDUFKHROR-â&#x20AC;? JLFLSUHVHQWLDQFKHQHOOD:HE$SS Il visitatore, tramite il sistema GPS del proprio dispositivo mobile, che ne traccia la posizione in ogni momento, può visualizzare un percorso di visita del sito scelto e fruire dei contenuti di RealtĂ  $XPHQWDWDFKHLOOXVWUDQRSDUWLFRODULVLJQLĂ&#x20AC;FDWLYLGHOOXRJR 1HOSHUFRUVRGLHVSORUD]LRQHGHOOD´'RPXVGHOOD3DQWHUDÂľGL$O-â&#x20AC;? tino, ad esempio, il visitatore può esplorare i diversi ambienti, ammirare i mosaici digitalizzati ed essere proiettato nella vita quotidiana allâ&#x20AC;&#x2122;interno della villa al tempo dei Romani. Con la Re-â&#x20AC;? altĂ  Aumentata il visitatore va oltre la normale percezione senso-â&#x20AC;? riale arricchendo la propria visita di contenuti che fondono reale e virtuale in unâ&#x20AC;&#x2122;esperienza di visione immersiva e coinvolgente. 7UDVIRUPDQGROHQR]LRQLLQD]LRQLODVWRULDGLYHQWDFRVuXQJLRFR coinvolgente e appassionante davvero per tutti.

Fig. 8 -â&#x20AC;? WebApp Altino Banchina scheda.

02'(//$=,21('$/7,12 9(

Lâ&#x20AC;&#x2122;importanza strategica e storica dei quattro siti archeologici del territorio dellâ&#x20AC;&#x2122;Alto Adriatico viene valorizzata grazie alla ri-â&#x20AC;? FRVWUX]LRQH'GHJOLHOHPHQWLDUFKLWHWWRQLFLHGHJOLHGLĂ&#x20AC;FLPDJ-â&#x20AC;? JLRUPHQWHVLJQLĂ&#x20AC;FDWLYL

26

Fig. 11 -â&#x20AC;? MobileApp Altino Domus AR.

Fig. 10 -â&#x20AC;? MobileApp Altino Domus Mappa.

Fig. 9 -â&#x20AC;? WebApp Altino Decumano Virtual Tour.

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

Fig. 12 -â&#x20AC;? WebApp Altino Domus Virtual Tour.

Fig. 13 -â&#x20AC;? WebApp Altino Domus Virtual Tour Dettaglio.

27

Fig. 16 -â&#x20AC;? WebApp Concordia Sagittaria VirtualTour.

/DFLWWjGL,XOLD&RQFRUGLDIXIRQGDWDGDL5RPDQLQHOD& per la necessitĂ di dare una sistemazione ai veterani delle guerre creando contestualmente un baluardo difensivo sul FRQĂ&#x20AC;QH RULHQWDOH DOO¡LQFURFLR GL GXH VWUDGH LPSRUWDQWL OD Via Annia e la via Postumia. 6RORQHOVHFRORVFRUVRODFLWWjqVWDWDULEDWWH]]DWD6DJLWWD-â&#x20AC;? ria, a memoria di una antica fabbrica di sagittae (frecce) dâ&#x20AC;&#x2122;epoca romana. /DULFRVWUX]LRQH'qLQFHQWUDWDVXLPRQXPHQWLSDOHRFULVWLD-â&#x20AC;? QLGL&RQFRUGLDOD7ULFKRUD0DUW\ULXPOD%DVLOLFD$SRVWROR-â&#x20AC;? rum e gli ambienti funerari posti sul retro della basilica. Gli hot spot installati offrono contenuti multimediali di ap-â&#x20AC;? profondimento sui temi principali, dallâ&#x20AC;&#x2122;evoluzione degli edi-â&#x20AC;? Ă&#x20AC;FLQHOWHPSRDOO¡LQWHUSUHWD]LRQHLFRQRJUDĂ&#x20AC;FDGHLPRVDLFL

&21&25',$6$*,77$5,$ 9(

6HFRQGR DOFXQL VWRULFL q OD FLWWj FKH Gj LO QRPH DO 0DUH Adriatico. Allâ&#x20AC;&#x2122;inizio del VI secolo a.C. Adria era un semplice insedia-â&#x20AC;? mento etrusco posto sul 0LQFLR, che allâ&#x20AC;&#x2122;epoca sfociava nel mare. I greci vi fondarono un emporion, per gestire di-â&#x20AC;? rettamente lâ&#x20AC;&#x2122;importazione dellâ&#x20AC;&#x2122;ambra che rivendevano in WXWWRLO0HGLWHUUDQHR$GULDGLYHQQHFRVuIDPRVDGDGDUHLO suo nome prima al ramo del Po su cui sorgeva, poi al golfo tra la foce del Po e lâ&#x20AC;&#x2122;IstriaHLQĂ&#x20AC;QHDOO¡LQWHURPDUHĂ&#x20AC;QRDO Golfo Jonio. La ricostruzione tridimensionale di una casa, con annesso laboratorio artigianale di un fabbro, mostra la tipologia abitativa tipica della cultura etrusca adattata allâ&#x20AC;&#x2122;ambiente paludoso padano, caratterizzata dallâ&#x20AC;&#x2122;intelaiatura di legno e frasche rivestita di terra e accompagnata da opere di boni-â&#x20AC;? Ă&#x20AC;FDSHUVWDELOL]]DUHLOVXROR Gli hotspot posizionati offrono informazioni sui principali DUJRPHQWL GL LQWHUHVVH H VRWWROLQHDQR OD SDUWLFRODUH NRLQq culturale e artistica di Adria, dove convergevano viaggiatori e mercanti del mondo greco, fenicio, etrusco e italico.

Fig. 15 -â&#x20AC;? MobileApp Concordia Sagittaria Basilica AR.

$'5,$ 52

Fig. 14 â&#x20AC;&#x201C; MobileApp Concordia Sagittaria mappa.

Solo alcuni resti ne testimoniano lo splendore e lâ&#x20AC;&#x2122;importanza. Sviluppatasi inizialmente come insediamento Paleoveneto, Altino divenne un porto di notevole rilievo, tappa obbligata SHULWUDIĂ&#x20AC;FLPHUFDQWLOL1HO,,VHFRORD&YHQQHDVVRJJHWWDWD al potere di Roma, e la costruzione di importanti strade che la collegavano direttamente a Treviso e a 2GHU]R FRQWULEXu a trasformarla in un importante centro commerciale, nodo cruciale per le rotte tra il 0HGLWHUUDQHR e il Settentrione. Per testimoniare gli splendori di quellâ&#x20AC;&#x2122;epoca sono stati ri-â&#x20AC;? FRVWUXLWLWUDPLWHODWHFQLFDGLPRGHOOD]LRQH'OD'RPXV della Pantera, una parte del Decumano che attraversava il settore nord-â&#x20AC;?est dellâ&#x20AC;&#x2122;abitato romano e la banchina posta sul canale Siloncello. ,OPRGHOOR'GHOODYLOODFKHQHOODSDYLPHQWD]LRQHGHOO¡LQ-â&#x20AC;? JUHVVR SUHVHQWDYD XQ PRVDLFR UDIĂ&#x20AC;JXUDQWH XQD SDQWHUD nellâ&#x20AC;&#x2122;atto di abbeverarsi, consente lâ&#x20AC;&#x2122;esplorazione virtuale dei diversi ambienti, dei mosaici digitalizzati e, tramite ap-â&#x20AC;? positi hotspot, di accedere a informazioni, contenuti multi-â&#x20AC;? mediali e reperti digitalizzati riguardanti la vita quotidiana nella villa in epoca Romana.

Fig. 17 â&#x20AC;&#x201C; WebApp Adria Virtual Tour.


Le abitazioni di legno e argilla ospitavano mercanti ed artigiani di diverse origini. Nel II secolo a.C. i Romani fecero transitare qui unâ&#x20AC;&#x2122;importante via consolare, la Popillia, proveniente da Rimini e diretta verso Adria. La localitĂ divenne, tra lâ&#x20AC;&#x2122;altro, sede di una stazione di posta, la mansio Hadriani. La modellazione virtuale mette in evidenza i ritrovamenti archeologici di origine paleocristiana rinvenuti nella Tenuta )RU]HOORFRVWLWXLWLGDXQEDWWLVWHURRWWDJRQDOH DQQHVVRDXQD chiesa) e dallâ&#x20AC;&#x2122;area cimiteriale retrostante lâ&#x20AC;&#x2122;abside con tombe alla cappuccina. Il complesso rappresenta una delle piĂš importanti testimonian-â&#x20AC;? ze della diffusione del Cristianesimo tra IV e VI secolo nellâ&#x20AC;&#x2122;area GHOGHOWDGHO3ROXQJRXQDVLJQLĂ&#x20AC;FDWLYDGLUHWWULFHFKHFROOHJD-â&#x20AC;? va lâ&#x20AC;&#x2122;area con gli importanti centri di Ravenna e Aquileia. Gli hot spot posizionati permettono di accedere alla descri-â&#x20AC;? ]LRQHGHOEDWWLVWHURHGHOO¡DUHDFLPLWHULDOHQRQFKpDVSXQWLGL DSSURIRQGLPHQWRVXOVLJQLĂ&#x20AC;FDWRGHOODOLWXUJLDGHOEDWWHVLPRH sulla scelta di diverse aree di sepoltura in base alla gerarchia di appartenenza.

Fig. 18 â&#x20AC;&#x201C; WebApp San Basilio Virtual Tour esterno.

ABSTRACT Eight partners, coordinated by the Veneto Region, are working on an ambi-â&#x20AC;? tious project with an innovative approach and tools, and with the ability to conserve content and exploit the immense archaeological heritage of the area concerned. This was the birth of the Parco Archeologico dellâ&#x20AC;&#x2122;Alto Adriatico (Upper Adria-â&#x20AC;? tic Archaeological Park), a project funded by the Italy-â&#x20AC;?Slovenia 2007-â&#x20AC;?2013 Co-â&#x20AC;? RSHUDWLRQ3URJUDPPHZLWKWKHDLPRIWUDFLQJDXQLĂ&#x20AC;HGDQGFURVVERUGHUSDWK of knowledge running from the coast of Emilia to the one in Slovenia.

Fig. 19 â&#x20AC;&#x201C; WebApp San Basilio Virtual Tour interno.

6$1%$6,/,2',$5,$121(/32/(6,1( 52

Il materiale emerso dalle campagne di scavo dimostra lâ&#x20AC;&#x2122;im-â&#x20AC;? portanza archeologica della localitĂ in epoca antica. San Basilio era un grande villaggio frequentato da Etruschi, Gre-â&#x20AC;? ci e Veneti, che sorgeva presso il cosiddetto Po di Copparo e a ridosso delle dune costiere, in una posizione strategica di FRQWUROORGHLWUDIĂ&#x20AC;FLĂ XYLDOLHPDULWWLPL

28

PAROLE

CHIAVE

REALTĂ&#x20AC; AUMENTATA; APP; TECNOLOGIE MULTIMEDIALI; MODELLAZIONE 3D

AUTORI EMILIA BUNIOTTO -â&#x20AC;? EMILIA.BUNIOTTO@ETTSOLUTIONS.COM CLAUDIA ALECCE -â&#x20AC;? CLAUDIA.ALECCE@ETTSOLUTIONS.COM ETT S.P.A. ELECTRONIC TECHNOLOGY TEAM

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

8126*8$5'22/75(/$9(75,-â&#x20AC;? 1$,17(5$77,9$08/7,0(',$/( /D VĂ&#x20AC;GD LQ DPELWR PXVHDOH VL gioca sul terreno dellâ&#x20AC;&#x2122;innova-â&#x20AC;? zione. Nella ricerca di nuovi ap-â&#x20AC;? procci e di nuovi strumenti per agevolare la fruizione dei conte-â&#x20AC;? nuti e rendere attivo il ruolo del visitatore allâ&#x20AC;&#x2122;interno e fuori del museo. Lâ&#x20AC;&#x2122;impegno a ripensare nuove forme di divulgazione del patrimonio storico e artistico e a stimolare il coinvolgimento del pubblico per favorire una QXRYDDOIDEHWL]]D]LRQHFXOWXUDOHqDOFHQWURGHOO¡DWWLYLWjGL(77 1HZ0HGLD Dopo aver applicato lâ&#x20AC;&#x2122;innovazione al mercato del lavoro, del-â&#x20AC;? la formazione e dellâ&#x20AC;&#x2122;istruzione, ETT ha impiegato la propria esperienza nella ricerca e sviluppo e nellâ&#x20AC;&#x2122;informatizzazione dei servizi in ambito turistico-â&#x20AC;?museale, attraverso la realizzazione di allestimenti con elevata innovazione, multimedialitĂ e mul-â&#x20AC;? ticanalitĂ . Ricerca e innovazione sono le parole chiave su cui poggiano le VROX]LRQL(771HZ0HGLDLQXQSHUFRUVRGLULGHĂ&#x20AC;QL]LRQHGHOO¡L-â&#x20AC;? GHD VWHVVD GL DOOHVWLPHQWR PXVHDOH FKH WUDH EHQHĂ&#x20AC;FLR GDOOD continua evoluzione delle tecnologie multimediali e dai loro costi ormai contenuti, che permettono di progettare e imple-â&#x20AC;? mentare installazioni sempre piĂš innovative. /DWHFQRORJLDGLYLHQHFRVuJHQHUDWRUHGLGLDORJRHGLUHOD]LRQL guida allâ&#x20AC;&#x2122;esperienza e stimolo allâ&#x20AC;&#x2122;approfondimento, grazie a so-â&#x20AC;? luzioni che annullano le barriere tra museo e visitatore, consen-â&#x20AC;? tendo a questâ&#x20AC;&#x2122;ultimo di personalizzare la propria interazione in maniera attiva e coinvolgente. Eâ&#x20AC;&#x2122; da questa visione del futuro e dalla continua ricerca di nuove soluzioni che ETT ha progettato e realizzato interactive show-â&#x20AC;? case, la vetrina interattiva in grado di coniugare lâ&#x20AC;&#x2122;osservazione di un oggetto o reperto reale con la consultazione interattiva di contenuti multimediali di approfondimento. In forza della tec-â&#x20AC;? QRORJLDLQYLVLELOHGLFXLqIRUQLWRTXHVWDYHWULQDUDSSUHVHQWDXQ vero e proprio salto nel futuro dellâ&#x20AC;&#x2122;allestimento museale. Lâ&#x20AC;&#x2122;e-â&#x20AC;? splorazione prende spunto dallâ&#x20AC;&#x2122;oggetto o reperto che contiene, FKHODUHQGHLQWXWWRVLPLOHDXQDYHWULQDWUDGL]LRQDOH0DLOPR-â&#x20AC;? QLWRUWRXFKWUDVSDUHQWH7)7LQVWDOODWRDOO¡LQWHUQRGHOODYHWULQD HODSRVVLELOLWjGLLQWURGXUUHXQOHWWRUH1)&SHULOULFRQRVFLPHQWR GLRJJHWWLDSURQRDOYLVLWDWRUHLQĂ&#x20AC;QLWLRUL]]RQWLGLFRQRVFHQ]DH di divertimento. ,OSRWHQ]LDOHWHFQRORJLFRGLTXHVWRVWUXPHQWRqWDOHGDSHUPHW-â&#x20AC;? tere la programmazione della regia di un evento museale, con la gestione di suoni, luci e proiezioni, direttamente dalla vetrina stessa. &RVuTXHOODFKHDOSULPRLPSDWWRVHPEUDXQDVHPSOLFHWHFDGD museo per lâ&#x20AC;&#x2122;osservazione passiva di un oggetto reale, avvicinan-â&#x20AC;? dosi o con semplice tocco sul vetro può attivarsi e dialogare con il visitatore, proponendogli materiale multimediale, schede di DSSURIRQGLPHQWRLPPDJLQLYLGHRHFRQWHQXWL'(LOGLDORJR ULVXOWD DQFRUD SL HIĂ&#x20AC;FDFH JUD]LH DOOD SRVVLELOLWj GL SURSRUUH contenuti in modalitĂ  multilingua, per una installazione davvero inclusiva, capace di coinvolgere visitatori di tutte le etĂ  e da tutto il mondo. Per maggiori informazioni: ettsolutions.com

1829$9(56,21(',')=(3+<5 3(5*(1(5$5(02'(//,''$)272 ')ORZKDDQQXQFLDWRDOFXQLDJJLRUQDPHQWLGL')=HSK\UVRI-â&#x20AC;? WZDUHGHGLFDWRDOODJHQHUD]LRQHGLPRGHOOL'GDIRWRJUDĂ&#x20AC;H7UD i diversi miglioramenti un nuovo processo di multiview stereo ULVFULWWR LQ &8'$ H OD QXRYD JHQHUD]LRQH GL WH[WXUH PXOWLEDQG VRQROHIHDWXUHSLLQWHUHVVDQWLGHOODYHUVLRQH

29

AZIENDE E PRODOTTI Si suggerisce di aggiornare la SURSULD LQVWDOOD]LRQH GL ') =HSK\U SHUFKp TXHVWD YHUVLR-â&#x20AC;? ne porta anche molti migliora-â&#x20AC;? menti minori. Si ringrazia tutti i beta testers per il prezioso feedback fornito. ,O FKDQJHORJ FRPSOHWR q FRQ-â&#x20AC;? VXOWDELOHVXOWKUHDGGHGLFDWRVXOIRUXPGL')ORZ ,QROWUHqVWDWRUHFHQWHPHQWHSXEEOLFDWRODVH]LRQHWXWRULDOSHU DLXWDUH JOL XWHQWL DG LQL]LDUH D PXRYHUH L SULPL SDVVL FRQ ') =HSK\U ')=HSK\USXzHVVHUHXWLOL]]DWRSHUIRWRJUDĂ&#x20AC;HDFTXLVLWHSHUUL-â&#x20AC;? lievi ambientali, monitoraggi e beni culturali di diversa natura. ') =HSK\U SXz HVVHUH DSSOLFDWR SHU 8$9 H PDSSDWXUD DHUHD SHUODFUHD]LRQHGLRUWRIRWR0RGHOOD]LRQHDUFKLWHWWRQLFD&ORVH 5DQJH )RWRJUDPPHWULD H$UFKHRORJLD$QDOLVL 9HKLFOH$QDO\VLV &RPPHUFLR ,QQRYDWLYR H VROX]LRQL GL PDUNHWLQJ 0RGHOOD]LRQH 'SHUO¡LQGXVWULDGHOJLRFR5LFRVWUX]LRQHGHQWDOH '3URWHVL sanitarie e di ricostruzione del volto. La versione 1.010 molti miglioramenti nella generazione della QXYRODGHQVDGHOODVXSHUĂ&#x20AC;FLHHGHOOHWH[WXUHV&RQTXHVWDYHU-â&#x20AC;? sione, sono esposti tutti i parametri che possono ora essere im-â&#x20AC;? SRUWDWLWUDPLWHĂ&#x20AC;OH[PO XQWXWRULDOVDUjSXEEOLFDWRLQVHJXLWR  '=HSK\UqRUDGLVSRQLELOHDQFKHVX0(3$LO0HUFDWR(OHWWURQL-â&#x20AC;? co Pubblica Amministrazione. )RQWH')ORZ ZZZGĂ RZQHW

9(75,1( ,1129$7,9( $/ &2/266(2 3(5/$%,%/,27(&$,1),1,7$ 'DOPDU]RDORWWREUHLO&RORV-â&#x20AC;? VHR RVSLWD OD 0RVWUD ´/D %LEOLRWHFD ,QĂ&#x20AC;QLWD,OXRJKLGHOVDSHUHQHOPRQ-â&#x20AC;? GRDQWLFRÂľRUJDQL]]DWDGLFRQFHUWR dalla Soprintendenza Archeologica e dalla Soprintendenza Capitolina. Nata dai risultati di due recenti scavi archeologici, gli auditoria di $GULDQR D SLD]]D 0DGRQQD GL /RUH-â&#x20AC;? WR VFRSHUWL QHO  LQ RFFDVLRQH GHL ODYRUL SHU OD OLQHD & GHOOD 0H-â&#x20AC;? tropolitana) e il Tempio della Pace, LQYLDGHL)RUL,PSHULDOLO¡HVSRVL]LRQHGRFXPHQWDO¡HYROX]LRQH GHOOLEURHGHOODOHWWXUDQHOPRQGRJUHFRURPDQRFRVuFRPHL luoghi pubblici e privati destinati alla custodia e allo scambio del sapere. I monumentali ambulacri del Colosseo si rivestono di armaria, le antiche scaffalature, e di immagini degli spazi de-â&#x20AC;? GLFDWLDOODFXOWXUDLQXQLQHGLWRDOOHVWLPHQWRVFHQRJUDĂ&#x20AC;FRFKHVL snoda attraverso statue, affreschi, rilievi, strumenti e supporti di scrittura. Per la mostra, la societĂ Goppion ha realizzato una vetrina de-â&#x20AC;? stinata a contenere un libro in prestito dalla Biblioteca Naziona-â&#x20AC;? le di Napoli. Si tratta di una vetrina speciale che appartiene alla nuovissima classe C Goppion (vetrine a clima attivo per esterni), FRPSRVWDGDXQEDVDPHQWRQHOTXDOHqDOORJJLDWRLOYDQRWHFQLFR e da una vetro camera. Le elevatissime condizioni di tenuta ga-â&#x20AC;? UDQWLVFRQRLOPDQWHQLPHQWRGHOPLFURFOLPDLGHDOH Â&#x192;85  8QRVFKHUPR/&'LQVHULWRQHOYDQRWHFQLFRFRQVHQWHLO PRQLWRUDJJLRFRVWDQWHGHLYDORUL,OGHVLJQqVREULRHGHOHJDQ-â&#x20AC;? WHLSURĂ&#x20AC;OLHLOSLDQRHVSRVLWLYRDSLUDPLGHVRQRUHDOL]]DWLLQ DFFLDLRLQR[VDEELDWRLOVXSSRUWRSHULOYROXPHqLQSOH[LJODV &RPHLQWXWWHOHYHWULQH*RSSLRQqFHUWLĂ&#x20AC;FDWRO¡LPSLHJRHVFOXVL-â&#x20AC;? vo di materiali a bassa emissione. )RQWH*RSSLRQ ZZZJRSSLRQFRP


AZIENDE E PRODOTTI 1829( 7(&12/2*,( 3(5 /$ 3527(=,21('(//$&$6$1$7$-â&#x20AC;? /(',5$))$(//2',85%,12 Dopo la protezione degli ora-â&#x20AC;? tori di San Giovanni e di San *LXVHSSH OD )RQGD]LRQH (Q]R +UXE\ LQWHUYLHQH QXRYDPHQWH D8UELQRTXHVWD YROWDSHUVR-â&#x20AC;? stenere gli oneri di un avanza-â&#x20AC;? to sistema di videosorveglianza per la casa natale del celebre Raffaello Sanzio. 1HOO¡HGLĂ&#x20AC;FLRFRVWUXLWRDJOLLQL]LGHO;9VHFRORHDFTXLVWDWRQHO GDOSDGUH*LRYDQQL6DQWL5DIIDHOORYLGHODOXFHLOPDU]R  H YLVVH L SULPL DQQL GHOOD IRUPD]LRQH DUWLVWLFD 'RSR YDUL SDVVDJJLQHOODVHFRQGDPHWjGHOO¡2WWRFHQWRODFDVDYHQQHDF-â&#x20AC;? quisita dallâ&#x20AC;&#x2122;Accademia Raffaello che ne fece la propria sede e ODDUULFFKuQHOWHPSRGLQXPHURVHRSHUHG¡DUWH2JJLqXQDFDVD museo, una delle tante disseminate in Italia che conservano e tramandano la memoria dei grandi personaggi che le hanno abi-â&#x20AC;? tate. Allâ&#x20AC;&#x2122;interno di Casa Raffaello sono esposti dipinti, sculture, ceramiche, arredi lignei, alcuni dei quali strettamente connessi DOO¡DUWLVWD7UDTXHVWLO¡DIIUHVFRGHOOD0DGRQQDFRO%DPELQRUH-â&#x20AC;? alizzato da Raffaello negli anni giovanili, oltre a vari manoscrit-â&#x20AC;? ti, edizioni rare, monete e ritratti ottocenteschi che celebrano il genio del grande urbinate. La realizzazione del progetto di videosorveglianza di Casa Raffa-â&#x20AC;? HOORqVWDWDDIĂ&#x20AC;GDWDDOODVRFLHWj8PEUD&RQWUROGL3HUXJLD$PL-â&#x20AC;? FDGHOOD)RQGD]LRQH(Q]R+UXE\FKHKDDPSOLDWRLOVLVWHPDGL videosorveglianza giĂ esistente con lo scopo di ottenere una to-â&#x20AC;? WDOHFRSHUWXUDGHOO¡HGLĂ&#x20AC;FLRLQVWDOODQGRWHOHFDPHUH'D\ 1LJKW antivandalo ad alta risoluzione che permettono la visibilitĂ  an-â&#x20AC;? che di notte passando dalla modalitĂ  a colori a quella in bianco HQHUR4XDWWURVLWURYDQRQHOOHVDOHDOO¡LQWHUQRGHOO¡HGLĂ&#x20AC;FLROD TXLQWDqFROORFDWDLQYHFHDOO¡HVWHUQRDSURWH]LRQHGHOFKLRVWUR ´&RQ TXHVWR SURJHWWR OD QRVWUD )RQGD]LRQH LQDXJXUD O¡DWWLYLWj GHO²GLFKLDUD&DUOR+UXE\9LFH3UHVLGHQWHGHOOD)RQGD]LR-â&#x20AC;?

