Issuu on Google+

design diffusion Bagno e Benessere

PROGETTO COVER INDA, GULLIVER UNO IL PUNTO PERSONAGGI A CONFRONTO

GREEN ATTITUDE SPECIALE TECNOLOGIA DDB Design Diffusion Bagno Rivista bimestrale anno VI n.62 marzo - aprile 2012 Italian/English edition Taxe percue (tassa riscossa) uff. CMP/2 Roserio_MI Sped. a. p. 45% Decreto legge 353/2003 (conv.in L.27/02/2004 n.46) art.1, comma 1, DCB Milano € 5,00 (Italy only) - A € 17,60 - F € 9,80 D € 10,50 - GR € 9,00 - P € 8,40 E € 8,00 - GB BP. € 5,70 - N NKr. 100,00 S SKr. 108,00 - CH SFr. 14,50

X

62


ARCHITECTURAL BATHROOMS & SHOWERS

IDEA AQUA BLOB DISENIA

IDEA / Collezione My Seventy Plus

Via Marigonda 3/1, 31040 Navolè di Gorgo al Monticano (TV) Italy _Tel.+39.0422.742184 _ Fax +39.0422.742187 _ ideagroup @ideagroup.it _ www.ideagroup.it


Studio Gori_Ph: Studio Pitari

IDEAGROUP

SALONE INTERNAZIONALE DEL BAGNO DI MILANO 2012 / 17_ 22 APRILE Pad. 22 Stand A37 A41


sommario

ddbB 62 marzo/aprile 8 Progetto coverInda 12 MagazineNews dal mondo progetto 20 A tu per tuGreen al centro del progetto 24 AzzurraGlaze: Eleganza senza tempo 26 Alberto LievoreLa sostenibile leggerezza della natura 28 Studi di architetturaArchitetti Berselli Cassina Associati 36 BLU ScavoliniLifestyle e wellness 38 Philippe NigroDesign etico 42 EventiMutable spirit 46 Daniel Irànyi e Tom StaubliUno….E trino 54 HpDesign digitale 44 NewsFiere 50NewsLibri il punto 58 Intervista multiplaTechnology&Green Attitude interiors 66 VareseTrasparenze soffuse, visuali prospettiche 72 SingaporeNotti a effetti speciali 76 LondraLondon Luxury 82 BerlinoIl lusso della semplicità wellness 88 Bathroom DesignPublic toilet 100 Ludovica+Roberto PalombaWellness outdoor. E freestanding… profili 102 FimaEclipse, Nomos e Fimabox 104 IdeagroupLa qualità come sistema 106 TotoIl giusto mix di tecnologia e design speciale 108 Salone SatelliteDesign&Technology 118Abbonamenti


colophon

Direttore Responsabile / Editor In ChiefFrancesca Russo Redazione / Editorial StaffMargherita Pincioni - m.pincioni@ddworld.it Progetto e Realizzazione Grafica / Graphic Design and LayoutFabio Riccobono - f.riccobono@ddworld.it Collaboratori / Contributors Ester Pirotta, Barbara Delmiglio, Chiara Naldini, Daniela Bonaretti, Nico Velvet Elviro Di Meo, Veronica Buratti, Andrea Brega, Patrick Fael, Alessandra Sala, Claudio Moltani Alberto Parise, Giacomo Fusciello, Adriano Pecchio, Patrizia Coggiola Casa Editrice / PublisherDDW S.r.l. Design Diffusion World via Lucano 3 - 20135 Milano T 02 55 16 109 F 02 54 56 803 www.designdiffusion.com - www.designdiffusion.tv Pubblicità / AdvertisingDDA S.r.l. Design Diffusion Advertising via Lucano 3 20135 Milano T. 02 54 530 09 F. 02 54 568 03 dda@ddadvertising.it Amministrazione / AdministrationNorberto Mellini Ufficio Traffico / Traffic DepartmentDaniela D’Avanzo - Barbara Tommasini d.davanzo@ddadvertising.it Ufficio abbonamenti / Subscription Office Numero Verde 800 318216 Poste Italiane spa Spedizione in abbonamento postale 45% decreto legge 353/2003 (conv in L. 27/02/2004 n. 46) art. 1 comma 1, LO/MI Registrazione Tribunale di Milano n. 140 del 16 marzo 2001 Fotolito / PhotolithografyBitgraph Cassina de Pecchi (Mi) - commerciale@bitgraph.org Stampa / PrintingColor Art S.r.l. Rodengo Saiano (Bs) - colorart@colorart.it Distribuzione all’estero / Sole agent for distribution abroad A.I.E. Agenzia Italiana di Esportazione S.p.A. via Manzoni 12 - 20089 Rozzano (Mi) T 02 57 539 11 F 02 57 512 CODICE ISSN1592-3452


editoriale

Green Attitude è il tema di questo numero, ovvero: cosa significa progettare un prodotto sostenibile? Come le innovazioni tecnologiche possono contribuire alla creazione di un prodotto ecologicamente corretto? Progettisti e produttori dovrebbero cooperare per raggiungere un obiettivo comune. Abbiamo chiesto ad alcuni di loro di parlarci del binomio tecnologia e sostenibilità ambientale: Gordon Guillaumier, designer, Silvana Angeletti di Angeletti Ruzza Design, Jonathan Carter, direttore marketing di Victoria+Albert, Stefano Nencioni, Image & Communication Manager Laminam, Aldo Magnani, direttore marketing Mosaico+.

Green Attitude is the theme of this issue with topics that include: what does it mean to design a sustainable product? How can technological innovations contribute to the creation of an ecologically correct product? Designers and manufacturers should cooperate to reach a common objective. We asked some of them to talk with us about technology and environmental sustainability including: Gordon Guillaumier, designer, Silvana Angeletti of Angeletti Ruzza Design, Jonathan Carter, marketing director for Victoria+Albert, Stefano Nencioni, Image & Communication Manager for Laminam, Aldo Magnani, marketing director for Mosaico+.

La sostenibilità dovrebbe essere al centro di ogni progetto; con Guido Pesenti, presidente di Mamoli Rubinetterie, e Giuseppe Presotto, amministratore di Arblu abbiamo affrontato un A tu per tu sul tema di questo numero, cercando di capire il significato della parola Green, spesso troppo abusata. Nella sezione Progetti abbiamo intervistato Philippe Nigro, progettista sensibile a un design etico, all’insegna dell’uso razionale delle risorse e del rispetto dell’ambiente: “Credo che le cose si stiano muovendo verso un ritorno a un uso sensato dei materiali – sostiene Nigro. Non si può e non si deve rinunciare alle plastiche, perché sono materiali preziosissimi che permettono di realizzare elementi fondamentali per il nostro progresso. Certo, ne va fatto un utilizzo ragionevole per non contribuire allo spreco”.

Sustainability should be at the heart of every design: with Guido Pesenti, the president of Mamoli Rubinetterie, and Giuseppe Presotto, the managing director of Arblu, we talked together about the theme of this issue to try and understand the meaning of the term ‘green’ which is frequently abused. In the Projects section we interviewed Philippe Nigro, who is working with ethical design that makes a rational use of resources and respects the environment: “I believe that things are going back to a more sensible use of materials – Nigro stated. We cannot and should not renounce the use of plastics because they are precious materials that allow for making elements that are fundamental for our advancement. It is true that we need to use them in a sensible manner so that we do not contribute to waste”.

Forme universali, capaci di armonizzarsi con ogni ambiente, sono la cifra stilistica dell’Atelier spagnolo Lievore Altherr Molina. Il Gruppo ha creato un team di lavoro dedicato alle problematiche dell’ambiente, il cui impegno principale è il controllo e la gestione dell’impatto ambientale, dalla progettazione allo smaltimento di fine vita: hanno raccontato a ddB l’ultimo progetto per Arper.

Universal forms that blend with any environment distinguish the stylistic matrix of Spanish design firm Lievore Altherr Molina. The group has created a work team dedicated to environmental problems with the primary aim of controlling and managing environmental impact from design to end of life waste: they talked to ddB about the latest project for Arper.

Quest’anno il Salone Satellite compie 15 anni e si conferma luogo di incontro per eccellenza tra imprenditoritalent scout e promettenti giovani progettisti; per questa occasione Cosmit ha invitato 15 designer, che in passato esposero con successo i loro prototipi, a partecipare con allestimenti inerenti a un tema di grande attualità, Design&Tecnologia. Per il nostro Speciale li abbiamo incontrati e abbiamo raccolto pensieri e pareri sull’esperienza passata e quella di oggi.

This year Salone Satellite is celebrating its 15th edition as an excellent meeting point for businesspeople, talent scouts and promising young designers. For the occasion, Cosmit has invited 15 designers who exhibited their prototypes successfully in the past. They will participate in this edition with exhibits regarding Design & technology, which is a particularly current issue. In the Special section we met with them and talked about their memories from past editions and their thoughts on this year’s edition.

Margherita Pincioni

Margherita Pincioni


2TQFWEVFGUKIPGFD[5QVVUCUU#UUQEKCVK rYYYMCNFGYGKEQO

%QPQƂCVGURTKOGWPNKPIWCIIKQRTQIGVVWCNGEQPPQVCVQ FCGUVTGOCGNGICP\C2KCVVQ FQEEKC KPPQXCVKXQ EQPEKNKC NCTKEGTECPGNFGUKIPEQPNoCVVGP\KQPG CNNoGUVGVKEC QHHTGPFQNKDGTV¼FKOQXKOGPVQGOCUUKOQEQOHQTVFKCRRQIIKQ 4GCNK\\CVQKPRTG\KQUQCEEKCKQUOCNVCVQ-CNFGYGKFCOO ÄICTCPVKVQCPPK

PIONIERE DELL’ESTETICA Salone Internazionale del Mobile, pad. 24, C07


progetto coverinda Testo di Elviro Di Meo

Inda: Il bagno in tutte le sue forme INDA: THE BATHROOM IN ALL ITS FORMS

DA UN MARCHIO INTERNAZIONALE, CON OLTRE MILLE ARTICOLI A CATALOGO, FONTE D’ISPIRAZIONE QUOTIDIANA PER PROGETTISTI E ARCHITETTI, NASCE GULLIVER UNO: IL MOBILE AD ANTA CON FINITURA LUCIDA TERRA DI LUNA A CUI È APPOGGIATO IL LAVABO PANAREA IN CERAMICA BIANCA AN INTERNATIONAL TRADEMARK WITH OVER ONE THOUSAND ITEMS IN ITS CATALOGUE THAT SERVES AS DAILY INSPIRATION FOR DESIGNERS AND ARCHITECTS HAS DEVELOPED GULLIVER UNO: THE TERRA DI LUNA STORAGE CABINET WHICH HOLDS THE PANAREA WHITE CERAMIC SINK Un’eccezionale varietà di proposte pensate per arredare i più differenti stili dell’abitare, in cui colori, materiali e cromature diventano l’espressione più autentica per caratterizzare l’ambiente bagno. Ed è dall’esigenza di personalizzare lo spazio, di conferirgli identità e carattere, che nasce Gulliver Uno: il mobile ad anta con finitura lucida Terra di Luna a cui è appoggiato il lavabo Panarea in ceramica bianca. Inda firma, così, un oggetto di design che parla un linguaggio contemporaneo, che nulla concede al superfluo, a certe tendenze dove il decorativismo imperante predomina sul progetto stesso. L’azienda preferisce l’essenza, rafforzando, ancora una

008

volta, il proprio codice genetico. Una tradizione che punta a espandersi su più fronti, sia commerciali e sia strategici, per sviluppare al massimo e a breve termine una penetrazione decisiva nei comparti delle pareti doccia e dei mobili. Chiaro l’obiettivo: allinearsi alla leadership riconosciuta dell’accessorio per l’arredo-bagno, grazie alla consolidata presenza in Europa. La svolta parte dal nuovo headquarter: la sede direzionale operativa da quest’anno, ubicata nell’innovativo polo commerciale proprio di fronte all’aeroporto di Milano-Malpensa. E sono proprio i must di Inda a dimostrare quanto le tre divisioni del Gruppo (Mobili, Pareti doccia e Accessori)


formino, in realtà, un unico filo conduttore, ideale per infinite soluzioni: da quelle più di tendenza design a quelle modern-minimal-young, passando attraverso una molteplicità di proposte che caratterizzano le composizioni, gli abbinamenti, le finiture. Da qui, la nuova scelta dell’immagine istituzionale in cui Inda sta fortemente credendo, dando sempre più valore alla relazione tra Brand e mercato, attraverso un ‘volto umano’ che rassicura e invita a condividere i valori di marca che ogni divisione-prodotto rappresenta: la freschezza del design con una Madre Natura; l’innovazione progettuale con un giovane architetto; la cura del dettaglio con una Lady sofisticata. Immagine accompagnata dallo stesso e unico claim corale: “Il bagno in tutte le sue forme”, che ben sintetizza la linea stilistica e il valore creativo intrinseco all’azienda e alle proposte progettuali emerse da una molteplicità di prodotti legati alla contemporaneità e alla coerenza di un progetto globale, a cui hanno collaborato i migliori designer di fama nazionale e internazionale, tra cui Antonio Citterio e Matteo Thun. Qualità del design che si traduce, poi, anche in qualità certificata TÜV della produzione, fortemente curata nel dettaglio e nelle varie fasi di lavorazione tutte interne agli stabilimenti di Pagazzano e Olmi, così da garantire sempre prodotti altamente controllati. Comunicare a più livelli e su più ambiti è diventata per Inda la sfida prioritaria, visto che il fenomeno di internazionalizzazione continua a rappresentare per la stessa azienda un punto di confronto con i competitors e gli operatori dell’intero mercato, attraverso le cinque filiali presenti in Europa - (Svizzera, Francia, Spagna, Austria e Germania) - e i cinquanta distributori nel mondo: dall’Estremo Oriente agli Emirati Arabi, dalla Nuova Zelanda all’Europa dell’Est e alla Russia. Ed è in questa direzione che il Gruppo si impegna a promuovere nuove strategie di vendita presso gli showroom con l’intenzione, sempre più radicata, di farsi sentire ‘ancora più vicina al cliente’, aumentando la fidelizzazione degli operatori e della clientela finale.

In apertura di servizio: parete doccia scorrevole, in cui leggerezza e design si uniscono alla tipologia dei binari e all’altezza di 200 cm. per i vetri. In questa pagina, in alto: le nuova finiture per il bagno. Sotto La nuova scelta d’immagine istituzionale in cui l’azienda sta fortemente credendo: dare ancora più valore alla relazione tra Brand e mercato, attraverso un “volto umano” che rassicura e invita a condividere i valori di Marca. Nella pagina successiva, il mobile Gulliver Uno, con anta in finitura lucida e lavabo Panarea in ceramica.

On the first page: sliding shower enclosure where the light design blends with the track type and the 200 cm height of the glass. On the page, above: the new bathroom finishes. Below The new choice of professional image that the company is promoting places an even greater accent on the relationship between the brand and the market with a “human face” that is a reassuring and inviting presentation of the brand values. On the following page, the Gulliver Uno unit with a shiny finish on the door and a Panarea ceramic sink.

009


It provides an exceptional variety of choices designed to match many different living styles where colours, materials and chroming are authentic expressions that characterise the bathroom. Gulliver Uno was born to customise space, giving it identity and character: it includes the Terra di Luna storage cabinet which holds the Panarea white ceramic sink. Inda has developed a design product with a contemporary syntax that leaves no room for the superfluous or for dominating decoration that overpowers the design and or almost distorts the functionality for which it was designed. Instead of excessive or redundant design, the company prefers targeting the essence and once again following in its own footsteps. That tradition is aimed to expand across a number of both commercial and strategic fronts to truly further decisive penetration into the shower enclosure and furniture sector quite soon. The objective is clear: to develop the same recognised leadership it holds in the bathroom accessory sector thanks to its consolidated presence in Europe. The changes start with a new headquarters: the operative headquarters this year is located in the innovative commercial centre in front of the Milan Malpensa airport. The three winning points of the Inda trademark give rise to the three group divisions (Furniture, Shower Enclosures and Accessories). However, the divisions work together to form a single guiding line that provides an unlimited choice of ideal solutions: ranging from the leading design fashions to modern, minimal and young designs, as well as including numerous ideas that characterise arrangements, pairings and finishes. This is backed up by the new company image that Inda is strongly promoting. It is giving more and greater attention to the relationship between the brand and the market by developing a more human side that is reassuring and inviting with the brand values that each division-product represents: the freshness of design with a Madre Natura; design innovation with a young architect; attention to detail with a sophisticated Lady. The image is accompanied by the same claim in chorus: “The bathroom in its many forms”, which sums up the stylistic design and creative value of the company and the proposals which have emerged from the many products tied to contemporary style with coherence to the global project where the best and most famous Italian and international designers have collaborated including Antonio Citterio and Matteo Thun. The design quality then translates into TÜV certification for quality manufacturing that pays attention to details and the various processing stages at the factories in Pagazzano and Olmi to ensure that the products are always well controlled. Communicating on multiple levels and environments has become a priority target for Inda due to the fact that internationalisation continues to represent a strong point with competitors for the company and professionals in the whole market, with five branches in Europe (Switzerland, France, Spain, Austria and Germany) and fifty distributors throughout the world: the Far East, United Arab Emirates, New Zealand, East Europe and Russia. The group is working to promote new sales strategies at the showroom with the constant intention of bringing itself ‘even closer to customers’ and increasing the loyalty of professionals and consumers.


magazinenews dal mondo Testi di Nico Velvet, Andrea Brega, Alessandra Sala, Veronica Buratti, Claudio Moltani

PROGETTO

ALTERNATIVE CREATIVE CREATIVE ALTERNATIVES Esteticità dinamica, personalizzazione, flessibilità, velocità di realizzazione, ottimizzazione del budget e qualità sono, in sintesi, i principali requisiti assicurati al mondo dell’interior design dalle innovative soluzioni grafiche sviluppate da 3M. Divenuto da tempo uno dei principali assetti culturali di 3M, il mondo dell’interior design, inteso nella sua accezione più ampia, ovvero, come interpretazione delle esigenze complesse dei propri clienti e assistenza nella progettazione di soluzioni integrate che gratifichino tali necessità, dispone oggi di una gamma di soluzioni particolarmente ampia e articolata. Grazie alla centenaria esperienza maturata e alla costante e meticolosa ricerca di nuove tecnologie compatibili con l’ecosistema, 3M Architectural Market può quindi essere considerato un indiscusso punto di riferimento per designer, architetti, studi di progettazione, converter e decoratori coinvolti nell’affascinante mercato dell’interior design, della riqualificazione e del contract. Settore quest’ultimo i cui confini spaziano dal corporate al retail, dal marine ai luoghi di transito, dall’hospitality all’health care. E proprio quello dell’office è uno dei segmenti maggiormente esposti alla riqualificazione degli ambienti, dalle pareti divisorie alle superfici vetrate, dagli arredi ai pavimenti. Le soluzioni 3M AMD destinate al contract offrono le più ampie risposte in proposito. Tecnologicamente all’avanguardia e con un design esclusivo, perfettamente in linea con i più attuali trend di mercato, questi materiali sono in grado di coniugare la soddisfazione di esigenze stilistiche e funzionali. Ma non solo, testati per durare nel tempo, in qualsiasi condizione, e facili da installare, garantiscono anche un investimento sicuro e una manutenzione quasi inesistente. Moltissime soluzioni 3M AMD destinate al contract sono inoltre antibatteriche, ignifughe e facilmente lavabili, caratteristiche che le rendono perfette per ambienti progettati per ospitare le persone. Semplici e veloci da realizzare, rispetto a una tradizionale ristrutturazione, questi elementi offrono la possibilità di eseguire riqualificazioni in regime di cantiere a secco, ovvero senza l’impiego di attrezzature invasive e strumentazioni rumorose, incompatibili con la normale attività dei locali pubblici. In questo modo si assicura agli esercenti e ai ristoratori il vantaggio di evitare la chiusura dell’esercizio, con la conseguente perdita di introiti, e la possibilità di realizzare rinnovamenti economicamente sostenibili. Le soluzioni 3M AMD sono in grado di rendere uno spazio unico - moderno o classico, colorato o minimalista - anche ogni ambiente della casa, dando un tocco di originalità ed eleganza a porte, finestre, pavimenti, pareti divisorie, cabine armadio, vani doccia e ante in vetro. Tra le alternative creative proposte dalla multinazionale americana in grado di realizzare ambientazioni nuove, uniche e inusuali per gli spazi del lavoro, del vivere quotidiano e del tempo libero, spiccano le Soluzioni 3M DI-NOC. Si tratta di una gamma di rivestimenti materici estremamente flessibili e adatti alla riqualificazione di ogni superficie, anche in 3D, declinabile in circa venticinque famiglie, per un totale di oltre cinquecento pattern, che riproducono fedelmente le più diffuse finiture, dal legno ai metalli, dal marmo allo stucco, alla pietra, al carbonio per arrivare fino ai tessuti goffrati e alla pelle. In grado di integrarsi perfettamente nel contesto dell’applicazione per la quale sono stati scelti, questi rivestimenti offrono nuove prospettive di espressione al design d’interni, nuove interpretazioni creative dello spazio, inedite dimensioni materiche e un sistema costruttivo leggero ma dall’elevata qualità estetica e tecnica. (VB) Dynamic aesthetics, customisation, flexibility, quick installation, optimal pricing and quality are the main guarantees for the interior design world with innovative graphic solutions by 3M. Having become one of the primary cultural assets of 3M, the world of interior design in the most ample definition of the term or rather, the interpretation of the complex needs of customers and design assistance for integrated solutions that answer those needs, 3M has a very wide range of

solutions available. Thanks to a century of experience with constant and meticulous development of new eco-compatible technologies, 3M Architectural Market can be considered without a doubt as a point of reference for designers, architects, design studios and decorators involved in the fascinating world of interior design, restoration and contracting. The contracting sector ranges from market to retail in areas ranging from seaside to transit and in sectors that go from hospitality to health care. Offices are one of the areas that are restored most frequently with the installation of dividing walls or glass walls as well as furnishings and flooring. 3M AMD solutions were developed for the contracting sector and they offer the widest array of choices. Technologically advanced, they have an exclusive design that is perfectly aligned with market trends. These materials are able to satisfy both stylistic and functional needs and more. They have been tested and they are durable under all conditions, they are easy to install, they are a secure investment and there is almost no maintenance required. Many 3M AMD solutions for the contracting sector are also anti-bacterial, fireproof and easy to clean which makes them perfect for areas where people interact. They are simple and easy to use even in areas where renovation has to be carried out without invasive tools or noisy equipment that interferes with the normal activity of the public area. This means that businesses and restaurants have no reason to close their business and lose profits in order to carry out economically sustainable renovation. The 3M


magazinenews dal mondo BELLEZZA

BLUETTE LIFESTYLE SALON E’ nato a due passi dai Navigli, BluetteLifestyle Salon, un salone dal design unico ispirato dalla passione del titolare, Ermanno, per la barca a vela, attività di chi vive e ama la natura. Il corpo della barca è rappresentato dai lavatesta, 5 postazioni ricavate da un unico tronco di rovere. L’Albero maestro si riconosce nella scaffalatura delle vetrine, un’unica struttura di 12 metri quasi completamente autoportante, sospesa grazie a soli due sostegni laterali e, infine, vere e proprie vele applicate a soffitto che riflettono la luce in tutto lo spazio. Il salone si sviluppa in 150 mq suddiviso in tre ambienti, quello principale con 6 postazioni, zona lavaggio e reparto tecnico dedicato alla colorazione e uno spazio all’interno con una zona più riservata e intima con altre 5 postazioni. Al primo piano una cabina dedicata ai trattamenti Aveda per viso e corpo. Le mura del salone sono trattate a calce della Valtellina. Completamente naturale e priva di pigmenti artificiali, questo fantastico materiale offre una composizione tridimensionale, pura e completamente eco-compatibile. Il pavimento del salone è ricoperto da una speciale miscela di resina, terra proveniente dall’isola di Creta. Le postazioni, i lavaggi, la cassa, gli espositori sono stati realizzati dall’ebanista Giuseppe Amato, che ha fuso materie prime nobili come acciaio inox di recupero da vecchie fabbriche e legno di rovere “stagionato in radice”. Ogni lampadina che illumina gli interni è a risparmio energetico pur diffondendo una luce calda e piacevole riflessa dalle candide vele bianche. I titolari del negozio, Ermanno e il figlio Lorenzo, lavorano costantemente fianco a fianco, uniti dalla comune passione per il lavoro e dalla voglia di offrire un servizio di altissima qualità nel rispetto dell’ambiente e del mondo in cui viviamo, in armonia con la filosofia di Aveda. (AS) www.avedaitalia.it Right nearby Navigli, the BluetteLifestyle Salon has a unique design inspired by the owner Ermanno’s passion for sailing – a favourite of nature lovers. The hair washing station looks like a ship with 5 sinks carved from a single trunk of oak. The mast can be seen in the display window shelves – the single 12 meter structure is almost entirely load bearing and it is only suspended by two supports on the side. Lastly, the sails applied to the ceiling reflect light throughout the area. The salon is set up in a 150 square

meter area divided into three rooms: one main room with 6 work areas, a washing area and a technical area for hair colouring as well as a space on the interior with a private area with another 5 work stations. On the upper floor we find a cabin dedicated to Aveda treatments for the face and body. The walls of the salon are treated with Valtellina lime. Completely natural and without any artificial pigments, this fantastic materials offers a threedimensional composition that is pure and completely eco-compatible. The floor of the salon is covered with a special mix of resin and earth from the island of Crete. The work stations, the washing station, the main desk and the stands were made by master cabinet maker Giuseppe Amato who used noble materials such as stainless steel recuperated from old factories and aged oak root wood. Each light bulb that illuminates the interiors saves energy and gives out a warm and pleasant light with white reflections. The owners of the store, Ermanno and his son Lorenzo, work side by side with a shared passion for the trade and a desire to offer incredibly high quality service that respects the environment and the world we live in – in harmony with the philosophy of Aveda. (AS) www.avedaitalia.it

BELLEZZA

Uno shampoo che profuma d’arancia SHAMPOO WITH AN ORANGE AROMA Rinfrescante e delicato, il nuovo shampoo arancia di Luca Milano è particolarmente adatto a tutti i tipi di capelli. La sua formulazione, con estratti di arancio, lo rende ideale per i lavaggi frequenti, purifica e rinfresca la cute lasciando i capelli morbidi, setosi e lucenti. Tutti i prodotti a marchio di Luca Milano sono realizzati con cura artigianale da esperti cosmetologi, utilizzando esclusivamente materie prime di derivazione naturale; prodotti in in Italia e non testati sugli animali. (AS) Refreshing and delicate, the new orange shampoo by Luca Milano is especially suited for all types of hair. Its formula contains orange extract which is ideal for frequent use. It purifies and refreshes the skin leaving your hair soft, silky and shiny. All Luca Milano products are made with artisan care by expert cosmetologists and they are made exclusively from natural materials produced in Italy that are not tested on animals. (AS)

14


studiocreta.it

Tulip. Una collezione Arblu introduce le novità di Tulip, il sistema arredo bagno completo di importanti novità. Consolle, colonne girevoli, specchiere e accessori in metallo verniciato. Ogni elemento della collezione è personalizzabile nelle finiture, per trasformare il bagno in uno spazio intimo e unico.

