Page 1

Local Business Collecting Shoes For Less Fortunate

⇢ A5

Primal Scream

May 8, 2013

Souris Watershed Back To Normal

WEDNESDAY

Mötley Crüe’s Vince Neil raises an arm and a cheer before the more than 3,000 rock fans who went to Spectra Place for a dose of hair metal on Saturday night. For more see A3.

www.estevanmercury.ca

⇢ A4

EMS Kicks Off 2013 Season

⇢ B1

Issue 1

Residential and commercial taxes taking big jump in 2013 Rotary Celebrates 90 Years

⇢ B7

Scan with your smartphone to visit The Mercury’s mobile website

Thursday

Friday

High 14º Low 4º

High 14º Low -1º

Saturday

Sunday

High 11º Low 4º

High 23º Low 9º

Careers ..... B14 - 16 Church Dir........ B12 Classifieds ....B9-13 Obituaries ....... B11 Perspective........ A6

Business .......... A12 Energy ............... B8 Services Dir. .... B13 Sports .......... B1 - 6 Community ....... B7

Mailing No. 10769

WEATHER & INDEX

Estevan property owners are going to have to dig deep when they pay their taxes this year. City council passed the 2013 mill rate at Monday’s regular meeting and announced that property taxes for both commercial and residential property in Estevan will rise by two mills, or roughly 10 per cent. The increase is expected to bring in an additional $1.7 million in tax revenue. Mayor Roy Ludwig said the increase, which is the largest single hike in years, was due to the major rehabilitation project on the north section of Highway 47 through Estevan. As The Mercury has reported previously, the City and province have reached a cost-sharing agreement to repave the dilapidated sections of the road. The project is now estimated to cost around $4 million. Ludwig said council did not arrive at the decision lightly but felt they did not have a choice with such a big project on their hands. “We did a lot of soul-searching and countless meetings. We have been talking about this since last year actually,” Ludwig said following

Monday’s meeting. “At the end of the day we needed the money to do the job, we knew we had to do the job, and although the province is

coming to the table to help us, we have to have the monies in place.” Although the City has been fighting to keep

up with their infrastructure work over the past decade, council has largely frowned on the idea of a large tax hike in one year. Ludwig said with so many needs on the infrastructure side it was felt a large increase was the only way they could begin to get control of the situation. “It’s not something that anybody likes and it’s not something, believe me, that we took lightly but at the end of the day, to start to get ahead of the game, it’s something that was necessary. “Looking forward, we can set aside some money and unless something unforeseen comes up, we will be looking at not only paying our debt down but also putting serious monies aside for doing our infrastructure work. We are hoping that moving forward we can go back to incremental increases, I would say half a mill a year is what I would like to see, but it will depend on where we are at when that time comes. But after this sizable increase to get control of our infrastructure deficit, we do see things calming down.” Mill ⇢ A2

No clear direction after open house It appears the future of a curbside recycling program in Estevan is as clear as mud. The City held an open house Thursday evening in the lobby of Spectra Place to present residents with the cost of the various options they included in a recent request for proposals. The

meeting also allowed for residents to voice their opinion on what direction they would like the City to take. There was certainly no shortage of opinions expressed during the 90-minute event, which was dominated by complaints about the current automated garbage pickup system oper-

ated by Regens Disposal, who also took its share of heat. When all was said and done, it was clear that the roughly 75 people in attendance were in favour of recycling but were largely against a curbside pickup program for either recycling or garbage.

Mayor Roy Ludwig said the anger towards any type of curbside recycling program is something the City will take seriously as they move forward in their decision making process. “That is a serious issue that we will have to explore,” he said. “We will enter into discussions with

Regens and see what we can do because obviously it is a serious issue and has to be addressed.” The City issued the RFP earlier this year and although three businesses picked up information, only Regens Disposal submitted a proposal. Curbside ⇢ A2

NOTHING COMPARES TO GETTING EVERYTHING YOU WANT AS % LOW

NO COMPARISON NO COMPROMISE

AS

0

APR PURCHASE FINANCING

ON SELECT NEW 2013 MODELS

FORD 9,250 $

UPTO

ON SELECT NEW 2013 MODELS

IN MANUFACTURER REBATES

)RUG6DOHV/WG 118 Souris Ave. N., Estevan 306-634-3696 Parts: 306-634-5653 E-mail: sales@senchuk.com www.senchuk.com

CALL FOR ALL THE DETAILS!


A2 May 8, 2013

Estevan Mercury

Accident claims life of community leader Southeast Saskatchewan lost one of its education and administration advocates and community volunteers this past week with the passing of Garry Hammett, who died in a tragic two-vehicle collision near Carlyle last Thursday afternoon. Hammett was driving an

Garry Hammett

eastbound van when it was in a collision with a westbound commercial truck on Highway 13. Hammett, the lone occupant of the van, was pronounced dead at the scene. Two men in the commercial vehicle were taken to hospital for treatment and later

released. Hammett was well known in educational circles in the southeast, having served several terms as a trustee on local, district and regional school boards including his most recent election to the board of the South East Cornerstone

Public School Division as the representative for several regional schools. He also served as a mayor and councillor for the Town of Bienfait for several years. Hammett, 63, is survived by his wife, Margo and children Garry Jr. (Kerrie), Regina; Rodney (Rebecca),

Regina: Nicole (Brad) Friars of Bienfait and Chris (Jenna) of Estevan, along with several grandchildren. Funeral mass was celebrated on Tuesday, May 7 at St. John the Baptist Roman Catholic Church in Estevan with Rev. Peter Nijssen officiating.

Mill rate increase to generate $1.7 million A1 ⇠ Ludwig added that if the Highway 47 project wasn’t on their plate this year, council could have raised taxes by half a mill but would have been limited as to how much work they could complete this year. He said that wasn’t palatable to council or to residents who have expressed a desire to see tangible progress on road repairs. Still, it remains to be seen how residents and business owners will react to such a large increase in a year in which a number of people saw their property assessments increase sharply. Asked if he felt it was fair to force such a big hit upon taxpayers in one year, Ludwig reiterated

the increase was the only way to start making progress. “We have to start getting serious with this, we honestly do,” he said. “As unsavoury as this is to all of us, this council does not see any other choice.” Ludwig said the need to rehabilitate Highway 47 also forced council to make tough decisions in other areas. He noted the scheduled work on the south portion of Milne Crescent was pushed until 2014, which saves them $600,000. As well, they will only do one lift of pavement in the parking lot of the Estevan Leisure Centre in 2013, which should them save them $400,000. The money al-

located for both jobs will now go towards the Highway 47 project. The 2013 budget was also presented at the meeting and the City is projecting a surplus of $459,857. Ludwig said council put a great deal of work into the budget, going through it four different times to get to the final document. “We did a lot of cutting on the budget, capital especially. Operations, you can only cut so much. We went over the numbers and saw what we needed for highway improvement and the money just wasn’t there.”

Curbside recycling and garbage pickup not popular A1⇠ That places the City in somewhat of a bind as the local company’s proposal did not include plans for back lane recycling and as the only bidder, they are in the driver’s seat. “We left it out there to the contractors as what options they would give us. As you know, Regens, with their big trucks do not want to go in the back al-

ley. But again, we are going to have that discussion and pursue those issues and see if we can’t make it happen because for (a lot of homes) it simply won’t work in the front.” The proposal from Regens included five different options and the price for each. Sticking with the current program of back alley garbage pickup in most of the city would cost

$7.35 per household each month. Going with the current garbage program and curbside recycling would cost $12.35 per household. A combined front street garbage and recycling program was the cheapest option at $8 per household. The flat rate for front street garbage pickup was $5.35, while recycling was $5. Despite hearing the

POLL RESULTS What NHL team do you feel is the Stanley Cup favourite?

Around 75 people attended a meeting Thursday night about the future of recycling in Estevan. costs and how much cheaper front street pickup was, those in attendance remained adamant in their stance with a number noting that in their area of the city front street pickup was not feasible as there was no room for a recycling container. Other im-

This poll was posted on www.estevanmercury.ca from Apr. 30 - May 7 This week’s question: Do you support council’s decision to raise taxes by two mills to pay for infrastructure projects such as the Highway 47 rebuild?

pediments such as heavy traffic, narrow streets and congested streets were also presented. Ludwig said many of the concerns presented are valid issues and because of that a “one size fits all solution” is not likely to be found.

2USKHXP7KHDWUH 'RZQWRZQ(VWHYDQ‡+U0RYLH,QIRUPDWLRQ/LQH‡

42

Friday, May 10 Thursday, May 16

6:30pm

My name is Laddie, I am a black & white border collie, I am neutered and have my vaccinations, I tried farm life but I am scared of horses & cows. I’m sure I would love an acreage or city life.

PG Coarse Language

PAIN AND GAIN

Friday, May 10 - Thursday, May 16

9:10pm 14A Frequent Coarse Language, Violence, Drug use

My name is Diesel, I am about one year old male, I am a Red Husky with sapphire blue eyes. I am a handsome dude.

My name is Bentley, I am a 2 year old male Shi Tzu. I was left on a doorstep with a note attached to me, that is how I got here. I am a very happy puppy. I am getting a haircut today, so I will look a little neater when you come and see me.

THE CROODS

General

Saturday, May 11 at 2:00 pm in 2D All seats $6.00 Sunday, May 12 at 2:00 pm in 3D All seats $9.00

Watch for The Great Gatsby opening May 17

Donations of chew bones for our canine friends would be great! Thank you! 7KH(VWHYDQ+XPDQH6RFLHW\UHVHUYHVWKHULJKWWRUHIXVHDQ\DGRSWLRQ

7KDQN\RXIRU\RXUFRQWLQXHGVXSSRUW 7KLVVSDFHLVVSRQVRUHGE\WKLVFRPPXQLW\PLQGHGEXVLQHVV

The First Name in Sprinkler Systems • Save water, time & money!

• Customized sprinkler design

• Parts & service

JOHNSON

PLUMBING & HEATING LTD. Serving Estevan & Area since 1967 1037 - 5th Street • Estevan - Ph: 634-5172 E-mail: jph@sasktel.net

®™ Trademarks of AIR MILES International Tradings V.V. Used under licence by Loyalty Management Group Canada, Inc. and SaskEnergy.

“At the end of the day we are going to have to have some front yard and some back yard pickup to make this work for our citizens,” Ludwig said. “We have until July until the (current) contract is up, so in between now and July, we are going to have to have some serious dialogue with Regens, iron out the difficulties with Regens, find out the solutions and then work to a proper solution.” Ludwig said the City also plans to speak with Regens about the complaints raised against the company at Thursday’s meeting. “I was taken aback about the amount of negative comments towards Regens. That’s why we requested the ones with concerns come through City Hall so we can track them and follow them through to the natural conclusion and find out what the issues are so we can address them because Regens do work for us, they are our contractor, and we want them to be our contractor in a responsible fashion.”


May 8, 2013

WEDNESDAY

A3

“My first thought was that he was security and was going to break up a fight or something but obviously not.�

'U'DQLHO&URRNV'0' 'HQWLVW

1HZ3DWLHQWV:HOFRPH

‡ 

– Josh Lewis

UG6WUHHW

UG6WUHHW

MÜtley Crße rocks Estevan Thirty-two years after they formed in Los Angeles, the group once described as the world’s most notorious rock band proved Saturday night they can still bring it. MÜtley Crße lit up Spectra Place with a 90 minute assault on the senses before a sold out audience of well over 3,000 people. Tearing through a set that included their catalogue of hits and a couple of new tunes, the legendary quartet put together a show that won’t soon be forgotten for more than a few reasons. Aside from the performances of MÜtley Crße and Big Wreck, the show will be remembered for the actions of an unruly fan after a 40-year-old Manor man ran on the stage and knocked guitarist Mick Mars to the ground. Although the incident got the bulk of attention postconcert, it did not seem to dampen the enthusiasm of fans who enjoyed what was the biggest show in Spectra Place’s brief history. Billed as a rock carnival, the concert proved to be exactly that, as Vince Neil, Nikki Sixx, Tommy Lee and Mars were accompanied by a team of dancers and a stage show that included everything from trapeze artists to a roller coaster. After entering through the crowd in what is described as the Death March, the band opened with the song Saints of Los Angeles before rolling through hits such as Wild Side, Shout at the Devil, and Same Old Situation. Among the highlights of the show was Lee’s drum roller coaster. With his drum kit attached to a massive circular structure, Lee played his solo while spinning around on the roller coaster and even hanging upside down for a period. After hitting its peak during the solo, the concert was cruising towards a strong fi nish before getting derailed somewhat by the incident with the fan. The band took a short break to ensure that Mars was OK but returned and closed with Dr. Feelgood and Kickstart My Heart. The Toronto-based Big Wreck provided the opening act for the show, marking their second appearance in Estevan in roughly six months. Their set was similar to the last show as they focused on songs from their current album Albatross while throwing in a couple of past hits including The Oaf. The next major concert scheduled for Spectra Place is July 8 when The Tragically Hip come to Estevan.

Tommy Lee

Nikki Sixx

Incident mars Saturday’s concert It was billed as the biggest show to hit Spectra Place and it delivered as expected. However Saturday night’s MĂśtley CrĂźe performance was tarnished somewhat after a member of the audience stormed the stage and knocked over the band’s guitarist, Mick Mars. The bizarre sequence of events took place towards the end of the concert. MĂśtley CrĂźe was just finishing the song Primal Scream when the man, whom the Estevan Police Service said is a 40-year-old from Manor, jumped on stage. Mercury sports editor Josh Lewis was seated behind the man and noted that he gained access to the stage from one of the ramps that stretched out from the sides of the stage to the crowd. “The guy slipped in behind the closest security guy at the corner of the stage,â€? Lewis said. “My first thought was that he was security and was going to break up a fight or something but obviously not.â€? After reaching the stage, the man collided with Mars and knocked him over. He then proceeded towards lead singer Vince Neil but was tackled by the band’s bodyguards and other security personnel. With the man on the ground, bass player Nikki Sixx delivered a kick to his face before he was led off the stage by security. The assault was particularly alarming as Mars suffers from a chronic medical condition called ankylosing spondylitis, which limits his mobility and causes him chronic pain. The disease also forced him to have hip replacement surgery. Ironically, it was also his 62nd birthday. On Sunday, Mars took to Twitter to thank his fans

for their concerns and well wishes and inform them that he was OK. Mars added that his bodyguard suffered two broken ribs in the melee. The incident cast a shadow on what was an otherwise great evening, as the band performed to a sold out crowd. News of the story was also quick to spread, as it hit the Internet on a number of news sites as well as the popular celebrity gossip site TMZ. A video showing the incident as it transpired was placed on YouTube Sunday but was deleted later in the day. The Estevan Police Service said in a press release Monday that after he was detained by security, the man was turned over to the EPS who transferred him to their cells. As of Monday, no charges had been laid but the EPS is continuing to investigate the matter.

Mick Mars

Crown seeking 60 days in jail for breaches The Crown and defence have very different sentencing ideas in the case of a man who won’t abide by his conditions. The Crown is asking to put Dominic Threinen in jail for 60 days for not complying with his probation orders. Threinen was supposed complete 80 hours of community service, abide by a curfew and not consume alcohol or attend bars, but has various breaches, as well as having completed just 18 hours of community service and missing appointments with his probation officer. Threinen appeared in Estevan provincial court on May 6. He was placed under the conditions following a break and enter, and the Crown prosecutor said they are tired of “wasting our limited resources,� on someone they accuse of “thumbing his nose at the justice system.� Threinen’s Legal Aid lawyer Greg Wilson countered that a jail sentence would be grossly disproportionate to the charges. With no new substantive offence, he said the Crown

could ask for Threinen to serve the rest of his 18-month suspended sentence in jail, but there has been no request from the Crown’s office. Presiding Judge Karl Bazin noted the pre-sentence report was a negative one. “The PSR says he’s going to do whatever he wants,� said Bazin, then asking defence, “What are we going to give him? There aren’t many options.� Wilson said his client requires another chance at probation and paying fines, and if breaches continue, then jail could be considered an option. If Bazin decides jail would not be appropriate, the Crown suggested they would seek to put Threinen on house arrest. Bazin reserved his decision until May 27. In other court proceedings, a matter involving the improper storage of guns came before the court. Adam Bachorcik was charged with careless use of a

firearm following an incident in December 2012. Bachorcik was changing a flat tire on his vehicle when police found him. He pleaded guilty to the charge, but after hearing the facts, Bazin refused to accept the plea. When police, who received a call about a truck driving in a field, arrived they inspected the vehicle, finding ammunition in the truck as well as rifles on the floor of the truck. Bachorcik told the court the rifles had to be moved in order to get his spare and he placed them under the seat. While he was working on the tire, he left the rifles under the seat. Bazin suggested Bachorcik speak to a lawyer about the matter and it was adjourned until May 27. Jennifer Schaff also appeared in court on Monday. She is charged with fraud of more than $5,000, after allegedly defrauding a third party between May 9 and Dec. 16, 2012. Her matter was adjourned until May 27 as well.

Grand Opening %X\2QH *HW2QH )5((

May 13th ONLY!

.HQVLQJWRQ/RFDWLRQ2QO\

.HQVLQJWRQ$YHQXH‡ J


A4 May 8, 2013

Estevan Mercury

Souris watershed back to normal water operations As water worries continue in several places around the province, the Estevan area and Souris River watershed is handling the gradual runoff very well. With temperatures heating up April 27 and 28, a cooler start to May helped slow runoff in the southeast. With the warm temperatures over the weekend and early this week, the southeast snowmelt ended without much to worry about. Patrick Boyle of the Saskatchewan Water Security Agency said all the snow in the Souris basin has melted without causing any major issues. “When we had a peak run through on Long Creek, it was cut off by the diversion channel and was still well below what we had forecasted,” he

said. “No issues with Rafferty or Alameda. The melts went off without any problems and now we’re back to just normal water management operations and getting the reservoirs back to their full levels.” Infl ows to Boundary peaked last week, Boyle said, adding that on April 29 they were at 120 cubic metres per second (m3/s) and down to 80 m3/s on April 30. Outflow from Boundary was at about 50 m3/s last week, but on Monday was down to 0.5 m3/s. After an April 30 snowfall in the southeast, there were concerns about potential water problems, but the fair weather put those issues to bed. “The good thing about this is that it’s a lot better that it’s snow and not rain. We don’t want any of it but

Rafferty Dam is seen releasing water in May 2011. (File photo) if we had to pick, we’d take snow,” said Boyle last week. “The reason being is that rain has heat in it, so if you have rain coming down on snow it can accelerate your snowmelt rate.” Cooler temperatures helped slow the runoff for much of the spring. When the heat did appear late last week, there wasn’t too much snow left to melt. “The prolonged runoff period here has probably helped us out. The Souris Watershed overall

is in recession and flows are being managed to refill the reservoirs. Essentially it’s done and we don’t expect any issues. We’ve seen everything that’s going to happen there,” said Boyle. Boyle said we’re at the mercy of Mother Nature when it comes to watching the snow melt in the spring and the runoff into the water systems. Though it felt like a long winter, the conditions made for tame water runoff.

“The impact of the runoff really depends on how much precipitation has fallen and where it has fallen,” said Boyle, noting the snowfall from April 30 didn’t have much impact on peaks and other areas that had already melted. “It will just flow down the recession of those peaks.” Flows out of Boundary and Rafferty are down to about nil because the WSA wants the reservoirs to be filled for the summer. The WSA was looking

at infl ow assessments to Rafferty Reservoir from the Souris River, and determining whether to divert some residual fl ows from Long Creek into Rafferty and away from the Boundary Reservoir. Because Boundary isn’t designed for flood storage, it has very little to do with peak flow in Long Creek, which fi lters into the reservoir. Those flows are being diverted into Rafferty, which is still being refilled.

Sun Country holds doctor recruitment/ retention workshop for southeast

13052TS00

Representatives from Sun Country Health Region’s (SCHR) rural and urban communities got together in late April for an information workshop regarding physician recruitment and retention. Representatives from Saskdocs, the College of Physicians and Surgeons of Saskatchewan, the University of Saskatchewan College of Medicine and the Labour Market Development Department of the Saskatchewan Ministry of the Economy were on hand to explain their respective roles in recruitment of doctors as it would relate to the SCHR. “We believe this session will give communities a better idea how we can work together on the settlement/ retention part of recruitment,” said Don Ehman, vicepresident of human resources and recruitment for SCHR. “Retention is important for all areas of our staff recruitment process but particularly so in recruiting doctors because they are in demand all over the continent,” he said. “Doctors have the most flexibility to move anywhere. We have to work hard to convince them to come here to practise,” SCHR has recruited over two dozen doctors in recent years, but many stayed only a short time. “The advice from these provincial agencies, for us

and for the local communities, is to concentrate on settling the doctors and their families if we want to retain them for a longer time. Our friendly communities are key to that settlement process,” said Ehman. Brenda Taylor of Saskdocs told the group that exit surveys show 48 per cent of doctors cite family reasons as the primary motivation for leaving the province over the past five years. The workload, on-call requirements at hospital emergency departments, weather and lack of support are the other main reasons for departure. “We can’t do anything about the weather, but we can make sure our doctors practise among larger groups rather than in isolated single practices,” said Ehman. “We can try to integrate the doctor and his/her family into the community where they live and we can try to match them better with the community. We can help local groups provide support systems that assists doctors and their families to move comfortably into Saskatchewan. In that way, we can make what we call a ‘soft landing’ for them.” SCHR’s human resources department plans to hold regular meetings within each catchment area of the region to support community recruiters and jointly work toward progress on recruitment in their area, as well as to discuss plans for retention programs.”

13052CC02

Visit us on the Web: www.estevanmercury.ca


www.estevanmercury.ca

May 8, 2013 A5

May is the month to give shoes away Now you really can help someone else walk a mile in your shoes. Kicking your old kicks to the curb isn’t necessary when you give them away and hopefully, the new wearer will be able to walk many miles in your unwanted shoes. Maybe your child grew out of their pair quickly or maybe you unknowingly bought the previous year’s fashion and couldn’t wear them for more than a couple of occasions. It doesn’t matter to Soles 4 Souls Canada, who are on a million shoe mission to give shoes to needy people in Canada and around the world. The organization seeks to collect one million shoes in each province in Canada. For Saskatchewan, that’s about one shoe per person, and the charity does accept one shoe of a pair, in case you have lost the its match, in the hopes that some day they will be able to find a suitable second to complete the pair. Jacqueline Garbutt is an organizer of the local Soles 4 Souls effort, which is running throughout the month of May, and said they already have a couple of garbage bags full of shoes that have been donated. The group accepts new or gently used shoes. “As long as they can be worn. We’re not looking for anything with big holes in them,� said Garbutt. “Kids shoes that

or to hurricane victims or tsunami victims and other natural disaster victims,� said Garbutt. “They also do a lot of work with charities across Canada, (giving shoes) to people who are going back to work and have been unemployed for awhile and can’t afford a new wardrobe and certainly can’t afford to go out and buy shoes.� Domestically, she added that shoes go to women’s shelters as well as victims of flooding and other natural disasters in Canada. Garbutt noted they accept all sizes as well, from toddler shoes up to 14 EEE. “It’s something that everybody has,� she said. “If you don’t have a pair of shoes (to give) we’ll take cash donations as well.� A donation of just $1 buys a brand new pair of shoes for someone. “I’m really looking forward to having to sort out a mountain of shoes. I’m Agents from Better Homes and Gardens Real Estate are getting swamped by one of the guilty ones. I have to through shoes this month, as they take part in the Soles4Souls Canada drive for one my closet this weekend. They’re going to a good cause, and they’re not going million shoes. into a landfill.� Shoes may be dropped off at the kids grow out of, shoes that you bought All donated shoes will go wherand wore a couple of times and didn’t ever they are needed, either remaining in Better Homes and Gardens Real Estate like them, we will take anything from Canada or getting shipped off to any other office’s outside entrance at the mall. There is a box by the door to accept shoes. For slippers to sandals to running shoes to country with people in need. work boots to pumps. Whatever you have “A lot of them go to Third World more information, contact Garbutt at 306in your closet.� countries where people can’t afford shoes, 634-5900.

Time to Twin group taking it to the people It has been confirmed, the Time to Twin committee members in Estevan and Weyburn are ready to take their program to the next level, which in this case, means a public forum. M a rg e Yo u n g a n d Lauralie Ireland, two of the most vocal and active members of the Time to Time group, said they don’t know what kind of reception is in store for them, but they felt it was time to see if there is any

kind of public support or renewed interest in the idea of twinning Highway 39 and Highway 6 (south) from North Portal to Regina. The meeting is scheduled for Tuesday, May 21 in the Days Inn Plaza in Estevan, starting at 7 p.m. “Yes, we’re nervous, we haven’t stepped into anything like this before,� said Young. The public session has been set to follow the committee’s scheduled

meeting with Saskatchewan’s Minister of Highways and Infrastructure, Don McMorris on May 14. There will be four committee members plus MP Ed Komarnicki making the trip to Regina on that day. “It has come this far, we are at a place now where we have to ask ourselves ‘where do we go from here?’ We’re beating the drums for twinning and some people have come forward to say

they’re backing the idea, but we need something more now,� said Young. Interest in the project is growing in the social media platforms that the Time to Twin committee is operating, but they are hoping that with a face-toface public forum, there will be some people out there who will bring some constructive ideas to the table. Young said that Spectra Credit Union CEO Tim Schroh has agreed to act as

Dustin Ritter Band to play at EAGM It has been a long time coming, following two postponed shows, but the Dustin Ritter Band is set to perform in Estevan on Friday. Last scheduled to appear on March 15, some bad weather kept the Regina band at home that day. Ritter appeared solo at the Estevan Art Gallery and Museum in March 2012 and is the next artist to play the After Dark/After Hours concert series, this time with his band. Ritter was accompanied in 2012 by Regina’s Chris Matchett who played a separate set following Ritter’s performance. The band’s new album, Drunk and Drowning, will come out this spring, and many of those

songs Ritter hopes to try while they are here. “We just got it sent off to get mastered, so we’re just waiting for that to get finished and then we’re sending it off to get packaged, and we should have it by April, I’m hoping,� said Ritter in an interview earlier this year. The band’s Facebook page noted the album arrived on April 17. The Regina band features Ritter alongside Orin Paquette playing lead guitar, Jon Fearnside on bass, and newcomer Cyprian Henry on drums. “The one really cool thing about the art gallery is when we played there last time, it’s like the most attentive audience I’ve ever played to. My buddy

played there and said he felt like a comic genius because everybody kept laughing at everything he had to say, which made him feel great,� said Ritter.

A sampling of some of the band’s music can be found through their Facebook page. Friday night’s performance at the art gallery begins at 8 p.m.

)RUDOORI\RXUFRQFUHWHQHHGV

moderator for the event. “We don’t want it to become a meeting where people just get up and complain about how bad it is. We know how bad it is; we’ll need to hear some suggestions as to what can be done about it,� said Young, adding that the ideas promoted will probably come from the general public and maybe from the politicians. The invitation is wide open to include elected officials and public administration types at all levels. The agenda for the meeting is being set and Young said she expected it will not be a lengthy one, but hoped it will be

fruitful in terms of helping the committee establish a target which could ultimately lead to a commitment from the provincial government to set a date for the building of a fourlane highway from North Portal to Regina. “It’s still is, and will always be about safety, social and economic needs. We’ve lost 55 people on this piece of highway already,� said Young. “It’s time for us to do a little brainstorming, time to find out what can be done to move it forward, or find out if the people are even interested in moving it forward,� she said in conclusion.

<PQVSQVOWN ;MTTQVO' <PMJ]aMZ[IZMZMILa Call today for a free home evaluation

0(,*$1:,/+(/0

&6$$SSURYHG&HUWLILHG3ODQW&HUWLILHG&RQFUHWH

(VWHYDQ6NÂ&#x2021;3ODQW0DQDJHU

Unlimited

talk, text & data* Now only $65/month *see in store for details

102 Souris Ave

(next to Boston Pizza)

5($/725Â&#x160; .LQJ6WUHHW(VWHYDQ6. &HOO 2IĂ&#x20AC;FH )D[ (PDLOPHLJDQZLOKHOP#EKJUHVVFD


May 8, 2013

WEDNESDAY

A6 EDITORIAL

Compromise must be reached The fact that Estevan does not have a good multi-material recycling program remains a major embarrassment to the city. What might be even more alarming is that after a public meeting last week on recycling, Estevan seems no closer to a recycling program. Roughly 75 people turned out for Thursday’s public meeting in the lobby of Spectra Place and the consensus among them was near unanimous; they are in favour of recycling provided the recycling bins are placed in back alleys, not curbside as the plan currently calls for. In spite of the fact it would actually save them money, the people in attendance were also against moving garbage collection to the front of homes. It was tough to get a sense at the meeting if the reluctance to a curbside recycling program was simply just a byproduct of the disdain many people have towards the idea of front yard garbage pickup. There is no doubt that was the case with some of the people in attendance who clearly spend too much of their time focused on their garbage. Whatever the case, there is really no argument that the City of Estevan needs to institute some type of recycling program and just because there is an objection to curbside pickup, that doesn’t mean they should throw the proverbial baby out with the bathwater. To accomplish that goal there will have to be some kind of a compromise from both those who are against the program and the City itself. As muddled as the picture was after Thursday’s meeting, one thing that was obvious is there is not going to be a one size fits all solution. As some people pointed out at the meeting, there are areas of Estevan where there are so many vehicles along the street there is no room for a recycling bin, let alone the possible addition of a garbage bin. It will be incumbent upon the City to do the legwork and find out what areas of Estevan are not feasible for curbside pickup and what areas are. It was mentioned at the meeting that the contract as presented was for blanket curbside pickup so the City will also need to work with Regens Disposal to find a solution. It was mentioned at the meeting that because they were the only contractor to submit a bid, the City did not have a pile of leverage. While that might be true, Regens also has to be willing to work with the City and residents for the common good. As for those vehemently against any form of curbside pickup, they too, are going to have to compromise. If you want recycling and a curbside program is the best way to proceed, then they are going to make something of a sacrifice. This prevailing argument that the bins belong in the alleys just because is not enough to scrap a potential recycling program. A comprehensive recycling program for Estevan is well past due. To make it happen, people on both sides of the argument are going to have to work together. We’ve shown what can happen in our community when all sides pull together towards a common goal. We hope this becomes another positive example.

