I
Maritime and Fishery Agency maps out salt potential of Bali
N
T
E
R
N
A
T
I
O
Monday, September 12, 2011
N
A
L
16 Pages Number 1873st Year Price: Rp 3.000,-
e-mail: info_ibp@balipost.co.id online: http://www.internationalbalipost.com. http://epaper.internationalbalipost.com.
PAGE 8
Charlie Sheen smiles through Comedy Central roast PAGE 12
Marking 10 years since 9/11
A changed America AP Photo/Oded Balilty
A girl reaches to touch a wall of remembrances set up on the ground zero fence in New York, Saturday, Sept. 10, 2011.
Associated Press NEW YORK - Ten years. Of longing for loved ones lost in the worst terrorist attacks to happen on American soil. Of sending sons, daughters, fathers and mothers off to war in foreign lands. Of redefining what safety means and worrying about another 9/11 — or something even worse.
WEATHER FORECAST CITY
TEMPERATURE OC
DENPASAR
21 - 30
JAKARTA
24 - 32
BANDUNG
17 - 25
YOGYAKARTA
19 - 31
SURABAYA
19 - 31
SUNNY
BRIGHT/CLOUDY
RAIN
HOTLINE For placing advertisment, please contact: Eka Wahyuni
0361-225764
Ten years has arrived. And with it, memories. Of that September morning, when terrorists crashed hijacked planes into the World Trade Center and the Pentagon, and a fourth plane crashed into a field in rural western Pennsylva-
nia. Of heroism and Samaritans and unthinkable fear. And of nearly 3,000 killed at the hands of a global terror network led by Osama bin Laden, himself now dead. On Sunday, people across
America gather to pray at cathedrals in their greatest cities and to lay roses before fire stations in their smallest towns. Around the world, many others will do something similar because so much changed for them on that day, too. Bells will toll. Americans will see new memorials in lower Manhattan, rural Pennsylvania and elsewhere, symbols of a resolve to remember and rebuild. But much of the weight of this year’s ceremonies lies in what will largely go unspoken. There’s the anniversary’s role in prompting
Americans to consider how the attacks affected them and the larger world and the continuing struggle to understand 9/11’s place in the lore of the nation. “A lot’s going on in the background,” said Ken Foote, author of “Shadowed Ground: America’s Landscapes of Violence and Tragedy,” examining the role that veneration of sites of death and disaster plays in modern life. “These anniversaries are particularly critical in figuring out what story to tell, in figuring out what this all means. Continued on page 6
Obama urges service, unity Associated Press WASHINGTON - Summoning America to unity and service, President Barack Obama paid tribute to its resilience and the sacrifice of its war dead as the country prepared to mark 10 long years since the horrors of 9/11. In an email to supporters, the president urged others to follow his lead. “With just a small act of service, or a simple act of kind-
ness towards others, you can both honor those we lost and those who serve us still, and help us recapture the spirit of generosity and compassion that followed 9/11,” the president wrote. Earlier, at Arlington, he and his wife held hands with each other and hugged other visitors among rows of white tombstones from the long wars that Obama is winding down after more than 6,000 American troop deaths.
Obama, a little-known state senator in Illinois at the time of the attacks, now has the responsibility to help lead America in remembrance of a trauma 10 years on. On Sunday, the president is scheduled to visit all three sites where hijacked planes struck — New York City, Shanksville, Pennsylvania, and the Pentagon — before delivering evening remarks at a memorial event at the Kennedy Center in Washington.
In his weekly radio and Internet address Saturday, Obama sought a balance between remembering the attacks and the nearly 3,000 people who died, and moving forward. He thanked troops who have served in the post-Sept. 11 wars in Iraq and Afghanistan, and praised the military successes that led to advances against al-Qaida and the killing of the group’s leader, Osama bin Laden. Continued on page 6
2
Monday, September 12, 2011
International
Bali News Denpasar Parking Still a Mess Denpasar (Bali Post) –
The parking ways in Denpasar still is violating some regulations applied such as a number of policies the government applied lately have been an opposite to what they have created and some side road parking tariffs were still inappropriate. This was revealed during a work meeting on parking tariff, vehicles retribution and permits selling oils between House of Representatives Special Committee XI with Head of Transportation Agency, I Gede Astika and colleagues also Head of Permit Agency, A.A. Gede Rai Sory&RPPLWWHHPHPEHU$$6XVUXWD1JXUDK3XWUDLQWKLVRSSRUWXQLW\ stated a number of policies that have been going on have to be reobserved such as forbidden parking at Gajah Mada Street, Thamrin Street and Sulawesi Street which lately have been unclear. As stated DW0D\RU5HJXODWLRQV1R<HDUDERXWJXLGDQFHWR5HJLRQDO 5HJXODWLRQQR<HDURQ3DUNLQJ$SSOLDQFHLQ'HQSDVDUVWLOO stated those road sides can be a side parking space. “Before any parking tariff is applied, these basic law regulations have to be revised so LWLVGHÂżQLWHO\RIÂżFLDO´3XWUDVWDWHG ,0DGH6XNDUPDQDDOVRTXHVWLRQHGWKHWLFNHWVWKDWKDYHEHHQXVHG for parkings lately where it is owned by the Parking Management ZKLFKLVRZQHGE\WKHUHJLRQZKHQDFWXDOO\RQWKH331R<HDU 2001, Regional Owned Enterprises is not allowed to take any retribution and only the government can. “So the parking tickets shouldn’t be the Parking Management but the Denpasar City Government,â€? Sukarmana explained. The worse part of this parking management is stated by A.A. Gede Mahendra who admitted when he was parking on the side and asked IRUWKHWLFNHWWKHSDUNLQJSHUVRQWKRXJKWKLPEHLQJZHLUG,URQLFDOO\ when given so, they gave the one for the owner side not the customer. “This is what really happened,â€? Mahendra exclaimed. 6DGO\WKHUHDUHPDQ\TXHVWLRQVVWLOOXQDQVZHUHGE\WKH7UDQVSRUtation agency remembering the three planned regulations came in TXLFNO\DQG/DZ6HFWLRQDOVR3DUNLQJ0DQDJHPHQWGLGQRWDWWHQG this discussion will be redone when all components involved can come. (kmb12)
Complained, Textile Waste Thrown to River Tabanan (Bali Post) –
The case of unwell waste management appeared again in Tabanan. This time a waste from textile dying factory that was thrown to the river at Banjar Batuaji Kelod, Batuaji Village, Kerambitan, as the river water changed black or red and smelt of chlorine according to a resident last Friday (9/9). This complains did appear when the factory was opened year 2001. At 2002, locals protested where it did resulted something and the wastes were never seen until now. Because of that, locals did not use the waters even livestock don’t want to drink the chlorine smelt waters when actually this river can be used wisely daily. Besides it was clear water, the water usually XVHGIRUULYHUZDWHUÂżVKHV,WLVKRSHGWKHZDVWHZLOOEHPDQDJHGDQG not brought here “Luckily the river is a bit far from the villages yet many have complained,â€? the resident continued. As Bali Post observed, the waste was being contained in a place nearby the river but due to it was holed then the waste went into the ULYHU&RQWUROOHURIWKLVIDFWRU\FDOOHG8',QGUD-D\D1HQJDK7DPD admitted that the factory does bring their waste to the river yet it is sterilised and neutral already also not dangerous as he showed a waste research done by the Bali Province Living Environment which can be used by the locals. (udi)
IBP/Bali Putra
The ceremony held on Goa Lawah, Klungkung. Hundreds of Hindus take part in the cleansing ceremony.
Cleansing Ceremony at Goa Lawah Temple Last Mass Mamukur and Mepandes Ongoing Semarapura (Bali Post) –
As the last batch of mass mamukur and mapandes done by Bali Province Government it was then continued with maajar-ajar or nyegara gunung (cleansing to the shore and sea) at Pura Goa Lawah temple, Pesinggahan, Dawan, Klungkung, last Saturday (10/9). The ceremony went on in the temple’s shores led by priest ,GD 3HGDQGD 6XQX IURP *HULD 7HODEDK 'DXK 3XUL Pemecutan, Denpasar and attended by Vice Governor, $$13XVSD\RJDSXEOLFÂżJXUHVDQGYLOODJHKHDGV The vehicles used to go there packed the whole road DQGFDXVLQJWUDIÂżF$QXPEHURI'DZDQDQG.OXQJNXQJ Police have been prepared to hel out clearing the trafÂżFVZLWKYLOODJHVHFXULWLHVDOVRLQYROYHGQRWOHIW+HDG RI.OXQJNXQJ3ROLFH*$3&7UL:DK\XGLDQG+HDGRI .OXQJNXQJ7UDIÂżF3ROLFH$3&0DGH6XWDUMDQD ,QWKHWHPSOHDOOVHNDKIURPZKROH%DOLZDVOHG to the shore for the cleansing where all prayers came to join from 8 am and ending 11 am. The ceremony was where gunung (mountain) is the lingga (purusa) which is the place of God Shiva and the segara (shore) is the yoni (pradana) where God Baruna stays united and stating the prayers thank you as the ceremony went ZHOO,WZDVVWDWHGWKHFHUHPRQ\RIPDPXNXUKDYHEHHQ happening since 2nd September 2011 starting with QJDQJHWGRQELQJLQWKHQQJDMXPIRUWKUHHGD\V September 2011), mapeapda, metatah and puncak nyekah (7 September 2011) starting with pamelaspas VHNDKPDSXUZDGDNVLQDWKHQQ\HNDK,WZDVFRQWLQXHG with memralina sekah then bring it to segara Matahari Terbit from 8th September 2011. “Today is the last RQHZLWKQ\HJDUDJXQXQJFHUHPRQ\´&HUHPRQ\+HDG &RPPLWWHH,%.DGHN3XWUDH[SODLQHG
According to him, mamukur was important as it is a GKDUPDDSSOLDQFHIRUWKH+LQGXVLQFRPSOHWLQJDFHUemony of their ancestors body where the mountain and VKRUHVPHHWLVWKHGLUHFWLRQRI+LQGX$IWHUDFFHSWHG by the two Gods, in a daksina palinggih form then brought to each houses where again with a ceremony and placed behind sanggah kembulan which ended the mamukur. Meanwhile the ceremony was responded positively by the prayers and hoped that this will again be held to less burden the Balinese and VWUHQJWKHQLQJWKHIDPLO\IHHOLQJ,WZDVVDLGWKH Government, which it was Puspayoga’s initiative, helped the unpaid responsibility done for their ancestors. The Government didn’t burden any payment from the people that joined except for each houses ceremonies including consumption. Ketut Sulatra, he Karangasem origin who lives at Banjar Pesalakan, Tuban, Kuta, Badung admitted KDYHMRLQHGVHNDKIURPKLVELJJDPLO\ZKHUH from it a number of it have been cremated until QJHURUDVVLQFH “We are very pleased we can do this ceremony that was held by the government after years we did not do it yet,� Ketut Sulatra stated. Similar feelings were stated by Wayan Moja’s family from Panjer where three sekah was joined. “We are very thankful especially for Puspayoga. We hope this kind of activities can happen again. Besides less burdening such a huge cost ceremony especially for those disadvantaged, it also strengthens the people’s brotherhood in Bali,� Madame Susi and Tirta stated from the family. (kmb20)
z Founder : K.Nadha, z General Manager :Palgunadi Chief Editor: Diah Dewi Juniarti z Editors: Gugiek Savindra,Alit Susrini, Alit Sumertha, Daniel Fajry, Mawa, Sri Hartini, Suana, Sueca, Sugiartha, Wirya, Yudi Winanto zDenpasar: Dira Arsana, Giriana Saputra, Subagiadnya, Subrata, Suentra, Sumatika, Asmara Putra. Bangli: Pujawan, Buleleng: Adnyana, Gianyar: Agung Dharmada, Karangasem: Budana, Klungkung: Bali Putra Ariawan. Jakarta: Nikson, Hardianto, Ade Irawan. NTB: Agus Talino, Syamsudin Karim, Izzul Khairi, Raka Akriyani. Surabaya: Bambang Wilianto. z Development: Alit Purnata, Mas Ruscitadewi. z 2IÂżFH: Jalan Kepundung 67 A Denpasar 80232. Telephone (0361)225764, )DFVLPLOH: 227418, P.O.Box: 3010 Denpasar 80001. Bali Post Jakarta, Advertizing: Jl.Palmerah Barat 21F. Telp 021-5357602, Facsimile: 0215357605 Jakarta Pusat. NTB: Jalam Bangau No. 15 Cakranegara Telp. (0370) 639543, )DFVLPLOH: (0370) 628257. Publisher: PT Bali Post
Bali News
International
3
Monday, September 12, 2011
Impact of US crisis
US tourists shorten their period of stay in Bali Denpasar (Bali Post)—
IBP/Sumatika
The All-Bali Arti Theater Parade 2011 in the Ksiraarnawa, Art Center, Denpasar. A total of eight theater groups from Denpasar, Tabanan, Buleleng, and Jembrana were ready to act featuring their best works on September 9-19, 2011.