Salone Internazionale del Bagno Padiglione 24 Stand F05 www.arblu.it - info@arblu.it - Numero Verde 800557989


magazinenews dal mondo WELLNESS

SPA PALAZZO ARZAGA Si deve all’architetto Silvia Giannini il riuscito restyling della Spa dell’Hotel Spa e Golf Resort Palazzo Arzaga, fascinosa struttura di Calvagese della Riviera, nelle vicinanze del Lago di Garda. Il centro Benessere trova spazio in un’ala più recente dello storico palazzo, antico monastero del XV secolo, quindi residenza nobiliare di campagna, e l’intervento, senza cadere nella trappola del falso storico, ha tenuto conto, reinterpretandola con spirito contemporaneo, della tradizionale eleganza del luogo, le cui stanze sono arredate in stile veneziano e lombardo del XVIII e XIX secolo. Il complesso è immerso nel verde e questo stretto legame con la natura circostante ha ispirato le linee guida del lavoro. I fiori, in particolare, sono diventati il motivo centrale della decorazione, di grande effetto anche se molto raffinata, soprattutto nella scelta delle tonalità cromatiche. Le grandi, spesso enormi corolle, compaiono infatti unicamente sulle porte dei camerini, declinando tutta una serie di dolci, delicate sfumature cipria, che ben si abbinano a riposanti beige e tortora. I materiali utilizzati, marmo e mosaico, sono anch’essi tradizionali, ma rivisitati in maniera molto attuale. Tutto nella Spa, che ha una superficie di 400 m2, deve contribuire a creare un’atmosfera propizia al relax, alla distensione, avvolgere come in un confortevole bozzolo La zona umida, “Sentiero delle nuvole”, elemento Aria, caratterizzata da mosaici in vetro nei pavimenti e nei rivestimenti, comprende sauna a bassa temperatura (aromatizzata), docce, sauna finlandese e bagno turco, la cui porta è incorniciata da lucenti, spettacolari mosaici violetti e grandi crocus, mentre all’interno si librano in volo farfalle leggere. l “Sentiero di campagna”, elemento Terra, comprende 5 cabine, ognuna dedicata ad una pianta del Lago di Garda, i cui componenti, siano essi foglia od olio essenziale, si ritrovano nella carta dei trattamenti, mentre il “Sentiero dell’acqua”, elemento Acqua, ha una piscina interna termalizzata con nuoto contro-corrente, e piscina esterna per la bella stagione. Lo spazio più esclusivo e vero punto di forza del centro benessere, dove vengono impiegati prodotti Clarins, è la Spa Suite, nel “Sentiero della Fiamma”, elemento Fuoco. Si tratta di un ambiente ideale per la coppia, una sorta di salotto privato in cui domina il marmo, e dagli esclusivi, originali arredi. Qui, infatti, dove troviamo una grande vasca per due con idromassaggio, le sedute nella sauna e nel bagno turco diventano, rispettivamente, grazie all’innovativo design, un divanetto di marmo e una panchetta sagomata con i braccioli. (CS) www.palazzoarzaga.com Architect Silvia Giannini must be complemented on her redesign of the Spa for Hotel Spa and Golf Resort Palazzo Arzaga. The enchanting structure is located in Calvagese della Riviera near Garda Lake. The wellness centre is located in the most recent wing of a historic building. Built as a monastery in the fifteenth century, it later became the country home of a noble family. This design went beyond the usual false historical traps and reinterpreted it with a contemporary spirit and the traditional elegance of the site. The rooms are furnished in Venetian and Lombard style from the eighteenth and nineteenth centuries. The complex is surrounded by greenery and this close bond with the surrounding nature inspired the guidelines for the project. The flowers in particular became a central theme for the decorations and they give it an impressive and very refined effect thanks to the colour pairings chosen. The large and almost enormous petals only appear on the doors of the rooms in a series of soft and delicate powder tones that blend with the relaxing beige and dove grey. The materials include marble and mosaics, which are traditional materials; but here, they have been interpreted in a contemporary key. Everything in the 400 square meter spa helps to create a relaxing atmosphere with an enveloping comfort that is like a cocoon. The wet area is named “Sentiero delle nuvole”, the element of air, which is characterised by the glass mosaic floor tiles and wall coverings, includes the low temperature aromatised sauna, showers, Finnish saunas and Turkish baths framed by shiny violet and large crocus mosaics while the interiors are decorated with light butterflies. The “Sentiero di campagna” represents the element earth with 5 cabins dedicated to a plant from Garda Lake with leaves and essential oils used in the treatments while “Sentiero dell’acqua” represents

the element of water with an internal thermal cross-current swimming pool as well as an outdoor pool for nice weather. The most exclusive area and a true strong point for the wellness centre (where they use Clarins products) is the Spa Suite. Part of the “Sentiero della Fiamma”, it represents the element of fire and it makes an ideal environment for couples with a private living area decorated with marble and exclusive original furnishings. Here where we find a large bathtub for two with a whirlpool bath. Seating in the sauna and the Turkish bath is provided by a marble sofa and a moulded bench with arms thanks to innovative design. (CS) www.palazzoarzaga.com

BELLEZZA IL PROFUMO DELLA RUGIADA THE PLEASURE OF DEW Piacerà agli ecologisti ma anche a tutte le persone che amano fare una bella passeggiata in montagna, assaporando i profumi della natura. E’ l’acqua profumata Muschio del Trentino, una vera e propria carezza per il corpo con le sue note delicate e floreali ancora umide della rugiada mattutina e i sentori silvestri. Ultimo nato nella collezione Acque d’Italia. Adatta per ogni momento della giornata vaporizzata sulla pelle, per renderla meravigliosamente profumata, risveglia i sensi con la sua avvolgente e esclusiva fragranza, regalando al corpo un’armoniosa sensazione di benessere. La linea comprende il Doccia Schiuma, Bagno Schiuma, Crema Corpo, Crema Fluida Corpo e Eau Toilette Spray. (AS) This will please ecologists and all those who like to walk in the mountains and breathe in the fresh natural air. The scented water Muschio del Trentino caresses the body with delicate floral tones that are still fresh with the morning dew and woodsy depth. It is the latest in the Acque d’Italia collection. Perfect for any time of the day just spray it on the skin to leave a wonderful aroma and reawaken your senses with its enveloping and exclusive fragrance that gives the body a harmonic feeling of wellness. The line includes the shower soap, bath soap, body cream, body cream and Eau Toilette Spray. (AS)


magazinenews dal mondo CONCORSI

PRODOTTO

IL RAME E LA CASA Lo spirito sempre più green degli 2012 aspirapolvere Electrolux COPPER AND THE HOME 2012 Il rame chiama a raccolta il mondo del design, e lo fa ancora una volta dall’Italia con la 4a edizione del concorso internazionale “Il Rame e la Casa”, promosso dall’Istituto Italiano del Rame (IIR) in collaborazione con European Copper Institute (ECI). Dopo il grande successo ottenuto nelle passate edizioni, si rinnova così l’ormai consueto appuntamento con un premio oggi riconosciuto in tutto il mondo e che continua ad attrarre un numero crescente di adesioni, più che triplicate dal 2007 a oggi. Giovani progettisti e studenti provenienti dai più diversi Paesi si confronteranno nell’ideazione e progettazione di oggetti in rame e sue leghe per il design d’arredo, sperimentando nuove applicazioni estetiche e funzionali di questo versatile materiale. Il premio, ideato da IIR per raccontare in maniera innovativa e anticonvenzionale le infinite potenzialità espressive del rame, si rivolge a due distinte categorie: designer e architetti professionisti e studenti regolarmente iscritti presso scuole superiori di grafica, arredamento, design, facoltà di architettura o design, dottorati e master. Il concorso è volutamente riservato ai giovani, motivo per il quale si è posto un limite di età inferiore a 40 anni. La scadenza per la consegna degli elaborati è il 30 settembre 2012. (PF) Copper is calling together the world of design once again in Italy with the 4th edition of the international competition “Il Rame e la Casa” promoted by the Italian Copper Institute (IIR) together with the European Copper Institute (ECI). After the great success of past editions, the occasion offers an opportunity to compete for an award recognised worldwide that continues to attract a growing number of participants (more than tripling since 2007.). Young designers and students from many different countries will debate over the creation and design of products in copper and its alloys for furnishing designs with new aesthetic and functional applications for this versatile material. The competition, developed by IIR to express the unlimited expressive potential of copper in an innovative and unconventional manner is aimed at two distinct categories: designers and professional architects as well as students attending graphic design, furnishing, design or architecture schools pursuing doctorates and masters’ degrees. The competition is especially for young people and participants must be less than 40 years old. The deadline for sending in designs is 30 September 2012. (PF)

18

THE INCREASINGLY GREEN SPIRIT OF THE ELECTROLUX VACUUM Ergorapido di Electrolux, la prima scopa elettrica ricaricabile 2in1 cordless, lanciata sul mercato nel 2004 e la più venduta in Europa nel 2010, ha continuato ad evolvere tra restyling e ampliamenti di gamma, mantenendo inalterato il suo glamour iniziale. E’ oggi la volta della versione extra-power dall’animo ancor più ecologico: Ergorapido Plus Green arricchisce e perfeziona la Green Range di Electrolux, completando gli innovativi aspirapolvere a traino dai massimi livelli di eco-compatibilità. Resistente e affidabile è realizzata per il 70% con materie plastiche riciclate. La batteria adottata, di ultimissima generazione, è al Litio da 18V per un’autonomia di carica maggiore e per la capacità di ricarica rapida (4h): leggera e potente, presenta caratteristiche che si traducono in una migliore resa, con la conseguenza di una maggiore forza aspirante (+20%) dell’apparecchio e di una potenza massima più elevata. Una scopa totalmente save energy in cui il carica batterie si spegne completamente a caricamento ultimato, consumando in stand-by soli 0,3W. (PF) Ergorapido by Electrolux is the first rechargeable 2 in 1 floor cleaner. It was launched on the market in 2004 and it was the biggest seller in 2010. Its evolution has been constant with design updates and range extensions without ever affecting its inherent glamour. Today the extra-power version has an even more ecological heart: Ergorapido Plus Green enriches and perfects the Green Range by Electrolux, extending the range of floor cleaners with the highest levels of environmental friendliness. It is resistant and dependable and it is made from 70% recycled plastic. The battery is the new generation of lithium 18V batteries which provide greater charging capacity with a quick recharge (4h): it is light and powerful which make it higher performing with higher level aspiration (+20%) and a higher maximum power. The energy saving floor cleaner’s battery turns off completely when the battery is charged and it only consumes 0.3W in stand-by mode. (PF)

BELLEZZA

UN CORPO PERFETTO OGNI GIORNO A PERFECT BODY EVERY DAY

La Crema Corpo della linea Perfect Body Hanorah è nutriente e leggera, favorisce l’idratazione e, come una seconda pelle, aiuta a proteggere l’epidermide dall’invecchiamento cutaneo e prematuro attraverso i suoi principi attivi. Macronutrienti dei semi di Carruba, alternativa vegetale all’acido ialuronico, che formano un film invisibile che protegge la pelle, con proprietà anti-disidratanti e emollienti; e Aloe vera. Applicare dopo bagno e doccia, massaggiando fino ad assorbimento. (AS) The body cream of Hanorah’s Perfect Body line nourishes the skin lightly to help moisturise and protect it from premature aging with its active ingredients like a second skin. Macro nutrients from carob seeds are a vegetable alternative for hyaluronic acid forming an invisible film that protects the skin with emollients, moisturising agents and aloe vera. Apply after baths and showers and massage until the cream has been completely absorbed. (AS)


WELLNESS

Il Castello del Nero Nel cuore del Chianti, a 20 km da Firenze, si erge l’Hotel Il Castello del Nero a dominare la Val di Pesa. Mozza il fiato lo spettacolo della natura che incornicia a 360° le vestigia rinnovate della storica residenza di campagna dei nobili fiorentini del Nero, risalente al XII secolo. I 400 ettari di terreno di proprietà, coltivati a vigneti e uliveti, circondano il Castello del Nero, fiore all’occhiello tra i membri del Leadings Hotel of the World, offrono un’eccellente e selezionata produzione di Rosso di Castello del Nero, e di olio extravergine d’oliva prodotto in loco. La recente ristrutturazione del Castello - passato di proprietà alla famiglia Torriggiani a fine ‘800 - ha conservato il suo aspetto originario e riportato alla luce una collezione di tesori d’arte come i blasoni e i camini originali, i pavimenti in cotto antico e i soffitti a volta in legno pregiato che si ritrovano ora sia nelle aree comuni che in alcune camere. Le 32 camere e 18 suite hanno mantenuto gli affreschi interni e le ampie finestre che le caratterizzano in modo unico, donando un’aura di antichi fasti. E’ in questo contesto che sorge la prestigiosa SPA dell’Hotel. Oltre 1000 mq. dedicati al benessere: il percorso Heat Experience, la Vitality Pool, un’ampia Area Relax e 10 cabine dove godere di trattamenti personalizzati. La piscina semi-olimpionica esterna è riscaldata e si affaccia sull’intera vallata. La spa è stata progettata da ESPA, uno degli studi internazionali più rinomati al mondo per la realizzazione di strutture benessere, tra le quali la recentissima Espa al Ritz Carlton di Mosca. .Susan Harmsworth, CEO e fondatrice di ESPA, ha riunito l’eccellenza dei progettisti e dei ricercatori per offrire uno studio completo della SPA: dalla progettazione all’immagine, ai prodotti, ai trattamenti. Susan applica da oltre trent’anni il suo approccio olistico nei trattamenti, avvalendosi dei più avanzati ritrovati scientifici per l’estrazione e applicazione dei prodotti naturali. (GT) www.castellodelnero.it - www.espaonline.com In the heart of the Chianti territory just 20 km from Florence we find Hotel Il Castello del Nero rising over the Valley of Pesa. It is a spectacular sight to see the nature framing the renovated vestiges of the historic country residence of the Florentine noble family Nero which dates back to the 12th century. With 400 hectares of land covered in vineyards and olive groves, Castello del Nero is one of the most important members of the Leading Hotels of the World and it also is known for its excellent red wine Rosso di Castello del Nero and the extra virgin olive oil produced there. The castle was recently renovated – ownership was transferred to the Torriggiani family at the end of the 1800s – maintained the original aspect and brought to light a collection of art treasures including family stems and original chimneys. The antique terracotta flooring and the vaulted wood ceilings are found in the common areas and in some of the rooms. The 32 rooms and 18 suites have frescoes inside and large windows that make it truly one of a kind with a tone of antique luxury. The hotel also has a prestigious spa measuring over 1000 square meters dedicated to wellbeing: with a choice of treatments including Heat Experience, the Vitality Pool, the large Area Relax and 10 cabins for enjoying personalised treatments. The semi-Olympic pool outside is heated and it faces over the valley. The spa was designed by ESPA, which is one of the most famous international firms in the world for the construction of wellbeing centres including the recently built Espa at the Ritz Carlton in Moscow. Susan Harmsworth, the chief executive officer and founder of ESPA has blended design and development excellence to provide a complete design with a spa: offering design, image, products and treatments. Susan has been using the holistic approach in treatments for over thirty years using the most advanced scientific discoveries to extract and apply natural products. (GT) www.castellodelnero.it - www.espaonline.com

PuraVida® DISCOVER PURIT Y

Scopri PuraVida® su www.hansgrohe.it/puravida

Diamo valore all‘acqua: con la tecnologia Ecosmart, i miscelatori Hansgrohe permettono di risparmiare il 50% di acqua e di ridurre il consumo energetico e le emissioni di CO2.


progettoa tu per tu Testo di Andrea Brega

Green al centro del progetto GREEN AT THE HEART OF DESIGN A COLLOQUIO CON GUIDO PESENTI, PRESIDENTE MAMOLI RUBINETTERIE, E GIUSEPPE PRESOTTO, AMMINISTRATORE ARBLU, SU UN TEMA SEMPRE PIÙ ATTUALE: LA SOSTENIBILITÀ AN INTERVIEW WITH GUIDO PESENTI, PRESIDENT OF MAMOLI RUBINETTERIE, AND GIUSEPPE PRESOTTO, THE MANAGING DIRECTOR ARBLU, ABOUT AN INCREASINGLY CURRENT ISSUE: SUSTAINABILITY Quanto è importante oggi il tema Green nell’arredo-bagno? Guido Pesenti Mamoli è un’azienda attenta agli stimoli di natura ambientale e sociale e non può quindi trascendere dal considerare il Green quale tematica centrale nella progettazione dei propri prodotti e processi industriali. L’ecosostenibilità e il risparmio idrico dovrebbero essere particolarmente sentiti nel nostro settore dal momento che l’oggetto della progettazione è un vero e proprio “strumento per l’acqua”. Oggi più che mai è infatti necessario progettare l’acqua, sia perché siamo consapevoli che si tratta di una risorsa pubblica e di un patrimonio comune da tutelare, sia perché crediamo che il design possa concretamente dare delle risposte e proporre nuovi e avanzati modelli di sviluppo sostenibile. Giuseppe Presotto E’ un tema sensibile che sta interessando una quantità sempre maggiore di aziende e un sempre maggior numero di persone orienta il proprio acquisto verso prodotti ecologici ritenendolo un valore aggiunto imprescindibile. A mio avviso le tematiche legate alla sostenibilità ambientale sono però ancora poco sviluppate dalle aziende dell’arredo-bagno, se non da una piccola parte che ha ripensato l’intero sistema in ottica Green. Nella sua azienda Green vuol dire materiali, tecnologia o progetto? Guido Pesenti Il concetto per Mamoli coinvolge più aspetti per noi inscindibili, declinati con coerenza in tutti gli ambiti della nostra attività, dalla progettazione fino alla scelta finale del packaging. Ci impegniamo, infatti, nella creazione di prodotti e sistemi che minimizzino il consumo energetico e riducano lo spreco di risorse durante l’utilizzo, attraverso l’uso di tecnologie innovative e imballi

020


in cartone riciclato biodegradabile. Investiamo in ricerca e sviluppo per trovare nuove soluzioni progettuali e produttive che portino ad avere prodotti e processi rispettosi dell’uomo e del suo habitat. Poniamo la massima attenzione all’uso responsabile delle risorse, preservando le fonti di energia non rinnovabili, ottimizzando i processi di produzione e attuando una pianificazione accurata. Per questo abbiamo predisposto impianti produttivi a circuito chiuso, dove l’acqua utilizzata nei processi galvanici viene depurata e reimpiegata in nuove produzioni e abbiamo realizzato un processo di gestione e lavorazione dei residui produttivi che non vengono dispersi nell’ambiente ma trattati a protezione del nostro ecosistema. Per lo stesso motivo, ogni singolo prodotto che esce dai nostri stabilimenti viene sottoposto a prove di tenuta tramite macchine pneumatiche: il meccanismo di collaudo ad aria permette di unire una maggiore precisione di misurazione a una migliore gestione delle risorse, innalzando contestualmente il livello qualitativo del prodotto. Il ciclo produttivo interno consente inoltre un costante monitoraggio delle fasi di lavorazione del prodotto e della sua conformità a quanto prescritto dalla norma UNI EN ISO 9001:2008 e nel rispetto dei principi del made in Italy. Giuseppe Presotto Green per noi è una visione delle cose, uno stile di vita che a partire dallo sviluppo, alla scelta dei materiali fino alla produzione, si svolge all’insegna della sostenibilità e della tutela dell’ambiente. L’attenzione verso gli impatti ambientali, il riciclaggio e l’ambiente di lavoro è da sempre parte integrante della filosofia di Arblu. Il nostro core business è il box doccia, le cui componenti essenziali sono vetro e profili in alluminio, materiali che a fine vita si possono tranquillamente riciclare. Inoltre stiamo lavorando sugli imballaggi escludendo polistirolo e plastica a favore della In apertura, la nuova serie della gamma Project di Mamoli, completa di accessori e soluzioni per il bagno e per la cucina. Sotto, un ritratto di Guido Pesenti, presidente di Mamoli Robinetterie spa. In questa pagina, in alto: collezione Tulip by Arblu. Sotto: Giuseppe Presotto, amministratore Arblu.

On the first page, the new series of the Project range by Mamoli complete with accessories and solutions for the bathroom and the kitchen. Below, a portrait of Guido Pesenti, president of Mamoli Rubinetterie spa. On this page above: the Tulip collection by Arblu. Below: Giuseppe Presotto, Arblu’s managing director.

021


carta, facilmente separabile e riciclabile. Per quanto riguarda il consumo d’acqua delle nostre docce cerchiamo di ridurre gli sprechi utilizzando, per esempio, soffioni a basso consumo. Un prodotto “Green” aiuta l’export? Guido Pesenti Nei mercati esteri, il processo di sensibilizzazione verso questa tematica ha avuto inizio in un periodo precedente rispetto a quanto avvenuto in Italia. Questo si è tradotto concretamente in requisiti di prodotto che includono standard legati al rispetto ambientale. Anche lo sviluppo di nuovi segmenti di mercato, quali il Social Housing, che in Italia sta ancora muovendo i primi passi, ma è già pienamente affermato soprattutto nei paesi del Nord Europa, ha contribuito all’affermazione sul mercato di prodotti eticamente corretti. In sintesi, il prodotto Green non “aiuta” l’Export, ma è funzionale all’acquisizione di valore aggiunto sui mercati esteri. Giuseppe Presotto Dipende molto dai mercati di riferimento che possono essere più o meno sensibili a queste tematiche e prediligere magari prodotti meno dispendiosi a soluzioni ecologiche. Dalla nostra esperienza, al momento, nell’arredo-bagno il Green non sembra ancora essere un fattore determinante per l’export.

How important is a ‘green’ philosophy to bathroom furnishings? Guido Pesenti Mamoli is very conscientious about environmental and social drivers and we absolutely consider green philosophies as a central theme in the design of our products and industrial processes. Eco-sustainability and water savings should be especially important in our sector considering that the product being designed is a true “water tool”. Today more than ever we need to apply design to water both because we are aware that it is a public resource and a shared patrimony that must be protected and because we believe that design can provide concrete answers and offer new and advanced models for sustainable development. Giuseppe Presotto It is a sensitive issue that is involving an increasing number of companies and a greater number of persons choose to purchase more ecological products and consider it as an absolute must. In my opinion, the themes surrounding environmental sustainability have still not been developed enough by bathroom furnishing companies except for a small part that has redesigned the whole system from an ecological standpoint.

022

In your company does ‘green’ refer to the materials, the technology or the design? Guido Pesenti For Mamoli the concept involves a number of absolutely fundamental aspects that equally include all of the areas of our business from design to the final packaging choices. We work to create products and systems that minimise energy consumption and that reduce the waste of resources during use with innovative technologies and recycled biodegradable cardboard packaging. We invest in research and development to find new design and manufacturing solutions that bring about products and processes that respect humanity and our habitat. We place the maximum attention on the responsible use of resources by preserving non renewable energy sources, optimising manufacturing processing and actuating accurate planning. That is why we have set up closed circuit manufacturing systems where the water used in the galvanising processes is purified and reused for new production and we have developed a management and processing system for manufacturing residues that are treated to protect our ecosystem instead of being dispersed into the environment. That is why each single product that comes from our

factories is put to the test with a pneumatic machine to check the seal: the air control mechanism test makes it possible to provide better measuring and a better management of resources thus furthering the quality of the product. The internal manufacturing cycle makes it possible to constantly monitor the product processing stages to ensure that they are conformant with norm UNI EN ISO 9001:2008 and that they respect Italian manufacturing codes. Giuseppe Presotto For us, ‘green’ is a vision of things. It is a lifestyle that begins with development and involves material choices and even production: it all has to be sustainable and protect the environment. Attention on environmental impact, recycling and the work environment has always been an integral part of Arblu philosophy. Our core business is shower enclosures. The essential components are glass and aluminium frames and these materials can be recycled easily at the end of the product life. We are also working on excluding polystyrene and plastic by using paper that is easy to separate and recycle. Regarding water consumption, our showers reduce waste by using, for example, low consumption shower heads.


Are “green” products easier to export? Guido Pesenti In foreign markets the process of making the public aware of this theme started earlier than it did in Italy. This translated concretely into product requisites that include standards tied to environmental respect. The development of new market segments such as social housing, which is just beginning in Italy while it is already functioning fully in northern European countries, has also helped to affirm ethically correct products on the market. To sum it up, ‘green’ products are not ‘easier’ to export but they do provide added value in foreign markets. Giuseppe Presotto That depends a great deal on the markets of reference, which can be more or less sensitive about these themes and favour less expensive products over ecological solutions. From our experience currently in the bathroom furnishing sector, it does not seem to be a decisive factor on imports whether a product is green.

Nella pagina precedente, da sinistra: serie Tool di Mamoli, finiture cromo, satinato e serie H2VIP di Mamoli, finiture cromo, nero, bianco. In questa pagina, box doccia Sei Separet by Arblu.

On the preceding page from the left: the Tool series by Mamoli with a chrome satin finish and the H2VIP series by Mamoli with a chrome, black and white finish. On this page the Sei Separet shower enclosure by Arblu.

023


progettoazzurra Testo di Elviro Di Meo

Glaze: Eleganza senza tempo GLAZE: TIMELESS ELEGANCE IL CONCETTO DI NUDITÀ, DI GESTI ANCESTRALI LEGATI ALL’INDIVIDUO, RISCOPERTO NELLA SUA ESPRESSIONE PIÙ NATURALE, HA STIMOLATO LINEE SEMPLICI E NITIDE PER POI DIVENIRE IL LEITMOTIV DELLA PROGETTAZIONE FIRMATA GORDON GUILLAUMIER THE CONCEPT OF NUDITY AND ANCESTRAL PRACTICES LINKED TO THE REDISCOVERY OF THE INDIVIDUAL IN HIS MOST NATURAL EXPRESSION GAVE RISE TO SIMPLE AND CLEAR LINES THAT HAVE DEVELOPED INTO THE LEITMOTIF FOR DESIGN BY GORDON GUILLAUMIER Porta la firma di Gordon Guillaumier la nuova serie di sanitari prodotta dal Marchio Azzurra. Una collezione di dieci pezzi in ceramica, in cui il designer di origine maltese ha racchiuso, nella ricerca formale, enfatizzata dalla componente materica, l’eleganza equilibrata dell’essenzialità, che rimanda, da subito, alla filosofia progettuale spiegata con le parole dello stesso autore. “Nudo, di fronte alla materia ceramica, bianca, piena di luce, totemica, nello svolgere la ritualità quotidiana della cura del corpo, sono entrato spesso in contatto con la parte più intima di me, svelandola. Questa primitiva gestualità che prescinde dalla classe sociale o cultura di appartenenza, ha sempre avuto per me un forte e sano valore democratico”. Il concetto di nudità, di gesti ancestrali legati all’individuo, riscoperto nella sua espressione più naturale, ha stimolato le linee semplici e nitide per poi divenire il leitmotiv nella progettazione della collezione Glaze, ispirata alle forme pure, morbide e funzionali dei beakers da laboratorio. Guillaumier pone l’accento sulle proporzioni e sulle dimensioni di ciascun elemento, così da renderlo adatto sia agli ambienti domestici e sia ai bagni pubblici. Ambienti, questi ultimi, dove lo spazio limitato rispecchia il vivere moderno. Ma l’attenzione di Gordon Guillaumier è andata oltre il dimensionamento dei corpi, soffermandosi su aspetti formali non meno importanti. Ha voluto mantenere, nel disegno dell’intera gamma di prodotti, un tratto omogeneo, in modo che ogni pezzo potesse riflettere lo stesso animo e la stessa filosofia. Ne viene fuori un’armonia visiva, sempre costante, che pervade tutta la collezione. La serie Glaze, proprio grazie al design, dall’approccio sobrio ed equilibrato, è destinata a sopravvivere alle mode e alle tendenze che durano

giusto il tempo di una stagione. L’atemporalità – altro valore aggiunto – fa accrescere sul mercato l’appeal del progetto. Questo fa sì che, dal momento in cui viene collocata nella stanza da bagno, è come se diventasse estensione naturale dell’architettura degli ambienti. Non esiste, infatti, - in questo caso - una linea di demarcazione netta tra architettura e oggetti di design, ma di reciproca corrispondenza in una sorta di funzione biunivoca. La linea è composta da due lavabi sospesi da 60 cm. e da 75 cm., due lavabi a incasso, sempre delle stesse dimensioni, un lavabo da appoggio da 60 cm; bidet e wc sospesi, bidet e wc terra: tutti da 52 cm. e monoblocco. Design e non solo. Con Glaze, l’azienda porta sul mercato prodotti che assicurano il risparmio del consumo idrico. A tale riguardo, i wc hanno ottenuto la certificazione per lo scarico a tre litri di acqua con un impianto idraulico standard, in conformità ai requisiti richiesti per i vasi di classe 2, secondo la norma EN 997 (standard europeo per i wc). Un traguardo importante raggiunto nell’ottica di rafforzare, all’interno della programmazione aziendale, il concetto della sostenibilità ambientale. Azzurra detiene il primato mondiale di ‘water saving’, attraverso il brevetto dello scarico da 2,7 litri applicato ai wc della serie Thin. Per un’ipotesi di utilizzo pari a venti scarichi giornalieri, prendendo come riferimento un nucleo familiare composto da quattro persone, il risparmio idrico con il sistema certificato Azzurra 2,7 litri è di 31000 litri in un anno: ovvero, circa quattro anni e mezzo di acqua garantita a persona. I prodotti Azzura, con la collezione Glaze, saranno presentati al padiglione 22 stand B39, del Salone del Mobile di Milano.


The new series of sanitary fixtures by Azzurra was designed by Gordon Guillaumier. The ten-piece ceramic collection was formally developed by the Maltese designer to embody the balanced elegance of essentialism emphasised by the material, which is strictly linked to the design philosophy as he describes it in his own words. “At times while standing undressed in front of the glossy white ceramic bathroom fixtures going about my daily personal care routine, I have been able to come into contact with and unveil the innermost part of myself. This almost primitive gestuality has always seemed like a strong and sound democratic value to me as it goes beyond social classes or different cultures” The concept of nudity and ancestral practices linked to the rediscovery of the individual in his most natural expression gave rise to simple and clear lines that have developed into the leitmotif for the design of the Glaze collection. Inspired by the pure, soft and functional forms of lab beakers, Guillaumier places the accent on the proportion and size of each element making it perfect for the home or for public bathrooms. The limited space of today’s bathrooms mirrors modern living, but Gordon Guillaumier has gone beyond the size of the fixtures to place emphasis on other developmental aspects that are just as important. He wanted to maintain a homogeneous bond in the design of the entire product range so that each piece reflects the same spirit and the same philosophy. The result is a totally constant visual harmony that is felt throughout the collection. Thanks to its design, the Glaze series has a refined and balanced approach that is destined to survive the fashions and trends that only last a season. The timelessness is another added value of this design that further increases its market appeal. This means that from the moment it is placed in the bathroom, it becomes a natural extension of the design of the areas. In this case there is no clear dividing line between the architecture and the design object: it is a reciprocal correspondence in bi-univocal function. The line is made up of two suspended sinks measuring 60 and 75 cm, two built-in sinks with the same measurements, a counter-top sink measuring 60 cm, suspended toilet and bidet fixtures as well as floor-mount bidets and toilet fixtures all measuring 52 cm and a tank-top toilet. Glaze is about design and more. With this line, the company is laun-

ching products that ensure water savings. The toilet fixtures have received certification for the three-litre flush for use with a standard plumbed system as required for class 2 toilet fixtures by EN 997 (European Toilet Standards). This is an important achievement for reinforcing the concept of environmental sustainability within the company programming. Azzurra holds the world title for ‘water saving’ with the patented 2.7 litre flush used for the Thin series. If we consider a family of four and a hypothetical twenty flushes per day, the certified Azzurra 2.7 litre system saves 31,000 litres per year, which is around four and a half years of water ensured per person. Azzurra products and the Glaze collection will be presented at pavilion 22 – stand B39 at Salone del Mobile in Milan. La serie Glaze ha un design dall’approccio sobrio che gli permette di sopravvivere a mode e tendenze passeggere. Questo fa sì che dal momento in cui viene collocata nel bagno, è come se diventasse estensione naturale dell’architettura degli ambienti in cui è inserita. The Glaze series has a sophisticated approach that goes beyond mere fashions and passing trends. That means that from the moment the bathroom is in place it becomes a natural extension of the surrounding architecture of the rooms.

025


progettoalberto lievore Testo di Elviro Di Meo - Immagini: courtesy, Atelier Lievore Altherr Molina

La sostenibile leggerezza della natura THE SUSTAINABLE LIGHTNESS OF NATURE UNO STILE ESSENZIALE, ELEGANTE E CONTEMPORANEO, CHE SI TRADUCE IN FORME UNIVERSALI, CAPACI DI ARMONIZZARSI CON OGNI AMBIENTE. E’ LA CIFRA STILISTICA DELL’ATELIER SPAGNOLO LIEVORE ALTHERR MOLINA CHE PER ARPER FIRMA LA COLLEZIONE LEAF, DAL DISEGNO IRREGOLARE ISPIRATA AI RAMI DI UN ALBERO AN ESSENTIAL, ELEGANT AND CONTEMPORARY STYLE THAT DESCENDS IN UNIVERSAL FORMS WHICH ARE ABLE TO HARMONISE ANY ENVIRONMENT. IT IS THE STYLISTIC MARK OF SPANISH DESIGNER LIEVORE ALTHERR MOLINA WHO DESIGNED THE LEAF COLLECTION FOR ARPER WITH AN IRREGULAR DESIGN INSPIRED ON TREE LIMBS Forme che evocano la naturalità di corpi organici, di linee che rimandano ai segni semplici ed essenziali dell’universo sensoriale, oggetti capaci di armonizzarsi con ogni ambiente della realtà contemporanea. Si sintetizza, così, la cifra stilistica dell’architetto Alberto Lievore, che, insieme a Jeannette Altherr e a Manel Molina, fonda l’omonimo Studio di progettazione, con sede a Barcellona. L’approccio umanistico del design sperimentato è permeato dalla ricerca verso espressioni formali esteticamente belle e pure, nate dalle costrizioni derivate da esigenze ed elementi funzionali, tecnologici e di contesto. Il lavoro dell’Atelier Lievore Altherr Molina, caratterizzato da un metodo multidisciplinare è stato esibito e riconosciuto a livello internazionale e gli è valso, nel 1999 – quasi un decennio prima che alcuni valori diventassero parte integrante di qualsiasi progetto –, il prestigioso National Design Award in Spagna. Una ricerca eterogenea dal punto di vista progettuale che trova in Arper, azienda italiana impegnata a produrre e distribuire in tutto il mondo sedute e tavoli per la collettività, il lavoro e la casa, un perfetto interlocutore. Inizia una collaborazione ricca e fruttuosa che si esprimerà attraverso una sequenza di nuovi prodotti, diventati “long seller”: tra questi, la collezione di sedute Catifa, declinata in cinque diverse versioni. Benché sembrino il risultato di una creazione spontanea, ottenuta senza sforzo apparente, i progetti Arper nascono da una rigorosa sintesi di tecnica, costi, funzione, uso e gusto, in cui qualità e sostenibilità, unite all’utilizzo di materiali poco inquinanti e riciclabili, sono i punti cardine della politica dell’azienda. Non a caso, già nel 2005 e, in particolare, nell’ultimo periodo, il Gruppo ha creato un team di lavoro dedicato alle problematiche dell’ambiente, il cui impegno principale è il controllo e la gestione dell’impatto ambientale, dalla progettazione allo smaltimento di fine vita.

