Page 1

Full text in English

Special cover NUMERO 4 APRILE 2014


Acma SpA

Altech Srl

AMB SpA

Cama Group

&LEXV7HF)RRG3DFN

40131 Bologna - Italy

Viale A. De Gasperi 72 20010 Bareggio (MI) - Italy Tel. +39 02 90363464 labellers@altech.it www.altech.it

Via S.Martino 28 33038 S. Daniele del Friuli (UD) - Italy Tel. +39 0432 946111 info@ambpackaging.com www.ambpackaging.com

Via Como 9 23846 Garbagnate Monastero (LC) - Italy Tel. +39 031 879811 commerciale@camagroup.com www.camagroup.com

Viale delle Esposizioni 393a 43126 Parma (PR) - Italy Tel. +39 0521 996211 cibustec@fiereparma.it www.cibustec.it

Interpack Hall 6 D31-E57 Macchine automatiche per il confezionamento di beni di largo consumo. Automatic machines for packaging FMCGs.

Interpack Hall 12 B23 Applicatori di etichette autoadesive e linerless, sistemi di etichettatura automatica, print&apply, sleeveratrici. Linerless and pressure sensitive labels applicators, automatic labeling systems, print&apply, sleeving devices.

Interpack Hall 09 C04 Film ad alta barriera per il packaging alimentare. High barrier food packaging film.

Interpack Hall 13 C31 Linee complete di imballaggio e isole di carico robotizzate. Complete packaging lines and robotic loading units.

Interpack Hall EN A-01 Fiera internazionale delle tecnologie di processo e imballaggio. International Exhibition on processing and packaging technologies.

CMI SpA

Dinamic Service Srl

Elesa SpA

(XUDVLD3DFNDJLQJúVWDQEXO

Famar Packaging Srl

Via Montegrappa 5 28047 Oleggio (NO) - Italy Tel. +39 0321 91144 cmi@cmiita.com www.cmiita.com

Via Tratturo 5/P (ex Fornace) 65010 Spoltore (PE) - Italy Tel. +39 085 8505671 www.dinamicservicesrl.it

Via Pompei 29 20900 Monza (MB) - Italy Tel. +39 039 2811.1 info@elesa.com www.elesa.com

18-21 settembre 2014 Tüyap Fair, Convention and Congress Center E-5 Karayolu, Gürpınar Kavúa÷ı, Büyükçekmece - 34522 østanbul - Turkey Tel. +90 212 86711 00 packagingfair@reedtuyap.com.tr www.packagingfair.com

Via Stelloni 39/F/G 40010 Sala Bolognese (BO) - Italy Tel. +39 051 6815243 info@famarpackaging.com www.famarpackaging.com

Volpak SAU 08130 Santa Perpetua de Mogoda (B) - Spain acma.marketingdep@acmavolpak.com www.acmavolpak.com

Interpack Hall 8a D23 Costruttore di macchine imbottigliatrici e tappatrici per il settore chimico, cosmetico, alimentare e farmaceutico. Bottling and capping machines manufacturer for the chemical, food and cosmopharma sectors.

Confezioniamo in conto terzi per tutte le aziende che hanno bisogno di personalizzare i loro prodotti. Contract packaging for all those companies that need to personalize their products.

Interpack Hall CS 308 Progettazione e produzione di componenti standard in plastica e metallo per l’industria meccanica. Design and manufacturing of standard plastic and metal components for the engineering industry.

Interpack Hall EN 1-04 20^ fiera internazionale del packaging: crocevia fra Sud-Est europeo, Nordafrica, Medio Oriente, Russia e area CIS. 20th int. packaging industry fair: the hub of South East Europe, North Africa, Middle East, Russia and the CIS region.

Interpack Hall 16 B47 Blisteratrici, termoformatrici e astucciatrici per l’industria farmaceutica. Blistering, thermoforming and cartoning machines for the pharmaceutical industry.

Fiorini International SpA

G.B. Gnudi Bruno SpA

Graco BVBA

IMA SpA

IPACK-IMA 2015, Fieramilano

Via Maestri Del Lavoro 13 60012 Z.I. Ponte Lucerta Trecastelli (AN) - Italy Tel. +39 071 791171 info@fiorinint.it www.fiorinint.it

Via Ernesto Masi 9 40137 Bologna (BO) - Italy Tel. +39 051 4290611 info@gbgnudi.it www.gbgnudi.it

Industrieterrein-Oude Bunders Slakweidestraat 31 B-3630 Maasmechelen - Belgium info@graco.be www.graco.com

Via Emilia 428/442 40064 Ozzano dell’Emilia (BO) - Italy Tel. +39 051 6514111 www.ima.it

19-23 maggio 2015 Organizer: Ipack-Ima SpA Corso Sempione 4 20154 Milano (MI) - Italy www.ipack-ima.com www.ipackima.it

Interpack Hall 8a E04 Vendita ed assistenza post-vendita di macchine automatiche. Automatic machine sales and post-sales assistance.

Sistemi e componenti per la movimentazione di una vasta gamma di materiali fluidi e viscosi impiegati nell’automotive, commercio e industria. Fluid handling systems and components for a wide range of fluids and viscous materials used in vehicle, commercial and industrial settings.

Live Tech Srl

Marchesini Group SpA

Omron Europe B.V.

Ronchi Mario SpA

Scandolara SpA

Via Coppa 3/B 12051 Alba (CN) - Italy Tel. +39 0173 440679 sales@live-tech.it www.live-tech.it

Via Nazionale 100 40065 Pianoro (BO) - Italy Tel. +39 051 6518711 marketing@marchesini.com www.marchesini.com

Wegalaan 67-69 2132 JD Hoofddorp - The Netherlands Tel. +31 023 568 13 00 info@eu.omron.com industrial.omron.eu

Via Italia 43 20060 Gessate (MI) - Italy Tel. +39 02950.881 info@ronchi.it www.ronchipackaging.com

Via delle Groane 65 20024 Garbagnate Milanese (MI) - Italy Tel. +39 02 9907061 scandolara@scandolara.com www.scandolara.com

Interpack Hall 14 B29 Sistemi automatici per la formatura, riempimento e chiusura di casse, display e scatole. Automatic packing case, display and box form-fill-seal systems.

Interpack Hall 8a F05-G03 Linee complete e macchine per il confezionamento di prodotti farmaceutici e cosmetici. Complete lines and machines for cosmopharma products packaging.

Interpack Hall CS 318 Componenti e sistemi per l’automazione industriale - Il tuo specialista di automazione per il packaging. Components and systems for industrial automation - Your automation specialist for packaging.

Interpack Hall 8A E-01 Macchine e attrezzature per il riempimento e la tappatura di prodotti liquidi in bottiglie. Machines and equipment for filling and capping liquid products in bottles.

Produzione e stampa di tubetti in alluminio, polietilene e laminato. Production and printing of alu-, PE and laminated tubes.

Schneider Electric SpA

Sun Chemical Group SpA

Tecmes Srl

Valmatic Srl

Zenith Srl

Via Circonvallazione Est 1 24040 Stezzano (BG) - Italy comunicazione@it.schneider-electric.com www.schneider-electric.it

Via Achille Grandi 3/6 20090 Caleppio Settala (MI) - Italy Tel. +39 02 957901 infosunchem@sunchemical.com www.sunchemical.com

Strada Provinciale 36 Km 3.950 26010 Vaiano Cremasco (CR) - Italy Tel. +39 0373 278623 tecmes@tecmes-italia.com www.tecmes-italia.com

Via Turati 5 41030 San Prospero s/S (MO) - Italy Tel. +39 059 906550 commerciale@valmaticsrl.com www.valmaticsrl.com

Sp Bs 668 Km 29,200 25025 Manerbio (BS) - Italy Tel. +39 030 9938152 Info@zenithalluminio.it www.zenithalluminio.it

Interpack Hall 7a C10 Inchiostri da stampa e pigmenti. Printing inks and pigments.

Interpack Hall 13 A65 Macchine per la produzione di capsule caffè e per l’assemblaggio di piccoli/medi componenti in vari settori industriali. Machine for coffee capsules filling and for the small/medium sized assembly components in a lot of industrial sectors.

Interpack Hall 8a D12 Confezionamento in contenitori monodose e fiale; fornitura macchine FFS. Packaging in monodose containers and vials; supply of FFS machines.

Interpack Hall 11 C41 Contenitori in alluminio sottile per alimenti. Aluminium foil food container.

Interpack Hall 11 A55 Sacchi e sacchetti di carta, shopping bags manuali e automatici, bobine di carta stampata. Paper bags, manual and automatic shopping bags, reels of printed paper.

Interpack Hall 05 G22 Soluzioni per l’automazione di macchina e di processo. Solutions for machine and process automation.

Interpack Hall 17 A20-B03 Macchine automatiche per il processo e il confezionamento. Automatic machines for the processing and packaging.

Interpack Hall EN EN1-02 La fiera internazionale leader del processing e del packaging: soluzioni innovative per il food e non food. The international leading exhibition for processing and packaging; innovative solutions for food and non food.


THE VOICE OF ITALIAN PACKAGING

ISSN: 2037-2183

4/2014 APRILE 6,50€

NUMERO 4 APRILE 2014


Il tuo partner di automazione per il packaging

Come partner di automazione specializzato, Omron può sostenerti in ogni fase dello sviluppo della tua nuova macchina per imballaggio o nel potenziamento di una macchina esistente. I nostri ingegneri ti forniranno soluzioni di motion control essibili e intuitive che includono il controllo real time di movimenti continui, una completa integrazione robotica e una semplice gestione dei cambi formato tipici di ogni produzione. Vieni a trovarci al Salone Components durante Interpack maggio 8, 9 e 10, 2014 presso la Hall CS, stand 318

industrial.omron.eu/components


4/ 2014

La grande avventura el mondo del packaging italiano si intrecciano innumerevoli storie di aziende, di successi e di insuccessi, ma soprattutto di uomini che hanno saputo inventare e dare impulso a questa industria e che, contando solo sulle proprie forze, hanno saputo offrire al mercato non semplice quantità (seppur di qualità) ma “quelle differenze che fanno la differenza”, ovvero servizio, innovazione, valori.

N

È successo e continua a succedere, con l’intento di costruire, con onestà, un mercato non solo solido ma anche virtuoso. Anche nei momenti di crisi. Anche a contrastare la banalizzazione dell’immagine del nostro Paese in un presente che, troppo spesso, premia superficialità, improvvisazione e pressappochismo. Persone intelligenti che guardano al di là dei confini della propria realtà con in mente l’immagine di un domani personale e collettivo. Perché preoccupazioni e cura sono (e dovrebbero essere) prima di tutto per i talenti e le professionalità di chi hanno intorno e a cui sentono di dover testimoniare, con il cuore prima di tutto, coraggio, sapere, serietà. D’altronde, fare impresa, ieri come oggi,

significa mettere al centro il valore del lavoro ma anche, come ha testimoniato col suo operato Giuseppe Meana, «il valore del “bello”, il rispetto per gli altri, la stima da guadagnarsi sul campo giorno per giorno, fino a farne uno stile di vita» (1). La storia dell’industria dell’imballaggio in Italia è tutta nel credere nella possibilità dell’impossibile. Una strada bella e difficile, affascinante e a volte crudele, fatta di tanta voglia di fare. Uomini, ma per fortuna anche donne, come Renata Marin, che ha privilegiato tra le scelte - quella di «lottare per strappare al degrado principi e parole di rispetto per l’essere umano, affermando con rigore il valore di quelle “differenze” che, sole, sono in grado di generare nuove esperienze, nel segno di una storia comune» (2). Il nostro mondo del packaging è storia di famiglie, più che di brand, di vita vissuta piuttosto che di progetti fatti a tavolino. Le cose sono cambiate, le aziende si sono adeguate, ma la modernità è ancora in un modello, in un disegno in cui si riflette prima di tutto l’anima dei protagonisti. Gente di grande ingegno e concretezza, come emerge chiaramente dalle parole che Bruno Gnudi spesso ripeteva: «Chi

The great adventure The world of Italian packaging is an intricate weft of countless stories of companies, of successes and failures, but aboveall of men who have been able to spur on this industry and who, only relying on their own efforts, were able to offer the market not simple quantity (albeit of quality) but “those differences that make the difference”, or that is service, innovation, values. This is the case and continues to be the case, with the intent of honestly constructing a market that is not only solid but also virtuous. This even in times of crisis, and also to contrast the banalisation of Italy’s image in a present that, all too often, rewards superficiality, improvisation and approximation. Intelligent people who look beyond the confines of their own reality with the image of a personal and collective tomorrow in mind.

www.dativoweb.net

Because their attention should first and foremost be directed towards the talents and the professional abilities of the people that surround them and to whom they wish to demonstrate courage, knowhow, reliability. Indeed, yesterday as today, entrepreneurship entails accepting work as a core value, but also, as Giuseppe Meana has borne witness to with his work, «as a value of “beauty”, of respect for others, of esteem to be won in the field day-in-day-out, up to turning all this into a lifestyle» (1). The history of the packaging industry in Italy fully lies in believing the impossible is possible. A wondrous though difficult path to take, fascinating while at times cruel, blazed by the irrepressible urge to get things done. Men, but luckily also women, like Renata Marin, who - caught between choice opted for «fighting to tear principles and

[

lavora sbaglia, ma poi deve subito saper rimediare e non limitarsi a chiedersi solo il perché. Quando ero bambino, una delle prime cose di cui ho potuto disporre è stata la bicicletta. Che cosa succedeva quando si rompeva? Dovevo farla riparare. Ma, se il meccanico era lontano, l’unica cosa che potevo fare era aggiustarla da solo. E così, pian piano, ho imparato. S’impara, facendo» (3). E allora, bene far crescere dimensionalmente le imprese, darsi una struttura manageriale, mettere in campo organizzazioni Lean, credere nella Total Quality, preoccuparsi della Corporale Social Responsability e dare valore alla Supply Chain… a patto di non dimenticare che, nell’attuale situazione congiunturale, bisogna anche lavorare di più. Così ci auguriamo che il mondo dell’imballaggio sappia essere, sempre più, specchio di un sistema produttivo capace di fare da cassa di risonanza ai temi del nostro tempo che, in modo trasversale, parlano di “scarsità di cibo (piaga indicibile), di rispetto per l’ambiente (risorsa per il futuro), di corretta gestione energetica (testimone di consapevolezza), di valore della ricerca e della tecnologia (bene dell’umanità).

A CCELERATIO N

]

Stefano Lavorini

“Non è possibile abbandonarsi alla rassegnazione, il futuro non si deve attendere, si fa” ”You cannot give in to resignation, you shouldn’t wait for the future, you should create it” (Umberto Galimberti) “Si volge ad attendere il futuro solo chi non sa vivere il presente” “Only the person who is incapable of living the present turns to await the future” (Lucio Anneo Seneca)

In ricordo di / In memoriam 1) Giuseppe Meana, Pusterla 1880 SpA 2) Renata Marin Polano, AMB SpA 3) Bruno Gnudi, G.B. Gnudi Bruno SpA

words of respect for the human being from decay, rigorously affirming the value of those “differences” that, on their own, are capable of generating new experiences, while featuring as part of a common story» (2). Our world of packaging is more a tale of families than of brands, of actual life lived rather than projects planned out at the drawing table. Things have changed, companies have adapted, but modernity still lies in a model, in a design which aboveall reflects the souls of the protagonists. People of great ingeniousness and concreteness, as clearly emerges from the words that Bruno Gnudi often repeated:«He (or she) who works makes mistakes, but they must me immediately capable of putting things right, and not merely limit themselves to asking why things went wrong. When I was a child, one of the first possessions I had was a bicycle. What happened when it broke down? I had to have it repaired. But if the repairer was a long

way off, the only thing I could do was repair in myself. And thus, slowly I learned. You learn things by doing». Hence it’s a good thing that companies grow in size, take on a managerial structure, field a lean organization, that they learn to believe in Total Quality, worry about Corporate Social Responsibility and give value to the Supply Chain….provided they don’t forget that, in the current economic and market situation, you also have to work harder. Thus we hope that the packaging world is evermore capable of mirroring a production system capable of acting as a sounding board for the great questions of our times, that unilaterally speak of “food shortage (a terrible scourge), of respect for the environment (resource of the future), of a correct management of energy resources (testimony of awareness), of the value of research and technology (heritage and treasure of humankind).


[

BE H I N D T H E COV E R

Michele Chiossi J.P. dripping, 2006 marmo statuario, intarsio, foglia d’oro, alluminio e ottone dorati, 180x60x60cm

] Nato a Lucca nel 1970, Michele Chiossi vive e lavora a Milano. Da anni segue una singolare e approfondita ricerca sui mood che segnano il nostro vivere, dalle analisi sul cibo, intese come identità o elementi sociologici, alle attitudini sociali del bere (la Cocktail Generation). Attraverso un’attenta indagine scultorea, si interroga sugli strumenti della scultura stessa, sui significati dei nostri comportamenti e sulle nostre scelte quotidiane, spesso rileggendo noti brand in propri e originali “still lives”. Primo fra tutti è stato il Parmigiano Reggiano, icona di una italianità globale, da cui ha attinto la tipica marchiatura d’origine, usandone il lettering per una riscrittura dei codici estetici: un font che, come una costellazione, afferma soggetti nella riscrittura concettuale del nome stesso. Il punto è complementare alla linea, e la linea è il suo personale e peculiare trade-mark: un originale tratto a mano libera, a zig-zag, fatto appunto di semplici linee orizzontali e verticali, che spesso ha anche tradotto tridimensionalmente e che, filosoficamente rivela la complessità del pensiero contemporaneo. Il pixel è il suo elemento distintivo. Attento decodificatore delle tendenze globali e acuto osservatore dei costumi contemporanei realizza raccolte di disegni che affrontano tutti i diversi temi della sua complessa indagine del vivere quotidiano e contemporaneo. Dopo gli studi di formazione artistica in Italia, ha soggiornato per sette anni a New York e viaggiato molto, per esempio in Giappone, dove ha incontrato non solo l’Oriente ma anche un vivere la tradizione in modo fortemente innovativo.