QH (Q]R +UXE\  LQWHUYHQHQGR QXRYDPHQWH QHOOD PHUDYLJOLRVD FLWWjGL8UELQRVLPERORGHO5LQDVFLPHQWRLWDOLDQRH3DWULPRQLR 0RQGLDOHGHOO¡8PDQLWj81(6&2/DSURWH]LRQHGL&DVD5DIIDHOOR consente di raggiungere un importante risultato in termini di sicurezza e di valorizzazione di un monumento di grande rile-â&#x20AC;? YDQ]DHGqO¡RFFDVLRQHSHUSURVHJXLUHORVSOHQGLGRUDSSRUWRGL FROODERUD]LRQHFRQO¡$PPLQLVWUD]LRQH&RPXQDOHGL8UELQRHFRQ la Soprintendenza per i Beni Storici, Artistici ed Etnoantropolo-â&#x20AC;? JLFL GHOOH 0DUFKH DYYLDWR LQ RFFDVLRQH GHOOD SURWH]LRQH GHJOL oratori di San Giovanni Battista e di San Giuseppe. Questo nuovo SURJHWWR FL VWD SDUWLFRODUPHQWH D FXRUH DQFKH SHUFKp UDSSUH-â&#x20AC;? VHQWD LO SURVHJXLPHQWR GHOO¡DWWLYLWj GHOOD )RQGD]LRQH D IDYRUH GHO SDWULPRQLR FRVLGGHWWR ´PLQRUHÂľ FKH FRPH DEELDPR ULSH-â&#x20AC;? tuto piĂš volte in questi primi sei anni di attivitĂ , costituisce la SLJUDQGHULFFKH]]DGHOORVWUDRUGLQDULR3DHVHLQFXLYLYLDPRÂľ )RQWHFondazione Hruby (www.fondazionehruby.org)

62)7:$5(/(,263(5/$6&$16,21(' ED IL RIVERSE ENGINEERING /HLRVqXQDVROX]LRQHYHORFHDIĂ&#x20AC;GDELOHHGLVHPSOLFHXWLOL]]R SHUHODERUD]LRQHGLVFDQVLRQL'HGLWLQJGLPHVKUHYHUVHHQJL-â&#x20AC;? neering. La nuova versione, Leios 2, rappresenta una svolta, JUD]LHDOODQXRYDLQWHUIDFFLDHDOODULRUJDQL]]D]LRQHGHOĂ XVVR di lavoro, il tutto sotto il segno della maggio-â&#x20AC;? re libertĂ per lâ&#x20AC;&#x2122;utente. &RQ/HLRVqSRVVLELOHDF-â&#x20AC;? quisire dati da qualsiasi WLSRORJLD GL VFDQQHU ' trasformare la nuvola di punti in un modello ma-â&#x20AC;? WHPDWLFR185%6LQPRGR semplice ed intuitivo,

Sai cosa câ&#x20AC;&#x2122;è sotto?

Una scansione con il georadar ti permette di verificare la presenza e la profonditĂ di reperti, cavitĂ , oggetti interrati... Il georadar per archeologia

Photo: Le MatĂŠriel de Sondage

Il nuovo georadar GSSI UtilityScan DF bit ha una rivoluzionaria antenna digitale a 300 e 800 MHz: rilievi precisi e affidabili contemporaneamente in superficie e profonditĂ .

30 30

(La profondità è legata alle condizioni del terreno).

Codevintec Italiana Via Labus 13 - Milano tel. +39 02 4830.2175 info@codevintec.it www.codevintec.it

CODEVINTEC Tecnologie per le Scienze della Terra

800 MHz: alta risoluzione nel primo metro 300 MHz: profonditĂ di indagine, fino a 5 metri molto produttivo, fino a 15 km/h interfaccia grafica sempre piĂš intuitiva ricerca di sottoservizi ricerca ordigni inesplosi, fusti interrati e cavitĂ  survey geologici, glaciologici, stratigrafici e idrogeologici > indagini archeologiche e forensi > > > > > > >

ArcheomaticA N° 1 marzo 2014 ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali Tecnologie per i Beni Culturali

31 31

con il costante controllo di ogni processo e analizzare i risultati con potenti strumenti di ispezione. Lâ&#x20AC;&#x2122;utente ha a disposizione performanti tools di calcolo e editing per agevolare la trasformazione delle nuvole di punti originali a meshes manifold e per approssimare le mesh con modelli mate-â&#x20AC;? matici CAD. Leios esporta i dati in vari formati, sia poligonali che CAD, adatti a svariati campi dâ&#x20AC;&#x2122;applicazione. /HLRV  q RWWLPL]]DWR SHU OH XOWLPH WHFQRORJLH DOO¡DYDQJXDUGLD RIIHUWHGDOPHUFDWR)DXVRHVWHVRGLWXWWDODPHPRULDHOD&38 disponibile nalla postazione di lavoro, valorizzazione lâ&#x20AC;&#x2122;investi-â&#x20AC;? mento in termini di risparmio di tempo per lâ&#x20AC;&#x2122;elaborazione dati. /¡XVRGHL:L]DUGQHOOHLQWHUIDFFHULGXFHVHQVLELOPHQWHLOWLPHWR market dei prodotti elaborati tramite Leios, offrendo le piĂš co-â&#x20AC;? muni funzioni a portata di click: preparare le mesh per la proto-â&#x20AC;? WLSD]LRQHDUFKLYLDUHHPRGLĂ&#x20AC;FDUHOHLPPDJLQL&$'LQSRFKLSDVVL La forte ottimizzazione dellâ&#x20AC;&#x2122;hardware permette allâ&#x20AC;&#x2122;utente di ot-â&#x20AC;? tenere le migliori performance dal sistema a sua disposizione, SHURWWHQHUHULVXOWDWLLOSLUDSLGDPHQWHSRVVLELOH8Q¡LQWHUIDFFLD utente intelligente e accessibile lascia maggior tempo a disposi-â&#x20AC;? zione per occuparsi del lavoro invece che dedicare lungo tempo DOOR VWXGLR GHL PDQXDOL GHO VRIWZDUH /HLRV  q VYLOXSSDWR SHU garantire risultati in maniera rapida e accurata. /¡LQWHJUD]LRQHGLUHWWDIUDLPLJOLRULVFDQQHU'VXOPHUFDWRHJOL strumenti dedicati permettono una rapida ottimizzazione di nu-â&#x20AC;? YROH GL SXQWL H GL PHVK HG XQ SLHQR VXSSRUWR SHU OH WH[WXUH HG enormi set di dati grezzi. Le procedure one-â&#x20AC;?click ottimizzano le nuvole di punti e mesh per lâ&#x20AC;&#x2122;elaborazione CAD ed esportano le VXSHUĂ&#x20AC;FLLQ,*(6H67(3FRQO¡LQWHJUD]LRQHGLUHWWDFRQODPDJJLRU parte delle soluzioni CAD presenti sul mercato. LA nuova funzione 'VNHWF FRQVHQWH OD PRGLĂ&#x20AC;FD GLUHWWD GL VH]LRQH LQ DUFKL OLQHH FXUYH185%6SHUFUHDUHSURĂ&#x20AC;OLSUHFLVL

60$5728581¡$333(5/$ 35202=,21( '(/ 785,602 &8/785$/(',6$/(512 /¡$VVRFLD]LRQH 1R 3URĂ&#x20AC;W 60$57285 q XQ¡HQWLWj FR-â&#x20AC;? VWLWXLWD GD  JLRYDQL LQJH-â&#x20AC;? gneri, esperti nella comuni-â&#x20AC;? cazione ed informatici un-â&#x20AC;? GHUFRQHVSHULHQ]DQHO-â&#x20AC;? la valorizzazione e gestione dei contenuti commerciali e culturali attraverso lâ&#x20AC;&#x2122;im-â&#x20AC;? piego dellâ&#x20AC;&#x2122;Information and Communications Technologies. Si tratta di un progetto completamente incentrato su Salerno, cit-â&#x20AC;? tĂ dalle enormi potenzialitĂ  turistiche e una comunitĂ  fortemente UDGLFDWDVXOWHUULWRULR60$57285FRQVHGHD6DOHUQRKDORVFRSR di realizzare marketing territoriale interattivo, social ed interope-â&#x20AC;? rabile, coniugando lâ&#x20AC;&#x2122;aspetto conoscitivo delle zone turistiche con quello promozionale delle attivitĂ  produttive, attraverso il coinvol-â&#x20AC;? JLPHQWRGHOOHFRPPXQLW\FKHIUXLVFRQRGHOOHLQL]LDWLYHWXULVWLFKH /¡LQL]LDWLYDqĂ&#x20AC;QDQ]LDWDGDO0,85 0LQLVWHURGHOO¡,VWUX]LRQHGHOO¡8-â&#x20AC;? QLYHUVLWD¡ H GHOOD 5LFHUFD  SHU UHDOL]]DUH XQD ´3LDWWDIRUPD SHU OD promozione del turismo culturale attraverso lâ&#x20AC;&#x2122;impiego di tecnolo-â&#x20AC;? JLHLQQRYDWLYHÂľ 60$57285UHDOL]]HUjSHUFLzSHUODFLWWjGL6DOHUQRXQD$SSWXULVWLFD interattiva e gratuita. Cittadini, passanti e turisti potranno incontrarsi con gli attori della Ă&#x20AC;OLHUDWXULVWLFDLQXQDPELHQWHYLUWXDOHVRFLDOLQIRUPDQGRVLHFRP-â&#x20AC;? mentando sui luoghi ed eventi della cittĂ , progettando tour in base alle proprie preferenze e accendendo a offerte commerciali.

)RQWHEGSolutions (www.egsolutions.com)

Sito web: www.smartour.it

TOUCHWINDOW

Sistemi e Tecnologie Interattive per Musei e Beni Culturali

www.touchwindow.it


SCHEDA TECNICA

TOUCHWINDOW SOLUZIONI E SISTEMI IMMERSIVI PER I BENI CULTURALI. SISTEMI E TECNOLOGIE PER CREARE SPAZI DINAMICI, PER COINVOLGERE, APPROFONDIRE ED EMOZIONARE. DI

TOUCHWINDOW

Touchwindow pone le tecnologie visive e tattili al servizio dell'arte e della cultura, offrendo consulenze, soluzioni e allestimenti interattivi in musei ed esposizioni. Le applicazioni e i prodotti Multi-â&#x20AC;?Touch di Touchwindow sono soluzioni tecnologiche fra le piĂš avanzate per creare prodotti unici, installazioni coinvolgenti ed esperienze visive indimenticabili.

I

grandi sistemi immersivi si inseriscono in una nuova rela-â&#x20AC;? zione tra il visitatore, gli spazi espositivi e le opere esposte. Coinvolgono lo spettatore in uno stato emotivo attraverso una percezione piĂš profonda. Le grandi proiezioni seamless e le soluzioni tecnologiche si integrano con le architetture e gli allestimenti di musei, mo-â&#x20AC;? stre ed esposizioni per creare XQD XVHU H[SHULHQFH QXRYD HG HPR]LRQDQWH,OYLVLWDWRUHqFRVu sollecitato e aiutato ad assume-â&#x20AC;? UHXQGLYHUVRUXRORQHOTXDOHq coinvolto non piĂš e non solo con la vista, ma con tutti i sensi. Ă&#x2C6; in questa dimensione che si inseriscono le soluzioni di Tou-â&#x20AC;? chwindow, l'azienda di Cervia da vent'anni ricerca e propone progetti che rivoluzionano la consueta fruizione delle opere e coinvolgono l'emotivitĂ del vi-â&#x20AC;? sitatore. ÂŤGli allestimenti inte-â&#x20AC;? rattivi creano un dialogo con gli utenti arricchendo l'esperienza del visitatore di realtĂ  virtuali. -â&#x20AC;? spiega Andrea Bianchi, titolare di Touchwindow -â&#x20AC;? Spazi e opere si trasformano in quinte sce-â&#x20AC;? QRJUDĂ&#x20AC;FKH JUD]LH D SURLH]LRQL

LPPHUVLYH VX JUDQGL VXSHUĂ&#x20AC;FL Supporti e tecnologie interatti-â&#x20AC;? ve sono gli strumenti per appro-â&#x20AC;? fondire la visita e la conoscenza e creano un avvolgente cano-â&#x20AC;? vaccio narrativo che coinvolge sonoritĂ e sensazioni, amplia la dimensione informativa dei luo-â&#x20AC;? ghi e degli oggetti raggiungen-â&#x20AC;? do la dimensione esperenziale e rendendo unica la visita per ogni utenteÂť. 8QSURJHWWRUHFHQWHVYLOXSSDWR HUHDOL]]DWRGD7RXFKZLQGRZq O HVSRVL]LRQH D 3DOD]]R 0DULQR 0LODQRGHOFDSRODYRURGL5DIID-â&#x20AC;? HOOROD0DGRQQDGL)ROLJQRGRYH qVWDWRDOOHVWLWRXQVLVWHPDLP-â&#x20AC;? mersivo di grande impatto. La JUDQGH SURLH]LRQH q SLORWDWD attraverso un leggio interattivo corredato da un ricco catalogo LFRQRJUDĂ&#x20AC;FRFLzSHUPHWWHDOOR storico dell'arte che accompa-â&#x20AC;? gna i visitatori di approfondire dettagli e particolari. La visione GHOO¡2SHUD VL q WUDVIRUPDWD LQ XQYLDJJLR´GLHWURO LPPDJLQHÂľ ´GHQWURO¡LPPDJLQHÂľ8Q¡HVSH-â&#x20AC;? rienza unica e irripetibile. I sistemi immersivi possono rivo-â&#x20AC;? luzionare l'offerta culturale di un museo o di una esposizione.

AUTORI TOUCHWINDOW S.R.L. VIA DELLâ&#x20AC;&#x2122;INDUSTRIA, 13 INT. 1 ZONA INDUSTRIALE MONTALETTO 48015 CERVIA (RA) WWW.TOUCHWINDOW.IT

ABSTRACT SINCE 1994

TOUCHWINDOW

produzione di hardware, col-â&#x20AC;? labora con imprese leader del settore e universitĂ nella ricer-â&#x20AC;? ca e nello sviluppo di prodotti e soluzioni innovativi, ha Clienti in diversi settori tra cui muse-â&#x20AC;? ale, retail, bancario, teleco-â&#x20AC;? municazioni e amministrazioni pubbliche. ŠĂ&#x2039; GDO  FKH 7RXFKZLQGRZ pone le tecnologie visive e tat-â&#x20AC;? tili al servizio dell'arte e della cultura, offrendo consulenze, soluzioni e allestimenti inte-â&#x20AC;? rattivi in musei ed esposizio-â&#x20AC;? ni. -â&#x20AC;? continua Andrea Bianchi -â&#x20AC;? Creiamo contenuti e software interattivi in grado di catturare lâ&#x20AC;&#x2122;attenzione dei visitatori e con-â&#x20AC;? durli lungo un percorso visivo e di apprendimentoÂť. Le applica-â&#x20AC;? ]LRQL H L SURGRWWL 0XOWL7RXFK di Touchwindow sono soluzioni originali, modulari e customiz-â&#x20AC;? zabili, uniscono la competenza nel settore hardware e softwa-â&#x20AC;? re con le soluzioni tecnologiche piĂš avanzate per creare pro-â&#x20AC;? dotti unici, installazioni coin-â&#x20AC;? volgenti ed esperienze visive indimenticabili.

WORKS WITH DIFFERENT VISUAL AND TACTI-â&#x20AC;?

LE TECHNOLOGIES IN CULTURAL HERITAGE, OFFERING ADVICE, SOLUTIONS AND INTERACTIVE INSTALLATIONS IN MUSEUMS AND EXHIBITIONS. PRODUCTS

MULTI-â&#x20AC;?TOUCH TOUCHWINDOW

APPLICATIONS

AND

ARE AMONG THE MOST ADVANCED

TECHNOLOGICAL SOLUTIONS TO CREATE UNIQUE PRODUCTS, INVOLVING INSTALLA-â&#x20AC;? TIONS AND MEMORABLE VISUAL EXPERIENCE.

PAROLE CHIAVE TECNOLOGIE IMMERSIVE; MUSEI; ALLESTIMENTI INTERATTIVI

32

THE

Le peculiaritĂ degli spazi di in-â&#x20AC;? tervento e la disponibilitĂ  degli strumenti tecnologici si combi-â&#x20AC;? nano in soluzioni che valorizza-â&#x20AC;? QRVXSHUĂ&#x20AC;FLGLSURLH]LRQLDUFKL-â&#x20AC;? tetture e geometrie complesse. ÂŤNoi vediamo i musei e le espo-â&#x20AC;? sizioni come spazi dinamici, dove le soluzioni interattive e i sistemi tecnologici coinvolgono i visitatori consentendo loro di esplorare, conoscere e appro-â&#x20AC;? fondire -â&#x20AC;? dice Andrea Bianchi -â&#x20AC;? Tecnologie e tools sviluppati ad-â&#x20AC;?hoc consentono di proiet-â&#x20AC;? tare contenuti multimediali VX TXDOVLDVL WLSR GL VXSHUĂ&#x20AC;FLH permettono di dialogare con le geometrie architettoniche in modo da sfruttare sistemi com-â&#x20AC;? plessi di multi-â&#x20AC;?proiezione per risultati eccezionali. Pareti cur-â&#x20AC;? ve e articolate diventano sce-â&#x20AC;? QRJUDĂ&#x20AC;D GRYH LPPDJLQL VXRQL e video diventano un racconto coinvolgente. Attraverso un'at-â&#x20AC;? tenta progettazione e simula-â&#x20AC;? zione del sistema prospettico viene studiata la soluzione di proiezione ottimale per realiz-â&#x20AC;? zazioni uniche e spettacolariÂť. 7RXFKZLQGRZ q SDUWQHU GHOOH piĂš importanti aziende per la

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

33

SCHEDA TECNICA

UNOCAD, TECNOLOGIE PER Lâ&#x20AC;&#x2122;ARTE IN SICUREZZA DI

UNOCAD

I gusci protettivi di Unocad ad avanzata tecnologia per il trasporto in alta sicurezza delle opere d'arte sono il risultato di una costante ricerca di soluzioni tecnologhe DOO DYDQJXDUGLDSHUOHSLGLYHUVLĂ&#x20AC;FDWHHVLJHQ]HGHOOD conservazione del patrimonio artistico.

P

er un'opera d'arte mettersi in YLDJJLRqVHPSUHVWDWDFRQVL-â&#x20AC;? derata un'impresa a rischio. Ca-â&#x20AC;? polavori di inestimabile valore che vengono richiesti in prestito per esposizioni temporanee nei vari musei e sono sottoposti alle sollecitazioni di trasferte impe-â&#x20AC;? JQDWLYH2SHUHFKHGHYRQRJLXQ-â&#x20AC;? gere a destinazione e ritornare a casa perfettamente integre: e il rientro di una scultura dopo cen-â&#x20AC;? tinaia o migliaia di chilometri di spostamenti di andata e ritorno rappresenta tradizionalmente uno dei momenti critici per i re-â&#x20AC;? sponsabili dei musei, chiamati a controllarne nei minimi dettagli le condizioni di salute. Grazie alla tecnologia ad altis-â&#x20AC;? sima protezione messa a punto GD8QRFDGSHULOWUDVSRUWRGHOOH RSHUHG DUWHLOSUREOHPDqRJJL superato. Si tratta di un sistema perfet-â&#x20AC;? tamente adattabile a qualsiasi tipologia di bene culturale in tre dimensioni, anche la piĂš de-â&#x20AC;? licata, e di qualsiasi grandezza e materiale, basato sull'analisi strutturale di gusci protettivi in EPS (Polistirene Espanso Sinte-â&#x20AC;? rizzato), particolarmente adatti per l'imballaggio di strutture fra-â&#x20AC;? JLOLHĂ&#x20AC;QDOL]]DWRDOWUDVSRUWRLQ alta sicurezza delle sculture in gesso, in marmo e in altri ma-â&#x20AC;? teriali. 8QDPHWRGRORJLDGLDVVROXWDSHU-â&#x20AC;? formance per l'integritĂ dell'og-â&#x20AC;? getto trasportato, in virtĂš della TXDOH q SRVVLELOH HIIHWWXDUH OR spostamento di opere anche quelle considerate inamovibili. /D WHFQRORJLD q EDVDWD VXOOD VFDQVLRQH LQ ' GHOO¡RSHUD FRQ avanzate strumentazioni non invasive che consentono di ac-â&#x20AC;? quisire il modello matematico DG DOWD GHĂ&#x20AC;QL]LRQH GHOO RSHUD d'arte. Il dato acquisito, che ri-â&#x20AC;?