026

Caratteristiche che emergono nel tavolo Leaf, uno degli ultimi lavori firmato dallo Studio spagnolo. E’ ancora una volta l’osservazione della natura il motivo di ispirazione. Una natura che suggerisce nella forma del top, simile a quella di un sasso levigato dall’acqua, e nella particolarità delle differenti strutture, il disegno irregolare dei rami di un albero. Come per la sedia della stessa collezione, il tavolo si adatta sia all’interno sia all’esterno, e soddisfa le richieste di chi predilige un design minimalista e una presenza leggera nello spazio. Architetto Lievore, a cosa si ispira per suoi progetti? C’è un filo conduttore nella sua ricerca progettuale? Ogni progetto ha le sue esigenze, oltre alle caratteristiche che sono condizionate dall’identità di ogni cliente. Questo tema emerge spontaneamente dalla nostra sensibilità e dal nostro background culturale. Quali sono i materiali che contraddistinguono i suoi lavori? Per noi, in linea di principio, non vi è né un buono né un cattivo materiale, ma solo un materiale appropriato a ciascun progetto; tuttavia, personalmente, il piacere e la sensualità che donano i materiali naturali e nobili non sono paragonabili con le fibre sintetiche. Come si può progettare una stanza da bagno moderna e funzionale mantenendo un buon rapporto qualità/prezzo? Semplicemente razionalizzando l’uso e i materiali impiegati. Com’è nato e come si è sviluppato il rapporto con Arper? L’empatia tra i valori dello studio e quelli dell’azienda ha reso fluidi il dialogo, le idee e le realizzazioni. Ci descrive il suo prodotto? Faccio una premessa: il bagno oggi non è solo un luogo meramente funzionale,


ma è uno spazio per il benessere generale. Questo consente che situazioni e prodotti, che fino a ieri non erano stati concepiti per questo luogo, oggi siano di uso comune. I prodotti Arper (come i tavoli Dizzie o la collezione di poltrone Saari, ndr) sono stati pensati in questo modo, per essere utilizzati in qualsiasi situazione. Come si sta evolvendo il mondo del design? Pensa che le aziende, al di là degli slogan, siano davvero pronte al cambiamento? Il mondo del design non è omogeneo, ci sono aziende sensibili ai cambiamenti in prima persona e altre che continuano a ripetere gli stessi modelli, validi fino a ieri e oggi non più. Questo trend è confermato dai mercati. C’è ancora spazio per il design italiano come riferimento internazionale? Senza dubbio, il Made in Italy è un valore profondo e riconosciuto. Quantomeno sarà osservato dai mercati, però la sua presenza nella società dipenderà dalla modalità con cui ogni azienda sarà capace di rispondere ai cambiamenti della società stessa. Quali sono i designer che più le piacciono e perché? Eames, Kjaerhom, Nelson, Wagner, Nakashima tra gli altri, perché hanno materializzato valori universali in tutto il loro lavoro. Questa è un’aspirazione cui ci piacerebbe arrivare un giorno. Per questo continuiamo a lavorare.

Forms that are reminiscent of the naturalness of organic shapes and lines that involve the simple and essential universe of the senses - objects that blend in any contemporary environment. That sums up the stylistic timbre of architect Alberto Lievore who together with Jeannette Altherr and Manel Molina founded the design studio with the same name in Barcelona. The humanistic approach to design is developed and permeated by the search for formally beautiful and pure expressions born from constrictions derived from necessity and the functional, technological and contextual elements. The work of the Lievore Altherr Molina firm is characterised by a multi-disciplinary approach and it was recognised internationally in 1999 (almost a decade before certain values became an integral part of any project) with the prestigious National Design Award in Spain. The heterogeneous approach found a perfect union with Arper from a design point of view as the Italian company manufactures and produces chairs and tables all over the world for groups, the workplace and the home. The fruitful collaboration began with a sequence of new products which became long sellers. One of these was the Catifa chair collection in five different versions. Though they seem to be created spontaneously and without effort, Arper

designs are born from a rigorous synthesis of techniques, costs, functions, uses and tastes where quality and sustainability are combined with non-polluting and recyclable materials: these are the cardinal points of the company strategy. It is no accident that in 2005 and especially lately, the Group has created a work team dedicated to environmental questions whose primary duty is to control environmental impact from the design phase to the end of product life waste stage. These characteristics can be found in the Leaf table which is one of the most recent works by the Spanish firm. Once again the observation of nature serves as the inspiration. The natural form in the shape of a top is similar to a river run rock and in the details of the different structures it seems like the irregular limbs of a tree. Just like the chairs in the collection, the table is suited for interiors or exteriors and it satisfies the requests of those who prefer minimalist and light design. Architect Lievore, what are your designs inspired by? Is there a guiding line in your design research? Each project has its own needs as well as characteristics which are conditioned by the identity of each customer. This theme emerges spontaneously from our sensitivity and cultural background.

In apertura: la collezione di tavoli Dizzie, con il piano in MDF bianco e il fusto in acciaio cromato o verniciato bianco. Qui sotto: la panca Saari. Al centro pagina: sedie e tavoli della linea Leaf. On the first page: the Dizzie table collection with a surface in white MDF and a body in chromed or white steel. Below: the Saari bench. At the centre of the page: chairs and tables from the Leaf line.

What are the materials that distinguish your works? To us, in general there are no good or bad materials; there are only more appropriate materials for each project. Personally however, I like the pleasure and sensuality of natural noble materials which synthetic fibres just cannot compete with. How is it possible to design a modern and functional bathroom with a good quality/price relationship? Simply by rationalising the use of the materials. How did the relationship with Arper start and develop? The empathy between the firm’s values and the company’s values made the dialogue, ideas and developments flow freely. Would you describe your project? I would like to premise it by saying: today’s bathrooms are not only merely functional; they are areas for overall wellbeing. That means that situations and products that were not designed for this room in the past are common today. Arper products (editor’s note: including Dizzie chairs or the Saari armchair) were designed with this in mind – to be used in any situation. How is the world of design evolving? Aside from the slogans, do you think that companies are really ready for change? The design world is not homogeneous, there are companies that are sensitive to the changes and others that continue to repeat old models that were valid in the past but are no longer. This trend is confirmed by the markets. Is there still space for Italian design as an international reference? Without a doubt, Italian design is well known and recognised. Though it is observed in the markets, however, its presence in society depends on the way each company is able to respond to the changes in society itself. Who are your favourite designers and why? Eames, Kjaerhom, Nelson, Wagner, Nakashima and others, because they incorporated universal values in all of their work. This is my aspiration and what I would like to obtain someday. That is why I keep working.

027


progettoarchitetti berselli cassina associati Testo di Veronica Buratti - Project Architetti Berselli Cassina Associati - htpp://ec2.it/bersellicassina - Photo > Giacomo Giannini - www.giacomogiannini.com

Reinterpretazioni minimali MINIMALIST REINTERPRETATIONS RISPETTOSI DEL PASSATO - RILETTO IN CHIAVE MODERNA, CONSERVANDONE ED EVIDENZIANDONE GLI ASPETTI PECULIARI -, GLI INTERVENTI DI RISTRUTTURAZIONE ATTUATI DALLO STUDIO BRESCIANO PONGONO AL CENTRO DELLO SVILUPPO PROGETTUALE LA LUCE RESPECTFUL OF THE PAST AND REINTERPRETED IN A MODERN KEY WHILE PRESERVING AND HIGHLIGHTING THE SPECIAL ASPECTS – THE RESTRUCTURING PROJECTS UNDERTAKEN BY THIS FIRM FROM BRESCIA PLACE THE DEVELOPMENT OF LIGHTING AT THE HEART OF THE PROJECT Fondato nel 1984 a Brescia dagli Architetti Berselli e Cassina, il lavoro dello studio Architetti Berselli Cassina Associati spazia dalle attività di ristrutturazione e restauro, all’attuazione di opere urbanistiche, nuovi edifici e spazi commerciali, fino alla realizzazione di allestimenti e al design. Sono numerosi i concorsi, nei più svariati settori, le pubblicazioni e le mostre, nazionali e internazionali alle quali lo studio ha preso parte. L’esperienza maturata in oltre un ventennio di attività ha visto gli architetti impegnati a lavorare su edifici storici di pregio, con interventi di tipo residenziale, commerciale ed espositivo. Dalla realizzazione di nuove costruzioni al recupero di edifici preesistenti, l’attenzione alla della luce naturale e artificiale è da sempre la componente fondamentale dei progetti sviluppati dallo studio bresciano. Nella progettazione di spazi commerciali come nel design industriale, ogni esperienza qualifica le modalità d’intervento, portando sempre nuovi contributi che si interscambiano, con risultati che tendono a evidenziare la ricerca e la sperimentazione di tecnologie innovative e nuovi materiali. Per meglio comprendere la filosofia progettuale che sta alla base degli interventi attuati dallo studio, abbiamo focalizzato l’attenzione su alcuni dei progetti residenziali più recenti.

028

Founded in 1984 in Brescia by Architects Berselli and Cassina, the works by the Berselli Cassina Associated Architects firm range from restructuring and restoration to urban architecture, new offices and businesses as well as exhibits and design. The firm has participated in a number of competitions in a myriad of sectors, publications, national and international exhibits as well. With over twenty years of experience in the sector the architects have worked on prestigious historic buildings to develop residential, commercial and exhibit projects. Both for new buildings and for the restoration of existing buildings, attention to natural and artificial light has always been a fundamental component in the designs developed by this firm in Brescia. Both in the design of commercial areas and in industrial design, each experience furthers their professionalism with new contributions that work together to provide results that highlight the sophisticated development of innovative technologies and new materials. In order to better comprehend the design philosophy that underlies the firm’s work, we focused our attention on some of the most recent residential projects.


029


CASA STUDIO Situato nella fascia cittadina limitrofa al centro storico di Brescia, l’edificio che ospita il progetto Casa Studio fa parte di una struttura composta da una palazzina dei primi del Novecento e dagli annessi spazi ex-industriali. La realizzazione architettonica ha previsto la suddivisione dell’edificio su due livelli e la collocazione, al piano superiore, dell’abitazione e, al piano terra, dello studio di architettura. Quest’ultimo si espande fino agli ex magazzini annessi alla casa, affacciati su un cortile in condivisione con uno show-room e l’abitazione di un artista. Lo studio di architettura è stato progettato con la volontà di scomporre l’impostazione rigida della pianta esistente, attraverso la demolizione di alcune pareti, in seguito ricostruite giocando con filtri traslucidi dalle trame incrociate, che conferiscono all’insieme nuove profondità di campo e nuove percezioni visive. L’impiego delle tonalità del grigio nelle sue diverse gradazioni ha creato una certa continuità tra le varie stanze e una perfetta integrazione con i complementi di arredo realizzati su misura. La zona operativa dello studio è collegata a uno spazio laboratorio, che ospita prototipi di oggetti di design, plastici e materiali di sperimentazione ed è stato pensato in modo da poter essere utilizzato come occasionale area espositiva dei lavori creativi di artisti e designer. Lo studio è unito allo spazio abitativo, che si sviluppa al piano superiore, da una scala interna preesistente. Anche su questo piano vi sono delle superfetazioni degli anni Cinquanta che alterano l’originaria conformazione simmetrica dell’edificio. Vi è una netta distinzione tra lo spazio living e la zona notte. Il primo è frutto di uno svuotamento spaziale finalizzato alla creazione un grande spazio conviviale che si estende visivamente attraverso le grandi aperture affacciate sull’ampia terrazza. Il secondo invece mantiene l’articolazione originaria dell’abitazione, strutturando gli ambienti attorno a un corridoio centrale e conservando quindi un carattere più privato. In queste pagine e nelle precedenti alcune immagini del progetto Casa Studio la cui realizzazione architettonica ha previsto la suddivisione su due livelli di un edificio dei primi del Novecento. Al piano superiore è stata sviluppata l’abitazione, al piano terra invece è stato alloggiato lo studio di architettura, progettato con la volontà di scomporre l’impostazione rigida della pianta preesistente e di creare nuove profondità di campo e nuove percezioni visive. On these pages and the preceding pages, a few images of the Casa Studio design for a building from the beginning of the nineteen hundreds, which was divided into two storeys. On the upper floor, we find the home and on the lower floor, we find the architecture studio designed with a desire to break down the strict outline of the existing floor plan and create new depth of field and new visual perceptions.

030


CASA STUDIO Located in the residential area near the historic centre of Brescia, the building that hosts the Casa Studio project is part of a complex structure including a building from the beginning of the nineteen hundreds and annexed former industrial areas. The architectural development called for dividing the building into two storeys and creating a home on the upper floor and an architecture studio on the ground floor. The studio expands up to the former warehouses annexed to the home, facing a courtyard shared with a show-room and the home of an artist. The architecture studio was designed with the idea of breaking down the rigid existing plan by demolishing some of the walls, which were later rebuilt with the addition of transparent filters with crossed patterns that provide a new depth of field and new visual perceptions. The use of grey in its many hues creates a sort of continuity between the various rooms and a perfect integration with the custom furnishings. The work area is connected to a laboratory area that contains design prototypes, plastics and materials for development. It was designed to be used as an occasional exhibit area for the creative works of artists and designers. The studio is linked to the living area on the upper floor through a pre-existing stairway. On this floor as well there are reminiscences from the fifties that alter the original symmetrical conformation of the building. There is a distinct difference between the living area and the sleeping area. The living area is sparse with open space that that extends visually across the large openings that face onto the large terrace. The sleeping area maintains the original layout of the home with a central hallway that has rooms built off of it to create a more private area.

031


VILLA SUL LAGO DI GARDA Il progetto è intervenuto su un’abitazione singola, situata nell’entroterra del Garda con vista panoramica sul lago e costruita negli anni Sessanta, rivisitandola completamente secondo le nuove esigenze della committenza. La particolare posizione rispetto al lago ha determinato la scelta di realizzare grandi aperture che si affacciano rispettivamente sulla terrazza e sul giardino che dominano il paesaggio circostante. L’abitazione si sviluppa su tre livelli: un piano seminterrato, adibito a garage e area relax, un piano rialzato, che ospita la zona giorno e le camere di servizio per gli ospiti, e un primo piano riservato ai proprietari, che accoglie la zona notte padronale, il guardaroba e i servizi. La grande luminosità degli ambienti ha reso possibile l’impiego al piano rialzato di una pavimentazione in pietra pece, molto scura, ma di grande impatto visivo. Per il primo piano invece è stata scelta una pavimentazione più calda fatta di grandi listoni di rovere. La scala che collega i tre piani, realizzata completamente in ferro nero, si avvolge intorno a un montante centrale quadrato, che alloggia alla sua sommità un faro a luce indiretta. L’arredo è stato quasi completamente disegnato su misura, come anche la parete del soggiorno, che è stata reinterpretata attraverso l’impiego di piccoli listelli di legno di varie essenze e diverse sporgenze, che conferiscono all’ambiente un’interessante vibrazione di ombre e colori. VILLA ON GARDA LAKE The project dealt with a single-family home built in the seventies located inland with a panoramic view of the lake and it completely reinterpreted the structure to meet the owners’ new needs. The special position of the home in front of the lake gave rise to the decision to create large windows that face the terrace and the garden over the surrounding landscape. The home is built on three storeys: a basement area for the garage and relaxation area, a raised floor that holds the living area and the guest bedrooms and an upper storey that is reserved for the owners with the master bedroom, closets and bathrooms. The incredible luminosity of the rooms made it possible to use very dark Pece stone that provides a great visual impact. On the upper storey, the large oak plank flooring is warmer. The stairway that connects the three levels is built entirely from black iron and it winds around a central squared column that holds an indirect spotlight on top. The furnishings were almost completely custom designed as was the living room wall which is decorated with small pieces of various types of woods in varying thicknesses giving the area an interesting vibration of shadows and colours.

032

Il progetto Villa sul Lago di Garda: lo studio è intervenuto su un’abitazione singola degli anni Sessanta rivisitandola completamente. La grande luminosità degli ambienti ha reso possibile l’impiego al piano rialzato di una pavimentazione in pietra pece di grande impatto visivo. La scala che collega i tre piani sui quali si sviluppa l’abitazione invece è interamente realizzata in ferro nero.

The Villa design on Garda Lake: the firm completely redesigned a single family dwelling from the seventies. The incredible luminosity of the rooms made it possible to use dark Pece stone flooring which provides great visual impact. The stairs that connect the three storeys of the home are built entirely from black iron.


033


LOFT IN MILANO Nel cuore di Milano, nel cortile di una palazzina dei primi del Novecento, uno spazio originariamente di servizio condominiale o probabilmente in uso come magazzino dei negozi adiacenti è stato oggetto di recupero a scopi residenziali. La struttura dello spazio, in origine completamente soppalcata e dotata di un annesso interrato, è stata interamente rivisitata. Il risanamento e consolidamento della costruzione è andato di pari passo con una nuova disposizione planimetrica interna, più consona alla nuova destinazione abitativa. Il soppalco, che

034

è stato ridimensionato e destinato a ospitare la zona notte, permette una lettura immediata del volume in tutta la sua altezza. I materiali impiegati nell’attuazione del progetto sono stati ridotti ai minimi termini in modo da mettere in evidenza quelli originali: il legno, il mattone, la pietra. Inserendo il cemento e il legno nelle pavimentazioni e impiegando il ferro e il vetro nei collegamenti verticali e nei parapetti, è stata ottenuta una chiara rilettura del contesto, che ha permesso di percepire a pieno la struttura originaria, contrappuntata e messa in risalto dagli interventi progettuali.


LOFT IN MILAN In the heart of Milan, the courtyard of a small building from the beginning of the nineteen hundreds, which probably served as a condominium area or a warehouse for nearby stores, was restored for residential purposes. The original structure of the space included a raised floor and an underground annex before it was entirely reinterpreted. The consolidation and repair of the construction went hand in hand with the new floor plan arrangement for the interiors which is more suitable for a living area. The raised floor was downsized to serve as the sleeping area and it allows a view of the entire height of the structure. The materials used for the project were reduced to the minimum so as to highlight the original materials: the wood, brick and stone. By including concrete and wood in the flooring and using iron and glass in the stairs and the parapets, a clear reinterpretation of the context springs forth allowing us to fully perceive the original structure as it is contrasted and highlighted by the works.

Situato in una palazzina dei primi del Novecento nel cuore di Milano, questo loft si caratterizza per la presenza di un soppalco, che è stato ridimensionato e adibito a zona notte, che permette una lettura immediata del volume in tutta la sua altezza. I materiali impiegati nel progetto sono stati ridotti ai minimi termini in modo da mettere in risalto quelli originali: legno, mattoni e pietra. Located in a building from the beginning of the nineteen hundreds in the heart of Milan, this loft is distinguished by a raised area that was downsized to serve as the sleeping area and it provides a complete view of the total height of the building. The materials used were reduced to a minimum in order to highlight the original materials: wood, brick and stone.


Fifty years of history in the kitchen sector with a number of successes and large revenues and a new challenge on the horizon: ‘Italy’s sweetheart’ as it was called in the famous ads, starts its entry into the world of bathrooms with an extension brand that is yet another testimony to the incredible strength of the brand and its constant dedication to supporting and promoting Italian manufacturing. Scavolini presents BLU: an ambitious project that was supported by considerable investments in light of the current financial situation and it is is demonstrated by the opening of a new thirteen thousand square meter facility. The decision mirrors the desire to satisfy a precise market request that has been coming above all from foreign markets and contractors for quite some time: the supply of ad hoc bathroom solutions. Bathrooms are – statistically speaking – the area in the home (together with the kitchen) where there have been the greatest changes in the social dimension in recent years: they have gone from being purely service areas to rooms to enjoy, live and display fully. With BLU, Scavolini has undertaken the further task of guaranteeing consumers their patrimony of design authority and excellence. The foundation of the historical brand – made up of functional values like style, a wide range, design, reasonably priced offers and intangible values like environmental sustainability – ensure the total reliability of this company that has always been dedicated to quality and service. To assess the feasibility of the project, the company leaders focused their attention on market research which proved just how much bathroom design influences the entire living context these days and just how much more demand there is for sophisticated products in terms of consultancy, design assistance, installation and post-sales services. The mission begins here: think of a room concept not as a simple grouping of individual products, but as a global project founded on a stylistic congruency between the various elements. These solutions are able to offer continuity with other spaces in the home depending on the

latest evolutionary trends in furnishing elements. In the brand development, carried out in collaboration with the Komma firm, the company had two objectives: to build an independent identity that accompanies the bathroom collections and to reproduce the unequivocal continuity of Scavolini’s performance. Not only in the chosen colour, but even in the name, BLU underlines this new connotation in an area that could be termed as ‘unexplored territory’ even though it is a related sector. The design, with art direction by Studio Castiglia&Associati, presents seven furniture collections that are distinguished by type and by door opening: one with a handle produced in three versions; three with different openings (horizontal, vertical and pocket); one with a curved door, with a decidedly more traditional imprint, a door with a frameless glass and lastly a special line highlighted by exclusive elements with new and extremely sophisticated shapes. The common denominator is the great modularity and the incredible level of quality, as well as the many finishes and colours and the incredible attention to detail. The interiors, for example, have the same lacquer finish (in a flat version) as the exteriors: this characteristic highlights the extreme attention to design and the incredibly sophisticated aesthetics. For the utmost in stylistic and functional personalisation, the collection is completed by a vast selection of accessories: from wooden dividers for drawers and extractable chests as well as others to place on the shelves or walls all available in a number of versions, shapes and sizes.

037


progettophilippe nigro Testo di Elviro Di Meo - Schizzi e disegni: Philippe Nigro Portrait: Photo by F. Coquerel, 2009 - Ph.: Alberto Parise

Design etico: la ricerca progettuale di Philippe Nigro ETHICAL DESIGN: DESIGN DEVELOPMENT BY PHILIPPE NIGRO “CREDO CHE LE COSE SI STIANO MUOVENDO VERSO UN RITORNO A UN USO SENSATO DEI MATERIALI. NON SI PUÒ E NON SI DEVE RINUNCIARE ALLE PLASTICHE, PERCHÉ SONO MATERIALI PREZIOSISSIMI CHE PERMETTONO DI REALIZZARE ELEMENTI FONDAMENTALI PER IL NOSTRO PROGRESSO. CERTO, NE VA FATTO UN UTILIZZO RAGIONEVOLE PER NON CONTRIBUIRE ALLO SPRECO” “I BELIEVE THAT THINGS ARE MOVING BACK TOWARDS A MORE SENSIBLE USE OF MATERIALS. IT IS IMPOSSIBLE AND THERE IS NO REASON THE GIVE UP PLASTICS BECAUSE THEY ARE INCREDIBLY IMPORTANT MATERIALS THAT MAKE IT POSSIBLE TO BUILD THE ELEMENTS THAT ARE FUNDAMENTAL FOR PROGRESS. SURE, THEY DO NEED TO BE USED IN A REASONABLE MANNER IN ORDER TO LIMIT WASTE” Un design etico, all’insegna dell’uso razionale delle risorse e del rispetto dell’ambiente, è un obiettivo sicuramente possibile. Un cambiamento a cui guardano aziende e progettisti, anche se non è a breve termine. Riorganizzare l’intero sistema e, soprattutto, educare il cliente finale occorre tempo. E’ una questione di fiducia tra produttore e consumatore, ma è anche un processo formativo dove il settore dell’industria e le nuove scoperte tecnologiche dovranno dare il proprio contributo. E’ ottimista e cauto allo stesso tempo il francese Philippe Nigro, giovane designer nato a Nizza. Dopo il diploma in Industrial Design a Lione, nel 1996 vince, con C. Gardet, il concorso dei giardini di Chaumont-sur-Loire, per il giardino sperimentale Ailleurs. Qualche anno più tardi arriva il contatto con l’Italia: collabora con lo studio De Lucchi. Qui segue progetti di design e di mobili per un crescente numero di brand nazionali e internazionali. Del 2004 sono suoi i progetti per i divani Vega e Vertigo prodotti da Nube e dell’anno successivo quello dello scaffale Spiral realizzato per “Aides à projet VIA 2005”. E sempre con De Lucchi firma la lampada Sarissa e Tatlin per Artemide, rafforzando la sua cifra stilistica e la sua attenzione verso una progettazione ‘eco’ in cui forma ed essenza si ritrovano in un equilibrio perfetto, fortemente ricercato. Fondamentale, a tale riguardo, è per Nigro l’incontro con De Castelli: azienda fondata nel 2003 da Albino Celato, destinata da subito a farsi valere, forte di un’esperienza ereditata dalla propria famiglia di fabbri ben radicata nel territorio della pedemontana trevigiana e maestri nella lavorazione del ferro. Questi, così come il legno e la pietra – tre materiali naturali e pregiati – rappresentano gli strumenti del brand per coniugare identità e tradizione in un linguaggio contemporaneo. Philippe Nigro, che cos’è per lei il concetto di sostenibilità? Buon senso e responsabilità. Sia nell’uso dei materiali, sia nel progettare l’oggetto che non sia superfluo, ma che cerchi di portare innovazione dal punto di vista funzionale e tecnico, cercando di raggiungere l’atemporalità: miglior modo per non sprecare.

Com’è nato e come si è sviluppato il rapporto con De Castelli? Con De Castelli ho avuto l’opportunità di lavorare su un progetto d’istallazione temporanea Think station realizzata da Interni durante il Salone del Mobile del 2009. Ora questo progetto si sta evolvendo per diventare un sistema di chioschi pensato per l’esterno. Dopo questa bellissima esperienza, abbiamo sviluppato un mobile contenitore in metallo, declinabile in varie misure: Lancelot. Lo può descrivere? Lancelot e un mobiletto di proporzioni contenute e compatte che può trovare posto in vari ambienti della casa come il salotto per metterci libri o oggetti delicati, oppure in bagno dove disporre asciugamani o cosmetici. Ha un aspetto misterioso nel senso che si deve girare un po’ intorno per capirlo e scoprire che l’apparente corazza è fatta, in realtà, da ante che si aprono generosamente. Questo volume contenitore prende importanza grazie a un basamento molto sottile che lo fa quasi galleggiare nell’aria.


Pensa che il design sarà sempre più eco? Eppure in giro si vedono ancora prodotti in cui predomina una ricerca progettuale che sembra muoversi in tutt’altra direzione. Sicuramente sì. In generale, credo che le cose si stiano muovendo verso un ritorno al concetto di un uso sensato dei materiali. Non si può e non si deve rinunciare alle plastiche, perché sono materiali preziosissimi che permettono di realizzare elementi fondamentali per il nostro progresso. Certo, ne va fatto un utilizzo ragionevole e ottimale per non contribuire allo spreco. Colpa delle aziende, dei designer o del pubblico se il design non è sempre etico? Se c’è una colpa, allora questa va condivisa con tutti. L’esplosione delle materie sintetiche, se ci pensiamo bene, è un fatto abbastanza recente. Impariamo tutti insieme e tutti i giorni dai nostri sbagli e queste ‘lezioni’ daranno i loro frutti lentamente. Non ci può essere un cambiamento tanto radicale, quasi improvviso. Ci vuole pazienza! Quanto le aziende sono disposte a investire nel design etico? Ancora poco ma ci stanno lavorando. Anche in questo caso occorre tempo. Le tecnologie sempre abbastanza recenti ci hanno permesso di fare un salto velocissimo verso il futuro lasciando, a volte, l’etica da parte. E’ difficile riorganizzare un intero sistema. Rinunciare a certe tecnologie a favore di tecniche più pulite e più tradizionali comporta un costo maggiore per le aziende, ecco perché si piegano al desiderio dei clienti e dei consumatori. Credo che la speranza stia nella ricerca tecnologica e anche nell’industria. In effetti, sono poi questi fattori a velocizzare qualsiasi fenomeno di cambiamento. Etica ed estetica potranno mai andare d’accordo in una società consumistica come quella attuale? Certo. Intendiamoci: non siamo di fronte a una sfida! Non è un problema di etica contro l’estetica, è un problema di consumare bene le risorse e con maggiore responsabilità. Alcune aziende di mobili hanno già cominciato e raccolgono un bel successo. Ecco, io mi accontento per ora di guardare i risultati positivi, perche si impara sia dagli sbagli e sia dai successi.

In apertura, ritratto di Philippe Nigro. Schizzi di progetto: Lancelot, grazie alla forma tonda e alle proporzioni contenute, è posizionabile in un angolo o al centro della stanza. E’ un mobiletto per contenere libri, tazze, bottiglie oppure per riporre asciugamani, spazzole e profumi. On the first page, portrait of Philippe Nigro. Design sketches: Lancelot, thanks to the round form and small size, can be positioned in the corner or the centre of the room. It is a storage unit for books, cups, bottles or even bath towels, brushes and cosmetics.

039


Ethical design that uses resources in a rational manner and respects the environment is definitely possible. Though not in short-term thinking, it is a change that companies and designers are seeking. Reorganising the entire system and above all, educating consumers, requires time. It is a question of trust between manufacturers and consumers, but it is also an educational process where the industries in question and new technological discoveries have to contribute as well. French designer Philippe Nigro is an optimist and cautious at the same time. Born in Nice, the young designer received his diploma in Industrial Design in Lyons and in 1996 he won the design

competition for the gardens and Chaumont-surLoire with C. Gardet for the experimental Ailleurs garden. A few years later he collaborated with the De Lucchi firm in Italy working on design and furniture products for a growing number of national and international brands. Then in 2004 he designed the Vega sofas and Vertico products by Nube and one year later he designed the

Appoggiata su una sottile struttura, la silhouette di Lancelot non si rivela subito cilindrica o ovale, conica o dritta. Bisogna girarle attorno per comprendere la sua forma. Resting on a thin structure, it is hard to tell if the silhouette of Lancelot is cylindrical or oval and conical or straight without first walking around it to completely to understand its shape.

040

Spiral shelf for “Aides à projet VIA 2005”. With De Lucchi, he also designed the Sarissa and Tatlin lamps for Artemide further reinforcing his stylistic imprint and his focus on ‘eco’ design where form and essence exist in perfect harmony and shrewdly developed balance. An important aspect in that was Nigro’s encounter with the De Castelli Company founded by Albino Celato in 2003.


It was destined for immediate success considering the long-term experience of a family metalworkers well rooted in the Piedmont and Treviso zones of Italy and masters in iron work. Metal, wood and steel (all three natural and prized) are the tools that blend identity and tradition with a modern syntax within the brand. Philippe Nigro, what does the concept of sustainability mean to you? It means good sense and responsibility both in the use of materials and in the design of products that are not superfluous. It means trying to bring innovation from a functional and technical point of view in order to create something timeless: and that is the best way to avoid waste. How did your relationship with De Castelli start and develop? I had an opportunity to work with De Castelli on the Think Station temporary installation that was set up by Interni during the Salone del Mobile in

2009. Now this project is evolving into a system of kiosks that were designed for exteriors. After this incredible experience we worked on a storage container in metal named Lancelot that is available in various sizes. Would you describe it for us? Lancelot is a small and compact container that is useful in a number of rooms in the home. It can be used in the living room to hold books or fragile items or it could be used in the bathroom for towels or cosmetics storage. It has a mysterious appearance because you have to look at it a minute to understand and discover that the apparent shield is actually a door that opens up wide. The storage piece is exceptional because it seems to float in the air thanks to the very thin base. Do you think design is moving towards a more ecological outlook? You know we still see products where the design development still seems to be moving in the opposite direction. I definitely do. In general, I believe that things are going back to a more sensible use of materials. We cannot and should not give up plastics, because they are fabulous materials that make it possible to create the elements that are fundamental for progress. Sure, I do believe that they need to be used in a reasonable and optimal manner in order to avoid waste. Is it the fault of designers, companies or the public that design is not always ethical? If it is anybody’s fault then it is everybody’s fault. If you think about it, the explosion of synthetic materials happened fairly recently. We are learning all together each day from our mistakes and these ‘lessons’ will show their results slowly. A truly radical change is impossible all at once. It takes patience. How far are companies willing to invest in ethical design? Not very much yet but we are working on that.

This is a question that takes time. Technologies that are still quite new have allowed us to make a quick leap into the future leaving ethics aside at times. It is difficult to reorganise a whole system. Renouncing certain technologies in favour of cleaner and more traditional techniques requires greater costs for companies. That is why they bend under customer and consumer desires. I believe that there is hope in technological research and industry. In effect, these are the factors that speed up any sort of change. Do you think ethics and aesthetics will ever be able to get along in a society of consumerism like we are living in now? Certainly. Sure we must understand that we are facing a challenge! It is not a problem of ethics against aesthetics; it is a problem of consuming resources well and with more responsibility. Some furniture companies have already begun and they are having great success. I am currently satisfied by looking at the positive results because we learn from mistakes as well as from successes.