All-Bali Arti Theater Parade 2011
Show off best theater works of regency and city Denpasar (Bali Post)—
Denpasar Art Center in cooperation with the Arti Foundation held the All-Bali Arti Theater Parade 2011 in the Ksiraarnawa Building. A total of eight theater groups from Denpasar, Tabanan, Buleleng, and Jembrana were ready to act featuring their best works on September 9-19, 2011. Eight theater groups ascertained to appear consisted of the Kini Berseri Theater (Denpasar), Bali Experimental Theater (Jembrana), Sastra Welang Theater (Denpasar), Seribu Jendela Theater (Buleleng), Jineng Theater (Tabanan), Lah 24 Theater (Denpasar), Banyuning Art Studio (Buleleng) and Bendrat Theater (Denpasar). Chairman of the Theater Parade Committee, Dewa Gede Palguna, in the midst of the event on Friday (Sep 9) night said the main purpose of the parade was to provide opportunity for the growth of modern theater in Bali as one of the artistic expressions for Balinese people. “The parade is also to encourage the growth of theater arts in Bali, VRWKDWLWFDQĂ€RXULVKDQGKDYHDQ equal position to the traditional arts LQWKHPLGVWRIWKHJHQHUDOSXEOLF´ he said. He added that modern theater was a form of very broad artistic expression. There was hardly a guidance restricting in it. Art Director, player, set stylist, musician,
lighting artist and all modern theater workers had a very wide space to show off their expression on stage. On that account, he said, the modern theater had become a kind of art ‘accommodating’ all forms and types of other arts into a single unit of performance. “The art of vocal, music, acting and dance are coalescing into a single entity in a theatrical performance. Therefore, there is a huge opportunity for theater artists to absorb and process the various forms of Balinese traditional arts into a new show that will enrich the DUWLVWLFWUHDVXUHVRI%DOL´KHVDLG The process, said Palguna, of course had to be pursued continuously. Expectedly, such kind of theater parade could be organized regularly in Bali. This year, there were only 8 theaters from 4 regencies and city getting involved. “We hope this parade can stimulate other theater groups to be more creative and hold performance more frequently so that in years to come all regencies/ city across Bali can participate in
WKHSDUDGH´KHKRSHG Meanwhile, Chairman of Arti Foundation, Kadek Suardana, added that selection of the 8 theater groups was based on the principle of regional representation that met the requirements. Among others, it concerned with the continuity to work indicated by regular exercise schedule and the quality of works produced by each theater group. Âł$OWKRXJKLWLVWKHÂżUVWSHUIRUmance, it does not necessarily mean the committee will hold this theater parade free of charge. We attempt to appreciate them (theater artists) by selling the ticket of the performance. The price is not expensive, RQO\,'5´KHVDLG In the meantime, the Head of Denpasar Art Center, Ketut Mantara Gandi, highly appreciated the implementation of theater parade. “This theater parade is very much in line with the government’s desire to enliven the Art Center with regular art activities. Hopefully, this SDUDGHFRXOGEHKHOGVXVWDLQDEO\´ he said. (par)
The impact of debt crisis of the United States on the Bali tourism begins to be felt by tourism perpetrators in Bali. The US economic slowdown marked by the slump in capital market indices in various countries affects tourists who stay averagely for a week to 3-4 days on the Island of the Gods. “The crisis occurring in the United States will not affect the visit of the US citizens to Bali because holidaying has become their lifestyle. However, they will diminish their expenditure during their stay, includLQJVKRUWHQLQJWKHSHULRGRIVWD\´VDLG&KDLUPDQRI,1&&$%DOL,% Surakusuma, in Denpasar, Friday (Sep 9). According to him, economic instability of the superpower country also affected the Meeting, Incentive, Convention and Exhibition (MICE) activities. Business perpetrators and government agencies that normally organized these activities extravagantly started to carry them out modestly. “Although there are trends in behavioral change of the US tourists GXHWRWKHFULVLVEXW,KDGFRQÂżGHQFHWKHUDWHRIWKHLUYLVLWWR%DOLZLOO UHPDLQVWDEOH´KHVDLGRSWLPLVWLFDOO\ 0HDQZKLOHWKH+HDGRI%DOL*RYHUQPHQW7RXULVP2IÂżFH,%.DGH Subhiksu, estimated the impact of the US economic turmoil would be felt within 3 to 6 months later. However, he was optimistic if the condition would not affect the Bali tourism that had often faced shocks and had been passed through. Âł2I FRXUVH WKH 86 FULVLV KDV LQĂ€XHQFH \HW PDQ\ WRXULVWV ZLWK middle to upper income level will remain not to change their decision to spend holidays as usual. In terms of their visit trend to Bali, it even VKRZVDQLQFUHDVH´KHVDLG He added that tourism posed an activity that was not so vulnerable WRWKHLQĂ€XHQFHRIFULVLVKDXQWLQJWKHZRUOGEXVLQHVVDQGHFRQRP\ but very vulnerable to security and comfort of tourists enjoying their holidays. The United States was a potential market for Bali. Based on market analysis, it was recorded that spending power of the US tourists in Bali reached USD 136.81 to USD163.60 dollars per day. “Among the total of 89.13 percent of the US tourists traveling to Bali, only a few fraction came for the purpose of doing business. Their loyalty to Bali destination was the same as that of Japanese and $XVWUDOLDQWRXULVWV´KHVDLG To attract the US incentive travel market, he considered that Bali entrepreneurs were necessary to make approach to Singapore Airlines and Singapore Tourism Board in the effort to plan a twin-market package containing Singapore and Bali through MICE package. (par)
IBP/Eka
Foreign tourists visited the Ground Zero Monument in Legian, Kuta.
4
News
Monday, September 12, 2011
International
Israel, Egypt try to stem damage from embassy riot Associated Press Writer CAIRO — Israel and Egypt’s leadership tried Saturday to limit the damage in ties after protesters stormed Israel’s embassy in Cairo, trashing offices and prompting the evacuation of nearly the entire staff from Egypt in the worst crisis between the countries since their 1979 peace treaty. The 13-hour rampage deepened Israel’s fears that it is growing increasingly isolated amid the Arab world’s uprisings and, in particular, that Egypt is turning steadily against it after the fall of Hosni Mubarak, the authoritarian leader who was a close ally. In Israelis’ eyes, the scene of cars burning outside the embassy and the tale of six Israeli guards trapped inside for hours in a steeldoored safe room underscored their view that anti-Israeli sentiment in Egypt was running free after decades of being contained by Mubarak’s regime. The ousted leader’s powerful security forces never would have let a protest get near the Nile-side embassy. Egypt’s new military rulers, in turn, appear caught between preserving key ties with Israel
— which bring guarantee them billions in U.S. military aid — and pressure from the Egyptian public. Many Egyptians are demanding an end to what they see as too cozy a relationship under Mubarak, who they feel knuckled under to Israel and the U.S., doing nothing to pressure for concessions to the Palestinians. Egyptian security forces did nothing as hundreds of protesters massed Friday outside the Nileside high rise residential building where the Israeli Embassy is located and tore down a concrete security wall Egyptian authorities erected there only weeks earlier. Many protesters saw the wall as a symbol of the government’s willingness to protect Israelis but not Egyptians, since it was put up to keep back protests after Israeli forces chasing militants accidentally killed five Egyptian soldiers in the Sinai Peninsula. Police and military also did little initially when a group of around 30 protesters after nightfall climbed in a third-story window and raced up to the embassy floors, broke into an office and began throwing Hebrew-language documents to the crowd below.
AP Photo/Ali Sultan
Tanzanian police carry bodies of children from the sea in Zanzibar, Tanzania, Saturday Sept 10, 2011.
Tanzania ship sinks, nearly 200 bodies recovered Associated Press Writer STONE TOWN, Tanzania — Passengers on the aging, crowded boat headed for one of Tanzania’s top tourist destinations said they realized something was wrong when the overnight ferry began to list from side to side.
AP Photo
An elderly man runs past flaming vehicles outside the building housing the Israeli embassy in Cairo, Friday, Sept. 9, 2011.
Then water rushed through and killed the engines, sending the M.V. Spice Islanders upside down and pitching hundreds of people into the deep sea early Saturday morning. A witness counted nearly 200 bodies, and the president of the nearby island of Zanzibar said more than 570 people were rescued, suggesting the boat was overloaded. Some survivors said the
boat’s capacity was about 600. Those lucky enough to find something to cling to floated in the dark waters for at least three hours until the strong currents began to wash them up on the white sandy shores of Zanzibar. As the sun rose, news of the tragedy had already spread throughout the community and thousands of people were on
the beach, desperately hoping their family members would be the next to emerge from the waves. One man — too upset to give his name — screamed over and over again the names of 25 missing family members, including his sisters, wife and grandsons. Throughout the day, police waded through the clear waters to shore, carrying bodies on stretchers, wrapped in brightly colored cloth and blankets. The smallest bundles — the children — they carried in their arms. Tourists on the popular island helped survivors and local charities provided blankets and tea.
Swedish security police arrest 4 terror suspects Associated Press Writer STOCKHOLM — Swedish police arrested four people on suspicion of preparing a terror attack and evacuated an arts center in Sweden’s second largest city on the eve of the 9/11 anniversary, officials said Sunday. The four were arrested in the west coast city of Goteborg and were suspected of plotting terrorism, said Sara Kvarnstrom, spokeswoman for the Swedish security police, SAPO. She declined to give details on the arrests and wouldn’t say whether they were linked to the 10-year anniversary of the Sept. 11 terrorist
attacks in the United States. Kvarnstrom said SAPO saw no reason to raise its terror alert level, which has been at “elevated” since October. “Our assessment is that there is no reason for public concern at the moment,” she told The Associated Press. Police in Goteborg said in a statement they had evacuated an arts center, located beneath Goteborg’s landmark half-mile (933-meter) Alvsborg bridge. They said the Roda Sten arts center was evacuated due to a threat deemed to pose “serious danger for life, health or substantial damage of property.” Goteborg police said they had assisted security police with the ar-
rests, but declined to give any further comments. Kvarnstrom declined to say if the arts center or the bridge were considered as potential targets for a terror attack. Mia Christersdotter Norman, the head of the Roda Sten arts center, said about 400 people were celebrating the opening of an international biennial for contemporary art when police ordered everyone to leave the building. “Around midnight I was called out by the police and they said there was a threat to the building and asked us to quietly stop the party, which we did and everyone left,” Christersdotter Norman told The Associated Press.