Prairie Perspective MURRAY MANDRYK Murray Mandryk is a political columnist with the Leader Post

Valuable Crowns still in fashion In this day and age when so much of the Saskatchewan economy is being driven by the private sector, it’s easy to forget the value of the province’s Crown corporations. With increased retail sales, record export trade, booming oil and potash revenue and even a strong agricultural sector where producers no longer have to sell their wheat through a government agency, it’s easy to assume government ownership is passé. At best, the Crown corporations aren’t top-of-mind among Saskatchewan voters who are betting on the ongoing success or our resource sector. At worst, the Crowns are seen by some as a rather antiquated notion of the previous NDP government, all too eager to jack up rates to pay high public sector salaries. Some may even wonder if the Crowns still serve a purSERVING CANADA’S SUNSHINE CAPITAL

Oh, that’s good enough I might be wrong here, and I have been reminded by the bride on occasion that I have been known to stumble in the assessment departments, but I have arrived at the conclusion that we are coming to accept less and less from more and more. Allow me to explain my theory and observations first, before you kick this column into the corner. My thoughts were triggered by an observation made by a business analyst who brought out statistics gathered from studies conducted by IBM and other companies, which indicated that 70 per cent of changes in initiatives in government and businesses simply fail. That includes things like mergers, quality improvements, efficiencies, cost-cutting moves, customer service enhancements and so on. Why? Well, it seems as if we have become a society in Canada that is now accustomed to accepting less from more. How often have you heard administrators spout the old line that the experiment in introducing

Norm Park All Things Considered efficiencies into the workplace was going to work this time because … wait for it … “we learned a lot from the previous attempt.” Right? So what have they done? Or what will they do? They simply reset the baseline to accept less, which will enable them to assess the second, third or fourth attempt as successful. In other words, they cheat the system. And what the heck, if you are the one setting the parameters for success, you don’t need to accept anyone else’s assessments. So the brain trusts will simply pursue their own madness and biased stances, comparing themselves with other failures so they can look good. They centralize corporate or government activities supposedly to increase efficiency while in reality, all they’re doing is appointing more administration to

pose, or whether we would be better off selling the lot of them. Heck, there will soon be two full-service private liquor stores in both Regina and Saskatoon - yet another example of Saskatchewan people departing from the age-old notion here that government ownership is better. Well, whether government truly needs to be in every business - including liquor retail - is a reasonable question. That one of the new “private” liquor storeowners in Saskatoon will be a Co-op store says much about how our thinking is changing. But when it comes to the more basic question of the value of Crown Corporations, no one should understand their worth more than Saskatchewan Party MLAs now in government. Nor should Sask. Party MLAs who now represent all of Saskatchewan’s rural voters underestimate the value of the service the Crowns are providing to their constituents. The value of the Crowns to the government, as well as Saskatchewan taxpayers, was best expressed in the 2012 Crown Investment Corp. (CIC) annual report that showed $479 million in overall profits that will translate into $364 million in dividends. Included in that total were profits of $159 million, $130 million, $107 million, $82 million and $52 million for SaskPower, SaskTel, SaskEnergy, SGI and the Saskatchewan Liquor and Gaming Authority, respectively. Even Information Services Corp., the land titles Crown that the government is trying to sell, made a tidy $21-million profit. While not necessarily a record for the Crowns, 2012 may very well have been the most profitable year that did not

BRANT KERSEY: Publisher CHAD SAXON AND NORM PARK: Co-Editors CINDY BEAULIEU: Advertising Sales Manager Member Canadian Community Newspapers Association. Member Saskatchewan Weekly Newspapers Association. Audited by Audit Bureau of Circulations.

Volume 111 Issue 1

Contact us:

Phone: 634-2654 Fax: 634-3934 e-mail: editor@estevanmercury.ca 68 Souris Ave. N., Estevan By mail: Box 730, Estevan, Sask. S4A 2A6 website: www.estevanmercury.ca

Subscription Rates: In Saskatchewan - $58.26 In Canada - $63.56 In the U.S. $95.00 Over Seas - $110.00

manage a mess. Then they raise debt limits, or print more money, or hire more people to deliver less with more and deem it successful … because they said so. Look, the job is getting done isn’t it? It might take more people, more money and more time, but it’s getting done. No problem with being labelled as a loser in the game, because we allowed them to set their own benchmark. If it was too high before and you didn’t reach it … you lower it the next time around, measure yourself against other losing entities, and declare you actually reached your self-proclaimed target. Aim for the sky? Well, how about the underground parking lot? It made sense to me anyway. I mean even I can consider myself a total success, so long as you’re willing to let me do the measuring. And it seems like the people who are demanding the efficiencies are willing to accept less than a best effort as the new normal. What does that say about us as a society? Probably not much … but good enough, I suppose.

involve the sale of assets. For a Sask. Party government that recently got another tongue lashing from the provincial auditor for keeping two sets of books, it’s these Crown profits that are now balancing the general revenue fund (GRF). After all, this is a government that did not set aside one nickel in its March GRF budget for flooding. But the value of the Crowns goes well beyond bailing out politicians when it comes to the balance sheet. Their greatest value is providing services to Saskatchewan people - especially rural people - that they might not otherwise get. We have frequently explored this topic when discussing the perennial money-losing Saskatchewan Transportation Company. But it may be a surprise to some to know that even profitable Crowns are providing services that the private sector does not. Take SaskTel for example, which competes with private land, cellular, Internet and television signal providers. Private suppliers do not provide 4G high-speed Internet outside of the cities or any Internet services to First Nations or communities of less than 150 people. However SaskTel, as a publicly owned enterprise, does do this. And, of course, its cellphone service simply covers a far wider rural area than any private cell provider. Admittedly, the Crowns are not perfect, as anyone who has dealt with them will attest. But both the Crown corporations’ profits and their wide mandate for service make them less out-of-date in Saskatchewan than some may think.

Published weekly by Prairie Newspaper Group Limited Partnership, 68 Souris Avenue N., Estevan, Saskatchewan. Postal address: Box 730 Estevan, Saskatchewan, S4A 2A6 The Estevan Mercury is owned and operated by Prairie Newspaper Group Limited Partnership, a subsidiary of Glacier Media Inc. Advertising rates are available upon request and are subject to change without notice. Conditions of editorial and advertising content: The Estevan Mercury attempts to be accurate in Editorial and Advertising content; however, no guarantee is given or implied. The Estevan Mercury reserves the right to revise or reject any or all editorial and advertising content as the newspaper’s principals see fit. The Estevan Mercury will not be responsible for more than one incorrect insertion of an advertisement, and is not responsible for errors in advertisements except for the space occupied by such errors. The Estevan Mercury will not be responsible for manuscripts, photographs, negatives and other related material that may be submitted for possible publication. All of the Estevan Mercury’s content is protected by Canadian Copyright laws. Reviews and similar mention of material in this newspaper is granted on the provision that The Estevan Mercury receives credit. Otherwise, any reproduction without the permission of the publisher is prohibited. Advertisers purchase space and circulation only. Rights to any advertisement produced by The Estevan Mercury, including artwork, typography, photos, etc., remain the property of this newspaper. Advertisements or parts thereof may not be reproduced or assigned without the consent of the publisher.

We acknowledge financial support of the Government of Canada through the Canadian Periodical Fund (CPF) for our publishing activies.


www.estevanmercury.ca

May 8, 2013 A7

Letters to the Editor Time to Twin team Border fee hike would will stay the course the hurt economy The Editor: If you are afraid on Highways 39 and 6, you are not alone. Our Time to Twin Highways 39 and 6 (south) committee began its work in 2009. Since then the average daily traffic counts continue to increase on these two stretches of highway, drastically. The Ministry of Highways and Infrastructure has informed us about the traffic counts between Bienfait and Estevan: June 2011, average daily traffic was 790 two-ton and larger trucks. In September 2012, the average daily traffic included 1,500 two-ton and larger trucks. This is a 90 per cent increase in heavy truck traffic and constitutes a total average daily traffic count of 6,900 vehicles. Many residents in southeast Saskatchewan who use Highway 39 feel unsafe with good reason due to the increasing number of semis, tractor trailer units and oil tankers. A majority of these large vehicles have no other option but to travel in convoys due to the sheer number of them travelling on these highways. This winter there were at least seven fatalities that included larger vehicles that occurred on southeast Saskatchewan highways. That means there are seven familiesâ&#x20AC;&#x2122; lives that were forever changed this year. By twinning Highway 39 and

K

6, some of these tragedies could have potentially been prevented. Itâ&#x20AC;&#x2122;s time we take steps needed to reinvest in the communities that are generating so much revenue for our government. The oil boom in this area has brought a lot of prosperity to this region and generated a lot of revenue for different levels of government. Itâ&#x20AC;&#x2122;s time the governments start providing the safety to the families and communities they serve. We continue to push our Saskatchewan government to use a portion of their highway infrastructure budget to twin Highway 39 and 6 south, thereby providing a safer highway. This does not include passing lanes. Passing lanes will save money but not lives. Our Time to Twin committee continues to ask all residents along these highways to write, phone, e-mail, text, Facebook or tweet their local MLA, Minister of Highways Don McMorris and Premier Brad Wall and tell them what is happening to you on these highways and how you feel about the passing lane option. Sincerely, Marge Young, Estevan Dustin Hockey, Weyburn On behalf of Time to Twin Committee.

U H V Y D L U\6 Q Q $

Ed Komarnicki, Member of Parliament, Sourisâ&#x20AC;&#x201C;Moose Mountain

Visit us on the web!! www.estevanmercury.ca

HÂ&#x2021;

W

proposed U.S. border fee would be bad for jobs and bad for the economy. A number of U.S. politicians whose districts are in border states have already vocally opposed such a measure. Some of these opponents are in the presidentâ&#x20AC;&#x2122;s own party. Decision-makers in Washington should consider the damaging impact of this jobkilling border fee. Indeed, this kind of fee has been proposed before and not enacted. We lobbied against the fee then, and we will continue to strongly make our case for open and free trade at the border. Thatâ&#x20AC;&#x2122;s why the government is vigorously advocating against such a proposal â&#x20AC;&#x201D; from cabinet ministers to Canadaâ&#x20AC;&#x2122;s frontline diplomats. We continue to work with the Obama administration to implement the Beyond the Border Action Plan to improve the flow of people and goods across the border. That should continue to be our focus. People in both countries will benefit.

DO

?W^^W <WiW^^Wde

0 D\



The Editor: Given the fragile state of the global economy, trading nations like Canada should be doing all we can to increase legitimate cross-border and international commerce. I know first hand that our government gets that: our government is pursuing an ambitious, pro-trade plan that is facilitating more trade and commerce, and less red tape at the border. Our commitment to free and open trade has helped Canada weather the global economic downturn better than other G-7 nations. It is in that spirit that we strongly oppose a border fee proposed by our closest trading partner and neighbour. President Barrack Obamaâ&#x20AC;&#x2122;s 2014 budget request to Congress proposes to study the feasibility of charging a fee to anyone crossing the American border by land. Such a fee would be very ill-advised as it would hurt the $1.9-billion in trade that flows between our two countries every single day, including the significant trade and shipment of goods at the North Portal crossing in our community. This government believes that the

WK VW  



6WRUH  2)) :,'(

0DQ\RWKHULQVWRUHVSHFLDOV )RXUWK6WUHHW (VWHYDQ6.Â&#x2021;

´0HUFKDQWVLQ)LQH-HZHOOHU\¾ BORDER REAL ESTATE SERVICE

SECURE â&#x20AC;˘ SOLID â&#x20AC;˘ SOLD 407-306 Petterson Drive MLS# 458603

- $239,000

1138 1st Street

#304-1637 1st Street

501 Milne Crescent

MLS# 457139 - $275,000

MLS# 458744 - $349,000

MLS# 454539 - $445,000

1339 - 4th Street, Estevan

634-1020 â&#x20AC;˘ www.century21.ca 7+(21/<5($/(67$7(&203$1< :,7+$,50,/(65(:$5'0,/(6

4 Royal Heights

Terry Germain

Melony Dew

MLS# 460884 - $139,000

421 Maple Bay

1501 2nd Street

MLS# 459113 - $449,000

MLS# 453660 - $429,900

New ng Listi

TRIMOUNT DEVELOPMENTS

Just 4 lots Left Lynn Chipley

Lisa Foley

Dana Krienke

Darla Shillington

(Part-time)

Oxbow

(Part Time)

Carnduff

2109 Larter Road

1902 Matte Court

MLS# 459456 - $499,900+GST

MLS# 450741 - $529,900+GST

Extensively renovated, 5 bedroom character home, with main ďŹ&#x201A;oor laundry, some new windows.

Starting $107,000 $129,900 +GST


A8 May 8, 2013

Estevan Mercury

Aquistore project takes next big step Someone or something is listening. Six hundred and thirty somethings. Just south of this city lies one of the most extensive permanent seismic arrays to

be used for tracking carbon dioxide movement in the subsurface. Itâ&#x20AC;&#x2122;s part of the Aquistore project and the seismic array is the first in the world to be used for CO2 monitoring. Aquistore is an independent research project built to demonstrate that the storage of carbon dioxide 3.4 kilometres deep is safe. By storing liquid CO2 in a saline sandstone formation, Aquistore will demonstrate the scien-

An Aquistore sensor prior to being buried.

Early

tific and economic feasibility of reducing greenhouse gases through dedicated CO2 storage. The project is warming up for a busy summer of 2013. The 2012 operations focused on the drilling and evaluation of two heavily instrumented wells, an injection and observation well, which are the deepest in Saskatchewan. As interest grew, over 250 international visitors came to see this world-class project. The implementation of a monitoring, measurement and verification program was also undertaken, of which the permanent seismic array is the critical component. To build the seismic array, 630 geophones were installed around the project site. Geophones, said Aquistoreâ&#x20AC;&#x2122;s top research scientist Don White of Natural Resources Canada, â&#x20AC;&#x153;are very sensitive listening tools. They measure ground vibrations used to image the Earthâ&#x20AC;&#x2122;s structure in a manner similar to medical ultrasound imaging.â&#x20AC;? While geophones and seismic surveys have been used for decades to define and illustrate the subsurface of the planet, Aquistore is the first project of this kind to implement seismic monitoring aimed at tracking and observing the movement 2 of CO .

DEADLINES

Installation of this innovative sparse array happened in March of this year on a 2.5 by 2.5 kilometre grid. The 630 geophones were installed at a depth of 20 metres. The installations will serve as both an active and passive source of monitoring and can be activated using various man-made sources of vibrations to monitor activity. Of all available remote monitoring systems, the use of sequential seismic imaging at the Aquistore site will provide the highest definition of C02 in the subsurface. The permanent array is now collecting data for Aquistore, allowing the project to establish monitoring baseline before C02 injection and to track any minute movements of the subsurface. Following the initial installation, a baseline test survey was conducted. Data from each of the 630 geophones was gathered, and the Aquistore team continues to process and analyze results. Continuing into the rest of the year, Aquistore moves closer to its goal of injecting C02, which will be captured at the nearby SaskPower Boundary Dam Power Station and transported via pipeline to the Aquistore site. Once injection begins, the permanent seismic array and its 630 geophones will listen and observe the C02 3.4 kilometres below the surface. The array should provide the

An artistâ&#x20AC;&#x2122;s rendering of the Aquistore well and underground sensor placements. clearest and most accurate information possible on the subsurface movement of C02. Aquistore and Natural Resources Canada have been working collaboratively to take advantage of the technology. White and his team have been out in the field during the past month, conducting additional baseline field-work. In one test, a group of geophones was lowered to the bottom of the injection well while a sound source was lowered into the observation well. This source produced sound waves that were then picked up by the geophones in the injection well. This allows for a de-

UNRESERVED PUBLIC CONSIGNMENT AUCTION

$V0RQGD\0D\LV 9LFWRULD'D\

Benson Consignment Auction Benson, SK | Friday, June 14, 2013 ¡ 10am

7KH(VWHYDQ0HUFXU\Ň&#x2039;V %XVLQHVV2IĂ&#x20AC;FHZLOOEH&/26(' WRPDUNWKHVWDWXWRU\KROLGD\ DQGWKLVZLOOUHVXOWLQ

DGYHUWLVLQJGHDGOLQHFKDQJHV IRUWKH

:HGQHVGD\0D\ (VWHYDQ0HUFXU\

2010 JOHN DEERE 5065E

ClassiďŹ ed Advertising )RU7+((67(9$10(5&85< 7KH'HDGOLQH:LOO%HÂŤ

7KXUVGD\0D\DW1RRQ  

AUCTION LOCATION: From ESTEVAN, SK go 33 km (20.5 miles) North on Hwy 47. Watch for signs. A PARTIAL EQUIPMENT LIST INCLUDES: 2010 John Deere 5065E MFWD ¡ 1988 Case IH 7130 MFWD ¡ 1975 John Deere 4630 2WD ¡ 1974 Allis-Chalmers AC-7030 2WD ¡ 2008 Case IH RB564 Round Baler ¡ 2005 Case IH RBX562 Round Baler ¡ 2002 Case IH RBX561 Round Baler ¡ Case IH/Trimble EZ-Guide 250 GPS ¡ 1983 Chevrolet 10 Silverado Pickup ¡ Computorspray

DONâ&#x20AC;&#x2122;T MISS OUT! Deadline to advertise your equipment in the Summer Auction Guide is May 10. Call Today!

)RUWKH(VWHYDQ0HUFXU\ 7KH'HDGOLQH:LOO%HÂŤ

Ritchie Bros. Territory Manager â&#x20AC;&#x201C; Eric Fazakas: 306.541.6024 800.491.4494

7KXUVGD\0D\DWSP

&KULV2OHVKNR )LQDQFH0DQDJHU

%UDG3LHUVRQ *HQHUDO0DQDJHU

60 Ft Field Sprayer ¡ Flexi-Coil 92 50 Ft Harrow Packer ¡ 1979 GMC 7000 S/A Grain Truck ¡ 1991 Hesston 8100 25 Ft Swather ¡ 2002 Hesston 1275 16 Ft Hydra Swing Mower Conditioner ¡ 1985 John Deere 7720 Titan II Combine ¡ 2001 John Deere 567 Round Baler ¡ Morris 8900 39 Ft Air Drill ...AND MUCH MORE!

For up-to-date equipment listings, please check our website: rbauction.com

Display Advertising

7UHYRU.QLEEV 2ZQHU

1988 CASE IH 7130

0LNH.HDWLQJ 6DOHV&RQVXOWDQW

7UDYLV2OYHU 6DOHV&RQVXOWDQW

'RQ1DND 6DOHV&RQVXOWDQW

-RKQ3UHWWH 6DOHV&RQVXOWDQW

tailed image that shows the geology within the reservoir and the cap rock which seals the injection zone. A second test of the permanent seismic array was hindered by this yearâ&#x20AC;&#x2122;s overwhelming snow pack, therefore the saline survey is now scheduled to take place later this month. These seismic tests are a regular occurrence, said White, although the schedule will depend on the C02 injection schedule. â&#x20AC;&#x153;In general, the surveys are repeated after time intervals in which the cumulative amounts of injected C0 2 have increased significantly. We anticipate repeating the surveys every 12 months for the first years of monitoring.â&#x20AC;? While the geophones continue to listen, the world watches. Aquistoreâ&#x20AC;&#x2122;s seismic program is the first of its kind and so the project continues to attract interest from international research partners, with the visits beginning again in May and June. The demonstrations will include deep saline C0 2 storage, economics and monitoring requirements developed by the Aquistore project since they are of global interest and application. With this project, Aquistore is helping Saskatchewan reduce greenhouse gas emissions and lead the way in C02 storage in Canada and the world. The entire project is being conducted by the Petroleum Technology Research Centre (PTRC) of Regina, a world leader in the study of geological storage of carbon

%UDG%HOLWVNL 3DUWV0DQDJHU

/DXULH.\OH )L[HG2SHUDWLRQV0DQDJHU

.HQVLQJWRQ$YHQXH



+RPHRIWKH3RZHU7HDP ,I\RXKDYHQ¡WVKRSSHG3RZHU'RGJH /RFDOO\RZQHG RSHUDWHG

\RXPD\KDYHSDLGWRRPXFK

)DPLO\2ZQHG 2SHUDWHG6LQFH

'RXJ6DQGV 6DOHV0DQDJHU

'XVWLQ6DQGV 6DOHV&RQVXOWDQW

.\OH&RWWUHOO 6DOHV&RQVXOWDQW

(VWHYDQ0RWRUV/WG )DPLO\2ZQHGDQG 2SHUDWHG6LQFH

2QH6WRS +HDGTXDUWHUV &RUQHURIWK 6RXULV




www.estevanmercury.ca

May 8, 2013 A9

Local safety patrollers off to jamboree They make sure everyone has a safe trip to school, watching their younger peers to help them cross the streets in order to get safely to class on time. They are the elementary school safety patrollers. Six of those patrollers were selected to attend the 2013 annual Safety Patrol Jamboree in Regina from May 2 to 4. A student was chosen from each of the elementary schools in Estevan, with Emily Alexander representing Spruce Ridge, Tanissy Sernick of Pleasantdale, Dezaray Findlay of St. Mary’s, Jace Carlisle of Sacred Heart, Treybias Kolke of Westview and Ryan Duckmanton of Hillcrest attending the jamboree together. The patrollers were selected for displaying leadership, enthusiasm, maturity, promptness and dependability.

A selection of local student safety patrollers were off to Regina for the two-day Safety Patrol Jamboree last week. From left are Braden Lonsberry, Jace Carlisle, Dezaray Findlay, Ryan Duckmanton, Emily Alexander, Treybias Kolke and Tanissy Sernick.

13052UC00

“The police officers on the street are happy to see you out there,” Sgt. Kevin Reed told the group of young safety patrollers, thanking them for their efforts before they headed for Regina last week. As part of the jamboree, the students attended a number of events and had tours of the Legislative Building, Government House, the RCMP Training Depot and the Saskatchewan Science Centre. Chaperoning the students was Const. Braden Lonsberry, the Estevan Police Service school resource officer. The wind-up dance for all safety patrollers will be May 29 at the Days Inn Plaza. An EPS press release noted “This dance is an opportunity for us to show our appreciation to all the patrollers for the great job they do during the school year in all weather conditions.”


A10 May 8, 2013

Estevan Mercury

Several international travellers turned back at border Canada Border Services Agency report Once again travellers entering Canada, hoping to dodge a few extra dollars in taxes, ended up paying significantly more for their transgressions after their schemes were uncovered by Canada Border Services Agents at border crossings in North Portal and the Estevan Highway in March of this year. CBSA agents report that one good example occurred on March 1 when a Saskatchewan resident importing a motorhome declared its value at US$21,500. CBSA officers conducted a routine secondary examination and found an Internet listing for the motorhome and after contacting the sellers, determined the motorhome had actually been purchased for US$36,500 and therefore had been undervalued at the port by $15,000. The motorhome was seized and only returned to the purchaser after he had paid a penalty of $8,485.13 to retrieve it. If the motorhome had been correctly declared, the taxes owing would have amounted to just over $771. In other border related incidents, CBSA officers reported that on March 3, a United States resident sought entry into Canada to work in Alberta. While attempting to enter Canada at North Portal, it was noted he had previously been granted work permits in Canada, but background checks also revealed a recent conviction for driving while under the influence of alcohol, so he was refused entry.

Eric Fazakas

Territory Manager Southeast Saskatchewan

Cell: 306.541.6024 Fax: 306.205.0553 Email: efazakas@rbauction.com

800.491.4494 | rbauction.com

83&20,1*$8&7,216 $SULO

(ULFDQG*OHQ6RUHQVRQ:DZRWD

-XQH

'XQFDQDQG1LHO%URZQ&DUO\OH

-XQH

*LOEHUWDQG:HQG\'HFKDLQH/DPSPDQ

-XQH

%HQVRQ&RQVLJQPHQW$XFWLRQ

-XQH

-LP %DUQVWDEOH 0DFKLQLQJ DQG :HOGLQJ 6KRS'LVSHUVDO(VWHYDQ

2FWREHU

0DUJDUHW 7KH(VWDWHRI*D\ORUG'DRXVW (VWHYDQ 3XEOLF1RWLFH %\ODZ1R $%\ODZWR$PHQGWKH=RQLQJ%\ODZ1R= RIWKH5XUDO0XQLFLSDOLW\RI(VWHYDQ1R 7KHFRXQFLORIWKH5XUDO0XQLFLSDOLW\RI(VWHYDQ1RSXUVXDQW WR6HFWLRQRI7KH3ODQQLQJDQG'HYHORSPHQW$FWKHUHE\ JLYHVQRWLFHRILWVLQWHQWLRQWRDPHQG=RQLQJ%\ODZ1R=E\ SDVVLQJ%\ODZ1RDVIROORZV $0DS&KDQJHV $ WKH=RQLQJ'LVWULFW0DSDVUHIHUUHGWRLQVHFWLRQ=RQLQJ 'LVWULFWVRI=RQLQJ%\ODZ1R=VKDOOEHDPHQGHGE\UH]RQLQJ 3DUFHO%3ODQH[WLQWKH1(6HFWLRQ7ZS 5JH:0IURP$JULFXOWXUDO'LVWULFW $ WR+LJKZD\&RPPHUFLDO DQG/LJKW,QGXVWULDO'LVWULFW & DVVKRZQLQEROGRXWOLQHRQWKH VNHWFKZKLFKDSSHDUVDVSDUWRIWKLVQRWLFH

The man returned to the port a couple of days later seeking to obtain documents to apply for a pardon so CBSA officers explained that he was not eligible to apply for a pardon, but he was advised on how to properly apply from outside Canada once he became eligible. He then returned to the U.S. On March 6, a commercial truck driver from Wisconsin arrived at the port of entry and when a background check was made it was revealed the man had previous convictions including child abuse and three counts of battery so he was refused entry into Canada. On the same day, a North Dakota-based commercial driver was refused entry due to a serious criminal record that included theft of government property, obstructing police and probation violation. He, too, was returned to the U.S. On March 12, a South Dakota resident operating a commercial truck was referred for secondary examination based on his vague responses to a series of primary questions. While examining the sleeper area of the transport truck, CBSA officers found a disassembled .40 calibre handgun. The gun was seized and the man paid a $1,000 penalty before returning to the U.S. Several suspected cannabis products were located in a vehicle being operated by a Saskatchewan resident who was returning to Canada on March 18. The items included 226 grams of suspected cannabis spray, 453 grams of suspected cannabis balm and 5.2 grams of suspected marijuana plant material. The items were seized along with the manâ&#x20AC;&#x2122;s vehicle. Following the payment of a $2,650 penalty, the vehicle was released. On March 20, CBSA officers seized an undeclared stun gun from a Minnesota man who was attempting to enter Canada as a visitor. The man paid a $500 penalty and was allowed to proceed with his trip into Canada. On March 24, a Colorado man was refused entry due to his having several serious offences listed on his record including sexual assault, assault, false imprisonment, kidnapping, battery and possession of cannabis. He was returned to the U.S. A New York resident who had been refused entry into Canada on previous occasions was once again denied entry at the North Portal Port on March 26. Further checks

A photo of some of the illegal substances confiscated by CBSA agents at the North Portal Port in March revealed he had been convicted of such offences as sexual assault, unlawful imprisonment, introducing contraband into a prison, burglary, assault and disorderly conduct. He was returned to the U.S. March 19 took on extra significance for seven CBSA employees at North Portal when they were presented with Queen Elizabeth II Diamond Jubilee Medals. The employees were recognized for their significant achievements and continued contributions to Canadians. The recipients included director Kevin Hewson, superintendent Scott Kienlen, superintendent Tim Fogarty, superintendent Greg Arnott, chief Wayne Brown and CBSA officers Richelle Perkins, Nedra Yurkowski and Tina Longney.

Traffic count at border down in March Traffic volumes at two international border crossings decreased slightly in March of this year compared with March of 2012, said Lisa White, Canada Border Services Agency communi-

cations and media relations officer. The year-over-year decline, she suggested, was probably due to several winter storms that struck the region in March, curtailing

travel significantly. The traffic count at the North Portal Port, the busiest in the province, totalled 22,378 travellers in March of this year compared with 24,697 in March of 2012.

JustforMom Help your mom feel and look her best with a gift certiďŹ cate.

2 years ago

Today

See what Bell Medical can do for your appearance and self conďŹ dence. 5HDVRQIRUWKH0DSFKDQJHV 7KHSURSRVHGUH]RQLQJZLOOHQDEOH&RXQFLOWRDFFRPRGDWHDOLJKW LQGXVWULDOGHYHORSPHQWZLWKLQWKHPXQLFLSDOLW\ %\ODZ,QVSHFWLRQ ,QWHUHVWHGSHUVRQVPD\LQVSHFWWKHSURSRVHGE\ODZDWWKHPXQLFLSDO RIĂ&#x20AC;FHLQ(VWHYDQWK6WUHHW0RQGD\WKURXJK)ULGD\DOO KROLGD\VH[FHSWHGIURPDPWR1RRQDQGSPWRSP %\ODZ&RSLHV &RSLHVRIWKHSURSRVHGE\ODZDUHDYDLODEOHDWFRVWDWWKHPXQLFLSDO RIĂ&#x20AC;FH 6XEPLVVLRQV $Q\SHUVRQPD\PDNHZULWWHQRUYHUEDOVXEPLVVLRQVWR&RXQFLO UHJDUGLQJWKHSURSRVHGE\ODZDWDSXEOLFPHHWLQJ 3XEOLF0HHWLQJ &RXQFLOZLOOUHFHLYHDQ\VXEPLVVLRQVUHVSHFWLQJWKHSURSRVHGE\ODZ DWDSXEOLFPHHWLQJWREHKHOG:HGQHVGD\WKHQGGD\RI0D\ DWWKHKRXURISPORFDOWLPHDWWKHPXQLFLSDORIĂ&#x20AC;FH

WOW! Right now buy a $100 gift certiďŹ cate and receive a $25 gift certiďŹ cate FREE or buy a $200 gift certiďŹ cate and receive a $75 gift certiďŹ cate FREE 3URPRWLRQVFDQQRWEHFRPELQHGRUXVHGRQSURGXFW

Ph: 306.634.6789 â&#x20AC;˘ Fax: 306.634.6793 3-419 Kensington, Estevan, SK S4A 2H8 (Strip Mall by Wal-Mart)

To see what people are saying about us go to: 'DWHGDW(VWHYDQ6DVNDWFKHZDQWKLVVWGD\RI0D\     *UDFH3RWWHU     $GPLQLVWUDWRU

www.bellmedicalaesthetics.com and see more before and after shots.