041


It is a natural and ‘alchemical’ material that forms and transforms evolving in a slow genesis where it takes on properties and characteristics from the environment where it forms absorbing and representing its individuality and uniqueness. Resistant and stable, it has traditionally been considered prestigious and long lasting making it a favourite material for architecture and sculpture seeking immortality. Today’s technologies continue to advance with the addition of digital technologies that rediscover its intimate and unexpectedly adaptable essence. Marble continues to transform and this time it is at the level of perception: it has become seemingly ductile to hold the flexible reflection of the design world in continuous evolution. Units, accessories and surfaces are reinterpreted by the sensitivity of designers to refine and develop increasingly advanced strategies for sustainability. On one side marble continues to impose its character by requiring respect for its specific characteristics, and on the other there are infinite variables (including colour, texture and impact) that make lots of variations possible. That is where the fundamental potential of design development and innovation enter the game. Exhibitors: Patricia Urquiola with Budri, Pietro Ferruccio Laviani with Citco, Setsu and Shinobu Ito with Grassi Pietre, Kjetil Thorsen-Snøhetta with Pibamarmi, Marco Piva with Regione Puglia (InSpo Marmi, Petra Design, Pi.Mar., Stonemotion), Raffaello Galiotto with Solubema and Merbes-Sprimont, Philippe Nigro with Testi Fratelli. The exhibit design is by APML-architects 17-22 April 2012 Location: Milan Triennial - Viale Alemagna 6 Open: 10.30 - 22.00 Entrance: free

Nella pagina di apertura, in alto il progetto di Pietro Ferruccio Laviani con Citco, sotto Setsu e Shinobu Ito con Grassi Pietre. In questa pagina: sopra, Kjetil Thorsen-Snøhetta con Pibamarmi, a sinistra, Philippe Nigro con Testi Fratelli. On the first page, above, the design by Pietro Ferruccio Laviani with Citco, below, Setsu and Shinobu Ito with Grassi Pietre. On this page: above, Kjetil ThorsenSnøhetta with Pibamarmi, on the left, Philippe Nigro with Testi Fratelli.

043


ROD Semplice come l’acqua

www.ponsi.it


progettodaniel irànyi e tom staubli Testo di Giacomo Fusciello

Uno….E trino ONE….AND THREE

PROGETTATI DA DANIEL IRÀNYI E TOM STAUBLI DELLO STUDIO DI DESIGN TRIBECRAFT DI ZURIGO, I MODULI MONOLITH PER LAVABO, VASO E BIDET RIVOLUZIONANO LA CLASSICA DISPOSIZIONE DEL BAGNO, CONIUGANDO QUALITÀ ESTETICA, RISPARMIO ENERGETICO E FACILITÀ DI MONTAGGIO DESIGNED BY DANIEL IRÀNYI AND TOM STAUBLI OF THE TRIBECRAFT DESIGN FIRM IN ZURICH, THE MONOLITH SINK, TOILET AND BIDET UNITS REVOLUTIONISE THE CLASSIC BATHROOM ARRANGEMENT BY BRINGING TOGETHER AESTHETIC QUALITY, ENERGY SAVINGS AND EASY INSTALLATION

E’ Geberit Monolith la grande rivoluzione con cui il gruppo svizzero, leader della tecnica idrosanitaria, fa ufficialmente il suo ingresso nel mondo del design con una spiccata attenzione per il rispetto dell’ambiente e, di conseguenza, con un notevole risparmio energetico. Un concept innovativo, in cui il modulo base può essere declinato come lavabo, vaso e bidet, diventando, in questo caso, un prezioso strumento per la progettazione dell’ambiente bagno. Progettati da Daniel Irànyi e Tom Staubli dello studio di design Tribecraft di Zurigo, i moduli permettono di installare sia il lavabo e sia i sanitari davanti a pareti preesistenti, anche in cartongesso, evitando complicate opere di muratura. Il doppio pulsante laterale per il risciacquo, uno grande da sei litri e l’altro da tre, garantisce il contenimento del consumo idrico. Monolith è considerato un prodotto rivoluzionario. Qual è stata la sfida più importante durante la fase progettuale? Daniel Irànyi Volevamo utilizzare Monolith per portare innovazione alla classica disposizione del bagno. Il modulo wc prima, e ora il lavabo e bidet avranno un nuovo ruolo. Motivo per cui abbiamo rivisto completamente il progetto stesso. In termini di design, abbiamo valutato numerose possibilità di utilizzo del prodotto come elemento di arredo a sé stante. Tuttavia, Geberit vuole proporre sul mercato prodotti in grado di offrire un montaggio semplice e universale. Monolith soddisfa in pieno questo criterio. A cosa vi siete ispirati per creare questa forma particolare? Tom Staubli Monolith presenta un design piuttosto elementare. Tuttavia, può essere usato per dare un tocco diverso all’ambiente bagno. Per ottenere questo effetto, abbiamo lavorato a lungo sulle proporzioni e fatto in modo che la linea dell’oggetto seguisse le ceramiche in maniera pulita. L’intero volume e la superficie in vetro sono stati studiati per raggiungere un buon equilibrio. Il vetro è il materiale ideale per Monolith perché è

046

elegante, igienico e leggero. Inoltre, l’effetto riflettente in combinazione con le ceramiche crea una sensazione di profondità. Come si possono combinare i moduli bagno valorizzandoli tra loro? Tom Staubli I vari moduli formano una gamma di prodotti. In una vera famiglia, i componenti non hanno tutti lo stesso aspetto, allo stesso modo i moduli sanitari presentano le loro caratteristiche individuali. A seconda del prodotto hanno funzioni diverse che si riflettono anche nel design. Fino a che punto la funzione determina la forma? Daniel Irànyi La condizione di base era quella che Monolith fosse il più semplice possibile da usare, anche per i bambini. Ma aspetti funzionali dovranno passare in secondo piano rispetto alla forma del prodotto. Ecco perché non vi è nessuna placca di comando nella parte anteriore della lastra in vetro. Non sarebbe stato coerente. Abbiamo anche pensato all’idraulico, rendendo così il prodotto logico e facile da installare. Come siete riusciti a ottenere la facilità con cui Monolith viene installato? Daniel Irànyi Nella fase progettuale abbiamo fatto in modo che la rinomata semplicità di installazione, tipica dei prodotti Geberit, diventasse una caratteristica fondamentale anche per Monolith. Inoltre, grazie all’azienda, siamo riusciti a collaborare con i tecnici per rendere quanto realizzato il più possibile affidabile e funzionale.

In questa pagina, da sinistra Daniel Irànyi e Tom Staubli. Nella pagina accanto: Geberit Monolith per lavabo e wc. “In termini di design – spiegano i progettisti -, abbiamo valutato numerose possibilità di utilizzo del prodotto come elemento di arredo a sé stante. L’azienda ha voluto proporre sul mercato prodotti in grado di offrire un montaggio semplice e universale”. On this page from the left, Daniel Irànyi and Tom Staubli. On the opposite page: Geberit Monolith for sinks and toilet fixtures. “In terms of design – the designers explained – we looked at a number of possibilities for using the products as a furnishing in itself. The company wanted to launch products on the market that are able to offer simple and universal installation”.


047


Geberit Monolith is the big revolution that is launching the debut of this Swiss group, which is a leader in hydro sanitary technologies, in the world of design with special attention to environmental respect and consequently to considerable energy savings. It is an innovative concept where the base unit is designed as a sink, toilet and bidet - making it a perfect tool for bathroom design. Designed by Daniel Irànyi and Tom Staubli of the Tribecraft design firm in Zurich, the units allow for installing both the sink and the fixtures on preexisting walls (even plasterboard walls) without any complicated masonry work. There is a double button on the side for the flush with one large six litre flush button and another three litre button to help ensure water savings. Monolith is considered to be a revolutionary product. What was the most important challenge during the design phase? Daniel Irànyi We wanted to use Monolith to help innovate classic bathroom arrangements. First the toilet unit and now the sink and bidet will have a new role. That is why we completely reviewed the project itself. In terms of design we have looked at numerous possibilities for using the element as a furnishing in itself. In any case Geberit markets products that are able to offer simple and universal installation and Monolith responds to these criteria fully. What was your inspiration for creating this particular form? Tom Staubli Monolith has a fairly simple design. However, it can also be used to give a touch of something different to the bathroom. To get that effect, we worked a great deal on the proportions so that the outline of the objects follows the ceramic in a clean way. The whole shape and the glass surface were designed to have a good balance. Glass is the ideal material for Monolith because it is elegant, hygienic and light. Moreover, the reflecting effect together with the ceramic gives a sense of depth. How can the bathroom units be used and highlighted together? Tom Staubli The various units form a range of products. In a real family, the members do not all look the same, just as the sanitary units have their own individual characteristics. Depending on the product, they have different functions that are reflected in the design as well. Just how far does the function determine the form? Daniel Irànyi The primary condition was that Monolith should be as simple as possible to use, even for kids. However, the functional aspects should not fade into the background when compared to the form of the product. That is why there is no flush plate in the upper part of the glass plate. It would not have been aligned with that idea. We even designed the plumbing to make the product logical and easy to install.

048

How were you able to make Monolith easy to install? Daniel Irànyi During the design phase we worked on the renowned aspects of easy installation, which is a standard trait in Geberit products, and we incorporated them as fundamental characteristics in Monolith too. Moreover, thanks to the company, we were able to collaborate with the technicians in order to make the design as dependable and functional as possible.

In questa e nella pagina accanto: alcune applicazioni del prodotto. I moduli permettono di installare sia il lavabo e sia i sanitari davanti a pareti preesistenti, anche in cartongesso, evitando complicate opere di muratura. Il doppio pulsante laterale per il risciacquo, uno grande da sei litri e l’altro da tre, garantisce il contenimento del consumo idrico. On this page and on the opposite page: a few product applications. The units make it possible to install both the sink and the sanitary fixtures in front of preexisting walls (even plasterboard) in order to avoid complicated wall masonry work. The double flush plate on the side helps save water with one large button for a six litre flush and another for a three litre flush.


049


newslibri Testi di Daniela Bonaretti

IL LIBRO DELLE STANZE DA BAGNO

DESIGN 2029

Le trasformazioni che da più di un decennio investono l’aspetto e l’uso dell’ambiente bagno sono senz’altro riconducibili a quelle in atto nel modo di vivere la casa sempre più come rifugio accogliente, anche se maggiormente profonde e stupefacenti. Il rafforzamento della dimensione privata unitamente all’enfasi sul benessere, da cui il boom dei centri fitness, spa, cliniche del relax e simili, giocano un ruolo fondamentale nella crescente passione per il bagno domestico che proprio da quegli ambienti consacrati al benessere trae significati e ispirazioni, questo anche in termini di materiali, apparecchiature, arredi. E la moderna tecnologia viene in aiuto: oggi ad esempio il legno è impiegato anche in bagno grazie ai trattamenti anti-umido, le soluzioni divisorie possono divenire quasi impercettibili, i dispositivi digitali consentono di emulare la cascata, la pioggia o la nebbia, e via dicendo. Il volume che presentiamo, con la sua dimensione (29x29 cm) e cartonatura importante, e le sue 600 pagine, quasi tutte illustrate, è un percorso per immagini nelle ambientazioni della stanza da bagno contemporanea, spaziando dai bagni piccoli agli extra-large, dalle soluzioni rétro-chic a quelle di ispirazione zen, fino ai bagni “unici” e ai bagni en suite, incorporati ad altri ambienti, alle camere da letto o addirittura alle terrazze. Uno sguardo ampio tra stili, forme e tendenze dove questi innovativi spazi domestici sono sempre al centro di scelte ricche di funzionalità e di fascino, di progettualità e invenzione.

Ciò che si progetterà e che si venderà da oggi fino al 2029, ovvero una pre-visione sul futuro prossimo del design. Questo è l’argomento del saggio, ultima fatica editoriale di Renato De Fusco, architetto e docente universitario, classe 1929, che introduce il testo spiegando: “La data che figura nel titolo non è solo augurale segnando il mio eventuale centesimo compleanno, ma delimita soprattutto un tempo entro il quale è lecito fare alcune ipotesi sul futuro del design, che intendo avanzare avvalendomi in primo luogo del metodo storico, solitamente trascurato dalla letteratura sul design”. Le sue principali previsioni sono: il Minimalismo, che secondo l’autore “fra tutte le tendenze dell’arte contemporanea è la più congeniale al design”; l’ipotesi che il design acquisisca sempre più le caratteristiche dei mezzi di comunicazione di massa; il kitsch, inteso non come cattivo gusto ma piuttosto come “commistione di elementi diversi quasi al livello dell’ossimoro”; il digitale salvatutto, la cui storia è già in corso; l’usa-e-getta, ovvero gli oggetti così economici che risulta più favorevole buttarli via piuttosto che spendere tempo a ripristinarli; gli inventori vs gli stilisti, cioè la prevalenza del tecnico sull’artistico; l’ipotesi del grottesco, come reazione dell’immaginario fantastico contro l’iper-razionale; la vendita orientata sul consumo; l’orientamento critico delle vendite.

The bathroom has been undergoing a transformation in use and look for over the past decade and it all is based on changing lifestyles with homes becoming more of a welcoming refuge, as well as deeper and more astounding. The reinforcement of the private dimension and the emphasis on wellbeing has given rise to a boom in fitness centres, spas, clinics for relaxation and more. These play a fundamental role in the growing passion for the home bathroom, which is inspired by those areas also in terms of materials, furnishings and fixtures. Modern technology is there to help: today wood is also used in the bathroom. Thanks to special anti-humidity treatments, divider solutions can become almost invisible, digital devices can create a simulated waterfall, rain or mist and more. The volume we are presenting is a large (29x29 cm) hardback and the 600 pages are almost all illustrated. It serves as a voyage through images of contemporary bathrooms from small bathrooms to extra-large ones including old-fashioned styles and Zen inspired ones as well as completely unique bathrooms and suite bathrooms incorporated into other rooms like bedrooms or even the terrace. It is a broad overview of forms and trends where these innovative domestic spaces are always developed through choices that are rich in function and charm, design and innovation.

This work presents what will be designed and sold from now until 2029 – a vision of the upcoming future of design. This is the latest editorial work by Renato De Fusco - an architect and university professor of the class of 1929 who introduces the work by explaining: “The data in the title is not just positive thinking (since it also marks my future hundredth birthday) it delimits a time within which it is reasonable to hypothesise the future of design. I intend to propose these hypotheses first of all with the historical method which is frequently ignored by literature and design.” His principle forecasts include: Minimalism according to the author is “the most congenial trend for design in contemporary art”. He also advances the ideas that design will continue to incorporate the characteristics of mass communication. Instead of bad taste, kitsch is intended as “a mixture of different elements that almost create an oxymoron”. Digital is the save all and its story has already begun. He also writes of disposable objects including those that are so inexpensive that it makes more sense to throw them out than fix them as well as the debate between inventors versus stylists or the prevalence of technical over artistic. Grotesque is hypothesised as a fantastic imaginary reaction to the hyper-rational, sales shall be oriented to consumers, and the orientation of sales will be critical.

050

Logos, pag. 600, testi: italiano-inglese-tedesco-francese-spagnolo, euro 49,95, www.logosedizioni.it

di Renato De Fusco FrancoAngeli, pag. 136, testi: italiano, euro 19,00, www.francoangeli.it


Illustrazione: Jean-Philippe Delhomme

Potrete lavarvi i denti anche altrove. Ella. Un design ricco di curve e una leggerezza moderna. Grazie a questi mobili, il vostro bagno diventerĂ  la vostra personale show-room. Salone Internationale del Mobile Milano. 17.04.-22.04.2012, Hall 24, Stand F12

burgkama GmbH, Morsbacher StraĂ&#x;e 15, D-91171 Greding, T +49(0)84 63- 901- 0, info@burgbad.com, www.burgbad.com


newslibri

L’ITALIA DELLA GREEN ECONOMY Oggigiorno, in tempo di crisi, si parla spesso di Green Economy come di una direzione da intraprendere necessariamente per supportare l’innovazione sociale e una ricrescita economica sostenibile. L’Italia, rispetto a questi scenari non è sotto i riflettori, anzi spesso la percezione è che il nostro paese, con i suoi annosi handicap infrastrutturali e burocratici, sia spettatore di un processo delegato ad altri. Ma non è così. Ci sono esperienze reali ed eccellenti, sviluppate in diversi settori produttivi, che possono contraddire una volta per tutte quest’immagine negativa. L’Italia della Green Economy documenta in particolare le storie di 80 aziende, tutte vincitrici del Premio Sviluppo Sostenibile dal 2009 al 2011 (indetto dalla fondazione omonima, con l’adesione del Presidente della Repubblica), che hanno investito su ambiente e tecnologie pulite, mettendo in luce una capacità diffusa di produrre idee e innovazione, nel senso dell’efficienza energetica, dell’impiego delle fonti rinnovabili, dell’edilizia sostenibile, della riduzione delle emissioni climalteranti, che consente di ricollocare la nostra economia nei grandi trend globali. Inoltre, come scrive Edo Ronchi nella prefazione, “la spinta verso la green economy in Italia è un processo che la crisi non lo ha rallentato, anzi, il 2009, anno della recessione più acuta, ha segnato un livello più alto di certificazione ecologica…”. I dati confermano del resto che tra il 2005 e il 2009 i prodotti ed i servizi che hanno ottenuto l’etichetta ecologica sono passati dai 1.300 ai 10.169. These days due to the financial crisis we hear the Green Economy touted as a necessary path to support social innovation and sustainable economic growth. Italy is not in the spotlight as far as these questions are concerned. We frequently have the idea that Italy, with its infrastructural and bureaucratic handicaps, is a spectator in a process delegated to others. However, that is not the case. There are really excellent undertakings going on in various manufacturing sectors that can completely contrast this negative image once and for all. L’Italia della Green Economy documents the stories of 80 companies that won the Sustainable Development Award between 2009 and 2011 (given by the Svillupo Sostenibile organisation with the adhesion of the President of Italy) which have invested in the environment and clean technologies to bring to light the widespread ability to produce ideas and innovation for energy efficiency, using renewable resources, sustainable construction and the reduction of climate altering gases to bring the Italian economy into line with global trends. Moreover, as Edo Ronchi writes in the preface, “the driver for the green economy in Italy is a process that has not been slowed down by the crisis. In 2009 at the height of the recession, Italy had a higher level of ecological certification...”. The data confirms that between 2005 and 2009 the number of ecologically certified products went from 1,300 to 10,169.

052

a cura di Silvia Zamboni Edizioni Ambiente, Pag. 320, testi: italiano, euro 28,00, www.edizioniambiente.it

LA PISCINA NATURALE La piscina naturale è un laghetto balneabile tecnicamente supportato dove la filtrazione dell’acqua è affidata alla sua vegetazione e microfauna, così come avviene nei bacini d’acqua in natura, e rappresenta un vero proprio piccolo ecosistema. “Costituisce sicuramente un’alternativa bio-sostenibile alla piscina tradizionale, e soprattutto in contesti con forti esigenze di conservazione ambientale, può rappresentare un importante elemento di salvaguardia di alcune specie di organismi (dalle libellule agli anfibi per citarne alcuni) […]In entrambe le tipologie di piscina si persegue l’obiettivo prioritario di garantire condizioni igieniche ottimali alla balneazione ma, mentre nelle piscine tradizionali si ricorre prevalentemente a prodotti chimici per creare un ambiente il più possibile sterile, nelle piscine naturali si crea un ambiente biologicamente vivo ed equilibrato…”. Il contributo che questo testo offre all’argomento è di tipo tecnico e divulgativo, cui fa gioco un importante apparato iconografico. Dai sistemi di ricircolo dell’acqua alla gestione degli esseri viventi, dalle tecnologie, ai materiali, alle normative, vengono approfonditi un po’ tutti gli aspetti che stanno alla base della progettazione dell’impianto, del suo mantenimento e della sua sicurezza. Non mancano schede descrittive di alcune interessanti realizzazioni e proposte ad hoc per le diverse realtà territoriali e i diversi committenti, pubblici e privati. The natural pool is a lake that is suitable for swimming with water that is filtered by vegetation and micro-fauna as it is in natural pools of water. It is a true tiny ecosystem. “It is certainly a bio-sustainable alternative to traditional swimming pools especially in those areas where environmental conservation is an important element in safeguarding certain species of organisms (such as amphibious dragonflies for example […]In both types of pools the priority objective is to guarantee the optimal sanitary conditions for swimming. However, while traditional pools rely prevalently on chemical products to create an environment that is as sterile as possible, in natural pools they search to create a biologically alive and balanced environment...”. This book offers a technical and narrative approach to the theme with a strong iconographic input. Including water recirculation systems, the management of living beings, technologies, materials and norms, it looks into all of the aspects that are important to designing the system including maintenance and safety. There are also descriptive charts with interesting designs and ad hoc proposals to meet different landscaping needs and for both public and private use.

di Maurizio Vegini e Claudio Vegini Sistemi Editoriali, pag. 224, testi: italiano, euro 30,00, www.sistemieditoriali.it


progettohp Testo di Veronica Buratti

Design digitale DIGITAL DESIGN NUOVE E SORPRENDENTI POTENZIALITÀ ESPRESSIVE SONO OGGI OFFERTE DALLA STAMPA DIGITALE AGLI ARCHITETTI CHE LAVORANO NEL MERCATO DELL’INTERIOR DECORATION, DELLA RIQUALIFICAZIONE AMBIENTALE, DELL’ALLESTIMENTO DI NEGOZI E PUNTI VENDITA E DELL’ARREDAMENTO TEMPORANEO PER EVENTI E FIERE TODAY’S ARCHITECTS WORKING IN THE SECTORS OF INTERIOR DESIGN, ENVIRONMENTAL RESTORATION, STORE/RETAIL OUTLET DESIGN AND TEMPORARY EXHIBITS FOR EVENTS AND FAIRS HAVE NEW AND SURPRISING EXPRESSIVE POTENTIAL THANKS TO DIGITAL PRINTING

In un’epoca in cui il decoro assume forme e funzioni sempre diverse, le nuove tecnologie di stampa e la versatile tecnologia Latex HP in particolare, offrono strumenti ecologici capaci di tradurre concretamente queste potenzialità espressive, trasferendo il decoro sui supporti più diversi, ma con la costante garanzia di performance estetiche sorprendenti e qualità tecniche innovative e avanzate. Il decoro da semplice ornamento statico fine a se stesso si è lentamente trasformato in un potente strumento di comunicazione, capace di esprimere con efficacia la vera essenza del pensiero progettuale che sta alla base di ogni proposta professionale. Un’evoluzione e una poliedricità di cui ha fornito un’interessante lettura, sviluppando il tema “Il decoro diffuso - la perdita dei confini”, l’architetto Manuela Bonaiti di Baolab, laboratorio che si occupa dei materiali e delle loro proprietà espressive e prestazionali, con lo scopo di identificare e progettare l’identità emozionale di prodotti industriali e di marchi. Dopo una rapida analisi delle attuali tendenze di mercato, l’architetto Bonaiti ha infatti evidenziato come oggi il decoro abbia assunto nuove forme e funzioni, trasformandosi da semplice modo per abbellire, variare o personalizzare un prodotto, in qualcosa dotato di una propria identità: un racconto, un’indicazione, una caratteristica. Il decoro non è più semplicemente una pelle, un rivestimento, ma è qualcosa di sempre più materico e di volta in volta diverso. Proprio grazie anche alle applicazioni realizzabili con la stampa digitale il decoro può oggi assumere le funzioni più disparate e divenire narrativo, come nel progetto Sin Den, realizzato a Tokyo da Klein Dythan Architecture, nel quale la decorazione della facciata dell’edificio è strettamente correlata al lavoro che il padrone di casa svolge nel negozio al pianterreno. Oppure, relazionale come nel progetto di Sabine Lang e Daniel Baumann Puente Figueroa Alcorta, realizzato a Buenos Aires, in cui i due artisti reinterpretano in maniera davvero efficace il concetto della pop art, lavorando in modo ironico e ludico sui luoghi di massa invece che sugli oggetti di consumo di massa, veicolando, attraverso il decoro, importanti messaggi sociali. O ancora comunicativo, come nell’installazione Louis Vuitton di Shanghai del 2011 in cui la campagna pubblicitaria raccontava, in modo quasi lapalissiano, la grandezza della maison

054

In questa pagina, abito Savage Beauty di Alexander McQueen, decorato con braccia meccaniche, e particolare dell’allestimento 2D3D chairs realizzato a Tokyo presso lo showroom Issey Miyake da Yoichi Yamamoto. Nella pagina accanto, stampa digitale realizzata con la tecnologia HP Latex. On this page, the outfit Savage Beauty by Alexander McQueen decorated with a mechanical arm and a detail from the 2D3D exhibit in Tokyo by Yoichi Yamamoto at the Issey Miyake showroom. On the opposite page, a digital print created with HP Latex technology.


055


lasciando stupito lo spettatore. Ma non solo, il decoro oggi può divenire emotivo, come nel progetto Off the Wall Wallpaper del 2009 di Kicki Edgren Nyborg, che esprime con molta chiarezza la labilità del confine tra decoro e funzione: la carta da parati diventa lampada o mensola senza alterare il suo linguaggio estetico. E ancora, il decoro può divenire identificativo, come nel caso dell’Hotel Fox di Copenhagen dove grafici e artisti hanno personalizzato le stanze che compongono l’albergo dando vita a un luogo estremamente eterogeneo e diversificato, capace di entrare in contatto emotivo con gli utenti e allo stesso tempo di caratterizzare in modo forte l’identità di questa struttura alberghiera. Andando oltre, il decoro può assumente una funzione informativa, come nel caso dell’Hostel Golly ± Bossy di Spalato, progetto realizzato dallo Studio Up preservando gli spazi pubblici, le scale mobili e l’ascensore panoramico dell’ex centro commerciale. Qui il giallo degli interni si vede nettamente dalla facciata che diviene una membrana storica con il quartiere e prolunga percettivamente lo spazio pubblico all’interno dell’edificio. Il decoro può inoltre essere trans-materico come nel caso dell’allestimento 2D3D chairs realizzato presso la show room Issey Miyake di Tokyo da Yoichi Yamamoto. Qui, lavorando su un supporto 3D e sulla sua proiezione su un piano, il decoro crea un gioco illusorio molto suggestivo, dando la sensazione, a chi guarda dalle vetrine, che le sedie siano dotate di gambe. Infine, il decoro può essere istantaneo, una performance dinamica, come nel caso dell’abito Savage Beauty di Alexander McQueen decorato con braccia meccaniche mentre la modella era in movimento. Oggi la versatile tecnologia HP Latex consente di realizzare applicazioni personalizzate assolutamente inodori ed eco-compatibili, che permettono la concretizzazione di numerosi progetti innovativi: carte da parati personalizzate, decorazioni di oggetti, arredi, pareti e superfici murali, pellicole per superfici vetrate, materiali decorativi e artistici. La semplicità di gestione, la massima versatilità, ovvero la possibilità di stampa su un’ampia gamma di supporti, l’ottima qualità delle immagini, i costi contenuti e il minore impatto ambientale garantiti dalla tecnologia HP Latex, offrono ad architetti e interior designer un sorprendente strumento creativo. La realizzazione di stampe inodori di elevata qualità per coperture di grandi e piccole dimensioni adatte alla decorazione di ambienti interni ed esterni consente infatti di accedere a nuovi mercati come per esempio quello della riqualificazione o decorazione di ospedali, scuole ed esercizi pubblici come bar e ristoranti.

In questa pagina, una stanza del singolare Hotel Fox di Copenhagen, un particolare del progetto Off the Wall Wallpaper Di Kicki Edgren Nyborg e un esempio di stampa digitale realizzata su tessuto. Nella pagina accanto, nell’ordine: installazione Louis Vuitton di Shanghai del 2011, particolare del progetto di Sabine Lang e Daniel Baumann Ponte Figueroa Alcorta, realizzato a Buenos Aires, dettaglio del progetto Sin Den, realizzato a Tokyo da Klein Dythan Architecture, una stanza dell’Hotel Fox di Copenhagen e uno scorcio dell’interno dell’Hostel Golly ±Bossy di Spalato, realizzato dallo Studio Up.

056

On this page, a room from the singular Hotel Fox in Copenhagen, a detail from the Off the Wall Wallpaper project by Kicki Edgren Nyborg and an example of a digital print on cloth. On the opposite page, in order: the 2011 Louis Vuitton installation in Shanghai, a detail from the Sabine Lang and Daniel Baumann Ponte Figueroa Alcorta project in Buenos Aires, a detail from the Sin Den design in Tokyo by Klein Dythan Architecture, a room at Hotel Fox in Copenhagen and a view of the interiors of Hostel Golly ±Bossy in Spalato, by Studio Up.

In an era where decoration assumes many different shapes and functions, new printing technologies (and versatile Latex HP technology in particular) serve as ecological tools that can concretely translate this expressive potential by printing decorations on a wide range of supports with the constant assurance of incredible aesthetics as well as innovative and technically advanced quality. Decoration goes from being a simple static ornament to become a powerful tool for communication that is able to effectively express the true essence of the design matrix that is at the foundation of any professional offer. Architect Manuela Bonaiti of Baolab provided an interesting evolution and multifaceted view with an interesting interpretation and development of the theme “The spread of decoration – the disappearance of boundaries”. The laboratory works with materials and their expressive properties and performance in order to identify and design an emotional identity for industrial products and brands. After a quick analysis of current market trends, Bonaiti highlighted that today’s decorations have taken on new forms and functions. They have gone from being simple embellishments that vary or customise a product to being something with a true identity: a story, an indication, a characteri-


stic. Decoration is no longer simply a covering or a surface, it is something that is more material and it is always different each time. Thanks to the possibilities provided by digital printing, decoration today serves a wide range of different functions and it is even narrative at times as in the Sin Den design by Klein Dythan Architecture in Tokyo where the decoration of

the building face was strictly linked to the work that the homeowner carried out in the store on the ground floor of the home. At times it is relational as in the design by Sabine Lange and Daniel Baumann Puente Figueroa Alcorta, in Buenos Aires, where two artists reinterpret the concept of pop art really effectively while working in an entertaining and fun way in public instead of on objects for mass consumption therefore driving important social messages through decoration as well. They can be even more communicative as in the 2011 Louis Vuitton installation in Shanghai where the straight forward ad campaign told the story of the great fashion house leaving the spectator truly astounded. That is not all; today decoration can even be emotional as in the Off the Wall Wallpaper project in 2009 by Kicki Edgren Nyborg, which clearly and easily expresses the narrow confines between decoration and function: the wallpaper becomes a wall or shelf without altering its aesthetic syntax. Decoration can even serve to identify something as in the case of Hotel Fox in Copenhagen where graphic designers and artists personalised the rooms in the hotel making for an extremely diversified and heterogeneous location that is able to enter in emotional contact with the users and at the same time strongly characterise the identity of this hotel. Going even further, decoration can assume an informative function as in the case of Hostel Golly ± Bossy in Spalato, designed by Studio Up to conserve the public areas, the escalators and the panoramic elevator of the former shopping centre. Here the yellow interiors are visible clearly from the façade which becomes a historical membrane with the neighbourhood and seems to lengthen the public area inside the building.

Decoration can even transcend the material as in the case of the 2D3D exhibit chairs at the Issey Miyake showroom in Tokyo by Yoichi Yamamoto. Working with a 3D support and its projection on a shelf, the decoration creates an entertaining illusion that gives those looking inside the display windows the sensation that the chairs have legs. Lastly, decoration can be an instantaneous dynamic performance as in the case of the Savage Beauty suit by Alexander McQueen decorated with mechanical arms while the model was moving. Today, versatile HP Latex technology makes it possible to create customised applications that are absolutely odourless and environmentally friendly making it possible to develop scores of innovative projects: customised wall paper, decorations for objects, furnishings, walls and murals, film coverings for glass surfaces, decorative and artistic materials. Easy to manage, it is extremely versatile since it is possible to print on a wide range of supports with high quality images, reasonable costs and less environmental impact. HP Latex offers architects and interior designers an amazing and creative tool. Since it is possible to create high quality odourless prints for large or small size coverings for decorating interiors or exteriors, it is possible to develop new markets such as restoration or decoration in hospitals, schools and public areas such as bars and restaurants.