AP Photo/Scanpix, Adam Ihse
The Roda Stens art exhibition center is seen under the Alvsborgsbron bridge in Gothenburg, Sweden, Sunday morning, Sept. 11, 2011.
International
Activities
Monday, September 12, 2011
5
Alila Soori illas
Toning & AntiCellulite Body Ritual IBP Slim, trim and breakdown clusters of fat cells in your body naturally with this exceptional therapy. The treatment makes use of active ingredients comprising of lemon, basil and grapefruit essential oils, as well as integrating coffee and chocolate body scrub. The ritual begins with a signature foot bath, continued with the coffee and chocolate body scrub. Toning sequence follow on with a seaweed body wrap, a -15 minute unwind in the steam room to help ‘sweat out’ toxins found in the body and then finish off with a 60-minute drainage massage technique to further break down fat cells and disperse them through the normal body functions.
Temple Ceremony Calendar Event for August 31 through October 5, 2011 31 Aug Buda Umanis Tambir Sari Bankar Titih Temple Kapal 12 Sep Purnama Ketiga Gunung Sari Temple Lombok Pauman Bhujangga Tonja Denpasar Kawitan Arya Gajah Para Tianyar Karangasem Pedarman Arya Telabah Besakih Bukit Mentik Temple Gunung Lebah Batur Kintamani 14 Sep Buda Keliwon Matal Village Temple Sukawati Merajan Agung Batuyang - batubulan Pasek Gelgel Bebetin Temple Sawan - buleleng Maspahit Temple Sesetan - Denpasar Selatan Pasek Bendesa Manik Mas Dukuh Kendran - Tegalalang Panti Pasek Gaduh Temple Sesetan Merajan Pasek Kubayan Wangaya Gede Pedarman Arya Kanuruhan Besakih 24 Sep Tumpek Kandang Puseh Temple Gianyar Luhur Dalem Sagening Kediri - Tabanan Merajan Pasek Gelgel Tegal Gede Badung 27 Sep Tilem Ketiga Ulun Kulkul Temple Ulun Kulkul Besakih 28 Sep Buda Wage Menail Tarukan Temple Cemenggaon Sukawati Mr. Pasek Dangke Bambang - Bangli Penataran Dalem Ketut Pejeng Kaja - Gianyar Puseh Menakaji Temple Peninjoan - Bangli Merajan Agung Temple Blangsinga - Blahbatuh Kawitan Gusti Agung Blangsinga Blahbatuh Gianyar Kawitan Gusti Celuk Kapal Mengwi
4 Ock Anggar Kasih Perangbakat Bukit Buluh Temple Gunaksa - Klungkung Tirta Sudamala Temple Bebalang - Bangli Paibon Pasek Bendesa Sangsit - sawan - Buleleng Pasek Gelgel Temple Pangi Dawan - Klungkung Gunung Tengsong Lombok Dalem Benawah Temple Benawah - Gianyar Dalem Temple Bitra - Gianyar Dalem Temple Banyuning Timur - Buleleng Dalem Pauman Batan Getas Pauman Batan Getas Titih Denpasar Tengah Padang Tegalalang Merajan Pasek Gelgel Desa Sande - Pupuan Tabanan Kawitan Tangkas Kori Agung Desa Adat Pagan Denpasar Hyangaluh/Jenggala Besakih Merajan Pasek Lurah Tutuan Gunaksa Mr. Pasek Gelgel Selulung Merajan Pasek Subrata Medahan Merajan Pasek Munggu Munggu Tengkulak Temple Tulikup - Gianyar Penataran Badung Ogang Sidemen 5 Ock Buda Umanis Perangbakat Puri Agung Dalem Tarukan Pejeng Tampak Siring Rambut Siwi Temple Jembrana Batu Bolong Temple Canggu - Kuta Pasek Marga Klaci Temple Tabanan Agung Pasek Temple Dauh Waru Jembrana Ratu Pasek Temple Sangsit Sawan - Buleleng Pasek Tangkas Darma R. Tabanan Village Temple Banyuning Buleleng Srijon Temple Tabanan Mr. Pasek Gelgel Lebah Pangkung Merajan Pasek Gelgel Patemon Tirta Anom Padang Sigi Sading - Tampak Siring Dadi Agung Pasek Bendesa Dukuh Manuaba Tegalalang Pedarmaan Batursari Ngilis Jegu Penebel Tabanan Puncak Mundi Nusa Penida
Balinese Temple Ceremony EVERY Temple and Shrine has a special date for it annual Ceremony, or “ Odalan “, every 210 days according to Balinese calendar, including the smaller ancestral shrine which each family possesses. Because of this practically every few days a ceremony of festival of some kind takes place in some Village in Bali. There are also times when the entire island celebrated the same Holiday, such as at Galungan, Kuningan, Nyepi day, Saraswati day, Tumpek Landep day, Pagerwesi day, Tumpek Wayang day etc. The dedication or inauguration day of a Temple is considered its birth day and celebration always takes place on the same day if the wuku or 210 day calendar is used. When new moon is used then the celebration always happens on new moon or full moon. The day of course can differ the religious celebration of a temple lasts at least one full day with some temple celebrating for three days while the celebration of Besakih temple, the Mother Temple, is never less than 7 days and most of the time it lasts for 11 days, depending on the importance of the occasion. The celebration is very colorful. The shrine are dressed with pieces of cloths and sometimes with brocade, sailings, decorations of carved wood and sometimes painted with gold and Chinese coins, very beautifully arranged, are hung in the four corners of the shrine. In front of shrine are placed red, white or black umbrellas depending which Gods are worshipped in the shrines. In front of important shrine one sees, besides these umbrellas soars, tridents and other weapons, the “umbulumbul”, long flags, all these are prerogatives or attributes of Holiness. In front of the Temple gate put up “Penjor”, long bamboo poles, decorated beautifully ornaments of young coconut leaves, rice and other products of the land. Most beautiful to see are the girls in their colorful attire, carrying offerings, arrangements of all kinds fruits and colored cakes, to the Temple. Every visitor admires the grace with which the carry their load on their heads.
News 10th Anniversary 9/11 All Around the World
6
Monday, September 12, 2011
A changed... From page 1 ,WIRUFHVSHRSOHWRILJXUHRXWZKDW happened to us.â€? On Saturday in rural western 3HQQV\OYDQLDPRUHWKDQSHRple began to tell the story again. The Pennsylvania memorial park is years from completion. But the dedication and a service to mark the WK DQQLYHUVDU\ RI WKH DWWDFNV DUH critical milestones, said Sally Ware, one of the volunteer “ambassadorsâ€? who has worked as a guide at the site since the disaster. Ware, whose home was rocked ZKHQWKHMHWFUDVKHGWZRPLOHVDZD\ recalled how hundreds of people flocked to the site in the days afterward to leave their own mementos and memorials. She began volunteering after finding one along the roadside — a red rose placed atop a flight attendant’s uniform. Âł,W UHDOO\ ERWKHUHG PH , WKRXJKW someone has to take care of this,â€? said Ware, whose daughter is a flight attendant. Now, a decade later, she said the memorial may do little to ease the grief of the families of those who died in the crash.
But the weekend’s ceremonies recall a story with far broader reach. The ceremonies honor those who “fought the first battle against terrorism — and they won,â€? Ware said. Âł,WÂśVVRPHWKLQJ,GRQÂśWZDQWWRPLVV ,WÂśVEHFRPHDSDUWRIP\OLIH´ On Sunday, the focus turns to cerHPRQLHVDWWKH3HQWDJRQMXVWRXWVLGH Washington, D.C., and in lower Manhattan for the dedication of the national 6HSW PHPRULDO 3UHVLGHQW %DUDFN Obama planned to attend events at the sites and was to speak at a Sunday evening service at the Kennedy Center. The New York ceremony begins at DP ZLWK D PRPHQW RI VLOHQFH PLQXWHV ODWHU ² FRLQFLGLQJ ZLWK WKH H[DFW WLPH ZKHQ WKH ILUVW WRZHU of the trade center was struck by a KLMDFNHGMHW And then, one by one, the reading RI WKH QDPHV RI WKH NLOOHG RQ 6HSW²LQ1HZ<RUNDWWKH3HQtagon and in rural Pennsylvania. 7KH\ LQFOXGH WKH QDPHV RI RI Lt. Patrick Lim’s fellow officers from the police department of the Port Authority of New York and New Jersey.
Obama... From page 1
Commemoration of 10th anniversary 9/11 were held all around the world. The photos show commemoration at Berlin, Australia, Phillipines, Bosnia, and French.
Âł$GHFDGHDIWHU LWÂśVFOHDUIRUDOO the world to see the terrorists who attacked us that September morning are no match for the character of our people, the resilience of our nation, or the endurance of our values, the president said. “They wanted to terrorize us, but, as Americans, we refuse to live in
fear. es we face a determined foe, and make no mistake they will keep trying to hit us again. But as we are showing again this weekend, we remain vigilant. We’re doing everything in our power to protect our people. And no matter what comes our way, as a resilient nation, we will carry on.
International
Indonesia Today
Monday, September 12, 2011
7
Military rescue helicopter missing in Indonesia Agence France-Presse A rescue helicopter was feared to have gone down in Indonesia’s remote province of Papua during a mission to find two foreign pilots whose plane crashed, according to the military. AFP PHOTO / Bay ISMOYO
The owner of Susiair, Susi Pudjiastuti (L), mourns after the crash of one her jets with two pilots aboard, as she speaks to her company’s former chief pilot (name available) in Pangandaran, West Java, on September 10, 2011. A Susi Air Cessna Grand Caravan aircraft with one Australian and one Slovak pilot on board crashed in the country’s remote Papua region, a company spokesman said, with both men feared dead.
The military chopper searching for the Australian and Slovakian pilots from the crashed Susi Air aircraft lost contact on Saturday, said Mimika military district commander Christian Tuhuteru. “There is a chance they have
RI to forge defense cooperation with European Antara JAKARTA - Indonesia will step up its defense cooperation with three European countries, namely Germany, France and Spain, Deputy Defense Minister Sjafrie Sjamsoeddin said here Saturday. Indonesia had so far already been cooperating in the defense field with the three counties but only on an irregular and informal basis, he said. Defense cooperation with the three European countries would be put on a more formal footing and intensified, including in the defense industry field, he said. “With Germany and Spain, talks have already reached an
advanced stage where memorandums of understanding are being prepared for signing by the respective defense ministers in the near future,” he said. Talks with France had already resulted in an initial draft cooperation agreement that still needed to be discussed and improved, Sjafruddin added. After the formal agreements had been signed, defense cooperation with the three European countries would be intensified and expanded. As part of the process to forge the closer defense cooperation with the three European countries, Sjafrie said, he would be making a one-week tour in Eu-
rope starting on September 11. He would make working visits to Berlin and Stuttgart (Germany), Madrid (Spain) as well as Paris and Marseille (France) during the one-week period. “Needless to say that the defense cooperation agreements with those countries will be based on the principles of mutual respect, appreciation and benefit, and made to serve the national interest,” Sjafrie said. Indonesia would also seek cooperation in the defense industry field with the three European countries as part of its efforts to develop its own defense industry and spur national economic growth, Sjafrie said.
landed somewhere for an emergency,” Tuhuteru said of the missing Bell helicopter, which had five people on board. Susi Air’s small Cessna Grand Caravan aircraft crashed in Papua’s Yahukimo district shortly
after taking off from Wamena on Friday. It was carrying fuel and food to a remote area. Susi Air said they had spotted the wreckage and the pilots would have had little chance of surviving. The sprawling Indonesian archipelago relies heavily on air transport and has a poor aviation safety record. Turbulent weather conditions in Papua have caused several accidents in recent years.