Art division 36077 Altavilla Vicentina (VI) - Via Vicenza, 232

mane di proprietĂ del museo o GHOVXRFRQVHUYDWRUHqODĂ&#x20AC;UPD digitale dell'opera: ne stabilisce con esattezza il peso in rapporto al materiale e consente di indivi-â&#x20AC;? duare i baricentri della scultura funzionali al suo spostamento. Con questa tecnica si elabora quindi il guscio protettivo dell'o-â&#x20AC;? pera, collocato a sua volta all'in-â&#x20AC;? terno di una apposita cassa di contenimento. 6XOOD EDVH GHO PRGHOOR ' YLH-â&#x20AC;? ne realizzata una controforma negativa in EPS, che viene ot-â&#x20AC;? tenuta per sottrazione tramite fresatura ad alta precisione con macchina utensile CNC e all'in-â&#x20AC;? terno della quale sarĂ  alloggiata la scultura, perfettamente com-â&#x20AC;? baciante in positivo. L'operazione viene eseguita in modo tale da distribuire il peso sulle parti piĂš resistenti dell'in-â&#x20AC;? volucro, sia nella collocazione dell'opera che nel trasporto. Assieme ai responsabili del mu-â&#x20AC;? seo vengono inoltre individuati i punti piĂš fragili e soggetti a maggiore sollecitazione, prima di adagiare l'opera sulla prote-â&#x20AC;? zione in EPS. La distribuzione del peso all'in-â&#x20AC;? terno del guscio viene quindi JHVWLWR GD VRĂ&#x20AC;VWLFDWL VRIWZDUH testati con prodotti di anali-â&#x20AC;? VL VWUXWWXUDOH VSHFLĂ&#x20AC;FL SHU OH strutture interne dei caschi per moto. Grazie a questa tecnologia i parametri di alta sicurezza non vengono applicati solo ai mate-â&#x20AC;? riali di protezione dellâ&#x20AC;&#x2122;involucro ma sono estesi anche alla cassa di contenimento, con particola-â&#x20AC;? ri accorgimenti all'interno della cassa in modo da porre il guscio dell'opera in una condizione di galleggiamento. /DVWUXWWXUDGHOODFDVVDqLQIDWWL solidale a una seconda struttura

AUTORE UNOCAD SRL VIA VICENZA 232 36077 ALTAVILLA VICENTINA (VI) www.unocad.it info@unocad.it

Fig. 1 -â&#x20AC;? Involucro protettivo realizzato per il San Giovannino di Ă&#x161;beda attribuito a Michelangelo, proveniente dalla Chiesa di San Salvador di Ubeda (Spagna) e recentemente restaurato GDOO¡2SLĂ&#x20AC;FLRGHOOH3LHWUH'XUHGL)LUHQ]H

interna ancorata a speciali mol-â&#x20AC;? le anti-â&#x20AC;?vibrazione la cui tecnolo-â&#x20AC;? JLDqVWDWDVYLOXSSDWDSHULWUD-â&#x20AC;? sporti in alta sicurezza in campo aeronautico e militare, e le cui dimensioni dipendono dal peso, dal materiale e dal baricentro dell'opera. In questo modo la scultura, giĂ protetta all'interno del suo guscio su misura, regge ulte-â&#x20AC;? riormente alle pressioni e alle tensioni esterne del trasporto: la cassa di contenimento non trasmette sollecitazioni o vi-â&#x20AC;? brazioni in grado di danneggiar-â&#x20AC;? OD SHUFKp TXDQGR OH SUHVVLRQL esterne superano determinati valori il materiale collassa limitando la sollecitazione mas-â&#x20AC;? sima trasmissibile. ,JXVFLSURWHWWLYLGL8QRFDGSHULO trasporto in alta sicurezza delle ABSTRACT THE PROTECTIVE SHELLS OF UNO-â&#x20AC;? CAD ADVANCED TECHNOLOGY FOR HIGH-â&#x20AC;?SECURITY TRANSPORT OF WORKS OF ART ARE THE RESULT OF A CONSTANT SEARCH FOR TECHNOLOGICAL SOLU-â&#x20AC;? TIONS TO THE DIVERSE NEEDS OF THE CONSERVATION OF ARTISTIC HERITAGE.

opere d'arte sono il risultato di una costante ricerca di soluzioni tecnologiche all'avanguardia per OHSLGLYHUVLĂ&#x20AC;FDWHHVLJHQ]HGHO-â&#x20AC;? la conservazione del patrimonio artistico. Tra i capolavori che hanno già ´YLDJJLDWRÂľDOO LQWHUQRGHLQRVWUL involucri a massima protezione VSLFFDQRLO´*LRYDQHGL0R]LDÂľ la celebre statua greca in mar-â&#x20AC;? PRFRQVHUYDWDDO0XVHR:KLWD-â&#x20AC;? NHUGL0R]LDLO&ULVWRLQOHJQRGL 'RQDWHOOR H LO ´6DQ *LRYDQQLQR GLĂ&#x201D;EHGDÂľDWWULEXLWRD0LFKHODQ-â&#x20AC;? gelo, oltre al bozzetto originale LQWHUUDFRWWDGHOOH´7UH*UD]LHÂľ di Antonio Canova. Tecnologie innovative e di com-â&#x20AC;? SURYDWD HIĂ&#x20AC;FDFLD SHU LO EHQH dell'arte universale: preservarla qODQRVWUDSDVVLRQHHODQRVWUD missione.

PAROLE CHIAVE PATRIMONIO ARTISTICO; SCANSIONE 3D; SICUREZZA; TRASPORTO


GUEST PAPER

A SYSTEMATIC

APPROACH TO

BRONZE

CORROSION PRODUCTS

AND THE METHODS OF TREATMENT, APPLIED ON THREE BRONZE ANKLETS FROM

DHAMAR

MUSEUM,

YEMEN.

by Mohamed M. Megahed

Three bronze anklets, found during the archaeological excavation of Yemeni mission 2002 A.D., in Gabal al-â&#x20AC;? lawd, Jawf area, Yemen and, dated back to Minaean period in Yemen (sixth century B.C. â&#x20AC;&#x201C; 24 B.C.),are now in Dhamar regional museum. They suffered deterioration: two of these anklets had a thick corrosion products of pale-â&#x20AC;? green/brown, the third had a rust-â&#x20AC;?colored Black and Brown with the presence of small parts and scattered pale green.

N

umerous studies on ancient and historical bronzes have tried to establish the chemical characteristics and structure of natural patinas grown on artifacts H[SRVHGIRUORQJSHULRGVRIWLPHWRVRLODWPRVSKHUHZDWHU or sea water. The long-â&#x20AC;?term corrosion of bronzes is accom-â&#x20AC;? SDQLHG E\ VWUXFWXUDO WUDQVIRUPDWLRQV OHDGLQJ WR D VWHDG\ state. Different surface patterns have then been observed, depending on the corrosive environment (chemical compo-â&#x20AC;? VLWLRQ3+UHVLVWLYLW\HWF EXWDOVRRQRWKHUQRQQHJOLJLEOH parameters such as historical periods, metallurgical tech-â&#x20AC;? niques or even kind and size of the artifacts [1]. $QDO\WLFDO LQYHVWLJDWLRQV UHYHDOHGWKDW WKHPDLQFRUURGLQJ DJHQWLVUHSUHVHQWHGE\FKORULQHFRQWDLQLQJVSHFLHVWKDWLQ-â&#x20AC;? GXFHWKHIRUPDWLRQRIGDQJHURXVFRSSHUFKORULGHVDQGR[\ chlorides at the interface between the metal surface and WKHRXWHUPRVWFRUURVLRQSURGXFWVOD\HUVYLDDFRQWLQXRXVO\ RFFXUULQJUHDFWLRQ)RUPDQ\DUFKDHRORJLFDOREMHFWVWKHUH-â&#x20AC;? active cuprous chloride (Cu Cl) species is considered as the principal agent of the so-â&#x20AC;?called bronze disease, i.e. the pro-â&#x20AC;? cess of interaction of chloride containing species within the EURQ]H SDWLQD ZLWKPRLVWXUHDQGDLUDFFRPSDQLHGE\FRU-â&#x20AC;? URVLRQRIWKHFRSSHUDOOR\LWVHOI7KHFXSURXVFKORULGHF\FOL-â&#x20AC;? FDOO\UHDFWVZLWK2[\JHQDQGDWPRVSKHULFZDWHU KXPLGLW\  WKXVJLYLQJULVHWRWKHIRUPDWLRQRI$WDFDPLWH&X 2+ &O DQG LWV SRO\PRUSKV 7KHVH R[\FKORULGH FRPSRXQGV UHDFW with copper to form cuprous chloride and water, and in this ZD\ &X &O 2 DQG +2 DUH FRQYHUWHG LQ FXSULWH &X2  DQG$WDFDPLWH &X 2+ &O  LQ D F\FOLFDO DQG FRQWLQXRXV SURFHVV7KHĂ&#x20AC;QDOSURGXFWVRIWKHUHDFWLRQDUHOLJKWJUHHQ SRZGHU\YROXPLQRXVEDVLFFKORULGHVRIFRSSHUZKLFKGLV-â&#x20AC;? UXSWWKHVXUIDFHDQGPD\GLVĂ&#x20AC;JXUHWKHDUWLIDFWV7KHQDWXUH DQGFRPSRVLWLRQRIWKHVRLODWWKHH[FDYDWLRQVLWHLVRIJUHDW importance for the degradation of the archaeological arti-â&#x20AC;? IDFWVEXWLQWKHFDVHRIPHWDOEURQ]HREMHFWVKXPLGLW\DQG FKORULGHVDUHWKHNH\IDFWRUV>@ 2UJDQLQWKH>@SURSRVHGPDQ\HTXDWLRQVIRUWKHVHUH-â&#x20AC;? DFWLRQVEXWLWLVQRZJHQHUDOO\UHFRJQL]HGWKDWWKHVHHTXD-â&#x20AC;? WLRQVDUHWRRVLPSOLVWLF7KH\VXJJHVWHGWKDWWKHSULQFLSDO PHFKDQLVPLVWKHSURGXFWLRQRIFXSURXVR[LGH &XSULWH E\ K\GURO\VLVRIFXSURXVFKORULGH

%XW0DFOHRG>@KDGSRLQWHGRXWWKDWWKH¨*RIUHDF-â&#x20AC;? WLRQ IRU HTXDWLRQ LV  NFDO PROHĂŽ VKRZLQJ WKDW WKH UHDFWLRQ ZLOO QRW SURFHHG VSRQWDQHRXVO\ EHFDXVH RI WKH SRVLWLYH YDOXH RI ¨* ,Q VWDQGDUG FRQGLWLRQV WKH SRVLWLYH VLJQRIWKH¨*RIUHDFWLRQIRUWKHK\GURO\VLVRI1DQWRNLWH means that the reaction cannot proceed as such without an DGGLWLRQDO WKHUPRG\QDPLF GULYLQJ IRUFH ,Q DGGLWLRQ 1DQ-â&#x20AC;? WRNLWHKDVDVROXELOLW\RIDERXWJSHUPORIZDWHU DWURRPWHPSHUDWXUHDQGWKLVORZVROXELOLW\OLPLWVWKHH[-â&#x20AC;? WHQWWRZKLFKK\GURO\VLVUHDFWLRQVPD\RFFXU,WLVSRVVLEOH WR SURYLGH D WKHUPRG\QDPLF WKUXVW WR WKH ULJKW KDQG VLGH RI 2UJDQ¡V HTXDWLRQ LI WKH SRVLWLYH ¨* FDQ EH RYHUULGGHQ E\ RWKHU IDFWRUV 2QH RI WKH IDFWRUV WKDW PXVW EH FRQVLG-â&#x20AC;? HUHGLVWKHSUHVHQFHRIDOOR\LQJHOHPHQWVWLQLQEURQ]HRU zinc in brass. There are, of course, electrochemical and NLQHWLF IDFWRUV WR EH FRQVLGHUHG KHUH 1RW RQO\ WKHUH DUH subtle electrochemical factors to be considered concerning the difference in potential between tin-â&#x20AC;?rich phases and the copper-â&#x20AC;?rich alpha phase in bronzes, but there are a vari-â&#x20AC;? HW\RIEXULDOFRQGLWLRQVWREHFRQVLGHUHG>@7KHIRUPDWLRQ RIWKHVHSDWLQDVLQEXULDOLVDVFULEHGWRR[\JHQDQGFDUERQ GLR[LGHFDUULHGE\JURXQGZDWHUV7KHVDOWVSUHVHQWLQVRLO VROXWLRQVFDQLQĂ XHQFHWKHIRUPDWLRQRIWKHSDWLQDDQGWKH nature of the corrosion, but on the whole are of minor im-â&#x20AC;? portance. The dissolution of copper and other divalent ions LVVROHO\GXHWRWKHIUHHFDUERQGLR[LGHLQWKHZDWHUDQGWKH progress of this dissolution is dependent on the concentra-â&#x20AC;? WLRQ RI FDUERQ GLR[LGH LQ VROXWLRQ ,I WKLV FRQFHQWUDWLRQ LV KLJK DVIRUH[DPSOH LQ KXPXV RUSRURXVVDQG\ VRLOVWKHQ WKH SDWLQD LV IRUPHG UDSLGO\ DQG WKH FRQWLQXLQJ GLVVROX-â&#x20AC;? WLRQRIFRSSHUUHVXOWVLQDQHQGSURGXFWRISXUHWLQR[LGH ZKHUHDVLQRWKHUVRLOVVXFKDVFOD\EURQ]HVRIWKHVDPHDJH PD\EHFRYHUHGRQO\E\DWKLQSDWLQD

34

2CuCl + H2O = 2HCl + Cu2O 7KHK\GURFKORULFDFLGJHQHUDWHGE\WKLVUHDFWLRQZLOOWKHQ produce more cuprous chloride: 2HCl + 2Cu = 2CuCl + H2

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

,QKXPXVULFKVDQG\VRLOV with low lime content, there is no inhibiting ef-â&#x20AC;? fect on the decomposi-â&#x20AC;? tion of the patina to cre-â&#x20AC;? DWH D WLQ R[LGH VXUIDFH while in lime containing soils, where the soil so-â&#x20AC;? OXWLRQV PD\ FRQWDLQ FDO-â&#x20AC;? cium bicarbonate, this decomposition is inhib-â&#x20AC;? LWHG>@ The purpose of the pre-â&#x20AC;? VHQWSDSHULVWRVWDUWĂ&#x20AC;OO-â&#x20AC;? ing the lacks diagnosed DERYH )LUVW E\ SURSRV-â&#x20AC;? ing a suitable methodol-â&#x20AC;? Fig. 1 -â&#x20AC;? shows the location of Gabal-â&#x20AC;? RJ\IRUWKHVXUIDFHVWXG\ al lawd , Al-â&#x20AC;?Gowf area ,Yemen. (After: of archaeological metals, 5RELQ&%UHWRQ-)>@  WKHQ E\ IRFXVLQJ RQ EL-â&#x20AC;? QDU\&X6QDOOR\VWRJHWDGHHSHULQVLJKWLQWRWKHSK\VLFDO and chemical characteristics of bronze patinas. This was DFKLHYHG WKURXJK D V\VWHPDWLF VWXG\ IRU WKUHH EURQ]H DQ-â&#x20AC;? NOHWVGDWLQJEDFNWRWKH0LQDHDQSHULRG VL[WKFHQWXU\%&WR %& DQGIRXQGGXULQJDUFKDHRORJLFDOH[FDYDWLRQLQ $'LQ*DEDODOODZG$O*RZIDUHD Ă&#x20AC;J  0$7(5,$/6$1'0(7+2'6'(6&5,37,21$1'&21',7,21 The dimensions of the three anklets are similar in size and VFDOH WKH GLDPHWHU RI HDFK DQNOHW LV DERXW  FP7KH\ suffered from the deterioration. The two others klets had DKHDY\FUXVWRISDOHJUHHQFRUURVLRQSURGXFWVLQFRUSRUDWLQJ VRLOSDUWLFOHVGLVĂ&#x20AC;JXULQJWKHPDQGOHIWWKHPXJO\ Ă&#x20AC;J 

35

Fig. 3 -â&#x20AC;? ME for a sample from the anklet A shows the Uniform corrosion (50X).

Fig. 4 -â&#x20AC;? ME for a sample from the anklet B shows the Grieve corrosion (150X). Fig. 5 -â&#x20AC;? ME for a sample from the anklet C, suffers from pitting cor-â&#x20AC;? rosion (50x).

6&$11,1*(/(&75210,&526&23,&(;$0,1$7,21 6(0

6(0H[DPLQDWLRQRIWKHDQNOHWVVKRZHGWKHLUGHWHULRUDWHG VSRWVZKLFKGLVSHUVHGRQWKHPHWDODVLWLVVKRZQLQ Ă&#x20AC;JV   7KLV FRQĂ&#x20AC;UPHG WKH UHVXOWV REWDLQHG E\ PHWDOOR-â&#x20AC;? JUDSKLFH[DPLQDWLRQ

A

B

C

)LJVKRZVWKHĂ&#x20AC;UVWVLGHRIWKHDQNOHWVEHIRUHWUHDWPHQW

(;$0,1$7,21$1'$1$/<6,6 7KH WKUHH DQNOHWV ZHUH H[DPLQHG E\ PHWDOORJUDSKLF DQG VFDQQLQJHOHFWURQ0LFURVFRSH&RUURVLRQSURGXFWVZHUHDQD-â&#x20AC;? O\]HG E\ ;UD\ GLIIUDFWLRQ PHWKRG ;5'  DQG WKH PHWDOOLF SRUWLRQE\;5) 0(7$//2*5$3+,&(;$0,1$7,21 0(  ([DPLQDWLRQ RI WKH WKUHH DQNOHWV VKRZV WKH HORQJDWLRQ RI the metallic grains in the direction of hammering. this is in addition to the appearance of deteriorated spots dispersed RQWKHPHWDOVXUIDFHDVLWLVVKRZQLQ Ă&#x20AC;JV 

Fig. 6 -â&#x20AC;? shows SEM examination for a sample from the an-â&#x20AC;? klet A, suffers from pitting corrosion and distorted surface (200X ). Fig. 7 -â&#x20AC;? shows SEM ex-â&#x20AC;? amination for a sam-â&#x20AC;? ple from the anklet B, suffers from micro cracks & Grieve corrosion (1500X).


Fig. 11 -â&#x20AC;? Shows XRD scan for the corrosion products of the anklet C. Fig. 8 -â&#x20AC;? Shows SEM examination for a sample from the anklet C, suffers from pitting corrosion and distorted surface (500X).

;5$<',))5$&7,21$1$/<6,6 ;5'

Three small samples were taken from the corrosion prod-â&#x20AC;? XFWVPL[HGZLWKWKHVRLOUHVLGXHVFRYHULQJWKHDQNOHWVDQG DQDO\]HG E\ XVLQJ D 3KLOLSV ;UD\ 'LIIUDFWRPHWHU ZLWK &X .Ĺ&#x17E;UDGLDWLRQ7KHĂ&#x20AC;UVWVDPSOHZDVWDNHQIURPWKHUHGGLVK EURZQOD\HUWKDWFRYHUHGWKHDQNOHWQR$WKHVHFRQGVDP-â&#x20AC;? ple was taken from the pale greenish crust that covering WKHDQNOHWQR%DQGWKHWKLUGVDPSOHZDVH[WUDFWHGE\WKH pale greenish crust that covered the surface of the anklet &7KHREWDLQHGGLIIUDFWLRQVFDQVDUHUHSRUWHGLQ Ă&#x20AC;JXUHV QR DQGWKHLGHQWLĂ&#x20AC;HGFRPSRXQGVLQWDEOH ;UD\GLIIUDFWLRQSDWWHUQVRIWKHFRUURVLRQSURGXFWVRIWKH DQNOHWVLQGLFDWHWKDWWKH\FRQVLVWHVVHQWLDOO\RI$WDFDPLWH Cu 2+ &O3DUDWDFDPLWH&X 2+ &ODQGFXSULWH&X2

Tab. 1 -â&#x20AC;? Shows XRD analysis results of corrosion products of the anklets.

;5$<)/825(6&(1&($1$/<6,6 ;5)  ;5D\)OXRUHVFHQFHLVDQRQGHVWUXFWLYHSRZHUIXODQGHDV\ WRXVH WHFKQLTXH IRU WKH HOHPHQWDO DQDO\VLV RI D ZLGH YD-â&#x20AC;? ULHW\ RI PDWHULDOV 7KUHH VPDOO VDPSOHV IURP WKH DQNOHWV ZHUHDQDO\]HGH[SORLWLQJWKLVWHFKQLTXHWRGHWHUPLQHWKHLU FRPSRVLWLRQ E\ XVLQJ D 1,721;/ 86$  GULYHQ ZLWK VRIWZDUH YHUVLRQ ( 7KH UHVXOWV VXJJHVW D EURQ]H DOOR\ with a high a mounts of Tin and traces from Lead, Iron and =LQFDVUHSRUWHGWDEOH

Tab. 2 -â&#x20AC;? Shows XRF analysis results of the anklets.

75($70(17$1'&216(59$7,21 The use of chemical treatments for the anklets is more ac-â&#x20AC;? ceptable than the mechanical cleaning, as these anklets KDG D WKLFN DQG FUXVW OD\HUV EHFDXVH WKH ORQJ SHULRG RI buried in the soil and the strong interaction between the VXUURXQGLQJ HQYLURQPHQW DQG WKH REMHFWV ,W ZLOO EH GLIĂ&#x20AC;-â&#x20AC;? FXOWWRUHPRYHWKHFRQFUHWLRQOD\HUVDQGWKHKDUGFUXVWVE\ PHFKDQLFDOWRROVZLWKRXWGDPDJLQJWKHVXUIDFHE\WKHSUHV-â&#x20AC;? VXUHH[HUWHGGXULQJPHFKDQLFDOFOHDQLQJ,QDGGLWLRQDSUH-â&#x20AC;? OLPLQDU\ H[DPLQDWLRQ SURYHG WKDW WKH DQNOHWV GLGQ¡W KDYH DQ\Ă&#x20AC;JXUHVRULQVFULSWLRQVRQWKHLUVXUIDFH6RWKHFKHPLFDO WUHDWPHQWZDVFKRVHQDVVLVWHGE\VNLOOHGPHFKDQLFDOFOHDQ-â&#x20AC;? ing to remove the loose corrosion products. A serial of tests were carried out to determine which chemical compounds ZRXOGEHHIIHFWLYHZLWKRXWGDPDJHWKHREMHFWVWKHOHDVWE\ YDU\LQJWKHFRQFHQWUDWLRQDQGWLPHRIFRQWDFWLWZDVIRXQG the following chemical compounds are the least damaging and fastest acting solutions.

Fig. 9 -â&#x20AC;? Shows XRD scan for the corrosion products of the anklet A.

Fig. 10 -â&#x20AC;? Shows XRD scan for the corrosion products of the anklet B.

36

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

37

The treatment procedures included the following steps: 6RDNLQJWKHDQNOHWVLQVROXWLRQRIVRGLXPKH[DPHW-â&#x20AC;? aphosphate to convert the insoluble calcium carbonate in the encrustation to soluble salt which can be subse-â&#x20AC;? TXHQWO\ZDVKHGDZD\7KLVZDVGRQHZLWKUHJXODUFKHFNV and removing loosened particles with silk brush. This SURFHGXUHZDVIROORZHGE\UHSHDWHGO\EDWKVRIGHLRQL]HG water with heating from time to time in order to loosen WKHFRQFUHWLRQDQGKDUGOD\HUVRIWKHFRUURVLRQSURGXFWV This step resulted in dissolving and removing soil granules and the soluble corrosion products, and left the anklets KDYHDKDUGFUXVWRIYHU\DGKHUHQWFRUURVLRQFRPSRXQGV The three anklets were soaked in alkaline Rochelle so-â&#x20AC;? OXWLRQ WKDW ZDV FKDQJHG PDQ\ WLPHV DVVLVWHG E\ JHQWOH mechanical cleaning with silk brush from time to time to GLVVROYLQJ WKH FRUURVLRQ OD\HUV RI FRSSHU >,,@ FRPSRXQGV .this step succeeded in removing green copper corrosion SURGXFWVDQGOHIWDUHGEURZQOD\HUFRYHULQJWKHDQNOHWV surfaces.

B

A

C

)LJ6KRZVWKHWKUHHDQNOHWV WKHĂ&#x20AC;UVWVLGH DIWHUWUHDWPHQW

7RGLVVROYHDQGUHPRYHWKHR[LGHOD\HU>&XSULWH@VROX-â&#x20AC;? WLRQRIVXOSKXULFDFLGZDVXVHGDVVLVWHGE\DEUXVKWRUH-â&#x20AC;? PRYHWKHORRVHGOD\HUWKLVZDVGRQHZLWKUHJXODUFKHFNV DQGUHPRYLQJORRVHQHGOD\HUWKHVHSURFHGXUHVVXFFHHGHG in removing all the corrosion products. After that the anklets were soaked in water and washed E\DWRRWKEUXVKWRGLVORGJHUHVLGXHIURPFUHYLFHV

A

B

C

Repeated washing in hot deionized water altering heating DQGFRROLQJWRHQVXUHĂ XVKLQJFDSLOODULHVWRUHPRYHDQ\ chemical residues. 'U\LQJLQUHSHDWHGEDWKHVRIHWKHUIROORZHGE\GU\LQJLQ KRWVDZGXVWDQGPRSSHGGU\ZLWKVRIWFOHDQFORWK )LQDOO\WKHDQNOHWVZHUHLVRODWHGZLWKSDUDORLG%GLV-â&#x20AC;? VROYHGWROXHQHDQGWKH\ZHUHKDQGHGWR'KDPDUPX-â&#x20AC;? VHXP VHHĂ&#x20AC;JXUHV  5(68/76$1'',6&866,21 It is worth noting that the selected Cu-â&#x20AC;?based archaeologi-â&#x20AC;? FDOREMHFWVKDYHEHHQSURGXFHGE\XVLQJWKHPDLQPDQX-â&#x20AC;? IDFWXULQJWHFKQLTXHVHPSOR\HGLQDQFLHQWWLPHWRSURGXFH EURQ]H DUWLIDFWV 7KH VWXG\ GHFODUHG WKDW WKH DQFLHQW Yemeni manufacturer used both of casting and hammer-â&#x20AC;? ing technique to manufacture the three anklets. ;5'DQDO\VLVRIWKHFRUURVLRQSURGXFWVKDYHVKRZQWKH presence of Copper and Tin species such as cassiterite [ 6Q2@FXSULWH>&X2@WHQRULWH>&X2@QDQWRNLWH>&X&O@ DWDFDPLWH>&X 2+ &O@DQGSDUDWDFDPLWH>&X 2+ &O@ The latter compounds are basic copper chloride and are YHU\GDQJHURXVDVFRUURVLRQSURGXFWV>@7KHVDQG\VRLO ZKHUH WKH WKUHH DQNOHWV ZHUH H[FDYDWHG SOD\HG DQ LP-â&#x20AC;? portant role in their severe corrosion. This soil is a porous one changed from sub saturation to saturation with water, KDGGLIIHUHQWVDOWLRQVVSHFLDOO\WKHGDQJHURXVFKORULQH ion [10,11]. This circulation of saline water in the soil had DVHULRXVHIIHFWRQWKHREMHFWVZKLFKOHGWRWKHIRUPD-â&#x20AC;? WLRQRIWKHEURQ]HGLVHDVHFKORULGHFRPSRQHQWV>@ 7KHH[LVWLQJRIEURQ]HGLVHDVHZKLFKLVDGDQJHURXVF\-â&#x20AC;? FOLFFRSSHUFRUURVLRQSKHQRPHQRQLQGXFHGE\WKHH[SR-â&#x20AC;? sure to air of the reactive cuprous chloride [Cu Cl] species located inside the archaeological anklets. Indeed, when

Fig. 13 -â&#x20AC;? Shows the three anklets (the second side) after treatment.