0HHW<RXU7UXVWHG3URIHVVLRQDOV

These travellers arrived in 5,622 regular vehicles and 10,297 commercial trucks. This was also a decrease from the previous year when 11,326 commercial trucks were counted in March, along with 6,259 regular passenger vehicles. The numbers were also down at the Estevan Highway Port, although not as significantly as North Portal. The Estevan Highway Port showed a total traveller count of 4,267 in March of this year, which was quite similar to the March count in 2012 when 4,297 travellers were counted. There were 2,470 regular passenger vehicles registered at the Estevan Highway Port in March of this year plus 447 commercial trucks. Last year in March, there were 2,537 regular vehicles counted plus 584 commercial trucks. Several travellers were refused entry into Canada when they arrived at the North Portal crossing point. There were a variety of reasons for the refusals including 29 for criminal records and 22 others who were seen as non-genuine visitors or people who failed to supply proper documents. At the Estevan Highway Port, 11 people were refused entry, with 10 of those being denied due to previous criminal activities and issues.

´<RXU+RPHRI$IWHU6DOHV6HUYLFH¾

6HQFKXN )RUG6DOHV/WG 6RXULV$YH1(VWHYDQÂ&#x2021; 7ROO)UHH VDOHV

 VHUYLFH

(PDLOVDOHV#VHQFKXNFRPÂ&#x2021;ZZZVHQFKXNFRP

Randy Senchuk

Rick Senchuk

Landon Senchuk

Dwight Thompson


www.estevanmercury.ca

May 8, 2013 A11

13052MF00


WEDNESDAY

May 8, 2013

“There isn’t much that isn’t already known about what’s down there.” — Kirsten Marcia Deep Earth Energy Production, president

A12

Geothermal electricity project steps closer to reality A geothermal power production model before year’s end might just be possible thanks to the recent announcement that Natural Resources Canada and SaskPower have expressed an intention to contribute a total of $2.2 million toward a deep well geothermal project in southeast Saskatchewan. The announcement was made by Saskatoon-based Deep Earth Energy Production (DEEP) and its president Kirsten Marcia (nee Muir), a former Estevan resident and vocal advocate for this green electrical power production model that can produce a baseload of power for the provincial electrical grid. Marcia, a geologist, was in Estevan in December of 2011 promoting the project and seeking interest from local developers for her initial five megawatt $5 million power plant that would serve as a model for a more ambitious $25 million, 50 megawatt plant. She said at the time she hoped to have the first phase underway by 2013. With the $2.2 million committed to fund the front end engineering design study on the economic and technical viability of geothermal as a source of clean electricity generation, that work can proceed. Marcia said earlier that selecting the southeast Saskatchewan sector was a natural choice since the underground knowledge base in this part of the province is huge. She noted that with over 35,000 oil wells drilled, “there isn’t much that isn’t already known about what’s down there.” Natural Resources Canada will be providing $1 million through its ecoEII program and SaskPower is on tap for $1.2 million following a successful completion

of negotiations with DEEP and the front end engineering study review that will include reservoir tests and a cost breakdown for the next phase of the project. Joe Oliver, Canada’s minister of natural resources said, “Through the ecoENERGY Innovation Initiative, our government is investing in innovative clean energy technologies that create jobs, generate new economic opportunities and protect the environment.” The five megawatt power plant would be located near Estevan and provide power from a hot aquifer located three kilometres down. Five megawatts is enough power to provide electicity for 5,000 homes. The environmental impact is the equivalent of removing 8,016 cars and their emissions from local highways. The plant will be sustainable since it uses renewable resources and Marcia pointed out that similar plants producing hundreds of megawatts of power are already in operation in the United States, Mexico and in 24 other countries. She also pointed out that geothermal produced bas load supply, unlike solar, wind and hydro which can only remain operational if weather conditions allow. It is cost competitive with coal and gas fired plants and has the smallest environmental footprint since the typical plants are housed in buildings no larger than a Quonset. Since geothermal units do not require any fuel, they are not subject to commodity price fluctuations. At the original presentation, Marcia said the project contains a six to eight year payback and surface rights issues had already been cleared. Plant operation would require just one or two people, with as many as 40 to 60 people being involved in the actual construction.

DO THE MATH. ADVERTISE IN THE NEWSPAPER.

Kirsten Marcia

F G O N R I L D E L ASE I U B Location: Zoning: Specs:

Estevan, SK Highway, commercial and light industrial 2.5 acre lot 1900 sq ft office space 5600 sq ft shop space Total 7500 sq ft Includes 6 offices, 1 boardroom, lunchroom, 2 bathrooms, reception area, storage, 5 overhead doors - including one 100’ drive thru bay For more information contact Ryan Smith at 306-483-8995 Smith Building & Development Ltd.

NADbank, ComBase: Adults 18+, print and online

HIRING SUMMER STUDENTS - PARKS - HIRING SUMMER STUDENTS - PUBLIC WORKS - HIRING SUMMER STUDENTS - PLAY PARKS - CONTACT HR@ESTEVAN.CA

ESTEVAN THE ENERGY CITY

Physicians In Estevan

WHAT’S HAPPENING AT THE ESTEVAN ARTS COUNCIL? “promoting the arts in OUR community”

STARS FOR SASKATCHEWAN SUBSCRIBE NOW ~ EARLY BIRD pricing for the upcoming

Nicholson Road Clinic 634-2661 Dr. Grobler Dr. Akensete Dr. Horri Dr. Oveuni Dr. Langeni

2013 - 2014 CONCERT SEASON Celtic Tenors • Musica Intima • Elmer Iseler Singers • Ballet Jörgen~ Romeo & Juliet • Guy and Nadina • Everything Fitz

For COMPLETE details visit: www.estevanartscouncil.com and/or call 306.634.3942

VISUAL ARTS Plein Air Painting (June 8) — Pre-Registration Required

Planning on summer camp (in the Arts)?

Apply for funding assistance - Scholarships available for $100 and $200

Deadline: Friday NOON - May 17, 2013

Application forms available at the Arts Council office, Online EAGM and Schools http://spectraplace.ca @SpectraPlace

7:30pm July 8

Clinic @ No Frills Grocery 634-6444 Dr. Tsoi Dr. Christie Dr. Pehlivan

Hospital Foundation Clinic Dr. Sheikh — 637-2750 Dr. Omosigho — 637-2760 http://facebook.com/spectraplace TICKETS: http://ticketmaster.ca

7:30pm September 17

COMING EVENTS:

ON SALE APRIL 15

HIRING SUMMER STUDENTS - PARKS - HIRING SUMMER STUDENTS - PUBLIC WORKS - HIRING SUMMER STUDENTS - PLAY PARKS - CONTACT HR@ESTEVAN.CA

CONTACT HR@ESTEVAN.CA - HIRING SUMMER STUDENTS - PARKS - PUBLIC WORKS -P LAY PARKS

CONTACT HR@ESTEVAN.CA - HIRING SUMMER STUDENTS - PARKS - PUBLIC WORKS -P LAY PARKS

CITY PAGE


www.estevanmercury.ca

May 8, 2013 A13

&,7<3$*(

CAREER OPPORTUNITIES City of Estevan

Equipment Operator - Swing Operator Permanent Full-Time â&#x20AC;˘ Operate and maintain heavy equipment such as: Â&#x2021; Compactor Â&#x2021;Grader Â&#x2021;Excavator / Backhoe â&#x20AC;˘ Maintain assigned tools and equipment â&#x20AC;˘ Complete logs, records, and reports

â&#x20AC;˘ Operate additional vehicles and equipment as required (skid steer, tandem trucks) â&#x20AC;˘ Relieve Sweeper Operator â&#x20AC;˘ Perform Labourer type tasks and duties as required

Education â&#x20AC;˘ Grade 12 or GED Equivalent â&#x20AC;˘ Valid Class 3 Driverâ&#x20AC;&#x2122;s License with Air Brake Endorsement

Experience â&#x20AC;˘ 500 hours operating Heavy Equipment

(67(9$17+((1(5*<&,7< *8$5'0$7521 7KH(VWHYDQ3ROLFH6HUYLFHLVVHHNLQJDSSOLFDWLRQVIRUWKHSRVLWLRQRI*XDUG0DWURQ6XFFHVVIXODSSOLFDQWV PXVWEHKRQHVWWUXVWZRUWK\DQGDEOHWRZRUNLQGHSHQGHQWO\ZLWKOLWWOHVXSHUYLVLRQ7KH*XDUG0DWURQZLOO SURYLGHFRQVWDQWREVHUYDWLRQRISHUVRQVZKRDUHEHLQJKHOGLQFXVWRG\ 5HWLUHGSHUVRQVDUHDOVRHQFRXUDJHGWRDSSO\6XFFHVVIXODSSOLFDQWVZLOOEHRQFDOODQGZLOOKDYHWKHULJKWWR WXUQGRZQVKLIWV $SSOLFDQWPXVWSDVVD6HFXULW\&OHDUDQFH ,I\RXZRXOGOLNHWRDSSO\RUZRXOGOLNHWRUHFHLYHIXUWKHULQIRUPDWLRQSOHDVHFRQWDFWWKH(VWHYDQ3ROLFH 6HUYLFHDW WK$YH (VWHYDQ6DVNDWFKHZDQ 6$& 2UFDOO<RXFDQDOVRHPDLOVFKDUWUDQG#HVWHYDQSROLFHFD 'HO%ORFN²&KLHIRI3ROLFH (VWHYDQ3ROLFH6HUYLFH

)LWQHVV&ODVVHV

8SIRUDQHZFKDOOHQJH"6WLOODFFHSWLQJUHJLVWUDWLRQVIRUWKHQH[W VSLQVHVVLRQEHJLQQLQJ0D\-XQH2SHQLQJVDWDP DQGSP&KLOGFDUHDYDLODEOH &DOOIRUPRUHLQIRRUWRUHJLVWHU

Contact: Human Resources - City of Estevan 1102 Fourth Street â&#x20AC;˘ Estevan, SK S4A 0W7 Ph: 306.634.1842 â&#x20AC;˘ Email: HR@estevan.ca

PUBLIC SWIM - MAY 13

$UH\RXLQWHUHVWHGLQEHFRPLQJD)LWQHVV,QVWUXFWRU":HDUHORRNLQJIRUHQHUJHWLF PRWLYDWLQJSHRSOHWRMRLQRXUWHDP (PDLOÂżWQHVV#HVWHYDQFDIRUPRUHLQIR

1- 4 pm - Schoolâ&#x20AC;&#x2122;s Out Come and Swim! 

WSI - Water Safety Instructor Course June 14 - 16, 2013 â&#x20AC;˘ $200 Call 306-634-1880 to register

      ' It takes a special person to ďŹ ll the boots of an Estevan FireďŹ ghter. 

&,7<2)(67(9$1  127,&(2)$66(660(17 3XUVXDQWWRVXEVHFWLRQ  RI7KH&LWLHV$FWQRWLFHLVKHUHE\JLYHQWKDWWKH DVVHVVPHQWUROOIRUWKH&LW\RI(VWHYDQIRUWKH\HDURIKDVEHHQSUHSDUHG DQGLVRSHQWRLQVSHFWLRQDWWKH&LW\RI (VWHYDQ)LQDQFH'HSDUWPHQW)RXUWK6WUHHW(VWHYDQIURPDPWR SPRQWKHIROORZLQJGD\V0RQGD\WR)ULGD\0DUFKWR0D\  $Q\SHUVRQKDYLQJDQLQWHUHVWLQDQ\SURSHUW\ZKRZLVKHVWRDSSHDOWKH DVVHVVPHQWRIWKDWSURSHUW\WRWKH%RDUGRI5HYLVLRQLVUHTXLUHGWRĂ&#x20AC;OHDQRWLFH RIDSSHDOLQZULWLQJWR7KH6HFUHWDU\RIWKH%RDUGRI5HYLVLRQ)RXUWK 6WUHHW(VWHYDQ6.6$:RQRUEHIRUHWKHWKGD\RI0D\ 'DWHGWKLVWKGD\RI0DUFK 7ULQD6LHEHQ &LW\$VVHVVRU

38%/,&127,&(

 It takes someone with the desire to do something important for the community, someone with courage and dedication who  isnâ&#x20AC;&#x2122;t afraid of hard work, and is willing to accept the challenge of a difďŹ cult job.  If you are this kind of person, you are needed as a paid on-call ďŹ reďŹ ghter.

We may be able to ďŹ t you with a pair of boots.   Contact Estevan Fire Rescue Services:  phone 306-634-1850 or visit the Fire Station at 1101 3rd Street

At The Library...

(VWHYDQ 7RDVWPDVWHUV  0HHWV HYHU\ 7XHVGD\#SP 7RGGOHU 7LPH  0D\  ² -XQH  $JHV  PRQWKV ²  \HDUV 7XHVGD\V RU $OO3URJUDPVDUH)5(( :HGQHVGD\V  DP /LVWHQ WR D VWRU\GRWKHPHGĂ&#x20AC;QJHUSOD\VIRUVRQJVWKHQĂ&#x20AC;QLVKZLWKDIXQFUDIW&DUHJLYHUVSDUWLFLSDWHZLWKWKHLUFKLOGLQ 7RGGOHU7LPH 6WRU\ 7LPH  0D\  ² -XQH  $JHV  \HDUV :HGQHVGD\V  7KXUVGD\V #  RU 7XHVGD\V #DP-RLQXVIRUVWRULHVĂ&#x20AC;QJHUSOD\VJDPHV FUDIWV$GLIIHUHQWWKHPHHYHU\ZHHN&DUHJLYHUV UHPDLQLQOLEUDU\ZKLOHWKHFKLOGLVLQSURJUDP 7DEOHW7LSV 7ULFNV7KXUVGD\0D\WK# 7DEOHWVHUHDGHUVDQGVPDUWSKRQHV²RKP\ ,I\RX¡UHIHHOLQJDOLWWOHRYHUZKHOPHGE\\RXUPRELOHGHYLFHZHDUHKHUHWRKHOS-RLQ.ULVWDIRUDPLQXWHRQH RQRQHWXWRULQJVHVVLRQRQ\RXUGHYLFH7RUHJLVWHUSOHDVHFDOODQGOHWXVNQRZZKLFKGHYLFH \RXUHTXLUHDVVLVWDQFHZLWK +HOOR&RPSXWHU0RQGD\WK#DQG&RPSXWHUVDUHFRPSOLFDWHGEXWGRQ¡WOHWWKHPJHW\RX GRZQ&RPHDQGJHWDQVZHUVWR\RXUFRPSXWHUTXHVWLRQVLQPLQXWHRQHRQRQHVHVVLRQV%ULQJ\RXUODSWRS RUXVHDSXEOLFFRPSXWHU7RUHJLVWHUSOHDVHFDOO.ULVWDDWDQGLQGLFDWHZKDW\RXZRXOGOLNHWR OHDUQ &UDIWHU¡V&LUFOH7XHVGD\V0D\WK VW#'R\RXNQLWRUFURFKHW"(QMR\WKHFRPSDQ\RIRWKHU FUDIWHUVOLNH\RXUVHOI%HJLQQHUVDGYDQFHGDQGPDVWHUNQLWWHUVDUHDOOZHOFRPH$JUHDWRSSRUWXQLW\IRURQJRLQJ VXSSRUWVKDUH\RXUNQRZOHGJHRUEHQHĂ&#x20AC;WIURPWKHDGYLFHRIRWKHUFUDIWHUV-XVWEULQJ\RXURZQPDWHULDOVDQG FRPHMRLQWKHFLUFOH1RSUHUHJLVWUDWLRQUHTXLUHG$JHVDQGXS &HOHEUDWH &KLOGUHQ¡V %RRN :HHN ZLWK &KLOGUHQ¡V $XWKRU /RLV 3HWHUVRQ )ULGD\ 0D\  #  SP(QMR\WKHFUHDWLYLW\DQGKXPRXURI/RLV3HWHUVRQDVVKHVKDUHVKHUHQWKXVLDVPDQGORYHIRUVWRULHVDQG VWRU\WHOOLQJ 0RP 0H6SD7LPH6DWXUGD\0D\#SP$JHVDQGDSDUHQWRUFDUHJLYHU *HWDKHDGVWDUWIRU0RWKHU¡V'D\%ULQJ\RXU0RPRURWKHUVSHFLDOODG\LQ\RXUOLIHDQGVLSRQ6KLUOH\7HPSOHV ZKLOHPDNLQJSHSSHUPLQWOLSJORVVDQGKRPHPDGHEXEEOHEDWK

7RSUHUHJLVWHURUIRULQIRUPDWLRQFDOO 

CITY OF ESTEVAN 2013 WATERMAIN FLUSHING SCHEDULE The City of Estevan will be doing maintenance work to ensure good water quality for all users of City water. This work includes the turning of main water valves around the City, and flushing large quantities of water from various hydrants in each area.  If your water appears discoloured during the days your area is scheduled for this work (see schedule below), please run a faucet for a few minutes until the water is clear again.  If the water remains dirty for a longer period, please contact City Hall at 634-1800 to let us know.   Thank you for your understanding during this important maintenance!

NOTICE

Due to weather conditions the gates at the City of Estevan Cemetery will be closed to vehicle access until further notice. The walk-thru gate will allow visitors to enter the cemetery. We apologize for any inconvenience that may be caused. Gates will re-open when the road conditions improve and become safe to drive on.

Tuesday, Wednesday, Thursday, Friday Tuesday, Wednesday, Thursday, Friday May 14, 15, 16, & 17, 2013 May 28, 29, 30 & 31, 2013 Pleasantdale & Royal Heights Areas, including Trojan Subdivision, including 9th Street, 8th Cundall Drive, Woodend Place and Chinook Bay Street and 7th Street Centennial Park Areas and Soo Industrial Wednesday, Thursday, Friday Subdivision May 22, 23, & 24, 2013 Hillside Area â&#x20AC;&#x201C; Bounded by Souris Avenue and Tuesday, Wednesday, Thursday, Friday King Street, Spruce Drive and Princess Street June 4, 5, 6, & 7, 2013 Area bounded by Valley Street and 1st Street, Souris Avenue, 6th Street, Alice Road, including Westview Place

Tuesday, Wednesday, Thursday, Friday June 11, 12, 13, & 14, 2013 Area bounded by Souris Avenue, Kensington Avenue and 6th street, Perkins Street, including the Valleyview Subdivision, Jubilee Place and Bay Meadows Tuesday, Wednesday, Thursday, Friday June 18, 19, 20, & 21, 2013 East of Kensington Avenue (within City limits)

HIRING SUMMER STUDENTS - PARKS - HIRING SUMMER STUDENTS - PUBLIC WORKS - HIRING SUMMER STUDENTS - PLAY PARKS - CONTACT HR@ESTEVAN.CA

HIRING SUMMER STUDENTS - CONTACT HR@ESTEVAN.CA - HIRING SUMMER STUDENTS - PARKS - PUBLIC WORKS - PLAY PARKS - CONTACT HR@ESTEVAN.CA - HIRING SUMMER STUDENTS - PARKS - PUBLIC WORKS -P LAY PARKS - CONTACT HR@ESTEVAN.CA - HIRING SUMMER STUDENTS - PARKS - PUBLIC WORKS - PLAY PARKS

HIRING SUMMER STUDENTS - CONTACT HR@ESTEVAN.CA - HIRING SUMMER STUDENTS - PARKS - PUBLIC WORKS - PLAY PARKS - CONTACT HR@ESTEVAN.CA - HIRING SUMMER STUDENTS - PARKS - PUBLIC WORKS -P LAY PARKS - CONTACT HR@ESTEVAN.CA - HIRING SUMMER STUDENTS - PARKS - PUBLIC WORKS -P LAY PARKS

HIRING SUMMER STUDENTS - PARKS - HIRING SUMMER STUDENTS - PUBLIC WORKS - HIRING SUMMER STUDENTS - PLAY PARKS - CONTACT HR@ESTEVAN.CA


A14 May 8, 2013

Estevan Mercury

Entries submitted by the finalists in the

QUEEN FOR A DAY - Motherâ&#x20AC;&#x2122;s Day Contest!

6XUSULVH 0RP 6KRSJLIWVVKH¶OODGRUH IRU0RWKHU¶V'D\

'ROO\6XH¶V

6DORQ 'D\6SD (VWHYDQ6KRSSHUV0DOO 

'ROO\6XH¶V

%RXWLTXH (VWHYDQ6KRSSHUV0DOO

0\VLVWHUDQG,ZDQWWRHQWHULQRXU0RPP\·VQDPHIRU´%HD48HHQ IRUWKH'D\µZLWKWKH0HUFXU\1HZVSDSHU+HUQDPHLV)DUUDK3LQH ,DPVL[\HDUVROGDQGP\QDPHLV$PDUUD3LQHDQGP\VLVWHULV $UD\DQDDQG,KDYHWKHEHVWPRPP\HYHU 6KHWDNHVXVWRWKHVLWWHUVRUWRVFKRROEHIRUHVKHJRHVWRZRUN6KH ZRUNVDOOGD\VHUYLQJSHRSOHDW+RXVWRQ3L]]DDQGKHOSLQJHYHU\RQH WKHUHZLWKIRRG6KHLVDOZD\VVPLOLQJDOOGD\DQGWKHQVKHSLFNVXV XSIURPWKHVLWWHUPDNHVXVVXSSHUKHOSVXVWRJHWKRPHZRUNGRQH DQGWHDFKHVXVQHZWKLQJV6KHUHDGVWRXVKHOSVXVVWD\FOHDQEX\V XVQLFHFORWKHVDQGLVDOZD\VPDNLQJVXUHKHUOLWWOHTXHHQVKDYH HYHU\WKLQJZHQHHG6KHFDOOVXVTXHHQVDQGRXUPRPP\LVD4XHHQ EHFDXVHVKHLVVRVSHFLDO :HZDQWHGWRHQWHUKHUQDPHDQGZHKRSHVKHZLQVEHFDXVHVKH GHVHUYHVWREHDVSHFLDOTXHHQIRUDGD\DQGGHVHUYHVWRUHOD[IRUD FKDQJH 7KDQNV\RXIRUHQWHULQJLQKHUQDPHIRUXV 7KDQN\RXIRUKDYLQJDVSHFLDOGD\IRURXUPRPP\

5RE\Q5X]LFNDUXOHVEHFDXVHVKHORYHVPHP\GDGDQGP\VLVWHUDORW DQGEHFDXVHVKHLVDKDUGZRUNLQJWHDFKHU6KHLVSUHWW\DQGWDOHQWHG DQG ORYLQJ 6KH FOHDQV RXU URRPV DQG GRHV GLVKHV DQG ODXQGU\ 0\ PRP PDNHV WKH EHVW FKRFRODWH FDNH DQG OHPRQDGH 6KH WDNHV XV FDPSLQJDQGPDNHVFUDIWVZLWKXV,ORYHP\PRP  %URRNO\QQ5X]LFND

Thank you for submitting all your letters about Mom!

Take Mom forMexican!



<RXU &RPPXQLW\ 1HZVSDSHU 6LQFH

7UHDW0RP WRDSHGLFXUHRUVSD WUHDWPHQWDQHZ RXW¿WIURPWKHERXWLTXH RUVRPHEHDXWLIXO Ã&#x20AC;RZHUV

3HWDOVWRWKH0HWDO )ORZHU6KRSSH WK6WUHHW 

&$//($5/< VR\RX¶UHQRW GLVSSRLQWHG

ay 11 M , y a d r u t a S IFT SPECIAL G pecial r or s e h t o m r u for yo life! r u o y n i n woma

0DLQ6W1RRQDQ1' :HZLOOEHFORVHG6XQGD\0D\

5GNGEV&KCOQPF4KPIU

RII

HQT/QVJGT¶U&C[

.)&

(67(9$1

+LJKZD\:HVW 

&ODVVLF-HZHOHUV )LQH-HZHOHU\ *LIWVIRUDOO2FFDVLRQV (VWHYDQ6KRSSHUV0DOOÂ&#x2021; 2SHQ6XQGD\V

:HHNE\ZHHN \HDUE\\HDU ±ZH¶YH DOZD\VEHHQ WKHUH V HY VW HYDQ (0 H HUFXU\

Visit us on the web!! www.estevanmercury.ca

Winner of The Mothers Day prize of a $500 gift certificate to be used at Dolly Sueâ&#x20AC;&#x2122;s Boutique, Salon and Day Spa or Petals to The Metal Flower Shoppe.


www.estevanmercury.ca

Happy Mother’s Day! 0\ PRPP\ .ULVWD 3XOOPDQ LV VSHFLDO EHFDXVH VKH OHWV PH FRORU DQG ZH FRORU WRJHWKHU 6RPHWLPHV VKH OHWV PH VWD\ XS UHDOO\ ODWH 6KH DOZD\V JLYHVPHNLVVHVDWQLJKW 0DGLVRQ

0\PRP0RQD+DFNLVVSHFLDOEHFDXVHVKHLVDQLFHDPD]LQJZRQGHUIXO PRP 6KH FRRNV XV DPD]LQJ IRRGV /LNH GHVVHUW DQG VXSSHU 6KH LV P\ZDWHUSRORFRDFK6KHKHOSVPHZLWKDORWRIWKLQJVOLNHVFKRROZRUN FOHDQLQJ«6KHLVDOVRVSHFLDOEHFDXVHVKHORYHVXVDQGWDNHVJUHDWFDUH RIXV6KHLVQLFH6KHZLOODOZD\VKHOSXVQRPDWWHUZKDWVLWXDWLRQZH DUHLQ6KHDOZD\VWULHVWRNHHSXVKDSS\:KHQZHDVNKHUWKLQJVVKH VD\VVRPHWKLQJOLNH<HV251RWWRGD\EHFDXVHZHKDYHRWKHUWKLQJV JRLQJRQPD\EHDQRWKHUWLPH 6KHUXOHVDORW,FRXOGQHYHUOLYHZLWKRXWP\PRP,ORYHKHUDORW7KLV LV ZK\ , WKLQN VKH LV VSHFLDO DQG GHVHUYHV WR ZLQ WKLV 0RWKHU·V 'D\V SUL]H  7DHJKHQ+DFN 

May 8, 2013 A15 0\ PRP 'HQLVH )HXVL LV YHU\ VSHFLDO EHFDXVH VKH QHYHU DVNV IRU DQ\WKLQJIURPDQ\RQHEXWDOZD\VJLYHV6KHKDVQ·WUHFHLYHGPXFK LQOLIHEXWDOZD\VKDVDSRVLWLYHRXWORRN0\PRPLVDYHU\FDULQJ KDUGZRUNLQJSHUVRQZKRORYHVKHUIDPLO\DQGDQLPDOVDQGDOZD\V SXWVWKHPÀUVW6KHLVYHU\DFWLYHLQKHUFRPPXQLW\DQGLVDOZD\V YROXQWHHULQJ KHU WLPH IRU HYHQWV IURP FOHDQLQJ XS WR FRRNLQJ 0\ PRP LV DOZD\V WKH ÀUVW WR YROXQWHHU KHUVHOI WR WDNH KHU PRWKHU LQ WRDGRFWRUDSSRLQWPHQWRUGULYHWRWKHFLW\IRUVXSSOLHVIRUWKHORFDO ULQN6KHQHYHUFRPSODLQHGZKHQVKHKDGWRGULYHP\EURWKHUDQG, WR+KLJKVFKRROHYHQWVRURWKHUH[WUDFXUULFXODUHYHQWV/LYLQJRQ WKHIDUPORRNLQJDIWHUWKHDQLPDOVDQGP\GDGDIWHUKHZDVLQDQ XQIRUWXQDWHZRUNDFFLGHQWLQKDVQ·WEHHQHDV\DQGVKHKDVQ·W PDGHWLPHIRUKHUVHOI,IP\PRPFRXOGEHSDPSHUHGIRUDGD\OLNHD TXHHQLWZRXOGPHDQWKHZRUOGWRPHMXVWWRVKRZKHUKRZPXFKVKH PHDQVWRXVDQGWKDWKDUGZRUNSD\VRII  7KDQN\RX 5RVHDQQD

+DSS\0RWKHU¯V'D\

Celebrate Mom

?afZWdÆe6Sk4dg`UZ

SUNDAY, MAY 12TH –#"S_$b_

Brunch first come first serve

and Evening Buffet Reserve Today 306-634-2220

Downtown Estevan 306-634-2220 www.bestfoodinestevan.com

&DWKHULQH*XLOODXPH(EHUOHP\ZLIHDQGZRQGHUIXOPRWKHUWRRXUWZR NLGVDJHVDQGPRQWKVZRUNVVRKDUGDWKRPHWRPDNHHYHU\RQH KDSS\SXWWLQJKHUVHOIODVW6KHLVYHU\LQYROYHGZLWKRXUNLGVDWKRPH DQGGRLQJVRFLDODFWLYLWLHVDVZHOO0RVWRIWKHWLPH,DPRQWKHURDG ZRUNLQJ VR VKH WDNHV FDUH RI WKH KRXVH DQG NLGV E\ KHUVHOI , WUXO\ EHOLHYHVKHLVWKHEHVWSHUVRQIRUWKLVSUL]HVKHQHHGVWRWUHDWKHUVHOI VXEPLWWHGE\.\OH(EHUOH

6RZKDWPDNHVP\PRP*ORULD-RKQVRQVSHFLDO":KHUHGR,EHJLQ 0\PRP DND*OR-R0DPD*OR LVDQH[FHSWLRQDOODG\/LNHDQ\ PRP VKH KDV DOZD\V SUHDFKHG WKH XVXDO ´EUXVK \RXU WHHWK FRPE \RXU KDLU PDNH \RXU EHGµ %XW QRZ WKDW , DP JURZQ DQG JRQH WRXQLYHUVLW\\RXZRXOGH[SHFWOHVVPRWKHULQJULJKW":URQJ,FDQ DOZD\VGHSHQGRQDQHPDLOHYHU\PRUQLQJZKHQZH·YHEHHQKLWZLWK DQRWKHUVQRZVWRUP´'HDU.LG0DNHVXUH\RXGULYHFDUHIXOO\WRGD\ RQ5LQJ5RDG\RXNQRZKRZWKRVHFLW\SHRSOHGULYHVRPHWLPHV/RYH \D0DPDµ6KH·VQRWRQO\SXWXSZLWKPHIRUWZHQW\WZR\HDUVEXW HYHU\ VXPPHU VKH SOD\V WKH UROH RI ERVV DQG VRPHWLPHV PRWKHU WR VXPPHUVWXGHQWV<HV,·PVXUHVKHWHOOVWKHP WR´*RPRZWKDWJUDVVSODQWWKRVHÁRZHUVZDWHU WKRVH WUHHVµ EXW VKH DOVR WDNHV WLPH RXW RI KHUZHHNHQGVWRJRWDNHDFRIIHHEUHDNZLWKWKH RQHORQHJUDVVPRZHURQ6DWXUGD\PRUQLQJ EULQJLQJ KHU DQ H[WUD ERWWOH RI ZDWHU IRU WKH -XO\ KHDW <HV P\ PRWKHU ´0DPD*ORµ LV D JUHDWPRPDQG,NQRZIRUVXUHWKDW,DPWUXO\ OXFN\WRKDYHKHU,ORYH\RXPRP