Malaysia ‘complains to Indonesia over haze’ Agence France-Presse Malaysia has complained to Indonesia about land-clearing fires in the neighbouring country that have led to a blanket of pollution and poor air quality. Environment Minister Douglas Uggah Embas sent a letter to his Indonesian counterpart Friday about hundreds of suspected fires on Sumatra island, national news agency Bernama reported. Indonesia’s government has outlawed land-clearing by fire but weak law enforcement means the ban is largely ignored, and pollution regularly blankets the region. Air quality on Friday dropped to a level deemed “unhealthy” in one area of Negeri Sembilan state, south of the capital Kuala Lumpur. Though conditions improved on Saturday, some
60 percent of the country recorded “moderate” pollution. Uggah Embas said Indonesia had improved efforts to tackle the problem since 2005 when parts of one Malaysian state experienced pollution at highly dangerous levels. He is expected to meet his counterpart, Gusti Muhammad Hatta, at an Association of Southeast Asian Nations (ASEAN) gathering in Bangkok on September 18. And he said Malaysia would push for the setting up of a regional fire fighting squad to tackle haze-related fires in ASEAN member countries. “We will push for this unit because we need quick deployment should any member country require such assistance,” he was quoted as saying. His aides could not immediately comment on the Bernama report.
Indonesia to require exporters to return earnings Agence France-Presse JAKARTA - Indonesia’s central bank will require exporters to bring home overseas funds, in a move aimed at boosting governance and reducing exposure to short-term capital flows, according to a spokesman. Bank Indonesia spokesman Difi Johansyah said the new regulation, expected to be launched this month, would require companies to repatriate foreign currency earned on exports. The move, he said, has the potential to bring $31.5 billion of forex earnings to the country. “The purpose is to strengthen our domestic forex market’s base,” Johansyah told AFP. “We can improve governance as we’ll be able to match fund data with the flow of goods.” Exporters currently face no restrictions on funds parked overseas. Several emerging nations, including Indonesia, are concerned at a growing amount of foreign capital flowing into their economies as investors seek better returns on their investments from higher interest rates compared with the West. Indonesia, Southeast Asia’s largest economy, grew close to 6.5 percent from a year earlier in both the first and second quarters this year after expanding 6.1 percent in 2010.
AFP PHOTO / ROMEO GACAD
Construction workers build a new elevated road to ease serious traffic problems in Jakarta on September 9, 2011. Indonesia on September 8, 2011 held its interest rate steady at 6.75 percent, with the central bank still wary of the effect of inflation. Bank Indonesia said the rate was being held in an effort to keep the economy stable amid increasing uncertainty in the world’s economic system.
8
International
Monday, September 12, 2011
Bali Today Maritime and Fishery Agency maps out salt potential of Bali Bali Post DENPASAR - Bali Maritime and Fishery Agency (DKP) will map out the salt potential of the region. This measure is in response to the target of government through the ministry RIPDULWLPHDQG¿VKHU\DIIDLUVWKDWKDVGHFODUHGVHOIVXI¿FLHQW in salt by 2015. “Although Bali is unnecessary to have too many production centers, but we are still exploring the existing potential such as the center of traditional salt farming in Buleleng, Karangasem, Gianyar and Tabanan,” said the Division Head of Management of Maritime and Fishery Resources, Saleh Purwanto, in Denpasar, Saturday (Sep 10). According to him, various efforts had been undertaken by government to increase the salt production. Among others, it had been implemented through the traditional salt farming program. This year, Bali had developed a plan to enhance and empower the sector of traditional salt farming, especially on the coastal areas in Bali. “The potential of salt land in Bali lies in four regencies such as Karangasem Regency on the area of 50.55 hectares, Buleleng (110 ha), Tabanan (2 ha) and Gianyar (0.30 ha). These regions will be made the center of salt industry in Bali,”
he explained. He further said that his party had asked the regency/municipality government to perform data collection on the potential of existing land and make coordination with landowners, so as not to result in problems later on. Related to partnerships with other parties, the salt farmers in Bali remained to face capital problem in access to bank or other financial institutions. Additionally, they had no partnership and still got in touch with collectors only. “Commercial flows of salt trade system are generally from farmers to collectors. Yet, there is also from farmers to middlemen and then to collectors. In the traditional salt farming, people experience difficulties in the form of production activity, limited storage, uncertain price as well as venture capital,” he explained. Potential of salt in Bali was still cultivated by local communities through small scale and traditional production. On that
FOTO ANTARA/M Risyal Hidayat
Bali Maritime and Fishery Agency (DKP) will map out the salt potential of the region. This measure is in response to the target of government through the ministry of maritime and fishery affairs that has declared self-sufficient in salt by 2015. account, to increase the production it required a training to enhance the capacity, financing of facilities and infrastructure as well as financing of human resources and institutional capacity. “Hopefully, with the good intention of central government, the land area of salt industry could be developed and managed properly,” he said. He added that market in Bali
still lacked of salt supply and it was brought in from Madura. As a matter of fact, by maximizing the existing potential the local market needs could be fulfilled. Meanwhile, the Empowerment Program of Traditional Salt Farming (PUGAR) 2011 by the Ministry of Maritime and Fishery Affairs on a land area of 4,365 hectares was expected to
generate as much as 349,200 tons of salt. This year, Ministry of Maritime Affairs allocated the fund of PUGAR worth IDR 96 billion for 70,000-100,000 salt farmer groups all over Indonesia. The PUGAR program was extended to West Java, Central Java, East Java, Bali, East Nusa Tenggara, West Nusa Tenggara and Sulawesi, where they totally consisted of 40 regen ies and cities. (par)
Supreme Courts Should Have Respect JC’s Decision Antara
DENPASAR - A constitutional law professor has expressed concern over the recent decision of the Supreme Court to reject the Judicial Commission’s (KY) recommendation to suspend judges for violating the judicial ethics code. “State officials and institutions must respect each other and implement whatever decision one official or one institution has made, whether they like it or not,” Jimly Ashidiqqie from state University of Indonesia said after speaking at a seminar here on Saturday. Three judges had been consid-
ered violating the code of ethics by neglecting evidence while trying former anti-graft chief Antasari Azhar. Antasari was sentenced to 18 years in connection with a murder case after the MA rejected his appeal. He is now seeking a judicial review. Due to that the Judicial Commission had asked the Supreme Court to suspend the judges from duty but the MA had refused to do it. Jimly Ashidiqqie who is also the former chief of the Constitutional Court said MA’s stand to reject KY’s recommendation was not wise. “KY is a constitutional institu-
tion and its existence is regulated LQWKHFRQVWLWXWLRQ,WLVDQRI¿FLDO state institution,” he said. He said once MA refused to honor the decision of other institutions it could not expect other institutions to also respect its decision. “This can be a bad precedent for the tradition of statehood in the future. This is an institutional affair, not a personal one. MA’s future decisions may be ignored (because of its stance),” he said. He said the KY’s decision actually could be used by MA as an entry point to correct what had been decided before. MA’s current stand would be counter-productive, he said.
“MA has rejected KY’s decision which it considered as an intervention into the substance of a case. This is a mere perception of MA towards KY’s decision-making process while that is not the actual fact. KY only saw the process of ruling not the substance when making the decision,” he said. Jumly said the view difference between the two sides could create DQ LQWHUVWDWH LQVWLWXWLRQ FRQÀLFW which could be used as an example of an inter-state problem that could be brought to the Constitutional Court for settlement. “Although under the law on constitutional court MA could not become a party in a dispute over
authority of state institutions,” he said. The law states that for fear MA would be used by people who are QRWVDWLV¿HGZLWKLWVGHFLVLRQWRFDOO for its review. “But if the Constitutional Court is willing to handle the case moreover after it has produced a regulation on procedures for a dispute among state institutions it is not impossible for the case to be handled by Constitutional Court,” he said. The prohibition for MA to be put as a party in a dispute is limited only to its rulings or the case substance. “Others are not prohibited such as about cost of a case and case making,” he said.