FXSURXVFKORULGHLVH[SRVHGWRWKHDWPRVSKHULFKXPLGLW\ F\FOLFDOO\UHDFWVZLWK2[\JHQDQGWKHZDWHUFRPLQJIURP the humid atmosphere thus gives rise to the formation of WKHJUHHQLVKDWDFDPLWH>&X 2+ &O@DQGLWVSRO\PRUSKV that reacts with copper to form new cuprous chloride DQG ZDWHU LQ WKLV ZD\ FRSSHU FKORULGH 2[\JHQ DQG ZDWHU DUH FRQYHUWHG LQWR FXSULWH >&X2@ DQG DWDFDPLWH >&X 2+ &O@ LQ D F\FOLFDO DQG FRQWLQXRXV SURFHVV WKDW FDQGLVĂ&#x20AC;JXUHWKHDUFKDHRORJLFDOREMHFWV>@ 0( 6(0 H[DPLQDWLRQV RI WKH WKUHH DQNOHWV VKRZ WKH elongation of the bronze grains revealed the use of the KDPPHULQJPHWKRGLQWKH0DQXIDFWXUHRIWKHDQNOHWVDI-â&#x20AC;? ter casting. 7KLVSOD\HGDQHJDWLYHUROHLQWKHLUGHWHULRUDWLRQGXHWR WKHH[LVWHGVWUDLQVLQVLGHWKHPHWDOOLFVWUXFWXUH,QDGGL-â&#x20AC;? tion to the appearance of deterioration spots dispersed RQ WKH PHWDO VXUIDFH UHSUHVHQW LQ 8QLIRUP FRUURVLRQ dispersed on the surface of anklet A , Grieve corrosion and the micro-â&#x20AC;?crocks in the second anklet B, and micro-â&#x20AC;? crocks with pitting corrosion which distort the surface of the third anklet C. 7KHVWXG\UHYHDOHGRQHW\SHRIFRUURVLRQSDWWHUQRQWKH archaeological anklets. It was shown that the structure of WKHFRUURVLRQSDWWHUQLVFORVHO\OLQNHGWRWKHW\SHRIFRU-â&#x20AC;? rosion process. A phenomenon common to the structure LV GHFXSLĂ&#x20AC;FDWLRQ  ,W ZDV DOVR VKRZQ WKDW WKH FRUURVLRQ structure has several features: ([LVWLQJWKUHHOD\HUV H[WHUQDOFXSURXVR[LGHDQGLQWHUQDO 


7KHH[WHUQDOOD\HUGXHWRDPRUHVHYHUHGLVVROXWLRQRI WKHDOOR\DVVRFLDWHGZLWKWKHSUHVHQFHRIVRLOHOHPHQWV LQWKHLQWHUQDOOD\HU 5HODWLYHO\ ODUJH DPRXQW RI FKORULGHV LQ WKH YLFLQLW\ RI the alteration front, which means the occurrence of mass transportation of chlorides from the soil to the metallic phase inward.

A

;5) DQDO\VLV LQGLFDWHG WKDW WKH DQNOHWV ZHUH PDGH RI EURQ]H DOOR\ >&X6Q@ WLQ ZDV IRXQG LQ D KLJK DPRXQW in the three anklets ,the percentage of it varied from >@DQGWKH\KDGDYHU\ORZSHUFHQWDJHRI /HDG ,URQ DQG =LQF DV SXULWLHV WKHVH SXULWLHV  FRQWHQWV PD\FDPHIURPWKHXVHGFRSSHURUHVGXULQJH[WUDFWLRQ Also we can deduce that the ancient manufacturer recog-â&#x20AC;? nized that the Lead isnâ&#x20AC;&#x2122;t valid to manufacture the anklets E\KDPPHULQJWHFKQLTXH B

It must be noticed that in the case of artifacts found in archaeological soils, chemical composition and properties 3+ EXIIHU FDSDFLW\  RI VRLOV KDYH EHHQ PRGLĂ&#x20AC;HG ZLWK WLPH DQG WKDW ERWK FOLPDWH DQG D DFWLYLW\ RQ WKH VLWH have changed. It is obvious that the soil in which the ar-â&#x20AC;? tifacts were discovered cannot be regarded as the initial RQHLQZKLFKWKH\ZHUHOHIWRUEXULHG7KHQLQRUGHUWR GHĂ&#x20AC;QHDUHDOPHDQLQJRIDQDUFKDHRORJLFDOVRLOFRQGLWLRQ UHJDUGLQJ WKH FRUURVLRQ LW LV QHFHVVDU\ WR FRQVLGHU WKH VRLO PLFURPRUSKRORJ\ LQ RUGHU WR GHWHUPLQH WKH HYROX-â&#x20AC;? WLRQV RI WKH VRLO FKDUDFWHULVWLFV VXFK DV GHFDOFLĂ&#x20AC;FDWLRQ PRGLĂ&#x20AC;FDWLRQRIEXIIHULQJFDSDFLW\>@ The choice of method for cleaning depends on what is UHTXLUHG IURP WKH REMHFW ZKDW LV PDGH RI DQG ZKDW condition it is in. The mechanical cleaning of metals is SUHIHUUHG PHWKRG IRU UHPRYLQJ GLVĂ&#x20AC;JXULQJ FRUURVLRQ ,W allows more control and has less effect on the metal al-â&#x20AC;? OR\-HGU]HMHZVND>@VXJJHVWHGWROHDYHVPDOOVWULSVRI FRUURVLRQ XQWRXFKHG E\ FOHDQLQJ LQ OHVV YLVLEOH SODFHV DVHYLGHQFHRIWKHVWDWHRIWKHREMHFWEHIRUH+RZHYHU the use of chemical treatments for the anklets is ac-â&#x20AC;? FHSWDEOH WKDQ WKH PHFKDQLFDO FOHDQLQJ DV WKHVH REMHFWV KDGDWKLFNKDUGDQGFUXVWOD\HUVRIFRUURVLRQSURGXFWV PL[HGZLWKWKHGLUW\RIVRLOLWLVYHU\GLIĂ&#x20AC;FXOWWRUHPRYH LWE\PHFKDQLFDOPHWKRGVZLWKVXUIDFHVWKDWFDQEHHDV-â&#x20AC;? LO\ GDPDJH E\ WKH SUHVVXUH H[HUWHG GXULQJ PHFKDQLFDO cleaning, besides the mechanical methods will create new points (pin Holes) for a new corrosion. Also if we OHDYHVPDOOVWULSVRIFRUURVLRQRUDWKLQOD\HURISDWLQDDV -HGU]HMHZVNDVXJJHVWHGWKHVHVWULSVZLOOEHFRPHDQHJD-â&#x20AC;? tive electrode (Cathodic), whereas the metal under it, EHFRPHDQRGLFDQGLQH[LVWLQJDPRLVWXUHDVHOHFWURO\WH LPPHGLDWHO\D*DOYDQLFFHOOZLOOFUHDWHDQGWKHFRUURVLRQ process will start. &21&/86,216 The information that can be derived from mineralogical VWXG\RIDQFLHQWEURQ]HVKDVDGLUHFWLPSDFWRQWKHGHJUHH WR ZKLFK VXUIDFH FOHDQLQJ RI VXFK REMHFWV FDQ EH FDUULHG RXWGXULQJFRQVHUYDWLRQ2QHRIWKHPRVWFXUUHQWO\IDYRUHG and best-â&#x20AC;?informed approaches to their surface cleaning is to H[DPLQHWKHREMHFWFDUHIXOO\E\PRGHUQDSSDUDWXV ,WLVQHFHVVDU\WRFRQVLGHUWKHVRLOPLFURPRUSKRORJ\LQRUGHU to determine the evolutions of the soil characteristics such DVGHFDOFLĂ&#x20AC;FDWLRQPRGLĂ&#x20AC;FDWLRQRIEXIIHULQJFDSDFLW\ 7KHUH LV VWLOO PXFK WR EH XQGHUVWRRG DERXW WKH FKHPLVWU\ DQGS+FRQGLWLRQVWKDWSUHYDLOLQEURQ]HREMHFWVDQGOHDGWR an accumulation of cuprous chloride in the corrosion prod-â&#x20AC;? XFWV7KHFXSULFFRPSOH[HVPXVWSOD\DQLPSRUWDQWUROHLQ

38

C

Fig. 14 -â&#x20AC;? Shows the three anklets (A,B,C) after treatment.

the continued reactions giving rise to bronze disease before either all of the cuprous chloride is consumed or the humid-â&#x20AC;? LW\OHYHOVLQSLWVRULQ]RQHVFRQWLJXRXVZLWKWKHVXUIDFHGURS below levels required for continuous reaction. There is a strong interaction between the surrounding en-â&#x20AC;? YLURQPHQWDQGDOOR\DOVRWKHUHLVDVWURQJUHODWLRQEHWZHHQ WKHVXUURXQGLQJPHGLXPDQGVWUXFWXUHRIFRUURVLRQOD\HUV The choice of method for cleaning depends on what is re-â&#x20AC;? TXLUHGIURPWKHREMHFWZKDWLVPDGHRIDQGZKDWFRQGL-â&#x20AC;? tion it is in.

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

ABSTRACT

THE AIM OF THIS PAPER IS TO EXAMINE, IN DETAIL, THE CORROSION OF THE SELECTED OBJECTS GROWN DURING THE LONG-â&#x20AC;?TERM BURIAL AND IDENTIFY ITS PRODUCTS; THIS WILL HELP US TO UNDERSTAND THE CORROSIVE FACTORS AND THE DEGRADATION MECHANISMS , AS WELL AS TO IDENTIFY THEIR CONSTITUTING METALS IN ORDER TO CARRY OUT SCIENTIFIC TREATMENT AND CONSERVATION . FOR THIS PURPOSE, SAMPLES FROM THE OBJECTS WERE EXAMINED BY METALLOGRAPHIC MICROSCOPE (ME) AND SCANNING ELECTRON MICROSCOPE (SEM), WHILE THE CORROSION PRODUCTS WERE ANALYZED BY X-â&#x20AC;?RAY DIFFRACTION (XRD). X-â&#x20AC;?RAY FLUORESCENCE( XRF) WAS USED TO DETERMINE THE BULK ELEMENTS OF THE OBJECTS. XRD DATA SHOWED THAT THE CORROSION PRODUCTS ARE CUPRITE , ATACAMITE AND PARATACAMITE , WHE-â&#x20AC;? REAS XRF ANALYSIS POINTED OUT THAT THE ANKLETS ARE COMPOSED BY A BRONZE ALLOY. MICROSCOPIC EXAMINATION REVEALS THAT THE THREE ANKLETS SUFFERED DETERIORATION MAINLY IN SPOTS. EXPLOITING THE COLLECTED INFO, CHEMICAL CLEANING WAS CHOSEN FOR TREATING THE OBJECTS.

KEYWORDS BRONZE OBJECTS; CORROSION;

SEM; XRF; XRD; TREATMENT; CONSERVATION

AUTHOR MOHAMED M. MEGAHED CONSERVATION DEPARTMENT, FACULTY OF ARCHAEOLOGY, FAYOUM UNIVERSITY, EGYPT. falconm_72@yahoo.com

39 BIBLIOGRAPHY 5REELROD/%OHQJLQR-0HWDO 0RUSKRORJ\ DQG 0HFKDQLVPV RI )RUPDWLRQRI1DWXUDO3DWLQDVRQ$UFKDHRORJLFDO9ROXPH1XP-â&#x20AC;? EHUSS &DVDOHWWR03'H&DUR*0HWDO3URGXFWLRQRIUHIHUHQFH DQFLHQW&XEDVHGDOOR\VDQGWKHLUDFFHOHUDWHGGHJUDGDWLRQPHWKRGV 0DWHULDOV6FLHQFH SURFHVVLQJ$SSOLHG3K\VLFV$SS  2UJDQ 50 7KH ([DPLQDWLRQ$QG 7UHDWPHQW 2I %URQ]H$QWLTXL-â&#x20AC;? WLHV,Q5HFHQW$GYDQFH,Q&RQVHUYDWLRQ%XWWHUZRUWK 0DFOHRG , ' &RQVHUYDWLRQ 2I &RUURGHG &RSSHU $OOR\V $ FRP-â&#x20AC;? SDULVRQ2I1HZ$QG7UDGLRQDO0HWKRGV)RU5HPRYLQJ&KORULGH,RQV 6WXGLHV,Q&RQVHUYDWLRQ 6FRWW$'%URQ]H'LVHDVH$UHYLHZRIVRPHFKHPLFDOSUREOHPV DQG WKH UROH RI UHODWLYH KXPLGLW\ 9ROXPH  1XPEHU  DUWLFOH SS 6FRWW$'$QH[DPLQDWLRQRIWKHSDWLQDDQGFRUURVLRQPRUSKR-â&#x20AC;? ORJ\ RI VRPH 5RPDQ EURQ]H -$,& 9ROXPH  1XPEHU  DUWL-â&#x20AC;? FOHSS 5RELQ&%UHWRQ-)/H6DQFWXDLUH3UHLVODPLTXHGX*DEDODO Lawd, Nord -â&#x20AC;?Yemen, Dans Academie des inscriptions et Belles Let-â&#x20AC;? WHUV)UDQFHSS )MDHVWDG0HWDO7KHGHFD\RIDUFKDHRORJLFDOFRSSHUDOOR\DUWL-â&#x20AC;? IDFWVLQVRLOLQ0HWDO-DPHV/7'/RQGRQ 9DURXIDNX*HWDO&RUURVLRQRIDQFLHQWEURQ]HV0HWDOOXUJLD 9ROXPH1XPEHU 7\OHFDWH5)7KHHIIHFWRIVRLOFRUURVLRQRQORQJWHUPFRUURVLRQ of buried tin bronzes and copper, Journal of Archaeological Science, 1R  (/0RZHOKL 10 +DPGL +7KH VRGLF VRLOV LQ (J\SW LQ 0LQH-â&#x20AC;? UDORJLFDOFKDUDFWHUL]DWLRQ(J\SW-RXUQDORI6RLO6FLHQFH9ROXPH 1XPEHU :HUQHU* HW DO &RUURVLYHGHFD\ RIDUFKDHRORJLFDO PHWDO Ă&#x20AC;QGV IURPGLIIHUHQWVRLOVDQGHIIHFWVRIHQYLURQPHQWDOSROOXWLRQLQ0HWDO  SURF RI WKH ,QWHUQ &RQI RQ 0HWDOV FRQVHUYDWLRQ )UDQFH SS 7HQQHQW1+ $QWRQLRN0%URQ]HGLVHDVHV\QWKHVLVDQG FKDUDFWHUL]DWLRQRIERWDOODFNLWHSDUDWDFDPLWHDQGDWDFDPLWHE\,Q-â&#x20AC;? IUDUHGVSHFWURVFRS\LQ,&20&RPPLWWHHIRU&RQVHUYDWLRQWKWULHQ-â&#x20AC;? QLDO0HHWLQJ2WWDZD3DULV ,QJR*0HWDO/DUJHVFDOHLQYHVWLJDWLRQRIFKHPLFDOFRPSR-â&#x20AC;? sition , structure and corrosion mechanism of bronze archaeological DUWLIDFWV IURP 0HGLWHUUDQHDQ EDVLQ $SSOLHG 3K\VLFV $ 0DWHULDOV VFLHQFH SURFHVVLQJSS 5REELROD/%OHQJLQR-0HWDO2S&LWS -HGU]HMHZVND+$FRUURGHG(J\SWLDQ%URQ]H&OHDQLQJ$QG'L-â&#x20AC;? VFRYHULHV6WXGLHV,Q&RQVHUYDWLRQ9ROXPH

fast. easy. XXXXJĂ&#x17D;HVJEFJU XXXFĂ?PXJU

APP SMARTPHONE

Sistema per il monitoraggio degli ACCESSI e dei FEEDBACK Eflow è un applicazione per il monitoraggio dei flussi turistici, degli accessi e per e la raccolta di feedback sulla soddisfazione dei clienti o visitatori. Attraverso un semplice e completo sistema di report e grafici è possibile ottenere in tempo reale informazioni statistiche e strategiche.

WIFI-CARD RENTALS/NOLEGGIO

La guida multimediale

sul tuo smartphone Wifiguide è la nuova audio guida multimediale con contenuti audio e video ideale per musei, aree archeologiche, gallerie dâ&#x20AC;&#x2122;arte e centri storici. Accessibile attraverso la rete wi-fi, apparecchiature a noleggio e Apps per smartphone.

Via Lima, 7 - 00198 Roma - Tel. +39 06 9838 1517 Via Mazzini, 205 - 92100 Agrigento - Tel. +39 092 261 0651


AGORĂ&#x20AC; Dal SALONE del RESTAURO di FERRARA

TECNOLOGIE DI RILIEVO 3D: sviluppo del mercato, qualitĂ e formazione report a cura di Renzo Carlucci Una delle sessioni, all'interno del XXI Salo-â&#x20AC;? ne del Restauro di Ferrara, appena chiuso presso gli spazi di Ferrara Fiere, ha dato ampio spazio ai problemi del mercato, della qualitĂ  e della formazione relativa-â&#x20AC;? mente alle nuove tecnologie per il rilie-â&#x20AC;? vo e la documentazione 3D, durante una Tavola Rotonda che si è tenuta sul tema: TECNOLOGIE DI RILIEVO 3D: sviluppo del mercato, qualitĂ  e formazione. /D 7DYROD 5RWRQGD q VWDWD DSHUWD GD 0DU-â&#x20AC;? FHOOR %DO]DQL 'LUHWWRUH GHO ',$35H0 (Centro Dipartimentale per lo Sviluppo di Procedure Automatiche Integrate per il Re-â&#x20AC;? VWDXURGHL0RQXPHQWL FKHGRSRDYHULOOX-â&#x20AC;? strato il focus centrale dellâ&#x20AC;&#x2122;incontro basa-â&#x20AC;? to sullâ&#x20AC;&#x2122;esame delle problematica relative DOODUHDOL]]D]LRQHGLULOLHYL'QHOPHUFDWR attuale italiano, ha passato la parola ad Andrea Cabrucci, presidente di New Busi-â&#x20AC;? QHVV +H[DJRQ *HRV\VWHPV LO TXDOH KD VX-â&#x20AC;? bito evidenziato uno dei problemi piĂš forti del momento precisando che agli operatori non manca la capacitĂ  ma la formazione. ´$OLYHOORLQWHUQD]LRQDOHOHWHFQRORJLHRUD sono molto avanzate rispetto al livello del-â&#x20AC;? la formazione Italiana, quindi il problema che spesso si ritrova nellâ&#x20AC;&#x2122;incapacitĂ  dâ&#x20AC;&#x2122;uso GHOOH QXRYH WHFQRORJLH q QHOOD GLGDWWLFD quindi nelle universitĂ  e nelle scuole. A causa di ciò le aziende produttrici sono costrette a formare gli stessi operatori, specialmente in Italia ove abbiamo una notevole mancanza di formazione pratica sul campo. Abbiamo una grossa quantitĂ  di operatori che conoscono la teoria, ma non sanno usare la strumentazione e questo SHUFKLSURGXFHqXQDPDQFDQ]DJUDYHSRL-â&#x20AC;? FKq O¡D]LHQGD QRQ KD XQ ULVFRQWUR GLUHWWR VXOO¡RSHUDWRÂľ /$0$1&$1=$'(//$)250$=,21(6&,(17,),&$ ´/D PDQFDQ]D IRUPDWLYD q VFLHQWLĂ&#x20AC;FD H QRQSURIHVVLRQDOHÂľKDWHQXWRDVRWWROLQH-â&#x20AC;? DUH &DEUXFFL ´ H SRUWD XQ JUDYH GDQQR DOO¡D]LHQGD4XHVWRYXROGLUHFKHF¡qXQD mancanza di formazione anche dellâ&#x20AC;&#x2122;utiliz-â&#x20AC;? ]DWRUHĂ&#x20AC;QDOHTXHOORDGHVHPSLRFKHVFULYH un capitolato dâ&#x20AC;&#x2122;uso. In molti sono quelli FKH QRQ VDQQR UHDOPHQWH FRVD YRJOLRQRÂŤ DOO¡HVWHURXQFDSLWRODWRqIDWWRGHOO¡RJJHW-â&#x20AC;? to di cosa si voglia e di come lo si deve FROODXGDUHPHQWUHLQ,WDOLDqLOFRQWUDULRÂľ ,O PHVVDJJLR GL &DEUXFFL SHUWDQWR  q ´LQ-â&#x20AC;? segnare a chi usa questi dati a chiedere TXHOOR GL FXL KD ELVRJQR LQ PRGR VSHFLĂ&#x20AC;-â&#x20AC;? co e chi fa i capitolati a non usare troppo VSHVVRLOÂśFRSLDHLQFROOD¡FRVuGDREEOLJDUH