͙͚͚͞ ͜–Š–”‡‡–ǡ •–‡˜ƒǡ ͛͘͞Ȉ͛͜͞Ȉ͚͚͙͝ ™™™ǤŒ‡™‡Ž„ƒ•‡Ǥ…‘Ȁƒ̸ƒ†̸ƒ

6LHQQD

0\PRWKHU'RQQD%UHKDXWLVWKH%(676KHUDLVHGJLUOVE\KHUVHOI 6KHZHQWZLWKRXWVRPXFKVRZHFRXOGKDYHPRUH ZKLFKZDVQ·WPXFK  0RPKDVVXIIHUHGZLWKQXPHURXVPHGLFDOLVVXHVKDGWRZRUNMREV FRQVWDQWO\UXEWZRSHQQLHVWRJHWKHUWRPDNHDGLPH6KHDOZD\VSXWV HYHU\RQHDKHDGRIKHUVHOI'XULQJWKLVDPD]LQJXSEULQJLQJVKHKDV WDXJKW KHU WZR GDXJKWHUV WR ZRUN KDUG JHW D JRRG HGXFDWLRQ DQG DOZD\VWKLQNRIRWKHUV6KHKDVDGRSWHGKHUVRQLQODZVDVKHURZQ $QGQRZVKHLVWKH%(67*UDQGPRWKHUWRJUDQGFKLOGUHQ6KHGRHV HYHU\WKLQJVKHSRVVLEO\FDQIRUIRUJUDQGFKLOGUHQDQGDWWHQGVDOO VFKRRO DQG VSRUWV DFWLYLWLHV 6KH KDV EXLOG DPD]LQJ UHODWLRQVKLSV ZLWK KHU JUDQGVRQ·V DW D \RXQJ DJH WKDW ZLOO ODVW D OLIH WLPH +HU JUDQGGDXJKWHU OLYHV RXW RI SURYLQFH EXW JUDQGPD KDV OHDUQHG WR XVH 6N\SHWRHQVXUHVKHLVDOVRLVLQWRXFKZLWKWKH JUDQGGDXJKWHUV :LWKORYHE\7UDF\1LFROH-'.\OHU .\OHQD 5HEHFFD

1SXLIV·W(E] 7YRHE] 1E]XL

0HUOH1RUPDQ&RVPHWLFV (VWHYDQ6KRSSHUV0DOO 

Park Avenue Gifts Paradise Tan

Paradise Tan 1202 - 3rd Street Estevan, Sk 634-7855


A16 May 8, 2013

Estevan Mercury

Lots of weekend action for police service The weekend was especially busy for members of the Estevan Police Service (EPS) with several events being staged in and around the city which increased the need for additional vigilance and policing action. The extra activity began as early as the night of April 30 when a 22-year-old man was arrested and charged by police for production of a controlled substance as well as possession of a controlled substance exceeding 30 grams. Police were called to an apartment building by the owner who was requesting their assistance in dealing with a problem tenant. The matter turned into a controlled substance investigation and the deployment of a search warrant that eventually led to police dismantling a grow operation and the seizure of a quantity of marijuana paraphernalia and other equipment used for the production of the contraband plants. The man was taken into custody and appeared in court the next morning before being released with a May 27 court date. Police were also asked to look into an alleged assault incident that occurred at a residence during a party. On May 2, EPS members were asked to look into a complaint of a motorcycle running in a garage in the neighbourhood. Police checked with the bike’s owner who noted he was doing an engine check to track down a problem. He was warned about the city’s noise bylaw. Police were then called to a lounge to check into a report of an intoxicated man who was asking patrons for drugs, or asking them if they knew where he could get some drugs. The 48-year-old subject became agitated when police arrived, so he was removed by police and arrested for being intoxicated in public. He was held in cells until sober. May 3 became a day for bylaw enforcement action pertaining to illegally parked vehicles, barking dogs and a hit and run investigation. Police also received a report of a vehicle driving by a school bus while the bus had the stop arms and

flashing lights activated. This investigation continues. The night before, EPS members reported that they investigated an accident involving a vehicle that had slowed down to allow a person in the downtown crosswalk to cross the street. A person driving a vehicle behind the slowed-down vehicle was distracted and ran into the back of the vehicle that was yielding to the pedestrian. Police later impounded an unregistered vehicle and the driver was charged with driving while suspended. During that same shift, EPS members charged a 36-year-old driver for driving while impaired and driving while his blood-alcohol content was over .08 per cent. He now has a June 17 court date. On the night of May 4, EPS members attended to a noisy party complaint, arrested a 50-year-old Estevan man for public intoxication, attended to a local lounge in response to a report of a man causing a disturbance and handed a 23-year-old driver a 24-hour driving suspension following a roadside check. The activity was just beginning, however, as shortly after this, a 42-year-old Ituna man was charged with driving while over .08 and his 47-year-old passenger was arrested for being intoxicated in a public place. An ongoing dispute between the owners of neighbouring properties attracted police attention during the next shift. The dispute occurred in the north central area of the city. Both owners were spoken to separately in an attempt to mediate the situation. They eventually agreed to work out their differences in a positive manner. A report of a blond-haired man in a black hoodie breaking into vehicles in the north central part of the city was looked into. The suspect fled the area when he noticed the complainant tracking him. A 48-year-old Macoun woman was arrested for causing a disturbance at a concert in Spectra Place. She was lodged in cells for several hours before being released. A 34-year-old Winnipeg man was arrested after

13052DS03

he was observed consuming illegal narcotics inside a cabaret venue. He was lodged in cells until sober and this matter remains under investigation. A 36-year-old Moose Jaw man was arrested for being intoxicated in public at a cabaret in the north central area of the city that same night. He was lodged in cells until regaining sobriety. Police then fi elded a 911 call from a distraught 29-year-old woman who indicated she required police assistance. She was unsure of her exact location, but with further conversation and investigation she was located and transported to St. Joseph’s Hospital for further care. A 21-year-old Estevan man was arrested later on in the evening for being intoxicated in a public place, the cabaret in the north central area of the city. He resisted arrest and now has a court date. A 32-year-old man from Lampman called EPS that same night requesting assistance. The man, who was in distress, was located and transported to the Estevan Police Service station where emergency medical service attendants paid him a visit and subsequently transported him to St. Joseph’s Hospital for further care. EPS members were also asked to look into the theft of a vehicle from the north central area of the city that evening. On May 5, police received a report of a domestic dispute in the south central part of the city. A 39-yearold woman and 33-year-old man were involved in the dispute. The man was taken to the Estevan Police Service station while the female came to the station on her own. The two in the dispute left the station separately and no further action was required. A report of a fight breaking out among several men in the central part of the city was responded to by police. A vehicle containing two of the men was located as it was leaving the area. The investigation revealed that three co-workers had become engaged in a physical confrontation, but all participants had left the area so no further policing action was required.


May 8, 2013

WEDNESDAY

SOUNDING OFF â&#x20AC;&#x153;I was looking pretty good the first few laps, and then five or 10 laps in everybody started passing me and I was kinda getting depressed there. I just found a good line, I guess.â&#x20AC;?

See us for bicycle sales & repairs and your baseball, lacrosse and soccer equipment.

â&#x20AC;&#x201D; Tyson Turnbull on how he won the mod feature at Estevan Motor Speedwayâ&#x20AC;&#x2122;s season opener on Saturday.

B1 (306) 634-2654 â&#x20AC;˘ sports@estevanmercury.ca â&#x20AC;˘ twitter.com/joshlewis306

â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t see any reason why weâ&#x20AC;&#x2122;re not competing for the provincial title again this year.â&#x20AC;? â&#x20AC;&#x201D;Estevan Haulers head coach Kent Phillips on the teamâ&#x20AC;&#x2122;s odds of repeating last yearâ&#x20AC;&#x2122;s provincial bantam AA championship.

ZZZMOVELNHVNDWHFRP (YD6WUHHW(VWHYDQÂ&#x2021;

It was a battle of two No. 10s in the mod feature on Saturday. Tyson Turnbull (right) took the lead from Dave Dease with six laps left and won the race.

Turnbull grabs late lead for mod win Mann, Beeter also win features on opening day at Estevan Motor Speedway Tyson Turnbull didnâ&#x20AC;&#x2122;t take the easy road to victory on Saturday. After hanging out near the leaders earlier in the race, Turnbull passed Dave Dease with six laps to go and hung on to win the modified feature at the first race program of the year at Estevan Motor Speedway. â&#x20AC;&#x153;(Dease) just showed me the line, I guess. Iâ&#x20AC;&#x2122;m usually up there, but I thought there was no way you could run like that up there (considering the track conditions), but he proved me wrong. I had to drive up in front of him to get the lead, but thatâ&#x20AC;&#x2122;s the way you have to do it sometimes,â&#x20AC;? said Turnbull, the defending modified champion at EMS. But in order to earn his fourth career victory at Estevan, Turnbull had to make adjustments earlier in the feature. â&#x20AC;&#x153;I was looking pretty good the first few laps, and then five or 10 laps in everybody started passing me and I was kinda getting depressed there. I just found a good line, I guess.â&#x20AC;? Mike Hagen would finish second, followed by Ed Turnbull. There was a very lengthy stretch near the end of the race with no cautions, although Turnbull said he wouldnâ&#x20AC;&#x2122;t have minded a yellow flag after he got into lap traffic. â&#x20AC;&#x153;I couldâ&#x20AC;&#x2122;ve almost used a caution when we got into lappers there. I got by the one guy and then we got to Jim Harris and they gave him the blue flag, the move over flag. I was on the outside and they gave him the move over flag and he was in the middle. I wanted him to move over to the bottom, not to the outside, so I damn near went right off the end of the track.â&#x20AC;? Meanwhile, Gregg Mann dominated the stock car class

on Saturday, winning both the feature and his heat in a walk. Mann had the pole for the stock feature and led from start to finish. Still, he said he would have preferred it play out differently. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;d rather come by a few guys and then know what theyâ&#x20AC;&#x2122;re doing, and how their speed is. When you start out front, you really donâ&#x20AC;&#x2122;t know whoâ&#x20AC;&#x2122;s got what line on you. You could be running a line thatâ&#x20AC;&#x2122;s going away and the other guyâ&#x20AC;&#x2122;s found something better. I made a good choice, I went up high, and it worked for me up there again,â&#x20AC;? said Mann. Mann has a new motor in his car and he said the vehicle was set up for success. â&#x20AC;&#x153;We spent a lot of time with the car over the winter. We took what we had last year at the end of the season, we were set up real good, and added a few more things to it to make it a little better. It seems to be working for us,â&#x20AC;? he said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a real nice car to drive and it was really working. Whatever I wanted to do with it on the track, whether it was dry or tacky, the car would do what I wanted it to do.â&#x20AC;? Minotâ&#x20AC;&#x2122;s Brock Beeter won the hobby stock feature, taking the lead midway through the race. Keith Cassidy had been in the lead up to that point, having taken the pole, but he spun out on a turn and eventually finished ninth. Beeter credited the victory in part to staying away from collisions like that one. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s mainly just staying out of trouble, keeping away

from the cars in front of you. Take your time, take it easy, itâ&#x20AC;&#x2122;s a long race, donâ&#x20AC;&#x2122;t get yourself in trouble early. I had trouble in the heat race. I went off Turn 1 and 2 in the heat race, so I learned my lesson there, so I didnâ&#x20AC;&#x2122;t want to do that again,â&#x20AC;? he said. â&#x20AC;&#x153;The car was handling good on the wet track. I was hoping for a caution at the end because the track was really starting to come in and become really fast, but I was in so much lap traffic I couldnâ&#x20AC;&#x2122;t really stretch the legs on it.â&#x20AC;? The next race program at EMS is on May 17.

EMS Stats Here are the top 10 finishers in each class at the race program at Estevan Motor Speedway on Saturday: MODIFIED Tyson Turnbull, 10T Mike Hagen, 27X Ed Turnbull, 10EH Travis Hagen, 14 Dave Dease, 10D Les McLenehan, 29M Marlyn Seidler, 7 Ryan Harris, 18 Kelly Bauman, 66 Joren Boyce, 67

STOCK CAR Gregg Mann, 95 Austin Daae, 17 Rocky Alexander, 99 Jordan Durward, 2D Dustin Byler, 97 James Frayn, 456 Tim Klassen, 43 Robert Pickering, 8 Tanner Matthewson, 12 N/A

HOBBY STOCK Brock Beeter, 48B Eric Sinness, 88 Brad King, 43 Gary Goudy Sr., 7 Blaine Durward, 12D Chris Dukart, 20 Dylan Crozier, 8D Cory Evans, 33 Keith Cassidy, 74 Kiana Stepp, 81

Big Dogs smoked by Rifles in opener The good news for the Estevan Tarpon Energy Big Dogs is thereâ&#x20AC;&#x2122;s nowhere to go but up. The junior lacrosse team got their season started on a sour note on Friday, losing 33-7 to the Regina Rifles in the Queen City in Prairie Gold Lacrosse League action. The Big Dogsâ&#x20AC;&#x2122; home opener is Saturday when they host the Yorkton Bulldogs at 7 p.m. They also play host to the Saskatoon Steelers on Sunday at 2 p.m. Dylan Smith led the team on Friday with two goals and five points, while Rhett Handley netted a goal and four points. Mark Moriarty, Ty Currie and Tanner Froese were also among the Big Dogsâ&#x20AC;&#x2122; scorers. 5('8&('

But it was a game to forget for Estevan. â&#x20AC;&#x153;What didnâ&#x20AC;&#x2122;t go wrong?â&#x20AC;? said head coach Evan Handley. â&#x20AC;&#x153;The first four or five minutes were actually pretty close, with both teams playing their first game of the year. It was back and forth, lots of scrambling, both sides turning the ball over. â&#x20AC;&#x153;Then they started to execute their offence. Like I said at the start of the year, if we do not do well defensively, we are not going to be successful.â&#x20AC;? Handley noted that with an arsenal of offensive weapons, including last yearâ&#x20AC;&#x2122;s league scoring leader Tristan Frei, itâ&#x20AC;&#x2122;s tough to limit the Riflesâ&#x20AC;&#x2122; scoring chances. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s going to be really 5('8&('

Dylan Smith, seen here winning a faceoff during a game last year, scored five points for the Estevan Big Dogs on Friday in a 33-7 loss to the Regina Rifles. (File Photo) hard to keep that team off the scoreboard. We took a ton of penalties, deserved or not ... and they capitalized. They did a really good job on their power play,â&#x20AC;? said Handley.

â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s one of those games you take out and throw away and say, â&#x20AC;&#x2DC;thatâ&#x20AC;&#x2122;s the best team in the league and if we donâ&#x20AC;&#x2122;t stay out of the box, thatâ&#x20AC;&#x2122;s whatâ&#x20AC;&#x2122;s going to happen.â&#x20AC;&#x2122;â&#x20AC;?

Despite a rough first period, Handley felt his team got better as the game went on, with the power play being a bright spot. â&#x20AC;&#x153;We started playing better in the second period. Our power play did pretty decent. We buried at least three power play goals. We moved the ball around quite well on our power play. â&#x20AC;&#x153;Cole MacCuish did really well for his first game ever. Isaac Elder did some good things out there, Ryan Kenzie played well, Ty Currie played really well and got a nice goal. Ryan Juhlke did really well. He played tough defence and moved the ball up the floor a couple of times. Dustin DeBruyne took a match penalty during the game and is facing a sus-

pension. Handley said the Big Dogs simply need to be better defensively in order to improve. â&#x20AC;&#x153;We need to keep the ball out of our net and that starts with our defence, so that theyâ&#x20AC;&#x2122;re not having breakaways and 3-on-1s and having free shots.â&#x20AC;? He added that they have to play â&#x20AC;&#x153;a lot meaner.â&#x20AC;? The team will play an exhibition game against the senior Impact team tomorrow night. Both games this weekend will be played at Spectra Place. The Impact opened their PGLL regular season on Saturday and Sunday in Saskatoon against the Brewers. Scores were not available at press time.

5('8&('

1(:/,67,1*

VW6WUHHW

0DSOH%D\

5RVV&RXUW

$$UWKXU$YH

0HDGRZ/DUN/DQG

MLS 439120

MLS 443837

MLS 451197

MLS 460384

MLS 449284

5('8&('

Most Productive Agency in Canada

306-634-2628 1(:/,67,1*

1(:/,67,1*

1(:/,67,1*

/\QG&UHVFHQW

6SUXFH'ULYH

+HQU\6WUHHW

7LYHUWRQ$YH7RUTXD\

MLS 458806

MLS 456639

MLS 460246

MLS 458966

Lorna Pylychaty Broker/Owner

306-421-6847

902 - 4th Street, Estevan www.estevanlistings.com Each ofďŹ ce individually owned & operated


B2 May 8, 2013

Estevan Mercury

Nearly 150 participate in Coal Country Run The annual Coal Country Run was staged in Bienfait on Saturday, with the 141 participants enjoying great weather for the event. The 10-kilometre division saw 62 people register, while 54 ran the five-kilometre race. There were also 17 children in the kidsâ&#x20AC;&#x2122; minimile pledge race, and eight others in the 5K bike-athon. Jody Harris was the top overall runner in the 10K division, with a time of 49:43. Braden Brock was also a challenger, but got mixed up on the course directions, resulting in his total distance being short of 10 kilometres. Brock did win the male under-16 category, however. There were no participants in the female

This yearâ&#x20AC;&#x2122;s Coal Country Run, a fundraiser for Bienfait, attracted a total of 141 official runners for the five and 10 kilometre event. under-16 category. In the 16-30 age group, Brad Brown took top spot

%()25(

Weâ&#x20AC;&#x2122;ll Make Your Car Look Like New Again!

on the male side, while Brady Johnson was the winner in the female category.

$)7(5

445 - 4th Street, Estevan â&#x20AC;˘ 634-2815

Why buy new?

Levi Clampitt was the top finisher in a time of 21:37. He was in the 16-30 age group. Noah Perkins and Hayley Dechaine were the winners in the under-16 category, while Keena McKnight won the female 16-30 group. Rodney Phillips and

See career ads online! www.estevanmercury.ca

Lackluster ďŹ nish? Dents and dings? Scratches and rust? Give your car a makeover!

Dent Repair â&#x20AC;˘ Custom Paint Frame Straightening Serving SE Sask. for 28Insurance years!Work

In the 31-44 age group, Tom Copeland won the male title, and Harris was the winner in the female category. Randy Dyck and Cathy Burton were the winners for ages 45-55, while Tim Perry and Peggy Rohatyn won the over-56 categories. In the 5K division,

Candace Wheeler were the top runners in the 31-44 categories, while Lorraine Schlamp took top spot in the 45-55 female group. There were no entrants in the male 45-55 or male 56 and over categories. Debby Knight crossed the finish line first among female 56 and over entrants. Meanwhile, the 25 kids entered gathered $4,199.25 in pledges for the Bienfait Memorial Arena. The top two pledge gatherers were Kyler Dutka and Barrett Fleck, combining for $2,188.25. The third highest pledge collector was three-year-old Sade Olson. The fastest male minimile runner was Brad Graves, while Calissa Lockerby was the top female mini-mile athlete. Each kid was presented with a medal and a T-shirt for their participation. A free brunch was provided for 5K and 10K entrants, and the Weldon School Community Council provided a barbecue for the kids and spectators.

Our professional auto body services will have your vehicle looking like new, for a lot less. Come in today!

Secure Storage Steel storage units that are portable, collapsible, expandable and affordable.

BUY

Serving SE Sask. for 28 years! 445 - 4th Street, Estevan â&#x20AC;˘306-634-2815

$1,499 plus tax

RENT

$75/MONTH 76 0

plus tax

FLAMAN

RENTALS

306-634-2017 | www.estevangolf.com | twitter @EstevanGolf

This week we are featuring HOLE #15 of the NEW BACK NINE.

Authorized Dealer - Calven Johnson, Johnson Bros Equip Rentals â&#x20AC;˘ (306) 421-0280

$77(17,21 $//.,1'62)5$&(56 ,I\RX UHUDFLQJDWWKH (VWHYDQ0RWRU6SHHGZD\ GUDJJLQJDWWKHDLUSRUWZLWKWKH (VWHYDQ'UDJ5DFH$VVRFLDWLRQRU 0;LQJZLWKWKH7UDFNVLGH0;$VVRFLDWLRQ WKLV\HDU :HZRXOGOLNH WRLQFOXGH\RXU '5,9(5352),/(6 DQGSLFWXUHV )RUWKLVPXFKDQWLFLSDWHG DQQXDOLVVXH

#15 â&#x20AC;&#x201C; PAR 5 Gold â&#x20AC;&#x201C; 500 yards, Blue â&#x20AC;&#x201C; 470 yards, White â&#x20AC;&#x201C; 460 yards, Red â&#x20AC;&#x201C; 400 yards This par 5 may look short but thereâ&#x20AC;&#x2122;s trouble on both sides and requires a precise tee shot and second shot to set up any chance at eagle. If you try to overpower this hole you may be penalized! Keep the ball in the fairway and you shall be rewarded.

3XUFKDVH\RXUPHPEHUVKLSDQGKDYH\RXUQDPHHQWHUHGLQD GUDZWREHLQWKH),567JURXSWRSOD\RXU1(:%$&.1,1(

7RVXEPLW\RXUGULYHUSURĂ&#x20AC;OHVIRURXUDQQXDOLVVXHRIWKH5DFH7UDFNHU FRPLQJRXWLQWKH0HUFXU\0D\DQG7UDGHU0D\ 6XEPLW\RXULQIRLQDQ\RIWKHVHZD\V Â&#x2021;*RWRRXUZHEVLWHZZZHVWHYDQPHUFXU\FDFOLFNRQVSRUWVUDFLQJ WKHQVXEPLWWKHUDFLQJSURĂ&#x20AC;OH Â&#x2021;(PDLOWKHPWR DGVDOHV#HVWHYDQPHUFXU\FD Â&#x2021;2QOLQHDW\RXUFOXEŇ&#x2039;VZHEVLWH Â&#x2021;%ULQJ\RXULQIRDQGSLFWXUHV LQWRRXURIĂ&#x20AC;FHDW 6RXULV$YHQXH E\)ULGD\0D\WK

/HW V*R5DFLQJ 6287+($6775$'(5

(;35(66

6RXULV$YHQXH1 (VWHYDQ6. 


www.estevanmercury.ca

May 8, 2013 B3

Haulers aiming to repeat as champs

Woodlawn tee The TS&M Woodlawn Golf Clubâ&#x20AC;&#x2122;s first tee time of the year went to Cole Dunville, Don Holinaty and Ron Dunville. The threesome teed off from Hole 1 at 11 a.m. on May 3.

Pitcher Carson Perkins will be relied on heavily by the Estevan Haulers this season as their ace. (File Photo)

Ć&#x2019;:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;Ć&#x2019;0272;Ć&#x2019;

:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;Ć&#x2019;0272;Ć&#x2019;:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;Ć&#x2019;0272;Ć&#x2019;:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;Ć&#x2019;0272;Ć&#x2019;:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;Ć&#x2019;0272;Ć&#x2019;:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;

reason that we do have some guys with live arms and we also have a lot of arms. Once you start getting into tournaments and provincials, having those extra two or three pitchers that other teams donâ&#x20AC;&#x2122;t have is key to getting into the later provincial rounds,â&#x20AC;? he said. Kyler Phillips will be another pitcher expected to eat up a lot of innings. The Haulers have added four players from Carlyle, where there is no AA program this year. They include Brady Third, Kyle Sargent, Dalton Loustel and Josh Brown. Phillips is excited about Third, in particular. â&#x20AC;&#x153;Without even playing a game yet, I have him figured in as my leadoff batter. That kid is always on base. You just canâ&#x20AC;&#x2122;t get him out, heâ&#x20AC;&#x2122;s so darn fast. â&#x20AC;&#x153;With four of the new guys being second-year players, Iâ&#x20AC;&#x2122;ve got quite a few expectations for them too, because they know what AA ball is all about.â&#x20AC;? The Haulers are also adding a pair of pitchers from last yearâ&#x20AC;&#x2122;s peewee Tornados team in Brett MacMurchy and Hunter Piche. Phillips said the teamâ&#x20AC;&#x2122;s success this year will come down to what they can do at the plate. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;ll all depend on hitting. I think defensively weâ&#x20AC;&#x2122;ll be fine, and weâ&#x20AC;&#x2122;ve got the pitching. Itâ&#x20AC;&#x2122;ll depend on whether we can manufacture runs at key times.â&#x20AC;? Heâ&#x20AC;&#x2122;s also hoping last yearâ&#x20AC;&#x2122;s championship experience will be a benefit to the returning players. â&#x20AC;&#x153;It gives them renewed confidence too. We got to play an extra month of ball that we donâ&#x20AC;&#x2122;t usually play, due to going to westerns,â&#x20AC;? said Phillips, adding that it also gave the Carlyle players an extra reason to play in Estevan instead of Weyburn.

YOUR

ONE-STOP

BMX

SHOP F BMX RESH PARTS

COMPLETE BIKES â&#x20AC;&#x153; RIDER DESIGNED, BUILT & TESTED!â&#x20AC;?

WK6WUHHW(VWHYDQ 3KRQH &KHFNXVRXWDWRXU :H\EXUQORFDWLRQ UG6WUHHW:H\EXUQ 3KRQH

:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;Ć&#x2019;0272;Ć&#x2019;:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;Ć&#x2019;0272;Ć&#x2019;:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;Ć&#x2019;0272;Ć&#x2019;:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;Ć&#x2019;0272;Ć&#x2019;:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;

Although they lost quite a few core players from last yearâ&#x20AC;&#x2122;s provincial championship team, the Estevan Sherritt Coal Haulers believe they can make another run at a title in 2013. With star pitcher Carson Perkins, several other key returnees and a group of newcomers who can make an impact, the bantam AA baseball club isnâ&#x20AC;&#x2122;t dimming its expectations at all. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t see any reason why weâ&#x20AC;&#x2122;re not competing for the provincial title again this year,â&#x20AC;? said returning head coach Kent Phillips. The Haulers kick off their regular season in the Baseball Regina bantam AAA division on Sunday with a doubleheader in Swift Current. Their home opener is on Tuesday against Weyburn. Game time is 6 p.m. at Cactus Park. The teamâ&#x20AC;&#x2122;s losses include pitcher Brandon Hutt, who dominated last yearâ&#x20AC;&#x2122;s provincial championship game on the mound and at the plate, along with Colton Gingras, Mitchel Clark, Bailey Lonsberry and Preston Hutt. But Perkins, entering his second year of bantam, is reaching speeds of 84 miles per hour and Phillips believes he is the top bantam-age hurler in Saskatchewan. â&#x20AC;&#x153;The top pitcher in the whole province will be on our team, so thereâ&#x20AC;&#x2122;ll be nobody that can touch him,â&#x20AC;? he said. â&#x20AC;&#x153;(84 mph) is unheard of at the bantam level.â&#x20AC;? The Haulersâ&#x20AC;&#x2122; pitching staff also includes three players who can throw in the low-to-mid 70s range. Of the 12 players who made the team, nine can pitch, with Phillips looking for the same kind of depth on the mound that helped last yearâ&#x20AC;&#x2122;s team win provincials. â&#x20AC;&#x153;Thatâ&#x20AC;&#x2122;s going to be one of our strengths, for the simple

Ć&#x2019;:$.(Ć&#x2019;6.$7(Ć&#x2019;612:Ć&#x2019;%0;Ć&#x2019;0272;Ć&#x2019;


B4 May 8, 2013

Estevan Mercury

Six from ECS heading to provincials Six badminton players from Estevan Comprehensive School did well enough at regional playoffs on the weekend to advance to provincials. Regionals were held in Oxbow. Carter Daoust and Dustin Doerr earned gold in boysâ&#x20AC;&#x2122; doubles for ECS, while Paige Collopy and Jolan Lingelbach won gold in mixed doubles, defeating another Elecs duo in the final, as Calder Clark

and Harley Doerr took silver in the same event. The three doubles teams will compete at provincials in Wilcox this weekend. Sydney Mellom and Keya Rode of Oxbow finished in second place in the girlsâ&#x20AC;&#x2122; doubles event, losing to a team from Cupar. Other regional playoffs on the weekend were held in Swift Current, Canwood and Saskatoon.

Six ECS athletes are headed to the provincial badminton championship in Wilcox this weekend. Back row, from left: Lindsay Collins (coach), Dustin Doerr, Carter Daoust, Jolan Lingelbach, Paige Collopy. Front row: Harley Doerr, Calder Clark. (Submitted Photo)

Prior Client Appreciation Draw DQGWKH:LQQHUVDUH

0DWWKHZ:LOVRQ 'HORUHV%XWOHU 'RQ7KRPSVRQ

Congratulations! Race Day

1134 4th St, Estevan, S4A 0W7 306-634-6737 fax: 306-634-3855 hrbestevan@sasktel.net

Travis Peery leads a pack of several cars around Turn 4 during the modified feature on Saturday at Estevan Motor Speedway.