International
Monday, September 12, 2011
Balinese Culture
Ancient Villages in Buleleng BULELENG Regency possesses many ancient villages in a row on the highlands along the Tejakula and Banjar Subdistrict. In Banjar Subdistrict sits quite a few villages like the Sidatapa, Pedawa, Cempaga, Tigawasa and Banyusri. Meanwhile, in Tejakula Subdistrict stand uniquely the village of Sembiran, Julah and other villages having close relationship to ancient villages in Bangli Regency. As villages retaining hisWRULFDOYDOXHVWKH\GH¿QLWHO\KDYH many distinctive cultural traditions which should be maintained, not merely for the sake of tourism, but more as an asset to trace back the pastime history. As tourist destination, those ancient villages apparently have not been managed optimally. It can be seen from the lack of attention extended by local government to preserve the tourism potential, whereas if these objects are managed accordingly they are surely able to boost the tourism development in Northern Bali. Moreover, many foreign tourists are now looking for the attraction of ancient villages. One of the evidences showing the lack of government’s attention to preserve the ancient villages is the absence of facilities indicating the direction to those villages. Although there are promotional tools of the objects such as signboard
pointing out the location of the ancient village, they are left damaged even for years. This condition happens to the signboard pointing out the village of Sidatapa, Cempaga, Tigawasa and Pedawa in Banjar Subdistrict. A wooden signboard whose paint has been obsolete even almost collapses as the pole has decayed. Not only that, the signboard is very difÂżFXOWWRVHHDVKLQGHUHGE\DJDWH building on the Singaraja-Seririt road section, precisely at Temukus Village, Banjar Subdistrict. “Many foreign guests often ask direction to location of Cempaga, Sidatapa, Pedawa, and Tigawasa Village. Actually, there has been a signboard but is invisible. So, they choose to ask for information to the local,â€? said one of the residents. In the meantime, Chief of Pedawa Village, Putu Sudarmaja, ZKR LV DOVR D SURPLQHQW ÂżJXUH of the village, was now very intensively arranging the Pedawa Village. One of the measures undertaken was preserving the ancient house with historical values. If only relying on the natural scenery of course Pedawa Village ZRXOGQRWKDYHDVSHFLÂżFYDOXH “We even highlight the historical value,â€? he said. According to Sudarmaja, the existing obstacle for tourism development was the matter of
road infrastructure. He added the road access to Pedawa Village, Tigawasa Village and other ancient villages was in damaged condition. At Pedawa, the village road had even been repaired but damaged again. “Most constraints of tourism development lie in the infrastructure such as the roads that are easily damaged,� he said. Meanwhile, the Head of Buleleng Culture and Tourism Agency, Putu Tastra Wijaya, did not dismiss if the management of the ancient village tourist destination in Buleleng had not been maximal. Tastra said that Buleleng was indeed known to have numerous ancient village attractions. They were located in Banjar Subdistrict including the Sidatapa, Cempaga, Tigawasa and Pedawa Village or often called SCTP. In addition, the other ancient villages could also be found in Tejakula Subdistrict such as Sembiran and Julah Village. Unfortunately, the potential of those ancient villages was now leaving a name only. Meanwhile, in reality a lot of houses belonging to local residents had been refurbished and converted into a modern house. This situation was unable to be dammed by government because community as the homeowners had the authority to renovate it and could not be intervened. (BTN/kmb)
Cooked Vegetables with Grated Coconut (Urap) Ingredients * 8 oz fresh green beans * 8 oz bean sprouts * 4 carrots * 1 can bamboo shoots * ½ small cabbage * 1 cup fresh grated coconut * 1 small onion, ďŹ nely chopped * ½ tsp. chilli sauce (sambal ulek) * 1 tsp. salt * 2 Tbs. lime juice * ½ tsp. dried shrimp paste (terasi) Directions Wash bean sprouts, pinching of any brown tail. Pour boiling water over bean sprouts, then rinse under cold water tap. Drain well. String beans and cut diagonally or bite-size lengths and cook in lightly salted water until just tender. Beans should still be crisp to bite. Scrub carrot and cut into thin strips, cook until tender. Drain well. Slice cabbage, discard the center stem. Blanch in boiling salted water for a minute or two, until tender but not limp. Drain and refresh with cold water. Cut bamboo shoots into strips the same size as the beans. Place fresh grated coconut into a bowl, add onion, chili sauce, salt, lime juice and the shrimp paste which has been grilled for a few minutes, or heated in a dry frying pan. Mix thoroughly together. Sprinkle this grated coconut mixture over vegetables, reserving some to garnish the dish when served. Put vegetables in a steamer and steam for 5-8 minutes. Put the steamed vegetables to a serving dish/platter and sprinkle with reserved grated coconut mixture. Use as an accompaniment to a meal, or as a salad by itself. (http://asiarecipe.com)
Biu Batu: Fruit Delicacy in Coconut Milk To Balinese people, biu batu or seedy banana is no more bizarre fruit. Actually, it is a versatile plant where ranging from its corm, false stem, leaf, blossom and fruit are often used. Though sweet, its ripe fruit is less delicious because of many seeds. However, it may be enjoyed by making it into a drink mixed with palm sugar and tamarind paste. Meanwhile, its young fruit is used for the mixture of tum (steamed chopped meat with complete spices) and lawar (chopped meat mixed with boiled vegetables served with complete spices). Here, the young seedy banana is enjoyed as vegetable in coconut milk. Ingredients: 6 pcs young seedy banana and 2 cup of coconut milk Spices: 4 cloves shallot, 2 cloves garlic, 2 small chilies, 1 red large chili, 1 slice turmeric, 1 slice kencur, ½ tsp coriander, 1tbsp cooking oil and ½ tsp salt, while MSG is optional. Others: 1 pc salam leaf, 1 tbsp of sliced large chili Method: Slice thinly the seedy banana, cleanse and drain. Then, boil until cooked and take out. Again, cleanse to remove its sap and drain. Ultimately, press as good as possible so it nearly contain no water. Grind all spices and stir-fry on the frying pan until fragrant. Put the coconut milk, ingredient, sliced large chili and salam leaf. Stir for a while and let them boil. Take out and it is now ready to serve. (BTN/punia) C.045 ibp
9
10
Monday, September 12 , 2011
Destinations
International
Kehen Temple IBP Kehen Temple is a beautiful Hindu temple located in foothills, south part of Bangli Regency and it is about 45 Km from Denpasar town. Inside of this temple are, there is Panyimpenan Temple building keep 3 inscriptions which is relating to its contents and temple existence. It is strategically located in the high land, so we can see the beautiful view. It is a famous temple in Bali and many visitors from foreign country has visited it. The existence of the inscription at Kehen Temple can be explained as follows: * Kehen Temple Inscription ‘A’ is mentioning the existence of 3 sanctums those are Hyang Api, Hyang Tanda, and Hyang Karimama * Kehen Temple Inscription ‘B’ from 11 century is mentioning the empire functionary that is the Senapati Kuturan pu Kandara and it elaborate with the anathema words in oath * The Inscription from 13 century (year 1204 M) is mentioning Hyang Kehen and Hyang Wukir. At the moment Hyang Kehen is equal to Kehen Temple and Hyang Wukir is Puncak Bukit Bangli Temple. * It is one of Monarchic Temple, The tem-
ple under the aegis of king while ceremony execution and construction is delivered to local countryside custom * As a sanctum which is used as a altar (oath) for empire functionary who disloyal to his obligation will incur the Sapata or very horrible anathema. The function of Kehen Temple as sanctum in execution of oath ceremony is supported by the existence of a circumlocutory canister by 4 dragon tails which is called canister Sarpantaka. Nowadays, the canister is placed in a building in form of Gedong * Worshiping supremacy Siwa God in the form of Eka Dasa Rudra utilizes to request the godsend to the good human life and universe for blessing of fertile life, secure, prosperous and peaceful. The structure of Kehen Temple yard is arranged to have a terrace and it shows the existence of tradition megalithic which is continued as a symbol from the existence of mount that is one of the fertility sources. The temple festival can be divided into 2 types those are Piodalan Ceremony which is executed every 6 month, that is on Wednesday Keliwon Sinta (Balinese Calendar) and Ngusaba Ceremony which is executed every 5 years.
Monday, September 12, 2011
11
BUSINESS Papandreou says to save Greece, stay in euro Reuters
AFP PHOTO / LIU JIN
Pedestrians wait for the trafďŹ c lights in front of a billboard promoting a new real estate project along a street in Beijing on September 11, 2011.
Commodity imports shows China economy resilient Reuters
SHANGHAI - China’s key commodity imports, including crude oil, copper and iron ore, all climbed in August from the previous month, adding to evidence that demand in world’s secondlargest economy was still going strong despite the economic turmoil in the West.
The wave of buying of oil and industrial commodities suggests that Chinese companies remain FRQÂżGHQWDERXWWKHGRPHVWLFHFRQomy and that they would likely see any price corrections as a rare restocking opportunity -- a move which should offer strong support to commodity prices. :LWK &KLQDÂśV LQĂ€DWLRQ KDYLQJ pulled back in August from a threeyear high, market watchers also H[SHFWWKHFHQWUDOEDQNWRKROGRII further tightening measures, which could in turn ease the credit crunch and potentially draw producers and traders to import more raw materials. &KLQD LPSRUWHG PLOOLRQ WRQVRIFUXGHRLOLQ$XJXVWXS SHUFHQW IURP WKH PLOOLRQ LQ the previous month, according to Reuters calculations using the revised July numbers. Although implied oil demand in August slipped to the lowest rate this year, plant maintenance and
accidents were the main reasons behind the dip and traders generally H[SHFW GHPDQG WR LPSURYH IURP September. “August-arrival crude cargoes were mostly loaded in June and -XO\ ZKHQ RLO SULFHV Ă€XFWXDWHG D lot,â€? said a crude oil trader. Data from the General Administration of Customs also showed China’s iron ore imports in August MXPSHGSHUFHQWIURPD\HDUDJR WRDÂżYHPRQWKKLJKRI PLOlion tons, thanks to the steel sector’s robust production. However, analysts have cautioned that steel output could decelerate in the coming months amid a seasonal demand slowdown. 'HVSLWH VORZLQJ H[SRUW JURZWK due to the economic malaise in the 8QLWHG6WDWHVDQG(XURSH&KLQDÂśV economy has continued to grow at DQHQYLDEOHFOLSRIRYHU SHUFHQW thanks in part to the government’s FRQVWUXFWLRQ RI RYHU PLOOLRQ houses as well as feverish invest-
ments in the less-developed mid and western provinces. These two factors have led Chinese mills to churn out near record amount of steel, cement plants to ramp up production and PHWDOVPHOWHUVWRH[SDQGFDSDFLW\ -- bolstering the country’s voracious appetite for a raft of commodities. Soybean was the only laggard RI DOO FRPPRGLWLHV IDOOLQJ percent from the previous month WR PLOOLRQ WRQV DV KLJK SULFHV overseas led crushers to turn to domestic supplies. Amid the economic doom and JORRPLQWKHHXUR]RQHDQG8QLWHG States, investors have wondered if China, one of the top buyers, would be able to avoid a hard landing. However, a series of economic data released over the past few months has suggested that domestic demand was holding up relatively well, although overall economic growth has eased.
THESSALONIKI - Greek Prime Minister George Papandreou said on Saturday he would do whatever it takes to rescue his country from bankruptcy and stay in the euro zone, as doubts in Europe grew over its membership in the bloc. Sending a message to international lenders increasingly frustrated with GHOD\VLQUHIRUPVDQGPLVVHGÂżVFDOWDUJHWV3DSDQGUHRXVDLGKLVJRYHUQPHQWZDVGHWHUPLQHGWRWDNHWKHGLIÂżFXOWGHFLVLRQVDQGPDNHWKHVDFULÂżFHV needed. Âł:HGHFLGHGWRÂżJKWWKHEDWWOHWRDYRLGDGLVDVWHUIRUWKHFRXQWU\DQGLWV people and to stay in the euro,â€? he said in his annual economic speech at a trade fair in the northern city of Thessaloniki. “Any delay and wavering is dangerous for the country.â€? $QJHUDWWKHFRXQWU\ÂśVIDLOXUHWRPHHWÂżVFDOWDUJHWVXQGHULWV(8,0) bailout has reached boiling point, prompting senior euro zone policymakers to cast doubt on its ability to avoid default or even its membership in the single currency. The embattled premier, who was heckled by angry labor unions on )ULGD\VDLGKHZRXOGUHGRXEOHHIIRUWVWRÂżJKWHQGHPLFWD[HYDVLRQDPDLQ KXUGOHLQDFKLHYLQJÂżVFDOWDUJHWV +LV)LQDQFH0LQLVWHU(YDQJHORV9HQL]HORVVDLGHDUOLHU*UHHFHPD\HYHQ WDNHDGGLWLRQDOÂżVFDOPHDVXUHVLQWRPDNHXSIRUEXGJHWGHÂżFLWVOLSSDJH WKDWWKUHDWHQVWKHGLVEXUVHPHQWRIDQELOOLRQHXUR(8,0)ORDQWUDQFKH 9HQL]HORVSOHGJHGWRIXUWKHUFXWWKHFLYLOVHUYLFHSD\UROOSXVKSULYDWL]Dtions and deepen labor market reforms. &LYLOVHUYDQWVZKRKDYHVHHQDERXWDÂżIWKRIWKHLUZDJHVVODVKHGZLOO suffer more after the government decided to put thousands of them in a soFDOOHGÂł/DERU5HVHUYH´LQZKLFKWKH\ZLOOGUDZSHUFHQWRIWKHLUVDODU\ DQGSRVVLEO\IDFHGLVPLVVDOLIWKH\ÂżQGQRRWKHUSXEOLFVHFWRUMREZLWKLQD year. But austerity measures are throwing the economy into an ever deeper UHFHVVLRQ*'3ZLOOVKULQNE\PRUHWKDQSHUFHQWWKLV\HDU9HQL]HORVVDLG WRSSLQJHDUOLHUSURMHFWLRQVLQLWVWKLUGVWUDLJKW\HDURIFRQWUDFWLRQ 0RUHWKDQSURWHVWHUVJDWKHUHGLQWKHQRUWKHUQFLW\WRPDUN3DSDQGUHRXÂśVVSHHFK3ROLFHÂżUHGWHDUJDVDW\RXWKVVPDVKLQJVKRSZLQGRZV DQGVHWWLQJÂżUHVRQWKHPDLQVKRSSLQJVWUHHWV3ROLFHVDLGSHRSOHZHUH detained 'HPRQVWUDWLRQVZHUHRUJDQL]HGE\FLYLOVHUYDQWVVWXGHQWVWD[LGULYHUV and even football fans. Some restaurants in the city shut down to protest a 9$7KLNHWKDWWRRNHIIHFWHDUOLHUWKLVPRQWK:KLOHYRZLQJWRNHHSLWVVLGH RIWKHEDUJDLQWKH*UHHNJRYHUQPHQWVKDUSO\FULWLFL]HGLWV(8SDUWQHUVIRU GHOD\LQJUDWLÂżFDWLRQRIDVHFRQG ELOOLRQHXUREDLORXWIRUWKHFRXQWU\ DJUHHGE\HXUR]RQHOHDGHUVRQ-XO\ “Europe must rise to the challenge and move toward implementing the -XO\GHFLVLRQVWRSXWDQHQGWRWKH6LV\SKHDQRUGHDOWKH*UHHNSHRSOHLV going through,â€? said Development Minister Mihalis Chrysohoidis.