057


il puntointervista multipla Testo di Ester Pirotta

Technology & Green Attitude DOPO TANTE PAROLE BEN SPESE È ORA DI PASSARE AI FATTI. IL FOCUS DI OGNI PROCESSO PRODUTTIVO DEVE ESSERE IL RISPETTO DELL’AMBIENTE. CIÒ È POSSIBILE (ANCHE) GRAZIE AL CONTRIBUTO DELLA TECNOLOGIA AFTER A LOT OF TALK IT IS TIME TO GET DOWN TO THE FACTS. THE FOCUS OF ANY PRODUCTION PROCESS HAS GOT TO BE ENVIRONMENTAL RESPECT. THAT IS POSSIBLE THANKS (AT LEAST IN PART) TO TECHNOLOGY L’ecosostenibilità è innanzitutto sinonimo di uno stile di vita, un modo di pensare, un approccio etico alla conservazione dell’ambiente, che si raggiunge (faticosamente in alcuni casi) adeguando le nostre esigenze alle necessità del pianeta. In tutto ciò la tecnologia ha un ruolo fondamentale perché è grazie alle continue evoluzioni in campo tecnologico che oggi si parla di prodotti a basso impatto ambientale, di risparmio energetico, di seconda vita dei prodotti,… Un oggetto sostenibile è innanzitutto un oggetto ben progettato, pensato guardando alla riduzione degli scarti, all’impiego di materiali riciclabili, al risparmio energetico che deriva dal suo impiego, alla durevolezza del prodotto stesso. In secondo luogo è un oggetto prodotto rispettando l’ambiente in tutte le fasi del ciclo produttivo, realizzazione, imballaggio e distribuzione. Progettisti e produttori devono cooperare al fine del raggiungimento di un obiettivo comune. Abbiamo chiesto ad alcuni di loro di parlarci del binomio tecnologia e sostenibilità ambientale. GORDON GUILLAUMIER/DESIGNER www.gordon-guillaumier.com La sostenibilità ambientale è un tema centrale per progettisti e per produttori, ma cosa significa progettare un prodotto sostenibile? Il tema della sostenibilità è diventato un argomento di moda e, come spesso accade in questi casi, viene abusato anche nel nostro settore. Ho la sensazione che spesso questo termine sia citato senza cognizione di causa. Per quel che ne so, si tratta di un concetto complesso con definizione incerta, che lascia spazio alla libera interpretazione da parte di progettisti e produttori. L’unica cosa davvero certa sono i benefici che un “comportamento eco” porta al nostro ambiente di oggi e domani. Tenere in mente ciò significa farsi carico di una grande responsabilità. Questo è già un’ottima premessa. Tecnologia al servizio dell’ambiente: come le innovazioni tecnologiche possono contribuire alla creazione di un prodotto ecosostenibile? Non sono così preparato tecnologicamente per dare una risposta adeguata, ma posso dire che, parlando di innovazioni tecnologiche e sostenibilità, si riscontrano due atteggiamenti contrastanti. Da un lato si producono prodotti tecnologici che vantano un certo riguardo nei confronti dell’ambiente: l’auto con emissioni c02 ridotte, la stampante che consuma meno inchiostro, il frigorifero domestico di classe A etc., argomentazioni eccezionali di marketing che promuovono le vendite. Però dall’altro lato gli stessi prodotti sono purtroppo destinati a durare sempre meno tempo. Se invece si iniziassero a produrre frigoriferi classe A funzionanti per 15/20 anni (e non solo i 6/8 anni attuali), i prodotti diventerebbero eco-sostenibili nel vero senso della parola e il produttore aiuterebbe il consumatore a diventare un vero eco-sostenitore. Secondo lei, il cliente finale è più interessato alla sostenibilità del prodotto che acquista o alle sue caratteristiche tecnologiche? L’atteggiamento dei clienti verso la sostenibilità varia molto in base alla cultura del luogo. Gli scandinavi, ad esempio, sono sicuramente più sensibili all’argomento rispetto agli italiani. In Italia, esistono notevoli differenze nel consumo fra il nord e sud del paese. Direi che le culture nordiche sono più propensi alla sostenibilità in quanto l’utente finale è più attento e preparato sull’argomento. Mentre nelle culture meridionali, la tecnologica è ancora fonte di status sociale specie fra i giovani dove la sostenibilità è ancora un concetto astratto. Cosa presenta al Salone del Mobile 2012? Pochi progetti ma buoni, Lema, Barovier&Toso, Tacchini e Pamar oltre a qualche allestimento per Roda, Interni.

SILVANA ANGELETTI, ANGELETTI RUZZA DESIGN/DESIGNER www.angelettiruzza.it La sostenibilità ambientale è un tema centrale per progettisti e per produttori, ma cosa significa progettare un prodotto sostenibile? Per prima cosa significa progettare un prodotto bello! Un buon design dura per sempre, pensiamo a una sedia di Mies Van Der Rohe o a una lampada di Castiglioni, sono esempi di oggetti fuori dal tempo, di cui non ci si stanca, che diventano compagni di vita. Per il resto, un prodotto è il risultato di tutta una serie di comportamenti etici che devono necessariamente essere rispettati dall’azienda produttrice. Tecnologia al servizio dell’ambiente: come le innovazioni tecnologiche possono contribuire alla creazione di un prodotto ecosostenibile? Sviluppando prodotti più efficienti dal punto di vista del consumo delle risorse che riducano al minimo l’impatto sull’ambiente. Considerando che più del 30% dei consumi domestici d’acqua finisce nel wc, nel progetto della collezione di sanitari Thin per Azzurra, ci siamo concentrati sull’obiettivo di ridurre gli sprechi e abbiamo raggiunto il grande risultato del primo scarico monoflusso al mondo ottenuto con il sistema idraulico standard che funziona anche con uno scarico fino a 2,7 litri d’acqua. Secondo lei, il cliente finale è più interessato alla sostenibilità del prodotto che acquista o alle sue caratteristiche tecnologiche? Bellezza e innovazione rappresentano ancora oggi le spinte principali all’acquisto ma è indubbio che il consumatore avverta con forza la necessità di affrontare il futuro con maggiore responsabilità; si sente parte di uno scenario globale e vuole, e vorrà sempre di più in futuro, oggetti e proposte di design compatibili con l’ambiente. L’acquisto dovrà essere quindi soddisfacente sul piano estetico e sul piano etico. Siamo però convinti che debba essere rimandata alle aziende la responsabilità maggiore di rendere il basso impatto sull’ambiente parte integrante e imprescindibile della progettazione. Cosa presentate al Salone del Bagno 2012? Tanti prodotti per il settore bagno, con aziende come Teuco, Fantini, Azzurra, Graff. JONATHAN CARTER/DIRETTORE MARKETING VICTORIA+ALBERT www.vandabaths.com La sostenibilità ambientale è un tema centrale per progettisti e per produttori, ma cosa significa produrre un oggetto sostenibile? Negli ultimi anni le credenziali ecologiche di tutti i tipi di beni di consumo durevoli sono diventate un argomento su cui discutere e il bagno non fa eccezione. Una maggior consapevolezza che l’acqua è un bene prezioso, così come l’evidenza del cambiamento climatico diffusa dai media, hanno portato molte persone a pensare come poter fare la differenza. L’azienda Victoria+Albert affronta questo tema in modo diretto creando vasche indipendenti per soddisfare le esigenze degli utenti nel lungo termine; li incoraggiamo a scegliere il comfort, la bellezza e la durata, sia nella costruzione che nell’estetica. Più veloce è il ciclo di vita di un prodotto e maggiori saranno i costi ecologici e finanziari associati alla sua sostituzione. Ci prendiamo cura anche dei dettagli, utilizzando pallet riciclati e cartone per trasportare i nostri prodotti. Anche se i nostri prodotti sono di fatto riciclabili, essendo realizzati principalmente in calcare vulcanico che può essere macinato e


In questa pagina: maniglia per mobili serie Basic in metacrilato e zama, progettata da Gordon Guillaumier per Pamar (2011). Collezione di sanitari Glaze di Gordon Guillaumier per Azzurra Ceramiche. Nella pagina opposta: collezioni di sanitari Thin disegnata da Angeletti Ruzza Design per Azzurra Ceramiche (2010). Rubinetto a tre fori Sento in ottone cromato, progettato da Angeletti Ruzza Design per Graff (2011). This page: handle for the Basic series furnishings in methacrylate and a zinc aluminium magnesium alloy, designed by Gordon Guillaumier for Pamar (2011). Collection of Glaze fixtures by Gordon Guillaumier for Azzurra Ceramiche (2011). Next page: collection of Thin fixtures designed by Angeletti Ruzza Design for Azzurra Ceramiche (2010). The Sento faucet with three spouts in chromed brass, designed by Angeletti Ruzza Design for Graff (2011).

riutilizzato per altri scopi, le nostre credenziali ambientali più forti derivano dal fatto che vasche e lavabi sono disegnati per la vita. Tecnologia al servizio dell’ambiente: come le innovazioni tecnologiche possono contribuire alla creazione di un prodotto ecosostenibile? Utilizziamo un materiale tecnologicamente avanzato, Quarrycast, per creare un prodotto davvero resistente ma anche caldo al tatto, senza quella sensazione di freddo che accompagna le vasche in ghisa o in pietra solida. Victoria+Albert si avvale della professionalità di un chimico che lavora insieme ai responsabili della produzione per ottenere la migliore miscela delle ultime resine che vengono combinate con il calcare vulcanico per creare Quarrycast. Una volta ottenuta la qualità desiderata e applicata a ogni stampo, il processo di produzione è assolutamente tradizionale e il prodotto viene modellato e levigato da un

060

artigiano. Il risultato finale è semplice, molto attraente e utilizza di gran lunga meno energia delle alternative in ghisa o con rivestimento acrilico. Secondo lei, il cliente finale è più interessato alla sostenibilità del prodotto che acquista o alle sue caratteristiche tecnologiche? Innanzitutto i nostri clienti sono interessati alla bellezza e alla funzionalità, scegliendo un prodotto che conferisca un tocco di design alle loro case. L’ecosostenibilità è importante per loro, ma non quanto un prodotto più tradizionale. I nostri prodotti, in particolare le grandi vasche indipendenti, sono articoli di lusso il cui impiego dona benessere all’utente. Tuttavia le credenziali ecologiche si possono misurare anche con parametri diversi, per esempio il modo in cui il prodotto isola l’acqua significa che occorre meno acqua per mantenere il calore. Inoltre se il prodotto è durevole significa che passeranno decenni prima


che sia necessario sostituirlo e questa è una considerazione fondamentale parlando di sostenibilità. Cosa presentate durante il Salone del Mobile 2012? E’ la prima volta che partecipiamo al Salone del Mobile di Milano. Particolarmente interessante per la questione della sostenibilità è l’anteprima di un design indipendente che combina bassi volumi (quindi risparmio d’acqua) con forme belle e avvolgenti. In parte scultura e in parte vasca da bagno, il nuovo modello reinventa le regole delle tipiche caratteristiche di una vasca indipendente di lusso, aumentando il comfort e riducendo il volume totale di acqua e il tempo di riempimento. Inoltre esponiamo la vasca a doppia testa Barcelona rifinita in nero lucido, la vasca ultra compatta Edge, il lavabo Edge 45 e Shropshire, una tradizionale vasca a schienale alto.

Laminam On Top, un nuovo sistema di utilizzo di Laminam per superfici orizzontali, che si presta a personalizzare con stili e effetti diversi ogni piano di lavoro per la preparazione dei cibi. ALDO MAGNANI/DIRETTORE MARKETING MOSAICO+ www.mosaicopiu.it

STEFANO NENCIONI/ IMAGE & COMMUNICATION MANAGER LAMINAM www.laminam.it

La sostenibilità ambientale è un tema centrale per progettisti e per produttori, ma cosa significa produrre un prodotto sostenibile? I produttori che realmente si impegnano ad agire e produrre in modo sostenibile vanno certamente incontro a maggiori oneri e costi per mantenere gli standard qualitativi richiesti dagli enti certificatori. Dopo alcuni anni di dichiarazioni spesso con pochi contenuti concreti, stiamo giungendo a una situazione più matura. Notiamo ancora però una certa “fobia da certificazione”, dettata dalla presenza di un cono d’ombra sulla conoscenza di quali siano le certificazioni necessarie e realmente piene di

La sostenibilità ambientale è un tema centrale per progettisti e per produttori, ma cosa significa produrre un oggetto sostenibile? Produrre in modo sostenibile significa sostanzialmente prestare attenzione alle materie prime impiegate, ai metodi utilizzati e ai processi che si innescano. Ciò comporta una maggiore conoscenza del proprio prodotto e del modo in cui la propria azienda funziona. Io credo che negli ultimi anni sia stato fatto molto, le aziende hanno capito l’importanza e la centralità del tema. I progettisti hanno cominciato a prestare molta attenzione alle scelte che prendono e credo che l’architettura e il design in generale non sia più pensabile lontano da questo tipo di approccio. Tecnologia al servizio dell’ambiente: come le innovazioni tecnologiche possono contribuire alla creazione di un prodotto ecosostenibile? Nel caso di Laminam, la tecnologia rivoluzionaria che sta alla base della creazione del nostro prodotto, è stata concepita per ottimizzare le risorse ed è stata pensata nel rispetto dell’ambiente. Laminam rappresenta il risultato di una scoperta tecnologica che pone attenzione nei confronti dell’ambiente. Secondo lei, il cliente finale è più interessato alla sostenibilità del prodotto che acquista o alle sue caratteristiche tecnologiche? Il cliente di oggi è informato, attento e sensibile. Sostenibilità e tecnologia vanno di pari passo e rappresentano due aspetti fondamentali. Il tema della sostenibilità è molto sentito e guida le scelte dei nostri interlocutori. Allo stesso tempo i progettisti e gli utenti finali non rinunciano alle migliori performance di un prodotto all’avanguardia dal punto di vista tecnologico. Cosa presentate durante il Salone del Mobile 2012? Durante la Design Week milanese nello showroom di via Mercato presentiamo

contenuti. A volte i documenti esibiti da alcune aziende a titolo di certificazione altro non sono che dichiarazioni di intenti o addirittura semplici attestati di membership a determinati enti. Insomma la strada è aperta, il cammino si sta chiarendo, ma siamo ancora arrivati alla meta. Tecnologia al servizio dell’ambiente: come le innovazioni tecnologiche possono contribuire alla creazione di un prodotto ecosostenibile? Per quanto riguarda Mosaico+ e le linee eco, le modalità sono molteplici. Si tratta di fare proseguire il ciclo di vita di un prodotto vetroso ormai a termine, reimmettendolo come materia prima in un nuovo ciclo produttivo. Parliamo inoltre di un processo di sinterizzazione e non di fusione del vetro: si ha un notevole risparmio energetico (intorno all’80-85%), in quanto si porta il materiale a 850°C (contro i 1450°C della fusione) e per meno di 3 ore (rispetto alle oltre 10 ore della fusione). Aggiungiamo l’emissione di gas combusti, praticamente innocui, rispetto ai gas notoriamente cancerogeni emessi durante il processo di fusione. Infine, nel processo di sinterizzazione, si ha un risparmio d’acqua pari al 50%. Secondo lei, il cliente finale è più interessato alla sostenibilità del prodotto che acquista o alle sue caratteristiche tecnologiche? In linea di massima viene data un’alta priorità al prodotto sostenibile. Nel caso però la sostenibilità vada a inficiare le caratteristiche tecnologiche a volte si ripiega sul valore tecnologico. Per quanto ci riguarda ecosostenibilità ed elevatissime caratteristiche tecnologiche convergono nelle ultime collezioni prodotte, Area24 e Crono, quindi il problema non si pone.

061


Eco-sustainability is above all a lifestyle choice and a way of thinking. It is an ethical approach to preserving the environment that is reached (though with difficulty at times) by bringing our needs into line with the needs of the planet. Technology has a fundamental role in all that because it is thanks to the constant evolution of technology that we can currently speak about low environmental impact products, energy savings, the second life of products and much more. A sustainable object has to be a well-designed object that was designed to reduce waste, to use recyclable materials, to save energy when in use and to be durable. Secondly, it is an object that was produced with environmental respect in each stage of the manufacturing, processing, packaging and distribution cycles. Designers and manufacturers have got to cooperate to reach a common goal. We spoke to some of them about technology and environmental sustainability. In questa pagina: lavabo e vasca da bagno della serie Edge in quarrycast®, prodotti da Victoria+Albert (2012). Lavabo da appoggio della serie Barcelona in quarrycast®, prodotto da Victoria+Albert (2011). Nella pagina opposta: collezione Linfa di Laminam, lastra in ceramica effetto legno, disponibile nelle varianti colore Cotone, Canapa, Corteccia, Cenere, Cocco (2011). Dettaglio della lastra Filo Mercurio di Laminam, in ceramica effetto tessuto.

062

This page: sink and bathtub from the Edge series in quarrycast®, produced by Victoria+Albert (2012). Counter top sink from the Barcelona series in quarrycast®, produced by Victoria+Albert (2011). Next page: the Linfa Collection by Laminam, ceramic sheet with a wood effect available in various colours including: cotton, hemp, bark, ash and coconut (2011). Detail of the Filo Mercurio sheet by Laminam, in ceramic with a woven effect.

GORDON GUILLAUMIER/DESIGNER www.gordon-guillaumier.com Environmental sustainability is a key theme for designers and manufacturers, but what does it mean to design a sustainable product? The concept of sustainability has become a fashionable topic, and that means unfortunately that it is often abused even in our sector. I have the feeling that this term is frequently cited without a real reason. From what I know, it is a complex concept with an uncertain definition that leaves room for free interpretation by designers and manufacturers.


The only things that are certain are the benefits that “environmentally friendly action” will bring today and tomorrow. Keeping that in mind means taking on a big responsibility. This is a good premise in itself. Technology serving the environment: how do technological innovations contribute to the creation of an eco-sustainable product? I am not technologically skilled enough to give you a precise answer, but I can say that in speaking about technological and sustainable innovation, we find two contrasting attitudes. On one side we find technological products that boast about attention to the environment: automobiles with low cO2 emissions, printers that use less ink, class A home refrigerators and more. However, on the other side, these same products are destined to last less time. If they began making class A refrigerators that functioned for 15-20 years (instead of just 6-8) then products would be eco-sustainable in the true sense of the word and manufacturers would be helping consumer to become real eco-supporters. In your opinion, are consumers more interested in the sustainability of the products they buy or their technological characteristics? Customers’ attitudes vary a great deal depending on the customs of the area in question. Scandinavians are certainly more conscientious about it than Italians. In Italy there are major differences between consumers in the north and those in the south. I would say that Nordic cultures are further along with sustainability because the end consumers are more aware of and informed about the topic. In cultures in the south where technology is still a source of social status among the young, sustainability is still an abstract concept. What are you presenting at Salone del Mobile 2012? A few very good designs including Lema, Barovier&Toso, Tacchini and Pamar as well as a few exhibits for Roda, Interiors. SILVANA ANGELETTI, ANGELETTI RUZZA DESIGN/DESIGNER www.angelettiruzza.it Environmental sustainability is a key theme for designers and manufacturers, but what does it mean to design a sustainable product? First of all it means designing a beautiful product! A good design is timeless like a Mies Van Der Rohe chair or a Castiglioni lamp. These are timeless examples that you never tire of and that become life companions. All said a product is the result of a series of ethical actions that must be respected by the manufacturing company. Technology serving the environment: how do technological innovations contribute to the creation of an eco-sustainable product? By developing products that consume resources more efficiently and reduce environmental impact to a minimum. In the development of the design for the Thin and Azzura sanitary fixtures we concentrated on the objective to reduce waste since over 30% of home water consumption winds up being flushed down the toilet. We had great results: the first single-flush in the world with a standard plumbing system that functions with a flush of only 2.7 litres. In your opinion, are consumers more interested


in the sustainability of the products they buy or their technological characteristics? Beauty and innovation are still the major purchasing drivers, but it is undoubtedly true that consumers are feeling a strong need to look to the future with greater responsibility. They feel like a part of the global world and they want and will continue to want design items that are environmentally compatible. The purchase has got to be satisfying on an aesthetic level and on an ethical level. However we are convinced that companies must take more responsibility to make low environmental impact design a necessary part of their designs. What are you presenting at Salone del Mobile 2012? A number of products for the bathroom sector with companies including Teuco, Fantini, Azzurra and Graff. JONATHAN CARTER/DIRETTORE MARKETING VICTORIA+ALBERT www.vandabaths.com Environmental sustainability is a key theme for designers and manufacturers, but what does it mean to design a sustainable product? In recent years the ecological credentials of all types of durable consumer goods have become a topic of discussion and bathrooms are no exception. Greater awareness that water is a precious resource and greater awareness of climatic changes thanks to the media has made people think about how to make a difference. The Victoria+Albert firm looks at this theme directly by creating independent bathtubs to satisfy consumer needs in the long term. We encourage them to choose comfort, beauty and long lasting products with high level construction and aesthetics. The shorter the life cycle of a product is the greater the ecological and financial costs associated with its replacement will be. We take care with the details as well by using recycled pallets and cardboard to transport our products. Our products are even recyclable since they were made primarily from volcanic lime that can be ground up and reused for other purposes. However, our greatest environmental credentials come from the fact that our bathtubs and sinks are designed to last a lifetime. Technology serving the environment: how do technological innovations contribute to the creation of an eco-sustainable product? We use a technologically advanced material named Quarrycast to manufacture a product that is truly resistant and it has a warm feel without that cold sensation that comes from cast iron or solid stone bathtubs. Victoria+Albert collaborates with a chemist who works together with the manufacturing personnel to create the best mix of the latest resins. Then they are combined with the volcanic lime to create Quarrycast. After reaching the desired quality and applying it to each mould, the production process is absolutely traditional and the product is shaped and polished by an artisan. The final result is simple, very attractive and it uses much less energy than the alternatives in cast iron or with acrylic finishes. In your opinion, are consumers more interested in the sustainability of the products they buy or their technological characteristics? Our customers are interested in function and beauty

first. They want a product that gives a touch of design to their home. Environmental sustainability is important to them but not as much as a more traditional product. Our products, and in particular the large independent bathtubs, are luxury items that provide the users with wellbeing. Ecological credentials can be measured with other parameters such as the way the product insulates the water, which in turn means that it takes less water to maintain the heat. And if the product is durable it will last decades before needing replacement and that is a fundamental consideration when talking about sustainability. What are you presenting at Salone del Mobile 2012? This is the first time we have participated at the Milan Salone del Mobile. The preview of an independent design that combines low capacity (therefore water savings) with beautiful and involving shapes is particularly interesting as regards the question of sustainability. It is part sculpture and part bathtub:

Le tessere tridimensionali della collezione Crono_ Pulsar firmata Giugiaro Design per Mosaico+ (2012). Colori brillanti per le tessere in vetro sinterizzato della collezione Area25 prodotta da Mosaico+ (2012). The three-dimensional tiles from the Crono_Pulsar collection by Giugiaro Design for Mosaico+ (2012). Brilliant colours for the sintered glass tiles of the Area 25 collection produced by Mosaico+ (2012).

the new model reinvents the typical characteristic rules of an independent luxury bathtub and increases the comfort while reducing the total volume of water and the filling time. We also have the Barcelona model double head bath in shiny black, the ultra compact Edge bathtub, the Edge 45 sink and Shropshire, which is a traditional high-back bathtub . STEFANO NENCIONI/ IMAGE & COMMUNICATION MANAGER LAMINAM www.laminam.it


Environmental sustainability is a key theme for designers and manufacturers, but what does it mean to design a sustainable product? Environmentally sustainable production basically means paying attention to the materials and methods used and the processes involved. That brings greater awareness of the product and the way the company functions. I believe that a lot has been done in recent years. Companies have understood the importance and the centrality of the theme. Designers have started paying a lot of attention to their choices and I believe that today it is impossible to consider architecture and design in general without this approach. Technology serving the environment: how do technological innovations contribute to the creation of an eco-sustainable product? In the case of Laminan, the revolutionary technology behind the product was designed to optimise resources and it was designed in respect of the environment. Laminam is the result of a technological discovery that pays attention to the environment. In your opinion, are consumers more interested in the sustainability of the products they buy or their technological characteristics? Today’s customers are well informed, careful and sensitive. Sustainability and technology go hand in hand and they represent two fundamental aspects. The theme of sustainability is taken to heart by consumers and it guides their choices. At

the same time, designers and end consumers will not renounce better product performance from a technological point of view. What are you presenting at Salone del Mobile 2012? During Design Week in Milan at the Via Mercato showroom we are presenting Laminam On Top, which is a new system of Laminam for horizontal surfaces that is perfect for customising each kitchen counter with different styles and effects. ALDO MAGNANI/DIRETTORE MARKETING MOSAICO+ www.mosaicopiu.it Environmental sustainability is a key theme for designers and manufacturers, but what does it mean to design a sustainable product? Manufacturers who really work and act to manufacture sustainably have more responsibilities and higher costs in order to maintain the quality standards required by the certification agencies. After several years of declarations that were backed up by few facts, we are reaching a more mature situation. We do still find some “certification phobia” dictated by a lack of knowledge regarding which certifications are necessary and important. Sometimes the documents certain companies use as titles of certification are nothing more than declarations of intent or even membership certificates from

certain institutions. We could say the road has been opened, the path is becoming clearer but we are still only half way there. Technology serving the environment: how do technological innovations contribute to the creation of an eco-sustainable product? Regarding the Mosaico+ and eco lines, there are a number of ways. It involves continuing the life cycle of a glass product that was waste and reusing it as a new material in a new manufacturing process. This is moreover the process of synterization and not fusion of glass: there are great energy savings (around 80-85%) since the material is heated to 850°C (compared to 1450°C for fusion) and for less than 3 hours (instead of the 10 hours required for fusion). The fumes produced are practically harmless compared to the notoriously cancerous gasses emitted during the fusion process. Lastly, the process of synterization saves about 50% in water. In your opinion, are consumers more interested in the sustainability of the products they buy or their technological characteristics? Generally speaking, a great deal of importance is given to sustainability in products. However, if the sustainability affects the technological characteristics, at times people choose technology over sustainability. The latest product collections such as Area24 and Crono combine sustainability and high level technology and therefore the problem doesn’t exist.


067


nazione, contribuendo a rendere un’atmosfera morbida e rilassante. Sul fondo, a definire ancora meglio l’area living, è collocato un divano nero, posto a cardine tra il grande terrazzo e la zona pranzo; quest’ultima, in cui predomina il tavolo, eseguito su disegno, con piano in resina madreperlacea e attorniato da sedie vintage, rielaborate artisticamente con patine e tessuti zebrati, è separata e, nello stesso tempo, collegata alla cucina tramite un grosso blocco materico-pittorico realizzato con colore, pigmento e velatura metallica. La ridefinizione spaziale dei vani ha permesso al ridotto spazio originale di ospitare un ampio e razionale sistema cucina. “La casa – osserva Bazzan – pur mantenendo una sua unità compositiva, è composta da due realtà funzionali e distributive, la zona giorno al primo livello e l’area notte al secondo piano, trattate in maniera diversa, a cominciare dalla scelta dei materiali e dalla paletta cromatica. Più algida la prima, dove è l’architettura stessa a divenire parte integrante dell’arredo, più calda e materica la seconda”. Elemento di cerniera tra i due livelli è la scala metallica avvolgente, posizionata al centro del living, che funge da collegamento linguistico oltre che fisico. Questa, partendo dall’effetto ottenuto dalle superfici traslucide dei parapetti in tela di lino grezzo, annegata nel metacrilato, e dalle pedate rivestite con la stessa resina usata per la pavimentazione, attraversa la soletta trasformandosi in un gioco di volumi ricavati nel total white del ribassamento e culmina in un geometrico squarcio sul livello superiore, dominato dagli accesi toni delle cromie utilizzate. Centro ideale del piano è rappresentato, in corrispondenza con il trasparente lucernario voltato a botte, da un rigoroso giardino d’estate realizzato in lastroni di pietra leccese proveniente da Melpignano e ciottoli di marmo in rosso Verona, quale solida reminescenza mediterranea. Pochi curvi gradini in lavagna nera permettono di accedere alla torretta belvedere; la quale, elevandosi sopra le falde in coppi, si configura come una splendida altana affacciata sui tetti del centro storico. Se da un lato, nell’area notte, si allineano i locali destinati ai bambini con camera da letto e il bagno, dall’altro, la stanza matrimoniale è preceduta da una zona relax, anticipazione della stanza stessa; che, grazie a una cabina armadio, eseguita su misura in rovere sbiancato, porta alla grande sala da bagno, dove il senso di rigore compositivo si associa ai criteri di pulizia e benessere. Qui, all’interno di un preciso volume cubico si è disposta una netta ma trasparente separazione dei tre ambiti di utilizzo, servendosi di due enormi lastre di vetro. “Il bagno, posto verticalmente sul vano scala, ha rappresentato la sfida più importante. E’ l’elemento più disegnato della casa, nel senso che la maggior parte degli arredi e i vari componenti sono stati appositamente progettati e realizzati per questo spazio, che è quello che ha comportato un impegno maggiore”. “Parlando con i committenti – aggiunge l’architetto – era emersa la necessità di creare un ambiente unico, in grado, tuttavia, di tenere ben divise le funzioni e la loro distribuzione. Ho immaginato, così, una sorta di scatola vuota formata dalle pareti del locale, in cui ho inserito un secondo cubo, in corrispondenza del lucernario, formato da due fogli in vetro, calati dall’alto, paralleli e perpendicolari al prospetto destro della stanza”. Appena entrati nella camera, si trovano gli eleganti lavabi, in vetro temprato e acidato, a cui è stata abbinata la rubinetteria in acciaio inox spazzolato. Sopra, lo specchio a incasso nel muro. Di fronte, sul lato opposto, i sanitari della serie Link di Flaminia. Al centro, il box doccia.

068

I tre ambiti, così suddivisi, sono messi in relazione da due gradini, tali da formare una pedana, che consentono il passaggio; più un terzo che permette di scendere nel vano centrale. “Il sistema individuato – commenta Bazzan – è un chiaro riferimento al repertorio stilistico veneziano. Città dove ho studiato, avvicinandomi al linguaggio di Carlo Scarpa, alla sua cura per il dettaglio; in particolare, lì dove l’architetto sperimenta il rapporto che si instaura nell’architettura tra materiali diversi e materiali acquei”. Le lastre in vetro temperato neutro, alte due metri e venti e larghe due metri, fungendo come impalpabili separatori d’ambiente, formano, per l’appunto, una specie di modulo volumetrico dedicato alla doccia; divenendo, quest’ultimo, contemporaneamente, anche vasca da bagno, quando l’acqua che fuoriesce dalla lunga lama d’acciaio lo colma fino a sommergere il primo gradino, alla pari di un acquario. Le superfici sono tutte rivestite in lastra ceramica agli ossidi di ferro della Porcelanosa, mentre le luci, a spot, sono incassate a parete. Il soffitto, tinteggiato con smalto all’acqua grafite, dove si apre il grande lucernario filtrato da un pannello in multistrato di metacrilato e lino, e il pavimento, sempre nei toni scuri, quasi plumbei, che


richiamano la cromia dei rivestimenti, contribuiscono alla definizione di un ambiente che si avvicina, per forma e sostanza, alla tipologia delle odierne spa e centri benessere. “La committenza è stata così contenta del risultato raggiunto – conclude l’architetto – che mi ha chiesto di riproporre lo stesso progetto per il bagno di servizio al primo livello, quello aperto agli ospiti; ovviamente, rivisitandolo e adattandolo a esigenze diverse. Concettualmente, ma anche per garantire una sorta di continuità compositiva, è stato traslato al piano terra il motivo predominante della sala da bagno padronale, quasi come se il locale, decisamente più piccolo, fosse una sua emanazione; un satellite come amo definirlo”.