Le ultime mostre personali/The latest one-man shows 2014: #ITSMILANOBABY, Atelier Les Copains-Gloria Maria Gallery, Milano (I). 2013: Burning feelings, Hotel Byron, Forte dei Marmi (I). 2011: LOL Doll, Spazio Sintesi, Milano (I). 2009: Talking to Wittkower, Galleria EFFEARTE, Milano (I). 2008: NeonClassic, Galleria Z2o, Roma (I). 2007: La Marie 2000, Susanna Orlando Vetrina, Pietrasanta (I); Let There Be Light, Galleria ZONCA&ZONCA, Milano (I). 2006: The jap diptyque room, Spazio Bigli, Milano (I); On sculpture, Galerie Metis NL, Amsterdam (NL). Le ultime mostre collettive/The latest collective shows 2013: Words of art, EDS Galeria, Mexico City (MX); Artrissima, Galleria ARTRA, Milano (I); Fortemarmissima Square, Forte dei Marmi (I); Cento la Lettura, Triennale, Milano (I); 2012: Personal Effectsonsale, Padiglione dell’Esprit Nouveau, Bologna (I); Inside-Out, Piazzetta dei Marmi, Forte dei Marmi (I); Osservazione della natura in stato di quiete, Museo Marino Marini, Firenze (I); 2011: Video-works, EDS Galeria, Mexico City (MX); L’aur’amara, La Générale en Manufacture, Parigi (F); Domesticity, Prague Biennale, Prague (CZ); 54° Esposizione internazionale d’arte della Biennale di Venezia, padiglione Toscana, Museo Pecci, Prato (I); Sculpture square, Piazzetta dei Marmi, Forte dei Marmi (I); 2010: Di cotti e di crudi, Fiera del Levante, Bari (I); 2009: Second look (at the surface), Kuenstlerhaus Palais Thurn und Taxis, Bregenz (A); Matt Dive Gold, LipanjePuntin, Roma (I). 2007: Once upon a time, Galleria ZONCA&ZONCA, Milano (I). 2006: Super Window, Susanna Orlando Vetrina, Pietrasanta (I); Food, Studio Guastalla, Milano (I). Le principali fiere europee/The most important European exhibitions: Fiac, Paris; Arco, Madrid; Liste, Basel; ArteFiera, Bologna; MiArt, Milano; Artissima, Torino; Art Rotterdam, Rotterdam; Art Brussels, Brussels.

Neon-Classic (Mini Cooper Vintage), 2008 marmo statuario, acciaio, neon 85x85x10cm

La Cage Aux Folles, 2005 marmo bianco statuario, acciaio verniciato, foglia d’oro 67x64x100cm

Born in Lucca in 1970, Michele Chiossi lives and works in Milan. For years he has followed a singular, in-depth study on the moods that mark our daily lives, from the analysis of food, understood as identity or sociological element, to that of the social attitudes to drinking (the Cocktail Generation). He uses sculpture to question the very tools of the discipline itself, along with the meaning of our everyday actions and choices, often offering a rereading of known brands in his own, original “still lives”.

2 • 4/14

First and foremost his Parmigiano Reggiano, icon of a global Italianness, from which he drew on the typical original branding, using the lettering to rewrite the aesthetic code: a source that, like in a constellation, affirms subjects in the conceptual rewriting of their selfsame name. The dot is complementary to the line, and the line is his personal and peculiar trademark: an original freehand zig-zag stroke comprising simple horizontal and vertical lines, that he has also often translated in 3D and that, philosophically reveals the complexity of

contemporary thought, with the pixel as its distinguishing element. Skilful in decoding global trends and acute observer of contemporary customs, he makes collections of drawings that tackle all the different themes in his complex delving into everyday and contemporary living. After formative art studies in Italy, he lived for seven years in New York and has travelled much, for example in Japan, where he also not only encountered the East but a strongly innovative way of experiencing tradition.

www.dativoweb.net


Badiamo ai contenuti.

Contenitori termoformati creati per soddisfare ogni vostra esigenza. Creiamo qualsiasi tipo di contenitore per alimenti seguendo tutto il ciclo di produzione, a partire dall’estrusione, fino ai servizi di termoformatura e alle linee di stampa offset. Studiando materiali e forme capaci di adattarsi a ogni richiesta. Garantiamo i più elevati standard di rispetto dell’ambiente, riconosciuti dalla certificazione ISO 9001 e ISO 14001, offrendo solo prodotti completamente riciclabili e biodegradabili (PLA). Soddisfare le vostre esigenze è la nostra natura. S t r a d a C h i e r i , 7 9 - 1 0 0 2 0 A n d e z e n o ( T O ) - Te l 0 1 1 . 9 4 3 . 3 1 . 1 1 w w w . a r c o p l a s t i c a . c o m - e - m a i l : i n f o @ a r c o p l a s t i c a . c o m


OFFICINA BOCEDI S.r.l. Via R. Guttuso 2/A 42019 Scandiano (RE) Italy Tel. +39 0522.76.70.25 Fax. +39 0522.98.19.83 www.bocedisrl.com info@bocedisrl.com

VISIT US AT HALL 12 STAND C01

STRETCH HOOD MACHINES: security, protection and stability for your products

SISTEMI DI CONFEZIONAMENTO PALLET - SYSTEMS FOR PALLET PACKAGING


4/ 2014

[

CO NTENTS

]

L’informazione continua su www.dativoweb.net

C o n t e n t s TechnoMemo M AT E R I A LS & M A C H I NERY 85

Food & Beverage Nuovo: PET con elevata barriera all’ossigeno (Arcoplastica) New: PET with high oxygen barrier

87

News

90

L’importanza dei materiali The importance of materials

2

Michele Chiossi Behind the cover

96

Cosmopharma Pharmapack punta sul 13 e vince (UBM Canon) Pharmapack plays 13 and wins

98

8

Rubrica degli eventi passati Memorandum

In fiera con nuove macchine e nuovi sistemi (MG2) On show with new machines and new systems

101

12

Rubrica degli eventi futuri Agenda

Innovazione delle linee e qualità del packaging (Bosch Rexroth, Bergomi) Innovation in packaging lines and quality

105

Omas: l’evoluzione aziendale e tecnologica Omas: the evolution of business and technology

107

News

110

Multimarket Flessibili e dedicate ai beni di largo consumo (AcmaVolpak, Gruppo Coesia) Flexible and dedicated to fast moving consumer goods

112

Innovativi, consapevoli, capaci (Gruppo IMA) Innovation, awareness, ability

114

News

117

TLM: la prossima generazione (Gerhard Schubert GmbH) TLM: the next generation

47

47

63

149

[ A PROPOSITO DI… Valutazione dei rischi ] 69

Il set off di materiali flessibili stampati (Giflex e IrcPack) Set-off in printed flexible materials

[ OSCAR & OSCAR ] 23

Oscar dell’imballaggio 2014: i finalisti Italian Packaging Oscar 2014: the finalists

[ MARKETING & DESIGN ]

AUTOMATION & CONTROLS

44

Lo sapevate che… (ADF Awards 2014) Did you know that...

121

47

Inchiostri: una buona ricetta (Sun Chemical) Inks: a good “recipe”

Cabinet-free technology: modularità ed efficienza energetica delle macchine automatiche (Bosch Rexroth) Cabinet-free technology: the modularity and energy efficiency of automatic machines

122

News

News

126

Un robot con Intelligent Motion (Keba) Intelligent Motion robot

127

Un Connection Point per l’automazione (Rockwell Automation) A connection point for automation

131

Insieme per migliorare (Siemens, Sasib) Together to improve

134

Un pick&place per l’alimentare (K.L.A.IN.Robotics) Pick&place for the food sector

53

[

I NDUST RY & MA NA G E ME N T

57 63

[

]

Senza eSITazioni (Gruppo SIT) Without heSITation Dalla produzione all’e-commerce, con etica (AMB SpA) From production to e-commerce, with ethics

E NV I R ONME NT & L E G ISL ATI ON

]

79

R-PET: da bottiglia a bottiglia (Coripet) R-PET: from bottle to bottle

82

Imballaggio metallico: strumento di marketing (Anfima, Mirato) Metal packaging: a marketing tool

LA B E LI N G & C O D I N G 143

News

E N D O F LI N E & H A N D L IN G 149

Con BTG verso il futuro (Cama Group) With BTG towards the future

151

News

C O M PO N E N TS & O T H ER EQU IP MEN T S

ItaliaImballaggio at interpack Eingang Nord www.dativoweb.net

153

Incollaggio con Freedom™ (Nordson Corporation) Freedom adhesive system

155

News

160

Company index

162

Advertiser

1-2/14 • 1


Colophon SEW-EURODRIVE–Driving the world

Ogni singolo componente rende il sistema efficiente.

Direttore responsabile

Stefano Lavorini

Condirettore

Luciana Guidotti

Servizi redazionali

Elena Piccinelli

Promoter

Daniela Binario, assistenza@dativo.it

Segreteria

Leila Cobianchi, Filomena D’Addona

Pubblicità

traffico@dativo.it

Hanno collaborato

Riccardo Ceredi

Traduzioni Coordinamento artisti Progetto grafico e impaginazione Fotolito e Stampa Numero

Dominic Ronayne Gianni Valentino Studio Grafico Page - Novate Milanese (MI) Vincenzo De Rosa, R. Rossi, S. Viapiana Ancora S.r.l. - via B. Crespi 30, 20159, Milano 4/2014 Aprile anno 21 Pubblicazione iscritta al n. 555 del Registro di Cancelleria del Tribunale di Milano in data 22/10/94 Iscrizione nel Registro degli Operatori della Comunicazione n. 4028 Una copia: € 6,50 - Arretrati: € 13.00

Periodicità Abbonamento per un anno:

mensile Italia € 60 Estero € 96 La riproduzione totale o parziale degli articoli e delle illustrazioni pubblicati su questa rivista è permessa previa autorizzazione della Direzione. La Direzione non assume responsabilità per le opinioni espresse dagli autori dei testi redazionali e pubblicitari

Redazione, Direzione Amministrazione, Diffusione

Product Manager Sales team (Italia)

Edizioni Dativo S.r.l. Via B. Crespi, 30/2 - 20159 Milano Tel. 02/69007733 - Fax 02/69007664 italiaimballaggio@dativo.it http://www.dativoweb.net Bruno G. Nazzani 02 69007733 - b.nazzani@dativo.it Massimo Chiereghin 02 69007733 - m.chiereghin@dativo.it Armando Lavorini 335 6266064 Mario Rigamonti 349 4084157 sales@dativo.it

Sales Representatives

Germany - P.Keppler Verlag GmbH & Co KG (VerpackungsRundschau) Industriestrasse 2 - 63150 Heusenstamm Tel.+49 6104 606322 - Fax +49/6104/606323 USA and Canada - Summit Publishing Company (Packaging World) Joe Angel One IBM Plaza/Suite 2401 330 N. Wabash Avenue, Chicago, IL 60611 Tel. +1 312/222-1010 - Fax +1 312/222-1310 con la collaborazione di

Una catena è forte tanto quanto il suo anello più debole. Ciò vale anche

SOCIO EFFETTIVO

per la produzione, per le vendite e per la logistica. In qualità di azienda leader specializzata nella tecnica degli azionamenti, SEW-EURODRIVE vi aiuta a mantenere efficienti i vostri impianti avvalendosi di soluzioni che assicurano il successo della vostra attività.

Informativa ex D.Lgs.196/03 - Edizioni Dativo Srl, titolare del trattamento, tratta i dati personali liberamente conferiti per fornire i servizi indicati. Per i diritti di cui all’art.7 del D.Lgs.196/03 e per l’elenco di tutti i responsabili del trattamento rivolgersi al responsabile del trattamento, che è il direttore responsabile. I dati potranno essere trattati da incaricati preposti agli abbonamenti, al marketing, all’amministrazione e potranno essere comunicati alle società del gruppo per le medesime finalità della raccolta e a società esterne per la spedizione della rivista e per l’invio di materiale promozionale. Il responsabile delle trattamento dei dati raccolti in banche dati a uso redazionale è il direttore responsabile a cui, presso la segreteria di direzione, via Benigno Crespi 30/2 20159 Milano, tel. 02 69007733, fax 02 69007664, ci si può rivolgere per i diritti previsti dal D.Lgs. 196/03.

www.sew-eurodrive.it

www.dativoweb.net SEW_Logistik_106x291_IT.indd 1

14.01.14 12


Memoran ndum Piccola rubrica di eventi che hanno lasciato il segno. Da leggere.

I BUONI RISULTATI DI INTERPLASTICA A dispetto delle incertezze politiche e della finanziare, l’economia della Russia cresce e sostiene la domanda di beni di consumo. Lo testimonia, fra l’altro, il buon andamento dell’ultima edizione di Interplastica che si è svolta a Mosca lo scorso 28-31 gennaio in concomitanza con Upakovka-Upak Italia, generando un flusso complessivo di 20mila visitatori. Un simile interesse, a poche settimane dalla grande “K” di Düsseldorf, sottolinea l’importanza del mercato e dell’evento a cui hanno partecipato 687 espositori di 28 paesi su 13.500 mq netti. Secondo le stime di Messe Düsseldorf, che organizza l’evento, la Germania guida la classifica dei fornitori di macchine per la lavorazione della plastica e della gomma alle imprese russe, con una quota di mercato del 32,2%, seguita a distanza da Italia (15,5%) e Cina (13,9%). Fra il 2011 e il 2012 l’export dei tedeschi nella regione è cresciuto del 7,5%.

THE GOOD RESULTS OF INTERPLASTICA Despite the political and financial uncertainties, Russia’s economy is growing and sustaining the demand for consumer goods. This is witnessed by the good performance of the latest edition of Interplastica, held in Moscow last January 28th to 31st in conjunction with Upakovka-Upak Italia, generating a total flow of 20 thousand visitors. A similar interest, a few weeks after the big “K” in Düsseldorf, stresses the importance of the market and the event which was attended by 687 exhibitors from 28 countries over a floorspace of 13,500 sqm net. According to estimates by Messe Düsseldorf, which organizes the event, Germany leads the ranking of plastics and rubber machinery suppliers to Russian companies, with a market share of 32.2%, followed at a distance by Italy (15,5%) and China (13,9%). Between 2011 and 2012 German exports to the region grew by 7.5%.

L’AUSTRALIA COMPRA GREEN A PIACENZA Il Console generale australiano, signora Simone Desmarchelier, si è recata lo scorso febbraio in visita ufficiale a Nordmeccanica - l’impresa multinazionale con base a Piacenza, che costruisce macchine per la produzione di imballaggi flessibili. Occasione dell’incontro, l’imminente inaugurazione del nuovo stabilimento dedicato alla produzione di macchine per la metallizzazione, con cui Nordmeccanica conta di intensificare i rapporti d’affari con il quinto continente. L’Australia rappresenta, infatti, un’importante area di sbocco per l’impresa piacentina, che si è affermata come fornitore eccellente di tecnologie a impatto zero. Fra i clienti principali spicca Amcor, con cui Nordmeccanica ha firmato contratti per un valore di circa 7 milioni di euro..

AUSTRALIA BUYS GREEN IN PIACENZA The Australian Consul General, Mrs Simone Desmarchelier, paid an official visited last February to Nordmeccanica - the Piacenza based manufacturer of machines for the production of flexible packaging. The occasion for the encounter, the opening of the new facility for the production of metalization machines, with which Nordmeccanica intends to intensify business relations with the fifth continent. Australia is in fact an important outlet for the Piacenza based company, which has established itself as an excellent provider of neutral impact technology. Among Nordmeccanica’s main customers include Amcor with which it has signed contracts to a value of some 7 million euros.

PLASTICA E CELLULOSA: I SEMINARI DELL’III A fine febbraio l’Istituto Italiano Imballaggio ha organizzato due giornate di studio sul packaging di plastica e cellulosa. Gli aggiornamenti hanno riguardato le Linee Guida CE del regolamento 10/2011/UE sui materiali plastici destinati a entrare a contatto con gli alimenti, e i corpus disciplinari inerenti il food contact e la gestione post consumo dell’imballaggio di cellulosa.

8 • 3/14

PLASTIC AND CELLULOSE: SEMINARS At the end of February the Istituto Italiano Imballaggio organized two study days on plastic and cellulose packaging. The updates regard EC guidelines for regulation 10/2011/EU on plastic materials for food contact, and the disciplinary body regarding food contact and the post consumption handling of cellulose packaging.


[

ME M O RAN D UM

] INNOVAZIONE BY B&R Oltre 100 clienti, 150 mq di area espositiva, più di 40 innovazioni, 6 presentazioni tecniche e 3 dimostrazioni live per il secondo Innovations Day B&R (25 febbraio scorso). L’evento 2014 ha riunito a Parma direttori tecnici e sviluppatori provenienti da tutta Italia, che a fine giornata hanno espresso vivo apprezzamento per il format e per i contenuti. Filo conduttore dei vari interventi, il nuovo concetto di automazione “ad alta scalabilità” (Scalability+), concepito per raggiungere nuovi livelli di efficienza nella produzione di macchine personalizzate, adottando un unico software per configurare e programmare tutte le piattaforme di controllo.

INNOVATION BY B&R Over 100 customers, 150 square meters of exhibition area, more than 40 innovations, 6 technical presentations and live demonstrations for the second B&R Innovations Day (25th February). The 2014 event drew technical managers and developers from all over Italy to Parma, that at the end of the day expressed their keen appreciation for the format and contents. The underlying theme of the various interventions, the new “highly scalable” automation concept (Scalability+), designed to achieve new levels of efficiency in the production of customized machines, using a unique software to configure and program all control platforms.

PASSA LA DIRETTIVA CE SUGLI SHOPPER Il 10 marzo la Commissione Ambiente del Parlamento Europeo ha votato la Direttiva Europea sugli shopper, presentata dalla Commissione lo scorso novembre del 2013. Riconosciuto, così, il diritto di ciascun paese di seguire una propria strada per raggiungere gli obiettivi comuni: -50% di shopper in circolazione in 3 anni e -80% in 5 anni a far data dal 2010. Per evitare elusioni della direttiva, è stabilito che i sacchi riutilizzabili non possano costare meno dei sacchi usa e getta. Inoltre, attraverso un differenziale di prezzo viene riconosciuto il contributo dei sacchi biodegradabili e compostabili alla qualità degli RSU. In questa logica, i sacchi per frutta e verdura al di sotto dei 10 micron dovranno essere biodegradabili e compostabili entro 5 anni dall’applicazione della direttiva.

EC DIRECTIVE ON CARRIER BAGS March 10th Environment Committee of the European Parliament voted on the proposed European Directive on carrier bags, presented by the Commission in November 2013. This recognizes the right of each country to follow its own path in achieving the community objectives: 50% less carrier bags in circulation in 3 years and 80% less in 5 years with effect from 2010. To forestall avoidance of the directive, it has been established that reusable bags cannot cost less than disposable bags. The directive in question in fact recognizes the positive results produced by the Italian standard, that has brought the consumption of disposable carrier bags from 180,000 t in 2010 to 90,00 t of 2013 (down 50%) and has improved the quality and the quantity of organic waste, creating a true and proper segregated collection model that functions the same way in low and densely populated areas, as the case of Milan shows.

L’ARTE DELLA PROFUMERIA Si è svolta dal 20 al 23 marzo nella nuova location della Triennale di Milano la sesta edizione di Esxence -The Scent of Excellence, organizzata da Equipe International e dedicata alla profumeria d’autore. In mostra, su 1700 mq, 132 marchi e 5.937 visitatori (per il 67% stranieri), a cui vanno sommati gli oltre 4500 utenti che hanno seguito l’evento in live streaming. Nell’ambito della mostra, oltre ai molti momenti di informazione e approfondimento, l’assegnazione dei premi ai giovani designer emergenti. Per il packaging si è distinto l’iraniano Radis Nikzad.