AFP PHOTO/ SAKIS MITROLIDIS
Demonstrators clash with riot police during a protest in Thessaloniki, northern Greece on September 10, 2011. Clashes broke out between police and demonstrators today as thousands took to the streets of Greece’s second city of Thessaloniki in a mass protest against austerity measures.
12
Entertainment
Monday, September 12, 2011
International
Charlie Sheen smiles through Comedy Central roast Associated Press Writer CULVER CITY, Calif. — Charlie Sheen smiled through a Comedy Central roast as Mike Tyson, William Shatner, actress Kate Walsh and half a dozen comedians riffed on his high-profile year. Sheen was famously fired from his sitcom “Two and a Half Men” in March after a very public meltdown during which he claimed to be a “rock star from Mars” who has “tiger blood” and “Adonis DNA.”
AP Photo/Dan Krauss
Charlie Sheen is seen with Slash at the “Comedy Central Roast of Charlie Sheen” on Saturday, Sept. 10, 2011 in Culver City, Calif.
The 46-year-old actor is the subject of the latest roast, which was taped Saturday night at Sony Studios and will air Sept. 19 on Comedy Central. Sheen took the stage in true rock-star fashion, as rock ‘n’ roll guitarist Slash heralded his introduction. The actor, dressed in a black suit, white shirt and red tie, smiled and laughed as roasters jabbed at his famous family, his notorious taste for drugs and prostitutes and his primetime firing. “Charlie’s meltdown was so bad, Al Gore’s making a documentary about it,” quipped comedian Jeffrey Ross, who was dressed as Muam-
mar Gaddafi in a military outfit with fringed epaulets and a sash. “The only time your kids get to see you is in re-runs,” Ross said. Comedian Jon Lovitz also took a timely swipe at Sheen: “How much (cocaine) can Charlie Sheen do?” he asked. “Enough to kill two and a half men.” Priceline pitchman Shatner reminded Sheen to “book your next rehab stay through Priceline.com.” Walsh, who is best known for her roles on “Grey’s Anatomy” and “Private Practice,” gave standup a shot at the roast. “It’s amazing, despite all those years of abusing your lungs,
Sokurov’s ‘Faust’ wins top Golden Lion at Venice Associated Press Writer VENICE, Italy — Russian director Aleksander Sokurov’s “Faust,” a new take on the German legend about the quest for knowledge at all cost, won the Golden Lion prize at the Venice Film Festival on Saturday. “Faust” tells the tale of a professor, played by Johannes Zeiler, who craves knowledge and sells his soul for the love of Margarete, played by Isolda Dychauk. The Mephistopheles character is played by Anton Adasinskiy. Dense and difficult to watch, “Faust” was nevertheless one of the critics’ top choices among the 23 in-competition films at Venice this year. It marks the final chapter in Sokurov’s four-film look at the relationship between man and power that began with “Moloch” in 1999 about Hitler, “Taurus” a year later about Lenin and the 2005 film “The Sun” about Japanese Emperor Hirohito. At a post-award news conference, Sokurov made an impassioned plea for governments to continue supporting culture with state funds. “Culture is not a luxury! It is the basis for the development of the society,” he said, adding that he had even raised the issue with Russian Prime Minister AP Photo/Andrew Medichini Director Aleksandr Sokurov holds the Golden Vladimir Putin in a phone call just Lion for best film for Faust, during the award after he won. “And so I am making an appeal ceremony of the 68th edition of the Venice Film Festival in Venice, Italy, Saturday, Sept. 10, 2011. to the Italian minister of culture:
Thank you for existing! Insist with all methods you have on keeping culture.” Sokurov said working with the German cast was one of the most impressive experiences he has had in years, even if he still wonders whether a German director would have been better suited for the task. “German culture is a fundamental one in Europe,” he said. Venice’s best actor award went to Michael Fassbender for his portrayal as a sex addict in Steve McQueen’s “Shame,” while the best actress award went to Deanie Ip, who plays an aging domestic servant opposite her master in Hong Kong director Ann Hui’s “A Simple Life.” “I can’t believe how young and beautiful and sexy this woman is!” jury chair Darren Aronofsky gushed of Ip after the awards ceremony. He said the jury, which included David Byrne and Andre Techine, was moved by the message of Hui’s film. “It’s an issue we deal with in every part of the world and ... to see a journey from health to death with such generosity was very touching,” he said of “A Simple Life.” Ip, for her part, said the film made her realize that she wasn’t getting any younger. “I don’t want to be a burden to anybody, and I really don’t want to go to a senior home, so I will start planning when I go back to Hong Kong,” she said.
your kidneys and your liver, the only thing you’ve had removed is your kids,” she said to Sheen. The most bizarre performer was Tyson, who got plenty of laughs despite his almost unintelligible delivery. “I’m the greatest poet alive,” he said as he concluded his time on stage. “I will eat your children!” Comedian Amy Schumer joked, “Is his interpreter here?” Steve-O of “Jackass” fame was also among the roasters. His big trick was running repeatedly into Tyson’s fist, which he did until he reportedly broke his nose. The comics also took digs at Sheen’s former live-in girlfriends, whom he referred to as “the goddesses,” and ex-wife Brooke Mueller, who was sitting in the audience Saturday. After the comedians had their say, roast master Seth MacFarlane introduced the night’s honoree as “a man with a big heart, because it’s been dangerously enlarged by cocaine use.”
De Niro back to NYC from Toronto premiere for 9/11 Associated Press Writer TORONTO — Robert De Niro helped revitalize lower Manhattan after the 9/11 terror attacks but says he has no plans to go to ground zero on the 10th anniversary. The New York resident was in Toronto on Saturday for the premiere for his film, “The Killer Elite.” He says he feels the ground zero ceremony is “for certain dignitaries and the families.” He returned home to New York for Sunday’s anniversary. A resident of the Tribeca neighborhood that housed the World Trade Center, De Niro was instrumental in starting t h e Tr i b e c a Film Festival, which brought business back to the devastated area. De Niro produced a prerecorded address commemorating the day that will be played at the football game when the New York Jets open their season against the Dallas Cowboys Sunday night.
Science
International
Monday, September 12, 2011
13
Arctic ice cover hits historic low: scientists Agence France Presse
Too wacky? Moving water from یRRGWRGURXJKW AP Photo/Tony Gutierrez, File
FILE - In this Sunday Aug. 7, 2011 file photo, Eddie Ray Roberts, superintendent of the city’s waste and water department is shown walking on the dried bed of Lake E.V. Spence in Robert Lee, Texas.
Associated Press Writer WASHINGTON — As the soggy East tries to dry out from flooding and Texas prays for rain that doesn’t come, you might ask: Isn’t there some way to ship all that water from here to there? It’s an idea that has tempted some, but reality gets in the way. A Texas oilman once envisioned long pipelines carrying water to drought-stricken Texas cities, just one of several untested fantasies of moving water vast distances. Parched Las Vegas still wants to indirectly siphon off excess water from the overflowing Mississippi River. French engineers have simulated hauling an iceberg to barren Africa. There are even mega-trash bags to move heavy loads of water. There’s certainly plenty of rain-
water available. Tropical Storm Lee dumped enough on the already saturated Mid-Atlantic, Northeast and Gulf Coast to bring 9.6 inches of rain across the entire state of Texas, according to calculations by the National Oceanic and Atmospheric Administration and The Associated Press. “One man’s flood control is another man’s water supply,” said Patricia Mulroy, general manager of the Southern Nevada Water Authority. “Doesn’t it make you want
to think about a larger distribution that helps both? That’s the crazy part of this. It’s a win-win. There’s no loser.” But moving vast quantities of water is not simple or cheap, and thus not realistic, experts say. Mostly, it’s too costly and political. However, these dreamed-up concepts show that a quiet water crisis is getting more desperate. “We will go to any lengths to avoid confronting the reality of water shortages,” said University of Arizona law professor Robert Glennon, author of the book “Unquenchable.” “What all those zany ideas suggest are the traditional beliefs that we can control nature and there must be some oasis out there where we can go to, to import water.”
The area covered by Arctic sea ice reached it lowest point this week since the start of satellite observations in 1972, German researchers announced on Saturday. On September 8th, the North Pole’s icy skull cap shrank to 4.24 million square kilometres (1.637 million square miles), about half-a-percent under the previous record low set in September 2007, according to the University of Bremen’s Institute of Environmental Physics. The Arctic’s dwindling summer sea ice is described by scientists as both a measure and a driver of global warming, with negative impacts on a local and planetary scale. It is also further evidence of a strong human imprint on climate patterns in recent decades, the researchers said. “The sea ice retreat can no more be explained with the natural variability from one year to the next, caused by weather influence,” Georg Heygster, head of
the Institute’s Physical Analysis of Remote Sensing Images unit, said in a statement. “Climate models show, rather, that the reduction is related to the manmade global warming which, due to the albedo effect, is particularly pronounced in the Arctic.” Albedo increases when an area once covered by reflective snow or ice -- which bounces much of the Sun’s radiative force back into space -- is replaced by deep blue sea, which absorbs the heat instead. Temperatures in the Arctic region have risen more than twice as fast as the global average over the last half century. The Arctic ice cover has also become significantly thinner in recent decades, though it is not possible to measure the shrinkage in thickness as precisely as for surface area, the statement said. The US National Snow and Ice Data Center, which likewise tracks Arctic ice cover on a daily basis, has not announced a record low ice cover. Data posted on its website only covered the period through September 6.
IBP/afp
A fishermen in Arctic waters off the coast of Greenland. The area covered by Arctic sea ice reached it lowest point this week since the start of satellite observations in 1972, German researchers announced on Saturday
China’s suicide rate ‘among highest in world’ Agence France Presse
IBP/ap
The sun rises over highrise buildings in downtown Beijing in 2010. A person tries to kill themselves in China every two minutes, the government and state media said Thursday, giving the country one of the highest suicide rates in the world.