In questa pagina: il bagno padronale al primo livello. Appena entrati nella camera, si trovano gli eleganti lavabi, in vetro temprato e acidato, a cui è stata abbinata la rubinetteria in acciaio inox spazzolato. Sopra, lo specchio a incasso nel muro. Nella pagina accanto, in alto: schizzo di progetto. All’interno di un preciso volume cubico si è disposta una netta ma trasparente separazione dei tre ambiti di utilizzo, servendosi di due enormi lastre di vetro. In basso: schizzi dell’area living e della scala avvolgente. On this page: the master bath on the first storey. After entering the bedroom, we find elegant sinks in tempered and frosted glass with brushed stainless steel taps. Above, the mirror is built into the wall. On the opposite page, above: design sketch. Inside a precise cubic shape there is a clear and transparent separation between the three areas of use created by two enormous sheets of glass. Below: sketches of the living area and the stairway.

069


Here we find a precise design objective that immediately answers the needs of the owners with every design choice reflecting the contemporary, fluid and dynamic language: it can be felt in the new design for interiors by architect Gian Luca Bazzan. In his redesign of the upper floors of an aristocratic building from the end of the eighteen hundreds in the centre of Busto Arsizio in the Varese province north of Milan, the designer created a new residence for a young couple working in the fashion sector. The four hundred square meter apartment is on two storeys with a terrace and panoramic loft. It is turned into a developmental base that creates a new paradigm of style through careful formal and material composition. At the moment of purchase, the home was in good condition even though it was visually reminiscent of the former owners’ style. This drove the desire to strongly customise the space. The guiding line of Bazzan’s design – the architect has two decades of experience in and outside Italy in the residential and fashion retail sector – can be found in his decision to focus on function and rigour and to distinguish the entire space. At the same time he also created a design matrix that is able to unite the needs of a young family with two kids and the development of an area that is also suited for frequent social occasions. This development is expressed through

070

visual criss-crossing, the management of the natural and artificial light, the accurate choice of materials and fun shapes that turn into folded, detached and layered surfaces. The final result is an enchanting atmosphere that starts at the entrance, opens onto the large living area and culminates in the master bath on the upper storey. “The building – the architect explains – has an eclectic style that echoes the classicism of its era and it is protected by the Superintendent of the Arts. This made it impossible to make any changes to the façade including different colours or new doors or windows. We absolutely respected the existing exteriors and the historical references while making them communicate with the interiors. We had to consider the load bearing walls in the configuration of the loft and then shortly after for the terrace; under certain aspects it will be the projection of the perspective axis that focuses on the living room. From the entrance, which faces onto the living area, it opens onto a visual binocular that is fifteen metres long and three and a half meters wide that rests on the mineral resin floor in neutral grey tones. Above, it is marked by light folded surfaces inclined towards the ceiling that hide long vertical slits of light. The careful study of the lighting made it possible to accentuate the

character of the home. During the day, the light sources create delicate chiaroscuro reflections inside the area showered by sunlight. In the evening, thanks to gradual regulation, they completely satisfy lighting necessities and contribute to making the area soft and relaxing. At the back of the living area a black sofa is placed between the large terrace and the dining area - dividing them. The dining room has a custom designed table in mother of pearl resin surrounded by antique chairs that have been artistically redesigned with new finishes and zebra upholstery. The kitchen and dining room are separate and connected at the same time with a large pictorial-material block made from colour, pigment and metallic coating. The spatial redefinition of the rooms made the small original space able to hold a large and rational kitchen. “The home – Bazzan stated – maintains its compositional unity even though it is made up of two functional and distributional realities. The living area on the first floor and the sleeping area on the second floor are treated differently: with a different choice of materials and colour palate. The first is cooler and the architecture itself becomes an integral part of the furnishings. The second is more material and warmer.” The joining element between the two levels is the metallic stairway positioned in the centre of the living room - ser-

In questa pagina: il bagno padronale. A destra: una veduta che guarda sui sanitari (serie Link, prodotti da Flaminia) e posizionati di fronte ai lavabi. Alla parete lo scaldasalviette bianco. Al centro: il vano dedicato alla doccia che diviene vasca da bagno, quando l’acqua che fuoriesce dalla lunga lama d’acciaio lo colma fino a sommergere il primo gradino. Nella pagina accanto: un’ampia vista sull’ingresso e sui lavandini. Tutte le luci sono incassate a parete.

On this page: the master bath. On the right: a view of the sanitary fixtures (Link series produced by Flaminia) and positioned in front of the sinks. On the wall, a white towel warmer. At the centre: the shower room also serves as the bathtub when the water that flows out of the long steel blade and fills it up to cover the first step. On the opposite page, a view of the entrance and the sinks. All of the lights are built into the wall.


ving as a stylistic connection as well as a physical one. Beginning with the effect of the transparent parapets in rough linen cloth dipped in methacrylate and the footstools covered with the same resin used for the flooring, a game of total white shapes develops and culminates in a geometric view of the upper storey dominated by tones of the same colours. The ideal centre of the floor is decorated with a domed transparent skylight, a rigorous summer garden made from stone from Melpignano in Lecce and red marble gravel from Verona which are reminiscent of the Mediterranean. A few curved stairs in black slate provide access to the panoramic tower which is above the tiled roof and seems like a splendid covered terrace above the roofs of the historic centre. In the sleeping area, the children’s rooms are aligned with a bedroom and bathroom. In the other, the master bedroom is preceded by a relaxation area in front of the room itself which is behind a built in closet in bleached oak that leads to the bathroom where the driving idea behind the composition is associated with cleanliness and wellbeing. Here inside this cubic shape there is a transparent separation between the three areas with two enormous glass sheets. “The bathroom is located vertically on the stairway area representing

the most important challenge. It is the most extensively designed element in the home in the sense that most of the furnishings and components were specially designed and developed for this space, and that was the biggest part of the job”. The architect added “after talking to the owners we decided to create one single environment that was able to keep the functions and the distribution separate. I imagined a sort of empty box formed by the walls of the room and I inserted another cube inside it that corresponds with the skylight formed by two sheets of glass from above - parallel and perpendicular with the right view of the room”. After entering the room, we find elegant sinks, tempered and frosted glass paired with stainless steel polished taps. Above, the mirror built into the wall. In the front, on the opposite side, the sanitary fixtures of the Link series by Flaminia. In the centre, the shower enclosure. The three rooms divided this way were put in relation by two stairs, to form a raised stand that allows for passing. Another third stair makes it possible to descend to the main room. Bazzan commented, “The system is a clear reference to Venetian style. That is where I studied and it brought me closer to the style of Carlo Scarpa and his care for detail. In particular, there where the

architect develops the relationship that is put into the architecture between different materials and aquatic materials”. The neutral tempered glass sheets are two hundred and twenty centimetres high and two meters wide and they serve as transparent dividers to form a kind of shaped unit for the shower which also serves as a bathtub when the water flows from the long steel unit it flows over to submerse the first stair like an aquarium. The surfaces are all covered in ceramic iron oxide ceramic sheets by Porcelanosa while the spot lights are built into the wall. The ceiling is coloured with water based graphite enamel where the large skylight filtered by a multilayer panel of methacrylate and linen opens up. The floor in darker tones is reminiscent of the hues of the coverings and it contributes to defining an environment that is similar in form and substance to contemporary spas and wellness centres “The owners were so pleased with the results – the architect concluded – that they asked me to repeat the same project for the service bathroom on the first floor for guests; with a new interpretation to meet the different needs. Conceptually and to ensure a design continuity, the predominating theme of the master bath was used on the ground floor almost as if the room, which is much smaller, were an emanation or a satellite as I like to define it”.

071


interiorssingapore Testo di Barbara Delmiglio e Chiara Naldini Progetto DP Architects (www.dpa.com.sg) Foto Rory Daniel (www.rorydaniel.com)

Notti a effetti speciali NIGHTS WITH SPECIAL EFFECTS VIAGGIO NELL’IMMAGINARIO IN UNO DEGLI HOTEL PIÙ ECCENTRICI DI SINGAPORE A TRIP THROUGH IMAGINATION IN ONE OF THE MOST ECCENTRIC HOTELS IN SINGAPORE A Little India, tra i colori accesi e i profumi esotici di un quartiere dalla storica immigrazione indiana, il Wanderlust Hotel è a non più di dieci minuti dalle cosmopolita Orchard Road e dal Central Business District, eppure non potrebbe sembrare più lontano: è un luogo pensato per viaggiatori non convenzionali, distante anni luce dai luoghi comuni di una Singapore proiettata verso un’anonima e standardizzata architettura del futuro. All’interno di un edificio degli anni Venti, i suoi 4 piani e le 29 camere sono stati progettati a più mani da 4 studi di architettura e graphic designer: Asylum, Phunk Studio, fFurious e DP Architects. Ognuno ha fornito l’interior concept per un intero piano, camere incluse, sotto il coordinamento dei DP Architects, che oltre a organizzare i progetti di tutto l’edificio hanno anche disegnato il terzo livello. Tutti e quattro gli studi avevano solo un obiettivo: realizzare spazi per chi viaggia non solo con la valigia ma soprattutto con l’immaginazione. Invitare a esplorare luoghi onirici ed estroversi, creativi e divertenti. È il proprietario


una surreale atmosfera fluo. Nonostante siano tutte diverse per forma e colore, in queste camere viene comunque riproposta la stessa tipologia nella distribuzione degli spazi e nella scelta degli arredi: bagno e camera sono un tutt’uno, con il letto rialzato su una pedana a due gradini e due box in vetro che racchiudono doccia e wc. A unificare gli ambienti ci pensa una piastrellatura a tessere di mosaico per il letto e per i rivestimenti interni delle capsule trasparenti. Tra questi due box, il lavandino è invece lasciato aperto, con uno specchio a parete e una serie di ripiani portaoggetti. La vasca free standing trova posto a parte, in un’area ritagliata all’interno della piastrellatura del pavimento. Qui il rivestimento è a grigliato per raccogliere l’acqua e gli schizzi che possono cadere durante il bagno. Una controsoffittatura sfaccettata con incassati alcuni faretti trasforma la stanza in una sorta di astronave futurista. CREATURE COMFORTS All’ultimo piano invece lo studio fFurious ha progettato le camere dei Creature Comforts, mostri ironici e giocosi pensati come compagni per i viaggiatori più avventurosi. Scenografie ludiche si rivelano attraverso maxi sculture, arredi o disegni grafici su pareti e pavimento. Con lo spazio a doppia altezza e un soppalco che ospita il letto, ogni stanza è stata pensata come una sorta di galleria d’arte, così da vivere la notte come un’esperienza di divertimento e creatività. Tra queste la camera ASCII ricorda l’antro di una grotta, con pareti rivestite di mattoni cifrati e scolpiti in rilievo che si assemblano a formare un albero pietrificato. In questo loft, il livello inferiore è occupato da una grande vasca incassata in una pedana, con il lavandino che poggia su un ripiano della stessa struttura. Docce e sanitari sono invece nascosti da separé in vetro traslucido. Se ASCII può sembrare un antro goticheggiante, Space è invece la stanza del futuro: nello sfondo blu elettrico di pareti e pavimenti, un razzo rosso fuoco sembra pronto a lanciarsi verso lo spazio. Il letto è su un soppalco sottolineato da un neon azzurro, mentre nello spazio sottostante, delimitato da un’esile colonnina rossa, è stato ricavato il bagno. Un top rivestito da tessere di mosaico blu fa da piano d’appoggio per il lavabo mentre doccia e sanitario sono nascosti in box chiuso da porte in vetro. A separare il lavabo da una candida vasca incassata ci pensano due specchi verticali che scorrono su binari nascosti nella struttura del soppalco. Sparsi per tutta la stanza, una serie di pupazzi alieni gioca tra realtà e fantasia. dell’hotel, Lob Lik Peng a spiegare come “i visitatori qui possono riconnettersi con una piccola parte della loro infanzia e, ancora una volta, rimanere incantati da ciò che aveva dato loro il desiderio di esplorare il mondo. Ricordo ancora il senso di avventura, il divertimento e l’emozione di scoprire il mondo quando viaggiavo da bambino, ma da grandi spesso si perde l’entusiasmo. Wanderlust è il mio tentativo di trasformare la realtà degli adulti in un parco dei divertimenti, ancora una volta”. A partire dal piano terra, dove la lobby e un ristorante anticipano i tratti che saranno poi di tutto l’hotel: un eccentrico melange di elementi industriali, tratti esotici, design contemporaneo, il tutto colorato a flash vivaci.

Ma sono soprattutto il primo e l’ultimo piano a determinare la personalità del Wandelust, uno con il tema Eccentricità, l’altro con Creature Comforts, che già il nome dice tutto. ECCENTRICITÀ Progettate da William Chan e Jackson Tan dello Phunk Studio le camere “eccentriche” sono pensate come sorte di capsule colorate, ognuna monocolore e corrispondente a una canzone celebre, come Yellow Submarine e Purple Rain. Le luci al neon sparano una luminosità diffusa sugli arredi e sulle pareti colorate, così che nelle camere dove i colori sono sgargianti, come nel caso della stanza pink o yellow, l’atmosfera si accende di

Nella pagina accanto, due versioni delle camere chiamate Eccentriche che giocano con il giallo e il grigio: hanno pareti colorate e luci che evidenziano le tinte choc. In entrambe i sanitari e la doccia sono “incapsulate” in box di vetro rivestiti da tessere di mosaico. On the opposite page, two versions of the rooms classified as Eccentriche that are highlighted in yellow and grey: they have coloured walls and lights that highlight the shocking hues. In both, the sanitary fixtures and the shower are ‘encapsulated’ in a glass enclosure covered with mosaic tiles.

073


In Little India, between the bright colours and exotic aromas of this neighbourhood that was traditionally inhabited by Indian emigrants, the Wanderlust Hotel is no more than ten minutes from cosmopolitan Orchard Road and the Central Business District and yet it couldn’t seem more distant. It was designed for more non-conventional travellers and it is light years away from the typical areas in Singapore that tend towards anonymity and standard futuristic architecture. Inside the building from the twenties, the 29 rooms are arranged on 4 floors and the design was developed by 4 architectural firms and graphic designers: Asylum, Phunk Studio, fFurious and DP Architects. Each provided the interior design for an entire floor including the rooms all under the coordination of DP architects, which and also designed the third floor. All four firms had a single objective: to create a space for people who want to travel not only with their luggage, but above all, with their imagination. It invites guests to explore dreamlike areas that are extroverted, creative and fun. The hotel owner Lob Lik Peng explains that “visitors can reconnect with a small part of their childhood here and once again be enchanted by that which gave them a desire to explore the world. I still remember the sense of adventure, fun and the emotion of discovery when I travelled as a child, but we frequently lose that as adults. Wanderlust is my attempt to transform the reality of adults into an amusement park another time”. Starting with the ground floor, the lobby and a restaurant give the first signs of the characteristics we find throughout the hotel: an eccentric melange of industrial elements with exotic features and contemporary design all coloured with lively flashes. However, it is above all the first and the top floors that create the personality of Wanderlust with the themes of Eccentricità and Creature Comforts – the names say it all.

074

ECCENTRICITÀ Designed by William Chan and Jackson Tan of Phunk Studio, the “eccentric” rooms were designed like coloured capsules, each with a single colour that corresponds with a famous song like Yellow Submarine or Purple Rain. The neon lights create diffused luminosity for the furnishings and coloured walls so that in the rooms with very bright colours (like the pink or yellow rooms) the area lights up in a surreal and fluid atmosphere. Despite the fact they are all different shapes and colours, the rooms have the same arrangement of spaces and the same choices in furnishings: the bedroom and bathroom are all one room with a bed raised on a stand, two steps and two glass boxes that enclose the toilet and shower. The areas were linked by a mosaic tile covering for the bed and the interior covering of the transparent capsules. Between these two enclosures, the sink has been left open with a wall mirror and a series of shelves. The free standing bathtub is in a separate area created within the floor tiles. Here the floor has a grill to catch any water that drips from the bathtub. The faceted lowered ceiling has built-in spotlights that seem to transform the room into a futuristic space ship. CREATURE COMFORTS On the top floor, the firm fFurious designed the Creature Comforts rooms with fun and entertaining monsters designed to be travel companions for the more adventurous. Playful scenes are depicted in large sculptures, furnishings and graphic designs on the walls and floors. The double height ceiling holds a loft with a bed and each room is designed like an art gallery so that guests can pass the night filled with fun and creativity. Among these, the ASCII room is reminiscent of a grotto with walls covered in textured


bricks that are arranged to assume the form of a petrified tree. In this loft, the lower level holds a bathtub built in a stand with a sink that rests on a shelf of the same structure. The showers and sanitary fixtures are concealed behind the divider in translucent glass. If ASCII seems a little like a gothic cave, Space is like the room of the future: the electric blue backdrop of the floors and walls is highlighted by a red rocket that seems poised for takeoff. The bed is on a raised floor highlighted by azure neon lights while the bathroom is in the area below delimited by a thin red column. A counter covered in blue mosaic tile serves as a base for the sink while the shower and sanitary fixtures are hidden by enclosures with glass doors. The sink and white built-in bathtub are separated by two vertical mirrors that slide on tracks hidden in the raised structure. A series of alien stuffed animals that are somewhere between reality and fantasy are arranged throughout the room.

All’ultimo piano del Wanderlust, sono state realizzate le stanze più scenografiche, tra cui la camera futurista Space, a sinistra, e la camera ASCII che ricorda l’antro gorico di una grotta, sotto. On the top floor of the Wanderlust, we find the most scenographic rooms including the futuristic rooms Space, on the left, and the ASCII room that is reminiscent of a gothic grotto below.

075


interiorslondra Testo di Barbara Delmiglio e Chiara Naldini - Foto di Ewout Huibers www.ewout.tv - Progetto Concrete Architectural Associates www.concreteamsterdam.nl

London luxury LOOK CONTEMPORANEO PER I BAGNI DI UN HOTEL LONDINESE CHE FA DEL LUSSO LA SUA CARTA VINCENTE A CONTEMPORARY LOOK FOR THE BATHROOMS IN A LONDON HOTEL THAT IS ALL ABOUT CAPTIVATING LUXURY Nel cuore del west end londinese, nella zona dell’intrattenimento tra Leicester Square e Wardour Street, tra Soho e una delle piazze più famose del mondo, sorge il nuovissimo W hotel, il quarantesimo hotel nel mondo del marchio W Hotels Worldwide di Starwood. Un’icona mondiale del lusso che nel corso degli anni si è trasformata in una vera e propria istituzione per quei viaggiatori sempre alla ricerca di servizi di prima classe e confort di elevatissima qualità. L’edificio, costruito dall’impresa edile irlandese McAleer & Rushe, è stato progettato dallo studio londinese Jestico + Whiles ed è già destinato a diventare una delle mete più ambite della città per visitatori e londinesi stessi. All’esterno la facciata dell’hotel è stata interamente “avvolta” da una seconda pelle in vetro traslucido come fosse una tenda mobile di un sipario, a evocare l’eredità cinematografica di questa zona di Londra. A creare una straordinaria e suggestiva scenografia, posto dietro a questo grande velo di vetro che funziona come un grande schermo pixelato, un impianto di illuminazione in grado di variare luminosità e colore durante le ore del giorno e della notte. Se di giorno il W hotel appare come una struttura fresca e sobria, nella notte si trasforma in una sorta di performance luminosa incandescente. Varcata la soglia d’ingresso,

076

segnalata da una gigante W luminosa, si accede all’interno della grande hall, uno spazio abbagliante di riflessi in cui la vera protagonista è una grande nuvola – scultura realizzata con 280 palle da discoteca. Gli interni, progettati dallo studio olandese Concrete Architectural Associates riprendono la doppia anima della cultura britannica, da un lato un certo rispetto per lo stile classico, dall’altro la ricerca della contemporaneità e di un design innovativo. I progettisti hanno saputo interpretare straordinariamente questo dualismo optando per un arredamento funzionale abbinato ad alcuni elementi del British style, mixando tecnologia, tradizione e design all’interno di spazi comuni che si sono trasformati in perfette locations per vivere la nightlife londinese. Atmosfere tecnologiche e lussuose per le 192 camere e le 17 suite all’interno dell’hotel: ospitate su diversi piani e identificate in base alla loro tipologia e al loro layout, hanno nomi e spazi differenti, dalla Wonderful alla Fabulous room, dalla Wow suite alla Spa e alla eWow suite. Qui in ciascuna di queste stanze gli interior designers si sono ispirati al concetto di “studio living”, che non considera più il bagno e la camera da letto come due aree separate e indipendenti ma piuttosto come spazi che si


In queste pagine, linee maschili e tonalità grigio scure nella eWow suite dove nell’angolo dedicato alla stanza da bagno spicca il grande bancone in corian, una sorta di toilette dalle forme contemporanee ed essenziali. On the opposite page a few photos of the Wonderful room where the bathroom is an integral part of the living space and it is visible from the bedroom forming one completely open space.

077


fondono l’uno nell’altro senza soluzione di continuità, pur mantenendo ancora una certa riservatezza e una loro privacy. Così i bagni diventano parte integrante dello spazio abitabile, visibili dalla camera in un ambiente open space. Caratteristica comune a tutte le stanze la presenza quasi scultorea di un grande bancone, dalle forme geometriche squadrate ed essenziali realizzato interamente in Corian®. Si tratta di una struttura completamente bianca giocata sulle forme geometriche e l’alternanza di pieni e di vuoti, corredata di contenitori, lavabi, porta asciugamani e ripiani in acciaio cromato. A decretarne la sua immagine contemporanea e rigorosa una rubinetteria estremamente minimalista, dalle linee geometriche pure ed eleganti. All’interno di ogni camera, ad accezione di alcune suite in cui si è optato per i toni del grigio, lo spazio bagno punta ai colori neutri, attraverso la scelta di un rivestimento che sfuma dal beige al marrone chiaro. Così i rivestimenti di pareti, porte, armadi e pavimentazione sono in perfetta armonia cromatica e non solo: gli arredi che attrezzano parte delle pareti, ripropongono anche i giochi di forme, di pieni e di vuoti del grande bancone toilette, fulcro totemico dello spazio bagno. Nelle suite, dove lo spazio delle camere ha dimensioni maggiori, la zona destinata a ospitare il bagno si dilata, anche per effetto delle grandi pareti a specchio su entrambi i lati che in alcuni punti nascondono gli ingressi alla zona dei sanitari e a quello del box doccia. Qui, in questo paradiso della privacy, la vasca da bagno è inserita, a seconda della tipologia di suite, in modi differenti ma altrettanto scenografici: in alcuni casi appare separata e interamente avvolta da una semplicissima struttura in Corian®, in altri diventa un tutt’uno con la struttura del bancone, trasformandolo in una sorta di maxi scultura contemporanea. Il tema dell’illuminazione, trattato con grande attenzione, è giocato sul contrasto morbido tra le luci a led bianche e calde e le luci led viola poste all’interno di una serie di insenature verticali. Un effetto visual fortemente tecnologico ma anche carico di forte impatto emotivo, capace di evocare atmosfere da assoluto relax tra riflessi algidi e ammalianti.


Nella pagina accanto, alcune immagini della Wonderful room, dove il bagno diventa parte integrante dello spazio abitabile, visibile dalla camera in un ambiente totalmente open space. In questa pagina, la spa suite caratterizzata da colori neutri e morbidi. Qui il bancone diventa un tutt’uno con la grande vasca da bagno, trasformandosi in una vera e propria presenza scultorea. On the opposite page a few photos of the Wonderful room where the bathroom is an integral part of the living space and it is visible from the bedroom forming one completely open space. On this page, the suite spa is characterised by neutral soft colours. Here the counter becomes a single unit with the large bathtub like a true sculpted element.

079


In the heart of London’s west end in the entertainment district between Leicester Square and Wardour Street between Soho and one of the most famous Squares in the world, we find the brand new W hotel – the fortieth in the world for W Hotels Worldwide by Starwood. An icon in the world of luxury, it has become an institution in recent years for travellers looking for first class services and high quality comfort. The building was constructed by the Irish firm McAleer & Rushe and it was designed by the London firm Jestico + Whiles. It is already destined to become one of the most popular destinations with tourists and Londoners themselves. Outside, the hotel façade was entirely covered by a ‘second skin’ in translucent glass that looks like the mobile curtain of a stage recalling the cinematic history of this part of London. Behind this large glass curtain that functions like a pixel screen, the lighting system creates extraordinarily interesting scenography with variable luminosity and colours during the day and night. During the day W hotel looks like a fresh and refined structure and by night it transforms into a lighted incandescent performance. After passing through the entrance marked by a giant lighted W, you reach the large hall with myriad reflections highlighted by a large cloud – the protagonist sculpture was created with 280 mirror balls. The interiors were designed by the Dutch firm Concrete Architectural Associates in homage to the twin souls of British culture – on one side the respect for classic style alongside the search for contemporary and innovative design. The designers did an extraordinary job interpreting this dualism by choosing functional furnishings blended with a few British style elements to mix technology, tradition and design inside the public areas making them a perfect location for living London’s nightlife. The 192 rooms and 17 suites are technological and luxurious: located on different floors they are divided by type and layout with different names and arrangements including the Wonderful or Fabulous rooms, the Wow suite, the Spa and even eWow suite. In each of these rooms, the interior designers developed the theme of studio living where the bedroom and bathroom are no longer considered as two separate and independent areas, but as spaces that blend together without interruption while maintaining some level of space for privacy. The bathrooms become an integral part of the living area and they are organised in an open space that is visible from the bedroom. All of the rooms share a large and almost sculpted vanity counter with a geometric square and essential shape made entirely from Corian®. The totally white structure is developed with geometric shapes and alternating full and empty spaces that are equipped with storage elements, sinks, towel holders and chromed steel shelves. The contemporary image comes from the sophisticated and extremely minimalist taps with pure and elegant geometric outlines.

080

Inside each room (with the exception of a few suites where grey tones were chosen) the bathrooms are decorated in neutral tones with coverings that range from beige to light brown. The wall coverings, doors, closets and flooring are in perfect colour harmony and that is not all: the


furnishings that cover part of the walls pick back up the shapes and the full and empty spaces of the large vanity counter that is like a symbolic fulcrum for the space. In the suites where the rooms are larger, the bathroom space is even larger. This is emphasised by the large mirrored walls on both sides that hide the entrances to the areas with the sanitary fixtures and the shower enclosure. We find the bathtub here in this private paradise. It is positioned in various scenographic ways depending on the type of suite: in some cases it is separate and entirely covered by a simple Corian® structure and in others it becomes one with the counter structure to create a sort of large contemporary sculpture. The lighting project was developed with great care and it highlights the soft contrast between the white and warm LED lights and the purple LED lights located inside a series of vertical insets. The highly technological look stimulates an atmosphere of absolute relaxation amidst cool hypnotic reflections.

In queste pagine, nella Wow suite, dai toni più algidi e metallici, la zona destinata alla privacy ha dimensioni extra large e la vasca si presenta separata dal bancone toilette. Le pareti a specchio nascondono gli accessi alla zona sanitari e al box doccia.

On these pages, in the Wow suite with cool metal tones, the private area is extra large and the bathtub is separate from the vanity counter. The mirrored walls hide the entrance to the area with the bathroom fixtures and the shower enclosure.

081


interiorsberlino Testo di Barbara Delmiglio e Chiara Naldini - Foto di Adrian Schulz - Progetto Berlinrodeo interior concepts (www.berlinrodeo.com)

Il lusso della semplicità THE LUXURY OF SIMPLICITY A BERLINO, DUE PROGETTI DOVE L’ELEGANZA È PROPOSTA IN UNA VERSIONE CLASSICA; SCEGLIENDO COLORI TENUI, LINEE NITIDE E UN DESIGN LINEARE TWO DESIGNS IN BERLIN WHERE ELEGANCE IS DEVELOPED IN A CLASSIC VERSION – WITH SUBTLE COLOURS, CLEAR LINES AND A LINEAR DESIGN Due spazi di grande respiro, due bagni che hanno mantenuto l’anima classica del contesto storico valorizzandola con una riprogettazione di gusto contemporaneo. Nessuno stravolgimento, ma neppure una conservazione meticolosa degli ambienti. È più un equilibrio tra quella che era l’ariosità dell’architettura guglielmina e l’essenziale eleganza del design più attuale. E il risultato è tanto prezioso quanto semplice. A mettere mano a questo appartamento a Berlino è lo studio tedesco Berlinrodeo, riprogettandolo per una famiglia che voleva abitare in una casa pratica e nello stesso tempo sofisticata. Quindi via libera agli spazi dagli alti soffitti e alle finestre retrò, e soprattutto via libera agli arredi dalle linee squadrate tanto amate dai minimalisti di questi anni, accostate ad algide piastrelle in marmo screziato o a tesserine in mosaico dalle sfumature degradanti. BAGNO AZZURRO Il primo bagno è quello padronale, con uno spazio tanto ampio da riuscire ad attrezzarlo sia con una maxi vasca da bagno sia con una doccia. Le pareti sono parzialmente lasciate in intonaco bianco per dare un senso di

082

continuità alle pareti candide del resto dell’appartamento, mentre nella cosiddetta “wet zone” sono rivestite con tessere di mosaico di vetro azzurro, grigie e celeste, posate apparentemente senza uno schema preciso ma per creare un movimentato effetto acqua. A dare luce a questo ampio bagno due lunghe finestre affiancate: nonostante i serramenti moderni, la loro silhouette retrò evoca le origini antiche dell’edificio e per questo non sono state nascoste da tende o sistemi di oscuramento interni. In un bagno così grande, per sfruttare al massimo lo spazio, sono stati scelti i doppi lavandini, che poggiano sopra un elemento contenitore realizzato su misura in legno scuro zebrano: le venature orizzontali del top scorrono parallelamente alla parete e spezzano la scacchiera regolare del mosaico. I lavabi sono i modelli Compact di Cosmic, in bathstone bianca, dalle linee molto squadrate accostati a rubinetteria altrettanto essenziale, dell’azienda scandinava Vola. Sopra i lavabi una striscia a specchio corre per tutta la parete, interrotta solo da lampade applicate dell’azienda Supermodular. Le luci da parete sono pensate per essere posizionate orizzontalmente ma qui diventano un’alternativa alle


Semplice nella pianta ma elegante nella scelta degli arredi: questo bagno a Berlino ha doppi lavabi Compact di Cosmic e rubinetteria Vola. Grazie all’ampiezza dello spazio disponibile sono stati realizzati sia la doccia a parete, sia la vasca realizzata su misura. Il radiatore è Snake di Scirocco.

classiche luci sopralavabo e, con il loro taglio verticale, spezzano otticamente l’andamento dello specchio a nastro. Alla stessa marca i progettisti sono ricorsi per i faretti a incasso nel soffitto, luci doppie posate simmetricamente per dare armonia spaziale a tutto l’ambiente. Lo stesso rivestimento in legno zebrano del top viene ripreso anche in un elemento contenitore posto sotto le due finestre. Oltre a piano d’appoggio questo mobiletto realizzato su misura funge da rivestimento della parete, così da poter incassare la rubinetteria della vasca da bagno. E’, questa, una maxi vasca realizzata su misura, interamente bianca e dagli angoli tagliati in diagonale per snellire la silhouette monolitica. A parete, il radiatore Snake, di Scirocco, dalla forma spirale squadrata in acciaio fa da scalda salviette. Libera, sulla parete interamente in mosaico che fronteggia la vasca, è posizionata la doccia, con soffione Combi, dotato di mixer termostatico con 3 getti differenti e doccia a manopola, tutto di Vola. Non è stato realizzato il piatto ma l’acqua scarica direttamente a pavimento, sulle piastrelle in Sandstone. I sanitari sono invece nascosti in un vano accanto alla porta d’ingresso, dietro una porta a vetro satinata.