10 • 1-2/14

THE ART OF PERFUMERY The sixth edition of Esxence -The Scent of Excellence, organized by International Team and dedicated to d’auteur perfumery, was held March 20th to 23rd in the new location of the Milan Triennale. On show, over 1700 square meters, 132 brands and 5,937 visitors (67% from abroad), to which must be added the more than 4500 users who followed the event via live streaming. As well as many moments of information and analysis, the show also featured the awarding of prizes to young emerging designers. Iranian Radis Nikzad won in the packaging section.

www.dativoweb.net


Rolling plant-Delebio

Headquarter and converting plant-Mandello del Lario

CARCANO: DA OLTRE UN SECOLO, IN TUTTO IL MONDO, SINONIMO DI ECCELLENZA NEL FOGLIO.

Carcano rappresenta in Europa una delle realtà più importanti nel campo dell’imballaggio flessibile con foglio d’alluminio, di cui ricordiamo, tra le varie applicazioni, l’utilizzo nell’industria dolciaria, alimentare e farmaceutica. L’Azienda è inoltre presente sul mercato con i suoi prodotti destinati ai settori tecnici quali la coibentazione, l’isolamento termo-acustico, il settore cavi e profili decorativi. Il prodotto Carcano è supportato dal foglio di alluminio autoprodotto nello stabilimento di Delebio, dove l’azienda ha sempre investito in qualità e tecnologia. Con l’entrata in funzione a fine 2013 della nuova modernissima fonderia “greenfield” (v.foto), Carcano completa l’adeguamento ai massimi livelli (oltre due metri) di tutta la sequenza produttiva dal lingotto di primario al foglio sottilissimo, in un unico sito produttivo. Un lungo cammino cominciato nel 1896.

CARCANO: FOR MORE THAN A CENTURY SYNONYMOUS WITH EXCELLENCE IN ALUFOIL ALL OVER THE WORLD Carcano is an important European manufacturer in the field of flexible packaging with aluminium foil for the confectionery, food and pharmaceutical industries. The company also operates in other foil market sectors, in particular in cable screening, insulation and soundproofing and decorative profiles. Carcano’s product is based on an in-house manufactured aluminium foil. This is produced in the Delebio plant, where the company has been investing in quality and technology. Thanks to the new, modern “greenfield” foundry (see picture), which began producing at the end of 2013, Carcano has completed the project of bringing the whole production process to the highest levels (over two metres) from primary aluminium ingots to thin foil in a single production plant. A long journey, which started back in 1896.


Agenda Rubrica degli eventi futuri: fiere, conferenze, convegni in Italia e nel mondo. Da ricordare.

EVENTS & SHOWS Cosmopack Cosmetics & perfumery packaging/ machinery & contract manufacturer 2-5/4/2014 Bologna (I) www.cosmoprof.com Cosmoprof Cosmetics & perfumery industry 4-7/4/2014 Bologna (I) www.cosmoprof.com Vinitaly Wine industry 6-9/4/2014 Verona (I) www.vinitaly.com Printpack Alger Printing & packaging technology 6-8/4/2014 Algiers (DZ) www.printpackalger.com InPrint Innovation in print technology 8-10/4/2014 Hannover (D) www.inprintlive.com Save Milano Automation, instrumentation & sensors 10/4/2014 Milano (I) www.exposave.com Luxe Pack Shanghai Luxury packaging 16-17/4/2014 Shanghai (PRC) www.luxepackshanghai.com A&T Affidabilità & Tecnologie Innovative technologies and services for design, manufacturing, testing 16-17/4/2014 Torino (I) www.affidabilita.eu Print Expo Prepress, press, printing finishing & converting 18-20/4/2014 Chennai (IND) www.printexpo.in Venditalia International vending exhibition 7-10/5/2014 Milano City (I) www.venditalia.com Interpack Processes & packaging 8-14/5/2014 Düsseldorf (D) www.interpack.com Cosmofarma Pharmaceutical industry (health care, beauty care & services) 9-11/5/2014 Bologna (I) www.cosmofarma.com Xylexpo Woodworking technology & furniture supplies 13-17/5/2014 Milano Rho (I) www.xylexpo.com

12 • 4/14

Luxe Pack New York Luxury packaging 14-15/5/2014 New York (USA) www.luxepacknewyork.com Cemat Intralogistics 19-23/5/2014 Hannover (D) www.hfitaly.com SPS/IPC/Drives Italia Industrial automation technology 20-22/5/2014 Parma (I) www.sps-italia.net Fespa Digital Digital print 20-23/5/2014 Munich (D) www.fespa.com Automatica + Maintain Automation & mechatronics + Industrial maintenance 3-6/6/2014 Munich (D) www.automatica-munich.com Fefco summit Corrugated board industry 4-6/6/2014 London (UK) www.fefco.org Pack & Gift Packaging, gifts & merchandising 4-5/6/2014 Paris (F) www.packandgift.com mcT Strumenti di Visione e Tracciabilità Conference & exhibition 12/6/2014 Bologna (I) www.eiomfiere.it/mct_visione_ tracciabilita Beauty Eurasia Cosmetics, beauty, packaging & private label 12-14/6/2014 Istanbul (TR) www.beautyeurasia.com Make-up in Paris Formulation, packaging & marketing for cosmetics 12-13/6/2014 Paris (F) www.makeup-in-paris.com RosUpack Packaging industry 17-20/6/2014 Moscow (RUS) www.rosupack.com www.internationalshow.it Cosmoprof North America Cosmetics & perfumery industry 13-15/7/2014 Las Vegas (USA) www.cosmoprofnorthamerica.com International FoodTec Brasil Food industry 5-7/8/2014 Curitiba (BR) www.foodtecbrasil.com.br

www.dativoweb.net


[

A GE N D A

] 5- 8 maggio, Parma

Cibus 2014 Q Le eccellenze italiane incontrano il mondo distributivo, nazionale ed estero. Ad un anno da Expo 2015, la food business community internazionale si dà appuntamento a Parma dal 5 all’8 maggio, “ospite” della 17° edizione di Cibus, di cui si prospettano importanti cambiamenti. Il tradizionale salone diventerà infatti una fiera multicanale, aperta a tutta la filiera alimentare, sia produttiva che distributiva, in un’evoluzione dettata dal mercato, ma anche dall’evento mondiale Expo 2015. Flessibile l’offerta in fiera, che vedrà le grandi aziende alimentari a fianco delle piccole e medie, le catene distributive estere e italiane assieme al commercio al dettaglio e ai duty free, i grandi brand del made in Italy vicino alle eccellenze e alle nicchie come il biologico e il gluten free, la ristorazione tradizionale accanto alla ristorazione travel e organizzata.

Imperativo, per Cibus 2014, è ancora una volta “aumentare l’export del food made in Italy”, senza ovviamente trascurare di rivitalizzare il mercato interno. I dati statistici sull’andamento del mercato nel 2013 rilasciati a fine febbraio da Federalimentare (l’associazione confindustriale dell’industria alimentare, partner di Fiere di Parma per Cibus) sul periodo gennaio/novembre 2013 sono eloquenti: la flessione delle vendite nel mercato italiano è del 2,1%, mentre l’export continua a crescere e realizza un +7,1%. Prosegue, a questo proposito, il progetto “Cibus Market Check”, che ha portato decine di aziende italiane a incontrare le realtà distributive dei Paesi di interesse prospettico per il nostro export. Cibus ospita anche la nuova area “Italian Region B2B”, dove le PMI delle regioni che producono sapori tipici italiani potranno valorizzare le proprie proposte agli occhi degli importatori esteri alla ricerca di specialità di fine food. Tanti gli eventi e le iniziative speciali, illustrati in dettaglio sul sito www.cibus.it/iniziative.

7- 10 maggio, Milano

Vending: il futuro in mostra Q A due mesi dall’apertura, si prospetta il tutto esaurito per Venditalia 2014 (Milano, 7-10 maggio), che “incassa” anche l’interesse crescente degli espositori internazionali, attestandosi come evento di riferimento globale per il mondo della distribuzione automatica. All’inizio di marzo, infatti, la manifestazione organizzata da Venditalia Servizi al polo espositivo di Fieramilanocity registrava già oltre il 90% degli spazi assegnati, e l’adesione di numerose new entry (anche straniere). «Nonostante la crisi non abbia risparmiato la distribuzione automatica, le imprese del vending non hanno perso né forza né coraggio», commenta Lucio Pinetti, presidente di Confida e Venditalia Servizi, che prosegue: «Quest’anno ci attendiamo una grande partecipazione di espositori e visitatori e siamo certi che anche la qualità e varietà delle proposte saprà sorprendere i visitatori». Più che una “fiera” Venditalia è un luogo di ritrovo della community di settore, nonché occasione per l’industria italiana di mettere in mostra uno dei suoi comparti eccellenti, con imprese leader di qualità e campioni di lungimiranza. E proprio all’eccellenza verrà dedicato un percorso all’interno della manifestazione: le aziende espositrici potranno così mettere in gioco il loro modo di intendere l’evoluzione del comparto, valorizzando le proposte più innovative e “diverse” dalla tradizione.

5-8th May, Parma

Cibus 2014 Italian fine food meets the world of distribution for both Italy and abroad. A year off from Expo 2015, the international food business community will be rendezvousing at Parma 5-8th May, “hosted” by the 17th edition of Cibus, where important changes are prospected. The traditional show will in fact become a multichannel fair, open to all the food chains, both productive and distributive, in an evolution dictated by the market, but also by the world event Expo 2015. Flexible the offer at the fair, that will see the large food concerns alongside the medium to smaller sized ones, foreign and Italian distributor chains alongside the retail trade and the duty free, the big Italian brands alongside niche excellences such as biological and gluten free, traditional

14 • 4/14

restauranteurship alongside travel and organized foodservice. Imperative for Cibus 2014 is once more the “increase in Italian food exports”, without obviously overlooking the revitalisation of the domestic market. The statistical data on the run of the market in 2013 released at the end of February by Federalimentare (the food industry Confindustria member association, partner of Fiere di Parma for Cibus) on the period January/November 2013 is eloquent: the drop in sales on the Italian market amounts to 2.1%, while exports continue to grow and reach a +7.1%. On this count the project “Cibus Market Check” continues, that has enabled tens of Italian firms to encounter distributors of the Countries of prospective interest for Italian exports. Cibus will also be hosting the new “Italian Region B2B” area, where

the SMEs of the regions that produce typical Italian relishes will be able to spotlight their proposals under the eyes of foreign importers on the lookout for fine food specialities. Many the special events and undertakings, illustrated in detail on the website www.cibus.it/iniziative/. Vending: the future on show Two months before opening, Venditalia 2014 (Milan, May 7th to 10th) promises to be fully booked, and is also “cashing in on” the the growing interest of international exhibitors, as the show positions itself as global benchmark in the vending machine world. In early March, in fact, the event organized by Venditalia Servizi at the Fieramilanocity exhibition center already registered the booking of more than 90% of available spaces, plus the registration of several new entries (including foreign ones).

«Although the crisis has neither spared the vending business, vending companies have lost neither strength nor courage» says Lucio Pinetti, president of Confida and Venditalia Servizi, who continues: «This year we expect a large turnout of exhibitors and visitors, and we are confident that the quality and variety of the proposals will surprise visitors to the event». More than a “fair”, Venditalia is a meeting place for the sector community, as well as opportunity for the Italian industry to showcase one of its segments of excellence, with leading quality firms that are champions of foresight. And it is indeed excellence that will be one of the main features of the coming event: exhibiting companies will thus be able to stake their way of interpreting the evolution of the sector, highlighting their most innovatory proposals.

www.dativoweb.net


EVENTS & SHOWS Indoplas + Indopack + Indoprint Plastics, Packaging & Printing exhibitions 3-6/9/2014 Jakarta (ID) www.indoplas.com www.indopack.net www.indoprint.net Asia Fruit Logistica Fruit & vegetable marketing 3-5/9/2014 Hong Kong (PRC) www.asiafruitlogistica.com East Afripack Processing, packaging & converting technologies 9-12/9/2014 Nairobi - Kenya (Eak) www.ipack-ima.com Labelexpo Americas Labeling & converting 9-11/9/2014 Chicago (USA) www.labelexpo-americas.com Beyond Beauty Events Cosmeeting Paris & Creative Beauty Paris 9-11/9/2014 Paris (F) www.beyondbeautyevents.com

Macropak Packaging industry 30/9-3/10/2014 Utrecht (NL) www.macropak.nl

IL FUTURO DELL’ IMBALLAGGIO

Bimu Metal forming & metal cutting machines, robots, automation and auxiliary technologies 30/9-4/10/2014 Milano Rho (I) www.bimu.it China Brew China Beverage Brew & beverage processing technology and equipment 13-16/10/2014 Beijing (PRC) www.chinabrew-beverage.com Viscom Italia Visual communication 16-18/10/2014 Milano Rho (I) www.visualcommunication.it Sial Agri-food industry, food retail & commercial catering 19-23/10/2014 Paris (F) www.sialparis.com Luxe Pack Monaco Luxury packaging 27-29/10/2014 Montecarlo (MC) www.luxepack.com

Equipmag Retail, distribution & point of sale Cibus Tec & Food Pack 16-18/9/2014 Paris (F) Food processing & packaging www.equipmag.com technology 28-31/10/2014 Parma (I) Eurasia Packaging Istanbul www.cibustec.it Packaging industry 18-21/9/2014 Istanbul (TR) Save www.packagingfair.com Automation, instrumentation & sensors Istanbul Food-Tech 28-29/10/2014 Verona (I) Food & beverage technologies, www.exposave.com food safety, additives, cooling, ventilation, storage systems & Labelexpo India logistic Label, product decoration & 18-21/9/2014 Istanbul (TR) converting www.foodtechistanbul.com 29/10-1/11/2014 New Delhi (IND) Macfrut www.labelexpo-india.com Fruit & vegetables 24-26/9/2014 Cesena (I) Pack Expo International www.macfrut.com Packaging technologies 2-5/11/2014 Drink technology India Chicago, Illinois (USA) Beverage & food industry www.packexpo.com 25-27/9/2014 Mumbai (IND) Ecomondo www.drinktechnology-india.com Materials and energy recovery & sustainable development International PackTech 5-8/11/2014 Rimini (I) India www.ecomondo.com Processing, packaging & printing Brau Beviale 25-27/9/2014 Mumbai (IND) Beverage technology www.packtech-india.com 11-13/11/2014 Nürnberg (D) www.ipackima.it www.brau-beviale.de Taropak Packaging technology & logistics 29/9-2/10/2014 Poznan (PL) www.taropak.pl

Cosmoprof Asia Cosmetics & perfumery industry 12-14/11/2014 Hong Kong (PRC) www.cosmoprof-asia.com

Interplas Plastics industry 30/9-2/10/2014 Birmingham (UK) www.britishplasticsshow.com

International FoodTec India Food processing & packaging technology 14-16/11/2014 Mumbai (IND) www.koelnmesse.it/international_ foodtec_india/home/index.php

www.dativoweb.net

SKINNYPACK

TM

NOVITA’ MONDIALE

SKINNYPACK BOTTLE TM

più leggera di una bottiglia tradizionale permette di ridurre il consumo di plastica del 60% è totalmente riciclabile mantiene un’elevata barriera all’ossigeno offre la possibilità di un packaging bicolore e personalizzato è estremamente versatile, adatta a numerosi impieghi è facilmente impilabile per ottimizzarne il trasporto e l’immagazzinamento senza investire in nuovi macchinari

SKINNYPACK

TM

… quando la technologia del Film si fonde con quella dello stampaggio ad iniezione.

INTERNOVA PACK s . r.l . Via A. De Gasperi, 35/B - Pianezze San Lorenzo 36060 Vicenza Italy Tel: +39 0424 470377 Fax: +39 0424 470747 E-mail: info@internovapack.it Wesite: http://www.internovapack.it


[

A GE N D A

] Parma, 20-22 maggio 2014

SPS IPC Drives Italia Q A due mesi dall’avvio (data in cui scriviamo, Ndr), la quarta edizione della fiera dell’automazione industriale organizzata annualmente a Parma da Messe Frankfurt Italia, già si mostra in crescita, con un +18% di espositori. E ai visitatori ripropone le tavole rotonde, molto apprezzate dagli operatori, una dedicata alle applicazioni nel Food&Beverage e l’altra al nuovo “fil rouge” Pharma&Beauty. A livello produttivo i due settori mostrano numerose affinità: sicurezza, tracciabilità, certificazione e produttività sono aspetti basilari e irrinunciabili per entrambi, e regolamentati da norme cogenti. Il packaging, in particolare, rappresenta un importante “minimo comune denominatore”, nelle funzioni logistiche, come nel marketing e nella tracciabilità

Bologna, 12 giugno 2014

mcT Strumenti di Visione e Tracciabilità Q Torna, alla seconda edizione, la mostraconvegno dedicata alle soluzioni di visione e identificazione per le applicazioni industriali di tracciabilità e logistica, organizzata da EIOM in concomitanza con la nona mcT Tecnologie per l’Alimentare. E, oltre a presentare gli ultimi traguardi della tecnologia con l’aiuto dei relatori e delle imprese espositrici, quest’anno sarà l’occasione per illustrare il progetto europeo Safetypack. La ricerca - coordinata dall’Istituto di Fotonica e Nanotecnologie del CNR IFN e supportata d a t 2 i Tr a s f e r i m e n t o Te c n o l o g i c o e Innovazione (partecipato dalle CCIAA di Treviso e Rovigo) - mette in campo un nuovo

Parma, 20th-22nd May 2014-03-24

SPS IPC Drives Italia Two months from the start (day of writing, Ed), the fourth edition of the industrial automation fair organized yearly at Parma by Messe Frankfurt Italia, is already seen to be on the increase, with a +18% of exhibitors. And the visitors will once again be offered round table discussions, much appreciated by the operators, one dedicated to the Food&Beverage applications and the other to the new Pharma&Beauty “lead thread”. On a productive level the two sectors show numerous affinities: safety, traceability, certification and productivity are the basic and essential aspects for both, and regulated by cogent standards. Packaging in particular stands as an important “minimum common denominator” in the logistics

16 • 4/14

- priorità assoluta negli ambiti alimentare e cosmaceutico. E in entrambi i casi l’automazione svolge un ruolo determinante per assicurare sicurezza e qualità, nonché sostenibilità dei prodotti e delle confezioni. Il 21 maggio si discuterà dunque di “Automazione per l’industria alimentare. Il packaging multifunzionale: non solo imballo”, e il 22 maggio de “L’automazione per l’industria farmaceutica e della cosmesi: la nuova frontiera del processo produttivo”. Fra i relatori figurano i fornitori di automazione ed end user del calibro di Alce Nero, Fonti Vinadio-Acqua Sant’Anna, Guido Gobino, Gruppo Gelati, Lavazza e Orogel in rappresentanza del settore alimentare, nonché Novartis, Ima, Teva, Supsi, L’Erbolario per il comparto farmaceutico e della bellezza.

sistema di sensori di gas, in linea, non intrusivo e in tempo reale, da impiegare nel bottling e nel confezionamento alimentare per il controllo qualità e integrità. I n c a m p o , u n s e n s o re spettroscopico a laser, che permette di misurare l’atmosfera interna e controllare l’integrità delle confez i o n i s e n z a e n t r a re i n contatto col prodotto (e, dunque, senza dover modificare il packaging), a cui sono destinate risorse non indifferenti: un finanziamento di 4,4 milioni di euro, tre anni di sviluppo, l’impegno di dieci enti di ricerca e partner industriali di cinque Paesi europei. Il convegno di mcT tratterà, con l’esposizione di best practices e casi applicativi di successo, anche di identificazione (RFID, codici a

functions, as in marketing then traceability - absolute priority in both the food and cosmaceutical fields. And in both cases automaton performs a decisive role in ensuring safety and quality, as well as the sustainability of the products and packs. My 21st hence the “Automation for the food industry. Multifunctional packaging: not just wrapping”, and 22nd May of “Automation for the cosmetics and pharmaceutical industry: the new frontier the production process” will be discussed. The speakers will include automation providers and end users the calibre of Alce Nero, Fonti Vinadio-Acqua Sant’Anna, Guido Gobino, Gruppo Gelati, Lavazza and Orogel representing the food sector, Novartis, Ima, Teva, Supsi, L’Erbolario the beauty and pharmaceutical segment.

barre mono e bidimensionali) e delle tecnologie emergenti per la raccolta e l’elaborazione dati nella trasformazione, distribuzione e logistica. Seguiranno, nel pomeriggio, i workshop e i corsi di formazione gestiti dalle aziende.