A person tries to kill themselves in China every two minutes, the government and state media said Thursday, giving the country one of the highest suicide rates in the world. China’s suicide rate is 22.23 people out of every 100,000, the Centre for Disease Control and Prevention said on its website. “Our nation has one of the highest rates of suicide in the world,” the Beijing Youth Daily quoted Beijing Health Bureau spokesman Mao Yu as saying. About 287,000 people
kill themselves in the country of 1.3 billion every year, while about two million try to commit suicide annually. China marks World Suicide Prevention Day on Saturday, according to the Beijing Youth Daily. The disease control centre said suicide is the biggest killer among Chinese aged 15 to 34. Extreme pressure to perform well at school and to find employment were the main reasons behind the high rate of suicide among China’s youths, media said. The suicide rate in rural areas is three times higher than in urban
centres and accounts for 75 percent of China’s suicide total, it said. According to the Guangzhou Daily, the number of suicides in China has risen sharply during the reform and open period, when the nation’s economy has boomed. A person attempts to commit suicide in China every two minutes, the paper said. In 2009, the British medical journal The Lancet identified Lithuania, Finland, Latvia, Hungary, China, Japan and Kazakhstan as all having exceptionally high rates of suicide, 20 per 100,000 people or higher.
14
Monday, September 12, 2011
Sport
International
Rare Barca slip up allows Real to pull Reuters
AP Photo/Jon Super
Manchester United’s Wayne Rooney, centre, celebrates with teammates after scoring his third goal against Bolton during their English Premier League soccer match at The Reebok Stadium, Bolton, England, Saturday Sept. 10, 2011.
Hat-tricks for United’s Rooney and City’s Aguero Reuters
MANCHESTER - Manchester United stole Manchester City’s thunder again when a Wayne Rooney treble sparked a 5-0 rout of Bolton Wanderers after their neighbours had breezed past Wigan Athletic 3-0 with a hat-trick from Sergio Aguero on Saturday. Champions United were three goals up after 25 minutes thanks to one from Javier Hernandez, makLQJKLVÂżUVWVWDUWRIWKHVHDVRQDQG two from Rooney who has scored in every Premier League game this term. Hernandez added another for the visitors in the 58th minute before Rooney struck his third 10 minutes later to complete back-to-back league hat-tricks. “They (Rooney and Hernandez) are a constant threat. Their movement and the pace they play at was UHDOO\ÂżUVWFODVVIRUXVWRGD\´PDQager Alex Ferguson told ESPN television. Like two weeks ago, when City recorded a 5-1 win at Tottenham Hotspur only to be trumped by United’s 8-2 thrashing of Arsenal, Ferguson’s side outgunned Roberto Mancini’s team to sit top of the table above City on goal difference. City prospered against Wigan thanks to Argentina forward Aguero who has six goals in four games for his new club but any headlines he might have received were soon overtaken by United’s masterclass at Bolton. Hernandez opened the VFRULQJLQWKHÂżIWKPLQXWHZLWKWKH W\SHRIÂżQLVKWKDWZDVDKDOOPDUNRI his debut season last year, making a fantastic run into the box to get an outstretched leg to Nani’s cross from the right. Two quick goals by Rooney,
Tevez missed a penalty and City wasted several other chances before substitute Samir Nasri, playing ZLWK D EURNHQ ÂżQJHU SXW$JXHUR WKURXJKZLWKKLVÂżUVWWRXFKRIWKH ball in the 63rd minute. Six minutes later Aguero completed his hat-trick when he tucked in another through ball from Silva to give his side plenW\RIFRQÂżGHQFHEHIRUHWKH\PDNH their Champions League debut at home to Napoli on Wednesday. “Sergio is a fantastic striker, he is an incredible player, he is young, he scored three fantastic goals. He has scored always in his career and I KRSHLWFDQFRQWLQXHKHUH´PDQDJHU Mancini told Sky Sports. Fellow Champions League combatants and title hopefuls Chelsea also gave themselves a boost with a 2-1 win at Sunderland BEING ECLIPSED with goals from John Terry and While Rooney and Ferguson said Daniel Sturridge while Arsenal United were concentrating on their QRWFKHGWKHLUÂżUVWZLQRIWKHVHDown game rather than worrying son. Arsene Wenger’s side scored about City, fans from the blue side a 1-0 victory courtesy of a lucky RI 0DQFKHVWHU ZLOO ÂżQG LW JDOOLQJ Andrei Arshavin goal gifted by a that their excellent start to the sea- blunder from Swansea City goalson is being eclipsed. Displaying keeper Michel Vorm. a more attacking brand of soccer 7RWWHQKDP+RWVSXUJRWWKHLUÂżUVW than last season’s more conserva- points of the season by overcoming tive approach, Mancini’s men took Wolverhampton Wanderers 2-0. just 13 minutes to get off the mark Liverpool’s unbeaten start came to a at home to Wigan with David Silva halt when they lost 1-0 at Stoke City and Carlos Tevez combining well to while Everton drew 2-2 at home to put Aguero through. Aston Villa.
both deft touches set up by defender Phil Jones, put United three up at the break as Bolton’s defence fell apart. Hernandez, who missed the start of the campaign after suffering concussion on a pre-season tour, showed last term’s great form was QRÀXNHDVKHVORWWHGLQIURPFORVH range after Bolton failed to clear in the 58th minute. Rooney completed his hat-trick ZLWKDVXSHUE¿UVWWLPHGULYHDIWHU a pull-back from Nani while Hernandez missed a couple of chances to snatch his own treble. United’s day was clouded by Tom Cleverley limping off in the opening minutes ZLWK)HUJXVRQVD\LQJWKHPLG¿HOGHU may have broken his foot after a ³EDG WDFNOH´ IURP %ROWRQ FDSWDLQ Kevin Davies.
MADRID - Barcelona blew a two-goal lead to draw 2-2 at Real Sociedad and Real Madrid took advantage of the slip-up with a 4-2 home win over Getafe in La Liga on Saturday. European champions Barca were cruising after early strikes from Xavi and Cesc Fabregas but they eased off and the Basques levelled with two goals in three second-half minutes. France striker Karim Benzema led Real to victory, scoring either side of a disputed Cristiano Ronaldo penalty, but it needed substitute Gonzalo Higuain to settle the match for Jose Mourinho’s men. Real have a perfect six points, the same as Valencia who were 1-0 winners at home to Atletico Madrid. Barca have four points along with Sociedad and Sevilla who grabbed a 2-2 draw at 10-man Villarreal. Roberto Soldado powered a header in off the bar for Valencia in the 52nd minute and tops the scoring charts with Ronaldo, on four goals from two games. Villarreal had goalkeeper Diego Lopez harshly sent off after 22 minutes at the Madrigal and Alvaro Negredo saw his penalty saved but scored on the rebound to put Sevilla ahead. Giuseppe Rossi levelled with a penalty at the other end and 0DUFR5XEHQÂżUHG9LOODUUHDODKHDGLQWKHUGEHIRUH$OH[LV5XDQR headed a late equaliser. MESSI ON BENCH 3HUKDSVZLWKWKHPLGZHHN&KDPSLRQV/HDJXHÂż[WXUHDJDLQVW AC Milan in mind, Barca coach Pep Guardiola left Lionel Messi, 'DYLG9LOODDQG$QGUHV,QLHVWDRQWKHEHQFKDQGDWÂżUVWWKH\ZHUH not missed. Fabregas dinked a ball over the top for Xavi to score in the 10th minute and the former Arsenal player also set up Pedro a minute later, putting away the rebound when the latter’s shot was blocked. Barca lost new signing Alexis Sanchez to a thigh injury, which could keep the Chilean sidelined for up to eight weeks, and the game began to get away from them in the 59th minute. Striker Imanol Agirretxe headed one back for the home side and almost immediately the same player intercepted a poor back pass from 9LOODDQGÂżUHGDJDLQVWWKHEDU Antoine Griezmann followed up to head into the open net, however, and Barca were lucky not to lose Sergio Busquets who had tipped Agirretxe’s original shot on to the woodwork with his hand. Guardiola threw Messi and Iniesta into the fray but it was a despairing last-minute defensive header from Dani Alves that denied the hosts a shock winner. “It was two defensive errors ... WKDWKDYHSURYHGYHU\H[SHQVLYH´%DUFDFDSWDLQ;DYLWROG6SDQish television.
AP Photo/Alvaro Barrientos
Barcelona’s Francesc Fabregas, left, is blocked by Macdonald Mariga from Kenya, right, during their Spanish La Liga soccer match, at Anoeta stadium in San Sebastian, northern Spain, Saturday Sept. 10, 2011. Barcelona and Real Sociedad tied 2-2.