(VWHYDQ6KRSSHUV0DOO ZZZEKJUHVVHVWHYDQFD

Â&#x2021;Â&#x2021;

/(

6RUOHLQ$YHQXH

0/6Â&#x160;

6HUHJJHOD3ODFH

0/6Â&#x160;

)7 1HZ

%XLOG

-HVVH%D\(VWHYDQ

(ULFNVRQ6WUHHW0LGDOH

0/6Â&#x160;

0/6Â&#x160; 1HZ

%XLOG

0DLQ %LHQIDLW

 0/6Â&#x160;

0D\IDLU%D\(VWHYDQ

0/6Â&#x160;

1LFKROVRQ5RDG(VWHYDQ

0/6Â&#x160;

:KLWH6WUHHW%LHQIDLW

0/6Â&#x160;

<RXQJ$FUHDJH

0/6Â&#x160;

QG6WUHHW

0/6Â&#x160;

6HFRQG6WUHHW(VWHYDQ

0/6Â&#x160;

$UFKLEDOG6W0LGDOH

0/6Â&#x160;

+ROPJUHQ%D\(VWHYDQ

0/6Â&#x160;

8OVWHU$YHQXH1RUWK3RUWDO

0/6Â&#x160;

'XWND$FUHDJH

0/6Â&#x160;

6SUXFH'ULYH(VWHYDQ

0/6Â&#x160;

<RXQJ6WUHHW

 0/6Â&#x160; +HQU\6WUHHW(VWHYDQ

0/6Â&#x160;

-DPLH '\HU REALTORÂŽ 

&KDUORWWH 5RHWWJHU REALTORÂŽ 

-DFNLH )LW]VLPPRQV REALTORÂŽ 

/RUL *RQDV REALTORÂŽ 

0HODQLH 3HWHUV REALTORÂŽ 

0HLJDQ :LOKHOP REALTORÂŽ 

7DOOPDQ6WUHHW0DFRXQ

0/6Â&#x160;

0LNH 'H%UX\QH REALTORÂŽ 

-RDQ 6HON REALTORÂŽ 

9LMD\ &KDQGRUD REALTORÂŽ 

3KLOOLSV3ODFH

0/6Â&#x160;

/LVD 0RQWH\QH REALTORÂŽ 

.HQ 5RZDQ REALTORÂŽ  SDUWWLPH

-RVK /H%ODQF REALTORÂŽ  SDUWWLPH

,QIRUPDWLRQLVGHHPHGUHOLDEOHEXWLVQRWJXDUDQWHHG6XEMHFWWRRPLVVLRQVSULRUVDOHFKDQJHRUZLWKGUDZOZLWKRXWQRWLFH1RWLQWHQGHGWRVROLFLWSURSHUWLHVDOUHDG\OLVWHGIRUVDOH


www.estevanmercury.ca

May 8, 2013 B5

No surprises on Speedwayâ&#x20AC;&#x2122;s opening day None of the feature winners at Estevan Motor Speedway on Saturday came as much of a surprise to anyone. Tyson Turnbull picked up his fourth career feature win at EMS. Although he doesnâ&#x20AC;&#x2122;t have a ton of wins under his belt, heâ&#x20AC;&#x2122;s a constant threat and is the defending modified champion â&#x20AC;&#x201D; not entirely of his own doing, but weâ&#x20AC;&#x2122;ll not rehash that again. Turnbull has shown in the past heâ&#x20AC;&#x2122;s able to come from way back to finish high â&#x20AC;&#x201D; look at championship night last year, where he came from 25th to finish second â&#x20AC;&#x201D; and he did that again. Turnbull started in fourth, but fell back a bit before making a charge to the front. In the stock car division, Gregg Mann was in a class of his own all day, dominating his heat and then going wire-to-wire for the win in the feature. Mann hasnâ&#x20AC;&#x2122;t managed a season championship yet, but heâ&#x20AC;&#x2122;s fourth all-time in stock wins at EMS with five, and heâ&#x20AC;&#x2122;s most definitely a threat to win it all this year. In the hobby feature, Brock Beeter grabbed the lead when early leader Keith Cassidy got involved in a wreck, and he never let it go. Beeter won both hobby features during the seasonending doubleheader last year and continued his streak in the 2013 opener. He now has five career wins at EMS. Most importantly, the Speedway didnâ&#x20AC;&#x2122;t get an unwanted surprise like they did so often last year. There wasnâ&#x20AC;&#x2122;t a raindrop to be seen all day, and that

Josh Lewis Hear Me Out allowed the 2013 season to get off to a far better start than last year, when the first four race days of the year were rained out. The afternoon race program worked out great, allowing fans to enjoy some great weather and then head to the MĂśtley CrĂźe concert in the evening. Speaking of surprises, needless to say, Mick Mars got a big one on his 62nd birthday. *** I was pleasantly surprised with the Toronto Maple Leafsâ&#x20AC;&#x2122; play in the second and third games of their series against Boston, but Iâ&#x20AC;&#x2122;m afraid theyâ&#x20AC;&#x2122;re still in over their heads. Game 1 was an unmitigated disaster where NHL defencemen completely forgot how to play the position.

Thatâ&#x20AC;&#x2122;s all Iâ&#x20AC;&#x2122;m saying about that. The Leafs rebounded in Game 2, earning a win in Boston, something I never thought they would do. Not only that, Phil Kessel finally scored an even-strength goal against his former team for the first time in four years. The Bruins have owned Kessel ever since he left, and that was a huge breakthrough moment. Randy Carlyle also did a great job of getting him away from Zdeno Chara, despite not having the last change. Kessel would score again in Game 3 on home ice, but despite a third period they couldnâ&#x20AC;&#x2122;t possibly have dominated more, the Leafs fell 5-2, with the Bruins adding an empty netter. The Leafsâ&#x20AC;&#x2122; biggest issue is the bad giveaways. Other than that, they played extremely well Monday night, sending 48 shots at Tuukka Rask. I donâ&#x20AC;&#x2122;t know how they managed not to score during that huge flurry in the later stages of the third, but they played well enough to win on most other nights. Iâ&#x20AC;&#x2122;m more confident than I was at the beginning of the series, especially with the heart the Leafs showed in Game 2, but itâ&#x20AC;&#x2122;s still going to be a steep uphill climb. Contact Josh Lewis at 306-634-2654 or sports@ estevanmercury.ca. If youâ&#x20AC;&#x2122;re going to tackle someone in MĂśtley CrĂźe, how much of a coward do you have to be to go after the one with a debilitating bone disease?

Blazers team to be honoured

Wrong Way Keith Cassidy was leading the hobby stock feature at Estevan Motor Speedway on Saturday until spinning out on this turn, leading to a yellow flag.

Twins doubleheader postponed The Southeast Legacy Twins had been scheduled to kick off their regular season on Saturday with a doubleheader against the Saskatoon Giants. However, the games in Saskatoon were postponed and will now be played on July 7. The season opener for the midget AAA baseball club will now come on Saturday, as the Twins host a doubleheader against the Moose Jaw Devons at

Lynn Prime Park. Game times are 1 and 3 p.m. After that, the Saskatchewan Premier Baseball League club heads to Regina on Tuesday to play the Regina Athletics. There are fi ve Estevan players on the Twinsâ&#x20AC;&#x2122; roster, including outfielder Tanner Odgers, infi elders Austin Orsted, Colton Gingras and Logan Hertes, and catcher Jolan Lingelbach, as well as Lucas Lafrentz of Bienfait.

Gingras and Hertes are rookies. There are also four

players from Weyburn and one each from Carnduff, Tribune and Oxbow.

Estevan Minor Baseball will honour members of the 2008 KPC Blazers at the Western Major Baseball League game being played in Estevan on June 10. The Blazers won the Western Canadian midget AAA championship that year. A pre-game ceremony will be held at Lynn Prime Park prior to the WMBL game between the Weyburn Beavers and Yorkton Cardinals. Game time is 7:10 p.m. Three players are now members of the Beavers and â&#x20AC;&#x153;it was a natural fit to celebrate their success at the same field where they captured the title,â&#x20AC;? said an EMB press release. The Blazers defeated British Columbia 9-4 in extra innings to win the championship. The WMBL game will also feature a draw for a trip to see the Toronto Blue Jays. Beavers players will return to Estevan on Tuesday and Wednesday to provide free minor ball clinics at Cactus Park. The 2008 Blazers team was coached by Mel Murray, Kelly Panteluk, Greg Fieber and Carl Henneberg. The roster was made up of Riley Panteluk, Dylan Lafrentz, Jordan Blanchette, Kris Keating, Riley Spencer, Grant Henneberg, Dylan Hauk, Brendan Phillips, Cody Cairns, Josh Naka, Jordan Fieber, Devon Carriere, Derek Wallace, Dylan Hauck, Evan Zerff, Logan Calanchie and Chris Untereiner.

)LUVW7ZR6SULQJ

(VWHYDQ)DUPHU¡V0DUNHWV ZLOOEHKHOGLQGRRUVDWWKHPDOO 6DWXUGD\0D\WK WK DPSP DPSP ´%X\/RFDO(DW/RFDO/LYH*UHHQ¾

&$7(5,1* )URPODUJHZHGGLQJVWRVPDOOHULQWLPDWHDIIDLUV (%¡V'LQLQJ(PSRULXP  /HWXVORRNDIWHUWKHFDWHULQJ 7KHUHVD0DFN 5RELQ+RGJHQV0D\ 'DQLHOOH.RQDQ] .\OH*DUDJDQ0D\ FDQPDNH\RXU6SHFLDO(YHQWD 'D\WR5HPHPEHU %UDG\%HQQLQJ -HUHPLH3\OH0D\

Bridal Guide 2013

$QJHOD$QGHUVHQ %U\DQ3UHWWH-XQH .DLWOLQ%LOO $URQ+DPPHUPHLVWHU-XQH 6WHSKDQLH&URVVPDQ %URRN'DQJHU-XQH .DVVH\6FKUDGHU $QGUHZ0XUUD\-XQH 0DU\/HYHU -RQ2UORZVNL-XQH &KDULW\-DKQ =DFKDU\0RUDQ-XQH %ULWWDQ\5DH 'HUHN:LOKHOP-XQH -HVVLFD'XNDUW 0DWWKHZ/HDVN-XQH 5HQHH6HKQ -RVHSK7KRPV -XO\ 1LNNL:LOVRQ -RVKXD+RXVH -XO\ .HOVH\+XG\P $GDP%URGQHU -XO\ -HVVLFD6HLGD -DVRQ%UDQGRQ -XO\ &RQQLH+HDWK %UDGOH\.LHVPDQ -XO\ -DQHOOH%XWOHU 7UHYRU/XGGLQJWRQ -XO\ $VKOH\6HQFKXN 5RE*DOODZD\ -XO\ 1LFROH%DQNV -XVWLQ']XED -XO\ +DOH\%DULO 6DQGRQ:HEHU$XJXVW $VKOHLJK&KHUHZ\N =DFK']XED 6HSWHPEHU .D\OD6FKRII &KULV'XFKFKHUHU 6HSWHPEHU /LVD0LWFKHOO .\OH3HWWHUVRQ 6HSWHPEHU 0RQLTXH%HODQJHU .HYLQ/H\2FWREHU $P\.HHVV 3DXO*XWKHLO2FWREHU $PLH6HKQ .\OH:KLWHKHDG -XO\ $P\+DPPHUPHLVWHU %UDGOH\%HOLWVNL$XJXVW %UHRQQD$OH[DQGHU 5REHUW*UDKDP$XJXVW

)URPODUJHZHGGLQJVWRVPDOOHU LQWLPDWHDIIDLUV /HWXVORRNDIWHUWKHFDWHULQJ 6RXULV$YH (VWHYDQ

 )$6+,21 &RWHDX$YH( :H\EXUQ6. 3K

Â&#x2021;$WWHQWLRQ*UDGXDWHV :HKDYHEHDXWLIXOJRZQVRQVDOH Â&#x2021;)DQF\DWWLUH0RWKHURI%ULGH Â&#x2021;-HZHOOHU\ $OZD\V7KDW3HUVRQDOL]HG6HUYLFH

$SSRLQWPHQWVPD\EHPDGH

7R$QQRXQFH<RXU8SFRPLQJ:HGGLQJ)RU)UHH

&DOO

6W0DU\·V6FKRRO0D\WKSP $UWKXU$YH(VWHYDQ

6HHXVDWWKH(VWHYDQ6KRSSHUV0DOO 3DUNLQJ/RWHYHU\6DWXUGD\XQWLO2FWREHU

Recycle This Paper

127,&(2)$118$/38%/,&*(1(5$/ 6&+22/&20081,7<&281&,/0((7,1*6

6DFUHG+HDUW6FKRRO0D\WKSP *LEEV5RDG(VWHYDQ

3XEOLF0HHWLQJVDUHVFKHGXOHGIRUWKHSXUSRVHRIHOHFWLQJ PHPEHUVWRWKHLU6FKRRO&RPPXQLW\&RXQFLOV 1RPLQDWLRQIRUPVFDQEHSLFNHGXSDWWKHVFKRROVGXULQJ UHJXODUVFKRROKRXUV&RPSOHWHGQRPLQDWLRQIRUPVDUHWREH UHWXUQHGWRWKHVFKRROVE\QRODWHUWKDQSPWKHQLJKWV RIWKHPHHWLQJV 7KHDWWHQGDQFHDUHDRIHDFKLQGLYLGXDOVFKRROLVWKH ERXQGDU\IRUWKHHOHFWLRQRIWKH6FKRRO&RPPXQLW\&RXQFLO PHPEHUV 7KH(OHFWLRQ0DQXDOGHYHORSHGE\WKH +RO\)DPLO\5&66'PD\ EHYLHZHGDWWKHVFKRROV

08/7,%5,&.¡[¡5XEEHU 6LGHZDONV 3DWLR%ORFNV

Applications for: â&#x20AC;˘ Sidewalks â&#x20AC;˘ Patios â&#x20AC;˘ Hot Tub Pads â&#x20AC;˘ Golf Cart Paths 1 inch overlap for weed control Provides instant access once installed. Flexible and will not crack from frost heave. Easy to move and rearrange if required.

(DV\WR,QVWDOO

&DOO'DYH Visit us on the web!! www.estevanmercury.ca


B6 May 8, 2013

Estevan Mercury

Tower Wolves will play ball again It appears senior baseball will be played in Estevan this year after all. The existence of the Estevan Tower Wolves was in serious jeopardy earlier this spring when no one could be found to manage the Saskota Baseball League team. They also didnâ&#x20AC;&#x2122;t have enough players. It seems both issues have been resolved. Layne Wolos will be running the Wolves this year. He said he didnâ&#x20AC;&#x2122;t want to see the team miss a year or more in the Saskota league. â&#x20AC;&#x153;I just feel the guys have given up their time in the past to look after it, and itâ&#x20AC;&#x2122;s one of those

things where you donâ&#x20AC;&#x2122;t want to let it get to the point where it falls by the wayside. I talked to some of the guys and we thought we had enough players to put together a team,â&#x20AC;? said Wolos. â&#x20AC;&#x153; We â&#x20AC;&#x2122; v e g o t s o m e younger players coming up from midget next year, six or seven of them, so we felt that if we could keep the team going that there would be more the next year.â&#x20AC;? The Wolves play their first regular season game on May 23 against the Arcola Threshers. The team has 14 players right now, though they are looking for more. Anyone interested in suiting

up is asked to contact Wolos at 306-421-4247. The Wolves will be holding open practices in the near future. Wolos said another factor in keeping the team going was that the players didnâ&#x20AC;&#x2122;t want to let the diamonds at Lynn Prime Park go underused. â&#x20AC;&#x153;With the new ball diamond being (put) in place a few years ago, a lot of guys felt, being a community thing, that we wanted to keep it going. Weâ&#x20AC;&#x2122;ve had a competitive team in the past, and itâ&#x20AC;&#x2122;s always good to keep things going so (playing on a senior team) is an option for future players,â&#x20AC;? he said.

Adam Ziegler of the Estevan Tower Wolves throws a pitch during a Saskota Baseball League game last year. (File Photo)

Smart and Hedges top them all at Walleye Classic A couple of friends got together for a day of fishing on the Boundary Dam reservoir on Sunday and finished around 5 p.m. with $1,500 in official prize money to show for their efforts. Ralph Smart of Estevan and Rom Hedges of Antelope, Mont., finished well ahead of their nearest challengers in the 2013 Walleye Classic at Boundary Dam, thanks mainly to the fact they landed two fish that weighed in at well over four pounds each. Their five fish total in the catch and release tournament came in at 15.82 pounds, relegating the team of Cody Degelman and Mychal Toth to second place with their 8.78 pounds of fish caught in the one-day event that began in the early morning on the first official fishing day in the new season. The tournament had been placed in jeopardy with recent water releases from Boundary to accommodate possible flood conditions in southeast Saskatchewan, but those fears were allayed and recent spring runoffs left the lake level more than adequate for tournament needs as 48 boats containing two-person teams went out in the water in two flights. â&#x20AC;&#x153;We had 50 entries, but two teams were no-shows,â&#x20AC;? said Estevan Wildlife Federation president Mike Halirewich, who credited a team of over 20 volunteers for making this yearâ&#x20AC;&#x2122;s event a smooth success. Smart and Hedges not only collected the $1,200 in first place prize money in the tourney, but they also picked up the $300 cash prize for bringing in the largest fish, a 4.4 pound specimen. Degelman and Toth received $900 for their second place finish and the Estevan father and son team of Mark and Josh Michel received $600 for their third place finish with a total catch of 8.58 pounds.

Ralph Smart (left) of Estevan and Rom Hedges from Antelope, Mont. teamed up to catch these two four-pound plus walleyes in the Boundary Dam reservoir on Sunday which helped them accumulate nearly 16 pounds of fish, giving them first place in the Estevan Wildlife Federationâ&#x20AC;&#x2122;s annual Walleye Classic. The 4.4 lb. fish, the biggest of the two, also gave them the winning cheque for having caught the biggest fish in the tourney. Finishing off the list of cash prize winners were Joel Campbell and Richard Panchuk with $400 for fourth place with 8.10 pounds of fish followed by Brad and Darren Frater who received $300 for 7.80 pounds and finally, Alen Nicholson and Nick Bennett who picked up $200 for 7.78 pounds of fish. This yearâ&#x20AC;&#x2122;s winning team compared favourably with most of the main prize winners of the past except for last yearâ&#x20AC;&#x2122;s winning combination of Dave Fawcett and Lorne Garland who brought in a total of 17.56 pounds. The fishers were pleased with the weather conditions as temperatures soared and winds remained calm. And while the Boundary Dam waters proved to be a bit murky due to the recent churning caused by the runoff and





2)) 3URP *RZQV

 &ORVLQJWKH'RRUV

6$/(

'LVFRQWLQXHG *RZQV

1211 4th Street - Estevan - 636-7001

2)),&($1'5(7$,/63$&( $9$,/$%/(,1(67(9$16.

.HQVLQJWRQ$YHQXH

DFURVVIURP+XPSW\V

release actions, it didnâ&#x20AC;&#x2122;t seem to bother them, or the fish. Local and visiting sportsmen and women will next be able to turn their attention to the upcoming Bass Master challenge, the annual bass fishing tournament slated for these same waters on June 15. Halirewich said the catch and release tournament was a big success on the fish survival front as well. He said only one fish was lost in

the whole tournament. The EWF president said since the rules regarding the fishing season have changed, next yearâ&#x20AC;&#x2122;s tournament will be held on the first Saturday following the official opening day date of May 5, which will be a Monday. â&#x20AC;&#x153;We canâ&#x20AC;&#x2122;t operate a tournament on a Monday, we wouldnâ&#x20AC;&#x2122;t get the volunteers weâ&#x20AC;&#x2122;d need, so it was a unanimous decision to hold this tournament on the first Saturday after the season opens.â&#x20AC;? In the past, the first official fishing day in each new season was the first Saturday in May. Halirewich said he didnâ&#x20AC;&#x2122;t expect the slight change would affect many fishers in the tournament. â&#x20AC;&#x153;Besides, it seems that about 80 per cent of the people who enter are returnees. They like this tournament and they keep coming back,â&#x20AC;? he said. Thoughts of expanding the event to include more teams and boats have been considered and rejected, he said. â&#x20AC;&#x153;Those doing the fishing feel that 50 boats is enough for this body of water, especially when you take into consideration there are a few dozen other boats out there doing some fishing who arenâ&#x20AC;&#x2122;t in the tournament,â&#x20AC;? he said. Getting all 50 boats launched in the early morning and then docked and loaded up at the end of the tournament becomes a logistical challenge, even with two docks available to handle the flow.

Riders coming for tournament Better Homes and Gardens Real Estate Signature Service will be holding a celebrity golf tournament in Estevan on May 24. All proceeds from the event at the TS&M Wood-

lawn Golf Club will go to the Estevan Kinsmen. Former and current Saskatchewan Roughriders Roger Aldag, Wes Cates, George Reed, Geroy Simon, Gene Makowsky, Chris

Notice

%RXQGDU\'DP/DNH'HYHORSPHQW$VVRFLDWLRQ &/($1832)&203281'$5($ 3URSHUW\QRWRZQHGE\%RXQGDU\'DP5HVLGHQWVPXVW EHUHPRYHGE\-XQH 3URSHUW\RZQHGE\UHVLGHQWVPXVWEHLGHQWLĂ&#x20AC;HGE\ -XQH $OOXQLGHQWLĂ&#x20AC;HGSURSHUW\ZLOOEHGLVSRVHG &RQWDFWV:D\QH=DQGHH'DUF\0F*LOOLFN\.HQ$OODQ RU5R\0RZEUD\

Szarka, Jeremy Oâ&#x20AC;&#x2122;Day, Scott Schultz and Don Narcisse will be in attendance along with members of the Ridersâ&#x20AC;&#x2122; cheerleading team. People can also bid to play golf with the celebrities. Participation is limited to 120 people and the tournament will get underway at noon. Golfers must register by Friday. Tickets are $100 each and available at Better Homes and Gardens in the Estevan Shoppers Mall, or from any Estevan Kinsmen member. Tickets include supper, but not cart rental.

3OHDVHMRLQXV WRFHOHEUDWHWKH WK:HGGLQJ$QQLYHUVDU\ RI

5HWDLO6SDFHV$YDLODEOH PLQLPXP6T)WEXLOGWRVXLW

+ROGLQJV,QF

)RUOHDVHRUUHQWDOLQIRUPDWLRQFRQWDFW7UHHQD RU HPDLOWKLUVFK#VDVNWHOQHW

1LFN 9HUQD0RUVN\  ZLWKD&RPH *R7HD 6DWXUGD\0D\ 30 7ULQLW\/XWKHUDQ&KXUFK QG6WUHHW


WEDNESDAY

May 8, 2013

â&#x20AC;&#x153;We do our stuff together.â&#x20AC;? â&#x20AC;&#x201C; Peter Peters, President of the Canadian Rotary Collaboration for International Development.

â&#x20AC;˘ Carpet â&#x20AC;˘ Linoleum â&#x20AC;˘ Laminate â&#x20AC;˘ Hardwood â&#x20AC;˘ Ceramic Tiles â&#x20AC;˘ Paint â&#x20AC;˘ Window Coverings â&#x20AC;˘ Granite 3URIHVVLRQDO,QVWDOODWLRQV)UHH(VWLPDWHV +Z\6RXWK (67(9$16.  %D\+Z\ &$5/</(6. 3K

B7

Rotary club celebrates 90th year in style The Estevan Rotary Club celebrated in style last Friday night, marking its 90th anniversary with some special guests and a few awards along with entertainment. One of the special guests, Lieutenant-Governor Vaughn SolomonSchofield, perhaps said it best when she said the club was a fine example of â&#x20AC;&#x153;the power of communal effort.â&#x20AC;? She said as a representative of the Queen who knows something about public service, she quoted Elizabeth II as noting that â&#x20AC;&#x153;the greatness in a country is measured by what it gives to the world.â&#x20AC;? â&#x20AC;&#x153;So thatâ&#x20AC;&#x2122;s you,â&#x20AC;? said Solomon-Schofield, in speaking to the Rotarians and about 150 of their guests who had gathered in the Days Inn Plaza for the banquet and celebration. The eveningâ&#x20AC;&#x2122;s program included the awarding of eight honourary Paul Harris Fellowship certificates and a keynote address from Peter Peters, a former health services executive who is currently serving Rotary as president of the Canadian Rotary Collaboration for International Development. Solomon-Schofield, during her brief address, noted that local Rotarians

focused not only on making a difference on the home front, but also on the international scene. â&#x20AC;&#x153;You make a difference here in Estevan and around the world,â&#x20AC;? she said. MLA Doreen Eagles and Estevan Mayor Roy Ludwig also brought greetings, with Eagles saying when the name Rotary comes up she immediately thinks of such things as exchange students, the annual carol festival and the well known Rotary Park, which is part and parcel of the larger Woodlawn Regional Park. Ludwig pointed out the clubâ&#x20AC;&#x2122;s strong volunteer base and the fundraising efforts over the years that have benefited the community. Wayne Claypool, a former Estevan club member and former district governor, brought greetings from current district governor Rick Hubbs, who was unable to attend due to flood problems in his home community of The Pas, Man. Kim Thorson brought greetings from the Weyburn Rotary Club, which was the group that sponsored the first Estevan Rotary Club back in 1923. John Johnson also

brought greetings and a plaque of recognition and congratulations from the Estevan Lions Club. Current club president Brian Pilloud provided an historical summary of the clubâ&#x20AC;&#x2122;s many achievements over the years on both the local and international fronts, suggesting that on more than a few occasions Rotary has been able to bring community stakeholders â&#x20AC;&#x153;to the tableâ&#x20AC;? and they soon expected to do that again. The honourary Paul Harris Fellow Awards are named after the man who founded Rotary in 1905. The fellowship program began in 1951. The local club provided a $1,000 donation in the name of each of the Estevan and area recipients: Stacy Grunert, Alan Hamann, Evelyn Johnson, Evelyn Mansuy, Gary St. Onge, Art Beselt and Eric and Erna Pullam. Each of the recipients, it was said, has contributed to the community in diverse ways, but all have done so with a positive approach in whatever project they have tackled. In his keynote address, Peters noted that â&#x20AC;&#x153;Rotary is not about kings and rulers, but rather building stepping stones.â&#x20AC;?

Eric and Erna Pullam Peters compared the privileged lifestyle his young granddaughter Mia enjoys compared with a youngster living in poverty in a Third World country where one million children die each year before they reach the age of five. â&#x20AC;&#x153;They live in worlds of forced labour, child prostitution, refugee camps. They live in a world where 17 per cent of the population canâ&#x20AC;&#x2122;t read and 18 per cent never have decent drinking water,â&#x20AC;? said Peters, adding that one-seventh of the worldâ&#x20AC;&#x2122;s population donâ&#x20AC;&#x2122;t have toilets, â&#x20AC;&#x153;another small attack on human dignity.â&#x20AC;? So Rotary comes to

that situation with a spirit of fellowship and assistance with 34,296 clubs and over 1.2 million members. â&#x20AC;&#x153;We do our stuff together,â&#x20AC;? he said. Peters added that Rotary does their work in a spirit that politicians would be better advised to follow, that being a spirit of friendship, honesty and forthcoming attitude to deal with issues in an environment of partnerships. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re in the business of partnership and in learning to do the dance and how to respond when we get there and weâ&#x20AC;&#x2122;re willing to listen to what they have to say,â&#x20AC;? he added.

On the international scene, Peters noted that Rotary was on the cusp of eradicating polio from the Earth in a spirit of partnerships, with just 22 cases reported this year. His advice in his closing remarks was to â&#x20AC;&#x153;build, donâ&#x20AC;&#x2122;t tear down even though itâ&#x20AC;&#x2122;s easier to tear down.â&#x20AC;? The program closed with musical entertainment from the Estevan A Cappella Singers. Rotarian Cory Prokop served as emcee for the eveningâ&#x20AC;&#x2122;s busy agenda, which also included the introduction of visiting Rotarians.

Honourary Paul Harris Fellow recipients from Estevan who received certificates on Friday night are pictured with presenter Saskatchwanâ&#x20AC;&#x2122;s Lt. -Gov. Vaughn Solomon Schofield.

Gary St. Onge

Art Beselt

.HHS$Q (\H 2Q<RXU +($/7+

Evelyn Johnson

Evelyn Mansuy

:KDWÂśV<285ERG\IDWSHUFHQWDJH"

&DOOIRUD)5((FRQVXOWDWLRQ DQG)5((%&$VFDQWRGD\ 306 637 2570

Alan Hamann

Stacy Grunert

Charlies

Weight Control for Wellness dĹ&#x161;Ä&#x17E;WĆ&#x152;Ĺ˝Ć&#x161;Ä&#x17E;Ĺ?Ĺś^ŽůƾĆ&#x;ŽŜ

#100 1176 - Nicholson Rd (St. Josephâ&#x20AC;&#x2122;s Hospital) Estevan, SK S4A 2V6 Email: charliesweightcontrol@sasktel.net Web: charliesdietcentre.com


YOUR QUICK LUBE SERVICE SPECIALISTS

May 8, 2013

WEDNESDAY

â&#x20AC;&#x153;SaskPower is making unprecedented investments to ensure the electricity system is environmentally sustainable and ready for the future.â&#x20AC;?

Lube Hours: Mon. - Sat. 7 am - 5 pm

â&#x20AC;&#x201D; Robert Watson, CEO of SaskPower

B8

238 4th Street, Estevan Phone 634-6276

Say goodbye to Unit 1 at Boundary Dam The oldest unit in Saskatchewanâ&#x20AC;&#x2122;s coal-fired electrical power generating system has been shut down for good. Unit No. 1 at Boundary Dam Power Station was retired in late April according to information released by the company in early May. The unit, which produced up to 62 megawatts of generating capacity, was deemed to be too old and too small to warrant conversion to a carbon dioxide capture program similar to what is currently underway on Unit No. 3, which is newer and capable of supplying up to 110 megawatts of

4XDOLW\&RQWUROOHG 6DIHW\&RRUGLQDWHG

electricity after retrofitting. Another aging unit, No. 2, which is as old as No. 1, being commissioned in 1960, is also slated for retirement in the near future. That will probably be sometime after Unit No. 3 is put back into service with the CO2 capture equipment fully implemented and operational. Mike Zeleny, Boundary Damâ&#x20AC;&#x2122;s former general manager, who has moved over to the transition and operation side for the re-introduction of Unit 3, said â&#x20AC;&#x153;Unit 1 will be made safe from an environmental perspective and will remain in that state. There are no immediate plans to dismantle it at this time.â&#x20AC;? Robert Watson, CEO for SaskPower, said that â&#x20AC;&#x153;SaskPower is making unprecedented investments to ensure the electricity system is environmentally sustainable and ready for the future.â&#x20AC;? He added that coal has been and will continue to be a reliable low-cost source of power since the $1.24 billion carbon capture project at Unit No. 3 will bring the company into a new era of clean coal technology and production. New emission standards take effect July 1, 2015 and Units 1 and 2 just could not fit into a refurbishment schedule in time, plus they are older and smaller units. The remake of Unit 3 will ensure that 90 per cent of the carbon dioxide emitted from that generator will be captured and stored underground for use as an agent for enhanced oil recovery practices in the nearby Goodwater/Weyburn

3URYLGLQJ2LOĂ&#x20AC;HOG6HUYLFHV 6LQFH

2[ERZ &DUO\OHÂ&#x2021; :DVNDGDÂ&#x2021; 3LSHVWRQHÂ&#x2021;

TECHNICAL SERVICES LTD

Box 931, 548 Bourquin Road Estevan, SK S4A 2A7 P: 306.637.3360

0D\&RQWUDFW

(A Division of Total Energy Services Ltd.)