Bologna, 12th June 2014

mcT Vision and Traceability Tools The exhibition and conference dedicated to vision and ID solutions for industrial traceability and logistics applications, organized by EIOM in conjunction with the ninth Food Industry Technology mcT is now back in its second edition. And in addition to presenting the latest breakthroughs in technology with the help of speakers and exhibitors, this year the European project SafetyPack will be highlighted. The research study coordinated by the Institute of Photonics and Nanotechnology of the CNR IFN and supported by t2i Trasferimento Tecnologico e Innovazione (partnered by the Chamber of Commerce of Treviso and Rovigo) - fields a new system of in-line, non-intrusive, real time gas sensors to be used in the bottling and packaging of food products for

checking the quality and integrity of the packs. Also on show a laser spectroscopic sensor, which enables the measurement of the internal atmosphere and the checking of the packaging integrity without coming into contact with the product (and, therefore, without having to modify the packaging). The sensor is the result of the investment of considerable resouces - namely a grant of 4.4 million euros, three years of development, the commitment of ten research institutes and industrial partners from five European countries. The mcT conference, including exposition of best practices and successful case studies, will also deal with identification (RFID, mono and two-dimensional barcodes) and emerging technologies for gathering and processing data in the converting, distribution and logistics fields. Workshops and training courses run by participant companies are scheduled for the afternoon session.

www.dativoweb.net


Abbiamo ripensato noi stessi e il nostro modello produttivo, e lo abbiamo fatto partendo dal vostro punto di vista. Gli apprezzamenti ci hanno resi fieri, le critiche ci hanno indicato la strada. Il risultato è la nuova linea di etichettatrici E-way: semplici, versatili, performanti e sorprendentemente meno costose. Semplicemente innovative.

NUOVE ETICHETTATRICI E-WAY DI ETIPACK. PENSATE PER IL FUTURO.

Etichettatrice mod. ENERGY Etipack s.p.a. - via Aquileia 55/61 20092 Cinisello Balsamo (MI) Italy Ph. 0039 02 660621 Fax 0039 02 6174919 www.etipack.it

CALEIDOS-NEXXUS.IT

Abbiamo guardato con i vostri occhi e abbiamo visto E-way.


[

A GE N D A

]

18th-21st September 2014, Istanbul

18-21 settembre 2014, Instanbul

Eurasia Packaging Organized by Reed Tüyap*, Eurasia Packaging is the flagship event for the packaging industry in Turkey and the Eurasian region. Now in its twentieth edition, it is preparing to celebrate the anniversary with a record event: The new section dedicated to technologies for packaging printing will in fact lead to a substantial increase in exhibitors and visitors (what is more, in September more than 1,200 companies from more than 40 countries are scheduled to attend the Tüyap Fair Convention and Congress Center). Extensive the synergies with the concurrent Istanbul Food-Tech, the ninth edition of the show focused on technology food and beverage, safety, additives and ingredients, refrigeration systems, ventilation, warehousing and logistics. Berkan Öner, Project Group Director Eurasia Packaging, expressed great satisfaction with the progress of the show (where, to date, 75% of available space has already been booked): «Firstly, the proposal to add package printing technologies to the product category has been welcomed. Secondly, visitors will have the chance to meet world level printing and packaging machine builders from North Africa, Russia and neighboring regions, the Middle East, Taiwan, Germany and Italy. Finally, the support received by the Turkish packaging producers, as well as from many other associations (AMD, ESD, KASAD, MASD and SEPA), has enabled the start-up of an intensive professional training program». Coordinated by the Reed and Tüyap commercial offices in collaboration with chambers of commerce of the various countries, at the fair the presence of numerous purchasing groups from all over Europe, Asia and Africa will be guaranteed. To promote the event, the organizers will be present at Interpack (Hall EN1/ /04). * Reed Tüyap is a joint venture between Reed Exhibitions (with over 500 events in 41 countries, including the major trade fair organizers in the world) and the Tüyap Fairs Group which, in Turkey and in the Eurasian region, organizes as many as 110 shows a year in 5 exposition centers. The joint collaboration between the two companies has as its objective the creation of business communities worldwide.

19th - 23rd May 2015, FieraMilano Rho

Intralogistica Italia debut A year still to go, but the attention and the interest of the market are already evident. At the same time as the International Expo and alongside the great processing and packaging IPACK-IMA (and the other complementary fairs), Intralogistica Italia will be proposing a broad offer of solutions for industrial handing, warehouse management, material storage, order preparation – as well as targeted IT systems, logistics transport services, logistics structures. As well as the wealth of the proposals, the event is bolstered by the authoritativeness and competency of the organizers: Deutche Messe AG, that fields experience built up with the international network of shows CeMAT Intralogistica and Ipack-Ima SpA, or that is the most important Italian fair organisation in the processing and packaging mechanical engineering field. Thanks to the cooperation between these two bodies, Intralogistica Italia is promoted at international level along with other shows of the CeMAT network and proudly bears the wording “powered by CEMAT”. Legitimate the growth expectations of the foreign visitor base: Qualified buyers from throughout the world will converge on Intralogistica Italia - in particular from emerging markets such as Brazil, Russia China,

18 • 4/14

Eurasia Packaging Q Organizzata da Reed Tüyap*, Eurasia Packaging è la manifestazione di punta per l’industria dell’imballaggio in Turchia e nella regione eurasiatica. Giunta alla ventesima edizione, si prepara a celebrare l’anniversario con un evento record: la nuova sezione dedicata alle tecnologie per la stampa di imballaggi porterà infatti a un consistente aumento di espositori e visitatori (per inciso, a settembre, al Tüyap Convention Fair and Congress Center, è prevista la presenza di oltre 1.200 aziende provenienti da più di 40 paesi). Ampie le sinergie sviluppate con la concomitante Istanbul Food-Tech, nona edizione della mostra focalizzata su tecnologie alimentari e delle bevande, sicurezza, additivi e ingredienti, sistemi di refrigerazione, ventilazione,

19 - 23 maggio 2015, FieraMilano Rho

Debutta Intralogistica Italia Q Manca oltre un anno, ma l’attenzione e l’interesse del mercato sono già evidenti. In contemporanea con l’Expo Internazionale e in concomitanza con la grande IPACK-IMA del processing e del packaging (e le altre fiere complementari), Intralogistica Italia proporrà un’ampia offerta di soluzioni per la movimentazione industriale, la gestione del magazzino, lo stoccaggio dei materiali, la preparazione degli ordini - oltre a sistemi informatici e software mirati, servizi logistici per il trasporto, immobili logistici. Oltre che dalla ricchezza delle proposte, la rassegna è sostenuta anche dall’autorevolezza e competenza degli organizzatori: Deutsche Messe AG, che mette in campo l’esperienza maturata con il network internazionale di saloni dell’intralogistica CeMAT, e Ipack-Ima SpA, ovvero il più importante organizzatore fieristico italiano nel campo della meccanica strumentale per il processing e il packaging. Grazie alla collaborazione fra questi due enti, Intralogistica Italia viene promossa a livello internazionale insieme alle altre mostre del network CeMAT e si fregia della dicitura “powered by CeMAT”. Legittime le aspettative di sviluppo della base di visitatori esteri: confluiranno a Intralogistica Italia buyer qualificati di tutto il mondo - in particolare dai mercati emergenti come Brasile, Russia, Cina, Eurasia - facendo di Milano un punto d’incontro focale della filiera.

magazzinaggio e logistica. Berkan Öner, Project Group Director di Eurasia Packaging, esprime grande soddisfazione per l’andamento della mostra (dove, ad oggi, il 75% degli spazi è già occupato): «Anzitutto la proposta di aggiungere in merceologia le tecnologie del package printing è stata accolta con favore. In secondo luogo, i visitatori avranno la possibilità di incontrare costruttori di macchine di stampa e

Coinvolgere i leader. Organizzare, implementare e controllare il flusso e lo stoccaggio di materiali, merci e relative informazioni all’interno di un’azienda: questo il vasto campo d’azione della catena intralogistica, che spazia dal ricevimento delle materie prime alla consegna del prodotto finito al cliente. L’eccellenza dell’industria italiana, e la sua vocazione all’export, alimentano l’interesse per gli sviluppi di questo comparto, a buon titolo individuato come strategico. L’intralogistica, infatti, è in grado di assicurare un importante vantaggio competitivo, grazie alle soluzioni innovative che permettono di razionalizzare e comprimere i costi. Un’innovazione in costante e rapido sviluppo, incarnata in componenti e sistemi sempre più funzionali, modulari e flessibili, ergonomici, sostenibili ed economici. Partendo da questi presupposti, per pianificare al meglio la prossima Intralogistica Italia, è stato costituito un Advisory Panel composto dai rappresentanti delle più importanti aziende espositrici e utenti. Il confronto costruttivo sui contenuti della fiera, che impegna organizzatori e operatori del settore, ne garantirà la piena rispondenza alle esigenze e alle tendenze del mercato. Al primo, recente, Advisory Board hanno partecipato responsabili di grossi calibri come Dematic Italia, Kardex Italia, Ssi Schaefer Systems Italia, Jungheinrich Italia e Still ItalienOm Carrelli Elevatori: tutte filiali di aziende tedesche che fanno parte del Comitato Consultivo del CeMAT e sono segnalate dall’associazione dei costruttori tedeschi di macchine e impianti VDMA, patrocinatore ufficiale della nuova rassegna.

www.dativoweb.net


[

A GENDA

]

Eurasia - making Milan a focal point of encounter for the sector.

confezionamento di livello mondiale, provenienti dai Paesi dell’Africa settentrionale, dalla Russia e regioni limitrofe, dal Medio Oriente, Taiwan, Germania e Italia. Infine, il sostegno ricevuto dall’Associazione turca dei produttori di imballaggi, così come da molte altre realtà associative (AMD, ESD, KASAD, MASD e SEPA), ci ha consentito di avviare un intenso programma di formazione professionale». Coordinata dagli uffici commerciali di Reed e Tüyap in collaborazione con le Camere di commercio dei vari paesi, in fiera sarà garanti-

ta la presenza di numerosi gruppi di acquisto provenienti da tutta Europa, Asia e Africa. Per promuovere l’evento, i responsabili saranno presenti a Interpack (Hall EN1 / / 04). * Reed Tüyap è la joint venture tra Reed Exhibitions (con oltre 500 eventi in 41 paesi, tra i maggiori organizzatori fieristici al mondo) e Tüyap Fairs Group che, in Turchia e nella regione euroasiatica, organizza ben 110 mostre all’anno in 5 centri espositivi. La collaborazione paritetica fra le due società ha come obiettivo la creazione di business community in tutto il mondo.

Involving the leaders. Organisation, implementation and control of flows and storage of materials and goods, and relative information, with a company, represent a vast field of action of the intralogistic chain, that range from the intake of raw material to the delivery of the finished product to the customer. The excellence of Italian industry, and its natural vocation to export, nourish the interest for the development of this segment, rightly seen as strategic. Intralogistics in fact is capable of ensuring an important competitive advantage thanks to the innovatory solutions that enable the rationalisation and the reduction of cost. And innovation in constant and rapid growth, incarnated in evermore functional, modular and flexible, ergonomic, sustainable and economical components and systems. Starting from these presuppositions, to best plan the coming intralogistica Italia an Advisory Panel has been set up comprising representatives of the most important exhibition and user companies. The constructive exchange on the conteints of the fair, that commits organizers and operators of the sector, guarantees the full compliance with the demands and market trends. At the first Adivsory Boar heads of large calibre concerns such as Dematic Italia, Kardex Italia, Ssi Schaefer Systems Italia, Jungheinrich Italia and Still Italien-Om Carrelli Elevatori took part: all branches of German concerns that are part of the CeMAT Consultative Committee and are indicated by the German machine and system builders association VDMA, official sponsor of the new event.

Il simbolo dei Brands responsabili

Oltre ad offrire un eccellente servizio ai clienti, i sacchetti prodotti in carta simbolizzano i valori corporativi dei brands responsabili verso l’ambiente ed il consumo sostenibile. Con i benefici ambientali della nostra carta e l’immagine che offre, aiutiamo i punti vendita a essere più vicini agli stili di vita dei loro clienti.

www.paperforbags.com IN TOUCH EVERY DAY www.mondigroup.com


(

-

0

#

"

-

$

6

4

5

0

.

&

3

4

&

3

7

*

$

&


UN VIAGGIO INSIEME DAL 1965

Un viaggio insieme, un servizio post-vendita affidabile, ricambi per tutte le macchine, anche le piÚ datate.Tecnici altamente competenti sono la nostra garanzia per l’alta qualità dei nostri prodotti e la passione che mettiamo nei nostri servizi.

PARTI A FORMATO, AGGIORNAMENTO IMPIANTI PER PRODUTTIVITĂ€, QUALITĂ€ PRODOTTO E SICUREZZA ASSISTENZA TECNICA PER INSTALLAZIONI, SOPRALLUOGHI, MANUTENZIONI PREVENTIVE, REVISIONI, TRAINING OPERATORI SERVIZIO RICAMBI CONSULENZA ON-LINE PROBLEMI TECNICI

PACKAGING EXPERIENCE SINCE 1965 .).U\KP)Y\UV:W(]PHLTHZP IVSVNUHP[HS`[  M  ^^^NINU\KPP[PUMV'NINU\KPP[ JHWP[HSLZVJPHSL0=**0(()VSVNUH9LN0TWYLZL)VSVNUH*-70=(=(;0;


Studio Borsetti Ferrara

contenitori ecologici che USI...

e ricicli al 100%

un sistema di gestione che permette di RISPARMIARE e OTTIMIZZARE i processi logistici

È un’eco-risorsa per tutti: operatori, consumatori e ambiente

CPR System S.c. a r.l. Sede Amministrativa Via Nazionale, 3 • 44028 Gallo (Ferrara) Tel. (+39) 0532 823912 • Fax (+39) 0532 823938 • info@cprsystem.it Sede Legale Via Verdi, 8 • 40051 Malalbergo (Bologna)

www.cprsystem.it


[

O SCA R & O SCA R

]

Oscar dell’imballaggio 2014 Il Quality Design dell’imballaggio made in Italy andrà in mostra dall’8 al 13 aprile a Milano. Tra gli eventi Fuorisalone del Brera Design District, quest’anno, ci sarà infatti anche uno spazio allestito alla Mediateca Santa Teresa (via della Moscova 28), dedicato ai 15 finalisti del concorso organizzato dall’Istituto Italiano Imballaggio. Premiazione il 9 aprile. iversi gli attori in gioco per la tradizionale competizione annuale, che punta a chiarire come le soluzioni proposte rispondano, da un lato, alle esigenze di servizio e informazione al consumatore, ma anche di visibilità, riconoscibilità e comunicazione del brand: i produttori di packaging in primis, l’Istituto Italiano Imballaggio, ovviamente, che ha lavorato in stretta collaborazione con la Scuola del Design del Politecnico di Milano e gode del patrocinio di Altroconsumo, Conai (Consorzio Nazionale Imballaggi) nonché di Ipack-Ima2015. E, infine, Studiolabo, curatori dell’allestimento nell’ambito di Visionica.

D

Chi vincerà e perché. Quest’anno dunque, il fil rouge delle valutazioni dei concorrenti sarà la qualità progettuale del packaging, riferita all’equilibrio e all’armonizzazione delle dimensioni comunicative, strutturali e funzionali. Con un’attenzione particolare nei confronti del destinatario/uten-

te, saranno dunque giudicate le innovazioni nel linguaggio grafico e nell’uso degli elementi comunicativi progettati per esprimere e rafforzare l’identità di marca e di prodotto, così come i valori correlati (comunicazione al servizio della sostenibilità ambientale). Saranno altresì considerati gli aspetti riferiti all’accessibilità e all’inclusività del packaging: le innovazioni che facilitano l’accesso al prodotto e al suo utilizzo, attraverso una chiara ed efficace articolazione comunicativo-strutturale e un’attenta qualità delle informazioni espresse, anche secondo una prospettiva di utenza allargata come nel caso del “design for all”. Ancora una volta, quindi, l’Oscar dell’imballaggio inquadra l’evoluzione della ricerca in tema di packaging e delle soluzioni alle problematiche di trasporto, protezione, sicurezza, ma anche di facilità di utilizzo e gestione da parte dell’utilizzatore professionale o del consumatore finale. I vincitori saranno proclamati il 9 aprile alle ore 16, durante una lezione di packaging design, tenuta da Valeria Bucchetti, professore associato del dipartimento di design del Politecnico. Q Nota: I testi pubblicati sono stati elaborati sulla scorta dei comunicati forniti dall’Istituto Italiano Imballaggio.