40 40

OHD]LHQGHDVHJXLUHXQFHUWRSURFHVVRÂľH LQXOWLPR´VSLQJHUHOHXQLYHUVLWjDIRUPDUH O¡XWLOL]]DWRUHGHOSURGRWWRWHFQRORJLFRÂľ /D SDUROD q SDVVDWD TXLQGL DG $QGUHD $O-â&#x20AC;? berti, Soprintendente per i Beni Archi-â&#x20AC;? tettonici e Paesaggistici delle Province di %UHVFLD &UHPRQD H 0DQWRYD LQWHUYHQXWR come uno dei committenti o un utilizza-â&#x20AC;? WRUH GHL ULVXOWDWL GL TXDOFKH FRVD FKH ´ non sia auto-â&#x20AC;?referenziale o che non abbia un valore in se ma che sia effettivamente XWLOHHGHIĂ&#x20AC;FDFHSHUPLJOLRUDUHLOVLVWHPD di conoscenza e quindi per fare un passo DYDQWLULVSHWWRDOSDVVDWRÂľ´,QXQDFRQGL-â&#x20AC;? zione normale non succede nulla. Nessuno fa investimenti e nessuno fa neanche dan-â&#x20AC;? ni, salvo il tempo perduto che può essere utilizzato per la conservazione dei beni culturali, mostrando nervi debolissimi nel momento dellâ&#x20AC;&#x2122;emergenza a causa di una YHULĂ&#x20AC;FD LQ PDQLHUD DPSOLĂ&#x20AC;FDWD GL TXHOOR FKH QHOOD FRQGL]LRQH RUGLQDULD q VROWDQWR XQDSDUYHQ]DÂľ /$0$1&$1=$',5,/,(9,$77(1',%,/, ´/DSULPDYDOXWD]LRQHqFKHPDQFDQRDQ-â&#x20AC;? cora, nonostante siano decine di anni che si propongono e si richiedano, non diciamo proprio dignitose banche dati, ma almeno ULOLHYLDWWHQGLELOLÂľ $OEHUWL KD FRQWLQXDWR DIIHUPDQGR FKH ´ tutta questa serie di considerazioni porta un utilizzatore della strumentazione a far-â&#x20AC;? gli dire che non può aver sbagliato avendo lui seguito perfettamente il manuale. Il SUREOHPDqFKHDOODĂ&#x20AC;QHODTXDOLWjSURJHW-â&#x20AC;? tuale ne risente molto e ne risente molto anche lâ&#x20AC;&#x2122;utilizzo corretto dei fondi e lâ&#x20AC;&#x2122;isti-â&#x20AC;? tuzione fa molta fatica a contrastare que-â&#x20AC;? VWRSURFHGLPHQWR4XHVWDqXQDFRQIHUPD della premessa iniziale della conferenza HG q XQ DXJXULR 6DSSLDWH FKH  DO QRVWUR interno ci sono valutazioni in atto ma non F¡qDQFRUDXQDFXOWXUDGHOO¡HVHFX]LRQHGHL lavori pubblici come dovrebbe essere in UHDOWjÂľ 327(5&217$5(68&$3,72/$7,6(5, A questo punto Balzani ha passato la paro-â&#x20AC;? la a Giuseppe Boselli di GeogrĂ srl (Sermi-â&#x20AC;? GH0DQWRYD LOTXDOHKDHYLGHQ]LDWRFRPH

il problema sia legato ai tempi di proget-â&#x20AC;? WD]LRQHQHOVHQVRFKHTXDQGRVLDIĂ&#x20AC;GDXQ appalto di progettazione integrato spesso ODIDVHGLFRQRVFHQ]DqDOO¡LQWHUQRGLTXH-â&#x20AC;? sti capitolati. ´2JQL SURJHWWLVWD SUHVHQWH SRWUHEEH DI-â&#x20AC;? fermare che ha dei tempi di progettazione che partono nel momento in cui ricevono le informazioni di conoscenza, quindi i ri-â&#x20AC;? OLHYL,OSULPRSUREOHPDGDULVROYHUHqDYH-â&#x20AC;? re un capitolato serio che possa garantire le amministrazioni appaltanti ed i proget-â&#x20AC;? WLVWL2FFRUUHSHUWDQWRWHQHUHEHQGLVWLQWH le fasi di conoscenza (rilievo morfometrico ed indagini) dalla fase progettuale, questo SRUWHUHEEHEHQHĂ&#x20AC;FLRSXUHDOODTXDOLWjGHL risultati. Inolte, non essendoci collaudi e prescrizioni tecniche rigorose allâ&#x20AC;&#x2122;interno dei capitolati, molto spesso si vedono ela-â&#x20AC;? borati che certo rispettano le precisioni ed il dettaglio che dovrebbe essere intrinseco DOODVFDODGLUHVWLWX]LRQHQRPLQDOHÂľ Interviene quindi Alessandro Capra, Diret-â&#x20AC;? WRUHGHO'LSDUWLPHQWRGL,QJHJQHULD´(Q]R )HUUDULÂľ 8QLYHUVLWj GHJOL 6WXGL GL 0RGHQD e Reggio Emilia, rispondendo al soprinten-â&#x20AC;? GHQWH $OEHUWL HYLGHQ]LDQGR FKH F¡q XQ aspetto di fondo che riguarda la proble-â&#x20AC;? matica del rilievo in Italia, in quanto non HVLVWHLOULFRQRVFLPHQWRGHOODĂ&#x20AC;JXUDSURIHV-â&#x20AC;? sionale del rilevatore e delle imprese che fanno rilievo, a livello dei bandi e a livello GLTXDOVLDVLFRQGL]LRQHGLĂ&#x20AC;QDQ]LDPHQWRGL queste attivitĂ sul territorio. ´1RL FL WURYLDPR GL IURQWH DSSDOWL GL PL-â&#x20AC;? OLRQH GL HXUR LQ FXL OD SDUWH GL ULOLHYR q destinata a imprese e non solo ai profes-â&#x20AC;? sionisti escludendo cosi la professionalitĂ  SRLFKp QRQ HVLVWH XQ DOER GHOOH LPSUHVH che hanno questa competenza professio-â&#x20AC;? nale riconosciuta. Il problema della forma-â&#x20AC;? ]LRQH q XQ SUREOHPD VWUHWWDPHQWH OHJDWR DOPHUFDWRVHQRQF¡qTXHVWDULFKLHVWDGL professionalitĂ  non ci può essere una cre-â&#x20AC;? VFLWDLQTXHVWRVHWWRUH)LQFKpQRQFUHLDPR OD FXOWXUD GHOOD IRUPD]LRQH q LQXWLOH GLUH cosa ne consegue e non si arriva a nessun ULVXOWDWRÂľ Balzani passa poi la parola a Nuccio Bucce-â&#x20AC;? UL/76/DQG7HFKQRORJ\ 6HUYLFHV7UHYL-â&#x20AC;? so, il quale dice che spesso un capitolato

ArcheomaticA N°1 marzo 2014 ArcheomaticA N° 1 marzo 2014


Tecnologie per i Beni Culturali

qVFULWWRDQQLSULPDGHOO¡HVHFX]LRQHSR-â&#x20AC;? nendo limiti che nei dati di fatto oggi non FLVRQRSL´4XLQGLXQSULPRSUREOHPDq da ascrivere ai capitolati e alle modalitĂ di partecipazione alla gara, il secondo pro-â&#x20AC;? EOHPDSRLqFKHUDUDPHQWHF¡qXQLQWHUOR-â&#x20AC;? cutore con il quale si possa discutere del SURJHWWRHVSHVVRFLVRQRGHOOHGLIĂ&#x20AC;FROWjD comprendersi, anche con le unitĂ  di misura che non vengono valutate con una giusta differenza di ordine di grandezza. Non si riesce a interfacciarsi con una committen-â&#x20AC;? za che di fatto possa comprendere queste FRVHÂľ ,//$6(56&$11(51219(/2&,==$,5,/,(9, 8QDOWURSUREOHPDPROWRDWWXDOHqHYLGHQ-â&#x20AC;? ]LDWRGD)XOYLR5LQDXGRGHO'LSDUWLPHQWR di Architettura e Design, Politecnico di To-â&#x20AC;? ULQRFKHDIIHUPDFKH´QRQqYHURFKH col laser scanner la fotogrammetria digita-â&#x20AC;? le del rilievo si fa in fretta, ma ci si mette DQFKHGLSLSHUFKpPHWWHUHO¡LQWHOOLJHQ]D dopo costa di piĂš che non metterla duran-â&#x20AC;? te lâ&#x20AC;&#x2122;acquisizione dei punti come si faceva prima, questo va bene solo da un punto di YLVWDHFRQRPLFRÂľ /$0$1&$1=$',&$03$*1(','2&80(17$=,21( ( FRQWLQXD GLFHQGR FKH ´ VRQR DQQL FKH si parla della documentazione del patri-â&#x20AC;? monio culturale e come documentazione invece non troviamo altro che tonnellate GL IRWRJUDĂ&#x20AC;H R YDODQJKH GL OLEUL SRL DG esempio succede che si incendia la cupola della sindone a Torino e, nonostante fosse DSSHQDĂ&#x20AC;QLWRXQFDQWLHUHGLUHVWDXURQHV-â&#x20AC;? suno era in possesso di misure per montare dei sostegni urgenti di puntellamento per cui non crollasse il tutto. Questo esempio deve mandare un messaggio forte allâ&#x20AC;&#x2122;ap-â&#x20AC;? SDUDWROHJLVODWLYRSHUFKpOR6WDWRQRQDLX-â&#x20AC;? WD SHUFKp ID GHOOH OHJJL XQLYHUVDOL FKH esclude sempre tutti dalle responsabilitĂ  e questo porta ad avere degli architetti che hanno dei bellissimi progetti ma costruiti su niente. La formazione quindi va fatta sempre tenendo conto sia della teoria che della pratica e a chi non misurerĂ  mai ma farĂ  capitolati o userĂ  dati di rilievo oc-â&#x20AC;? corre almeno un corso di cultura generale, anche teorico, per fargli conoscere le basi e, ad esempio, che le misure esatte non HVLVWRQRÂľ ,QWHUYLHQH D TXHVWR SXQWR 0DUFR 1DUGLQL Amministratore delegato Nikon Instrumens SpA, che conforta il discorso di Rinaudo e UDFFRQWDODVXDHVSHULHQ]DDOOD1,.21FKH SHUODSDUWHWULGLPHQVLRQDOHqSLULYROWD allâ&#x20AC;&#x2122;industria. Cita un esempio, a Parma, RYHLOFDSLWRODWRqEHQFKLDURVXFLzFKHVL vuole costruire e lo conferma una mostra RULHQWDWDDO'SHUDSSOLFD]LRQLLQGXVWULDOL DFXLKDSRWXWRSDUWHFLSDUH2VVHUYDSHUz FKH´qGLIĂ&#x20AC;FLOHSDUODUHGLXQSURFHVVRGL valutazione del metodo. Esiste un proce-â&#x20AC;? dimento, un capitolato, un metodo? Sono stati fatti dei test per i metodi integrati? Ne consegue che determinare un metodo SHUDQGDUHDYDQWLqIRQGDPHQWDOHÂľ Interviene Vito Leonardo Chiechi, della Di-â&#x20AC;? gitarca Bari, che riporta un caso di alcuni

PHVL SULPD DYYHQXWR LQ XQ FDQWLHUH  ´ sono andati sul campo facendo un analisi di quelli che potevano essere i potenzia-â&#x20AC;? li problemi del rilievo e hanno trovato di tutto e di piĂš a livello di margine di erro-â&#x20AC;? re. Per fortuna ora la committenza inizia a capire che ci sono tanti soggetti ambigui VXO PHUFDWR FKH QRQ GDQQR DOFXQ DIĂ&#x20AC;GD-â&#x20AC;? mento professionale. Quindi osserva che alla lunga questa generale diffusione della tecnologia paga, ma da per scontato che dovrebbe esistere una normativa a cui far ULIHULPHQWR 0DJDUL VRVWHQXWD GD XQ¡DVVR-â&#x20AC;? FLD]LRQHGLULOHYDWRULÂľ Interviene Alberto Raschieri della Geomar. LW 0RQGRYu &XQHR FRQ GXH DIIHUPD]LRQL OD SULPD q ´ FKH HVLVWH XQD GLVWRUVLRQH del lavoro nata con lo scanner sin da quan-â&#x20AC;? GRVLqLQL]LDWRDXVDUORGLPHQWLFDQGRXQ poâ&#x20AC;&#x2122; del lavoro manuale, approcciando una visione sbagliata sullâ&#x20AC;&#x2122;aspetto di come si ID XQ ULOLHYRÂľ /D VHFRQGD ULJXDUGD LO IDW-â&#x20AC;? WR FKH ´ LO FRPPLWWHQWH WRUQD VH WURYD XQDSHUVRQDFKHqFDSDFHGLIDUHXQFHUWR rilievo con un certo risultato, ma se il com-â&#x20AC;? mittente va la prima volta e si fa fare un ri-â&#x20AC;? lievo non qualitativamente adatto (in base RYYLDPHQWH DQFKH GHO SDJDPHQWR  F¡q XQ rischio serissimo che il risultato ottenuto non sia un buon risultato. Quindi se chi fa il rilievo non ha una conoscenza accurata ri-â&#x20AC;? schia di far crollare tutto il sistema anche se le macchine da rilievo siano migliorate tantissimo non tanto per il risultato ma per ODIDVHGLDFTXLVL]LRQHÂľ Alessandro Capra interviene di nuovo di-â&#x20AC;? FKLDUDQGR FKH ´ ÂŤ q XQD TXHVWLRQH PROWR FRPSOHVVDHULXVFLUHDGDUHXQDULVSRVWDq DOWUHWWDQWRGLIĂ&#x20AC;FLOH1HOVHWWRUHLQGXVWULD-â&#x20AC;? le metrologico ci sono delle norme in fase di realizzazione del lavoro che sono in sta-â&#x20AC;? to avanzatissimo, non solo in Germania ma DQFKH LQ ,WDOLD SHUFKp FL VRQR GHOOH GH-â&#x20AC;? Ă&#x20AC;QL]LRQLPROWRDFFXUDWHHSUHFLVH4XHVWH GHĂ&#x20AC;QL]LRQL FUHDQR XQ DSSURFFLR GL SURIHV-â&#x20AC;? VLRQDOLWj QHOO¡DPELWR GHO ULOLHYR SHUFKp OD ULFKLHVWDqDOWLVVLPDHSHUFKpODYHULĂ&#x20AC;FDq estremamente rigorosa. Questo non avviene nellâ&#x20AC;&#x2122;ambito del rilievo WRSRJUDĂ&#x20AC;FRÂľ 6&$56$ 352)(66,21$/,7­ ', 7877( /( &20321(17, &RQWLQXD &DSUD ´ LQGLYLGXDUH LO SHUFKp QRQqIDFLOHPDVLFXUDPHQWHqXQDTXHVWLR-â&#x20AC;? QHGLVLVWHPD,OVLVWHPDQRQqPDWXURQRQ qSURQWRSHUODFHUWLĂ&#x20AC;FD]LRQHGLTXDOLWjGHL lavori del rilievo per il metodo del laser VFDQQLQJ 'RY¡q LO OLPLWH GHOOH LPSUHVH" 6H QRQ F¡q WUDVSDUHQ]D H FKLDUH]]D QHOOD ULFKLHVWD GHOOD YHULĂ&#x20AC;FD QRQ F¡q QHPPHQR trasparenza e professionalitĂ nella compe-â&#x20AC;? tizione. Da un punto di vista formativo se ODULFKLHVWDGLPHUFDWRqEDVVDODULVSRVWD sempre a livello formativo può essere bas-â&#x20AC;? sa e quindi se il mercato non richiede si indebolisce anche la qualitĂ  e il livello for-â&#x20AC;? mativo. Se tutti gli attori di questo proces-â&#x20AC;? so, non richiedono qualitĂ  nel rilievo e non richiedono degli standard, non usciamo da un percorso di scarsa professionalitĂ  in tut-â&#x20AC;? WHOHVXHFRPSRQHQWLÂľ

41

81 $33(//2 3(5 /$ 5($/,==$=,21( ', 1250$7,9$$'(*8$7$ Andrea Cabrucci riprende a questo punto FRQ )XOYLR 5LQDXGR LO WHPD GHO FROODXGR GHO ' PROWR XWLOL]]DWR DOO¡HVWHUR H PDL WHQWDWR LQ ,WDOLD ´ QRQ HVLVWRQR QRUPH VXLULOLHYLGLQHVVXQOLYHOORSHUFKpIDUĂ&#x20AC;QWD che tutte le misure siano corrette, paga GL SL FKH QRQ IDUORÂľ ,QWHUYLHQH %DO]DQL HYLGHQ]LDQGRFKH´O¡LQWHUYHQWRGL5LQDX-â&#x20AC;? do a man forte della opinione di Cabrucci ci conferma quanto siano veritiere le sue affermazioni considerando anche che il collaudo andrebbe fatto a fasi e non dal FROODXGDWRUH WHU]R FRPH LQ FDUWRJUDĂ&#x20AC;D H TXLQGL q OD VWHVVD GLWWD FKH FRPH FRGLFH GLTXDOLWjLQWHUQDGRYUHEEHYHULĂ&#x20AC;FDUHVHLO SURJHWWRqIDWWRUHDOPHQWHEHQHHGHVSRU-â&#x20AC;? re a seguire una relazione tecnica con le YDULHPRGLĂ&#x20AC;FKHHLQFDVRQHJDWLYRULFRPLQ-â&#x20AC;? FLDUHFRQLULOLHYLÂľ ´/DSURSRVWDGHYHSDUWLUHGDXQHQWHFKH venga riconosciuto facendo riferimento ai manuali dâ&#x20AC;&#x2122;uso di quella commissione geo-â&#x20AC;? GHWLFD FKLXVD SURSULR SHUFKp LQ ,WDOLD F¡q una mancanza della formazione di misura tecnica vera al quale in malo modo siamo DELWXDWLÂľ +$1123$57(&,3$72 0DUFHOOR %DO]DQL 'LUHWWRUH GHO ',$35H0 8QLYHUVLWjGL)HUUDUD²'LSDUWLPHQWRGL$U-â&#x20AC;? chitettura Andrea Alberti, Soprintendente per i Beni Architettonici e Paesaggistici delle Pro-â&#x20AC;? YLQFHGL%UHVFLD&UHPRQDH0DQWRYD Alessandro Capra, Direttore Dipartimento GL ,QJHJQHULD ´(Q]R )HUUDULÂľ 8QLYHUVLWj GHJOL6WXGLGL0RGHQDH5HJJLR(PLOLD )XOYLR5LQDXGR'LSDUWLPHQWRGL$UFKLWHW-â&#x20AC;? tura e Design, Politecnico di Torino Andrea Cabrucci, Presidente New Busi-â&#x20AC;? QHVV+H[DJRQ*HRV\VWHPV Diego Borsani, Amministratore delegato =),WDO\VUO 0DUFR 1DUGLQL $PPLQLVWUDWR GHOHJDWR Nikon Instrumens SpA Sergio Padovani, Amministratore delegato /HLFD*HRV\VWHPV6S$ Giuseppe Boselli, GeogrĂ srl, Sermide, 0DQWRYD 1XFFLR %XFFHUL /76 /DQG 7HFKQRORJ\  Services, Treviso Vito Leonardo Chiechi, Digitarca, Bari $OEHUWR 5DVFKLHUL *HRPDULW 0RQGRYu Cuneo :LOKHOPYRQ+DVH GLUHWWRUHGHO0XVHRGL 0DJRQ]D 


INTERVISTA

DEL

INTERVISTA

AL

PROF. ANGELO CHIANESE, PRESIDENTE

DISTRETTO

AD

ALTA TECNOLOGIA

DEI

BENI CULTURALI

a cura di Luca Papi

Nato nel 2012 il DATABENC, Distretto ad Alta Tecnologia dei Beni Culturali nasce per rispondere allâ&#x20AC;&#x2122;esigenza di attuare un piano strategico di gestione e valorizzazione del Patrimonio Culturale della Regione Campania. Abbiamo incontrato il Presidente Angelo Chianese.

Luca Papi (L.P.): Gentile Presidente, quando e come nasce il distretto DATABENC?

di ricerca tra loro integrati in una piattaforma di sistema e sorretti da una moderna infrastruttura tecnologica. Con una nuova vision di smartness che YHGH QHOOD SURGX]LRQH H JHVWLRQH GL XQD FRQRVFHQ]D FHUWLĂ&#x20AC;FDWD H FRQGLYLVD lâ&#x20AC;&#x2122;asse portante di qualsiasi ulteriore processo di monitoraggio diagnostico e di fruizione sostenibile nel tempo.

Angelo Chianese (A.C.): Il Distretto ad Alta Tecnologia per i Beni Culturali '$7$%(1& VLqFRVWLWXLWRFRPH6RFLHWj&RQVRUWLOHD5HVSRQVDELOLWj/LPLWDWD (SCARL), il 17 ottobre 2012, per procedere allâ&#x20AC;&#x2122;attuazione dello Studio di )DWWLELOLWjSUHVHQWDWRDYDOHUHVXOO¡$YYLVR5LFGHORWWREUH²7LWROR ,,,GHO0,85HULVXOWDWRPHULWHYROHGLĂ&#x20AC;QDQ]LDPHQWRVXOODEDVHGHOO¡DUWGHO '0 '$7$%(1&qQDWRGDOODYRORQWjGHOOH8QLYHUVLWjGL6DOHUQRHGL1DSROL)HGHULFR ,,GLFUHDUHLQ5HJLRQH&DPSDQLDXQSHUFRUVRĂ&#x20AC;QDOL]]DWRDFROPDUHXQYXRWR di programmazione strategica integrata sui beni culturali, sul patrimonio ambientale e sul turismo. Le due universitĂ , insieme a tanti altri partner, hanno formulato una proposta che focalizza lâ&#x20AC;&#x2122;attenzione verso un heritage scarsamente protetto, ma soprattutto poco valorizzato e quasi per nulla FRPXQLFDWR VHFRQGR XQ DSSURFFLR GL VLVWHPD LQWHJUDWR /¡LGHDSURJHWWR q stata sviluppata anche rispetto al processo di diffusione dei distretti culturali evoluti che, in Italia, hanno avuto come obiettivo primario la realizzazione di quattro driver: il rafforzamento dellâ&#x20AC;&#x2122;identitĂ  culturale e dellâ&#x20AC;&#x2122;immagine WHUULWRULDOH ORFDOH XQ¡LQWHUQD]LRQDOL]]D]LRQH GHOO¡RIIHUWD FXOWXUDOH XQD SURJUDPPD]LRQHGLHYHQWLHVSHULHQ]LDOLLQFOXVLYLGHOIUXLWRUHXQDOHDGHUVKLS condivisa con responsabilitĂ  e cooperazione tra pubblico e privato.

L.P.: Quali sono gli ambiti di intervento del distretto? A.C.: ,O SURJHWWR GHO GLVWUHWWR YXROH DIIHUPDUH FKH OD FXOWXUD q LQ JUDGR di generare processi di riconversione creativa ed innovativa dei sistemi tradizionali di sviluppo territoriale sostenibili nel breve e nel lungo termine. Con un innovativo uso delle risorse, in cui il driver tecnologico, rappresentato soprattutto dalle ICT, deve giocare un ruolo importante di facilitatore dei processi di innovazione. In un sistema non piĂš caratterizzato dalla VSHFLDOL]]D]LRQHPRQRĂ&#x20AC;OLHUDPDSLXWWRVWRGDOO¡LQWHJUD]LRQHGLPROWHGLHVVH afferenti al cultural heritage materiale e immateriale, che in tre anni intende raggiungere i seguenti risultati: IDYRULUHXQXVRSULYDWRGHOSDWULPRQLRFXOWXUDOHDQFRUFKpUHJRODPHQWDWR dal pubblico e ad alto valore aggiunto, creando delle comunitĂ di pratica IUDJOLDWWRULGHOVLVWHPD creare processi e infrastrutture abilitanti per supportare gli attori del VLVWHPDLQWHJUDWRGHLEHQLFXOWXUDOL incrementare le collaborazioni tra grandi imprese (GI) e piccole e medie LPSUHVH 30,  stimolare la nascita di imprese innovative che utilizzino i beni culturali FRPHYRODQRGHOORVYLOXSSRHFRQRPLFRORFDOH SRWHQ]LDUH OH FDSDFLWj GL JHQHUDUH LQQRYD]LRQL PLUDWH H VSHFLĂ&#x20AC;FKH DWWUDYHUVR LO FRĂ&#x20AC;QDQ]LDPHQWR GL SURJHWWL GL VYLOXSSR DPPRGHUQDPHQWR HRDFTXLVL]LRQHGLLPSLDQWLHGLVSRVLWLYLGDSDUWHGL8QLYHUVLWjHFHQWULGL ULFHUFD(QWLGL5LFHUFDVWUXWWXUHGHO0L%$&GHOOD&DPSDQLD attrarre capitali privati, competenze eccellenti e imprese internazionali ad DOWDWHFQRORJLDDWWUDYHUVRVWUXPHQWLLQQRYDWLYLGLSULYDWHHTXLW\YHQWXUH FDSLWDOLQRSHUD]LRQLĂ&#x20AC;QDQ]LDULHQHOFDSLWDOHGLULVFKLR rafforzare il valore giuridico dei brevetti campani, di cui la maggior parte legato allo sviluppo di tecnologie per la sicurezza e la protezione dei beni culturali e sostenere la diffusione delle competenze delle imprese DOO¡LQWHUQRGHOODIUDPPHQWDWDĂ&#x20AC;OLHUDGHLEHQLFXOWXUDOL creare nuova imprenditoria capace di realizzare una gestione economica del patrimonio culturale, sia sul piano della valorizzazione e fruizione che dei VLVWHPLLQQRYDWLYLGLPHVVDLQVLFXUH]]DGHLEHQLFXOWXUDOL promuovere e favorire il trasferimento tecnologico attivando azioni di raccolta e diffusione di opportunitĂ  di innovazione con impatto sul EXVLQHVV IRFDOL]]DQGR OR VIRU]R VXOO¡HIĂ&#x20AC;FDFLD GHOOD FRPXQLFD]LRQH SHU VWLPRODUH O¡LQWHUHVVH H LO IROORZXS FRQ SURGRWWL GLYHUVLĂ&#x20AC;FDWL LQ IXQ]LRQH GHOOHFDUDWWHULVWLFKHGHOOHLPSUHVHGHVWLQDWDULH ampliare lâ&#x20AC;&#x2122;offerta del turismo culturale, sia tramite forme di fruizione YLUWXDOLHPXOWLPHGLDOLVLDDWWUDYHUVRVWUXPHQWLGLPDUNHWLQJHVSHULHQ]LDOH UHLQGLUL]]DUHHGLVWULEXLUHVXDUHHSLYDVWHLĂ XVVLWXULVWLFLFKHDWWXDOPHQWH si concentrano in un numero ristretto di siti, individuando e sperimentando strumenti per la fruizione e valorizzazione di luoghi periferici regionali maggiormente in grado di attirare operatori e turisti.