TRUCKING â&#x20AC;˘ Pickers â&#x20AC;˘ Bed Trucks â&#x20AC;˘ Winch Tractors â&#x20AC;˘ Texas Beds

&ORVLQJSULFHDVRI 0RQGD\0D\

6SRQVRUHGE\



 86'2//$56

area oilpatch. SaskPower is also building a carbon capture test facility in partnership with Hitachi Ltd. at nearby Shand Power Generating Station. This is a $60 million project with the two companies sharing the construction costs equally. It will be ready to accommodate neutral platform tests for electrical power vendors by mid-2014, said Watson. These vendors will be able to test, verify and improve their own post-combustion technologies in a commercial environment. Boundary Dam, in the meantime, now has a total generating capacity of 766 megawatts after discounting the 62 megawatts that Unit 1 used to bring to the table. Retiring the old unit means the removal of about 350,000 tonnes of CO2 emissions while not negatively impacting SaskPowerâ&#x20AC;&#x2122;s ability to supply all the electrical power needs for customers.

www.canyontech.ca

&58'(2,/ 

Robert Watson, CEO of SaskPower

%UDQFKHVLQ(VWHYDQ&DUQGXIIDQG%UDQGRQ

RENTALS â&#x20AC;˘ 400 BBL Tanks, Lined, Sloped, Steam Coiled, Sumped & Sour Serviced, ACID Enviro-Vac Units, Flare Tanks â&#x20AC;˘ Rig Mats â&#x20AC;˘ Invert Systems

MIDALE 306â&#x20AC;˘458â&#x20AC;˘ 2811

â&#x20AC;˘ Surface Sump Tanks â&#x20AC;˘ Caterpillar Loaders â&#x20AC;˘ Vapor Tight Equipment â&#x20AC;˘ Portable Flaring Equipment â&#x20AC;˘ Flow Back Separators â&#x20AC;˘ Pre-Mix Systems

midale@totaloilĂ&#x20AC;eld.ca

(/(&75,&$/&216758&7,21 0$,17(1$1&( 6(59,&( 3/&Ň&#x2039;69)'Ň&#x2039;6 %$77(5<&216758&7,21 *(16(75(17$/6 75(1&+,1* 027256$/(6 5(3$,56

2LOĂ&#x20AC;HOG(OHFWULFDO &RQVWUXFWLRQ 6HUYLFH

(QIRUP&25&HUWLĂ&#x20AC;HG

,QVWUXPHQWDWLRQ 0RWRU6DOHV5HZLQGV 5HSDLUV .HQVLQJWRQ$YH(VWHYDQ6.

  +2856(59,&(

+2856(59,&( '(921,$167(67(9$16. 3+)$; /2&$//<2:1(' 23(5$7('

6 H U Y L Q J  W K H 2,/3$7&+RI:(67(51&$1$'$

/RQJ+DXO&DQDGD86

ZZZEED[WHUWUDQVSRUWFDÂ&#x2021;

'5,//,1*/,&(16(6

(LJKWHHQQHZOLFHQVHVLVVXHGWR7KXUVGD\0D\ ' ' ' ( (

&3(&*OHQ(ZHQ1+] $% &3(&9LHZĂ&#x20AC;HOG+]&' 5HG%HGV*DLQVERURXJK+] $$ .LQJODQG$XEXUQWRQ+]'& 3HWUH[HWDO4XHHQVGDOH:+]'%

5,*5(3257

. $GYDQFH &3(&9LHZĂ&#x20AC;HOG+]&& ( '=9&7DEOHODQG+]$'

% / % % . . . %

:$,7,1*21352*5$0

552,5\HUVRQ+] %' 6KRRWLQJ6WDU)DLUOLJKW 4XHVWHUUHHWDO5\HUVRQ+] %$ 92&5HGYHUV 3%(10RRVRPLQ (SSLQJHWDO%HOOHJDUGH6:' +LJKURFN/LJKWQLQJ 0RVDLF.(VWHUKD]\:6:

"For all your OilĂ&#x20AC;eld Construction, Maintenance & Pipeline needs!" Randy: 634-5405 Cellular 421-1293

Darcy: 634-5257 Cellular 421-1425

24 Hour Service - 634-8737 LOCALLY OWNED & OPERATED FAX # 634-4575 BOX 843, ESTEVAN, SK.

7+( (67(9$10(5&85< '5,//,1*5(3257 ( * ' % - - + & * % % ( & & - $ $ - % $ % & .

0RVDLF(VWHUKD]\(+ &3(&:DZRWD 0RVDLF.(VWHUKD]\:6:  .5&&DQWDO6RXWK'''' 3KDVHHWDO0DQRU 7ULZHVW$ODPHGD(DVW6:' .LQZHVW$ODPHGD &3(&9LHZĂ&#x20AC;HOG+] '' 6LOYHU6SXU9LHZĂ&#x20AC;HOG+] &% &3(&9LHZĂ&#x20AC;HOG+] '' &3(&9HLZĂ&#x20AC;HOG+]'' &3(&9LHZĂ&#x20AC;HOG&' &3(&9LHZĂ&#x20AC;HOG&& &3(&9LHZĂ&#x20AC;HOG:6: &9(:H\EXUQ &3(&+RIIHU+]$% &9(:H\EXUQ &9(:H\EXUQ7 $UF7ULEXQH 5LR7LQWR6HGOH\ 6SDUWRQ&H\ORQ (SVLORQ&H\ORQ+] && 3%(13DQJPDQ'' %'


May 8, 2013

WEDNESDAY



'LDQH -RFHO\Q

WK6W

B9 TENDERS

URGENT NEED To locate Mandy B oye r a n d G e ra l d B i d y k a n d where employed. Believed to be in the Stoughton area. Monetary reward for information leading to their current location. jrey@live.ca

LAND PARCEL SALE BY TENDER

IN MEMORIAM

ZZZHVWHYDQUHDOHVWDWHFRP MOBILE/ MANUFACTURED

ANNOUNCEMENTS

MOBILE/ MANUFACTURED

SPIRITWOOD

SW 17-28-29W1 RM of Shell River, MB 80 acres Hay/Pasture/Bush For Farm/Recreation/ Acreage Highest or any Tender not necessarily accepted.

At the Estevan Mercury Pay Full Price for a CLASSIFIED in

Estevan

Mercury

13052JJ00

www.estevanmercury.ca

Repeat the Same Ad in the SOUTHEAST TRADER

EXPRESS

¡ 1,894 sq. ft. ¡ Main ďŹ&#x201A;oor laundry ¡ 5â&#x20AC;&#x2122; jetted bathtub ¡ Triple pane windows ¡ Optional gas ďŹ replace ¡ Optional stone on exterior of living room AND MUCH MORE â&#x20AC;˘ SEE STORE FOR DETAILS

Closes 05/17/2013 204-937-7054 (Roy)

For

(306) 652-5322 Toll Free 1-877-665-6660 Call Us Today or visit www.jhhomes.com

1/2 Price! Our ClassiĂ&#x20AC;ed Sale Never Ends!

2505 Avenue C North, Saskatoon

HOUSES FOR SALE

:LQQRQD -RKQHU

REAL ESTATE SERVICES James Owen Gillies November 1975 - May 1992 In Loving Memory of Our Son and Brother Your place no one can fill; In life we loved you dearly, In death we love you still. Your resting place we visit And put flowers there with care, But no one knows the heartache When we turn and leave you there. - Sadly missed and forever loved, Mom, Dad, Stacy and your little niece Tayler.

COMING EVENTS

ONLY A FEW UNITS LEFT! 55 P L U S A D U LT C O M M U N I T Y. Ground Level Ranchers. www.diamondplace.ca 306 241 0123 WARMAN, SK

OUT OF TOWN FOR SALE in Stoughton: 2002 Four bedroom home with double car attached garage. Call for details: 306-457-2840 or 306-4577113. FOR SALE In Stoughton: New modular home on own lot. 3 Bedrooms, 2 baths. Vacant. $8,000 d ow n ; Pay m e n t s $ 8 0 0 / m o n t h . Must have good credit and be able to bank qualify. Phone 1-587-4348525.

High Quality Canadian Built Modular Homes & Cottages Over 175 Plans to Choose from. 60-90 Day Turnkey 10 Year Warranty Regina, SK Toll Free: 1-(855)-494-4743 Visit us online: www.prairiebilt.com

PARK PLACE 402 PERKINS STREET FOR RENT: 1, 2 BR Apartments. Air conditioning, 5 Appliances. Fireplace in suites; Security doors. No Pets!! For more information, Phone 306-634-4010 between 8 a.m. and 8 p.m. only, or see our Web site @ www.apartmentsestevan.ca

Come and Help Us Celebrate LOUIS BELANGERâ&#x20AC;&#x2122;S 80th BIRTHDAY May 11, 2013 Come and Go Tea from 2:00 - 4:00 p.m. in the Senior Place at the Souris Valley Aquatic & Leisure Centre 701 Souris Avenue Estevan, Sask. Your presence is your gift.

ROOMS ROOMS FOR RENT: In Benson. $500 a month. Phone 1-306-4419672.

Estevan Regional Nursing Home MOTHERâ&#x20AC;&#x2122;S DAY TEA May 10, 2013 2:00 - 4:00 p.m. Estevan Regional Nursing Home Dining Room Draw to be made on raffle Everyone Welcome

MOBILE/ MANUFACTURED

PSYCHICS TRUE PSYCHICS For Answers CALL NOW 24/7 Toll FREE! 1-877-342-3032 Mobile: #4486 www.truepsychics.ca

SERVICES FOR HIRE NEED A HOME PHONE? Cable TV or High Speed Internet? We Can Help. Ever yone Approved. Call Today. 1-877-852-1122 Protel Reconnect.

Modular, Manufactured or RTM homes. A variety of homes in production or ready to ship Regina,SK 1-866-838-7744 Estevan, SK 1-877-378-7744 www.sherwoodhome.ca

Estevan Mercury & Southeast Trader Express CLASSIFIED INDEX

BUSINESS SERVICES HAVE YOU BEEN DENIED Canada Pension Plan Disability Benefits? The Disability Claims Advocacy Clinic can help. Contact Allison Schmidt at 1-877-793-3222 www.dcac.ca

FARM IMPLEMENTS

APARTMENTS/CONDOS FOR RENT HARVEST HEIGHTS 542 Bannatyne Avenue 1 & 2 Bedroom Units. Utilities included. A/C, fridge, stove and laundromat. Parking with plug-ins. Security entrance. No pets. For More Info Go to: www.apartmentsestevan.ca For Apar tment Availability and Pricing e-mail us: harvestheightsteam@gmail.com

 CANCEL YOUR TIMESHARE. No RISK program. STOP Mortgage & Maintenance Payments Today. 100% Money Back Guarantee. FREE Consultation. Call us NOW. We can Help! 1-888-356-5248

CANADIAN MANUFACTURED backed by 10 year warranty -multi family, single section, motel style homes -Qualify for C.M.H.C.Financing FOR MORE INFO CALL 1.800.249.3969 www.medallion-homes.ca Hwy 2 South Prince Albert

LOTS & ACREAGES FOR SALE ACREAGE for sale: $409,000. Well maintained 1,500 sq. ft. bungalow, 3 bedroom, 1 1/2 bath home with a beautifully landscaped yard. Double detached garage, shop and bar n on 7.8 acres. Just 7 miles SW of Stoughton. Call 306-457-2940. LAKE LOTS FOR SALE by Owner at Lake of the Prairies: Prairie Lake Lodge, Russell, Manitoba is offering a good selection of treed, non treed lots and acreages with views and privacy adjacent to an 18 h o l e , p a r 3 g o l f c o u r s e . Suitable for RV or cottage use. Contact: 204-773-0380, Gerald; 204-773-6819, David. LAND FOR SALE: Approximately 12 acres for sale, 3 miles West of Stoughton, Sask. Approximately 250 yards north of Highway #13 off grid on west side. No improvements. Power available. $50,000. Please contact Dr. Larry Yingst at 1-480-940-0440 or e-mail: lrsy@cox.net RESIDENTIAL LOT on crescent in west side of Stoughton for sale or trade for commercial lot in area. Phone 1-800-843-3984.

WANTED: Massey #36 discers, Paying $100. Hydraulic endgate drill fills, Paying $50. Will pick up. Ca l l A n d rew 1- 3 0 6 - 9 4 6 - 9 6 6 9 , leave message if no answer.

FEED & SEED Buying/Selling FEED GRAINS heated / damaged CANOLA/FLAX Top price paid FOB FARM

Western Commodities

Engagements Wedding Annivers. Anniversaries Birthdays Announcements Prayer Corner In Memoriam Cards of Thanks Coming Events Garage Sales Memorial Services Personals Health/Beauty Lost Found Introduction Services Readings Psychics Travel Health Spas Tickets Childcare Available Childcare Wanted

SERVICES Accounting/

877-695-6461 Visit our website @ www.westerncommodities.ca

HEATED CANOLA WANTED!! - GREEN CANOLA - SPRING THRASHED - DAMAGED CANOLA FEED OATS WANTED!! - BARLEY, OATS, WHT - LIGHT OR TOUGH - SPRING THRASHED HEATED FLAX WANTED!! HEATED PEAS HEATED LENTILS "ON FARM PICKUP" Westcan Feed & Grain 1-877-250-5252

LAND WANTED WANTED: Farmland to cash rent North of Estevan or near Bienfait. Phone 306-421-0679.

Bookkeeping Appliance Repairs Auctioneers Bricklaying Building/Contracting Building Supplies Drywalling Building/Contracting Electrical Handyperson Hauling Cleaning Janitorial Landscaping Lawn & Garden Moving Painting/Wallpaper Renos/Home Improvement Roofing Snow removal Services for Hire Vacuum Services

LEGAL Notices to Creditors Assessment Rolls Tax Enforcement Tenders Notices/Nominations Legal/Public Notices Judicial Sales Houses for Sale Apts./Condos for Sale Out of Town Cabins/Cottages/ Country Homes Apts./Condos for Rent Duplexes for Rent Houses for Rent Mobiles/Pads Housesitting Wanted to Rent Rooms for Rent Room & Board Shared Accomm. Mobile/Mft. Homes for Sale Recreational Property Revenue Property Garages Real Estate Services Investment Opport. Business Opportunities Hotels/Motels Business Services Financial Services Industrial/Commercial Storage Space for Lease Office/Retail for Rent Warehouses Farms for Sale Farms/Acreages for Rent Land/Pastures for Rent Mineral Rights Farm Implements Livestock Horses & Tack

Farm Services Feed & Seed Hay/Bales for Sale Certified Seed for Sale Pulse Crops/Grain Wanted Steel Buildings/ Granaries Farms/Real Estate Antiques For Sale/Miscellaneous Furniture Musical Instruments Computers/Electronics Firewood Sports Equipment Farm Produce Hunting/Firearms Plants/Shrubs/Trees Pets Wanted to Buy Auctions Adult Personals Domestic Cars Trucks & Vans Parts & Accessories Automotive Wanted RVs/Campers/Trailers Boats Snowmobiles Motorcycles ATVs/Dirt Bikes Utility Trailers Oilfield/Wellsite Equip. Heavy Equipment Career Opportunities Professional Help Office/Clerical Skilled Help Trades Help Sales/Agents General Employment Work Wanted Domestic Help Wanted Career Training Tutors Memorial Donations Obituaries

CLASSIFIED DEADLINE: FRIDAY AT 4:00 P.M. NOTICE

PAYMENT FOR CLASSIFIED ADVERTISING MUST BE MADE IN ADVANCE Prepaid ClassiĂ&#x20AC;ed Advertising Rates â&#x20AC;&#x201C; $7.95 per Week for up to 20 Words Over 20 Words Please Add 20¢ per word REMEMBER TO ADD 5% GST!

Estevan

Mercury

Note: No Refunds are issued for Cancelled ClassiĂ&#x20AC;ed Ads â&#x20AC;&#x201C; If you cancel your ad before expiry, Credit will be given which may be applied to future advertising ***** CHECK YOUR ADS We will only accept responsibility for Errors the First Time an Ad appears.

MAIL YOUR ADS TO: The Estevan Mercury Box 730, Estevan, SK S4A 2A6 or e-mail: classiĂ&#x20AC;eds@estevanmercury.ca with payment or card number included Please Select Your Category from the ClassiĂ&#x20AC;ed Index

PLEASE NOTE

Remember: Each Abbreviation Counts as One Word (You donâ&#x20AC;&#x2122;t save money by abbreviating â&#x20AC;Ś You just make your ad more difĂ&#x20AC;cult to read

Rewording or changing an ad after it has appeared in the paper requires Payment for a NEW AD No Credits are issued for ads that are Changed Cancellations Must be received by 4:00 p.m. Friday for the Mercury and 3:00 p.m. Wednesday for the Trader Name ____________________________________________

or e-mail: classiĂ&#x20AC;eds@estevanmercury.ca Business OfĂ&#x20AC;ce Located at 68 Souris Avenue North in Estevan (Across from the Water Tower) Phone 634-2654 for further information OfĂ&#x20AC;ce Hours: 8:00 a.m. to 5:00 p.m. Monday through Friday

_____________________________________________________ _____________________________________________________

www.estevanmercury.ca

Box 730, Estevan, SK S4A 2A6

PLEASE PRINT

Address __________________________________________

_____________________________________________________

Telephone No. _____________________________________

_____________________________________________________

Number of Weeks ___________________________________

_____________________________________________________

Amount Enclosed ___________________________________ VISA/MC No. _______________________________________ Card Expiry Date ____________________________________

_____________________________________________________ _____________________________________________________


B10 May 8, 2013

Estevan Mercury

LAND FOR SALE

FOR SALE - MISC

FARMLAND WANTED

HOT TICKETS

NO FEES OR COMMISSIONS! Thanks again Doug for buying our property. Dealing with you and your company, Freshwater Land Holdings Co. Ltd., made the sale quick and efficient. It was a tough transaction, but you came through and kept all of the promises you made at teh beginning of our talks. I would recommend you to anyone whoâ&#x20AC;&#x2122;s interested in selling quickly and efficiently. I will pass on your name to ayone whoâ&#x20AC;&#x2122;s interested. Thanks again. Leo and Linda

SUMMARY OF SOLD PROPERTIES Central - 62 1/4â&#x20AC;&#x2122;s South Central - 17 1/4â&#x20AC;&#x2122;s East Central - 74 1/4â&#x20AC;&#x2122;s South - 70 1/4â&#x20AC;&#x2122;s South East - 22 1/4â&#x20AC;&#x2122;s South West 58 1/4â&#x20AC;&#x2122;s North - 6 1/4â&#x20AC;&#x2122;s North West - 8 1/4â&#x20AC;&#x2122;s East - 39 1/4â&#x20AC;&#x2122;s FARM AND PASTURE LAND AVAILABLE TO RENT

PURCHASING: SINGLE TO LARGE BLOCKS OF LAND. LAND. PREMIUM PRICES PAID WITH QUICK QUICK PAYMENT. YMENT. RENT BACK AVAILABLE

See P!NKâ&#x20AC;&#x2122;S SOLD OUT Concert Thursday, October 24th in Saskatoon or Saturday, October 26th in Winnipeg

FOR SALE - MISC

PARTS & ACCESSORIES

CAREER OPPORTUNITIES

Restless Leg Syndrome & Leg Cramps? Fast Relief In One Hour. Sleep At Night. Proven For Over 32 Years. www.allcalm.com MonFri 8-4 EST 1-800-765-8660

WRECKING TRUCKS all makes, all models ..Dodge..GMC..Ford.. Imports. Lots of 4X4 stuff...Diesel..Gas.. Trucks up to 3 tons.. We ship anywhere. CALL 306-8210260 Bill... (lloydminster) reply text.....e-mail...call blackdog2010doc@hotmail.com... We ship same day bus..dhl... transport

CLARK BUILDERS REQUIRES out of town Surveyors. Must have commercial construction experience. Contact us at: 1-877-4166815. Email: careers@clarkbuilders.com. Fax 1-888-403-3051.

ADULT PERSONAL MESSAGES

V-I-P RINGSIDE FRONT ROW TICKETS available These tickets are held for fans in Rural Saskatchewan only

LAND AUCTION for Souris River Bison Corp., Saturday, June 22, 9:00 a.m. Selling 2 quarters: RM of Estevan #5 SE 24-1-7 W2 and RM of Coalfields #4 NW 7-1-6 W2. Mack Auction Company, 306-6349512. PL311962.

LAND WANTED Wanted All Wild Fur. Shed antlers and old traps. Call Phil (306) 2782299 or Bryon (306) 278-7756.

STEEL BUILDINGS / GRANARIES BUILDING FOR SALE... Two UNCLAIMED Steel Buildings. Must be sold. One is 40x80. GREAT savings! Hurry, these wonâ&#x20AC;&#x2122;t last. Go Direct. Rocket Steel Canada. 1-877-218-2661. S T E E L B U I L D I N G S / M E TA L BUILDINGS 60% OFF! 20x28, 30x40, 40x62, 45x90, 50x120, 60x150, 80x100 sell for balance o w e d ! C a l l 1- 8 0 0 - 4 5 7- 2 2 0 6 www.crownsteelbuildings.ca

DONâ&#x20AC;&#x2122;T MISS Carlyle R.V. & Leisureâ&#x20AC;&#x2122;s Annual Motherâ&#x20AC;&#x2122;s Day Show & Sale, May 8-12. Super Sale Prices!! Low Interest Rates!! Prize Draws!! 306-453-6773. www.carlylerv.com

DOMESTIC CARS

Go on line to www.dashtours.com or call Dash Tours at 1-800-265-0000 One Call & Youâ&#x20AC;&#x2122;re There

F O R SA L E : 2 0 0 5 Co b a l t LS, 97,000 km, sunroof, automatic, fully loaded, heated leather seats, Command Start, Pioneer stereo. $8,800 - O.B.O. Phone 306-6349401.

Adver tisements and statements contained herein are the sole responsibility of the persons or entities that post the advertisement, and the Saskatchewan Weekly Newspaper Association and membership do not make any warranty as to the accuracy, completeness, truthfulness or reliability of such advertisements. For greater information on advertising conditions, please consult the Associationâ&#x20AC;&#x2122; s Blanket Advertising Conditions on our website at www.swna.com.

Guaranteed approval drive away today! We lend money to everyone. Fast approvals, best interest rates. Over 500 vehicles sale pr iced for immediate deliver y OAC. 1-877-796-0514. www.yourapprovedonline.com.

DOMESTIC CARS

8VHG&DUV

.,$237,0$/;ORDGHGNPV 0$='$*7NPV )25'&52:19,&725,$/;ORDGHGNPV 3217,$&*GRRUDXWRPDWLFORDGHGNPV62/'

ANTIQUE FURNITURE for sale: Matching dresser with mirror and wardrobe. Map cabinet with 12 drawers in front, quarter-cut oak. Round plant stand, quar ter-cut oak. Phone 306-634-9465.

8VHG7UXFNV689V 9DQV

(;3(',7,21[/,0,7('NPV (;3/25(5/,0,7('[NPV )/$5,$7&5(:&$%[ORDGHGRQO\NPV )/$5,$7&5(:&$%GLHVHONPV ));683(5&5(:;NPV &+(952/(7$9$/$1&+([NPV ))[683(5&5(:/(FR%RRVWNPV ('*(63257$:'ORDGHGZLWKNPV62/' )683(5&5(:);ORDGHGNPV )/$5,$7&5(:&$%[/GLHVHONPV (6&$3(;/7[NPV )/$5,$7&5(:&$%[/GLHVHO *0&$&$',$$:'ORDGHGNPV (;3(',7,21('',(%$8(5[NPV *0&<8.21'(1$/,[ORDGHGOHDWKHUNPV (;3/25(56325775$&;/7;NPV '2'*(5$063257;48$'&$%NPV62/' )/$5,$7683(5&5(:;NPV &+5<6/(53$&,),&$7285,1*(',7,21):' NPV ).,1*5$1&+[/GLHVHONPV )/$5,$7&5(:&$%[ORDGHGRQO\NPV (;3/25(5;/6[NPV62/'

C O LO R A D O B L U E S P RU C E : $ 1. 4 9 / e a c h fo r a b ox o f 2 7 0 ($402.30). Also full range of trees, shrubs, cherries & berries. Free shipping. Replacement guarantee. 1-866-873-3846 or treetime.ca. DISCONNECTED PHONE? ChoiceTel Home Phone Service. No One Refused! Low Monthly Rate! Calling Features and Unlimited Long Distance Available. Call C h o i c e Te l To d ay ! 1- 8 8 8 - 3 3 3 1405. FLOODING - SPRING RUN OFF Protect your property with dewatering pumps from DSG Daily, weekly, monthly rental rates or easy purchase plans Call PJ 1888-920-1507 www.dieselservices.com Located in Saskatoon. HOT TUB (SPA) COVERS. Best Price, Best Quality. All Shapes & Colours Available. Call 1-866-652-6837 www/thecoverguy.com/newspaper

6HQFKXN )RUG6DOHV/WG

PROVINCE-WIDE CLASSIFIEDS. Re a c h ove r 5 5 0 , 0 0 0 re a d e rs weekly. Call this newspaper NOW or 306-649.1405 for details.

DOMESTIC CARS

Call The Estevan Mercury at 634-2654 to place your ad today!

6HQFKXNÂŻV6XSHU'HDOV 

AT LAST! An iron filter that works. IronEater! Fully patented Canada/U.S.A. Removes iron, hardness, smell, manganese. Since 1957. Visit our 29 innovative inventions: www.bigirondrilling.com. Phone 1-800-BIG-IRON.

Call DOUG 306-955-2266 saskfarms@shaw.ca

RVS/CAMPERS/TRAILERS

LOCAL HOOKUPS BROWSE4FREE 1-888-628-6790 or #7878 Mobile **************** HOT LOCAL CHAT 1-877-290-0553 Mobile: #5015 **************** Find Your Favourite CALL NOW 1-866-732-0070 1-888-544-0199 18+

See UFC-161 Saturday, June 15th LIVE in Winnipeg

@V\YOVTLVMHM[LYZHSLZZLY]PJL 6RXULV$YHQXH1RUWK²(VWHYDQ6DVN

DOMESTIC CARS

634-3696

CARS

TRUCKS, SUVS, VANS

2012 DODGE SPORT QUAD CAB 4x4 leather, 31,000 kms........................$36,400 2012 CHEV EQUINOX AWD silver metallic, 12,500 kms, GST only ................$24,700 2012 JEEP LIBERTY NORTH EDITION 4x4, excellent cond., 32,900 kms ....$24,400 2011 CHEV AVALANCHE buckets, 20â&#x20AC;? rims, orange, 38,000 kms ..................$34,400 2011 CHEV TRAVERSE LT AWD 8 passenger, 45,000 kms...........................$26,358 2011 DODGE DAKOTA SXT QUAD CAB 4x4 30,300 kms ........................$23,989 2010 CHEV CREW 4x4 LT chrome pkg, 5.3L, 56,000 kms ............................$27,900 2009 GMC ACADIA SLT AWD loaded, 72,557 kms .....................................$27,316 2009 GMC SLT EIC 4x4 leather, all terrain pkg, 90,000 kms ..........................$24,900 2009 CHEV AVALANCHE rear DVD, sunroof, leather, 20â&#x20AC;? rims, 121,000 kms ..$24,900 2009 BUICK ENCLAVE AWD leather two pannel roof, base, 97,580 kms.........$27,900 2008 CHEV EIC 2500 H.D. 4x4 gas, cloth, 130,00 kms .............................$19,900 2008 GMC ACADIA blue, 80,000 kms .........................................................$16,900 2007 HONDA RIDGELINE 4x4 silver, 83,000 kms ......................................$23,900 2004 TOYOTA TUNDRA CREW CAB 109,723 kms ....................................$12,900

TIME TO GO ROW

2012 JEEP COMPASS 4x4 silver, 24,000 kms.............................................$19,900 2008 JEEP COMPASS AWD leather, 83,600 kms .........................................$14,995

THE GM OPTIMUM ADVANTAGE

CAREER OPPORTUNITIES SASK ALTA ENVIRONMENTAL SOLUTIONS Is looking for equipment operators for our Poplar River Power Station, Ash Lagoon Ren e w a l Pr o j e c t i n C o r o n a c h Saskatchewan. The equipment includes, dredge (will train), farm tractor equipment, front end loader, semi tractor with flat deck, tanker B-train. Please email your resume: shawn@gabrielconstruction.ca or fax: 306-757-6764

DRIVERS WANTED AZ, DZ, or 1 with airbrakes: Terrific career oppor tunity with outstanding growth potential to learn how to locate rail defects using non-destructive testing. Plus extensive paid travel, meal allowance, 4 weeks vacation and benefits pkg. Skills Needed - Ability to travel 6 months at a time. Apply online at www.sperryrail.com under careers. Click here to apply, keyword: Drive. DO NOT FILL IN CITY OR STATE EOE

Recycle This Paper

SOBEYS GROCERY STORE now hiring Meat Wrappers. Full-time & part-time hours available. Please fax resume to: 780-875-2103. Mail or drop off at: 4227 - 45 Ave., Lloydminster, AB, T9V 2E9.

DOMESTIC CARS

DOMESTIC CARS

8VHG&DUV &KHYUROHW,PSDOD/76LOYHUNP  &KU\VOHU7RXULQJ/RDGHG5HGNP  'RGJH&KDOOHQJHU657<HOORZNP  'RGJH&DOLEHU6;7%ODFNNP  'RGJH&DOLEHU657/RDGHG5HGNP 

8VHG7UXFNV689V 9DQV

5$0/DUDPLH/RDGHG'LHVHO*UH\NP 5$06/7/LIWHG%ODFNNP 5$06SRUW/RDGHG%ODFNNP5('8&(' 5$06SRUW/RDGHG%ODFNNP 5$0%LJ+RUQ6DJHEUXVKNP -HHS:UDQJOHU8QOLPLWHG'R]HU2UDQJHNP 5$0/DUDPLH/RDGHG:KLWHNP 5$06SRUW4XDG&DE:KLWHNP )RUG);/75HJ&DE/RQJ%R[:KLWHNP 'RGJH-RXUQH\57/RDGHG%ODFNNP 'RGJH'XUDQJR6;7*UH\NP )RUG)/DULDW%OXHNP &KHYUROHW6LOYHUDGR/6([W&DE%ODFNNP 'RGJH5DP6SRUW6LOYHUNP 'RGJH5DP/DUDPLH:KLWHNP &KHYUROHW6LOYHUDGR/7&UHZ&DE*UH\NP 'RGJH5DP/DUDPLH:KLWHNP )RUG)/DULDW7DQNP &DGLOODF(VFDODGH3HDUO:KLWHNP

+20(2)7+(32:(57($0 .HQVLQJWRQ$YHQXHa(VWHYDQ6DVN 3KRQH ,I\RXKDYHQ¡WVKRSSHG32:(5'2'*( \RXPD\KDYHSDLGWRRPXFK

,/.'#2%%+-/4/23 !QPK3=HAO 3ANRE?A3EJ?A

&$56

801 13th Ave., ESTEVAN Ph: 634-3661 or 1-888-634-3661

2012 CHRYSLER CHARGER SXT loaded, red, 16,500 kms...........................$25,939 2012 FORD FUSION SEL AWD loaded, silver, 24,926 kms ...........................$22,973 2012 CHRYSLER 200 LTD red, only 17,800 kms..........................................$22,800 2012 DODGE AVENGER SXT 19,000 kms, power roof .................................$19,990 2012 MALIBU LT auto, remote keyless entry, 41,000 kms ...............................$16,949 2009 TOYOTA COROLLA silver, 127,930 kms ..............................................SOLD 2009 PONTIAC G5 COUPE 5 speed, power roof, 40,000 kms ........................SOLD 2006 MAZDA 5 Red, 148,000 kms................................................................$7,900 2005 PONTIAC PURSUIT 4 door, auto, very nice, 56,000 kms.........................$8,990

ROADEX SERVICES requires experienced 3 ton drivers to haul RVs from USA to Western Canada. 5-6 day round trip, paid by running mile and benefits available. 1800-867-6233; www.roadexservices.com

CRIMINAL RECORD? Donâ&#x20AC;&#x2122;t let your past limit your career plans! Since 1989 Confidential, Fast Affordable A+BBB Rating EMPLOYMENT & TRAVEL FREEDOM. Call for FREE BOOKLET. 1-8-NOW-PARDON (1-866-972-7366) www.RemoveYourRecord.com

ZZZORQJFUHHNPRWRUVFDUSDJHVFD



SOUTHEAST SASK USED CAR SUPERSTORE

PYRAMID CORPORATION is now hiring! Instrument Technicians and Electr icians for var ious sites across Alberta. Send resume to: hr@pyramidcorporation.com or fax 780-955-HIRE.