[

OS C AR & O S CA R

]

Utilizzatore ACQUA MINERALE SAN BENEDETTO SPA www.sanbenedetto.it

Utilizzatore COOP ITALIA SOC. COOP www.e-coop.it In collaborazione con CO. IND SC www.coind.it

CAVALCA L’ONDA CON “T-SURF”

CAFFÈ: UNA CAPSULA SOSTENIBILE

Thè San Benedetto, il thè pronto più amato dalle famiglie italiane, innova ulteriormente la categoria con un nuovo ed esclusivo formato. Da sempre riconosciuta come azienda capace di soddisfare concretamente i bisogni del consumatore e di rispondere alle esigenze di un mercato in continua evoluzione, San Benedetto amplia la propria offerta thè con un pizzico di brio in più e propone “T-Surf”: un pack unico nel suo genere, tutto ispirato al mare, alle onde, ai colori e alla fresca emozione di una scia estiva che dura tutto l’anno. Disponibile in formato da 20cl, con l’utile maniglia che lo rende pratico e maneggevole, intelligente e divertente e dal gusto inconfondibile garantito San Benedetto. L’azienda veneta è sempre in piena sintonia con i piccoli consumatori e le nuove generazioni: sa assecondare i loro gusti, stimolandone la voglia di gioco e di fantasia con iniziative di grande attrazione. Ed è proprio con l’obiettivo di spingere i più giovani al giusto consumo di una bevanda sana e di qualità, che stupisce col nuovo “T-Surf”. Proposto nei gusti Pesca e Limone, con aggiunta di fruttosio, il nuovo prodotto è concepito per avere sempre a portata di mano un Thè San Benedetto rinfrescante e dissetante, da gustare in modo più insolito e divertente in ogni momento della giornata: basterà strappare l’angolo della confezione e inserire la cannuccia in dotazione… e il gioco è fatto! Il pack, dalla grafica colorata e attraente, trasmette una sensazione di fresco anche al tatto e si distingue per leggerezza e praticità: può essere, infatti, trasportato facilmente in borse e zaini senza rompersi perché molto flessibile. “T-Surf” rappresenta un modo innovativo di proporre una bevanda classica come il thè di alta qualità senza coloranti né conservanti e gluten free, adatto a chi ama “cavalcare l’onda”.

Con l’obiettivo di soddisfare un consumo di caffè sempre più orientato verso i sistemi monodose, con un’offerta che fosse anche coerente con i valori d’insegna, a fine 2012 Coop ha lanciato sul mercato la linea “Capsule di caffè tostato e macinato Fior Fiore Coop”. Il nuovo prodotto è abbinato a una macchina per caffè espresso dalle caratteristiche distintive, interamente Made in Italy sia per assetto tecnologico sia per il design e l’assemblaggio dei componenti. Sono stati necessari quasi due anni di ricerche, svolte in stretta collaborazione con l’azienda produttrice Co.Ind. soc. coop., per mettere a punto una capsula sostenibile per l’ambiente e, al contempo, compatibile con le esigenze di qualità, sicurezza e convenienza che da sempre caratterizzano il prodotto Coop. Al cuore della soluzione, il sigillo pelabile messo a punto da Co.Ind. soc. coop., e dotato di un’apposita linguetta, in fase di brevetto, che dopo il consumo permette al consumatore di aprire la capsula manualmente e di separare con un gesto semplice i suoi componenti per svuotare il fondo di caffè. Il fondo può, così, essere destinato a raccolta differenziata nei rifiuti organici domestici. Questa soluzione evita dunque lo spreco generato dalle capsule tradizionali che, dopo l’uso, restano piene e vengono dunque conferite alla raccolta indifferenziata: processo che disperde il fondo di caffè, ottimo ammendante agricolo da valorizzare come materia prima seconda.

1

2

24 • 4/14

www.dativoweb.net


Utilizzatore DECO INDUSTRIE SCRL www.decoindustrie.it

DETERGENTI GREEN EMOTION Deco Industrie ha lanciato nel 2013 una linea ecologica basata su ingredienti naturali e flaconi in plastica totalmente riciclata, per dare una risposta al crescente numero di consumatori che ricercano uno stile di vita più salutistico, maggiore benessere personale e una chimica più sicura per l’ambiente. Il suo nome è Green Emotion per comunicare immediatamente l’aspetto green del prodotto facendo anche leva su una componente emozionale. I prodotti di Green Emotion sono concentrati e quindi riducono il consumo di acqua, di efficacia testata anche alle basse temperature, realizzati con materie prime di origine naturale biodegrabili, privi di fosfati, ipoallergenici, nichel e cromo tested e, infine, non sono testati su animali. Ogni variante della linea è profumata con essenze naturali, ciascuna con le sue proprietà benefiche peculiari e coerenti con la destinazione d’uso del prodotto: per lavatrice con essenza di lavanda rilassante, per lana e delicati con essenza di rosa addolcente, ammorbidente con gelsomino rigenerante, per piatti con limone antisettico e per pavimenti con pino e abete decongestionanti. Dunque, tutto il prodotto Green Emotion è “verde”, anche il packaging perché i flaconi sono di PET 100% riciclato post-consumo proveniente dalle campane della raccolta differenziata e l’imballo secondario è in fardello anziché in cartone. Questo sistema di packaging - unico in Italia nella detergenza e brevettato - comporta un minor numero di alberi abbattuti e minor inquinamento da CO2 perché i processi di produzione della plastica e del cartone sono ridotti. I benefici comprendono anche l’ottimizzazione dei trasporti oltre che vari vantaggi sul punto vendita, ovvero minor tempo per caricamento a scaffale, minor costo e tempo per smaltimento cartoni, maggiore visibilità in testata. Per comunicare la filosofia green, la grafica di Green Emotion è stata impostata secondo concetti e colori che evocano messaggi positivi: foglia verde, coccinella e il pay off “Ama la natura”, perchè il rispettare la Natura con le nostre scelte e le nostre azioni dovrebbe emozionarci ogni giorno.

3 www.dativoweb.net


[

OS C AR & O S CA R

]

Produttore GOGLIO SPA www.goglio.it

Produttore ICIMENDUE SRL www.icimen.com

GOGLIO FRES-COOL, IL DESIGN DAL GUSTO FRESCO

INCARTO SPECIALE PER UN MAGNUM SPECIALE

Goglio presenta Fres-cool, il nuovissimo stand-up monodose dal beccuccio 100% flessibile, arricchito da una speciale pellicola protettiva pelabile. Destinato al comparto del beverage, Fres-cool sostituisce il tradizionale bocchello erogatore in plastica rigida, superandone i limiti in materia di ingombro, volume e costo, in un irresistibile pack dalla silhouette elegante e dalle proporzioni equilibrate. Questo traguardo di design si accompagna all’assoluta garanzia di igiene e sicurezza per il consumatore: la speciale pellicola protettiva keep clean, trasparente o stampata a discrezione del cliente, assicura infatti la protezione del beccuccio da qualsiasi agente esterno. Ideale per succhi, concentrati di frutta, yogurt da bere, the, bevande energetiche, acqua, topping per dolci, creme e panne da cucina, Fres-cool è il packaging perfetto per le merende dei più piccoli, per gli allenamenti degli sportivi e per i pranzi fuori casa. Al cinema come a teatro, in occasione di concerti o eventi sportivi, il nuovo stand-up Goglio è leggero e discreto, resistente, sicuro (grazie all’assenza di bordi taglienti) e pratico: “pela” la pellicola, apri il beccuccio seguendo l’apposito invito allo strappo e gusta senza pensieri tutta la freschezza del tuo drink preferito! Completa il Fres-cool un’eccezionale superficie personalizzabile con i più svariati effetti di stampa ad alta risoluzione: la sovrapposizione della pellicola al corpo dello stand-up permetterà al cliente di dare libero sfogo alla fantasia realizzando innovative stampe sovrapposte, per un pack dal design irresistibile sul lineare di vendita.

Per l’edizione limitata del Magnum Marc de Champagne, voluto da Unilever per festeggiare le “nozze d’argento” del suo premium brand, lo storico converter di imballaggi flessibili Icimendue ha realizzato un incarto originale, che mette in gioco la sua consolidata esperienza in stampa rotocalco e metallizzazione di film plastici. Il gelato, ricoperto di cioccolato al latte e glassa argentata, prodotto e pensato per celebrare il 25° anniversario, aveva la necessità di esser vestito e valorizzato da un incarto particolarmente attraente e unico nel suo genere. Per rimanere in tema col progetto, basato sui concetti di silver e champagne, si è pensato a un materiale olografico con effetto di bollicine. Grazie a un forte impegno del team di ricerca e al coordinamento di più competenze, è stato così realizzato un flowpack olografato e metallizzato, decorato con un originale disegno ripetitivo che richiama le bollicine dello Champagne. Non solo: gli esperti di Icimendue sono riusciti a ottenere caratteristiche tecniche equivalenti a quelle che il cliente ha messo in campo per i suoi gelati con i gusti standard e a mantenere inalterati gli standard produttivi di confezionamento. La distribuzione del Magnum Marc de Champagne sarà effettuata in tutta Europa. L’incarto è costituito da un laminato con saldante a freddo che impiega solo polipropilene ed è ottenuto con un film OPP coestruso, accoppiato a un film speciale ologrammato con effetto tridimensionale. Icimendue ne ha curato la realizzazione sia per la fase di metallizzazione sia per quella di stampa, quest’ultima effettuata con processo di accoppiamento e spalmatura del saldante a freddo, in linea su una rotocalco a undici elementi.

4

5

26 • 4/14

www.dativoweb.net


hicadv.it

Una goccia di purezza

Riempimento senza conservanti anche per i multidose Il futuro delle preparazioni oftalmiche è senza conservanti. Un traguardo che Lameplast Group oggi ha raggiunto anche nel settore dei multidose, grazie ai servizi di produzione, riempimento e confezionamento di soluzioni ad uso oculare nel contenitore OSD (Ophthalmic Squeeze Dispenser) di Aptar Pharma: il rivoluzionario flacone multidose per prodotti oftalmici senza conservanti che consente l’utilizzo del prodotto fino all’ultima goccia. Un’alternativa per chi vuole guardare lontano.

AFI - RIMINI (stand 108) 11 - 13 GIUGNO 2014

www.lameplastgroup.com


[

OS C AR & O S CA R

]

Utilizzatore ILLYCAFFÈ SPA www.illy.com

Produttore NEWBOX SPA www.new-box.com

REFILLY DA 200 GRAMMI

TWIST CAN: RICHIUDIBILE, SPACE SAVER ED ECOLOGICO

Refilly è la nuova ricarica di caffè da 200 grammi, per il barattolo di latta illy da 250 g. Rappresenta una vera innovazione nel mercato del caffè macinato, poiché è la prima e unica confezione di poliaccoppiato polipropilenealluminio a 5 strati dotata di pressurizzazione. Due brevetti proprietari garantiscono la qualità del prodotto in quanto, proprio grazie alla pressurizzazione, tutte le caratteristiche migliori del caffè non fuoriescono dalla confezione. Refilly è frutto della collaborazione fra illycaffè, che ha concepito l’idea e creato il concept, Huhtamaki, che ha dato il suo contributo alla realizzazione della tecnologia dell’imballo, e Optima che ha prodotto la linea di confezionamento FFS.

New Box SpA presenta la lattina in tre pezzi “twist can’’ (modello depositato) da 75 cl, atta a contenere qualsiasi tipo di bevanda, piatta o in pressione. Si tratta di un contenitore monocomponente, realizzato al 100% d’acciaio, progettato per essere sicuro e igienico e dotato di una nuova cupola d’acciaio richiudibile (per vuoto e/o pressione). Non solo: la nuova lattina è “space-saver” grazie alla forma cuboidale, appositamente studiata per ottimizzare gli spazi in fase di trasporto e di esposizione a scaffale. Particolarmente rilevanti anche i plus di ordine ambientale: l’utilizzo di un solo tipo di materiale agevola le attività di riciclo; inoltre, grazie a un’assidua attività di ricerca mirata a ridurre gli spessori, New Box ha diminuito del 15% l’impiego di materia prima, generando rilevanti economie. L’altro fattore di rilievo sul piano della compatibilità è l’elevata percentuale di materiale riciclato: la lattina è formata per il 56% da materia prima seconda. New Box SpA si è dotata di un Sistema di Gestione Ambientale ed Energetico con certificazioni UNI EN ISO 14001 e 50001.

6

7

Produttore NOVACART SPA www.novacart.com

FORMA DI COTTURA POLIGONALE “GARDENIA” Il contenitore aperto assume la forma del fiore di gardenia e questo, dunque, è il nome della forma di cottura proposta da Novacart. Si tratta di un contenitore in carta microonda alimentare, adatto alla cottura in forno, caratterizzato dalla forma poligonale e prodotto in diverse dimensioni. La struttura è rifinita da un bordo ripiegato lungo tutto il perimetro superiore, che garantisce un’ottima tenuta alla lievitazione dei prodotti da forno. Questo particolare tipo di bordo, inoltre, assicura una serie di altri vantaggi: permette di chiudere la forma senza alcuna necessità di colla e ne agevola l’apertura nel momento in cui si deve tagliare il dolce contenuto. Tirando il lembo del bordo superiore e aprendo tutti i settori, Gardenia si trasforma infine in un vassoio che raccoglie le eventuali briciole di taglio. Non solo: la divisione poligonale imprime sul dolce contenuto un tracciato utile a eseguire i tagli delle porzioni con divisioni regolari. Grazie a tutte queste caratteristiche, dunque, Gardenia è un contenitore eco-compatibile e sano, con un’ottima tenuta degli impasti soggetti a lievitazione e particolarmente facile da aprire, e con un elevato contenuto di servizio. La possibilità di stampare a piacimento la parte esterna permettono la sua personalizzazione.

8 28 • 4/14

www.dativoweb.net


Produttore O-I MANUFACTORING ITALY SPA www.o-i.com

HELIX: INASPETTATO TWIST DI SUGHERO E VETRO Helix (www.helixconcept.com) è l’innovativa soluzione di packaging progettata da Amorim e O-I per i vini di fascia medio-alta. È il risultato di una partnership nata 4 anni fa tra i due grandi produttori, rispettivamente di sughero e di bottiglie in vetro, con l’obiettivo di rispondere alla crescente domanda di prodotti sostenibili e, al contempo, di garantire al consumatore qualità e comodità d’uso: Helix consente di aprire e richiudere la bottiglia più volte e con semplicità, utilizzando un’unica soluzione combinata sughero/vetro. Il nuovo “concept twist to open” associa un tappo in sughero dal design ergonomico a una bottiglia di vetro con una filettatura interna posizionata nel collo, creando un packaging sofisticato e dalle performance elevate. Helix somma, dunque, tutti i benefici del sughero e del vetro - qualità, sostenibilità e quell’immagine premium che le aziende vinicole veicolano tramite il packaging - alla praticità dell’apertura richiudibile. Inoltre, può essere velocemente e facilmente implementato dalle aziende vinicole, con adeguamenti minimi delle linee di imbottigliamento esistenti. Questo nuovo concetto crea, dunque, un prodotto moderno, riciclabile al 100%, che esalta l’esperienza sensoriale del vino. Come verificato durante i numerosi test condotti in Amorim e O-I, il prodotto conservato con il sistema Helix non subisce alterazioni di gusto, aroma o colore. Inoltre, secondo le indagini di mercato condotte in Francia, UK, USA e Cina, la sua adozione per il confezionamento di vini qualità ha riscontrato un alto grado di consenso. Molto apprezzato dai consumatori anche il classico “pop”, tipico suono festoso, associato alla stappatura della bottiglia di vino.

9 www.dativoweb.net


[

OS C AR & O S CA R

]

Produttore P.E.T. ENGINEERING SRL www.petengineering.com

Produttore SCATOLIFICIO CRISTINA SRL www.cristina.it

VITASNELLA, ESPRESSIONE DI BENESSERE

TRAVEL PACK CAMPARI APEROL SPRITZ

Acqua Vitasnella si presentava sul mercato con un packaging che, seppur profondamente radicato nell’immaginario dei consumatori italiani, era disallineato rispetto all’advertising dinamico, moderno e dal tocco glamour degli ultimi anni. Pur godendo di grande notorietà, Ferrarelle ha deciso di attualizzare l’immagine di Vitasnella tramite un restyling che non solo permettesse di veicolare, attraverso codici estetici e iconografici più attuali, la promessa di marca, ma che migliorasse anche le performance e l’ergonomia del packaging, rendendolo coerente con la qualità percepita dai consumatori. Il restyling fa leva sul benefit della promessa di marca, ossia il sentirsi leggeri e in forma, che è stato tradotto in un contenitore dalla forma affusolata e armonica, ottenuta grazie a un riproporzionamento delle parti superiore e inferiore della bottiglia. La leggerezza è stata resa visivamente, eliminando il complesso apparato decorativo della versione precedente e inserendo un motivo grafico che, partendo dalla spalla e scorrendo sinuosamente lungo il corpo, simboleggia l’ingresso dell’acqua nell’organismo e l’eliminazione dei liquidi e delle tossine in eccesso. Il motivo grafico funge non solo da significante ma anche da elemento strutturale che, rinforzando la zona presa studiata secondo criteri ergonomici e antropometrici, rende il packaging “l’attrezzo” perfetto per un esercizio fisico uguale per tutti: bere acqua Vitasnella.

Scatolificio Cristina - The Transparent Packaging produce da 45 anni packaging trasparenti in PET, PET-R e PP. Per il cliente Campari, l’azienda ha ideato un travel pack con una caratteristica peculiare: l’ottimizzazione dei volumi e costi di trasporto dalla sede di produzione allo stabilimento di confezionamento. Il travel pack Campari Aperol Spritz nasce dall’esigenza di creare un pack innovativo, in cui il brand abbia grande risalto e forte impatto visivo, capace di differenziarsi da quelli dei competitor e con una forte attrattività rispetto al target di riferimento. Il packaging in questione viene utilizzato nei Duty Free, il che ha sollevato molteplici problematiche legate alla location di destinazione: la forte concorrenzialità di altri prodotti, la necessità di creare un imballaggio in grado di proteggere il contenuto durante il viaggio in aereo, l’imprescindibile comodità di trasporto per il cliente. È nato così un pack cilindrico con base ovale, in grado di contenere due bottiglie di altezza differente e interscambiabili tra loro, che viene però consegnato al cliente sotto forma di fascia stesa incollata e stampata. Destrutturando il classico contenitore cilindrico, Scatolificio Cristina ha abbattuto notevolmente le emissioni di CO2 legate al trasporto su 4 ruote, ottimizzando al contempo la palettizzazione dei vari componenti e ha permesso al cliente di confezionare il prodotto just in time, riducendo così sensibilmente lo spazio occupato dal packaging in magazzino.