With a simple design and an elegant choice of furnishings: this bathroom in Berlin has double Compact sinks by Cosmic and Vola taps. In the ample space available, a large wall shower was created as well as a custom bathtub. The Snake radiator is by Scirocco.

BAGNO VERDE Il secondo bagno ha dimensioni più ridotte, con un piccolo lavandino e sanitario sospeso. Le pareti di tutto il locale sono rivestite da materiali diversi, con mattonelle in marmo verde, piastrelle in ardesia grigia e intonaco bianco. A terra, il pavimento è sempre in marmo ma dalle tonalità più chiare. Anche qui, come nell’altro bagno, i sistemi di illuminazione sono di Supermodular, con doppi faretti a soffitto e una barra luminosa applicata allo specchio. Il lavandino è di Cosmic, formato da un elemento contenitore a sospensione con un vano aperto che diventa un portaoggetti. Il sanitario, dalla linea altrettanto basic, è a sospensione, firmato Duravit.

083


Two large open areas, two bathrooms that have maintained the classic feel of the historical context highlighting it with a contemporary redesign. There was no major overhaul or meticulous conservation of the existing environments. It was more of a balancing between that which was the airy architecture of Guglielmina and the essential elegance of the most current design. The result is as fabulous as it is simple. The Berlinrodeo design firm is the hand behind this apartment in Berlin redesigning it for a family who wanted a practical and sophisticated home. Therefore no holds barred for the areas with high ceilings and he retro windows and especially for the squared furniture that is so popular with minimalists in recent years. It is all set against cool tile in veined marble or mosaic tiles with tonal shading. BAGNO AZZURRO The master bath has so much space that it is able to contain a large-size bathtub and a shower. The walls were left partially in white mortar to give a sense of continuity with the white walls throughout the rest of the apartment. The so-called ‘wet zone’ is covered with azure, grey and light blue glass mosaic tiles which are mounted without any apparent pattern while creating an effect similar to the movement of water. This large bathroom is lit by two long windows that are side by side: despite the modern window fittings, the retro silhouette brings to mind the historical origins of the building which is why they were not hidden by curtains or shades on the inside. In this very large bathroom, double sinks were chosen to take the maximum advantage of the space. The counter top sinks rest atop a custom storage piece made from dark zebrawood: the horizontal veining of the top runs parallel to the wall breaking up the regularity of the chequered mosaic. The sinks are Compact models by Cosmic in white bathstone with a squared shape and a truly essential tap by the Scandinavian firm Vola. Above the sinks, a strip of mirror runs all along the wall and it is only interrupted by the lamps by Supermodular. The wall mount lights were designed to be positioned horizontally, but here they are used as an alternative to the classic light above the sink and their vertical design helps to visually break up the long ribbon mirror. The same brand was chosen by the designers for the inset ceiling lights – the double lights are mounted symmetrically to create spatial harmony in the whole area. The same zebrawood covering of the top is picked back up in the storage element

084


under the two windows. Besides serving as a counter, this custom furnishing serves to cover the wall so that the taps for the bathtub are inset. This huge bathtub was custom designed. It is white with diagonally cut corners to make the large shape less bulky. A Snake radiator by Scirocco has a squared spiral form in steel and serves as a towel warmer. On the interior wall in mosaic in front of the bathtub, we find the freestanding shower with a Combi showerhead and a thermostatic mixer with three different spray settings and a hand shower all by Vola. There is no shower tray, but instead the water drains directly into the floor covered in Sandstone tile. The sanitary fixtures are concealed in a room beside the entrance, behind a frosted glass door. BAGNO VERDE The second bathroom is smaller with a small sink and suspended toilet fixture. The walls of the room are covered with various materials including tiles in green marble, tiles in grey slate and white plaster. On the floor, the flooring is in marble in lighter hues. Here, as in the other bathroom, the lighting systems are by Supermodular with double lights inset in the ceiling and a lighted bar on the mirror. The sink by Cosmic has a suspended storage element with an open area for easy access. The Duravit toilet fixture is simple and suspended model.

La doccia a parete e quella della vasca, sono entrambe modello Combi di Vola. Nel secondo bagno, qui sotto, i rivestimenti hanno materiali diversi: mattonelle in ardesia, marmo verde e pareti lasciate a intonaco bianco per dare articolazione a uno spazio piccolo. Il lavandino formato da un elemento contenitore a sospensione è Cosmic, mentre il sanitario è firmato Duravit. The walls shower and bath shower are Combi models by Vola. In the second bathroom here below, the flooring has different materials: slate bricks, green marble and white stucco walls to enliven the small space. The Cosmic sink counter is formed by a suspended container and the sanitary fixtures are by Duravit.

085


:::'(6,*1',))86,2179

DDW srl | Via Lucano, 3 | 20135 Milano | Italy Tel. +39 02 5516109 Fax +39 02 5456803 e-mail: info@designdiffusion.com internet: www.designdiffusion.com web tv: www.designdiffusion.tv


Design Diffusion World

:::'(6,*1',))86,21&20


Il progetto Tuout del gruppo Clears 5 interpreta in modo innovativo l’ambiente bagno di un Centro Commerciale, lasciando molto spazio anche all’interazione comunicativa dei cilindri. Tuout by the Clears 5 group innovatively interprets the bathroom in a shopping centre also by leaving a lot of space for the communicative interaction of the cylinders.

089


TUOUT DEL GRUPPO CLEARS 5 (Chiara Sbrizzi, Laura Anna Carella, Enrica Cortesi, Rocco Morrone, Shayan Karim) Tuout è l’ambiente bagno di un Centro Commerciale, progetto partito dalla verifica di tutto quello che solitamente manca all’interno di questi ambienti. La prima scelta è stata quella di progettare spazi accessibili a tutte le tipologie di utenza e di situarli in una posizione non tradizionale. Normalmente i bagni, in queste realtà, sono collocati in posizioni di risulta e comunicano poche emozioni per l’uso di materiali poco innovativi e colori poco vivaci. La prima fase progettuale è stata la ricerca di una forma, il cilindro, che si potesse ripetere generando complessivamente una sensazione di movimento. Da qui i dieci cilindri, cinque per uomo e cinque per donna, con colori e dimensioni differenti posizionati al centro di una

090

galleria e contenuti in una “teca” di vetro che riesce a far vedere quello che accade dall’interno all’esterno e viceversa. Per creare un collegamento tra in e out sono previsti tubi rivestiti con un materiale morbido e deformabile, che all’esterno possono essere utilizzati come sedute, mentre all’interno del cilindro ricoprono la rete idraulica. Nel bagno sono stati utilizzati i sanitari della linea Bohemien e Flow di Simas, e la rubinetteria Deque di Dornbracht, mentre le pavimentazioni delle due “teche” contenenti i cilindri sono rivestite in gres porcellanato della linea Pietra Mediterranea di Casadolcecasa di Florim. Grazie alla tecnologia di Sime, l’ambiente utilizza l’impianto solare termico a soffitto del Centro Commerciale per il riscaldamento dell’acqua a uso sanitario, e l’areazione avviene attraverso una canalizzazione a sezione rettangolare incassata a scomparsa nel controsoffitto, producendo riscaldamento e raffrescamento all’ambiente.


Sempre per il progetto Tuout, i dieci cilindri, cinque per uomo e cinque per donna, con colori e dimensioni differenti sono posizionati al centro di una galleria e contenuti in una teca di vetro. Another view of the Tuout design: ten cylinders (five for men and five for women) in different colours and sizes contained in a glass case at the centre of a gallery.

(Chiara Sbrizzi, Laura Anna Carella, Enrica Cortesi, Rocco Morrone, Shayan Karim) Tuout is a bathroom for a shopping centre that searches to include everything that is usually missing in these areas. The first choice was to design accessible areas for all types of users and place them in a non-traditional location. Normally bathrooms in shopping centres are located in quiet corners and they rarely use innovative materials or lively colours. The first phase of the project was to develop a form – the cylinder – that could be repeated to generate an overall feeling of movement. Then the ten cylinders (five

for men and five for women) of different heights and colours were placed at the centre of a gallery and closed inside a glass ‘case’ that provides a view of the inside and the outside. To create a connection between the inside and outside, there are soft pliable tubes that can be used as chairs on the outside, and inside the cylinder they cover the plumbing system. The bathrooms were furnished with Bohemien and Flow fixtures by Simas, and Deque taps by Dornbracht, while the flooring in the two ‘cases’ contains cylinders covered in stoneware from the Pietra Mediterranea line by Casadolcecasa di Florim. Thanks to

the technology of Sime, the area uses thermal solar power from the ceiling of the shopping centre to provide hot water and it is ventilated by a rectangular duct built into the false ceiling that produces heating and cooling.

091


SPLASH_MONODOSI DI BENESSERE DEL GRUPPO TETRA (Antonio Iaconianni, Viola Lucioni, Sebastiano Marchiò, Valeria Mercogliano, Marco Testa) Il concept Splash_Monodosi di Benessere è una flash spa pensata per un pubblico giovane, dinamico che vive i ritmi frenetici di una metropoli come Milano. Splash (spa+flash) nasce come spazio bagno a servizio di un centro benessere, ma può vivere anche in maniera indipendente. All’interno di un’area di circa 120 mq oltre agli spazi di servizio come spogliatoi, docce, wc e lavabi è stato creato un mini centro benessere nel quale sono reinterpretate diverse stazioni di un percorso termale fruibili in completa autonomia in spazi e tempi ridotti. L’intera area bagno si presenta come un ambiente futuristico e asettico, grazie all’eps armato e successivamente rasato e verniciato con pittura idrorepellente, utilizzato sia come struttura autoportante della flash spa sia per il rivestimento delle pareti laterali e del soffitto. Per la pavimentazione interna alla mini spa sono state utilizzate le piastrelle Link della linea Casamood di Florim, mentre per quella esterna le piastrelle Chromtech/1.0 Point nero della linea Floor Gres di Florim. L’elemento che caratterizza questo locale è un tunnel lungo 12,80 m e alto 2,40 m, in cui si sviluppa un percorso wellness veloce in cui ai benefici dell’acqua, che da più calda diventa sempre più fredda, si uniscono quelli della luce colorata secondo le regole della cromoterapia. Per garantire il comfort termico sia all’interno che all’esterno del tunnel le pareti

092


racchiudono un sistema di riscaldamento radiante a bassa temperatura gestito da una caldaia a condensazione di Sime, unito a sistema U.T.A. a soffitto per la deumidificazione degli ambienti. Per quanto riguarda l’acqua calda sanitaria, è prevista una caldaia ad alta temperatura sempre di Sime. Il tunnel costituisce l’elemento separatore tra l’ambiente donna e uomo, che contengono sei servizi igienici ognuno celati dietro le pareti contenitore. Ogni modulo misura 1,60 m per 1,60 m e presenta un antibagno, con funzioni di spogliatoio, destinabile però interamente all’area wc nel caso in cui la flash spa fosse utilizzata a supporto di un centro benessere che già dispone di spogliatoi. Per tutti i moduli sono stati utilizzati i wc sospesi in ceramica bianca della linea OH! di Simas Acqua Space. Il tunnel è strutturato secondo una scansione alternata di zone di passaggio e zone di sosta, in queste ultime è presente uno spazio per ricevere i massaggi seduti o in piedi. Il percorso inizia con il passaggio attraverso tre lame d’acqua, ottenute grazie alle Water Bar della linea Balance Modules, e conduce alla prima area dedicata al massaggio cervicale, che è possibile ricevere posizionandosi sotto le Water Sheet della linea Balance Modules che erogano un getto d’acqua pieno a cascata, tutti di Dornbracht. La seconda area è destinata al massaggio lombare, ottenuto sempre grazie alle Water Bar della linea Balance Modules di Dornbracht, il cui getto d’acqua colpisce dolcemente la schiena, e per accedervi occorre passare attraverso un portale d’acqua nebulizzata. L’accesso alla terza zona, che si diversifica attraverso una pavimentazione con sassi arrotondati che fanno l’effetto di un massaggio plantare, si presenta come un getto d’acqua con effetto pioggia ottenuto grazie ai Soffioni Laterali della linea Meta.02 di Dornbracht. L’esperienza si conclude con una doccia sotto il Rain Sky E della linea Balance Modules di Dornbracht, dove per il fruitore potrà scegliere tre tipi di programmi, rilassante, energizzante o doccia scozzese, prima di accomodarsi nell’area relax finale In Splash _Monodosi di Benessere, il progetto del gruppo Tetra, una flash spa pensata per un pubblico giovane e dinamico che vive i ritmi frenetici di una metropoli come Milano. Splash _Monodosi di Benessere, designed by the Tetra group is a flash spa created for a young and dynamic public that lives the frenetic lifestyle of big cities like Milan.

093


(Antonio Iaconianni, Viola Lucioni, Sebastiano Marchiò, Valeria Mercogliano, Marco Testa) Splash_Monodosi di Benessere is a flash spa designed for a young and dynamic public that lives the frenetic rhythms of big cities like Milan. Splash (spa+flash) was developed as a bathroom for a wellness centre, but it can also be used independently. Inside the 120 square meters, it contains dressing rooms, showers, toilets and sinks as well as a mini wellness area with various thermal stations that can be used independently in a small space quickly. The entire bathroom area seems like a futuristic and ascetic environment thanks to the reinforced EPS that has been plastered and painted with waterproof paint which serves as a load-bearing structure for the flash spa and it covers the side walls and ceiling. The flooring inside the mini spa is covered in Link tiles from the Casamood line by Florim, and outside the spa the flooring is made from Chromtech/1.0 Point black tiles from the Floor Gres line by Florim. The element that distinguishes this locale is a 12.80 m long 2.40 meter wide tunnel that contains a short wellness path with beneficial waters that go from warm to cooler blended with the coloured lights that serve to provide chromotherapy. To ensure that it is comfortably warm inside and outside the tunnel, the walls contain a radiant low temperature heating system with a condensation boiler made by Sime, with a U.T.A. ceiling system to dehumidify the rooms. The hot water for the fixtures is provided by a high temperature boiler by Sime. The tunnel serves to separate the men’s and women’s area and the sanitary services are each concealed by the containing walls. Each unit is 1.60m x 1.60m with an anteroom that serves as a dressing room or it can be incorporated into the bathroom area if flash spa is used at a wellness centre that already contains dressing rooms. All of the bathrooms use suspended white ceramic toilets from the OH! Line by Simas Acqua Space. The tunnel is developed with alternating traffic and rest areas. In the rest area there is a space for seated or standing massage. The path begins by passing through three blades of water provided by Water Bar from the Balance Modules line and it leads to the first area dedicated to neck massage, which can be enjoyed while sitting under the Water Sheet of the Balance Modules line that provides a full sheet of water by Dornbracht. The second area is destined to lumbar massa-

ge once again thanks to Water Bar from the Balance Modules line by Dornbracht, which provides a spray of water that gently caresses the back and to reach it you must pass through a portal of nebulised water. In the third area, which has different flooring made of rounded stones that give a foot massage, we find a jet of water for a rain effect that comes from the Soffioni Laterali from the Meta.02 line by Dornbracht. The experience ends with a shower under Rain Sky E from the Balance Modules collection by Dornbracht, where the user is able to choose between three programs: relaxing, energising or a Scottish shower before relaxing in the final area.

I moduli doccia per progetto Splash.

094

The shower units for the Splash design.


UNI.TO DEL GRUPPO SEISTELLE (Raffaela Cameli, Raffaele Cataldi, Gaia Cicaloni, Marta Grimoldi, Claudia Sgandurra, Laura Valli) UNI.TO è collocato all’interno di un hotel di design e l’idea di emancipazione è alla base del concept, che nel bagno viene enfatizzata con ambienti wc unisex e totalmente accessibili, immediatamente identificabili nello spazio e liberamente fruibili. Il progetto occupa un’area di circa 120 mq, in una posizione d’angolo, predominante, con doppio affaccio su strada rispetto a un’ipotetica location nel centro di Milano. L’intera progettazione è ispirata ai principi dell’universal design, pensando in prima istanza all’utenza più debole; i volumi e le superfici sono caratterizzati da contrasti di tipo materico e cromatico volti a favorire l’immediata riconoscibilità degli ambienti. Lo spazio bagno è aperto nella fascia oraria 7-22 e totalmente visibile dalla strada: entrando l’utente sarà libero di accedere direttamente alla zona wc oppure agli spazi accessori, o di accedere alla hall dell’hotel e alla zona ristorante lounge. I wc sono disposti attorno a uno spazio ibrido di forma circolare, caratterizzato dalla pavimentazione realizzata materiali naturali opportunamente trattati: il cerchio è il luogo geometrico ideale, che non impone una gerarchia di spazi dato che tutti i punti della circonferenza sono equidistanti dal centro. Le cabine wc, dodici in totale, prevedono i sanitari sospesi serie Duemilasette di Simas Acqua Space e sono caratterizzati da rivestimenti verticali in mosaico serie vetro della linea Casamood di Florim, mentre per la pavimentazione è stata scelta la serie Geotech, della linea Floorgres di Florim. La zona dei lavabo, dove sono previsti lavabi serie Duemilasette di Simas Acqua Space incassati in

(Raffaela Cameli, Raffaele Cataldi, Gaia Cicaloni, Marta Grimoldi, Claudia Sgandurra, Laura Valli) UNI.TO is located inside a design hotel and it is based on the concept of emancipation and in the bathroom that is emphasized with unisex, completely accessible restrooms which are easy to spot and accessible. The design covers around 120 square meters with a dominant corner position with two sides facing the road in a hypothetical location in the centre of Milan. The entire design is inspired on the universal design principles and always considering the weakest users’ first. The shapes and surfaces have material and colour contrasts to make the areas immediately recognisable. The bathroom is open from 7-22 and it is completely visible from the road: after entering you can freely decide to head on to the bathroom area or the accessory areas or to access the hotel hall or the restaurant lounge. The toilets are arranged around a circular area with flooring made from natural materials

with a resistant finish: the circle is the ideal geometric place without any hierarchy of space since all of the points of the circumference are equidistant from the centre. The twelve shower cabins have suspended sanitary fixtures from the Duemilasette series by Simas Acqua Space and glass mosaic tile on the walls from the Casamood line by Florim, and Geotech from the Floorgres by Florim was used on the floors. The sink area calls for the Duemilasette series built into a solid petal element with Supernova taps in a platin matt finish by Dornbracht, which develops aside the glass ribbon distinguished by a curving shape. The glass, which is made from transparent thermoplastic, has accessory areas that can be used independently to suit the user’s needs. To make the area completely usable, the various consoles are developed in different heights and they come with a courtesy kit of products in a special package. The area is comfortable with an acclimatization system developed thanks to the specialised consultancy of Fonderie Sime.

un elemento continuo a petalo e serviti dalla rubinetteria serie Supernova finitura platin matt di Dornbracht, si sviluppa lungo la vetrina nastro, caratterizzata dall’andamento curvilineo. La vetrina, sagomata in termoplastica traslucida, è integrata da spazi accessori che l’utente può sfruttare in modo autonomo a seconda delle proprie esigenze. Per favorire la totale fruibilità di quest’area, le varie consolle si sviluppano a diverse altezze e sono attrezzate e fornite di un kit di prodotti di cortesia in una speciale confezione. L’ambiente è reso confortevole da un sistema di climatizzazione realizzato con la consulenza dell’azienda specializzata Fonderie Sime.

Nel progetto UNI.TO del gruppo SeiStelle l’idea di emancipazione è alla base del concept, che nel bagno di un hotel di design viene enfatizzata con ambienti wc unisex e totalmente accessibili. UNI.TO designed by SeiStelle is based on the concept of emancipation – the designer hotel bathroom emphasises the idea with unisex bathrooms that are totally accessible.


RE3”DEL GRUPPO WCINQUE (Miriam Confetto, Genoveva Gomez, Karolina Kaszubowska, Marcello La Guardia, Pietro Speziale) Re3, relax, refresh e recharge, è il progetto di un ambiente bagno all’interno di un aeroporto che offre ai passeggeri in transito un luogo dove potersi rinfrescare, rilassarsi e ricaricare le proprie energie tra un volo e l’altro, un “pit-stop”, una piccola area di tranquillità in un luogo dove caos e stress dominano. Gli spazi interni si dispongono in modo sequenziale, in un “viaggio” esperienziale circolare dove il passeggero, dopo aver lasciato la propria valigia in un deposito all’ingresso, può iniziare il suo percorso attraversando subito i servizi igienici: 4 bagni per uomo e 4 bagni per donna, più uno accessibile per disabili. Successivamente si accede all’area dedicata alla cura del corpo, dove è possibile fare una doccia emozionale rinfrescante, usufruendo anche degli spogliatoi attrezzati con accappatoi e salviette usa e getta. L’area dei bagni è realizzata per la maggior parte con metallo cor-ten e da forme molto fluide che danno continuità al percorso. A terra il rivestimento in Pietre/2 Nepi Fiammata della linea Casa Dolce Casa di Florim mentre ciascun ambiente wc è fornito di un lavabo FL 03 e con vaso sospeso F85 della Linea Flow di Simas Acqua Space. Al centro della zona servizi sono collocati i lavabi da appoggio FL 12 della linea Flow di Simas Acqua Space, e la rubinetteria inserita è Lulu di Dornbracht. La doccia esperienziale Ambiance Tuning Technique di Dornbracht incastonata lungo il percorso poco prima dell’area relax, costituisce poi un elemento fortemente caratterizzante e centrale del progetto. Per quanto concerne gli impianti si prevede prevalentemente l’utilizzo di termoarredi, dato che il sistema è collegato con l’impianto centrale dell’aeroporto, come verificato grazie alla consulenza di Fonderie Sime.

096

(Miriam Confetto, Genoveva Gomez, Karolina Kaszubowska, Marcello La Guardia, Pietro Speziale) Re3, relax, refresh and recharge, is the project for an airport bathroom that offers travelling passengers a chance to relax, refresh and recharge themselves between flights. It is designed as a sort of little ‘pit-stop’ where you can find tranquillity in a place where stress and chaos dominate. The interiors are designed sequentially like a circular ‘voyage’. The passengers leave their baggage at a baggage deposit and then reach the sanitary services: 4 bathrooms for men and 4 for women and another provides access for disabled persons. Then it moves on to the body care area where it is possible to take a refreshing multi-function shower (complete with disposable robes and towels). Most of the bathroom area is covered with cor-ten metal and it has a very fluid feel that gives the area continuity. The floor is covered in Pietre/2 Nepi Fiammata from the Casa Dolce Casa line by Florim while each bathroom is supplied with a FL 03 sink and suspended F85 toilet fixture from the Flow line by Simas Acqua Space. At the centre of the service area, we find FL 12 counter top sinks from the Flow line by Simas Acqua Space, and Lulu taps by Dornbracht. The Ambiance Tuning Technique shower by Dornbracht is built-in the path just before the relaxation area and it is a key element in the project. The heating system calls for radiators since the system is connected with the central airport system as verified with the support of Fonderie Sime.


Il progetto Re3 del gruppo WCinque, ovvero relax, refresh e recharge, è il tentativo di creare un ambiente bagno all’interno di un aeroporto che offra ai passeggeri in transito un luogo dove potersi rinfrescare, rilassarsi e ricaricare. The Re3 design by WCinque group stands for relax, refresh and recharge. It develops an airport bathroom that gives travelling passengers a chance and a place to relax, refresh and recharge.

097


FRECCIA OASI DEL GRUPPO MEV (Carolina Araldi Tortato, Gabriella Inhan De Souza, Minyi Zhang, Oreste Zingarelli, Ralitsa Dobreva, Valeria Di Toro) Il contesto nel quale il progetto Freccia Oasi è stato inserito è la Stazione Centrale di Milano. Il concept prevede uno spazio a due velocità, per offrire una risposta efficace alle necessità di chi è in transito e ha quindi poco tempo da dedicare a se stesso, ma anche di chi ha tempi più lunghi e cerca un luogo dove fermarsi per rinfrescarsi, prendersi cura di sé e fare una pausa. Il progetto prevede un’articolazione complessa degli spazi e delle funzioni in un’area di 120 mq; gli accessi sono due e distinti per uomini e donne, gli spazi interni sono strutturati in maniera concettualmente simmetrica con un veloce passaggio che, attraverso pittogrammi figurativi

098


finitura platino, con miscelatori montati a parete e virtualmente duplicati dallo specchio dal quale spuntano. I pavimenti di quest’area riprendono quelli degli ingressi, con lastre serie Chromtech della linea Floor Gres di Florim. Una funzione non comunemente associata a un bagno pubblico è la doccia, inserita in una cabina sufficientemente ampia da ospitare lo spazio necessario a cambiarsi d’abito. Da un punto di vista strettamente tecnico, il trattamento dell’acqua calda sanitaria è affidato a un impianto abbinato con una caldaia a condensazione da 35 kw, e un impianto solare termico a circolazione forzata che copre il 51% del fabbisogno; lo studio di entrambi gli impianti si avvale della collaborazione di Sime; una vasca di accumulo è indispensabile per coprire i picchi di utilizzo inevitabilmente connessi alla tipologia di utenza.

Con Freccia Oasi, del gruppo MEV, il progetto riguarda un concept di nuovi bagni e ambienti rilassanti alla Stazione Centrale di Milano. The design of Freccia Oasi by the MEV group looks at the concept of new bathrooms and relaxing areas at the Central Railway Station in Milan.

e percorsi di luce a pavimento, guida gli utenti alla zona servizi vera e propria. I rivestimenti a pavimento alternano lastre in due diversi toni di grigio della linea Chromtech della serie Floor Gres a finitura liscia e naturale di Florim, a listelli di lastre Iroko della serie Abisko della linea Rex di Florim. La zona bagno ospita quattro locali wc con sanitari sospesi della collezione Duemilasette di Simas Acqua Space; i bagni per i diversamente abili sono trattati esattamente come gli altri, e si differenziano solo per le dimensioni e il posizionamento dei sanitari. I locali antibagno ospitano lavabi sospesi della collezione Duemilasette. La tipologia di lavabi e il loro posizionamento li rende anche utilizzabili da utenti in carrozzella senza bisogno di accorgimenti diversi dalla scelta di un sifone specifico. La rubinetteria ha il design pulito ed essenziale della linea Supernova di Dornbracht con

(Carolina Araldi Tortato, Gabriella Inhan De Souza, Minyi Zhang, Oreste Zingarelli, Ralitsa Dobreva, Valeria Di Toro) Freccia Oasi was designed for the Central Railway Station in Milan. It foresees one area and two different speeds to offer an effective answer for travellers who have little time to dedicate to themselves as well as those who have time to wait and are looking for a place to stop, freshen up and take a break. The design calls for an articulate complex of spaces and functions inside 120 square meters. There are two entrances (one for men and one for women) and the interiors are structured in a conceptually symmetric manner with a quick passage offering figurative pictograms and floor lights guiding the user to the service areas. There are two different tones of grey tiles used for the flooring from the Chromtech line of the Floor Gres series with a natural smooth finish by Florim, Iroko tiles from the Abisko series of the Rex line by Florim. The bathroom has four stalls with suspended fixtures from the Duemilasette collection Simas Acqua Space. The bathrooms for disabled persons are exactly like the others, they are only slightly larger with a different positioning of the fixtures. The anteroom to the bathroom holds suspended sinks from the Duemilasette collection. The type of sinks and their position makes them accessible for wheelchair users without anything more than choosing a specific drain. The taps have a clean and essential design of the Supernova line by Dornbracht with a platinum finish, and wall mixers that are virtually duplicated in the mirror they are built into. The floor in this area is the same as the entrances with Chromtech tiles from the Floor Gres line by Florim. One function that is uncommon in public bathrooms is the shower which is located in a large enough area so that the user can change clothing. From a strictly technical point of view the water is heated with a 35kw condensation boiler and a thermal solar installation with forced circulation that covers 51% of the heating needs. Both of the systems were developed with the collaboration of Sime; an accumulation tank is absolutely necessary to cover the peaks in usage depending on the type of usage.


wellnessludovica + roberto palomba Testo di Patrizia Coggiola

Wellness outdoor. And freestanding… QUANDO L’ART DIRECTION ARRIVA A CREARE UN NUOVO TERRITORIO DI DESIGN WHEN ART DIRECTION CREATES A NEW DESIGN TERRITORY Tre anglicismi in un solo titolo, è un azzardo che occorre giustificare subito: li usiamo per indicare la possibilità che si possa andare oltre i generi e abbattere le divisioni tra categorie classiche del design. La soluzione firmata dallo studio Ludovica + Roberto Palomba per le collezioni Exteta, Kos e Zucchetti, a nostro avviso riesce a far saltare molte delle categorie di prodotto che si sono costruite in questi ultimi anni, anche sull’onda delle tendenze appunto, che spesso generano lemmi esterofili. Una nuova linea di elementi per la creazione di isole benessere e mobili per l’esterno, terrazze o giardini, è stata presentata a Maison&Objet a gennaio 2012: formalmente ha la purezza e l’equilibrio di un canone classico unito alla pragmaticità di una soluzione componibile, interamente personalizzabile e soprattutto installabile anche fuori terra. Tra la visione del bagno, il mondo degli esterni e l’idea di relax quotidiano si è costruito un concept fluido, la testimonianza che una nuova visione delle soluzioni per il benessere è possibile, in un territorio appena esplorato e che apre scenari completamente innovativi, sia per la categoria benessere che per l’outdoor. “La collaborazione di tre aziende diverse in un unico progetto, anche se legate dall’eccellenza nelle rispettive produzioni, nasce grazie alla capacità di proiezione di Ludovica e Roberto Palomba. Una triade che si è creata lungo i corridoi di Maison&Objet di qualche anno fa, per la più classica delle attrazioni. Roberto Palomba vide nello stand Exteta una casetta di legno, con all’interno una vasca Kos da lui progettata, una soluzione in fieri che lo entusiasmò, proprio nel mezzo di una deludente giornata di fiera.” Allo stand di Exteta, l’incontro con Roberto, viene ricordato come un folgorante confronto che è poi scaturito in una art direction spontanea. Quale è l’idea iniziale? Exteta innanzitutto avevano già avuto un’intuizione, ovvero inserire in padiglioncini per esterno degli elementi provenienti dall’universo del bagno. Noi abbiamo raccolto l’intuizione e l’abbiamo portata oltre. L’idea nasce dalla voglia di dare una scatola fisica e architettonica ai miei progetti per il bagno, che potessero essere integrati in una visione integrata, per l’esterno, capace di restituire un ambiente totale, in cui anche il profumo del legno avesse una componente tonale. Questa linea costruisce una visione del wellness più leggera, fluida, contemporanea, in cui nasce una possibilità architettonica per il wellness outdoor.

100

Far lavorare tre aziende nello stesso progetto… In realtà è stato molto divertente, si è generato un bel magnetismo, tanto che abbiamo anche attratto un grande vivaista di Zurigo che ci ha proposto di unirsi a questo scenario integrato. Questa operazione è la dimostrazione che nel settore, come nel design in generale, le sinergie tra microcosmi sono possibili, salutari, benvenute. Un segnale che stimola a incrociare expertise, aree di competenza, network. In cosa consiste il progetto? Sono moduli per esterni, moltiplicabili all’infinito, padiglioncini per creare veri e propri ambienti, gazebo, fino a complete spa outdoor, siano essi su terra o su terrazza. Non sono necessari scavi perché le tubature e ogni struttura di funzione è fuori terra. Si possono ideare aree living, benessere, cucina, training … Ma è possibile una distribuzione convenzionale? Tutto è aperto agli incroci e ai frutti reciproci. Ognuno dei player coinvolti porta nella propria area distributiva il progetto, che in questo modo approfitta di una esponenziale visibilità.