GENERAL EMPLOYMENT

)DPLO\2ZQHG'HDOHUVKLS6LQFH WK675((7(67(9$1 3+21(  

86('&$56 &+5<6/(5/7'NPV62/' &+(90$/,%8/7ORDGHGNPV  &+(9&2/%$/7/7NPV  &+5<6/(56(%5,1*2QO\NPV  *NPV62/' '2'*(&+$5*(557NPV 

86('758&.69$16 5$063257ORDGHG  '2'*(4&[  72:1 &28175<9$1NPV  *5$1'&$5$9$11(:  5$0/$5$0,(ORDGHG62/' '2'*(&5(:&$%;  5$0287'22560$1  '2'*('$.27$4&[  '2'*(-2851(<57$:'  -2851(<&5(:  )25'('*(/7'NPV  '2'*(4&/$5$0,(NPV  '2'*(&5(:&$%;ORDGHG  '2'*(-2851(<57ORDGHG  )25'&5(:&$%;;/7  '2'*(-2851(<NPV  -((33$75,27/7';NPV  *5$1'&$5$9$16;7  '2'*(*5$1'&$5$9$16;7  72:1$1'&28175<  '2'*(5$06/74&;'LHVHO  '2'*(',(6(/VS75$164&[/21*%2;62/'

)RUG)RFXV6(/GUOHDWKHUVXQURRINP &KHY,PSDOD/7GUIDFWRU\ZDUUDQW\ 'RGJH&DOLEHU6;7GUIDFWRU\ZDUUDQW\NP 3RQWLDF9LEHGUIDFWRU\ZDUUDQW\NP &KHY&REDOW/7GUZDUUDQW\NP 0D]GD*6GUORDGHGZDUUDQW\ 3RQWLDF3XUVXLWGUZDUUDQW\ 3RQWLDF6XQILUH*7GUZDUUDQW\ &KU\VOHU6HEULQJ/;GUZDUUDQW\ &KHY,PSDODGUZDUUDQW\

758&.69$16 689Ň&#x2039;V -HHS/LEHUW\1RUWK(GLWLRQGU[IDFWRU\ZDUUDQW\NP  )RUG)6XSHU&UHZ&DE;/7[(FR%RRVWIDFWRU\ZDUUDQW\  7R\RWD5$96SRUW:'GUIDFWRU\ZDUUDQW\VXQURRINP  &KHY6LOYHUDGR/7&UHZ&DE[=IDFWRU\ZDUUDQW\)OH[IXHO  *0&6LHUUD(&DE[6/(ZDUUDQW\  %XLFN5DLQHU&;/:'GUZDUUDQW\VXQURRIOHDWKHU  &KHY6LOYHUDGR=&UHZ&DEGUZDUUDQW\  &KHY6LOYHUDGR&UHZ&DE/6GU[WRQZDUUDQW\  *0&6LHUUD(&DE6/([ZDUUDQW\ORZNPV  )RUG)6XSHU&DE;75;/7[ZDUUDQW\  -HHS/LEHUW\6SRUW[GUZDUUDQW\6$9( &KHY9HQWXUH9DQGUZDUUDQW\ 'RGJH&DUDYDQ6(GUZDUUDQW\  -HHS7-6(:'GU+DUGWRSZDUUDQW\0DQ\([WUDV

Most of Our Vehicles are Covered by Lubrico Powertrain Warranty 3ULFHV5HGXFHGa:H7DNH7UDGHV 5HDVRQDEOH2IIHUV&RQVLGHUHG

3+21(&2//(&7)25.(1 

$)7(5+2856&HOO

WK6WUHHW²(VWHYDQ6DVN ZZZORQJFUHHNPRWRUVFDUSDJHVFD HPDLOVDOHVORQJFUHHNPRWRUV#VDVNWHOQHW

75$,/(5602725+20(659V 75$9(/$,502725+20()W 

3/86$33/,&$%/(7$;(6

â&#x20AC;˘ Manufacturerâ&#x20AC;&#x2122;s Warranty â&#x20AC;˘ Exchange Privilege â&#x20AC;˘ 150+ Point Inspection â&#x20AC;˘ 24hr Roadside Assistance

Look in Todayâ&#x20AC;&#x2122;s Mercury for the Best Deals on Wheels!


www.estevanmercury.ca

May 8, 2013 B11

GENERAL EMPLOYMENT ESTEVAN A&W - Job Title: Food Service Supervisor. Number of positions: 2 Full-time positions. Duties: *Supervise, co-ordinate and schedule the activities of staff who prepare, portion and serve food; *Estimate and order ingredients and supplies required for meal preparation; *Establish methods to meet work schedules; *Maintain records of stock, repairs, sales and wastage; *Train staff in job duties, and sanitation and safety procedures; *Ensure that food and service meet quality control standards; *May participate in the selection of food service staff and assist in the development of policies, procedures and budgets; *Must be willing to work rotating shifts (hours of operation are 6 a.m. - 11 p.m., 7 days a week). Benefits Package: RRSP and wellness program (including gym m e m b e rs h i p ) . S a l a r y R a n g e : $13.00/hr. depending on experience. Education: Secondar y school. Experience: 3-5 years of experience in related field. Interested candidates can apply with resume by: Address: 1437 - 4th Street, Estevan, SK, S4A 0X4; Website: www.aw.ca; Phone: 306634-9228; Contact: Darcy/Michelle. HELP WANTED!!! $28.00/HOUR. Undercover Shoppers Needed To Judge Retail And Dining Establishments. Genuine Opportunity. PT/FT. Experience Not Required. If You Can Shop - You Are Qualified! www.MyShopperJobs.com HELP WANTED!!! Make $1000 weekly mailing brochures from home! No experience required! Start Immediately! www.TheMailingHub.com HELP WANTED! Men & Women In Demand For Simple Work. P/T-F/T. Can Be done from home. Acceptance GuaranteedNo experience required. No Fees, All Welcome! www.HiringCanada.Com THE CARLYLE & DISTRICT Leisure Complex is now accepting resumes for Manager, Assistant Manager, Head Lifeguard, Full and Part-time Lifeguards, Instructors and Assistant Guards. Contact Mel at 306-577-2476 or Danielle at 306-577-1991 for more information.

CAREER TRAINING M E D I CA L T R A N S C R I P T I O N R AT E D # 2 fo r wo r k - a t - h o m e. Train with the top-rated accredited school in Canada. Financing and student loans available. Contact CanScribe today at 1-800-4661535 www.canscribe.com

The Mercury Classifieds Are Blooming with Great Buys!

OBITUARIES

OBITUARIES

OBITUARIES

OBITUARIES

Jennie Deren March 24, 1931 - April 28, 2013 The family of Jennie Deren is saddened to announce her passing on Sunday, April 28, 2013 in Regina at the age of 82. Jennie was predeceased by her husband, Andrew Deren; her parents, Peter and Julia Kazuik; siblings, Mike Kazuik and Steve Kazuik; and son-in-law, Graham Langford. She is survived by her loving family: June Horsman of Regina, Paul (Cheryl) Deren of Estevan, Donna (Richard) Jasper of Regina, Bill Deren of Bienfait, Lil (Randy) Olynyk of Regina, Linda (Barry) Mitchall of Regina, Delmar (Virginia) Deren of Stoughton and Joy Langford of Regina; grandchildren and great grandchildren, Nicole (Greg) Bawden (children Emma and Matthew) of Pilot Butte, Jennifer (Mike) Brown (sons Carter and Finley) of Milestone, Brent (Carlie) Jasper (son Easton) of Regina, Christelle (Kelly) Batty (daughters Averi and Kailee) of Regina, Deren (Hilary) Olynyk of White City, Darcy (Larrah) Olynyk (daughter Callie) of Regina, Kelcie Deren-Mitchall of Regina, Doug (Tracey) Deren (sons Cole and Jett) of Minot, Kris (Tammi) Deren of Invermere and Lindsay (Brant) Dammann (children Sierra and Cooper) of Creelman; sisters-in-law, Berva Kazuik of Estevan and Anne Deren of Medicine Hat, as well as numerous nieces, nephews and cousins. Prayers were held on Thursday, May 2, 2013 at 7:30 p.m. in the Chapel of Hall Funeral Services, Estevan, with Doug Third officiating. Funeral Mass was celebrated on Friday, May 3, 2013 at 10:30 a.m. at St. Monica’s Roman Catholic Church, Bienfait, by Rev. Peter Nijssen. Interment followed in the Bienfait Cemetery. In lieu of flowers, those wishing to make donations in Jennie’s memory may do so directly to STARS Air Ambulance, 2640 Airport Road, Regina, Sask., S4W 1A3 or online at www.stars.ca Funeral arrangements were entrusted to Hall Funeral Services, Estevan.

Mary Joan Howard Mary Howard, late of Frobisher, Sask. passed away suddenly on April 17, 2013 at the age of 86. Mary is survived by her husband, Lyle Howard; children, Brian Howard, Frobisher, Sask.; Janice (Melvin) Hannah, Yorkton, Sask.; Heather Howard, Frobisher, Sask.; Jim (JoAnne) Howard, Alameda, Sask.; Grandchildren: Jordan (Chantelle) Hannah, Jillian Hannah, Samantha and Jessica Howard; Great Grandson Connor Hannah; siblings Jack Sabroe and Irene Gibson, Edmonton, Alta., as well as numerous nieces and nephews. Mary Joan Howard was the born October 1, 1926, in Portal, North Dakota to Ernest and Mary Sabroe. She was the eldest child of six. Mary spent her early years on the farm south of Frobisher and attended Erniwin School. In 1938 the Sabroe family moved into Frobisher when her father Ernie became the postmaster. After finishing her Grade 12 schooling in Frobisher, Mary worked in Shapiro’s store and after the passing of her father, in 1949, started working at the Frobisher post office, first as part-time then 21 years as Post Mistress. Mary retired in 1991 after 42 years associated with the post office. On January 23, 1952, Mary married Lyle Howard. Mary and Lyle celebrated their 61st anniversary this past January. Mary enjoyed life. She was a great cook who took the time to prepare all the special things her family enjoyed. Spring always was a special time of year for Mary as she looked forward to starting her tomatoes. This year the tomatoes that were started by Mary, will be lovingly planted by her family. Mary was always proud of her Danish heritage. Her father Ernest, who had immigrated as a young man from Denmark to Canada, spoke often to Mary about his family remaining in Denmark. One of Mary’s great pleasures in life was her trip to Denmark, Sweden and Norway to observe first-hand what her father had loved. In the last few years, as her health declined and she was unable to do the things she most enjoyed, she always managed to be optimistic and looked to the good in life. Her favorite saying was “If you can’t say something nice then don’t say anything at all.” Mary will be remembered as a quiet, kind, faithful wonderful person who will always be in our hearts. The Funeral Service for Mary was held April 23, 2013 at 11:00 in the Frobisher Union Church with Don Britt officiating. A family interment followed in the Frobisher Cemetery. Urn bearers were Brian and Jim Howard. Those wishing to make donations in Mary’s memory may do so directly to STARS Air Ambulance or the Frobisher Union Church. Arrangements entrusted to Hall Funeral Services, Estevan.

Thank You Special thanks to Sun Country EMS, STARS Air Ambulance, Dr. V. Pillay and the nurses at RGH Unit 5A for all their kindness and compassionate care they offered during this difficult time. A heartfelt thank you to Fr. Peter Nijssen and St. Monica’s Parish, Bienfait for the wonderful celebration of our mother’s life. Thank you to Doug Third for leading the prayer service, the choir for leading the music and Dustin Hall for the solo, the readers, those who prepared the slide presentation, the pallbearers, St. Monica’s C.W.L. for a lovely lunch, Bienfait Legion and Hall Funeral Services for going above and beyond with your care and compassion. We would also like to thank those who called, sent food, flowers, cards, memorial donations, and those who travelled short and long distances to be with us. We are so grateful for such wonderful friends. If we have neglected to acknowledge anyone, please forgive us. - The family of Jennie Deren

OBITUARIES

Virginia Angela Weinrauch Virginia passed away at Parkridge Centre on Tuesday, April 30, 2013, at the age of 68. She is loved and remembered by her daughters, Angela Foster and Tamara Sifton; son, Kim (Catherine) Foster; grandchildren, Jason, James, Niketa (Ryan) Hitchens, Joel and Aaron Graham; siblings, Randy (Donna) Johnson, Colette Johnson (Fred Swan), Gail (Terry) Robinson, Warren (Simone) Johnson and Wesley (Barbara) Johnson. A Memorial Service will be held at a later date. Arrangements in care of David Schurr MOURNING GLORY FUNERAL SERVICES Saskatoon, SK (306-978-5200) www.mourningglory.ca

Remember Your Loved Ones with a Memorial Tribute in The Mercury

Children’s book tour and author Lois Peterson hit Estevan on Friday Children’s Book Week is being celebrated in Estevan this week and it includes an appearance and reading by author Lois Peterson in the Estevan Public Library on Friday, May 10 starting at 1 p.m. Canadian Children’s Book Week has been supported by TD Canada Trust for 35 years now and the company has again sponsored a series of appearances by Peterson as well as Lizann Flatt. The theme for this year’s

celebration is All the Bookshelf’s a Stage: Celebrating the Performing Arts. The celebration in the past has introduced thousands of children to some favourite authors, storytellers and illustrators and encouraged them to explore the benefits of getting lost in the pages of a book. This year ’s theme allows children to explore once again, this time giving them an opportunity to provide some creative

expression without the nerves that come with getting on stage. Flatt or Peterson will be making their way not only to Estevan, but also to Tisdale, Nipawin, North Battleford, Meadow Lake, Moose Jaw, Rouleau and Weyburn as part of the tour this year. Other authors will be touring through Alberta, British Columbia, Manitoba, New Brunswick, Newfoundland and Labrador, Northwest Territories and Nova Scotia as part of the TD tour that

is also supported by the Canadian Children’s Book Centre, a nonprofit organization founded in 1976, dedicated to encouraging, promoting and supporting the reading, writing and illustrating of Canadian books for young readers. Their programs help teachers, librarians, booksellers and parents select the best for young readers. Over 35 authors and illustrators will be speaking to over 25,000 students during the weeklong tours.

Trinity Tower community happenings By Peggy Bolton Trinity Tower Correspondent Nowadays we constantly hear: Be active - exercise, walk, participate. With this in mind, I started a new daily workout routine ... everyday I do diddly-squat. All kidding aside, there is a young lad down the street who caught my attention shortly after we moved here. This boy s always outside in his free time, shooting pucks at a net in their driveway. Clearly he is not entrapped by today’s electronics. Very often a man I assume is his dad is out there playing with him. I do not know them, but I really admire their energy being spent in participaction. Susanne Widenmaier and her granddaughter, Virginia, visited with Susie’s sister, Eva Farnden at the Villa in Oxbow on April 27. Les and Judy Crandall left for a month’s vacation during which they will

EVENT

S

visit family in New Brunswick. We welcome Ann Zohner who moved here from her residence in Estevan. We look forward to meeting you, and hope you enjoy living at Trinity Tower. Lyall and Peggy Bolton are visiting relatives at Macklin, Lloydminster and Shaunavon. Luverne and Dianne Bod went to Colonsay where they attended their granddaughter’s dance recital. They are so proud of Kianna, as she was recognized as the most improved dancer, out of the 40 dancers who participated. Luverne and Dianne said, “It was a great weekend.” At the Hi-Risers meeting, it was decided not to have potluck over the summer. Patio parties will be held every second week, starting May 28, with each floor taking a turn. Our wonderful manager, Dianne, has a Mother’s Day tea planned and a Father’s Day breakfast. Our resident gardeners, Judy and Debby, will be plant-

Friday, May 10: • Estevan Regional Nursing Home Mother’s Day Tea - Nursing Home Dining Room - 2 to 4 p.m. Saturday, May 11: • Estevan Farmers Market Indoors at the Estevan Shoppers Mall - 9:30 a.m. to 4 p.m. • Relay for Life Expo - Estevan Shoppers Mall - 9:30 a.m. to 4:30 p.m. Craft & Home Business Products, Slide show of past relay events; Sign up for this year’s relay (team or volunteer).

ing when the weather smartens up. Plants and donations for the purchase of plants are provided by the residents. The next meeting of the Hi-Risers will be held on Sept. 4. I am really appreciating everyone who is giving me news items and who has agreed to be profiled. It makes this job so much easier. Thanks, people! This week, I would like to introduce you to a very friendly woman, Hilda Eagles. She is always smiling, and has a great sense of humour. Hilda is the secretary for the Hi-Risers. She wrote: “Hello everyone. I was born in Estevan, raised on a farm four miles northeast

of Macoun, and remained there until moving to Estevan. I attended Macoun School, being transported by sleigh and horses in the winter, pony and bike in the summer. We were married in November 1947 - a bitterly cold and muddy day. My mother and siblings moved to Estevan and we carried on mixed farming. We raised six boys and one girl, who have all spread their wings into various vocations. When Rea passed away, I remained on the farm for one year and then moved into Trinity Tower, which I have never regretted. If you want a place to live where people are kind and forgiving, get your name on the list. - Hilda Eagles.”

60 and Over Club notes Submitted by Shirley Graham Club Secretary What do you get if you cross a lion with a parrot? I don’t know either, but if it wants a cracker, you better give it one! Our jam session will be held on Sunday, May 12 beginning at 2 p.m. and running until 5, with lunch and a free-will donation. This is also Mother’s Day, so bring her along with you. Here are the winners of the bridge played on

Wednesday, May 1: Coming first was Bernie Collins, second place went to Al Fellner, and taking third was Wilma Tedford. The regular monthly meeting was held on Thursday, May 2 after which cribbage was played. The following were winners: Art Friesen took first place, Nick Morsky came in second, while third went to Jake Fichter. There was a very nice group out for the cribbage tournament on Saturday, May 4. First place winners

were Colin Renwick and Gary St. Onge, second went to Doris Heidinger and Helen Parish, and placing third were Charlene Anderson and Al Fellner. Ole and Lena Ole and Lena went out for supper in a very nice restaurant. The meal came, but Lena wasn’t eating. Concerned, the waitress asked, “Is there something wrong with your meal?” “Oh, no,” said Lena, “I’m just waiting for the teeth.” Have a good day ...


B12 May 8, 2013

Estevan Mercury

Midale community happenings By Catrina Moldenhauer Midale Correspondent A celebration of life was held for Darla Yurkowski (Carlson) on Friday, April 26 at the Midale Civic Centre. The Civic Centre was packed and the family was overwhelmed with all of the support they have received since the accident. Darla passed away at the age of 44 as the result of an accident on Highway 39 just outside of Midale on April 18. Darla leaves behind her husband, Todd Yurkowski of Halbrite; seven children, Jeremy (Billie Joe) Troendle, Chantel Carlson, Cole Troendle (Latisha Glenn), Brooke Troendle, Dawson Troendle, Charitee Troendle and Chevy Yurkowski; five grandchildren:

Pierce, Lane, Baillie, Kira and Colton; her parents, Bazel and Darlene Carlson of Midale; sisters, Marla(Harvey) Brasseur of Midale and Charlene Carlson (Steven Duffy) of Yorkton; brother, Adam (Glynis) Carlson of Macoun, along with numerous nieces, nephews, aunts, uncles, cousins and friends. Midale Central Schoolâ&#x20AC;&#x2122;s front entrance foyer has been transformed into a Reading Area for the elementary students. It has a nice floor mat and some great chairs where the teachers and students are able to sit, relax and read. The school is requesting that no messy footwear be worn and to please keep food and drinks out of this area. The elementary track and field day will be held on Friday, May 31. There will be no school on Friday, June 7.

Outram-Torquay community news By Betty Ribling Outram-Torquay Correspondent Happy birthday to Ross LeBlanc whose birthday was on May 4. Also celebrating birthdays were Michelle Yergens, Esther Mantei and Margaret Daoust. On Sunday, April 28, Club D.J. (David and Jonathon) held their windup activities at Trinity Lutheran Church in Torquay. The club ran Monday afternoons from 4:15 to 5:30, starting in mid-October. Twenty-two children were registered. The three main components of the club were Bible time, games and crafts. The camp director was Cindy Daae, Darwin

Daae directed the games, Stephanie Pederson directed the crafts, and Shannon Daae directed the singing. They were thankful for the help of many parents. A car rally was held to celebrate the ending of the childrenâ&#x20AC;&#x2122;s club. They used their club cars that they had designed and decorated to race on a wooden track. A short program consisted of the children singing songs and reciting Bible verses. Awards were given for work they had completed throughout the year. Fifty-six children and adults were in attendance for this exciting event. They plan to resume again next fall. If anyone is interested in hosting a five-day Bible

Club in their backyard this summer, please contact Cindy Daae at 306-923-2221. There is one more month of play school in Torquay. They close at the end of May and plan to resume again in October. Joe and Christine Pyra of North Battleford spent last weekend visiting at the home of Jeff and Heather Pyra and family. Sympathy is extended to the family and relatives of Viola Halvorson who passed away at the age of 95. Interment was at Trinity Lutheran Cemetery at Torquay. Congratulations to Rebecca Duncan who was recognized at an awards ceremony for the literary

and poster contest winners that was held at the Estevan Legion on April 18. Rebecca entered in the primary coloured poster category and received first place at the branch, zone, district and provincial levels. Her poster was then sent to the national level. William Duncan placed second at the branch level. Julia Klatt has returned home from a band trip to Chicago. They left on April 24 and returned April 29. Don and Faye Mantei and Farah and Travis Klatt and family attended the wedding celebration and dance for Fayeâ&#x20AC;&#x2122;s nephew Brandon (Paula) Lohse on Saturday, May 4 at the Legion Hall in Weyburn.

For those students in Grades 1-6 who are struggling with or wish to improve their math and reading skills, Math Club is scheduled for May 15, May 27 and May 29, while Reading Club will be held May. The end of May marks the end of the clubs for this year. Midale Lions Club steak fry is happening on Saturday, May 25 at the Midale Seniorsâ&#x20AC;&#x2122; Centre. The event will be catered by Lionel Wanner from Goodwater. Tickets are available at Bernieâ&#x20AC;&#x2122;s (Midale Variety Store), Midaleâ&#x20AC;&#x2122;s Conexus Credit Union and Tumbleweeds. Cost is $25/person. Cocktails start at 5 p.m., with supper at 6 oâ&#x20AC;&#x2122;clock. This is a fundraiser for community projects, so please come out a support a worthy cause! Mainprize Market Place will again be running once a month in the Pederson Building at Mainprize Park. Markets are scheduled for May 25, June 15, July 13 and August 17. For tables contact Julie Van Alstyne at home or e-mail mainprizemarketplace@yahoo.ca.

North Portal news By Betty Baniulis North Portal Correspondent Pat and Trish Barker recently returned from a threeweek holiday in Europe where they cruised around the western Mediterranean with friends from Ontario for 12 days, then visited with Trishâ&#x20AC;&#x2122;s cousin in Spain. The bridge club met at the home of Dorothy Fuchs on April 29 with two tables in play. Arva Walters took high honours, with second high going to Brenda Schindel. Born to Todd and Kim Baniulis of Saskatoon on May 3 at 10:10 a.m., a son, Ethan Todd; a brother for Olivia. He weighed nine pounds, and was 21 1/4-inches long. Proud grandparents are Moe and Sharon Eauclet of Saskatoon and Darryl and Cheryl Baniulis of Coronach; great grandparents are Joe and Betty Baniulis, North Portal. Betty and Joe Baniulis and Maxine Amos of Oxbow drove to Carievale on May 2 to attend the funeral of a friend, Maurice Chester, held at the United Church there.

(VWHYDQ*RVSHO&KDSHO

6W3HWHU¡V/XWKHUDQ&KXUFK

WK6WUHHW(VWHYDQ

´(TXLSSLQJ*RG¡VSHRSOHWRWKLQNELEOLFDOO\ WROLYHJRGO\DQGWRVHUYHHIIHFWLYHO\²LQà XHQFLQJ RXUZRUOGIRU&KULVW¾

,VDEHOOH 6RXULV 5HYHUHQG5DQG\.OHHPROD 3KRQH HPDLOVWSHWHUV#DFFHVVFRPPFD

6XQGD\:RUVKLS

%LEOH&ODVVDP²:RUVKLSDP (YHQLQJ:RUVKLSSP :HGQHVGD\0HHWLQJSP

QG6WUHHW 3KRQH

3DVWRU-RVK3HUPDQQ 6XQGD\:RUVKLSDP :HHNO\3UD\HU0HHWLQJ

ZZZHVWHYDQJRVSHOFKDSHOFD $Q$VVRFLDWHG*RVSHO&KXUFK

/&&

7LP3LSSXV 2IĂ&#x20AC;FH 6XQGD\6HUYLFHV

DP%LEOH6WXG\ DP'LYLQH6HUYLFHZLWK+RO\&RPPXQLRQ 6XQGD\6FKRRO

&RUQHUWK$YHQXH QG6WUHHW

$&RQJUHJDWLRQRI/87+(5$1&+85&+&$1$'$

 .LQ J 6W UHH W 5($//,)( REAL LIFE (VW HYDQ  6D VN REAL PEOPLE 5($/3(23/(      REAL GOD 5($/*2' ZZZOLYLQJKRSHFDRUJ 

3DVWRU-XDQLWR9DUJDV $VVRFLDWH3DVWRU )DWKHU3HWHU1LMVVHQ 0$66(66DWXUGD\SP 6XQGD\ DP

67*,/(6$1*/,&$1 &+85&+ 3DULVKRI(VWHYDQ

WK$YHQXH

6XQGD\:RUVKLS7LPHVDP 0RUQLQJSUD\HUVQG6XQGD\RI WKHPRQWK DPZLWK6XQGD\6FKRRO

)UHH&ORWKLQJ2XWOHW )LUVW 7KLUG7KXUVGD\RI(DFK0RQWKWRSP

6W-RKQWKH%DSWLVW 5RPDQ&DWKROLF&KXUFK 3KRQH)D[

#(52#(/&#(2)34

12:6XQGD\VHUYLFHVWRFKRRVHIURP DPDQGDP:LWKFRIIHHLQEHWZHHQ

LIVE RUSSIAN TRANSLATION /,9(5866,$175$16/$7,21 during the 11:00 am service GXULQJWKHDPVHUYLFH

673$8/Ň&#x2039;681,7(' &+85&+ &RUQHURIWK$YHQXH UG6WUHHW 3KRQH²)D[

681'$<:256+,3  681'$<6&+22/$0 &RIIHH)HOORZVKLS%HIRUH&KXUFK

7+( 6$/9$7,21 $50< 3KRQH

(67(9$1&20081,7<&+85&+ WK6WUHHW

3DVWRUV/LHXWV%ULDQ -XQH%REROR 681'$<DP:RUVKLS6HUYLFH

$//:(/&20(

Church of God Pursuing God Building Relationships Impacting Lives 1920 Wellock Road, Estevan â&#x20AC;˘ (306) 634-7955 www.estevancog.com Estevan Church of God

7KH5HY0DUN2VERUQH

:(/&20(

$//$5(:(/&20( &KXUFK2IĂ&#x20AC;FH

Senior Pastor: Geoff Thiessen

0,1,67(55(9%5(11$1,&.(/ (PDLOVWSDXOVXF#VDVNWHOQHW :HEVLWHVWSDXOVHVWHYDQFD

10:30 a.m. Sunday Worship with Childrenâ&#x20AC;&#x2122;s Ministries & Nursery.