10

11

30 • 4/14

www.dativoweb.net


REDESIGNING THE FUTURE WITH RENEWABLE PACKAGING Ottimizzate le Vostre confezioni e aumentate il valore dei Vostri marchi con imballaggi riciclabili e rinnovabili. Siamo il Vostro partner responsabile con un’ampia offerta di avanzati materiali e soluzioni per imballaggio di origine naturale. Ripensiamo insieme alle Vostre esigenze d’imballaggio. Stora Enso partecipa all’iniziativa Save Food. Venite a incontrarci a Interpack – stand 9B20, Düsseldorf dall’8 al 14 Maggio 2014. renewablepackaging.storaenso.com


[

OS C AR & O S CA R

]

Produttore SEALED AIR SRL CRYOVAC FOOD PACKAGING SOLUTIONS www.sealedair-emea.com

Produttore SMURFIT KAPPA ITALIA SPA www.smurfitkappa.it

CRYOVAC® DARFRESH® FLEX FLEX+

PROGETTO GOLFING

Packaging di nuova concezione, il sistema Cryovac® Darfresh® Flex Flex+ di Sealed Air garantisce innegabili vantaggi al comparto “proteine”. Leggero e sostenibile, dà risposte alla domanda emergente di confezioni porzionate, è di facile utilizzo e risponde all’esigenza di praticità e riduzione degli scarti alimentari. Facilita inoltre l’utilizzo di una porzione singola senza dover aprire quelle restanti, che possono essere quindi riposte nel frigo o nel congelatore. Evoluzione del sistema di confezionamento Darfresh® nel settore case ready, la soluzione Darfresh® Flex Flex+ permette di ottenere elevata efficienza operativa, qualità ottimale e conservabilità prolungata. L’ampia gamma di film inferiori e superiori con proprietà barriera garantisce confezioni integre per una maggiore sicurezza alimentare. Con un sorprendente effetto “seconda pelle” Darfresh® Flex Flex+ rispetta i contorni del prodotto e si presta all’esposizione verticale e di forte impatto. La differenziazione a scaffale è inoltre garantita da numerose opzioni di stampa. Le confezioni mono porzione e multipack con apertura facilitata sono ermetiche e mantengono inalterate le caratteristiche organolettiche e le proprietà nutritive dei prodotti anche durante il trasporto e il magazzinaggio. In relazione alle carni, il processo di frollatura continua nella confezione, migliorandone la tenerezza. Il processo sottovuoto, insieme all’impiego di film ermetici multistrato e con elevate proprietà barriera garantiscono una conservabilità prolungata durante il ciclo di distribuzione e fanno sì che i prodotti giungano al consumatore finale in perfetto stato, a prescindere dalla distanza tra l’impianto di produzione e il punto vendita. Oltre che per le innovazioni tecniche, questo imballaggio è prezioso per la sua sostenibilità, grazie a: - riduzione alla fonte delle risorse impiegate e dei fattori inquinanti (strutture molto sottili, riduzione del peso del packaging; dimensioni ridotte al minimo, con un migliore utilizzo dello spazio e meno emissioni nocive dovute al trasporto e al mantenimento della catena del freddo); - riduzione degli scarti dovuta alla prolungata conservazione del contenuto (diminuzione degli sprechi di cibo) e al contenimento del packaging (minore impatto sul ciclo di vita del prodotto).

Dando vita al progetto Golfing, Smurfit Kappa e Unilever hanno sviluppato una soluzione di confezionamento RRP (Retail Ready Packaging) che ha permesso di risparmiare materie prime, tempi e costi di gestione, migliorando al contempo funzionalità e design. Il problema da affrontare si presentava in questi termini: per imballare le pouches di detersivo Svelto venivano utilizzate delle scatole che, una volta consegnate al terzista, venivano eliminate per riposizionare le pouches su un display manuale. In base allo studio condotto dalle due società, è stata adottata una soluzione alternativa, del tipo Retail Ready Packaging, che ha permesso di eliminare la lavorazione manuale del re-pack, riducendo tempi, costi e materie prime utilizzate. Grazie a questa soluzione, il prodotto arriva dallo stabilimento Unilever direttamente al retailer, semplificando la gestione e generando economie lungo l’intera catena logistica. Il nuovo sistema di confezionamento, inoltre, presenta una migliore funzionalità grazie alle speciali maniglie che agevolano la presa del pack trasformandolo facilmente in unità di vendita. Perforazioni e apertura ottimizzate, insieme a un design più curato, permettono anche di raggiungere la migliore comunicazione del brand resa possibile dallo studio integrato fra prodotto e scatola. Una soluzione amica dell’ambiente, dunque, e vincente su tutti i fronti, che durante la prima campagna promozionale di Svelto ha permesso di risparmiare 152 tonnellate di carta.

12

13

32 • 4/14

www.dativoweb.net


Il sistema Hot Melt che mette la sicurezza al primo posto

INVISIPAC

TM

Il sistema Hot Melt senza serbatoio Graco ti offre il sistema Hot Melt pi첫 sicuro per il mercato del packaging. Combinando un design senza serbatoio e un sistema di caricamento automatico, garantisce la riduzione degli incidenti da ustione in produzione.

Collegati su im1.invisipac.eu e rendi il tuo luogo di lavoro pi첫 sicuro


[ Produttore TETRA PAK ITALIANA SPA www.tetrapak.it

O SCA R & O SCA R

]

Produttore VERALLIA SAINT-GOBAIN VETRI SPA www.verallia.it Utilizzatore GRUPPO CAMPARI SPA www.camparigroup.com/it

TETRA TOP® CON SEPARABLE TOP

VERMOUTH MONDORO

L’imballaggio facilita la raccolta differenziata. Il cartone per alimenti Tetra Top® rende più semplice ed efficace il riciclo separato dei materiali grazie al “separable top”, la calotta superiore di plastica staccabile dalla confezione. Con questa soluzione Tetra Pak® rafforza la propria leadership ambientale nelle soluzioni di confezionamento degli alimenti: il nuovo design del contenitore Tetra Top®, con la parte superiore ora separabile, garantisce un riciclo di qualità. L’innovazione introdotta consente ai consumatori, con un gesto semplicissimo, di separare la calotta superiore di plastica dal corpo di cartone del contenitore, confezione molto diffusa e apprezzata per alimenti liquidi come il latte fresco, la panna e gli yogurt da bere. Grazie a una fustellatura pre-tagliata sullo strato più esterno della confezione, dopo il consumo basta la sola pressione del pollice per staccare il top di plastica dal cartone: con questo gesto si possono quindi già separare in ambito domestico le diverse componenti del packaging, agevolando la raccolta differenziata e il riciclo. La nuova soluzione non comporta costi aggiuntivi né per la filiera produttiva né per il consumatore e mantiene inalterate tutte le caratteristiche di sicurezza alimentare, garantendo massima protezione alle proprietà nutrizionali e organolettiche del prodotto, coniugata a una maggiore praticità e funzionalità dell’imballaggio. Il tutto con l’appeal naturale di una confezione in cartone certificata FSC® (Forest Stewardship Council).

Il mercato dei vermouth, soprattutto nel segmento “bianco”, presenta oggi un packaging con elementi standardizzati: bottiglie consolidate, vetro trasparente, label & cap poco distintivi e preziosi. Per questo Campari ha deciso di consolidare la propria posizione nella categoria lavorando su un’immagine premium e di alta qualità, che sembra oggi essere l’unico elemento rilevante in grado di sostenere la crescita in mercati non ancora maturi e potenzialmente a più alto margine, coinvolgendo un target più evoluto e sensibile, pronto a investire in prodotti di qualità superiore. Mondoro è il brand Campari che, nato nel mondo degli sparkling wines, grazie all’expertise ha mostrato grandi potenzialità. In un’ottica di ampliamento della gamma, il packaging del vermouth Mondoro riprende gli stilemi forti e rappresentativi del brand nel segmento degli sparkling wines. È stato dunque realizzato un packaging unico e distintivo che, grazie alla shape iconica, fonde la tradizione del mondo vermouth (spalle e collo della bottiglia) alla forma sinuosa e dinamica della base (le onde), di forte impatto visivo che caratterizza immediatamente la presenza sullo scaffale. Ma l’elemento di differenziazione forte sta sicuramente nel verde che “veste” le onde alla base della bottiglia: un colore che è nel DNA della marca e che aiuta il prodotto ad acquisire unicità, riconoscibilità e impatto a scaffale rispetto ai competitor della categoria.

14

15

www.dativoweb.net

4/14 • 35


[

OS C AR & O S CA R

]

E NGL I S H

Italian Packaging Oscar 2014 The Quality design of Italian packaging will go on show from 8th to 13th April in Milan. Among the fringe events in the Brera Design District this year, there will in fact be a space set up at the Mediateca Santa Teresa (via della Moscova 28), dedicated to the 15 finalists of the contest organized by the Istituto Italiano Imballaggio. The awards ceremony will be on April 9th. A number of actors have staked much on the traditional annual competition, that aims at clarifying how the proposed packaging solutions on the one hand respond to the consumers’ need for service and information, but also to that of the visibility, recognisability and communication demanded by the brands: packaging producers first and foremost, and obviously the Istituto Italiano Imballaggio, that has worked in close cooperation with the Milan Polytechnic Design School and enjoys the sponsorship of Altroconsumo, and then there is Conai (Consorzio Nazionale Imballaggi) as well as Ipack-Ima 2015. And lastly Studiolabo, curators of the installation as part of Visionica.

competitors will by the design quality of packaging, or that is the balance and harmony between the communicative, structural and functional dimensions of the proposals. With a special attention for the receiver/user, hence the innovations in the graphic language and the use of communicative elements designed to express the brand and product identity will be judged, along with correlated values (communication serving environmental sustainability). Equal consideration will also be given to the aspects of accessibility and the inclusiveness of the packaging: the innovations that facilitate access to and use of the product, this through a clear and attentive communicative-structural articulation and a care for the quality of the information expressed, also within the prospect of a “design for all” extended user base. Hence once again the Packaging Oscar freeze frames the evolution of research regarding packaging and the solutions to the problems of transport, protection, safety, but also facility of use and handling by the professional user or final consumer. The winners will be proclaimed April 9th at 4pm, during a packaging design lesson held by Valeria Bucchetti, associate professor of the Design Department of the Milan Polytechnic. Q Note: the material published has been elaborated on the basis of the communiqués provided by the Istituto

Who will win and why. This year hence the lead thread for the evaluation of the

Italiano Imballaggio.

1. User Acqua Minerale San Benedetto SpA www.sanbenedetto.it

consumption allows the consumer to open the capsule manually and easily separate its components and empty out the coffee dregs. In this way the dregs can be recycled and placed with the household’s organic waste. This solution avoids the wastage that occurs with traditional capsules which, after being used, remain full and are therefore thrown away with non-recyclable waste: this process gets rid of the coffee dregs, a great soil improver which can be reused as a secondary material.

RIDE THE WAVE WITH “T-SURF” Thè San Benedetto, Italian families’ most loved ready-to-drink tea, has added further innovations to the sector with a new and exclusive format. The company is known for always providing consumers with what they really want and responding to the needs of a market that is in constant evolution; San Benedetto is adding an extra dash of vitality to its range of teas through “T-Surf”: a pack that is unique, totally inspired by the sea, the waves, the colors and the cool sensation of a summer trail that lasts all year round. Available in a 20cl format its useful handle makes it practical, easy to use, smart and fun, with the guaranteed and unmistakable flavour of San Benedetto. The Venetian company is always on the same wavelength as its young consumers and the new generations: it knows how to indulge their tastes and encourage their love of play and imagination with highly attractive initiatives. And it is their desire to encourage young people to consume a healthy and high quality drink that led them to surprise us with “T-Surf”. This new product, with added fructose, comes in two flavours - Peach and Lemon - and was created in order to have a refreshing and thirst quenching Thè San Benedetto drink always at hand that could be enjoyed in a more unusual and fun way at any time of the day: just tear off the corner of the pack and insert the straw provided… that’s all it takes! The pack’s colourful and attractive design

36 • 4/14

feels fresh even to the touch and stands out because it is light and practical: it can easily be carried in bags or backpacks without breaking as it is very flexible. “T-Surf” is an innovative way of offering a good quality, traditional drink such as tea, free of colourings or preservatives and gluten free, and just right for those who love to “ride the wave”. 2. User Coop Italia Soc. Coop www.e-coop.it In collaboration with Co. Ind Sc www.coind.it

3. User Deco Industrie Scrl www.decoindustrie.it

COFFEE: SUSTAINABLE CAPSULES

GREEN EMOTION DETERGENTS

With the aim of satisfying the rise in coffee consumers using monodose systems while still remaining loyal to its brand’s values, at the end of 2012 Coop launched its “Fior Fiore Coop roasted and ground coffee capsules” line. The espresso coffee machine which is being launched with the new product has a number of distinguishing characteristics and is entirely Made In Italy - including its design, technological features and the actual assembly of its components. It took nearly two years of research, in close collaboration with manufacturers Co.Ind. Soc. Coop., to create a capsule which was environmentally sustainable and, at the same time, compatible with the standards of quality, safety and good value which have always defined Coop products. At the heart of the solution lies the peelable seal created by Co.Ind. Sc complete with a special tab, patent pending, which, after

In 2013 Deco Industrie launched an eco-friendly line using natural ingredients and fully recycled plastic bottles in answer to the growing number of consumers looking for a healthier lifestyle, greater personal well-being and more environmentally friendly chemical solutions. It was named Green Emotion in order to immediately convey the green aspect of the product whilst also hitting an emotional button. Green Emotion products are concentrated and so use less water, tested for their effectiveness at low temperatures, produced with natural biodegradable raw materials, phosphate free, hypoallergenic, nickel and chrome allergy tested and, lastly, not tested on animals. Each one of the products in this line is scented using natural essences, each one with specific beneficial properties which are consistent with what the product is used for: relaxing lavender essence for

washing machines, softening rose essence for wool and delicates, reinvigorating Jasmine essence for fabric softeners, lemon based antiseptic for dishes and a pine and spruce decongestant for floors. So, the entire Green Emotion line is eco-friendly, including the packaging because the bottles are made of 100% recycled PET, sourced from recycling banks and the secondary packaging uses bundles instead of cardboard. This packaging system - the only one in Italy in the detergent sector and already patented - means fewer trees need to be cut down and that there is less CO2 pollution because of a reduction in the plastic and cardboard production processes. Benefits include transport optimisation as well as several advantages at the retails outlets, such as less time filling shelves, lower costs and less time lost disposing of the cartons and greater visibility at the front. In order to convey its Green philosophy, the Green Emotion graphics are based around concepts and colors that evoke positive messages: green leaf, ladybird and the “Love nature” pay off, because respecting Nature thanks to the choices and actions we take should trigger emotions every day. 4. Manufacturer Goglio SpA www.goglio.it

GOGLIO FRES-COOL, TASTEFULLY COOL DESIGN

Goglio has launched Fres-cool, the brand-new stand-up monodose pouch with a fully flexible spout, enhanced by a special protective peelable film. Aimed at

www.dativoweb.net


[ the beverage sector Fres-cool replaces traditional dispensing nozzles in rigid plastic, with improvements in terms of size, volume and cost thanks in an irresistible pack with elegant silhouette and wellproportioned shape. Its innovative design has been developed with the highest level of consumer hygiene and safety in mind: the special “keep clean” protective film, which can be clear or bear a design if required by the customer, guarantees that the spout is protected from all external agents. Ideal for juices, fruit concentrates, yoghurt drinks, tea, energy drinks, water, dessert toppings, creams and whipping creams, Fres-cool is the ideal packaging for kids’ snacks, sports enthusiasts and outdoor lunches. At the cinema, theatre, concert or sports event the new Goglio stand-up pouch is light and discrete, sturdy, safe (there are no sharp edges) and practical: peel back the film, open the spout where shown and enjoy your favourite cool drink without giving it another thought! Fres-cool’s packaging is an excellent way to display customised and high-resolution graphics: by overlaying the film on the actual stand-up pouch customers can give free rein to their imagination and create innovative overlaid designs, creating an irresistible and highly marketable product. 5. Manufacturer Icimendue Srl www.icimen.com

SPECIAL WRAPPER FOR A SPECIAL MAGNUM In honour of the limited edition Marc de Champagne Magnum, conceived by Unilever to celebrate the “silver” wedding anniversary of its premium brand, Icimendue, the historical flexible packaging converter, has developed an original wrapper which showcases its consolidated experience in the fields of rotogravure and plastic film metallizing. The ice-cream, coat ed in milk chocolate and a silver glaze, was produced and conceived to mark its 25th anniversary and needed to be dressed and embellished by an especially attractive and unique wrapper. Consistently with the theme of the project, based on the concepts of silver and champagne, the idea was to use holographic materials and a bubbly effect. A holographic and metallic flowpack, decorated with an originally repetitive design reminiscent of Champagne bubbles, was created thanks to the full commitment of the research team and a skilled and coordinated taskforce. Not

www.dativoweb.net

O SCA R & O SCA R

]

only: Icimendue experts managed to match the technical characteristics that the customer uses for its standard flavoured ice-creams and maintain the same packaging production standards. The Marc de Champagne Magnum will be distributed throughout Europe. The wrapper consists of a cold seal laminate which uses only polypropylene and is obtained using a co-extruded OPP film, combined with a special hologram film with 3-D effect. Icimendue was responsible for implementing both the metallization and printing phases, with the latter being achieved using binding and spreading of the cold seal, in line on an eleven element gravure press. 6. User Illycaffè SpA www.illy.com

ILLYCAFFÈ: 200 GRAM REFILLY Refilly is illy’s new 200 gram coffee refill for its 250 gram tins. It features as a true innovation in the ground coffee market, because it is the first and only pressurised 5 layer polypropylene-aluminium polylaminate pack. Two proprietary patents guarantee the quality of the product inasmuch as, thanks to the pressurisation, all the best characteristics of the coffee remain inside the pack. Refilly is the result of the cooperation between illycaffè, that created the idea and the concept, Huhtamaki, that contributed to creating the packaging technology, and Optima, that produced the FFS packaging line. 7. Manufacturer Newbox Spa www.new-box.com

TWIST CAN: RECLOSABLE, SPACE SAVING AND ECOLOGICAL

New Box SpA presents the three piece patented 75 cl “twist can”, that can contain any type of beverage, flat or carbonated. It is a single component container, made 100% in steel, designed to be safe and hygienic and fitted with a new reclosable steel top (for vacuum and/or carbonated). Not only that: the new can is “space-saver” thanks to the cubical shape, especially studied to optimize space in the transport phase and when displayed on the shelf. Particularly significant too the environmental pluspoints: the use of a single type of material facilitates recycling; as well as that, thanks an assiduous research aimed at downgauging, New Box has reduced the use of raw materials by

4/14 • 37


[

OS C AR & O S CA R

]

E NGL I S H

15%, generating considerable savings. The other key factor on the level of compatibility is the high percentage of recycled material: the can is made up 56% of recycled raw material. New Box SpA has a certified UNI EN ISO 14001 and 50001 grade Energy and Environment Management System. 8. Manufacturer Novacart SpA www.novacart.com

“GARDENIA” POLYGONAL BAKING MOULD

The open container takes on the shape of a gardenia and thus this is the name of the baking mould offered by Novacart, a container in microwave food paper, suitable for baking in the oven, polygonal in shape that comes in various sizes. The structure is finished with a folded edge along the entire upper perimeter, that guarantees excellent raising resistance for bakery products. This particular type of edge, what is more, ensures a series of other advantages: it enables the mould to be closed without requiring glue and facilitates the opening in the moments in which the product contained has to be cut. Indeed pulling the corner of the upper edge and opening all the sectors, Gardenia lastly turns into a tray that gathers any crumbs from cutting. Not only that: the polygonal division gives the product contained a trace that helps cut equal portions. Hence, thanks to all these features, Gardenia is a health friendly, eco-compatible container, with an excellent resistance to raising mixes and particularly easy to open, and with a high service content. The broad possibilities of printing the outer part enable extensive personalisation. 9. Manufacturer O-I Manufacturing Italy Spa www.o-i.com