L.P.: Qual è lâ&#x20AC;&#x2122;obiettivo principale di DATABENC? A.C.:'$7$%(1&QHOSLHQRULVSHWWRGHOVLJQLĂ&#x20AC;FDWRGLGLVWUHWWRWHFQRORJLFRq una rete integrata di ricerca, sperimentazione, formazione e divulgazione, che realizza output lavorativi connessi a beni, siti e attivitĂ culturali, progettando itinerari di valorizzazione e incoraggiando lâ&#x20AC;&#x2122;avvio di start up e spin off. Con una convinta condivisione delle linee e delle soluzioni riportate QHL SLDQL GHO 0,%$& H QHO QXRYR &RGLFH GHL EHQL FXOWXUDOL H GHO SDHVDJJLR e nel solco di una proiezione verso quella necessaria innovazione afferente alle proposte di smart innovation applicate al patrimonio culturale presentate GDOOD8QLRQH(XURSHDFRQLOSLDQRHorizon 2020, DATABENC intende contribuire alla piena e concreta affermazione della cultura quale fonte di generazione ed alimentazione dei processi di riconversione creativa, innovativa e sostenibili dei sistemi di sviluppo territoriale tradizionali. ,QWDOHFRQWHVWRLOGLVWUHWWRLQWHQGHSURFHGHUHQHOODGHĂ&#x20AC;QL]LRQHGLSURJHWWL

42

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

Pertanto DATABENC si propone come distretto tecnologico per i beni culturali non nellâ&#x20AC;&#x2122;accezione di un organismo incentrato sulla sola produzione di nuove tecnologie, ma piuttosto come un catalizzatore di sinergie ed abilitatore di VROX]LRQLHGDSSOLFD]LRQLLQQRYDWLYHLOWHUPLQH´WHFQRORJLDÂľVLDPSOLDĂ&#x20AC;QRD comprendere quello di metodologia per lo sviluppo di nuovi processi, prodotti, PHUFDWLHVHUYL]LLGRQHLDUHQGHUHXQFHUWRVSD]LR´LQWHOOLJHQWHÂľ L.P.: Per realizzare gli interventi individuati quali sono le linee progettuali strategiche su cui il distretto opererĂ ? A.C.: Il fattore chiave della svolta introdotta dal Distretto consiste nella nuova ottica con cui si può affrontare il grave problema della tutela e valorizzazione GHOSDWULPRQLRFXOWXUDOHPLUDQGRDGXQDGLPHQVLRQHGLVLVWHPDFKHIDFFLD della Campania una regione dellâ&#x20AC;&#x2122;innovazione, un centro di produzione e diffusione di cultura capace di attrarre non solo capitali economici ma anche, e soprattutto, capitali umani. In particolare gli ambiti di intervento del Distretto si sviluppano su tre linee portanti: 1 la Conoscenza integrata, SHUFKp OD SULPD IRUPD GL WXWHOD GL XQ EHQH q QHOODVXDFRQRVFHQ]D3HUWDOHPRWLYRqQHFHVVDULRUHDOL]]DUHXQHVDXULHQWH sistema di salvaguardia cognitiva del patrimonio culturale (ad esempio, LQGDJLQL FHQVXDULH PDSSDWXUH GL SUHHVLVWHQ]H FDUWRJUDĂ&#x20AC;H GHO ULVFKLR piattaforme digitali, itinerari di formazione/divulgazione). 2 il Monitoraggio diagnosticoLQTXDQWRDLĂ&#x20AC;QLGHOODWXWHODGLXQEHQHULVXOWD indispensabile il monitoraggio diagnostico inteso in senso ampio, che non VL OLPLWD VROR DOOD YHULĂ&#x20AC;FD GHOO¡LQWHJULWj PDWHULDOH GHO EHQH VWHVVR PD VL HVWHQGHDQFKHDOO¡DUHDLQFXLLOEHQHqLQVHULWRRDOOHGLQDPLFKHWXULVWLFKH che lo coinvolgono e che comunque provocano stress e consunzione GHO EHQH $ WDOH VFRSR q QHFHVVDULR VWUXWWXUDUH XQ VLVWHPD LQWHJUDWR GL salvaguardia conservativa che comprenda, ad esempio, analisi precoci di vulnerabilitĂ  (territoriali, strutturali, ecologiche, ecc.), test sperimentali (materiali, ricostruttivi, prototipali, ecc.), valutazioni socio-â&#x20AC;?economiche ed attitudinali (rilevazione densitĂ  di carico e (ri-â&#x20AC;?)funzionalizzazione siti/ beni). 3 la Fruizione sostenibile per la quale lâ&#x20AC;&#x2122;aspetto fondamentale del bene FXOWXUDOH q TXHOOR GHO VXR XWLOL]]R  3HU UDJJLXQJHUH XQ XWLOL]]R GHO patrimonio culturale che sia sostenibile si rende necessario, ad esempio, la realizzazione di soluzioni per lâ&#x20AC;&#x2122;interazione utente/visitatore (on-â&#x20AC;? VLWH RQOLQH GD UHPRWR  DWWUDYHUVR SHUFRUVL GL UHDOWj Ă&#x20AC;VLFD VFHQRJUDĂ&#x20AC;D ' PHGLD LPPHUVLYLWj IUXL]LRQH VLQJRODPXOWLSOD  GL UHDOWj DXPHQWDWD su piattaforma mobile (modalitĂ  ravvicinata, alta immersivitĂ , fruizione singola/multipla), applicazioni di ricostruzione virtuale (modalitĂ  da remoto, limitata immersivitĂ , fruizione singola/multipla), itinerari di apprendimento (formazione/divulgazione). L.P.: Si è attivato il primo laboratorio di ricerca del distretto: UNINA DATABENC lab. Qual è la particolaritĂ  di questo laboratorio? A.C.:,OODERUDWRULRDWWLYDWRGDOO¡8QLYHUVLWjGL1DSROLYXROHSURSRUVLFRPHOXR-â&#x20AC;? go di confronto aperto non solo ai ricercatori ed agli esperti del mondo delle imprese, ma anche e soprattutto a dottorandi e tesisti per lo svolgimento del loro lavoro. Con unâ&#x20AC;&#x2122;attenzione al confronto tra settori disciplinari diversi per sviluppare un linguaggio comune tra tecnologici ed esperti del mondo dei Beni &XOWXUDOLFKHDEELDO¡RELHWWLYRGLVYLOXSSDUHPHWRGRORJLHHIĂ&#x20AC;FDFLLQJUDGRGL far crescere lâ&#x20AC;&#x2122;interesse sul patrimonio culturale. DatabencLab nasce per essere il punto di riferimento per lo sviluppo di tec-â&#x20AC;? nologie basate sulla metafora degli oggetti capaci di parlare. Per comunicare la loro storia, la loro vita. Con modalitĂ  che si adattano ai gusti e alle attese dellâ&#x20AC;&#x2122;interlocutore. Inoltre il laboratorio vuole candidarsi come centro di riferimento per la pro-â&#x20AC;? gettazione e lo sviluppo di percorsi e processi supportati dalle piĂš moderne tecnologie per dominare ed organizzare lâ&#x20AC;&#x2122;enorme e polimorfa massa critica di informazioni sulle opere dâ&#x20AC;&#x2122;arte con modelli di fruizione avanzata basati, da una parte, sullâ&#x20AC;&#x2122;attrattiva esercitata dalle piĂš recenti e affascinanti tecnologie ICT (smart environment and technologies) e, dallâ&#x20AC;&#x2122;altra, sulla necessitĂ  di forte personalizzazione e partecipazione, implementando metodologie di analisi dei SURĂ&#x20AC;OLGHJOLXWHQWLHGLFRLQYROJLPHQWRVRFLDOH VRFLDOQHWZRUNLQJ  3HUUDJJLXQJHUHLVXRLRELHWWLYLLOODERUDWRULRSXQWDDOODGHĂ&#x20AC;QL]LRQHGLXQSUR-â&#x20AC;? cesso che generi, diffonda, trattenga valore partendo dalle informazioni, rielaborandole, ristrutturandole e riproponendole nelle forme piĂš avanzate GLFRQRVFHQ]D7DOHFRQĂ&#x20AC;JXUD]LRQHVLHVSOLFLWDLQSHUFRUVLSDUDOOHOLGDTXHOOL mirati alla realizzazione di sistemi a supporto degli esperti di dominio del si-â&#x20AC;? stema dei Beni Culturali (piattaforma di Authoring), atti a favorire e stimolare la raccolta, catalogazione e successiva normalizzazione delle informazioni di valore relative ad un oggetto dâ&#x20AC;&#x2122;arte, a quelli destinati allâ&#x20AC;&#x2122;analisi comporta-â&#x20AC;? PHQWDOHGHLIUXLWRULGLXQ¡DPELHQWD]LRQHPXVHDOH SLDWWDIRUPDGL3URĂ&#x20AC;OLQJ Ă&#x20AC;-â&#x20AC;? QDOL]]DWLDOO¡DSSUHQGLPHQWRGHLJXVWLHSUHIHUHQ]HGLTXHVWLXOWLPL,GXHĂ XVVL che mettono a disposizione i contenuti relativi agli oggetti dâ&#x20AC;&#x2122;arte (contenuti disponibili da proporre) e le preferenze degli utenti (a chi/cosa proporre),

43

FRQYHUJRQRLQXQXQLFRSURFHVVRĂ&#x20AC;QDOHPLUDWRDOODVHOH]LRQHVWUXWWXUD]LRQHH comunicazione della conoscenza, altamente personalizzato (come proporlo). La frontiera della comunicazione della conoscenza si sposta, dunque, da un PRGHOORGLIUXL]LRQHSRFRGLIIHUHQ]LDWR RQHWRPDQ\ DGXQPRGHOORSOXUDOL-â&#x20AC;? stico (one to one), in cui ogni percorso può potenzialmente assumere diversi JUDGLGLSHUVRQDOL]]D]LRQHHOHRS]LRQLGLVHOH]LRQHVRQRDIĂ&#x20AC;GDWHDOIUXLWRUH stesso. Tale evoluto modello, applicato al cultural heritage, pone al centro del per-â&#x20AC;? corso non piĂš lâ&#x20AC;&#x2122;oggetto in quanto tale, ma il rapporto della conoscenza dello stesso ed il fruitore. Questâ&#x20AC;&#x2122;ultimo diventa protagonista del proprio percorso, scegliendo gli oggetti della sua visita, la tipologia di contenuti dâ&#x20AC;&#x2122;interesse, le modalitĂ ed i protocolli di interazione e comunicazione. ,OVHQVRGHOO¡2SHUD3DUODQWHqTXHOORGLXQ¡HVSUHVVLRQHDUWLVWLFDSHUYDVLYDFKH si racconta, che stimola e coinvolge proattivamente il fruitore rendendolo promotore della sua esperienza cognitiva e sensoriale del bene culturale. Con XQFDQDOH´SLORWDÂľSUHIHUHQ]LDOHDWWUDYHUVRFXLODIUXL]LRQHDYDQ]DWDSXzSUHQ-â&#x20AC;? dere corpo e attraverso cui lâ&#x20AC;&#x2122;opera può animarsi e raccontarsi rappresentato GDOOH0RELOH$SSVYLOXSSDWHSHUGLVSRVLWLYL´VPDUWÂľ VPDUWSKRQHHRWDEOHW  Attraverso opportuni meccanismi di registrazione degli utenti e di connessione FRQOHWHFQRORJLHVHQVRULVWLFKHGLFXLqGRWDWDODVLQJRODRSHUDG¡DUWHO¡XWHQWH viene a contatto dei contenuti di suo interesse semplicemente avvicinandosi allâ&#x20AC;&#x2122;oggetto. Non di meno, lâ&#x20AC;&#x2122;utente può anche effettuare esplicita richiesta di contenuti non suggeriti, elaborandoli per la costruzione di un percorso ad hoc. L.P.: Cosa intende proporre il DATABENC in funzione di Horizon 2020? A.C.: Negli obiettivi giĂ  GLFKLDUDWL GHOO¡8QLRQH HX-â&#x20AC;? ropea, il nuovo ciclo di pro-â&#x20AC;? grammazione dei fondi eu-â&#x20AC;? URSHLSHUJOLDQQL attraverso il Programma (8523$&5($7,9$DVVHJQHUj alla cultura e allâ&#x20AC;&#x2122;industria creativa piĂš di un miliardo di euro. DATABENC nelle sue azioni sostiene che il driver Cultura riveste unâ&#x20AC;&#x2122;importanza prioritaria soprattutto in quei paesi maggior-â&#x20AC;? mente dotati di giacimenti di beni culturali immobili e mobili, TXDO q OD &DPSDQLDFRQLVXRLQXPHURVLVLWL81(6&2 /DFXOWXUDGLYHQWDFRVuXQRGHLIDWWRULFKHVWDQQRDOO¡RULJLQHGHOVLVWHPDGHO valore, il canale per eccellenza attraverso cui affermare e attestare un diffuso orientamento sociale verso il nuovo, il diverso, il non previsto. La cultura rien-â&#x20AC;? WUDFRQSDULGLJQLWjULVSHWWRDOODULFHUFDVFLHQWLĂ&#x20AC;FDHWHFQRORJLFDQHOULVWUHWWR ambito della core creativity e della core innovation, ovvero nei fondamentali dellâ&#x20AC;&#x2122;economia della conoscenza. Trasformare il territorio, italiano in generale e della Campania in particola-â&#x20AC;? re, in cittĂ /regioni dellâ&#x20AC;&#x2122;innovazione, vuol dire in primo luogo trasformarle in luoghi culturalmente vivi, propositivi, internazionali per vocazione, capaci di offrire ai loro residenti e soprattutto ai giovani continue opportunitĂ  di espe-â&#x20AC;? ULHQ]HVWLPRODQWLXPDQDPHQWHHGLQWHOOHWWXDOPHQWHTXDOLĂ&#x20AC;FDQWLIRUWHPHQWH motivanti allâ&#x20AC;&#x2122;investimento personale in nuove competenze. In assoluta coerenza con le direttive europee, lâ&#x20AC;&#x2122;azione di DATABENC sarĂ  quin-â&#x20AC;? GLRULHQWDWDDOODGLIIXVLRQHGLXQDSSURFFLR60$57QHJOLDPELWLGHOOD&RQVHUYD-â&#x20AC;? ]LRQH9DORUL]]D]LRQH)UXL]LRQHGHL%HQL&XOWXUDOLJDUDQWHQGRQHOD6LFXUH]]D e puntando ad una forte Innovazione.

RIFERIMENTI www.databenc.it

ABSTRACT Born in 2012 DATABENC, District of High Technology for Cultural Heritage was created to implement a strategic plan for the man-â&#x20AC;? agement and enhancement of cultural heritage of the region of Campania. We met the President Angelo Chianese.

PAROLE CHIAVE 5LFHUFDEHQLFXOWXUDOLWHFQRORJLHLQQRYD]LRQH

AUTORE LUCA PAPI luca.papi@cnr.it

DIPARTIMENTO INGEGNERIA ICT E TECNOLOGIE TRASPORTI â&#x20AC;&#x201C; CNR ROMA

I

PER Lâ&#x20AC;&#x2122;ENERGIA E


FORUM

MEMNONE di Francesca Salvemini 0LVXUDFPGLGLDPHWURLOJORERGHOO¡$WODQWH)DUQHVH 0$11  con il cosmo a rilievo tra i tracciati dellâ&#x20AC;&#x2122;equatore, dei tropici e dei coluri equinoziali e solstiziali. La scultura, non senza con-â&#x20AC;? WUDGGL]LRQLULWHQLELOHODPXWLOD)DEL1ODVFLDDIĂ&#x20AC;RUDUHVXOODFDORW-â&#x20AC;? ta delle costellazioni il centauro del Sagittario con la nave Argo, suddivisa da Nicolas Louis De Lacaille. Le due formazioni di VWHOOHVRQRFDPSLWHVXOODVXSHUĂ&#x20AC;FLHWUDOHPDQLGHOODVWDWXDFKH VRUUHJJHODVIHUDROWUH3HJDVRH2ULRQHQHOOD]RQDGHO&DSUL-â&#x20AC;? corno, del Cancro, del Serpente, dellâ&#x20AC;&#x2122;Anfora o dellâ&#x20AC;&#x2122;Acquario e GHOOR6FRUSLRQHHRSSRVWH3HVFL$ULHWH$TXLOD'HOĂ&#x20AC;QR$XULJD tra le altre, incluse le osservabili dallâ&#x20AC;&#x2122;emisfero australe. Il se-â&#x20AC;? gno lasciato dal planetario nellâ&#x20AC;&#x2122;universo mediceo dei Prigioni di 0LFKHODQJHOR FKH FRPSDUH ROWUH FKH QHOOH UDIĂ&#x20AC;JXUD]LRQL GL Ercole sulle bordure di arazzi da Raffaello con Storie di S. Paolo 3DOD]]L9DWLFDQL3DOD]]R'XFDOHGL0DQWRYD QHJOLLQGDFLGHOOH calotte degli arcosoli absidali della Sacrestia Vecchia di S. Lo-â&#x20AC;? renzo e, parziale il suo complesso recupero nei restauri del GHOOD&DSSHOODGHL3D]]LLQ6DQWD&URFHD)LUHQ]HqWXWWR-â&#x20AC;? UDLQHVWULFDELOHGDOOHVHTXHQ]HGHOOR=RGLDFRFKHFRQDOWHUQDQ-â&#x20AC;? WHYDOHQ]DDVWURORJLFDRURVFRSLFDHGDVWURQRPLFDqUDSSUHVHQ-â&#x20AC;? tato nelle residenze nobiliari rinascimentali sparse sul territo-â&#x20AC;? rio italiano. Le costellazioni che furono affrescate da Baldassar-â&#x20AC;? UH3HUX]]LQHOODYROWDGHOODORJJLDGL*DODWHDGHOOD9LOOD)DUQHVL-â&#x20AC;? na a Roma, situando il globo ovidiano sotto i piedi del genio nudo negli scomparti a monocromo dei pennacchi, rappresen-â&#x20AC;? WDQRXQSODQLVIHURPLWRSRLHWLFRFKHLQFOXGHOR=RGLDFRULTXD-â&#x20AC;? drato da esagoni. La proiezione svolta a grande scala del plane-â&#x20AC;? WDULRYLqĂ&#x20AC;JXUDWDLQXQDFRPSOHVVDĂ&#x20AC;ORORJLDGDUHSHUWLDUFKHR-â&#x20AC;? ORJLFL VWDWXDUL LGHQWLĂ&#x20AC;FDWL FRQ OD VLPERORJLD DVWURQRPLFD GHO EDVVRULOLHYRGHOODVIHUD)DUQHVH)UDJOLitineraria picta,qQHOOD Scuola dâ&#x20AC;&#x2122;Atene della Stanza della Segnatura che il globo ricorre QHOGXSOLFHDVSHWWRĂ&#x20AC;FLQLDQRGLPDSSDPRQGRHGLPDFURFRVPR che nella sfera marmorea vaticana (giĂ Rondanini o Rondinini) qDWWUDYHUVDWRGDOODIDVFLD]RGLDFDOHHGqULSHWXWRQHOULTXDGUR GHO3ULPR0RELOHGHOODYROWDWUDOHEUDFFLDGHOJHQLRVXOO¡DUFR-â&#x20AC;? ne, come nel medaglione della vela destra sullo sfondo, e in due dei monocromi dellâ&#x20AC;&#x2122;alto zoccolo sottostante, che rappre-â&#x20AC;? sentano la Logica velata, contrapposta alla Dottrina allâ&#x20AC;&#x2122;altra HVWUHPLWjHOD'LVSXWDGHL0DJL/DVLPXOD]LRQHGHLĂ&#x20AC;QWLEDVVR-â&#x20AC;? ULOLHYLXQRGHLTXDOLLQEDVVRDGHVWUDQHOO¡DIIUHVFRUDIĂ&#x20AC;JXUDLO ULOLHYR0HGLFLFRQ&LPRWRHVXOO¡LSSRFDPSRGDOOD*DODWHDGHOOD Casa di Livia sul Palatino, e delle spalliere di Giovanni Giocondo GD9HURQDSUHHVLVWHQWLDO6DFFRGL5RPDGHOWHVWLPRQLH-â&#x20AC;? rebbe nella Stanza il conseguente restauro ad opera di Seba-â&#x20AC;? stiano del Piombo, sebbene la restituzione del globo marmoreo costellato dal brillio lossodromico dei raggi luminosi delle stelle sia dissimulata dallâ&#x20AC;&#x2122;effetto atmosferico a cascata di un pallone areostatico compresso nellâ&#x20AC;&#x2122;Amore Giustiniani di Caravaggio. Tra il primo ed il secondo decennio del Cinquecento, Peruzzi, FKHGL9LOOD)DUQHVLQDHUDDUFKLWHWWRYHQLYDFHOHEUDWRSHUJOL DIIUHVFKLGHOĂ&#x20AC;QWRSRUWLFRQHOOD6DODGHOOHSURVSHWWLYHGDOSUL-â&#x20AC;? PRSLDQRGHOODFRVWUX]LRQHDSHUWRVXJOLHGLĂ&#x20AC;FLDQWLFKL e moder-â&#x20AC;? ni svettanti nel panorama di Trastevere, il Campidoglio, lâ&#x20AC;&#x2122;isola 7LEHULQDHGLO*LDQLFROR *9DVDUL>@Vita di Seba-â&#x20AC;? stian Viniziano e Vita di Baldassarre Peruzzi$'RQDWL$PVWHU-â&#x20AC;?