ZZZHVWHYDQDQJOLFDQFRP

Faith Lutheran Church 1LFKROVRQ&HQWUH(VWHYDQ

6XQGD\:RUVKLS 6XQGD\6FKRRO DP (YHQLQJ:RUVKLS SP 3DVWRUV 'DQQ\.UDXVV&DOHE5LHJHU -RVKXD/RZH 3KRQH &HOO

&RPHDQG:RUVKLS:LWK8V

Trinity Lutheran Church E.L.C.I.C. 738 - 2nd Street, Estevan Church OfďŹ ce: 306-634-5684 SUNDAY WORSHIP AND SUNDAY SCHOOL 10:00 a.m. Coffee and fellowship after worship Pastor Stewart Miller ALL ARE WELCOME email: trinity.luth@sasktel.net â&#x20AC;˘ www.etlc.ca

7:30 p.m. Fridays theGROVE Youth Ministries Please call us or visit our website for more information about other ministries and events.


www.estevanmercury.ca

May 8, 2013 B13

Other Side of Liberation ready to launch The 11th volume of a series of post Second World War recollections told in narrative style has now reached the public, said author Marie Donais-Calder. The Other Side series, a tribute to her late father who served in the Canadian militaryâ&#x20AC;&#x2122;s engineering division in post-war Germany, takes readers into The Other Side of Liberation in this latest volume of work. â&#x20AC;&#x153;And again, I have heard more stories. I got to meet those from the Netherlands who befriended Canadian troops who helped liberate that country,â&#x20AC;? said Donais-Calder. â&#x20AC;&#x153;Then I met Jack Van

Vaals from Langenberg who befriended Canadian soldier Cliff Schnell and whose family spent years trying to track him down and yet they were only a few miles apart. Cliff died a few years ago, but now Jack Van Vaals and the Schnell family will be getting together at the book launching party we have arranged in Moose Jaw on June 1,â&#x20AC;? said Donais-Calder, who said this is just the most recent tie-in to her ongoing series that has been filled with side stories that never cease to amaze her. In fact, it turns out Van Vaal is pictured on the cover of The Other Side of Lib-

eration as one of the children who lined the streets for the Canadian troops as they marched into Holland. The photo appeared in the Franeker Friesland newspaper and a copy of the photo has become a part of the latest bookâ&#x20AC;&#x2122;s cover. These coincidences keep happening, she said, as the story about her father

remain firmly etched in her own memory. So Jack Van Vaals, who was there when the Canadian soldiers arrived, will be at the book launch. The Dutch and Canadians have a unique association that continues to this day,â&#x20AC;? Donais-Calder said as she set up the display of all 11 easy-reading books that

Published weekly by the Boundary Publishers Ltd., a subsidiary of Glacier Ventures International Corp. The Glacier group of companies collects personal information from our customers in the normal course of business transactions. We use that information to provide you with our products and services you request. On occasion we may contact you for purposes of research, surveys and other such matters. To provide you with better service we may share your personal information with our sister companies and also outside, selected third parties who perform work for us as suppliers, agents, service providers and information gatherers. Our subscription list may be provided to other organizations who have products and services that may be of interest to you. If you do not wish to participate in such matters, please contact us at the following address: The Estevan Mercury, Box 730, Estevan, Saskatchewan, S4A 2A6; or phone (306) 634-2654. For a complete statement of our privacy policy, please go to our Web site at: www. estevanmercury.ca The Estevan Mercury is owned and operated by Boundary Publishers Ltd., a subsidiary of Glacier Ventures International Corp.

Legal 25/2:6.,/$:2)),&( %DUULVWHU 6ROLFLWRU

6WHSKHQ-2UORZVNL%(G//% WK6WUHHW(VWHYDQ

3KRQH)D[ RUORZVNLODZ#VDVNWHOQHW %UDQFKRIĂ&#x20AC;FHVDW $UFROD 5HGYHUV &DUQGXII $UFROD$JHQFLHV &DUOVHQ%OGJ &DUQGXII$JHQFLHV%OGJ :HGQHVGD\$0 :HGQHVGD\30 7KXUVGD\30 3KRQH 3KRQH 3KRQH

752%(57 /$:),50

-DPHV)7UREHUW %$//% %DUULVWHU 6ROLFLWRU (VWHYDQ:LFNORZ&HQWUH WK6W (VWHYDQ6.6$: 3K)D[

(PDLOWUREHUWODZ#VDVNWHOQHW

Financial Planning ,QVXUDQFH  ,QYHVWPHQWV6HUYLFHV

5RQ$UHVKHQNRII 0XWXDO)XQG$GYLVRU /LIH,QVXUDQFH5HSUHVHQWDWLYH

),1$1&,$/

%WK$YHQXH(VWHYDQ6.6$9 3+  7ROO)UHH   LQIR#VSHFWUDĂ&#x20AC;QDQFLDOFD ,QVXUDQFH2IIHUHG7KURXJK6SHFWUD)LQDQFLDO 0DQXOLIH6HFXULWLHV,QYHVWPHQWV6HUYLFHV,QFLVD0HPEHU0)'$,3&

%,//(6%(5*(5 /$:),50 %$55,67(56$1'62/,&,7256 -2+1-%,//(6%(5*(5%$//%

7KLUG6WUHHW (VWHYDQ6DVNDWFKHZDQ 6$5 3KRQH   )D[  

%UDQFK2IĂ&#x20AC;FHV /$030$1)ULGD\VÂ&#x2021;50%XLOGLQJÂ&#x2021; 0,'$/(7XHVGD\VÂ&#x2021;0DLQ6WUHHWÂ&#x2021;

3WPITa-TI[P4]L_QO 4I_.QZU448

%DUULVWHUV 6ROLFLWRUV 3DXO'(ODVK%$//% $DURQ/XGZLJ%6F//% WK6WUHHW(VWHYDQ 7HOHSKRQH )D[   *DLQVERURXJK &DUQGXII 7KXUVGD\DP 7KXUVGD\SP 3KRQH 3KRQH

Roofing : $// :2 HKDYH\ R 5. *8$ XUURRĂ&#x20AC;  QJ 5$1 QHH 7(( '_) GV´FRY H 5(( (67 UHGÂľ 5HV ,0$7 LGH (6 Q

 WLDO  

7UDLOEOD]HU6FRRWHU

23(17+856 &$// 72//)5((

Â&#x2021;LQ%ODFN7LUHV Â&#x2021;)XOO6XVSHQVLRQ 6XLWHWK$YH(VWHYDQ Â&#x2021;'HOX[H/LJKW3DFNDJH VWGRRU6RXWKRI&,%&IRUPHUO\ Â&#x2021;+3#03+ 6XQ/LIH%OGJ

Â&#x2021;3RZHU6HDWRU/JH%DWWHULHV

C G C SS ADVERTISING RATES Businesses/Private Parties placing ClassiĂ&#x20AC;ed Advertising (Want Ads) in either The Estevan Mercury or the Southeast Trader Express and requesting these ads to be BILLED TO AN ACCOUNT WILL BE CHARGED THE FOLLOWING RATE: $9.95 for the First 20 Words + 20¢ for Each Additional Word ALL PRICES SUBJECT TO 5% GST Please remember â&#x20AC;Ś Each Abbreviation Counts as One Word (You donâ&#x20AC;&#x2122;t save money by abbreviating, you just make your ad more difĂ&#x20AC;cult to read) Web Sites (i.e. www.world.ca) count as three words

/-%/DZUHN-RKQVRQ%LUG 5HDO(VWDWH$SSUDLVDOV &RQVXOWLQJ 0HPEHURI$SSUDLVDO,QVWLWXWHRI&DQDGD

Commercial and farm land appraisals Serving Eastern Saskatchewan and Western Manitoba Robin Johnson, M.A. Econ., AACI, P.App 2126 Rose Street â&#x20AC;˘ Regina, Saskatchewan â&#x20AC;˘ S4P 2A4 Direct: (306) 721-5525 Cell: (306) 529-3236 Email: johnsonr@accesscomm.ca www.ljbappraisals.com

Dental 6RXULV$YHQXH :H\EXUQ6. 

'U*UHJ.RQRWRSHW] 7ROO)UHH LQIR#VPLOHVRQVRXULVFD ZZZVPLOHVRQVRXULVFRP

Funeral Directors Dustin Hall - Owner/Funeral Director Allan Styre - Funeral Director Jeff Sully - Funeral Director 1506 4th Street, Estevan (306) 634-8233 12 Warren Street, Redvers (306) 452-6020 www.hallfuneralservices.ca

Optometrist

 ,QVXUHGDQG:&%&RYHUHG

Health & Mobility Aids Equipment Rental /,)7&+$,56 :$/.(56 (/(&75,&%('6 $1' 08&+025(

official launching of The Other Side of Liberation will be preceded by her appearance on CTVâ&#x20AC;&#x2122;s noonhour community news show the day before.

Appraisals

´,QWKHEXVLQHVVRI FUHDWLQJHQKDQFLQJ DQGLQVXULQJ FOLHQWŇ&#x2039;VQHWZRUWKÂľ 5H\QROG%HUW &HUWLĂ&#x20AC;HG)LQDQFLDO3ODQQHU

deal with the topic of war, its devastation, post war challenges and healing, at the May 4 Farmersâ&#x20AC;&#x2122; Market in Estevan. She said the June 1

)255(17

Â&#x2021;58%%(5 75$&.6.,'67((56 Â&#x2021;0,1,75$&.+2(6 Â&#x2021;3257$3277,(6 Â&#x2021;0,1,6.,'67((5 Â&#x2021;&$5+$8/(575$,/(5 Â&#x2021;)/$7'(&.75$,/(56 Â&#x2021;/%528*+7(55$,1()25./,)7

)5(6+:$7(5$9$,/$%/()25)5$&:$7(5'5,//,1*5,*(7&

3RQJR+ROGLQJV/WG

RU 31/2 miles South of Estevan on Hwy 47 (35 of 1 of 8, West of the 2nd)

'U6DUDK6OLYD2SWRPHWULVW 6RXULV$YH(VWHYDQ6.

3KRQH   ZZZVRXWKHDVWH\HFDUHFD

)RULQIRUPDWLRQRQ ERRNLQJ\RXUDG &DOORUHPDLO DGVDOHV#HVWHYDQPHUFXU\FD


B14 May 8, 2013

Estevan Mercury



       !  & "*

"   ! !!"!" +  &!#!#" !$  ! *   -#  / 460(/ 0  !+" !$!$% "(-% &.$! !!!'    # , / 80( #"   -%  !"!!"+$ !!!!' 1!!# !"! 1  11 " "! " !! -&! ! !11 

 &!* $$$+"-&+ %!*736+569+;95:   !! !! !)$#(&!  !#$ $!!+

)RXQGDWLRQ'LUHFWRU 7KH%RDUGRIWKH6W-RVHSK¡V+RVSLWDO)RXQGDWLRQRI(VWHYDQ LVVHHNLQJDGHGLFDWHGDQGTXDOLĂ&#x20AC;HGLQGLYLGXDOWRPDQDJHWKH +RVSLWDO)RXQGDWLRQ

Careers 7XUQEXOO([FDYDWLQJLVORRNLQJIRUD

*UDGHU2SHUDWRU 7XUQEXOO([FDYDWLQJ/WGLVDQHVWDEOLVKHGFRQVWUXFWLRQFRPSDQ\LQ(VWHYDQ6N:HNQRZWKDWRXU HPSOR\HHVDUHFULWLFDOWRRXURYHUDOOVXFFHVV:HDUHGHGLFDWHGWRLQYHVWLQJLQWKHLUIXWXUHWRPDLQWDLQ ORQJWHUPUHODWLRQVKLSVIRUODVWLQJFRPPLWPHQWV 7KHLGHDOFDQGLGDWHZLOOKDYH Â&#x2021;([SHULHQFHZLWKJUDGLQJURDGVFXWWLQJIRUHOHYDWLRQVDQGVORSHVPRYHPDWHULDOVRQWKHZRUNVLWH Â&#x2021;6WURQJVNLOOVGULYLQJDQGRUPDQLSXODWLQJHTXLSPHQWWREODGHDQGPRYHHDUWKVDQGJUDYHOHWF Â&#x2021;7KHDELOLW\WRHIIHFWLYHO\FRPPXQLFDWHDQGVDIHO\IROORZGLUHFWLRQVUHSRUWDQ\TXDOLW\RUSURFHVV LVVXHVLQIRUPLQJZKHQPDLQWHQDQFHRIPDFKLQHLVQHHGHG Â&#x2021;6DIHO\IROORZSROLFLHVDQGSURFHGXUHV &DQGLGDWHVPXVWSRVVHVV Â&#x2021;$VROLGNQRZOHGJHRIHTXLSPHQWPDLQWHQDQFHDQGLW¡VVDIHRSHUDWLRQ Â&#x2021;0HFKDQLFDODSWLWXGHIRUPLQRUSUHYHQWDWLYHPDLQWHQDQFHDQGSUHVKLIWLQVSHFWLRQV Â&#x2021;$SURYHQVDIHW\UHFRUGDQGDKLVWRU\RIEHLQJDWHDPSOD\HU Â&#x2021;,QLWLDWLYHDQGEHDEOHWRZRUNZLWKRXWGLUHFWVXSHUYLVLRQ Â&#x2021;9DOLG&ODVVGULYHUOLFHQVHRUKLJKHU &ODVV$RU$  Â&#x2021;6DIHW\7LFNHWVZRXOGEHDQDVVHW )LUVW$LG+6$OLYH:+0,6

:KDWZHRIIHU Â&#x2021;&RPSUHKHQVLYHEHQHĂ&#x20AC;WVSURJUDP Â&#x2021;&RPSHWLWLYHVDODULHVZKLFKDUHUHJXODUO\UHYLHZHGWRPDLQWDLQWKHPDWFRPSHWLWLYHOHYHOV Â&#x2021;3URĂ&#x20AC;WVKDULQJERQXVHV

(PDLOWRGDYHWXUQEXOOH[FDYDWLQJ#VDVNWHOQHW RU)D[WR

5HSRUWLQJWRWKH)RXQGDWLRQ%RDUGWKH)RXQGDWLRQ'LUHFWRULV UHVSRQVLEOHIRUWKHIROORZLQJGXWLHV Â&#x2021;0DQDJHWKHGDLO\RSHUDWLRQVRIWKH)RXQGDWLRQ Â&#x2021;2UJDQL]HLPSOHPHQWDQGRYHUVHH)XQG5DLVLQJ(YHQWV Â&#x2021;5HVHDUFKIXQGLQJVRXUFHVJUDQWVDQGRSSRUWXQLWLHV Â&#x2021;6WUDWHJLFSURJUDPPDWLFDQGĂ&#x20AC;QDQFLDOPDQDJHPHQWRIWKH 2UJDQL]DWLRQ Â&#x2021;0DQDJHWKHDQQXDO%XGJHWRIWKH)RXQGDWLRQ Â&#x2021;0DQDJH)RXQGDWLRQ5HDO(VWDWHLQFOXGLQJDSK\VLFLDQFOLQLF Â&#x2021;3XEOLF5HODWLRQUHVSRQVLELOLWLHVZLWKPHGLDDQGSXEOLF 7KLVLVDGHPDQGLQJIXOOWLPHSRVLWLRQ7KHLGHDOFDQGLGDWH ZLOOKDYHSURYHQH[SHULHQFHLQ)XQG5DLVLQJ0DUNHWLQJ3XEOLF 5HODWLRQVDQG)LQDQFLDO0DQDJHPHQW 7KH)RXQGDWLRQ¡VJRDOVDUHWRUDLVHIXQGVDQGWRPDLQWDLQDVWURQJ IHHOLQJRIJRRGZLOOWRZDUGV6W-RVHSK¡V+RVSLWDORI(VWHYDQ ,QWHUHVWHGDSSOLFDQWVVKRXOGIRUZDUGWKHLUUHVXPH SULRUWR0D\WR )RXQGDWLRQ'LUHFWRU3RVLWLRQ 6W-RVHSK¡V+RVSLWDORI(VWHYDQ (PDLO-RDQ%DUQVWDEOH#VFKUVNFD )$;

7XUQEXOO([FDYDWLQJLVORRNLQJIRUD

7UXFN'ULYHUV$ $ *UDYHO 5HGL0L[

7XUQEXOO([FDYDWLQJ/WGLVDQHVWDEOLVKHGFRQVWUXFWLRQFRPSDQ\LQ(VWHYDQ6N:HNQRZWKDWRXU HPSOR\HHVDUHFULWLFDOWRRXURYHUDOOVXFFHVV:HDUHGHGLFDWHGWRLQYHVWLQJLQWKHLUIXWXUHWRPDLQWDLQ ORQJWHUPUHODWLRQVKLSVIRUODVWLQJFRPPLWPHQWV 7KHLGHDOFDQGLGDWHZLOOKDYH Â&#x2021;([SHULHQFHGULYLQJ$RU$WUXFNVLQERWK21URDGDQG2))URDGFRQGLWLRQV Â&#x2021;6WURQJVNLOOVGULYLQJJUDYHOWUXFNVKDXOLQJVDQGURFN JUDYHOPDWHULDOV Â&#x2021;([SHULHQFHKDXOLQJDQGGHOLYHULQJ5HGL0L[FRQFUHWH Â&#x2021;7KHDELOLW\WRHIIHFWLYHO\FRPPXQLFDWHDQGVDIHO\IROORZGLUHFWLRQV Â&#x2021;5HSRUWDQ\TXDOLW\RUSURFHVVLVVXHVLQIRUPLQJZKHQPDLQWHQDQFHRIWKHWUXFNLVQHHGHG Â&#x2021;6DIHO\IROORZSROLFLHVDQGSURFHGXUHV &DQGLGDWHVPXVWSRVVHVV Â&#x2021;$VROLGNQRZOHGJHRIYHKLFOHPDLQWHQDQFHDQGVDIHYHKLFOHRSHUDWLRQ Â&#x2021;0HFKDQLFDODSWLWXGHIRUPLQRUSUHYHQWDWLYHPDLQWHQDQFHDQGSUHVKLIWLQVSHFWLRQV Â&#x2021;$SURYHQVDIHW\UHFRUGDQGDKLVWRU\RIEHLQJDWHDPSOD\HU Â&#x2021;,QLWLDWLYHDQGEHDEOHWRZRUNZLWKRXWGLUHFWVXSHUYLVLRQ Â&#x2021;6DIHW\7LFNHWVZRXOGEHDQDVVHW )LUVW$LG+6$OLYH:+0,6

:KDWZHRIIHU Â&#x2021;&RPSUHKHQVLYHEHQHĂ&#x20AC;WVSURJUDP Â&#x2021;&RPSHWLWLYHVDODULHVZKLFKDUHUHJXODUO\UHYLHZHGWRPDLQWDLQWKHPDWFRPSHWLWLYHOHYHOV Â&#x2021;3URĂ&#x20AC;WVKDULQJERQXVHV

(PDLOWRGDYHWXUQEXOOH[FDYDWLQJ#VDVNWHOQHW RU)D[WR

Child Care Needed Looking for a responsible, caring individual to come into our home 3-4 days a month to care for 2 small children. Individual must have experience with children and provide references.

is expanding its

PRODUCTION DEPARTMENT The Estevan Mercury requires a full time ad builder in their production department.

Please send resume to:

Applicants must be able to multi-task in a fast paced, deadline driven environment, He/she must be a team player with an eye for detail. Knowledge of Mac Computers and Adobe Creative Suite is an asset, but not necessary. We are willing to train the right applicant.

Box 730A, Estevan, SK S4A-2A6

The position is Monday to Friday, 8:00 am - 5:00 pm. Our company offers a health benefit package.

See career ads online! www.estevanmercury.ca

Please e-mail resume, complete with cover letter and references to: Trinda Jocelyn, Production Manager prepress@estevanmercury.ca

Pay negoĆ&#x;able upon experience.


www.estevanmercury.ca

May 8, 2013 B15

Career Opportunities )22'6(59,&(:25.(56 :HDUHDFFHSWLQJUHVXPHVIRU SDUW IXOOWLPHSRVLWLRQV 'XWLHVLQFOXGH)RRGSUHSDUDWLRQVWRFNDQG LQYHQWRU\VHUYLQJFXVWRPHUVVRPHEDNLQJPDNLQJ VDQGZLFKHVRSHUDWHFDVKUHJLVWHUDQGEHDEOHWR JLYHSURSHUFKDQJHDVZHOODVJHQHUDOFOHDQLQJDQG HTXLSPHQWPDLQWHQDQFH

&RRNV

/RRNLQJIRUDQ

21,215,1*0$.(5 +RXUVDUH 0RQGD\:HGQHVGD\DQG)ULGD\ $0$0 $SSO\RQOLQHDWDZFDRULQSHUVRQDW

7RZHU&DIHLVORRNLQJIRUFRRNV IRUSHUPDQHQWIXOOWLPHHPSOR\PHQW 3UHSDUH FRRNSL]]DVVDODGVVDQGZLFKHVDVRUGHUHG6HWXS VWRFN OLQH WR PDLQWDLQ SURSHU OHYHOV RI LQJUHGLHQWV UHTXLUHG 7UDLQ QHZ VWDII 8VH SURSHU ZHLJKWV  PHDVXUHPHQWV WR PDNHSUHSDUH FRQVLVWHQW SURGXFW&OHDQHTXLSPHQW FOHDQOLQH ZRUNDUHDDVUHTXLUHG0XVW EHDYDLODEOHWRZRUNXQWLOPLGQLJKWSHUKRXUSHUPDQHQWIXOOWLPH DYDLODEOH

6WDUWLQJZDJHKU ,I\RXDUHLQWHUHVWHGLQMRLQLQJRXUWHDPDSSO\ LQSHUVRQZLWKUHVXPH

$SSO\LQSHUVRQZLWKUHVXPHWR

WK6WUHHW (VWHYDQ

Â&#x160;

WK6WUHHW(VWHYDQ

1HZ/RFDWLRQ1RZ2SHQ .HQVLQJWRQ1RZ+LULQJ

)RRGDQG %HYHUDJH6HUYHUV IRUSHUPDQHQWIXOOWLPHHPSOR\PHQWWR SUHVHQWPHQXWDNHRUGHUVVHUYHWDEOH SUHVHQWELOO1RH[SHULHQFHLVQHFHVVDU\ZLOO WHDFK 

KRXU

'URSRIIUHVXPHRUID[WR  

WK6W (VWHYDQ6.

)RUPRUHLQIRUPDWLRQRQWKHSRVLWLRQEHORZYLVLW ZZZFRUQHUVWRQHVGFD 3HUP )XOO7LPH,QIRUPDWLRQ6\VWHPV7HFKQLFDO$QDO\VW 6RXWK6HUYLFH$UHD,QFOXGLQJ(VWHYDQ 7KHVDODU\UDQJH LVFXUUHQWO\KUDORQJZLWKDIXOO EHQHILWSDFNDJHDQGDQHPSOR\HU GHILQHGSHQVLRQSODQ

GEM-WELL MAINTENANCE INC. Box 212 Lampman, SK 20C 1N0 Owner: Scott Stein 306-421-1500 Safety Coordinator: Marty 306-421-0516

:($5(3/($6('72$11281&( 7+$7:(+$9(&203/(7('285 &25&(57,),&$7,21

COR CERTIFIED Gem-Well is a pump jack maintenance company that is dedicated to completing every procedure in a safe manner following all provincial and federal legislation.

We are a service company that performs a variety of services for pump jacks such as inspections, aligning units, replacing gear boxes and bridle cables.

Looking to Hire?? Need Skilled Help??

We have been servicing the surrounding area since 1989 and are dedicated to completing service with excellent workmanship and communication with your company.

We can help you find them! Call today and Book Your Career Ad! 634-2654


B16 May 8, 2013

Estevan Mercury

Career Opportunities

    

  

!) $  

$'ULYHUV'ULOOHUVDQG2SHUDWRUV :H DUH FXUUHQWO\ ORRNLQJ IRU H[SHULHQFHG DXJHU ULJ GULOOHUV EDFNKRH DQG FHPHQWXQLWRSHUDWRUVZLWKDFODVV$OLFHQVH :HRIIHUFRPSHWLWLYHZDJHVMREERQXVHVDQGD EHQHĂ&#x20AC;WVSDFNDJH )RUPRUHLQIRFDOO )D[RUHPDLOUHVXPHVWRRU SUDLULHUDWKROH#VDVNWHOQHW

      

027256&5$3(523(5$725 :DQWHGIRU6XPPHU6HDVRQ 0XVWKDYHH[SHULHQFHLQURDG FRQVWUXFWLRQ:HUXQDJRRGFOHDQ VDIHRSHUDWLRQDQGKDYHUHVSHFWIRU JRRGKDUGZRUNLQJSHRSOH 6YHLQ%U\HLGH&RQVWUXFWLRQ/7' %HQVRQ6. SKRQH ID[UHVXPHWR RUHPDLOFRQVYH#VDVNWHOQHW

     

               #""$%!%#!!! !%$"'!""!"!%&# # "$"#!(+%""5!%!," "&#'#!%!,""#!#" ! $!+ !%$"'!&##! $!" $". ,"/""!$## ! $!#+#"#"&"# "#%!+    "!""! !%##! "$!##$!$"#!"$#"# "#&)#(!#$#"!%  "$#"+#&% '#$"#!"!%$# ""+     "!""!# "##)"")#!$"# "#"#!$!" $("#" &#!"!!%"+ #&!%'#&"#"!% %!(#$!$"#!"$#"# "#&+ $!(#!,"##! !#$"#!('!&# ,"""!$# #""!(! $!#+  - #!&!% - ##%"!($" - $#"  !!"$"$""" (7)3124   $#!"#)"(($! !"$#*   $ # !'# .671/855-3832+

 !   "  

    !  $-1%/7% -/*-)/( )17%/6 -6 % /)%(-1+ 6833/-)5 2* 1(8675-%/ "5%-/)56 %1( %036 *25 7,) -/  %6 1(8675<13325781-7<);-676*25%7%/)17)(-1(-9-(8%/ *257,)*2//2:-1+52/) 

     ",-6 326-7-21 :-// &) 5)63216-&/) *25 7,) 6)7 83 %1( %-17)1%1') 2* $-1%/7% -/*-)/( )17%/=6 1(8675-%/ "5%-/)567:28/(&)%1%66)7*257,)'%1(-(%7)72,%9) .12:/)(+) 2* $)//6-7) "5%-/)56 -1'/8(-1+ 3/80&-1+ )/)'75-'%/ # %1( 6%7)//-7) 6<67)06  ",) %&-/-7< 72 7528&/)6,227352&/)06-17,)*-)/(-6%0867  $)%5)'855)17/<6)).-1+72*-//7,-6326-7-21-17,) *2//2:-1+/2'%7-21    ",-652/):-//-192/9)75%9)/62%9%/-(5-9)5=6-')16)-6 5)48-5)( %1( 6)/)'7)( '%1(-(%7)6 :-// &) 5)48-5)( 72 &5-1+ % 5-9)5=6 &675%'7 *25 -17)59-):6  #)5< '203)7-7-9)67%57-1+:%+)6%1(%*8//&)1)*-73%'.%+)  /)%6)%33/<-1'21*-()1')&<68&0-77-1+<2855)680) '29)5/)77)572  $-1%/7%-/*-)/( )17%/6 2; 67)9%1!!    %;     0%-/(:-+/)<:-1%/7%-1''20 

6XQ9DOOH\/DQG/WG LVORRNLQJIRUDQLQGLYLGXDOZLWK DKLJKOHYHORIRUJDQL]DWLRQDQG SURYHQWLPHPDQDJHPHQWVNLOOV  6WURQJRUDODQGZULWWHQ FRPPXQLFDWLRQVNLOOVDUH UHTXLUHG 7KHFDQGLGDWHPXVWKDYHDQ DFXWHDWWHQWLRQWRGHWDLOLQ HVWDEOLVKLQJDQGPDLQWDLQLQJDOO GDWDĂ&#x20AC;OHVDQGUHSRUWVWRHQVXUH WKHLUDFFXUDF\ /DQG$GPLQLVWUDWLRQ&HUWLĂ&#x20AC;FDWH  ([SHULHQFHLVDQDVVHW

$SSO\DW FDUHHUV#VXQYDOOH\ODQGFD

KVVY

2SHQWKH

KYLHTZ WR\RXU

Book Your Career ad today! Call A COMPANY ON THE MOVE

%&(   *."!&""&+(*'*%)-"(%&,,+,"&  *("*+"+%&,$"& ++%$"& &',!*-,"+ ++'",/",!,!+*."&,*!1(*'*%,! &++*1,+,+(*(,$(($"$(*'-*+ &+("","'&+'*.*"'-+*"$$"& ,''$+'%($,+ '-%&,,"'&&*('*,+  !" *"$   "&&'#'$ $  )"$!(  '%%'!"&! !"$"!+ & $'

!!%$ % &!$+!$&%&+  %&(!%&!   &,*+,(($"&,+%1+-%",,!"**+-%+"& '&"&&$"&,///&'.'%**+%"$ '*$$&++& &'.'%0   

 '* *'("&, &,$-#,*,&+"& ,'&*".   

/$1'$'0,1,675$725

:$17(',00(',$7(/<

$(  %, 

634-2654

This is a remarkable time for global agriculture and for Richardson. Our industry is undergoing unprecedented change with increasing world demand, and our company is experiencing transformational growth. Richardson International is Canadaâ&#x20AC;&#x2122;s largest, privately owned agribusiness and is recognized as a global leader in agriculture and food processing.

5()5$1&+,6(23325781,7<,1 (67(9$1 $UH\RXWKHW\SHRISHUVRQZKRLVFRPPXQLW\PLQGHG NQRZVWKHYDOXHRUH[FHOOHQWFXVWRPHUVHUYLFHDQG HQMR\VWKHLQWHUDFWLRQZLWKRWKHUSHRSOH"7KHQZH ZRXOGOLNHWRRIIHU\RXDWXUQNH\SDFNDJHFRPSOHWH ZLWKSURYHQRSHUDWLQJV\VWHPIXOOWUDLQLQJDQGRQ JRLQJVXSSRUWE\DQDWLRQDOIUDQFKLVRU$VNLQJSULFH RISOXVLQYHQWRU\ ,IWKLVRSSRUWXQLW\LVRILQWHUHVWWR\RXSOHDVHFDOO-HII 8UTXKDUW DW WKH :HVWHUQ 5HJLRQDO 2IĂ&#x20AC;FH IRU PRUH LQIRUPDWLRQ  H[W RU HPDLOMHIIX#FDOJDU\PPPVFD HUNDREDS OF

ONE UNIQUE

MEAL IDEAS

OPPORTUNITY

We currently have an opportunity at our Estevan, SK Richardson Pioneer Ag Business Centre.

Repair & Maintenance Lead This position contributes to the safe, efficient and profitable operation of grain handling and/or crop input facilities. Specific responsibilities include the repair and maintenance of high throughput grain handling and crop input facilities, utilizing both in-house and contract maintenance resources. The ideal candidate will be mechanically inclined with relevant maintenance experience; have strong communication, interpersonal and organizational skills; be detail-oriented with demonstrated accuracy; possess excellent customer service skills; and a willingness to relocate. An agricultural background would be considered an asset.

+$5' :25.

+$6,7ÂŽ65(:$5'6

Richardson International provides an excellent compensation package consisting of competitive salary, pension, a flexible benefits plan and training and career development opportunities.

Arcola now hiring!

Interested candidates should apply online by visiting www.richardson.ca to upload their cover letter and rĂŠsumĂŠ before May 24, 2013.

&/$66$$1'$'5,9(523(5$7256 Drive and operate one or more of the following units:

Hot Oiler, Pressure Truck Steamer, Vacuum Truck, Hydrovac, Combo Units and Tank Trucks Clean 5-year driverâ&#x20AC;&#x2122;s abstract required. H2S and first aid certification preferred. Please apply online: www.cleanharbors.com/careers or fax your resume to 306-455-2517 Clean Harbors is an equal opporunity employer Richardson values diversity in the workplace. Women, aboriginal people, visible minorities and persons with disabilities are encouraged to apply and self-identify.

w w w. c l e a n h a r b o r s. c o m / c a r e e r s

Estevan Mercury  

May 8, 2013

Read more
Read more
Similar to
Popular now
Just for you