HELIX: UNEXPECTED TWIST OF CORK AND GLASS

Helix (www.helixconcept.com) is an innovatory packaging solution designed by Amorim and O-I for the medium-high range of wines. It is the result of a partnership that came into being 4 years back between two big manufacturers, respectively of corks and glass bottles, with the objective of responding to the growing demand for sustainable products and, at the same time, to guarantee the consumer quality and convenience of use: Helix enables the bottle to be simply

38 • 4/14

opened and closed several times, using a single combined solution of cork/glass. The new “concept twist to open” associates the ergonomically designed cork stopper to a glass bottle with an inner thread in the neck, creating a sophisticated, high performance packaging. Hence Helix associates all the benefits of cork and glass - quality, sustainability and that premium image that the winemaking concerns transmit via packaging - with the practicality of a reclosable opening. As well as that, it can be speedily and easily implemented by the wineries, with minimum adjustments to the existing bottling lines. This new concept hence creates a modern product, 100% recyclable, that exalts the sensorial experience of wine. As verified during the numerous tests carried out by Amorim and O-I, the product preserved with the Helix system does not suffer alterations of flavour, aroma or color. As well as that, according to market studies carried out in France, UK, USA and China, its use for packaging quality wines has experienced considerable success. Much appreciated also by consumers its classic “pop”, the typically festive sound associated with the uncorking of wines bottles. 10. Manufacturer P.E.T. Engineering Srl www.petengineering.com

VITASNELLA, EXPRESSION OF WELLBEING

Acqua Vitasnella presented itself on the market with a packaging that, even if deeply rooted in the imagination of Italian consumers, was out of line with its dynamic, modern advertising with a touch of glamour of these last years. While enjoying great notoriety, Ferrarelle has decided to revamp the image of Vitasnella with a restyling that not only enables the transmission, via the most up-to-date aesthetic and iconographic codes, of the brand promise, but that also improves the performance and the ergonomy of the packaging, making it coherent with the quality perceived by the consumers. The restyling levers on the benefits of the brand promise, or that feeling light and shapely, that has been translated into the streamlined and harmonic shape, obtained thanks to the reproportioning of the upper and lower parts of the bottle. The lightness has been rendered visually, eliminating the complex decorative apparatus of the preceding version and inserting a graphic motif that, starting from

the shoulder and running sinuously along the body, symbolises the water entering into the organism and the elimination of excess liquids and toxins. The graphic motif not only acts as signifier but also as a structural element that, reinforcing the gripping area studied according the ergonomic and anthropometric criteria, turning the packaging into the perfect “tool” for a physical exercise that can be done by everyone: drink Vitasnella water. 11. Manufacturer Scatolificio Cristina Srl www.cristina.it

TRAVEL PACK CAMPARI APEROL SPRITZ Scatolificio Cristina - The Transparent Packaging has been producing transparent packaging in PET, PET-R and PP for 45 years. For its customer Campari, the company has created a travel pack with a peculiar feature: the optimisation of transport volumes and costs from the manufacturing site to the packaging works. The Campari Aperol Spritz travel pack has been created to satisfy the need for an innovatory pack, in which the brand is highlighted and has a strong visual impact, capable of standing out from its competitors and strongly appealing to the main target group. The packaging in question is used in the Duty Free, which has raised many problems associated with the location of destination: the strong competition from other products, the need to create a packaging capable of protecting the contents during the air trip, the essential convenience of transport for the customer. Hence a cylindrical pack with an oval base was created, capable of containing two bottles of different heights and interchangeable, that though is handed to the customer in the form of a glued and printed flat strip. Destructuring the classic cylindrical container, Scatolificio Cristina has considerably reduced CO2 emission associated with road transport, at the same time optimising the palletisation of the various components and has enabled the customer to pack the product ‘just in time’, thus considerably reducing the space taken up by the packaging in storage. 12. Manufacturer Sealed Air Srl Cryovac Food Packaging Solutions www.sealedair-emea.com

CRYOVAC® DARFRESH® FLEX FLEX+ Sealed Air’s new packaging system Cryovac® Darfresh® Flex Flex+ brings undeniable advantages to the “protein” sector. Light and sustainable it satisfies the increasing demand for portioned packages; it is easy to use and fulfils the need for practicality and for cutting food wastage. It also makes it easier to use an individual portion without opening the ones that are left, which can then be placed back in the fridge or freezer. The Darfresh® Flex Flex+ solution has evolved from the case ready sector Darfresh® packaging system and offers high operational efficiency, excellent quality and a longer life. The wide range of top and bottom barrier films guarantees that packages remain intact and provides higher food safety levels. The surprising “second skin” effect of Darfresh® Flex Flex+ follows the contours of the product and is ideal for vertical and high impact displays. On-shelf differentiation is also guaranteed thanks to several printing options. Single portion and multipack packages have an easy-to-use opening, are airtight and preserve the colour and flavour of products even during transportation and storing. As far as meat is concerned the aging process continues in its packaging, making it more tender. The vacuum packing process, together with the multilayered hermetic films which provide a thick barrier, ensures that food lasts longer during the distribution cycle and that the products reach the end consumer in perfect condition, irrespective of the distance between the production plant and the retail outlet. As well as for its technical innovations this packaging is valuable for its sustainability, thanks to: - a reduction at source of the resources deployed and of pollutants (very thin structures, lighter packaging, size kept to a minimum and space is used more effectively resulting in fewer harmful emissions being released during transportation and management of the cold chain); - less waste as content is preserved longer (less food is wasted) and reduced packaging (lower impact on the product’s life cycle). 13. Manufacturer Smurfit Kappa Italia SpA www.smurfitkappa.it

GOLFING PROJECT Creating the Golfing project, Smurfit Kappa and Unilever have developed a

www.dativoweb.net


ENGLIS H

RRP (Retail Ready Packaging) that has enabled saving on raw materials, time and management costs, at the same improving functionality and design. The problem to be faced was presented in these terms: the Svelto detergent pouches were packed in boxes, that were eliminated on delivery to the subcontractor, the pouches being repositioned on a manual display case. On the basis of the study carried out by the two companies, an alternative RRP solution was adopted, that has enabled the elimination of the manual working of the re-pack, reducing times, costs and raw materials used. Thanks to this situation, the product reaches the retailer directly from the Unilever facilities, simplifying management and generating economies along the entire logistics chain. The new packaging system, what is more, presented a better functioning thanks to the special handle that facilities the picking-up of the pack, easily turning it into a sales unit. Optimised perforations and openings, along with a more painstaking design, has also enabled the attainment of better brand communication thanks to an integrated study between product and box. An environmentally friendly solution, hence, and successful on all fronts, that

during the first Svelto promo campaign helped save 152 tons of paper. 14. Manufacturer Tetra Pak Italiana SpA www.tetrapak.it

TETRA TOP® WITH SEPARABLE TOP The packaging helps segregated waste collection. Tetra Top® food board makes separate recycling of materials easier thanks to the the pack’s separable plastic top. With this solution Tetra Pak® reinforces its environmental leadership in food packaging solutions: the new design of the Tetra Top® container, with the upper part now separable, guarantees quality recycling. With only a simple gesture, the innovation introduced enables the consumer to separate the plastic upper part from the cardboard body of the container, a pack very common and appreciated for liquid foods such as fresh milk, cream and yoghurt drinks. Thanks to a pre-cut die on the external layer of the pack, after consumption the plastic top can be separated from the board with a mere press of the thumb:

with this gesture in fact one can hence separate the different parts of the packaging in the home, thus facilitating segregated waste collection and recycling. The new solution does not entail any additional costs either for the production chain or for the consumer and keeps all the food safety features unaltered, guaranteeing max. protection of the nutritional and organoleptic properties of the product, combined with a more practical and functional packaging. All this with the natural appeal of and FSC® (Forest Stewardship Council) certified carton. 15. Manufacturer Verallia Saint-Gobain Vetri SpA www.verallia.it User Gruppo Campari Spa www.camparigroup.com/it

VERMOUTH MONDORO The vermouth market, aboveall the “white” segment, today presents a packaging with standardised elements: consolidated bottles, transparent glass, though with

[

O SCA R & O SCA R

]

label & cap with standardized decorations. This is why Campari has decided to consolidate its position in the category, working on a premium and high quality image, that seems today to be the sole element capable of sustaining growth in markets still not mature, and where margins show growth potential, involving a more evolved and sensitive target, ready to invest in superior quality products. Mondoro is the Campari brand that, created in the world of sparkling wines, thanks to its expertise has shown great potential. With a view to extending the range, Mondoro’s vermouth packaging echoes the strong and representative style of the sparkling wine segment. Hence a unique, distinctive packaging has been created that, thanks to its iconic shape, merges the tradition on the world of vermouth (bottle shoulder and neck) to the sinuous shapes and dynamics of the base (the waves), giving a strong visual impact that immediately features in shelf presence. But what really makes it stand out is the green “cladding” of the waves: a colour that is in the DNA of the brand and that helps the product in appearing unique, recognisable, giving it the edge in shelf impact on its competitors in the category.

L’IMBALLAGGIO PRENDE VITA A INTERPACK Vi aspettiamo allo stand D21, padiglione 10 www.rpc-group.com 52521 RPC Italia Imballaggio_April.indd 1

www.dativoweb.net

@rpc_group 20/03/2014 17:08

4/14 • 39


[

OS C AR & O S CA R

]

CONCORR E NT I OS CAR 2014

1. Utilizzatore Acqua minerale San Benedetto SpA Viale Kennedy 65 30037 Scorzè (VE) Tel. +39 041 5859500 www.sanbenedetto.it

2. Utilizzatore Coop Italia Soc. Coop Via del Lavoro 6/8 40033 Casalecchio di Reno (BO) Tel +39 051 596111 www.e-coop.it In collaborazione con Co. Ind Sc Via Saliceto 22H 40013 Castelmaggiore (BO) Tel +39 051 6328511 coind@coind.it www.coind.it

4. Produttore Goglio SpA Sede centrale e Divisione Imballaggi Via dell’Industria 7 21020 Daverio (VA) Tel +39 0332 940111 www.goglio.it info@goglio.it

5. Produttore Icimendue Srl Via R. Piaggio Zona industriale Asi Sud Marcianise 81025 Marcianise (CE) Tel +39 0823 821293 www.icimen.com

6. Utilizzatore Illycaffè SpA Via Flavia 110 34147 Trieste Tel +39 040 3890111 www.illy.com 3. Utilizzatore Deco Industrie Scpa Via Caduti del lavoro 2 48012 Bagnacavallo (RA) Tel. +39 054 5935511 mail@decoindustrie.it www.decoindustrie.it 7. Produttore Newbox SpA Via Industriale 11 36043 Camisano Vicentino, (VI) Tel. +39 0444 419500 info@new-box.com www.new-box.com

40 • 4/14

8. Produttore Novacart SpA Via Europa 1 23846 Garbagnate Monastero (LC) Tel. +39 031 858611 info@novacart.com www.novacart.com

9. Produttore O-I Manufacturing Italy SpA Via I maggio 18 21040 Origgio (VA) Tel. +39 02 434531 www.o-i.com

10. Produttore P.E.T. Engineering Srl Via Celtica 26/28 31020 San Vendemiano TV Tel +39 0438 403069 marketing@petengineering.com www.petengineering.com

11. Produttore Scatolificio Cristina Srl Via Mottarone 14 21020 Bodio Lomnago (VA) Tel +39 0332 949160 info@cristina.it www.cristina.it

12. Produttore Sealed Air Srl Cryovac Food Packaging Solutions Via Trento 7 20017 Passirana di Rho (MI) Tel. +39 02 9332415 www.sealedair-emea.com

13. Produttore Smurfit Kappa Italia SpA Strada Serravalle 65 15067 Novi Ligure (AL) Tel +39 0143 773277 www.smurfitkappa.it

14. Produttore Tetra Pak Italiana SpA Viale Resistenza 56/A 42048 Rubiera (RE) Tel +39 0522 263411 www.tetrapak.com

15. Produttore Verallia Saint-GobainVetri SpA Sede amministrativa: Loc. Colletto 4 17058 Dego (SV) Tel. 019 55701 Sede legale: via del Lavoro 1 36045 Lonigo (VI) Tel. +39 0444 725700 www.it.verallia.com Utilizzatore Gruppo Campari SpA Via Franco Sacchetti 20 20099 Sesto San Giovanni (MI) Tel. +39 02 62 25 1 www.camparigroup.com

www.dativoweb.net


Macchine per il packaging più performanti fino al 50% più veloci

PacDrive 3 specifico per il settore del packaging

Le soluzioni MachineStruxure ottimizzano le prestazioni delle vostre macchine e i vostri risultati economici

Le architetture MachineStruxure di motion control ad elevate prestazioni utilizzano PacDrive™ 3, la nuova piattaforma adatta al comando di macchine e sistemi multiasse adatta in modo specifico alle applicazioni di packaging.

Come costruttori di macchine per confezionamento e imballaggio siete costantemente alla ricerca di soluzioni innovative che vi permettano di realizzare prodotti sempre più efficienti e capaci di gestire al meglio l’energia, riducendo i costi e i tempi di sviluppo e progettazione. Le soluzioni di controllo MachineStruxure™ vi permettono di gestire tutte le applicazioni di controllo e automazione, dalle più semplici alle più avanzate. Oltre 60.000 impianti di packaging nel mondo possono provarlo!

Velocizzare il time to market Architetture e funzioni testate e validate ed una serie completa di librerie di software specifici per le applicazioni di packaging vi permettono di ridurre i tempi di progettazione. Piattaforme e soluzioni hardware multiple e scalabili supportate da un unico software assicurano massima flessibilità applicativa ed espandibilità oltre ad un elevato livello d’integrazione.

Migliorare disponibilità e prestazioni delle vostre macchine Grazie all’utilizzo delle nuove tecnologie di automazione e meccatronica le soluzioni MachineStruxure vi aiutano a progettare macchine più affidabili, sicure ed efficienti dal punto di vista energetico, ottimizzando la disponibilità e riducendo le esigenze di manutenzione.

Costruire un vantaggio competitivo Il nostro know-how e la nostra esperienza nelle applicazioni di packaging e controllo vi permettono di ridurre al minimo i costi operativi globali ad ogni fase del ciclo di vita della macchina. Dalla progettazione alla messa in servizio alla manutenzione siamo pronti ad aiutarvi, grazie alla nostra rete presente su scala mondiale, con servizi di formazione, progettazione soluzioni, centri di distribuzione e assistenza post-vendita, mettendo a vostra completa disposizione i nostri esperti in soluzioni di packaging control.

Automazione multiasse flessibile ed efficiente PacDrive 3 è adatto ad una vasta gamma di macchine e applicazioni: - packaging, produzione, material handling, e linee di assemblaggio - dai piccoli sistemi alle soluzioni di robotica industriale più complesse e ad elevate prestazioni - possibilità di gestire da 0 a 99 servoassi e fino a 30 robot.

Ottimizzate il vostro impianto di packaging! Scaricate ‘Automation solutions for packaging machines’. Visitate il sito web www.SEreply.com Codice chiave 44590p ©2014 Schneider Electric. All Rights Reserved. Schneider Electric, MachineStruxure, and PacDrive are trademarks owned by Schneider Electric Industries SAS or its affiliated companies. All other trademarks are the property of their respective owners. www.schneider-electric.com t 998-6567_IT


TRANS L’elemento centrale di ogni impianto di confezionamento Schubert è costituito dai transmoduli che si muovono su un sistema di rotaie. Questi robot trasportatori guidano i prodotti in maniera

interpack, Düsseldorf 08 – 14 Maggio 2014 Hall 14 | A06 Benvenuti!


MODUL autonoma sulla linea ideale attraverso tutti i settori dell’impianto. Si aprono così nuovi orizzonti in fatto di flessibilità, sicurezza, praticità di comando ed efficienza.

Il transmodulo in azione youtu.be/ DCzTWYCSkkM

Gerhard Schubert GmbH Packaging machines Industriegebiet Suedost, Hofaeckerstrasse 7 74564 Crailsheim, Germany Phone +49-7951/400-0, Fax +49-7951/8588

www.gerhard-schubert.it


[

MARKE T I N G & DE SI G N

]

Did you know that ...

Lo sapevate che… … esiste la luce in bomboletta? E il dispenser per esplosivi? E l’aerosol compresso, il sifone per condimenti, l’applicatore per tinte…? Gli ADF Awards fra tecnica, marketing e fantasia, all’ultima edizione della fiera convegno di Oriex. nche quest’anno la visita al doppio evento organizzato a Parigi da Oriex, dedicato alle tecnologie per aerosol (ADF) e al confezionamento dei prodotti di bellezza (PCD), è valsa il viaggio e l’impegno: con un incremento a due cifre di espositori (+25%) e visitatori (+14%), è ormai solidamente attestato come occasione di aggiornamento e incontro tra fornitori e utilizzatori di packaging per il cosmofarma, food non solo. Confermata la formula del convegno non stop abbinato alla fiera snella: solo due giorni di impegno, piccoli stand preallestiti, costi contenuti. E grande efficacia nel valorizzare prodotti e tecnologie, con gli award a fare da cassa di risonanza alle soluzioni più innovative, curiose, complesse. Come i vincitori degli ADF Awards 2014 nelle varie categorie.

A

Health/Pharma Granulox, Haemoglobin spray, Sastomed GmbH La confezione agevola l’erogazione locale del farmaco ovunque e con tempestività, efficacia, igienicità, oltre a rappresentare un forte elemento identificativo. The package facilitates the speedy, effective, hygienic spot-on dispensing of the pharmaceutical product as well as constituting a strong identifying feature.

... light can come in a spraycan? And what about the dispenser for explosives? And the compressed aerosol, the syphon for condiments, the dye applicator? The ADF Awards where technology, marketing and the imagination ran riot at the latest Oriex fair-conference. This year too the visit to the double event organized in Paris by Oriex, dedicated to aerosol technologies (ADF) and beauty products packaging (PCD), was well worth the journey and commitment: with a double-digit increase of exhibitors (+25%) and visitors (+14%), it is now solidly attested as an opportunity to update and exchange between cosmopharma, food and not only packaging suppliers and users. Confirmed the formula of the non-stop conference combined with the streamlined exhibition: only two days of commitment, small shell-scheme stands, limited cost. And very effective too in enhancing products and technologies, with the awards acting as a sounding board for the most innovative, curious and complex solutions. Like the winners of the 2014 ADF Awards in various categories.