In alto a sinistra, un allestimento Exteta con Zucchetti.Kos. In alto a destra, Faraway Collection di Zucchetti.Kos con Zen Screen della Zen Line Collection by Exteta. Ludovica e Roberto Palomba. Nella pagina opposta: in alto, Minipool di Kos, una novità 2012, con Zen Light della Zen Line Collection by Exteta; in basso, Zen Village della Zen Line Collection by Exteta con i complementi d’arredo Paraggi camp Bed e Paraggi Beach Hut by Exteta. Above to the left, an Exteta exhibit with Zucchetti.Kos. Above to the right, the Faraway Collection by Zucchetti.Kos with Zen Screen from the Zen Line Collection by Exteta. Ludovica and Roberto Palomba. Above, Minipool by Kos, brand new for 2012, with Zen Light from the Zen Line Collection by Exteta. Below, Zen Village from the Zen Line Collection by Exteta with Camp Bed and Paraggi Beach Hut furnishings by Exteta.


Three innovative concepts in a single title indicate that it is possible to go beyond genres and break down the divisions between the classic categories of design. The solution by the Ludovica + Roberto Palomba firm for the Exteta, Kos and Zucchetti collections in our opinion go beyond many of the product categories that have developed in recent years also as trends from outside Italy have popularised. A new line of elements create wellness islands and furnishings for exteriors, terraces and gardens. Presented at Maison&Objet in January 2012, formally it has the purity and balance of classical style with the pragmatic nature of a modular solution that is entirely customisable and can be installed above ground as well. A fluid concept has been created between the vision of the bathroom, the world of exteriors and the idea of daily relaxation. The testimony of this new vision of solutions is possible in a new still unexplored territory that offers completely innovative solutions both for wellbeing and the outdoors. The collaboration between three very different yet excellent companies in a single project was developed thanks to the Ludovica + Roberto Palomba firm’s ability to design. The triad was created in the Maison&Objet halls a few years back from the most classic of the attractions. Roberto Palomba says to have seen a wooden box with a bathtub inside it and he was enthused by it in the middle of a rather deluding fair day. At the Exteta stand, meeting Robert can be remembered as a lightening meeting that developed into spontaneous art direction. What is the initial idea? Exteta first of all already had an intuition which was to incorporate some elements from the bathroom world into small pavilions for exteriors. We caught onto the idea and developed it. The idea comes from the desire to give a physical and architectural box for my bathroom projects that could be integrated into an integrated vision for exteriors that is able to create a total environment where the smell of the wood is tonal. This line creates a lighter and more fluid vision of wellness where there is an architectural possibility for outdoor wellness. And three companies working on the same project… In truth it was lots of fun and there was a lot of magnetism generated by it. In fact we even attracted a large nursery in Zurich who offered to join this integrated project. This operation proves that in a sector like design synergies between microcosms are possible, healthy and welcome. It is a signal that moves us to blend expertise and skill areas and to network. What does the project include? They are units for exteriors that can be multiplied to infinity. They are pavilions that create rooms, gazebos and even complete outdoor spas for the ground or the terrace. There is no need to dig because the tubing and each structure stands above ground. They can provide ideas for furnishing living, wellness, kitchen and training areas... Is conventional distribution possible? It is all open to crossing paths and reciprocal fruits. Each of the stakeholders incorporates the project into their distribution area which provides much greater visibility.

101


profilifima Testo di Elviro Di Meo

Eclipse, Nomos e Fimabox: esclusività, unicità e semplicità made in Italy ECLIPSE, NOMOS AND FIMABOX: EXCLUSIVE, ONE-OF-A-KIND, SIMPLE AND ITALIAN UN CONNUBIO PERFETTO, RIGOROSAMENTE ITALIANO, TRA LA SUGGESTIONE FORMALE E LA CIFRA STILISTICA, TRA L’INNOVAZIONE TECNOLOGICA E L’ALTA QUALITÀ DEI PRODOTTI, TRA LA SEMPLICITÀ E LA FUNZIONALITÀ DI UTILIZZO. LA RUBINETTERIA NON È STATA MAI COSÌ UNICA A PERFECT AND RIGOROUSLY ITALIAN BLEND THAT IS SOMEWHERE BETWEEN FORMAL SUGGESTION AND STYLISTIC MEASURE, TECHNOLOGICAL INNOVATION AND THE HIGH QUALITY OF THE PRODUCTS, AND THE SIMPLICITY AND FUNCTIONALITY OF USE – TAPS HAVE NEVER BEEN THIS UNIQUE

102

Funzionalità, design, produzione di alta qualità, rigorosamente made in Italy: il marchio FIMA Carlo Frattini continua la sua ricerca progettuale. Una sperimentazione in grado di coniugare, in ogni oggetto, esclusività e unicità del prodotto, senza dimenticare la semplicità che lo contraddistingue. Caratteristiche che si ritrovano nelle recenti collezioni, tra cui Eclipse: sinuose geometrie declinate in tutta la rubinetteria bagno come perfetto trait-d’unione fra suggestione formale e innovazione stilistica. Un grande appeal visivo, in cui la morbida armonia dei dettagli si sposa con il minimalismo del segno e della componente materica. La linea, nata dalla matita di Giuseppe Bavuso, e appartenente alla divisione FIMA Aqua Code, propone una gamma completa di miscelatori monocomando per bagno, che si declina nelle versioni per lavabo, bidet, vasca e doccia. Cuore pulsante del progetto, nonché elemento caratterizzante e innovativo, è la leva a spinta che scompare, fluidificandosi, nel corpo del miscelatore. Il risultato è un oggetto organico che diventa un tutt’uno con la bocca di erogazione - provvista di un rompigetto a scomparsa – come se fosse una scultura inscindibile. In particolare, la versione doccia propone un doppio miscelatore a incasso brevettato che permette di erogare l’acqua dai soffioni, giocando sulle differenti temperature e sulle diverse portate dei flussi. Come tutti i prodotti Fima, la collezione Eclipse ha sette anni di garanzia, oltre all’elevato livello di servizio con assistenza tecnica e tempi di consegna estremamente rapidi. E sempre della Divisione FIMA Aqua Code fa parte Nomos: il miscelatore touch screen, unico sul mercato, frutto di tre anni di incessante ricerca nel campo dell’elettronica, firmato dallo studio Castiglia associati. Il contributo tecnologico fornito alla meccanica del rubinetto ne aumenta il livello di sicurezza, di qualità e di efficienza, rendendolo assolutamente affidabile nel tempo. Il display permette di regolare con precisione le varie funzioni acqua, semplificando l’interazione tra utente e schermo; in particolar modo, nel momento della doccia. Il controllo elettronico di Nomos monitora in tempo reale i consumi idrici ed energetici e storicizza quelli passati, assicurando, in questo modo, un comfort senza sprechi, che si tramuta in risultati ecologici ed economici. Nomos, disponibile anche nella versione meccanica, è abbinabile, così come per tutte le serie presenti nel catalogo, a Fimabox: il nuovissimo corpo da incasso al 100% universale, con una profondità di soli sei centimetri, progettato per facilitare l’operazione di montaggio - sia in fase di ristrutturazione e sia di nuovo impianto – e per garantire la più ampia scelta della finitura e tipo di rubinetto, tra i quaranta modelli prodotti e le ben otto diverse colorazioni. Il fissaggio a parete – una delle caratteristiche - è realizzabile su qualsiasi materiale di muratura tramite un attacco posteriore per muri in cemento e anteriore per pareti in cartongesso. Grazie alla presenza di un esclusivo sistema di galleggiamento del corpo in ottone all’interno del guscio plastico, Fimabox assicura massima silenziosità ed è certificato secondo la normativa UNI EN ISO 3822 in classe A per acustica. Tutte le componenti del corpo incasso sono inserite, inoltre, all’interno di un packaging ecologico totalmente riciclato.


Italian function, design and high quality manufacturing: the FIMA Carlo Frattini trademark continues on its design development path with an advancement that is able to blend product exclusiveness and uniqueness in any object without forgetting the simplicity that distinguishes it. These characteristics are evident in the recent collections which include Eclipse: sinuous shapes that are carried through in the bathroom taps like a perfect connection that is between formal suggestion and stylistic innovation. With great visual appeal, the soft harmony of the details blends with the minimalism of the input and with the materials. The line designed by Giuseppe Bavuso, is part of the FIMA Aqua Code division and it includes a complete range of single lever mixers for the bathroom that are available in sink, bidet, bathtub or shower versions. The beating heart of the project and the distinguishing and innovative element is the disappearing push lever that flows into the mixer body. The result is an organic object that becomes one with the spout – with a hidden faucet aerator – as if it were a true sculpture. In particular, the shower version has a double built in patented

mixer that allows for using water from the showerheads with different temperatures and different water flow capacities. As all Fima products, the Eclipse collection has seven years of guarantee as well as high level technical assistance services and very rapid delivery. The FIMA Aqua Code Division also produces Nomos: the touch screen mixer that is one-ofa-kind on the market. It was developed after three years of unceasing development in the field of electronics and it was designed by the Design Castiglia Associati firm. The technological addition to the sink mechanics increases the level of safety, quality and efficiency making it absolutely dependable. The screen makes it possible to precisely regulate the various functions of the water simplifying the interaction between the user and the screen, particularly when showering. The electronic control of Nomos monitors the water and energy consumption in real time and it stores past data to ensure comfort without waste, which has advantages for your budget and the environment. Nomos is also available in a mechanical version and it can be combined (as can all of the series in the catalogue) with Fimabox: the new universal built-in unit with a depth of only six centimetres designed to facilitate installation – both during restructuring and for new systems – and it guarantees an ample choice of finishes and taps with forty models available in eight different colours. The wall mounting – one of the characteristics – is possible on any type of wall material with an attachment on the back for walls in concrete and one on the front for plasterboard walls. Thanks to the exclusive floating system of the brass unit inside the plastic, Fimabox is absolutely silent and it is certified under UNI EN ISO 3822 in class A for acoustics. All of the parts for the built-in unit are contained in completely recycled ecological packaging.

In apertura, gruppo doccia da incasso Eclipse, design Giuseppe Bavuso, completato da una manopola doccia con supporto a muro e soffione da parete. Si tratta di un doppio miscelatore a incasso brevettato che permette di erogare l’acqua dai soffioni giocando sulle differenti temperature e sulle diverse portate dei flussi. Sotto, miscelatore monocomando cromato per lavabo Eclipse, design Giuseppe Bavuso. Si caratterizza per l’innovativa leva perfettamente integrata nel corpo del miscelatore, diventando un tutt’uno con la bocca come fosse un’unica scultura. In questa pagina, sopra a sinistra, gruppo vasca doccia da incasso cromato Eclipse, completo di manopola doccia con supporto. A destra gruppo doccia Nomos, design Castiglia associati, dotato di display touchscreen che si distingue per innovazione e tecnologia. Sotto, Fimabox, il corpo a incasso universale, rapido da montare, ideale sia in caso di nuovo impianto sia di ristrutturazione. On the cover, the built-in Eclipse shower system, designed by Giuseppe Bavuso, with a hand shower with a wall support and a wall-mount showerhead. This double built-in patented mixer provides water from the showerheads allowing for different temperatures and different flow capacities. Below the single-lever chrome mixer for the Eclipse sink designed by Giuseppe Bavuso. The innovative lever integrates perfectly in the mixer body to become one with the spout as if it were all a single sculpture. On this page, above on the left, the chromed built-in Eclipse shower and tub system with a hand shower and support. On the right, the Nomos shower system designed by Castiglia Associates with a touch screen display highlighting the innovative technology. Below, Fimabox, the universal built-in unit that is easy to mount making it ideal for both new systems and restorations.

103


profiliideagroup Testo di Nico Velvet

La qualità come sistema QUALITY IS A SYSTEM DESIGN INNOVATIVO E FUNZIONALE, RICERCA E QUALITÀ DEI MATERIALI, FANNO DI OGNI BAGNO FIRMATO IDEAGROUP UN LUOGO DOVE CONVIVONO ARMONIA ESTETICA E INNOVAZIONE FUNZIONALE INNOVATIVE FUNCTIONAL DESIGN, RESEARCH AND QUALITY MATERIALS MAKE IDEAGROUP BATHROOMS INTO AREAS WHERE AESTHETIC HARMONY AND FUNCTIONAL INNOVATION BLEND PERFECTLY Il gruppo si è specializzato in ambiti molto precisi: Idea, Aqua, Blob e Disenia, una perfetta simbiosi tra 4 aziende capaci di offrire un gamma completa di prodotti; quattro marchi distinti, ciascuno con una precisa identità, dedicato a un ambito specifico arredo bagno.

BLOB. UNA NUOVA FILOSOFIA Pezzi d’arredo che risolvono con gusto, armonia e professionalità lo spazio lavanderia e i bagni di piccole dimensioni. Lo spazio lavoro diventa perfettamente conforme alle necessità quotidiane, funzionale ed ergonomico.

IDEA. OBIETTIVO MIRATO Un ampio ventaglio di composizioni, dal gusto moderno e disinvolto a quello raffinato ed elegante, fino a raggiungere un pubblico più classico. Questa duttilità ha permesso di sperimentare con successo vari materiali e tecnologie fino a raccogliere una notevole esperienza negli abbinamenti più estroversi, senza nulla togliere a praticità, sicurezza e gusto.

DISENIA. UN PERCORSO MINIMALE Disenia, completa l’offerta con una gamma di soluzioni box doccia e cabine doccia, analizzando, studiando e progettando sia l’aspetto estetico che quello tecnologico e prestazionale. Dalle linee squadrate o curve, adatte a piccoli o grandi spazi, realizzate con telai e particolari dall’alto valore tecnico, senza mai dimenticare l’obiettivo principale: funzionalità, estetica ed essenzialità.

AQUA. PROGETTAZIONE ESSENZIALE Pezzi d’arredo dalle linee essenziali, dove la funzionalità è declinata in forme pulite e lineari: un disegno contemporaneo che si accompagna alla scelta di materiali pregiati, ricercati, tecnici e molto spesso innovativi.

104

Tra le novità e i prodotti presenti al Salone del Bagno 2012, la collezione My Seventy, ribattezzata My Seventy Plus dopo un profondo restyling che prevede l’integrazione della nuova essenza in legno di frassino: disponibile


nelle varianti tinto wengè, in sei colorazioni laccate opache decapè, a cui si aggiunge la versione laccata a poro aperto nei 40 colori del campionario; ampia scelta anche per le ante lisce, nelle 40 varianti colore opache e lucide spazzolate: alle nuove finiture, si aggiungono grandi novità inerenti numerosi nuovi moduli dalle forme arrotondate, morbide e sinuose. Novità anche per il marchio Aqua: da scoprire direttamente al Salone. Presenti anche le proposte doccia della nuova serie Slim by Disenia, un perfetto connubio tra funzionalità ed estetica: cabine doccia pivotanti con vetro spessore 6MM non intelaiate, con 30MM di regolazione per lato e possibilità di posizionamento sui bordi esterni dei piatti doccia a filo pavimento. E il nuovo piatto doccia Join, realizzato in Tecnogel, una speciale resina poliestere caricata; disponibile in sei colorazioni di serie con possibilità di personalizzarne dimensione e forma. Non mancheranno le proposte della collezione arredo bagno Cubik, che espande ulteriormente le possibilità compositive grazie alla nuova proposta di modulo contenitore con altezza 25.5 cm e mensoloni uso top di spessore 10 cm.

The group is specialised in very precise areas: Idea, Aqua, Blob and Disenia form a perfect symbiosis between 4 companies that are able to offer a complete range of products – 4 distinct brands with their own individual identity dedicated to a specific bathroom furnishing area. IDEA. PRECISE OBJECTIVE A wide range of compositions including modern casual and refined elegance to satisfy more classic tastes. This flexibility has made it possible to successfully use various materials and technologies for masterfully extroverted pairings without any less practicality, safety or good taste. AQUA. ESSENTIAL DESIGN Furnishing items with an essential design where function is conjugated into clean and linear shapes: contemporary design accompanies the choice of refined, sophisticated, technological and frequently innovative materials. BLOB. A NEW PHILOSOPHY Furnishing items that arrange your wash areas and small bathrooms with harmony and professionalism. The work space is perfectly coordinated with daily functional necessities and it is ergonomic. DISENIA. A MINIMAL INFLUENCE Disenia completes the range of shower enclosure and shower cabin solutions that are researched, analysed and designed for the best aesthetics, technology and performance. With

square or curving lines it is perfect for small or large areas. Made with highly technological frames and particulars, they are aligned with the main objectives: functionality, aesthetics and essentialism. Some of the innovations at Salone del Bagno 2012 include the My Seventy collection, which has been renamed My Seventy Plus after a profound restyling that calls for the use of a new wood – Ash. It is already available with a wengè finish, in six colours of flat pickled lacquers as well as an open-pore lacquer in 40 standard colours. There is a wide range of choices for the smooth doors with 40 flat and brushed polish colours available. Further innovation comes from the numerous new rounded, soft and sinuous units. There are also innovations for the Aqua trademark: to be discovered directly at the Salone. There will also be new shower proposals for the new Slim series by Disenia, which is a perfect blend of function and aesthetics: rotating shower enclosures with 6MM frameless glass and 30mm for adjustment on each side – and it can be used on the edge of a flush mount shower tray. The new Join shower tray is made from Tecnogel, which is a special enhanced polyester resin. It is available in six standard colours with the possibility to customise the form and the shape. The Cubik bathroom furnishing collection also has a number of offers further expanding design possibilities with a new storage unit that is 25.5 cm in height with shelves that serve as a 10 cm thick counter.

In apertura, Aqua, collezione City: piano in rovere massiccio piallato L180 cm, spessore 12cm, P 20cm, basi a terra laccate bianco lucido spazzolato L180cm; lavabo in Aquatek, lo specchio L180 H 70, contenitore a vetro h110, L 35cm. In questa pagina in alto, Disenia, doccia SLIM, 90 x 90 cm, apertura 69cm extrabrill\trasparente, piatto doccia filo pavimento Join in tecnogel bianco. A sinistra, Idea, collezione Cubik: doppia base lavabo bianco opaco, (H25,5;L120;P50), piano in Aquatek con 2 vasche integrate e doppia base standard (H25,5;L120;P50) in laminato unicolor HPL cemento; sopra Idea, collezione My Seventy Plus, L250, P50736, frassino laccato bianco, top in Aquatek bianco. On the first page, from Aqua, the City collection: counter in solid planed oak L 180cm, thickness 12 cm, W 20cm, floor stands in shiny white brushed lacquer L 180cm; sink in Aquatek, mirror L180 H70, glass storage unit h110, L 35cm. On this page, above, Disenia SLIM shower 90 x 90cm, door opening 69cm in extra-shiny/transparent glass, the Join built-in shower tray in white Tecnogel. On the left, Idea’s Cubik collection: a double base sink in flat white (H25.5;L120;W50), counter in Aquatek with 2 integrated basins and double standard base (H25.5;L120,W50) in unicolor HPL cement; above, Idea’s My Seventy Plus collection L250, W50736 in painted white ash with a white Aquatek top.

105


profilitoto Testo di Patrick Fael

Toto has developed a product that takes the best advantage of this virtue. Luminist is an extraordinary material patented by Toto. It is used for bathtubs and sinks and it unites the translucence of glass with incredible resistance to impact and heat. These incredible qualities make it possible to build formidable artisan-quality bathtubs and sinks. They are long-lasting and durable and they can even be lit from the inside to help set the mood or the atmosphere. Whether they are turned off or lit from below, these sinks are the focal point of any bathroom - capturing your attention and exalting all of the other furnishings. Made from epoxy resin, they are a pleasure to touch and they light up making to possible to set the desired tone with specially positioned lighting. The circular base of Luminist Luna is available in two different colours: pure white to blend with the sink or in black for a sharp contrast. The relaxing and essential forms of these sinks are exalted by the automatic faucet that smartly responds to hand signals. When it is in use, the water seems to dance on the translucent surfaces creating the effect of life and movement that only the combination of water and light can give.

Il giusto mix di tecnologia e design THE RIGHT MIX OF TECHNOLOGY AND DESIGN È IMPOSSIBILE SOTTOVALUTARE IL POTERE DELLA LUCE: LA LUMINOSITÀ PUÒ CAMBIARE L’UMORE DELLE PERSONE, CREARE L’ATMOSFERA GIUSTA E MODIFICARE IN MODO SOTTILE IL DESIGN DI OGNI INTERNO IT IS IMPOSSIBLE TO IGNORE THE POWER OF LIGHT: LUMINOSITY CAN CHANGE PEOPLE’S MOODS, SET THE RIGHT ATMOSPHERE AND SUBTLY TRANSFORM ANY INTERIOR DESIGN Toto ha sviluppato un prodotto che sfrutta al massimo questa virtù. Il Luminist è uno straordinario materiale brevettato da Toto, utilizzato per vasche e lavandini, che unisce la traslucenza del vetro a un’eccezionale resistenza agli urti e al calore. Le incredibili qualità consentono di realizzare artigianalmente vasche da bagno e lavabi formidabili, che non sono solo durevoli nel tempo, ma che possono anche essere illuminati internamente per creare innumerevoli atmosfere. Spenti o illuminati da sotto, questi lavabi saranno il punto focale di ogni stanza da bagno, cattureranno l’attenzione ed esalteranno il resto dell’arredamento. La resina espossidica, estremamente piacevole al tatto, si fa attraversare dalla luce, offrendo così la possibilità di creare l’ambiente desiderato con un’illuminazione sapientemente posizionata. La base circolare di Luminist Luna è disponibile in due diverse versioni di colore: in bianco puro, da abbinare al lavabo, oppure in nero, per un

106

effetto di contrasto. Le forme rilassanti ed essenziali di questi lavabi sono esaltate dal rubinetto automatico, che risponde in modo intelligente al movimento delle mani. Quando è in uso, l’acqua sembra danzare sulle superfici traslucide, creando un effetto di movimento e di vita che solo la combinazione di acqua e luce può dare. Le linee forti e incisive del piano da bagno offrono l’ambientazione più adatta al delicato splendore di Luminist. Illuminato da sotto, il lavabo forma un accattivante anello di luce che ricorda la corona di un’eclisse di sole. The strong and bold outlines of the bathroom counter make the room more suited to the delicate splendour of Luminist. Lighted from below, the sink makes an interesting ring of light that is reminiscent of the solar corona during an eclipse.


ikXiYh_fj_edi

''1'(6,*1',))86,211(:6 E QXPHUL

2) $5&+ E QXPHUL

&$6$'L E QXPHUL

'(&25/,9,1* E QXPHUL

DDB DESIGN DIFFUSION BAGNO E (6 numeri) ,B7B61HZV E QXPHUL

'+'+27(/'(6,*1',))86,21 E QXPHUL

+27&2/' &DOGR)UHGGR

E QXPHUL

''1(GL]LRQH5XVVD E QXPHUL

''1&8&,1(,17(51$7,21$/ E QXPHUL

' /8; E QXPHUL

''1.g/1'(6,*1 E QXPHUR

''11(: <25.'(6,*1 E QXPHUR

''1026&$'(6,*1 E QXPHUR

''10,/$12'(6,*1 E QXPHUR

''1/21'5$'(6,*1 E QXPHUR

1RPHHFRJQRPH ,QGLUL]]R &DS &LWWj 7HOHIRQRHID[ (PDLO

3URY

**CONDIZIONI DI PAGAMENTO

9HUVDPHQWRVXO&&3Q '':6UO 9LD/XFDQR² 0,

%RQLÀFRFFQ %,&%30,,70,%$1,78  %DQFD3RSUH0L $J '':6UO 9LD/XFDQR0L $GGHELWDQGRO·LPSRUWRGL(XUR VXOODPLDFDUWDGLFUHGLWR &DUWD6u 9LVD(XUR&DUG0DVWHU&DUG $PHULFDQ([SUHVV

&99

1ƒ 6&$'(1=$



(IMPORTANTE)

SDJDPHQWRDQWLFLSDWR

SUHJRLQYLDUHIDWWXUDD

GDWDÀUPD 3,

&)

FDPSLREEOLJDWRUL

,QIRUPDWLYDH['/*6Q '':6UOWLWRODUHGHOWUDWWDPHQWRUHQGHQRWRFKHLGDWLSHUVRQDOL UHODWLYLDLVRWWRVFULWWRULGHJOLDEERQDPHQWLVRQRWUDWWDWLHVFOXVLYD PHQWHSHUO·LQYLRGHOODSXEEOLFD]LRQHHQRQVRQRFHGXWLDWHU]LSHU QHVVXQPRWLYR

_jWb_W '':6UO 9LD/XFDQR0LODQR 7HO)D[1XPHUR 9HUGH HPDLODEERQDPHQWL#GHVLJQGLIIXVLRQFRPZZZGHVLJQGLIIXVLRQFRP


685)$&( 0$,/ ''1'(6,*1',))86,211(:6  LVVXHV

2) $5&+  LVVXHV

&$6$ 'L  LVVXHV

'(&25 /,9,1*  LVVXHV

DDB DESIGN DIFFUSION BAGNO (6 issues) ,B7B6 1HZV  LVVXHV

'+' +27(/'(6,*1',))86,21  LVVXHV

+27&2/' &DOGR)UHGGR

 LVVXHV

''1(GL]LRQH5XVVD  LVVXHV

''1 &8&,1( ,17(51$7,21$/  LVVXHV

' /8;  LVVXHV

''1 .g/1 '(6,*1  LVVXH

''1 1(: <25. '(6,*1  LVVXH

''1 026&$ '(6,*1  LVVXH

''1 0,/$12 '(6,*1  LVVXH

''1 /21'5$ '(6,*1  LVVXH

$,5 0$,/

1DPH

E

E

$GGUHVV

E

E

E

E

E

E

E 120

E 240

E

E

,PSHUDWLYH

E

E

0(7+2'62)3$<0(17

E

E

E

E

E

E 

E

E

E

E

E

E

E

E

E

E

(;3,5<'$7(

E

E

3D\PHQWLQDGYDQFH

=LS FRGH

7RZQ

&RXQWU\

7HOHSKRQHDQGID[QR (PDLO

'LUHFWWRDFFRXQWQR %,&%30,,70,%$1,78  %DQFD3RSUH0L $J RI '':6UO, 3OHDVH FKDUJH HXUR WRP\FUHGLWFDUG &DUWD6u 9LVD(XUR&DUG0DVWHU&DUG $PHULFDQ([SUHVV

&99

(VERY IMPORTANT)

SOHDVHLQYRLFH

GDWHVLJQDWXUH

[njhWY[[ ''1'(6,*1',))86,211(:6  LVVXHV

2) $5&+  LVVXHV

&$6$ 'L  LVVXHV

'(&25 /,9,1*  LVVXHV

DDB DESIGN DIFFUSION BAGNO (6 issues) ,B7B6 1HZV  LVVXHV

'+' +27(/'(6,*1',))86,21  LVVXHV

+27&2/' &DOGR)UHGGR

 LVVXHV

''1(GL]LRQH5XVVD  LVVXHV

''1 &8&,1( ,17(51$7,21$/  LVVXHV

' /8;  LVVXHV

''1 .g/1 '(6,*1  LVVXH

''1 1(: <25. '(6,*1  LVVXH

''1 026&$ '(6,*1  LVVXH

''1 0,/$12 '(6,*1  LVVXH

''1 /21'5$ '(6,*1  LVVXH

E E

$8675,$%(/*,80%8/*$5,$&<3586'(10$5.(6721,$),1/$1' )5$1&(*(50$1<*5((&(+81*$5<,5(/$1'/$79,$/,7+8$1,$ /8;(0%85*0$/7$1(7+(5/$1'632/$1'32578*$/520$1,$8. &=(&+5(36/29$.,$6/29(1-$63$,16:('(1

E E

1DPH

E 60

$GGUHVV

E

=LS FRGH

E

7HOHSKRQHDQGID[QR

E

(PDLO

E

7RZQ

,PSHUDWLYH

E E E E E E E

0(7+2'62)3$<0(17

'LUHFWWRDFFRXQWQR %,&%30,,70,%$1,78  %DQFD3RSUH0L $J RI '':6UO, 3OHDVH FKDUJH HXUR WRP\FUHGLWFDUG &DUWD6u 9LVD(XUR&DUG0DVWHU&DUG $PHULFDQ([SUHVV

1ƒ (;3,5<'$7( 3D\PHQWLQDGYDQFH

SOHDVHLQYRLFH 9$7 QR GDWHVLJQDWXUH

Y[[

&RXQWU\

&99 (VERY IMPORTANT)


SFOGLIA Lâ&#x20AC;&#x2122;ULTIMO NUMERO DI LEAF THROUGH THE LAST ISSUE OF

La rivista è anche su tablet! Scarica gratuitamente lâ&#x20AC;&#x2122;applicazione

,

lâ&#x20AC;&#x2122;edicola virtuale della

DINING ESIGN WITH D N IN MILA :KBL I DÂĽEG OLM H K STOC

dove poter acquistare e leggere tutte le riviste del gruppo! Now the magazine is even

184

available for tablet! Download

E 8.00 â&#x20AC;&#x153;Italy onlyâ&#x20AC;? - F E 14,50 - D E 18,00 - GR E 14,30 P E 15,40 - E E 12,80 - GB GBP. 11,50 - N NKR. 172,00 .S SKR. 170,00 - CH SFR. 23,00 - NL E 19,00. *44/t.FOTJMF5"9&1&3$6& 5"44"3*4$044" 6''*$*0$.1304&3*0.*-"/0 4QFEJ[JPOFJOBCCPOBNFOUPQPTUBMF%- DPOWJO-O BSU DPNNB %$#.JMBOP %*453*#6;*0/&.&1&

Design Diffusion World,

the App

for free.

It is the virtual news-stand of Design Diffusion World, where you can buy and read all the groupâ&#x20AC;&#x2122;s journals!

IA MERITAB<LA>MM: LH?Â&#x2DC;F

Design Diffusion World DDW srl | Via Lucano, 3 | 20135 Milano | Italy Tel. +39 02 5516109 Fax +39 02 5456803 e-mail: info@designdiffusion.com internet: www.designdiffusion.com web tv: www.designdiffusion.tv


www.ditre.com

Serie T

MATTEO THUN & ANTONIO RODRIGUEZ Non solo un termosifone ma un elemento d’arredo che si integra nello spazio con grande personalità, ma che non vuole esserne il protagonista, essenzialità, leggerezza ed ecletticità sono, infatti, le sue caratteristiche principali. Il primo radiatore sartoriale, realizzato in alluminio estruso dalla sezione a forma di T da cui deriva il nome, è disponibile in diverse JVUÄN\YHaPVUPZPHULSSH]LYZPVUL]LY[PJHSLZPHPUX\LSSHVYPaaVU[HSL Oltre alle misure standard di 150 cm e 200 cm l’elemento può essere richiesto nella lunghezza più utile al cliente con un minimo di 100 cm e un massimo di 250 cm con step di 1 centimetro. 8\LZ[HWVZZPIPSP[nJVUZLU[LPSTHZZPTVKLSSHÅLZZPIPSP[nLMHKP¸;¹\U WYVKV[[VJOLW\~]LUPYLºJ\JP[V»PUTVKVZHY[VYPHSLZ\SSLZWLJPÄJOL esigenze del cliente integrandosi in modo perfetto con l’ambiente che lo circonda. 3HZ\HZWLJPÄJHJVUMVYTHaPVULSVYLUKLVS[YLJOL\UWYVKV[[VWLYML[[V WLYS»HTIPLU[LNPVYUVHUJOL\U\[PSLLKLĄJHJLYHKPH[VYLWLYSHaVUH bagno/benessere, dove può funzionare come scaldasalviette e porta accappatoio o immagazzinare asciugamani.

100

101

102

103

104

105

106

107

108

109

110

111

112

113

114

115

116

117

...

SU MISUR URA AL CENTIMETRO ALTA AL TA A EFF FIC ICIE CIE IENZ N A TERMICA ALLU AL LUMI MINI MI NIIO R N RIIC CIICLABILE BA ASS SSO CO C ON NT TENUT EN E NUT UTO D’ACQUA

ANTRAX IT SRL [ VIA BOSCALTO 40 31023 RESANA TV

TEL.

+39 0423 7174

FAX

+39 0423 717474

WWW.ANTRAX.IT ANTRAX@ANTRAX.IT

]


DDB 62