GDP   LQWHUFHWWDWR GDOOH Ă&#x20AC;QHVWUH QHOOD FDPHUD FKLDUD dellâ&#x20AC;&#x2122;intera sala nel foro della Regula. Ancora dissimulata dal vivo appare lâ&#x20AC;&#x2122;atmosfera di nove venti delle Metamorfosi in uc-â&#x20AC;? FHOOLGD3XEOLR2YLGLR1DVRQHQHOOHOXQHWWHGL6HEDVWLDQRGHO Piombo2, che, disposte su tre lati della Sala di Polifemo e Gala-â&#x20AC;? tea al piano terreno, ne sostiene la calotta picta costellata. Nella monocroma, la tecnica in chiaroscuro a biacca e pece dellâ&#x20AC;&#x2122;incrostatura che Giorgio Vasari attribuirĂ a Sebastiano del Piombo, e Raffaello Borghini, nellâ&#x20AC;&#x2122;altra loggia di Cupido e Psi-â&#x20AC;? che, agli stucchi e alle grottesche dallâ&#x20AC;&#x2122;antico di Giovanni da 8GLQHVLVWDJOLDORVFRUFLRGLXQDWHVWDFRORVVDOHGDVHPSUH apparsa agli esegeti enigmatica ed acrolitica sulla falsariga aneddotica dellâ&#x20AC;&#x2122;improvvisazione a tromp lâ&#x20AC;&#x2122;oeil, copiosi i coevi UHFXSHULQHJOLVFDYLDUFKHRORJLFLVXOFROOH2SSLR 5%RUJKLQL )LUHQ]HHG 1HOODVPLVXUDWDHGDFUREDWLFDHVWHPSRUDQHL-â&#x20AC;? WjGHOODVXDLQFOLQD]LRQHVFRUFLDWDULDO]DWDHULYROWDDOVRIĂ&#x20AC;WWR dal rilievo di un gigantesco frammento statuario capitolato a terra, assume le fattezze di un ritratto aneddotico in antico e alla stregua di una panoplia, analogo dellâ&#x20AC;&#x2122;Aristotele di Raffael-â&#x20AC;? ORFKHUDIĂ&#x20AC;JXUHUHEEH0LFKHODQJHORSHUODVRPLJOLDQ]DDOULWUDW-â&#x20AC;? WRFRQ)UDQFHVFR*RQ]DJDDO/RXYUHWUDGL]LRQDOPHQWHDVFULWWR tanto a Raffaello quanto a Sebastiano del Piombo, il quale nel &DSLWDQRGLYHQWXUDGL+DUWIRUGDYUHEEHHIĂ&#x20AC;JLDWR*LRYDQQLGDO-â&#x20AC;? OH%DQGH1HUH/DPRQXPHQWDOHWHVWDVEDUEDWDqDSSDUVDDOWUL-â&#x20AC;? PHQWLIHPPLQLOHHFRPHGL)UDQFHVFD2UGHDVFKLRGHOOD)RUQD-â&#x20AC;? ULQDFLRqXQVLPXODFUREODVRQLFRHSURPHWHLFRSDURGLFRGHOOD nascita di Elena dallâ&#x20AC;&#x2122;uovo nella metamorfosi di Giove in cigno, PXQLĂ&#x20AC;FHQ]DSHUODTXDOH(JLGLR*DOORDYUHEEHFRPSRVWRO¡HOH-â&#x20AC;? gia Cytherea (legata in miscellanea, BC, Accademia dei Lincei) H0LFKHODQJHORGDXQDVWDWXDGHOODGHDLOFDUWRQHFRQ9HQHUH che bacia Cupido, come sarĂ  Il RiposoGL5DIIDHOOR%RUJKLQL )L-â&#x20AC;? UHQ]H VXOODVFRUWDGHOO¡XPDQLVWD%HQHGHWWR9DUFKLDWHVWL-â&#x20AC;? moniare, che avrĂ  se non altro ispirato Bronzino nella graziosa WRUVLRQHGL&XSLGRFKHOHVĂ&#x20AC;ODLOGLDGHPDIUDLFDSHOOLVHQRQ Lorenzetto nello stiacciato donatelliano della formella di Vene-â&#x20AC;? UHDGDJLDWDFRQ&XSLGRGHOFRUWLOHGL0LFKHOR]]RD3DOD]]R0H-â&#x20AC;? GLFL5LFFDUGLD)LUHQ]H9HQHUHGLVWHVDVXOODFRQFKLJOLDqQHOO¡DI-â&#x20AC;? fresco pompeiano della Casa di Venere e nel gesto di acconciar-â&#x20AC;? VLLFDSHOOLQHOUHSHUWRULRPXVLYRGD6XZHLGDLQ6LULD 01' HLQ Tunisia. La scultura dellâ&#x20AC;&#x2122;archetto alluderebbe al vario colorito statuario dei colossi, tra cui quello della dea Roma, colorito che DQFKH %DOGDVVDUUH UHVWLWXu ELDQFDVWUR QHL EXVWL PDUPRUHL GL $FRQWHR FRPH GL )LQHR WUD OH Ă&#x20AC;JXUH LPSLHWULWH GD 0HGXVD nellâ&#x20AC;&#x2122;ottagono di Perseo della volta, se non la mole leggendaria del colosso di Costantino nel â&#x20AC;&#x2DC;Portico della dea Romaâ&#x20AC;&#x2122; di Palaz-â&#x20AC;? zo dei Conservatori, nella tradizione dellâ&#x20AC;&#x2122;immaginario pliniano apollineo del colosso di rame di Carete Lindio e di Lachete VROOHYDWRGD9HVSDVLDQRD5RGLHODVXDPDJQLĂ&#x20AC;FHQ]DIUDLVHWWH colossi romani. Saranno Benedetto Varchi e Giorgio Vasari a diffondersi sul restauro di antichitĂ  e statue frammentarie e sulla loro ricostruzione policroma in antico ad opera di Seba-â&#x20AC;? stiano del Piombo scultore (G. Vasari, Vita di Michelangelo)L-â&#x20AC;? UHQ]H   DO WHPSR GHOOR VFDYR D &DUDFDOOD FKH QHO  SRUWHUjDOODOXFHLO7RUR)DUQHVHDQFRUDLQDWWXDWRLOFROOHJD-â&#x20AC;? PHQWRGHOOHSURSULHWjGL3DROR,,,D&DPSRGHL)LRULHVWHVHDOOD villa Chigi sulla sponda opposta del Tevere. Tra le allegorie del-â&#x20AC;? le tavole o fasi di Venere delle lunette la gigantesca testa, GDOODIDYRODRYLGLDQDGL0HPQRQH allâ&#x20AC;&#x2122;umanesimo archeologico boccaccesco (Genealogiae3DULJL9, UDSSUHVHQWDYDLO

 /0DXUR *LRYDQQL7DUFDJQRWDSVHXG 8$OGURYDQGL9HQH]LD &RORSKRQ>PLVFHOODQHD@

 /'ROFH9HQH]LD*9DVDUL/H9LWHFLWHSDVVLP*% $UPHQLQL5DYHQQD>@*&HOLR>@1DSROL&'DWL)LUHQ]H )7LWL5RPD)%DOGLQXFFL)LUHQ]H>@$'DOPD]]RQL5RPD $9HQWXUL0LODQR

44

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

tramonto eliaco del pianeta, come ne dirĂ lâ&#x20AC;&#x2122;Idea>@GL*LR-â&#x20AC;? YDQ3LHWUR%HOORUL´Ben può dunque chiamarsi questâ&#x20AC;&#x2122;idea per-â&#x20AC;? fezione della natura, miracolo dellâ&#x20AC;&#x2122;arteâ&#x20AC;Ś sole che dallâ&#x20AC;&#x2122;Oriente inspira la statua di MemnoneÂľ1HOQHODe Viridario Augu-â&#x20AC;? stini Chigii dello stesso Gallo, cinque dei nove sottarchi sembra-â&#x20AC;? vano aver preso corpo nella loggia della villa pliniana ed otto erano cantati, sotto lo pseudonimo di Blosio Palladio romano, dal Suburbanum Augustini ChisiiFRPHOH´Tavole di Venere e SoleÂľ ´RhodusÂľ GHO7HPSLRGL9HQHUHVXOODYDOOHGHO&RORVVHR nella tela di Aracne del pittore e del poeta, i luoghi delle appa-â&#x20AC;? rizioni di Venere ricordati da Virgilio, e delle stasi di Venere e Cupido. Nell'altra loggia dove lâ&#x20AC;&#x2122;acconciatura della dea nel pen-â&#x20AC;? nacchio del Carro di Venere di Giulio Romano appare ripresa dalla Venere capitolina, assumendone come superstite nei re-â&#x20AC;? VWDXULGL&DUOR0DUDWWDLOPRGHOORFRPHO¡DUDOGLFRQHO0HUFXULR &DSLWROLQR H LO ODWRUH QHO 0HGLFL DJOL 8IĂ&#x20AC;]L DWWLQWL GDOOH GXH YHOHHO¡DQĂ&#x20AC;WULRQLGHGHO/XGRYLVLDO0XVHR1D]LRQDOH5RPDQRGL Palazzo Altemps del Convito. Le sculture della dea farnesiane, HUHWWDHGDFFRYDFFLDWDFRQ(URV 0$11 FKHVDUDQQRGHVFULWWH SULYDGHOOHPDQLQHOJLDUGLQRFKLJLDQRHQHO3DOD]]R)DUQHVHGD 8OLVVH$OGURYDQGLDYUHEEHURLVSLUDWRLGXHSHQQDFFKLQHOODORJ-â&#x20AC;? JLDGL3VLFKHOD9HQHUHGLSURĂ&#x20AC;ORGLSLQWDVHGXWDDEUDFFLRWHVR con Cupido frecciato, e la torsione della testa della Grazia di GRUVRDOOXVLRQHGL5DIIDHOORDOO¡LGHDGL)LORVWUDWRGHOO¡LPSDUDJR-â&#x20AC;? QDELOH$SHOOH,QVWLOODWRLQROWUHLPRWLLQHQDUUDELOLGL)XOJHQ]LR nellâ&#x20AC;&#x2122;atteggiamento pudico di Venere con lâ&#x20AC;&#x2122;ippocampo dellâ&#x20AC;&#x2122;esa-â&#x20AC;? gono della loggia di Galatea e, contaminato dalla reinvenzione raffaellesca, del pennacchio con Cerere e Giunone nel Trionfo di Cupido e Psiche, argomento dei misteri della villa pompeia-â&#x20AC;? QD'LVFHVDGDOO¡HVWHQVHVHGXWDGHL0XVHLYDWLFDQLDOWULPHQWL GHVFULWWDGD$OGURYDQGL´seminudaÂľHFRQGXHDPRULQL (URVHG $QWHURV QHOO¡DJUXPHWRGL9LOOD)DUQHVLQDOD9HQHUHQHOODSURYD di Psiche del dono di Proserpina della loggia. La Cytherea di (JLGLR*DOORGHOHVDOWHUHEEHTXLQGLO¡$IURGLWH accovaccia-â&#x20AC;? ta )DUQHVH *%&DYDOLHULAntiquarum statuarum urbis Romae >WY@Âś9HQXVFRUROODULDLQDHGLEXV)DUQHVLDQL¡5RPD/ Vaccaro, idem5RPD GDOOD9HQHUHGL'HGDOVD R'RLGDO-â&#x20AC;? VDV QHO3RUWLFRG¡2WWDYLDD5RPDGHVFULWWDGD3OLQLR´lavantem seseÂľ1RQVROWDQWRGDOOHLQFLVLRQLQRWDD:LQFNHOPDQQQHOO¡DV-â&#x20AC;? VHWWRDFFRYDFFLDWRGLVDUPDQWH(URV 0$11 DSSDUHVXOGHOĂ&#x20AC;QR nellâ&#x20AC;&#x2122;affresco dei Carracci mentre addita Elena, nel vasto reper-â&#x20AC;? WRULRVFXOWRUHRGDOO¡DQWLFRGHOOD*DOOHULDGL3DOD]]R)DUQHVH $ Carracci, Cartone del riquadro di Elena e Proteo della Galleria )DUQHVH1DWLRQDO*DOOHU\'UDZLQJV/RQGUD 1HOJHVWRSRPSH-â&#x20AC;? iano di raccogliersi i capelli della Venere dellâ&#x20AC;&#x2122;esagono della Sala GL*DODWHDHGHOULWUDWWRGL7L]LDQRG¡,VDEHOODG¡(VWHFRPH0DG-â&#x20AC;? GDOHQDDO/RXYUHGRY¡qHIĂ&#x20AC;JLDWR)UDQFHVFR*RQ]DJDFRPHGHO-â&#x20AC;? la Venere seduta allo specchio delle grottesche di Giulio Roma-â&#x20AC;? no nella stufetta del cardinal Bibbiena e di Siringa e Pan. Sono

45 censite quaranta copie in marmo dellâ&#x20AC;&#x2122;Afrodite accosciata: cin-â&#x20AC;? que QHO0XVHRQD]LRQDOHURPDQRWUDLO3DOD]]RGL7HUPLQLGHO 0DVVLPR  XQDGHOOHTXDOLFRQLOFLJQRO¡HVHPSODUH*LXVWLQLD-â&#x20AC;? QLHLO3DOD]]R$OWHPSV  XQDFRQLOGHOĂ&#x20AC;QR 'HOOD9DOOH XQD QHL 0XVHL 9DWLFDQL H DJOL 8IĂ&#x20AC;]L OD 0HGLFL 3$ 0DIIHL 5RPD  . Ritratti di spalle lâ&#x20AC;&#x2122;Eros capitolino nel Concilio, ritenuto anche provenire dalla raccolta di Girolamo Garimberti, al quale HUDDSSDUWHQXWRLOULOLHYRDODEDVWULQRGL)HWRQWHDOWUDPHPRULD dallâ&#x20AC;&#x2122;antico della lunetta di Cigno della Sala di Galatea, e il Ga-â&#x20AC;? QLPHGHGL*LRYDQ)UDQFHVFR3HQQLFKHSRUJHD*LRYHODFRSSD QHO&RQYLWRGHLĂ&#x20AC;QWLDUD]]LGHOODYROWDGHO7ULRQIRGL$PRUHH Psiche dalle Metamorfosi di Apuleio, dove il persuasivo pennac-â&#x20AC;? FKLR FKH 9DVDUL GLUj GL ´Giove che con grazia celeste bacia GanimedeÂľVDUjHPHQGDWRLQ*LRYHH&XSLGRGD*LRYDQ3LHWUR Bellori. Anastilosi inoltre dal Laocoonte, dalla Venere da Pras-â&#x20AC;? sitele e dallâ&#x20AC;&#x2122;Apollo del Belvedere, collocati nellâ&#x20AC;&#x2122;Antiquarium YDWLFDQR QHO  ,GHQWLĂ&#x20AC;FDWL VHEEHQH QRQ FRQFRUGHPHQWH dalle incisioni delle Stanze GL$XUHOLR0RUDQL (XULDORG¡$VFROL pseud., Stanze sopra le statue di Laocoonte, di Venere et dâ&#x20AC;&#x2122;A-â&#x20AC;? SROOR5RPD FKHDFFHQQDDVXDYROWDDGXQD9HQHUHlar familiaris, e dai piĂš noti estensori di serie incisorie dedicate alle antichitĂ , sono esemplati scultoreamente negli esagoni e nei pennacchi dellâ&#x20AC;&#x2122;una come dellâ&#x20AC;&#x2122;altra loggia del viridario di Venere chigiano, affabulazione del transito del pianeta, che sarĂ  supposto regolare cervello e cuore nellâ&#x20AC;&#x2122;immaginativa di %RUJKLQL6HGDOOHSDJLQHHUXGLWHGL5LGROĂ&#x20AC;QR9HQXWLULDIĂ&#x20AC;RUHUj il criterio di astrazione dallâ&#x20AC;&#x2122;antico della lunetta monocroma della Sala di Galatea, lo sarĂ  come scaturito dal chiaroscuro michelangiolesco, per contrasto coloristico a Raffaello, nellâ&#x20AC;&#x2122;in-â&#x20AC;? WHUSUHWD]LRQHGLXQDWHVWDGL$OHVVDQGURLO0DFHGRQHLQFRQFRU-â&#x20AC;? danza agli affreschi di Sodoma della sala della villa dedicata ad $OHVVDQGUR0DJQRFRVuFRP¡HUDUHVWLWXLWRGDL&DUUDFFLHGDOOD critica belloriana del modello di bellezza, alla statura umana il minuto simulacro prometeico di Venere rinascimentale. La te-â&#x20AC;? sta di un colosso ramesside appartiene alle vestigia del sito di Eliopoli, in declino dalla fondazione di Alessandria dâ&#x20AC;&#x2122;Egitto, di-â&#x20AC;? venuto un quartiere nei sobborghi del Cairo, che come Heliopo-â&#x20AC;? lis in Libano, Baalbek, designava un centro di espansione di Alessandro divinizzato nel sole.3HUX]]LUDIĂ&#x20AC;JXUzVWDWXDULDPHQ-â&#x20AC;? te le costellazioni di Cigno e dellâ&#x20AC;&#x2122;Auriga nelle vele del registro sovrastante il monocromo e, negli esagoni di Saturno e della Luna o Diana, dalla scultura con il cane appartenuta alla colle-â&#x20AC;? ]LRQH)DUQHVHVLPEROLFDPHQWHL3HVFLHGLO&DQH6FKLDFFLDWR sotto il peso di un ammasso lunare, Atlante campiva il disastra-â&#x20AC;? to fregio murale di Baldassare Peruzzi dellâ&#x20AC;&#x2122;epopea di Ercole  *3%HOORULDescrizione delle immagini dipinte da Raffaello dâ&#x20AC;&#x2122;Urbino nel Vaticano e di quelle alla Farnesina, Roma 1821, FXU00LVVL-â&#x20AC;? ULQL>3V\FKDHHW$PRULVQXSWLDH5RPD'RULJQ\VGOD)DYRODG¡$PRUHH 3VLFKHGHGLFDWDD)UDQFHVFR)DUQHVHGXFDGL3DUPDH3LDFHQ]DQHO@ %8$5RPD


QHOODVDOHWWDDOSLDQRWHUUHQRGL9LOOD)DUQHVLQDUHFXSHUDWRLQ-â&#x20AC;? tegrativamente a piĂš riprese nei secoli scorsi da restauri inter-â&#x20AC;? SUHWDWLYLSHUPH]]RGHOODGRFXPHQWD]LRQHGLIRWRJUDĂ&#x20AC;DVWRULFD seguiti nellâ&#x20AC;&#x2122;ultimo decennio da interventi di monitoraggio dei pigmenti terrigni nel ripristino, e dove speculare allâ&#x20AC;&#x2122;eroe con il FLQJKLDOHHULPDQ]LRqO¡HUPDGHOODVXDDVFHVDLOYDULRSLQWRSOD-â&#x20AC;? QHWDULRVXOOHVSDOOHGHOO¡(UFROHFDUUDFFHVFRGHO&DPHULQR)DU-â&#x20AC;? QHVHGHOSDOD]]RURPDQRD&DPSRGHL)LRULQHOODVWXGLDWDUHVD classicista della policromia del reperto antiquario della colle-â&#x20AC;? ]LRQH FODVVLĂ&#x20AC;FD XQ WHVWR UHVWLWXLWR H RVVHUYDWR DVWURQRPLFD-â&#x20AC;? PHQWH8QDSURLH]LRQHJUDĂ&#x20AC;FDTXDGULSDUWLWDGHOOR=RGLDFRGHO JORER)DUQHVHYHUUjLQFLVDGD)UDQFHVFR%LDQFKLQLFKHQHO aveva scavato sullâ&#x20AC;&#x2122;Aventino la cosiddetta Sphaera barbarica al Louvre, stele con le tavole di concordanza allâ&#x20AC;&#x2122;astrologia meso-â&#x20AC;? SRWDPLFDHSXEEOLFDWDQHOLOOXVWUDQGRODVWDWXDGL$WODQWH D&DSRGLPRQWHUHLQWHJUDWDGDJOLVFXOWRUL&DUORH)LOLSSR$OED-â&#x20AC;? FLQLDFFDGHPLFLGL6/XFD5LFKDUG%HQWOH\DYHYDHGLWRGDXQ decennio, corredato da concordanze di collimazione planisferi-â&#x20AC;? ca delle regioni imperiali al sistema di riferimento delle costel-â&#x20AC;? lazioni, lâ&#x20AC;&#x2122;AstronomiconGL0DUFR0DQLOLRO¡DWODQWHDXJXVWqRSHU GHĂ&#x20AC;QL]LRQHFKHDYUjUHVRSDOSDELOHDJOLVFLHQ]LDWLODJHRPHWULD descrittiva della scultura del globo e il moto ideale della tecni-â&#x20AC;? ca proiettiva della macchina archimedea. La statua parlante GHLFRORVVLGL$PHQRĂ&#x20AC; $PHQKRWHS,,,,5RVVHOOLQL3LVD D /X[RU GDOOD TXDOH XQ¡HFR q VHPEUDWD LQ RJQL WHPSR VLELODUH PDOLQFRQLFDPHQWHYHQQHLGHQWLĂ&#x20AC;FDWDGD3DXVDQLDFRQO¡HURH della Tebe egiziana e da Strabone illustrata come rappresenta-â&#x20AC;? WLYDGHO´MennonioÂľGL7HEH&RSHUWDGLLVFUL]LRQLVRSUDWWXWWRLQ greco, afferiva ad un gruppo frammentario di almeno quattro HOHPHQWL 8Q EXVWR UDPHVVLGH DWWHUUDWR GHWWR GHO JLRYDQH 0HPQRQH YHQQH WUDVSRUWDWR DO %ULWLVK 0XVHXP D /RQGUD GD *LRYDQQL%DWWLVWD%HO]RQLQHO5HFDDQFKHLOGLDGHPDHGq SRVWHULRUPHQWHLQFLVRGDXQ¡LVFUL]LRQHLQJHURJOLĂ&#x20AC;FL,OVDFHOORGL 1HEDPRQVFRSHUWRGD$OH[DQGHU+HQU\5KLQGQHOODQHFURSROL GL6KULNK$EG(O4XUQDD7HEHQHOHOHVXHWHPSHUHVWDF-â&#x20AC;? FDWHSHUYHQXWHLQSDUWHDO%ULWLVK0XVHXPHULDOOHVWLWHLQXQ XQLFRDPELHQWHQHOFODVVLĂ&#x20AC;FDFULSWLFDPHQWHODOHJJHQGD omerica nella dinastia di Amenhotep II. Tra le piĂš note: il labi-â&#x20AC;? rinto di Apis, la pesatura del cuore simboleggiato dalle anatre, la musica ed il giardino celestiale accompagnano nei reperti il passaggio dellâ&#x20AC;&#x2122;arciere sepolto sulle acque nilotiche tra una mi-â&#x20AC;? riade di uccelli, bianco lâ&#x20AC;&#x2122;avvoltoio. 1HO Ă&#x20AC;QWR DUFR GL YLOOD )DUQHVLQD LO JLJDQWHVFR DXULJD QRQ VFHYUR GD DVVRQDQ]H DOOD Ă&#x20AC;HUH]]D GHOOD PLUD GHO 'DYLG

michelangiolesco, che nel dire dantesco di Vasari, ad ogni altro VĂ&#x20AC;GDQWHDYUHEEHWROWR´il gridoÂľIDHFRQHOODPLPHVLGHOVXR nicchione oltre il giardino e le nubi, alla litania di Polifemo, mentre il suo sguardo diverge alla fuga della conclusione di Apelle descritta da Lorenzo Ghiberti, come il metonimico tromp lâ&#x20AC;&#x2122;oeil GHO SDUDJRQH GL =HXVL H 3DUUDVLR LQYDOVD QHO repertorio rinascimentale dalle citazioni e dalle metafore pliniane. Lâ&#x20AC;&#x2122;aurora della camera picta mantegnesca in ciascuna lunetta, al vertice delle antiche cittĂ del globo, sorge nel volo di pernici, sacre al labirinto, cigni, gallinelle, aquile, nibbi, corvi, pavoni, allodole, usignoli, rondini, upupa e gazze. Lâ&#x20AC;&#x2122;allegoria PHGXVqD GHOOD FDORWWD FLUFXPSRODUH YLUWXDOPHQWH VRVWHQXWD GDL Ă&#x20AC;QWL DUFKHWWL GHOOD VDOD FRUULVSRQGH QHOOD OXQHWWD DQFKH DWWULEXLWDD3HUX]]LGD*DVSDUH&HOLRH)LOLSSR7LWLDOO¡DUPRQLD GHJOL XFFHOOL 0HPQRQLGL GHOOH Metamorfosi (Met., Libro XIII,  FKHQHOO¡HSLFOHVLRYLGLDQDLGHQWLĂ&#x20AC;FDWLLQRJQLVSHFLH RUQLWRORJLFD GDL FRPPHQWDWRUL $ ) )DOFRQHWWL  ( )RUFHOOLQL  * 3DVFROL Poemi Conviviali /H 0QHPRQLGL oca o chiurlo), tra cui gli odierni Numididi o faraone ed il falco, come una costellazione si aprirono titanicamente a stormo GDOOH FHQHUL GL 0HPQRQH VIDYLOODQWL DOO¡DXURUD QRQ DSSHQD SHUFRUVR LO VROH L GRGLFL VHJQL GHOOR =RGLDFR FDPSHJJLDWR GDOOD TXDGUDWXUD DG HVDJRQL )UD JOL LQQXPHUHYROL YLVLWDWRUL HGDXWRULFKHGDOO¡DQWLFKLWjĂ&#x20AC;QRD-HDQ)UDQoRLV&KDPSROOLRQ KDQQRULFRUGDWRLOJHPLWRHYDQHVFHQWHGHLFRORVVLGL/X[RULO poeta nel suo materialismo cosmogonico, prosato da Plinio Seniore, collegava al mitico nido sul tempio di Iperione (Met., /LEUR ;9   GHOO¡XFFHOOR LPPRUWDOH FKLDPDWR IHQLFH GDJOL Assiri, o sferico vertice degli obelischi, le meraviglie delle cittĂ  adagiate sotto il sole al tempo in cui, secondo Strabone, LO QRPH 0HQQRQLR GDOOR VIUHFFLDQWH HWLRSLGH Ă&#x20AC;JOLR GL7LWRQH divenne pertinente allo ziggurat &KRJD =DQELO 5 *KLUVKPDQ  $WUHQWDFKLORPHWULGDOODFLWWjGL6XVD (ODPLWH LQ,UDQ VĂ&#x20AC;GDYDJOLDSVLGLURGLRHJL]LDQLHPHVRSRWDPLFLODEDELORQHVH 3RUWDGL,VKWDULOPDJLFRGL$QXDG8UXNHGL8ULQ,UDTEDEHOLFR SHUOHLQQXPHUHYROLLVFUL]LRQLVFDYDWRGD/HRQDUG:RROOH\ LO 3URJHWWR0$(GL&RRSHUD]LRQHLWDORLUDFKHQDLQFRUVRqVWDWR DYYLDWRQHOGD5&DUOXFFL)'¡DJRVWLQRH&/HRSDUGL  7UDOHDUFKLWHWWXUHPHPRUDELOLO¡DVWURQRPLDGL2YLGLRVLWXDYDLO &DPSLGRJOLRFKHVDUjVYHWWDQWHVXLFRORVVLGHL)RUL $'RQDWL $PVWHUGDP GRYHDOGLVLQFDQWRQHOO¡DQHOLWRGHJOLÂśHOLVVHL¡ o alisei ed al lamento poetico, al levarsi del canto del gallo echeggiavano oche (Met /LEUR ,,   FRPH UDFFRQWHUj %UXQHWWR/DWLQL 9HQH]LDHG 