International
Sport
Djokovic and Nadal set up 862SHQ‍ۋ‏QDOUHPDWFK Reuters
1(:<25.1RYDN'MRNRYLFDQG5DID1DGDOZLOOPHHWLQWKH862SHQÂżQDOIRUWKHVHFRQG \HDULQDURZDIWHUZLQQLQJWKHLUVHPLÂżQDOVRQDGD\RIXQUHOHQWLQJGUDPDDQGSUHFLVLRQWHQQLVDW Flushing Meadows on Saturday. Djokovic showed why he is the hottest player in the game right now when he saved two match points to roar back from the brink of defeat and beat Roger Federer in a ÂżYHVHWWKULOOHUWKDWZKLSSHGWKH$UWKXU$VKH6WDGLXPFURZGLQWRDIUHQ]\RIH[FLWHPHQW7KHQ1DGDO 1DGDOEHDW'MRNRYLFPRQWKVDJRWRFRPSOHWHKLV collection of grand slam titles but the Serbian has had his PHDVXUHWKLV\HDUÂł,ÂśYHORVWP\ODVWÂżYHPDWFKHVDJDLQVW KLPÂżYHÂżQDOV´1DGDOVDLGÂł+HÂśVREYLRXVO\WKHIDYRXULWH IRUWKHÂżQDODQG,NQRZ,KDYHWRGRVRPHWKLQJEHWWHUWKDQ those other matches to try and change the situation.â€? For Djokovic, who has already won two grand slam titles this year, at the Australian Open and Wimbledon, WKHUHZDVMXVWUHOLHIWKDWKHPDGHWKHÂżQDODIWHUKHVXUYLYHG a pulsating contest with Federer that could have gone HLWKHUZD\)HGHUHUZRQWKHÂżUVWWZRVHWVWKHQUHJDLQHG KLVFRPSRVXUHWROHDGLQWKHÂżIWK 7KH6ZLVVPDHVWURDÂżYHWLPHFKDPSLRQDW)OXVKLQJ Meadows served for the match and had two match points, but Djokovic saved them both and won the last four games WRFRPSOHWHDQLQFUHGLEOHFRPHEDFNÂł,WÂśVDVSRUWZKHUH one wins, one loses,â€? Djokovic said. “We have a saying, ‘what doesn’t kill you makes you stronger.â€? For Federer, LW ZDV D KHDUWEUHDNLQJ ORVV +H PD\ KDYH ZRQ PRUH grand slam titles than any other man that has played the JDPHEXWKLVODVWZDVDWWKH$XVWUDOLDQ2SHQ1RZ RQWKHZURQJVLGHRIKHGRHVQÂśWPRYHDVIDVWDVKH once could and hit a string of ugly shanks. Âł6XUH LWÂśV GLVDSSRLQWLQJ EXW , KDYH RQO\ P\VHOI WR EODPH´VDLG)HGHUHUÂł,VHWLWDOOXSSHUIHFWEXW,FRXOGQÂśW ÂżQLVKLW´³,WKXUWVEXWLWÂśVÂżQH,WFRXOGEHZRUVH,WFRXOG EH D ÂżQDO´ 0XUUD\ QHYHU UHDOO\ WKUHDWHQHG 1DGDO although he had the consolation of taking a set off him, a feat that none of his other opponents have managed at the U.S. Open this year. +HSOD\HGDJJUHVVLYHO\FUDFNLQJZLQQHUVPRUH WKDQ1DGDOEXWKLVXQIRUFHGHUURUVZDVPRUHWKDQWZLFH his opponent’s total. The Scotsman still has time on his VLGHEXWKHFDUULHVWKHDGGHGEXUGHQRI\HDUVRI%ULWLVK IUXVWUDWLRQ7KHZRUOGQXPEHUIRXUPDGHWKHVHPLÂżQDOV of all four grand slams this year but is still searching for KLVÂżUVWPDMRUZLQ
³,WœVVRPHWKLQJ,ZDQWWRWU\DQGDFKLHYHEXWLI\RX want to judge someone’s whole career based purely on VODPV,ZRXOGKDYHKDGDWHUULEOHFDUHHU´KHVDLG ³,œYHVWLOOJRWKRSHIXOO\WKUHHRUIRXUPRUH\HDUVZKHUH ,œPSOD\LQJWKHWHQQLVLQP\SHDN,QHHGWRVWD\KHDOWK\ and improve.�
Monday, September 12, 2011
15
Brazil, Argentina claim Olympic basketball berths Agence France Presse
MAR DEL PLATA, Argentina — Brazil and Argentina picked up victories Saturday to claim berths in next year’s London OlymSLFV%UD]LOEHDWWKH'RPLQLFDQ5HSXEOLFDQG$UJHQWLQD HGJHG3XHUWR5LFR LQWKHVHPLÂżQDOVRIWKH2O\PSLFPHQÂśV EDVNHWEDOOTXDOLI\LQJIRUWKH$PHULFDV 7KH WZR ÂżQDOLVWV PHHW 6XQGD\ DQG TXDOLI\ DXWRPDWLFDOO\ IRU/RQGRQ7KHWKLUGWKURXJKÂżIWKSODFHWHDPVHDUQVSRWVLQD TXDOLI\LQJWRXUQDPHQWMXVWEHIRUHWKHJDPHVZKLFKZLOODZDUG VHYHUDO PRUH EHUWKV IRU /RQGRQ 9HQH]XHOD FODLPHG WKH ÂżIWK place spot. The United States won the world championship last year and ZDV WKH ÂżUVW WHDP WR TXDOLI\ IRU /RQGRQ %ULWDLQ$XVWUDOLD and Tunisia have since gained spots. Manu Ginobili made WKHWLHEUHDNLQJIUHHWKURZZLWKVHFRQGVOHIWIRU$UJHQWLQD DQG3DEOR3ULJLRQLDGGHGDQRWKHUZLWKVHFRQGVWRJREHIRUH -RVH%DUHDRIWKH'DOODV0DYHULFNVPLVVHGDSRLQWHUZLWKD second to play. “Mission accomplished,â€? Ginobili said. “But we really sufIHUHG,WZDVRQHRIWKHWRXJKHVWJDPHVRIP\OLIH´/XLV6FRODRI WKH+RXVWRQ5RFNHWVOHG$UJHQWLQDZLWKSRLQWVDQGWKH6SXUVÂś *LQRELOLDGGHG%DUHDKDGDQG'DQLHO6DQWLDJRVFRUHG IRU3XHUWR5LFRZKLFKOHGDWKDOIWLPH Âł7RGD\LWZDVDOORUQRWKLQJ´$UJHQWLQDFRDFK-XOLR/DPDV VDLGÂł,IHHOYHU\HPRWLRQDODERXWTXDOLI\LQJ´0DUFHOR0DFKDGR OHG %UD]LO ZLWK SRLQWV LQ WKH VHPLÂżQDO YLFWRU\ ZLWK IRU WHDPPDWH 0DUFHOR +XHUWD$O +RUIRUG RI WKH$WODQWD +DZNV DQG-DFN0DUWLQH]VFRUHGIRUWKH'RPLQLFDQ5HSXEOLFLQD game that was close throughout. “We have realized a dream,â€? Machado said. “We have worked hard for this, and this is a prize for effort and talent.â€?
AP Photo/Charlie Riedel
Novak Djokovic of Serbia reacts after winning a semiďŹ nal match against Roger Federer of Switzerland at the U.S. Open tennis tournament in New York, Saturday, Sept. 10, 2011.
Serena runs away from Wozniacki at U.S. Open Associated Press Writer
NEW YORK — This one didn’t come down to a foot fault, a referee’s call or anything else that could’ve made 6HUHQD:LOOLDPVPDG1RSHMXVWDIHHOJRRG6DWXUGD\ night for a player who has had her share of injuries and turmoil over the past few years. ,QZKDWZDVVXSSRVHGWREHKHUWRXJKHVWWHVW\HWDW the U.S. Open, Williams dominated top-seeded Caroline :R]QLDFNLLQWKHVHPL¿QDOVWRPRYHDZLQDZD\ IURPKHUWK*UDQG6ODPWLWOH³)RUPHLWœVDPD]LQJ´ :LOOLDPV VDLG ³,œYH FRPH D ORQJ ZD\ D UHDOO\ ORQJ way.� Williams, who missed the better part of a year with LQMXULHVDQGLOOQHVVZDVEDFNLQWKHVHPL¿QDOVDW)OXVKLQJIRUWKH¿UVWWLPHVLQFH ZKHQDOVRRQD6DWXUGD\ night in Arthur Ashe Stadium, she got called for a foot fault against Kim Clijsters, then went on a tirade against the referee that cost her match point. An ugly moment she’d love to forget — sort of the same way Wozniacki would like to forget almost everything that happened on a worst-case-scenario night for her in the world’s biggest tennis stadium.
+HUORVVOHIW1R 6DP6WRVXUDVWKHODVWSOD\HUZLWKD FKDQFHWRVWRS1R:LOOLDPVDWDWRXUQDPHQWLQZKLFK she has lost a grand total of 29 games over six matches DQGKDVQÂśWGURSSHGDVHW6WRVXUEHDW$QJHOLTXH.HUEHU WRUHDFKKHUVHFRQG*UDQG6ODPÂżQDO7KH\ÂśOO KDYHDTXLFNWXUQDURXQGDQGSOD\6XQGD\ZLWK:LOOLDPV going for her fourth U.S. Open championship on the 10th anniversary of the Sept. 11 attacks. Âł,WPHDQWDORWWRPHWRFRPHRXWKHUHDVDQ$PHULFDQ DQGVWLOOEHLQWKHWRXUQDPHQW´:LOOLDPVVDLGÂł,UHDOO\ wanted to play tomorrow. Such a special day for the 8QLWHG6WDWHVVR,ÂśPUHDOO\H[FLWHG´:LOOLDPVÂżQLVKHG ZLWKZLQQHUVFRPSDUHGWRÂżYHIRU:R]QLDFNLWKRXJK the clearest picture was painted early in the second set when Williams led 20-0 in that category. That’s typical of each player’s game — Williams is about power and Wozniacki is about persistence — but the difference on this night was glaring and the contest turned into a mismatch. Âł,QHYHUJDYHXS,ZDVDOZD\VWU\LQJWRSOD\WKHQH[W point, the next point,â€? Wozniacki said. “But Serena played YHU\YHU\ZHOOWRGD\6KHÂśVLQJUHDWVKDSH+LWWLQJDOOKHU strokes. And that serve was a killer.â€?
AP Photo/Martin Mejia
Brazil’s Tiago Splitter, left, attempts to dribble past Dominican Republic’s Jack Martinez during a FIBA Americas Championship semi-ďŹ nal basketball game in Mar del Plata, Argentina, Saturday Sept. 10, 2011.
I N T E R N A T I O N A L
16
Sport
Monday, September 12, 2011
Jarno Trulli extend contract JARNO Trulli will remain at Team Lotus for 2012, after the Hingham-based outfit announced on Sunday that the Italian had extended his contract. The Italian joined Team Lotus for its inaugural campaign in 2010 and has played a major role in helping develop the outfit over the past two seasons. Speaking about his new deal, Trulli said: “I am very pleased that we have been able to confirm today that my contract with Team Lotus has been extended into 2012. The challenge I first accepted when I joined the team is becoming more exciting every day, and I am very proud that I can keep helping the team take steps forward for at least another year.” Team principal Tony Fernandes, who made a big push during the formation of his outfit in going for experienced drivers like Trulli, said: “We are all delighted that we have been able to reach an agreement to keep Jarno on board for at least one more year with our team. “He has shown in qualifying in Monza just how much pace he has and how he can wring every last drop of performance out of his car and since day one with us he has brought a level of professionalism, insight and raw speed to our team that has helped accelerate our development on and off track. “Today’s announcement will give us the benefit of his experience and knowledge into 2012, another very important year in the growth of our team.” AP Photo/Rally Australia, Jeremy Rogers
In this photo released by the Rally Australia, Finland’s Mikko Hirvonen and co-driver Jarmo Lehtinen race their car on the final day of the Rally Australia, Sunday, Sept. 11, 2011 in Coffs Harbour, Australia.
Hirvonen closes on Sebastien Loeb with Australia win Mikko Hirvonen claimed Ford’s first World Rally Championship victory for nine rounds in Australia, after a rally that began with rain and chaos, and ended with a flurry of team orders. Ford ended its drought in emphatic style, with Hirvonen’s team-mate Jari-Matti Latvala coming home second. The team had not won since the season-opener in Sweden, but Hirvonen’s consistency in the interim meant that the Australian result brought him straight back into title contention - placing him 15 points behind Sebastien Loeb with three rallies to go. Friday had seen heavy rain and extraordinarily slippery conditions, and at first it was Citroen duo Loeb and Sebastien Ogier who battled for victory as both Ford men made minor errors and lost time. But after Loeb rolled and Ogier slid into a tree, Hirvonen and
Latvala found themselves back in first and second - and were able to charge away from third-placed Petter Solberg (Solberg Citroen). With Latvala almost out of mathematical title contention but Hirvonen still in with a shout, Ford had no qualms about hinting that the elder of its Finns was going to be in front by the finish whatever happened in the interim. So while Latvala moved into the lead on Saturday, when Hirvonen lost time running first on the road, a reversal of positions was always inevitable. Sure enough, on the penultimate stage of the rally Latvala slowed significantly and dropped into
second place as Hirvonen reclaimed the lead and went on to clinch the win. “I do like this place, it’s been really kind to us, but we have this victory only because of the fantastic teamwork we have done,” said Hirvonen, who has now won the last three Rally Australias. “It’s a fantastic result and it’s so important for Ford. Of course big thanks to Jari-Matti for slowing down on the long stage and giving me the points for the championship. Now we’re back in it.” Both Citroen drivers were able to rejoin under superally for Saturday. Initially Ogier seemed to have by far the better chance of salvaging something from the event, as his charge brought him within sight of eighth place, while 11th looked to be Loeb’s limit. However Citroen decided
on the final day that with Hirvonen gaining so much championship ground, it had to throw all its efforts behind Loeb - despite Ogier having started the rally second in the standings, 25 points from his team-mate. Ogier was therefore ordered to check in late before the penultimate stage to incur a penalty, and then to park on the stage for 10 minutes. That dropped him back to finish 11th, and ensured Loeb was able to grab 10th place. The world champion then added a further three points to his tally by winning the power stage, which saw Latvala and Solberg take the second and third bonus points. “The team made a decision because we are now under pressure from Mikko after our mistake,” said Loeb. “That is the situation.”
Published on Sep 11, 2011
Headline : A changed America