46

ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

47

RECENSIONI

MESOPOTAMIA ANTICA. ARCHEOLOGIA

DEL PENSIERO CREATORE DI

MITI NEL PAESE DI

SUMER

E DI

ACCAD

AUTORE: MARCO RAMAZZOTTI EDIZIONE: ARTEMIDE EDITORE PAGINE: 387 PREZZO: 30 EURO ISBN: 8875751757

A

d un anno appena dallâ&#x20AC;&#x2122;uscita del quarto tesauro del monu-â&#x20AC;? mentale Corpus dei testi urartei edito dal CNR, a cura di Mirjo Salvini (Roma 2012), il compendio sullâ&#x20AC;&#x2122;Asia anteriore di 0DUFR 5DPD]]RWWL GHĂ&#x20AC;QLVFH XQ¡DXWRQRPLD DUWLVWLFD GHOOD Meso-â&#x20AC;? potamia antica (Roma 2013) con fondatezza e spessore. Se il FDWDORJRGLSDOHRJUDĂ&#x20AC;DGHOPDWHULDOHHSLJUDĂ&#x20AC;FRXUDUWRORJLFRVXL PROWHSOLFL VXSSRUWL FODVVLĂ&#x20AC;FDWL GDL ODSLGHL DL EURQ]HL DSHUWRVL nel 2008, è esaustivo, la silloge della complessa produzione ar-â&#x20AC;? WLVWLFDHGHPEOHPDWLFDGHOEDFLQRSDOHRVLULDQRQRQVLHVDXULVFH LQ6LULDHVSD]LDQGRGDOO¡DSSRUWRHEODLWDDWWUDYHUVRPDWHULDOLH reperti annoverati tra Anatolia, Palestina ed Iraq, ne avanza un approccio estetico e neostoricistico. Argomentato da tempo tra LSLULOHYDQWLHVHPSODWLHGDGGRWWLQHOO¡DPELWRXQVXJJHOORGD (EOD RUQDWR QHO FXOWR GL ,VKWDU /XFLDQR GL 6DPRVDWD 'H 6\ULD GHD FKHYLqLPSUHVVDFRQOHRQLELQDWLHODELULQWLFRPLQRWDXUL-â&#x20AC;? QR VXPHULFR q HVSRVWR QHO 0XVHR DUFKHRORJLFR GL$OHSSR FKH FRPH LO 0XVHR DUFKHRORJLFR QD]LRQDOH GL 'DPDVFR q FKLXVR DO SXEEOLFR PHQWUH OH VXH UDFFROWH YHQJRQR SUHVLGLDWH VXO FDP-â&#x20AC;? po per la sicurezza e la salvaguardia dei siti siriani. Il sigillo, DOO¡DVSHWWR ELDQFR DUJLOORVR UHFD SDUDGLJPDWLFD QHOOH WHRULH GL SHUVRQLĂ&#x20AC;FD]LRQL H ]RRPRUIzVL OD UDIĂ&#x20AC;JXUD]LRQH GL XQ XRPR FKH VRUUHJJH LQ HTXLOLEULR XQ GLVFR DQWURSRPRUĂ&#x20AC;FR D TXDWWUR IDFFH H GDOOH FXL EUDFFLD SHQGH LQ RUL]]RQWDOH OD WUHFFLD D GXH FDSL /¡DWWHQ]LRQHSHULOWLWDQRRLOGLRRO HVVHUHXPDQRV¡LGHQWLĂ&#x20AC;FKH-â&#x20AC;? UHEEHWDQWRQHOPLFURFRVPRDJULFRORHXUEDQRRWXUULWRTXDQ-â&#x20AC;? WRQHOPDFURFRVPRJOREDOHFKHVRUUHJJHVXOODWHVWDQHOVHFROR VFRUVRqHPHUVDGDOODVWUDWLJUDĂ&#x20AC;DDUFKHRORJLFDHGDOULOHYDPHQWR DHUHRDOODODWLWXGLQHGHOOHFXOWXUHPHVRDPHULFDQHDIURDVLDWLFKH HG RFFLGHQWDOL /¡DWOHWLFR DUWLIH[ GHOOD FUHWXOD HG LO VXR FRSUL-â&#x20AC;? FDSR YDULDPHQWH LQWHVL KDQQR VXVFLWDWR GDO ULQYHQLPHQWR XQ YLYDFHGLEDWWLWRLFRQRORJLFRULIHULWRDOQHPHVWXUULWRRVIHULFR ramesside o tolemaico,o radiato per analogie al sumerico Utu, D7XEDO&DLQR9XOFDQRRDOEHDWR*LOJDPHVRUHGL8UXNHDG

Atlante (al tempo della scoperta), e come tale connesso alla PLWRJUDĂ&#x20AC;DHDOO¡DSRWHRVLGL(UFROHLOYLUWXRVRWHODPRQHGHOODQX-â&#x20AC;? YRODRFHDQLFDGHOO¡DUWHJUHFDHGHOOHQLVWLFDFKHULFHYHGD$WODQWH L SRPL HVSHULGL /D QXEH FKH OD SRHVLD GL 2YLGLR KD LGHDOL]]DWR QHOJORERRFHDQLFRHGDVWUDOHHO¡DUWHURPDQDHODGDPDVFqQDD 5RPDKDULYHUVDWRQHOODVIHUDFRVWHOODWDVXOOHVSDOOHGHOO¡$WODQWH )DUQHVH GHO 0XVHR DUFKHRORJLFR QD]LRQDOH GL 1DSROL PDFURFR-â&#x20AC;? smo dellâ&#x20AC;&#x2122;enfasi classicista, non scevra da suggestione polemica LQIRU]DGLDFFRVWDPHQWLPHWDVLPEROLFLGHĂ DJUDQWLGLUHFHQWHKD ULDSHUWR XQ GLEDWWLWR DPSOLDWR FKH LO YROXPH GL 5DPD]]RWWL FR-â&#x20AC;? UDJJLRVDPHQWHDUULFFKLVFHGLDSSRUWLELEOLRJUDĂ&#x20AC;FLHGLFRQRJUDĂ&#x20AC;FL HVWHVL DQFKH VRWWR LO SURĂ&#x20AC;OR WHPDWLFR QRQ VROR DFFUHVFHQGR LQ serie ed in parallelo il corpus documentale sul versante artistico canonico e alterno della civiltĂ dellâ&#x20AC;&#x2122;Egeo e del vicino oriente an-â&#x20AC;? tico, ma sincronizzandone semiologicamente i valori polinomiali e scritturali piĂš insistenti e frequenti nel coacervo. Il parziale svolgimento del sigillo, ineditamente conformato dal confronto QHOOD FRPSDJLQH GL FULWLFD DUFKHRORJLFD GHO YROXPH FRQVHQWL-â&#x20AC;? UHEEHLQIRU]DGHOODFODVVLĂ&#x20AC;FD]LRQHGDSURWRWLSLDFFROWLQHOO¡LQ-â&#x20AC;? YROXFURVHPDQWLFRGHOFRPSOHVVRSURWRVLULDQRFKHULDIĂ&#x20AC;RUDQGR DOLYHOORVWUDWLJUDĂ&#x20AC;FRGDO3DOD]]R5HDOH*PHVRSRWDPLFRDFXWD-â&#x20AC;? PHQWHLQWHUSUHWDQRHVLJQLĂ&#x20AC;FDQRXUEDQRGHOSHULRGRSUHGLQDVWL-â&#x20AC;? co, di distinguere in area semitica urritala forma concoide delle monete, documentate consistentemente nella valenza storica GHOORVYLOXSSRGHOODVRFLHWjHGHOODSROLWLFDPHVRSRWDPLFKH A cura di Francesca Salvemini


OPEN SOURCE

L

e soluzioni software libere e open source sono ormai particolarmente diffuse tra i professionisti del settore cul-â&#x20AC;? WXUDOH SRLFKp FRPH JLj DEELDPR DYXWR modo di sottolineare, sono ormai numerosi i campi in cui tali soluzioni sono altamen-â&#x20AC;? WH FRPSHWLWLYH 0HQWUH L SURIHVVLRQLVWL H le aziende sono sempre piĂš interessati a queste soluzioni, nel settore pubblico cosa accade? Nella Pubblica Amministrazio-â&#x20AC;? QH O¡DFTXLVWR GHO VRIWZDUH q GLVFLSOLQDWR GDOO¡$UW  GHO &RGLFH GHOO¡$PPLQLVWUD-â&#x20AC;? ]LRQH'LJLWDOH '/JV LOTXDOHq VWDWRUHFHQWHPHQWHPRGLĂ&#x20AC;FDWRGDOOD/HJ-â&#x20AC;? JHFRQXQ¡LPSRUWDQWHQRYLWj/D precedente versione prevedeva la necessi-â&#x20AC;? tĂ di effettuare una comparazione di tipo tecnico-â&#x20AC;?economico tra: software sviluppa-â&#x20AC;? to per conto della PA o dalla stessa PA, sof-â&#x20AC;? tware proprietario, software libero/open VRXUFH QRQRVWDQWH FLz LQ TXHVWL DQQL OD PDJJLRUSDUWHGHJOLXIĂ&#x20AC;FLSXEEOLFLKDTXD-â&#x20AC;? si sempre scelto software proprietario. Il QXRYR $UW  FDPELD FRPSOHWDPHQWH OD situazione, prevedendo che lâ&#x20AC;&#x2122;acquisizione di software libero/open source e il ricorso a soluzioni giĂ  sviluppate allâ&#x20AC;&#x2122;interno della PA sia la regola generale, mentre lâ&#x20AC;&#x2122;acqui-â&#x20AC;? sizione di software di tipo proprietario co-â&#x20AC;? stituisce ora lâ&#x20AC;&#x2122;eccezione. Da questo punto GLYLVWDLO0L%$&7VLGLPRVWUDSDUWLFRODU-â&#x20AC;? mente virtuoso, adottando e incentivando l'utilizzo e lo sviluppo di soluzioni softwa-â&#x20AC;? re libere e open source giĂ  prima dell'en-â&#x20AC;? trata in vigore della nuova normativa, e gli esempi sono ormai numerosi.

029,2 5HFHQWHPHQWH q VWDWR SUHVHQWDWR 029,2 (www.movio.beniculturali.it) un applica-â&#x20AC;? WLYRUHDOL]]DWRGDOO¡,&&8JUD]LHDOFRQWUL-â&#x20AC;? EXWRGL)RQGD]LRQH7HOHFRP,WDOLD029,2 q XQ NLW FKH JOL LVWLWXWL FXOWXUDOL LWDOLDQL possono utilizzare per realizzare mostre YLUWXDOL RQOLQH (  FRPSRVWR GD &06 02-â&#x20AC;? 9,2SHUODUHDOL]]D]LRQHGLPRVWUHYLUWXDOL Ă&#x20AC;J   &06 029,2 YHUVLRQH PRELOH SHU GLVSRVLWLYL L26 H $QGURLG L029,( OD YHU-â&#x20AC;? sione App per le piattaforme mobile piĂš diffuse. Ad oggi sono state realizzate, come progetti pilota, due mostre virtuali con contenuti digitali resi disponibili dal 0XVHR GHO 5LVRUJLPHQWR H GDOO¡$UFKLYLR VWRULFRGHOOD)RQGD]LRQH7HOHFRP,WDOLD,O VRIWZDUH q VWDWR SHQVDWR FRPH XQ FRQWH-â&#x20AC;? nitore che integra strumenti diversi al ser-â&#x20AC;? vizio dei curatori delle mostre: da diversi

Fig. 1 â&#x20AC;&#x201C; Esempio di mostra virtuale online realizzata con CMS MOVIO.

48

WLSLGLJDOOHULHIRWRJUDĂ&#x20AC;FKHDOODWLPHOLQH DOOH PDSSH LQWHUDWWLYH DOOR VWRU\WHOOHU 8Q DVSHWWR SDUWLFRODUPHQWH LQQRYDWLYR q costituito dal cosiddetto ontology builder, attraverso il quale il curatore ha uno stru-â&#x20AC;? mento per costruire la mappa concettuale dellâ&#x20AC;&#x2122;esposizione e consentire allâ&#x20AC;&#x2122;utente di comporre percorsi cognitivi personali con i contenuti predisposti per la mostra. 0,1(59$ ,O SURJHWWR 0,1(59$ Ministerial Network for Valorising Activities in digitisation -â&#x20AC;? ZZZPLQHUYDHXURSHRUJ Ă&#x20AC;QDQ]LDWRGDOOD &RPPLVVLRQH HXURSHD GDO  DO  aveva l'obiettivo di realizzare servizi e strumenti per migliorare l'accessibilitĂ e la fruizione del patrimonio culturale. ,O &06 Content Management System) 086(2 :(% Ă&#x20AC;J   SUHVHQWDWR SHU OD SULPDYROWDLQLWDOLDQRQHOGLFHPEUH rappresenta il risultato piĂš concreto del progetto nellâ&#x20AC;&#x2122;ambito della progettazione di siti web culturali. Attualmente sono disponibili numerosi modelli di riferi-â&#x20AC;? mento, sviluppati appositamente per enti GLIIHUHQWL 086(2 :(% $5&+,9,2 :(% %,%/,27(&$ :(% ',5(=,21( :(% 6235,17(1'(1=$ :(% 6&82/$ :(% $WWXDOPHQWH FLUFD  LVWLWX]LRQL KDQQR JLj XWLOL]]DWR 086(2 :(% SHU OD UHDOL]-â&#x20AC;? zazione di siti web di musei, archivi, bi-â&#x20AC;? blioteche, monumenti, soprintendenze, aree archeologiche, direzioni regionali, associazioni culturali e fondazioni, iti-â&#x20AC;? nerari culturali, musei virtuali, eventi e progetti.

Fig. 2 â&#x20AC;&#x201C; Esempio di sito web della Soprintendenza Speciale per i Beni Archeologici di Roma realizzato con il CMS MUSEO&WEB (progetto MINERVA).

0,&+$(/ ,OSURJHWWR0,&+$(/ Multilingual Invento-â&#x20AC;? ry of Cultural Heritage in Europe â&#x20AC;&#x201C; www. michael-â&#x20AC;?culture.org) realizza e mette in opera i risultati conseguiti dal progetto 0,1(59$  /¡RELHWWLYR SULQFLSDOH GHO SUR-â&#x20AC;? JHWWR FRRUGLQDWR GDOO¡ ,&&8 H Ă&#x20AC;QDQ]LDWR dalla Commissione Europea nellâ&#x20AC;&#x2122;ambito GHO SURJUDPPD H7(1 q TXHOOR GL FUHDUH una rete di banche dati nazionali delle collezioni digitali di musei, archivi, bi-â&#x20AC;? blioteche e altre organizzazioni culturali e VFLHQWLĂ&#x20AC;FKHPHWWHQGRLGDWLDGLVSRVL]LR-â&#x20AC;? QH GHO SRUWDOH HXURSHR 0,&+$(/ &XOWXUH che li aggrega e li propone al pubblico di tutto il mondo.

5$3725 ,OSURJHWWR5$3725 5LFHUFD$UFKLYLH3UD-â&#x20AC;? WLFKH SHU OD 7XWHOD 2SHUDWLYD 5HJLRQDOH ² www.raptor.beniculturali.it), ideato dalla Soprintendenza per i Beni Archeologici del )ULXOL9HQH]LD*LXOLDqQDWRGDOO¡HVLJHQ]D di creare un sistema informativo in grado di rispondere a tutte le necessitĂ dei fun-â&#x20AC;? zionari archeologi della Soprintendenza Ă&#x20AC;J   ,O VLVWHPD JLj DGRWWDWR GD DOWUH Soprintendenze, permette la gestione del patrimonio archeologico in una struttura unitaria, integrando sia la parte burocra-â&#x20AC;? WLFD H G DUFKLYLR VLD TXHOOD WRSRJUDĂ&#x20AC;FD H FDUWRJUDĂ&#x20AC;FD

Fig. 3 â&#x20AC;&#x201C; Homepage del progetto RAPTOR.

ARTPAST 7UDLOHLODOO LQWHUQRGHOSURJHW-â&#x20AC;? to di digitalizzazione del patrimonio cul-â&#x20AC;? turale ARTPAST (Applicazione informatica in Rete per la Tutela e la Valorizzazione del Patrimonio culturale nelle aree sot-â&#x20AC;? toutilizzate -â&#x20AC;? www.artpast.org) sono stati sperimentati con successo due software per la gestione di informazioni di vario WLSR$5,6726 $UFKLYLRLQIRUPDWLFRSHUOD storia della tutela delle opere storico ar-â&#x20AC;? tistiche) dedicato all'organizzazione e alla gestione delle informazioni relative alla storia della tutela concepita in tutti i suoi diversi aspetti, anche se con un peculiare LQWHUHVVHSHUODVWRULDGHOUHVWDXUR6,&D5 (Sistema Informativo per i Cantieri di Re-â&#x20AC;? stauro -â&#x20AC;? sicar.beniculturali.it) che gesti-â&#x20AC;? sce, attraverso un GIS web-â&#x20AC;?based, la docu-â&#x20AC;? mentazione di un intervento di restauro, dalla progettazione alla documentazione dell'intervento. Il progetto Re.Arte (Re-â&#x20AC;? VWDXUL LQ 5HWH  QDWR QHO  VX YROHUH GHOOD 'LUH]LRQH *HQHUDOH 2,) H VRWWR LO coordinamento della Soprintendenza BAP-â&#x20AC;? PSAE di Pisa, ha lo scopo di continuare a implementare e popolare i due sistemi e formare il personale interno alle soprin-â&#x20AC;? WHQGHQ]HLQWDOHVHQVR,QĂ&#x20AC;QHULFRUGLDPR DQFKH O DSSOLFD]LRQH $5&+,0,67$ VYLOXS-â&#x20AC;? pata per la schedatura, l'ordinamento e la GHVFUL]LRQHGHJOLDUFKLYLVWRULFLH;'$06 una piattaforma web per il trattamento, la gestione, la fruizione online del patri-â&#x20AC;? monio documentale conservato dall'Archi-â&#x20AC;? YLR&HQWUDOHGHOOR6WDWR DUFKLYLIRWRJUDĂ&#x20AC;-â&#x20AC;? ci, sonori, audiovisivi). A cura di Giulio Bigliardi e Sara Cappelli (Progetto Open TĂŠchne)

ArcheomaticA N°1 marzo 2014 ArcheomaticA N° 1 marzo 2014


Tecnologie per i Beni Culturali

49



ALTERNATIVA ARTE

9HQW·DQQLGLSDVVLRQH

ZZZDOWHUQDWLYDDUWHLW

A S S O C I A Z I O N E A LT E R N AT I V A A R T E

Associazione di  Volontariato  e  di  Protezione  Civile  Regione  Puglia  


EVENTI

0$**,2 Los Angeles ,QWHUQDWLRQDO6\PSRVLXPRQ $UFKDHRPHWU\ :HEZZZDUFKDHRPHWU\ com 0$**,2 Pisa 2SHQLQJWKH3DVW :HEKWWSPDSSDSURMHFW arch.unipi.it 0$**,2 $JVX$]HUEDLMDQ <R&R&X <2XWKLQ &2QVHUYDWLRQRI&8OWXUDO +HULWDJH  :HEZZZ\RFRFXFRP *,8*12 Roma 7(&+12/2*<IRU$// :HEZZZPHGLDJHRLW *,8*12 6KDUMDK Lasers in the Conservation of $UWZRUNV/$&21$; :HEZZZODFRQDRUJ

*,8*12 0DGULG $UW WK,QWHUQDWLRQDO Conference on Non-â&#x20AC;?Destructive ,QYHVWLJDWLRQVDQG0LFURDQDO\VLV for the Diagnostics and Conservation of Cultural and Environmental Heritage :HEKWWSDUWQHW *,8*12 Verona $5&+(2)266)UHH/LEUH DQG2SHQ6RXUFH6RIWZDUHH 2SHQ)RUPDWQHLSURFHVVLGL ricerca archeologica :HEZZZDUFKHRIRVVRUJ DUFKHRIRVV *,8*12 Riva del Garda ISPRS Technical Commission 96\PSRVLXP&ORVH range imaging, ranging and applications :HEKWWSLVSUVFRPPLVVLRQ fbk.eu/

S.T.Art

Diagnostica per Arte, Territorio e Ambienti

Test

6(77(0%5( Lecce 1st International Conference on $XJPHQWHGDQG9LUWXDO5HDOLW\ 6$/(172$95 :HEZZZVDOHQWRDYULW 6(77(0%5( CittĂ del Vaticano $3/$5$SSOLFD]LRQLODVHUQHO restauro :HEZZZDSODUHX 2772%5( Lucca /X%H&;(GL]LRQH :HEZZZOXEHFLW 2772%5(129(0%5(  Paestum ;9,,%RUVD0HGLWHUUDQHDGHO Turismo Archeologico :HEZZZEPWDLW

129(0%5( Conference on Cultural Heritange and New 7HFKQRORJLHV&1+7 Vienna :HEZZZVWDGWDUFKDHRORJLHDW 129(0%5( Boston WK,QIUDUHGDQG5DPDQ8VHUV Group Conference :HEZZZLUXJRUJ 129(0%5( )LUHQ]H Salone dell'Arte e del Restauro GL)LUHQ]H :HEZZZ VDORQHUHVWDXURĂ&#x20AC;UHQ]HRUJ ',&(0%5( Napoli V Convegno Diagnosis of Cultural Heritage :HEZZZ diagnosisculturalheritage.com

Technology and services for art and environment diagnostics ECOX di M. ALBERGHINA & C. S.A.S.

S.T.ART-TEST DI S. SCHIAVONE & C. S.A.S.

ecoxdiagnostica@gmail.com, www.ecoxdiagnostica.it

info@start-test.it, www. start-test.it

UV

/8*/,2 &KHPLVWU\IRU&XOWXUDO+HULWDJH &KHP&K Vienna :HEZZZFKHPFKRUJ

ViS

IR

XRay

Our services: Imaging and Scanning IR, reflectography, False Colour IR imaging, UV Fluorescence, imaging; XRF analysis and mapping IR Termography, Ultrasonic testing, GPR surveys, Microclimate 50 ArcheomaticA N°1 marzo 2014


Tecnologie per i Beni Culturali

51

Art division 36077 Altavilla Vicentina (VI) - Via Vicenza, 232

Trasporto in ALTA SICUREZZA Il rientro di un’opera da un’esposizione non è sempre di pura e semplice gioia per chi di quell’opera ne è responsabile. Il conservatore osserva, le reali condizioni di salute dell’opera prestata, per quanto celate esse siano …

INFORMAZIONI

www.unoarte.it info@unocad.it Tel. 0444.340742

Foto e progetto grafico - Unocad srl

Nel trasporto delle opere d’arte è necessario fornire il più corretto e adeguato imballo delle stesse. Grazie ad un approfondito studio scientifico, UNOCAD realizza dei gusci protettivi in EPS per l’imballo di strutture fragili finalizzati al trasporto in alta sicurezza di sculture in gesso, legno, marmo, etc.


Archeomatica 1 2014  

Archeomatica - Tecnologie per i Beni Culturali

Read more
Read more
Similar to
Popular now
Just for you