Technical & Security Product Glow Spray, Soppec Certo che esisteva già la luce liquida, ma chi la conosceva? Ora, in bomboletta spray, tutti possono usarla: per feste ed eventi, per illuminare gli angoli bui della cantina, se ci si perde nel bosco, quando non si riesce a infilare la chiave nella toppa… Of course liquid light already existed, but who knew about it? Now, in a spraycan, everyone can use it: for parties and events, to illuminate the dark corners of the basement, if you get lost in the woods, when you are unable to insert your key in the lock ...

Design, quality of technical presentation - Protection 5 + Nivea Cool Kick & Dry Confidente. Household - Assainissant, Puressentiel Un preparato di aromaterapia con funzioni igienizzanti: 41 oli essenziali e alcol, senza coloranti, conservanti e profumi di sintesi. La pompa brevettata è inviolabile ed eroga un getto fine e potente. A preparation of aromatherapy with sanitizing functions: 41 essential oils and alcohol, no dyes, preservatives and synthetic fragrances. The patented pump is tamper proof and delivers a fine and powerful spray.

44 • 4/14

Spray rinvigorente per uomini attivi. Invigorating spray for active men.

Hygiene, Beauty, Coloration Salon de Pro, Dariya Corporation Colorante in schiuma pronto all’uso, da erogare direttamente sui capelli in quantità predosate. Dye foam ready to use, to be dispensed directly on the hair in pre-measured quantities.

www.dativoweb.net


[

MA RKETING & DESIGN

]

Food - Les Siphonés, Cheese mousse Linea di creme da spalmare sul pane: amplia gli orizzonti dell’aerosol come contenitore per alimenti, crea una nuova gestualità e conferisce plusvalore di servizio e appeal. Line of bread spreads: broadens the horizons of the aerosol as a food container, creates a new gestuality and gives appeal and service added value.

Hygiene, Beauty, Coloration Mousse Absolue, L’Oréal Il primo colorante pronto per l’uso (non ci sono elementi da mescolare) in un contenitore riutilizzabile per la tinta fai-da-te. Premere l’erogatore e aspergere.

Hygiene, Beauty, Coloration Goldwell Applicator, Kao Dispenser brevettato, composto da due componenti di materiale termoplastico, ottenuti per stampaggio a iniezione. Permette di applicare coloranti per capelli senza sporcare e in modo uniforme schiacciando l’apposita membrana.

The first ready-to-use dye (there are no elements to be mixed) in a reusable container for the do-it-yourself hue. Press the dispenser and apply.

Patented dispenser, consisting of two components of thermoplastic material, obtained by injection moulding. It enables the even application of hair dye without creating a mess simply by pressing the appropriate membrane.

Menzioni speciali MTI Group: Blast Bag ZeroTM Moltiplica la potenza esplosiva in sicurezza e con la massima semplicità, grazie al dispositivo che libera e innesca l’esplosivo, una volta inserita la “bomboletta” nel foro scavato nella roccia. It safely and simply multiplies the explosive power, thanks to the device that frees and triggers the explosive, once the “spraycan” has been inserted into the hole in the rock.

R&D Food Revolution: Sifon, Evolution I condimenti spray escono dalla nicchia. La linea Sifòn Evolution è creata dal celebre cuoco Albert Adrià, stella della ristorazione. R&D Food Revolution: Sifon, Evolution I condimenti spray escono dalla nicchia. La linea Sifòn Evolution è creata dal celebre cuoco Albert Adrià, stella della ristorazione.

www.dativoweb.net

Colep: Natural Foaming Cream Sigillato ermeticamente, l’aerosol dosa con precisione anche piccole quantità di prodotto, che si preserva nel tempo anche se utilizzato occasionalmente. Ideale per i preparati naturali e delicati, come la crema addizionata di CO2. Hermetically sealed, the aerosol can also accurately dose small quantities of product, which is preserved in time even if used occasionally. Ideal for natural and delicate preparations such as cream with added CO2.

Unilever: Compressed deodorant range Stessa quantità di prodotto in una bomboletta più piccola per un deodorante maschile di nuova concezione. Alta tecnologia per una riduzione di volumi e materiali, con rivisitazione del sistema spray in funzione del minor uso di gas propellente. Same amount of product in a smaller canister for a new concept men’s deodorant. High-tech for a reduction of volumes and materials, with a review of the system in terms of using less propellant gas.

4/14 • 45


[

MA RKETING & DESIGN

]

Inchiostri: una buona ricetta 10 parti di qualità (assoluta e certificata), 10 parti di servizio (just in time), 10 di innovazione (adeguatamente finanziata) e altrettanti di fiuto, con l’aggiunta di relazioni ottime con il mercato e istituzioni. Con questi ingredienti gli inchiostri e le vernici Sun Chemical crescono ancora, soprattutto nel packaging. Il bilancio consuntivo e preventivo di Fabio Deflorian, AD del gruppo in Italia. Stefano Lavorini l 2013? Bene per quanto riguarda in particolare il settore packaging, dove sono aumentati i volumi ed è stata mantenuta una buona redditività. E il 2014? È iniziato in modo incoraggiante, con l’imballaggio sempre più centrale, sebbene il crescente numero dei player rischi di spostare la competizione in prevalenza sui prezzi. Il futuro, comunque, è di chi si apre al cambiamento - in termini organizzativi, di approccio al mercato, culturali - e investe in ricerca. Questi, andando per grandi temi, gli spunti e le valutazioni che ricaviamo dall’incontro con Fabio Deflorian, Amministratore Delegato di Sun Chemical Italia, a chiusura di un anno intenso. La filiale nazionale del produttore di inchiostri e pigmenti per la stampa, infat-

I

ti, durante lo scorso esercizio ha portato a termine il trasferimento delle attività produttive dallo stabilimento di Firenze a quello, rinnovato e potenziato, di Calappio 1 («senza l’ombra di ricadute negative sui clienti»); ha stanziato ulteriori investimenti e si propone di accelerare (ancora) sulla strada del rinnovamento. «Perché il mercato, di certo, non diventerà meno impegnativo, competitivo o esigente; per adeguarsi o, meglio ancora, per anticiparne gli sviluppi, bisogna avere buone gambe e mente agile», chiosa Deflorian, che ci svela la ricetta “Sunchem”.

SEMPRE PIÙ IMBALLAGGIO Il bilancio 2013 di Sun Chemical Italia chiude con un +5% medio a volume, sia in Italia sia all’estero, per gli inchiostri liquidi, con numeri positivi sia nel busi-

Inks: a good “recipe” 10 parts quality (absolute and certified), 10 parts service (just in time), 10 of innovation (adequately funded) and the same amount of instinct, adding excellent relations with the market and institutions. With these ingredients Sun Chemical inks and varnishes continues to grow, aboveall in packaging. The final balance and budget of Fabio Deflorian, CEO of the group in Italy. Stefano Lavorini

The year 2013? Good in particular regarding the packaging sector, where volumes have increased and a

www.dativoweb.net

good profitability has been maintained. And 2014? It began in an encouraging

fashion, with packaging evermore central, even if a growing number of players risk shifting competition mainly to price. The future at any rate belongs to those that open up to change - in terms of organization, market approach, culturally- and that invest in research. This, in terms of the big issues, is what we gleaned from our encounter with Fabio Deflorian, CEO of Sun Chemical Italia, at the end of an intense year.

Fabio Deflorian

Indeed during the year the Italian branch of the printing ink and pigment producer concluded the transfer of the production activity from their Florence work to that, renewed and empowered, of Caleppio 1 («and our customers’ business was not even mildly affected»); it has earmarked further investments and offers to further speed things up on the road to renewal. «Because for sure the market will not become any less committal, competitive or demanding; to adapt

4/14 • 47


[

MARKE T I N G & DE SI G N

]

Imballaggio alimentare: fatti, non parole Chi ha paura delle normative sul packaging a contatto con gli alimenti? Sun Chemical no. «Anzi - dichiara provocatoriamente ma non troppo Fabio Deflorian, AD del Gruppo in Italia - norme ancora più severe, che potrebbero mettere in difficoltà alcuni produttori nostri concorrenti di medie dimensioni, ci troverebbero preparati. I nostri prodotti sono infatti formulati e realizzati con riferimento puntuale alla normativa vigente e alla luce di quella in divenire in materia di sicurezza. Questo significa, ad esempio, che gli inchiostri e le vernici Sun Chemical per imballaggio alimentare non contengono coloranti azoici, che possono potenzialmente decomporsi in ammine aromatiche cancerogene di categoria 1 e 2; sono formulati in modo da minimizzare la potenziale migrazione attraverso il substrato e il set-off, nonché, nei casi in cui necessario, con i componenti listati nell’Allegato 6 dell’Ordinanza Svizzera RS 817.023.21. Inoltre, in veste di membro EuPIA, partecipiamo a tutti i tavoli di lavoro che si occupano dello sviluppo della legislazione sulle materie plastiche (Regolamento PIM), degli inchiostri per la stampa alimentare (Ordinanza Svizzera e futura Ordinanza Tedesca) e del Regolamento REACH. In questo modo possiamo capire l’orientamento delle varie nazioni e impegnarci, in ultima istanza, a tutelare la sicurezza dei consumatori». Non è una boutade, e Deflorian può documentarlo. Anzitutto, con il coraggio di un impegno assunto pubblicamente, a voce alta e verificabile: quello di percorrere, anche in tempi “di crisi”, solo e soltanto la strada maestra della qualità senza scorciatoie né cedimenti («Non abbiamo fatto un solo downgrading di materia prima»). Quindi con la chiarezza di un metodo che sostanzia i buoni propositi, Sun Chemical ha reso operativa una struttura dedicata al recepimento delle normative e alla gestione della responsabilità di prodotto: una quindicina di addetti a livello globale, altri 20 a livello europeo più uno in ciascun paese. In sintesi, la procedura Per quanto riguarda la materia prima in ingresso, vengono richieste ai fornitori una serie di informazioni dettagliate, in relazione alla composizione e al contenuto/contaminazione da metalli pesanti, livello di impurezze/sottoprodotti nei pigmenti… In caso di dubbio, vengono disposte indagini analitiche mirate. Gli inchiostri e le vernici Sun Chemical per l’imballaggio alimentare sono quindi formulati secondo la Lista di Esclusione EuPIA, e vengono fabbricati sulla base delle GMP e delle Linee Guida EuPIA. I pigmenti utilizzati soddisfano i requisiti di purezza della Risoluzione del Consigli d’Europa AP (89)1 e della Raccomandazione IX del BfR sulla contaminazione di metalli pesanti. Ciascuna specialità, quindi, viene prodotta con materie prime selezionate con estrema cura e senza cedere alle sirene del cost saving. La multinazionale, a sua volta, rilascia le dichiarazioni di composizione che servono a garantire qualità e prestazioni promesse. Fatti, dunque, non parole…

or, better still, to anticipate the developments, one has to have good legs and an agile mind», Deflorian noted, as he illustrated the “Sunchem” recipe to us.

EVER GREATER ONUS ON PACKAGING The 2013 balance of Sun Chemical Italia closed with a +5% in average volume for liquid inks, both in Italy and abroad, with positive figures both in the business of waterbased products

48 • 4/14

ness di quelli all’acqua per carta e cartone ondulato sia di quelli a solvente, nonché vernici per alluminio sottile e affini. Per quanto riguarda i prodotti per la stampa offset a foglio (sia packaging, che commerciale), l’incremento, sempre a volume, è stato a doppia cifra. In calo, invece, la stampa heatset (editoria, pubblicità) dove, dice Deflorian «Nonostante Sun Chemical abbia mantenuto le quote di mercato, addirittura incrementandole in alcuni casi, prevediamo che il trend negativo proseguirà». Il 2014, comunque, è partito bene; proseguono i trend di crescita registrati lo scorso anno sia nell’offset a foglio per la stampa commerciale e di packaging, sia negli inchiostri liquidi per imballaggio flessibile, carta e cartone ondulato. «In questi settori - precisa il manager stanno riprendendo gli investimenti in mezzi, un po’ in tutto il territorio nazio-

for paper and corrugated board as well as for solvent based products, including varnishes for thin aluminium and like products. This was accompanied by a double digit increase in volume for sheet-fed offset printing products (both packaging and commercial). Heatset printing (publishing, advertising) though has shown a drop where, as Deflorian tells us «despite the fact that Sun Chemical has

nale, e non si tratta di sostituzioni ma di ampliamenti del parco macchine. È un segnale confortante, e mi auguro, tuttavia, che questa attenzione all’imballaggio da parte dei produttori di materie prime, di inchiostri e dei converter non inneschi le dinamiche classiche sui prezzi che, alla fine, sono di vantaggio solo per i brand owners». L’imballaggio, dunque, conferma la propria centralità anche grazie al profilo peculiare dell’industria della trasformazione in Italia che, a differenza di quella europea, è costituita in prevalenza da aziende familiari, dinamiche e flessibili, con una buona propensione all’esportazione. Secondo le mie stime, in Italia, nella stampa di imballaggi flessibili con inchiostri o vernici a base solvente, l’incidenza delle multinazionali straniere sul nostro portafoglio clienti è molto bassa, intorno al 4-5%. Se invece andiamo sugli inchiostri ad acqua nel settore del

maintained its market shares, even increasing them in some cases, we predict that the negative trend will continue». Year 2014 at any rate got off to a good start; the growth trends registered last year in sheet offset for commercial printing and packaging are continuing, both in liquid inks for flexible packaging, paper and corrugated board.«In these sectors the manager states - investments in

means, this all told involving the entire country, are picking up again, and these are not replacements but additions to the machine yards. It is a comforting sign, and I hope all the same, that this attention to packaging by raw materials and ink producers and converters does not trigger off the classic price surge that in the end only favours the brand owners». Packaging hence confirms its centrality also thanks to the peculiar

www.dativoweb.net


[

MA RKETING & DESIGN

]

Food packaging: deeds, not words cartone ondulato è il 52%, ma se poi consideriamo la produzione complessiva di inchiostri all’acqua per tutti i business, il peso delle multinazionali cala attorno al 25%. In Europa è l’opposto: c’è una prevalenza assoluta delle multinazionali, che nei singoli Paesi, sono orientate ai mercati locali, ed esprimono dunque, logiche, tempi, metodi e criticità completamente diversi».

INVESTIRE E INNOVARE Sun Chemical Italia, dal canto proprio, prosegue sulla strada degli investimenti per razionalizzare e ammodernare gli impianti, con la duplice intenzione di contenere i costi di produzione e garantire al mercato forniture adeguate per quantità e costanza qualitativa. Così, dopo aver potenziato lo stabilimento di Caleppio 1, ora lavora a rinnovare Caleppio2, dove si producono inchiostri a base solvente, investendo in impianti a elevata automazione. Ma non solo. Altrettanto significativi gli investimenti in R&S di Sun Chemical, che ha dato vita a un laboratorio completamente rinnovato nel lay-out, nelle strumentazioni

analitiche e di controllo oltre che negli arredi, con postazioni di lavoro razionali ed all’avanguardia. «Per quanto riguarda il flessibile - rivela Deflorian - e dunque la stampa roto, stiamo testando alcune nuove serie di inchiostri a base acqua per stampa interna e successivo accoppiamento, progettate e messe a punto in Inghilterra, che hanno suscitato l’interesse di alcuni converter. Non ci aspettiamo grandi volumi (il grosso del mercato è ormai attrezzato con impianti di recupero solvente), ma si tratta di una nicchia interessante dal punto di vista tecnologico. Più ampio, invece, l’interesse per l’UV, tipicamente nel settore delle etichette, dove cresciamo grazie alle ottime prestazioni che si ottengono con macchine narrow web. Nella seconda metà del 2013, abbiamo acquisito nuove quote di mercato, il che ci ha permesso una crescita a due cifre, e continueremo a impegnarci in questa direzione». E se, per quanto riguarda la stampa di imballaggi alimentari con inchiostri UV,

Who is afraid of food contact packaging standards? Sun Chemical is certainly not. «Indeed - Fabio Deflorian, CEO of the Group for Italy, provocatively declares - even more severe standards, that might trouble some of our medium sized competitors, would find us prepared. Our products are in fact formulated and made with precise reference to the standards in force and in the light of the standard in the making concerning safety. This means for example that Sun Chemical packaging inks and varnishes do not contain azoic dyes that can potentially break down into category 1 and 2 cancerogenous aromatic ammines; they are formulated to minimize the migration potential through the substrate and the set-off, as well, in the cases where needed, with the components listed in attachment 6 of the Swiss decree RS 817.023.21. What is more, in the role of EuPIA member, we take part in all the worktables that deal with the development of the legislation of plastics (PIM Regulation), inks for printing food products (Swiss decree and future German decree) and the REACH Regulation. In this way we can understand the orientation of the various nations and ultimately commit ourselves to safeguarding the consumers». This is no joke, and Deflorian can vouch for it. Aboveall, with the courage of a commitment of, even in times of “crisis”, publicly traveling down the main road of quality without taking shortcuts or yielding concessions («we have not even been involved in a single raw material downgrading»). Hence with the clarity of a method that substantiates good intentions, Sun Chemical has implemented a structure dedicated to the adoption of applicable standards and the management of product responsibility - featuring some fifteen experts worldwide, another twenty at European level for each country. In brief, the procedure As far as the incoming raw materials are concerned, detailed information is demanded from the suppliers regarding the composition and the of heavy metal content/contamination, the level of impurity/by-products of the pigments… In case of doubt, targeted analytical investigations are carried out. Sun Chemical inks and varnishes for food packaging are hence formulated according to the EuPIA Exclusion List, and are manufactured on the basis of GMP and EuPIA guidelines. The pigments used satisfy the purity requisites of the Council of Europe AP (89)1 resolutions, and recommendation IX of the BfR on contamination from heavy metals. Each speciality hence is produced with raw materials selected with extreme care and without heeding the sirens of cost saving. The multinational, in turn, releases the composition declarations that safeguard and guarantee the quality and performance promised. Deeds hence and not words...

profile of the converting industry in Italy that, as opposed to the European one, mainly comprises dynamic and flexible family firms with a strong propensity towards export. According to my estimates, in Italy, in the print of flexible packaging with solvent based inks or varnishes, the incidence of foreign (non Italian) multinationals in our customer portfolio is very low, around 4-5%. If instead we go over to waterbased inks in the corrugated

www.dativoweb.net

board segment the figure stands at 52%, but if we then consider the overall production of waterbased inks for all businesses, the proportion of multinationals drops to around 25%. In Europe things are the other way around: the multinationals prevail totally, that in the single countries are oriented towards the local markets, and hence express logic, times, methods and criticalities that differ totally from nation to nation».

INVEST AND INNOVATE Sun Chemical Italia, for its part, is carrying on with the investments to rationalize and modernize its facilities, with the double intention of containing production costs and guaranteeing the market sufficient provisions in terms of quantity and qualitative constancy. Thus, after having empowered its Caleppio 1 facilities, it is now working on the renewal of Caleppio 2, where solvent based inks are produced,

investing in highly automated systems. But not only that. Equally significant are Sun Chemical’s investments in R&D, that have given rise to a laboratory completely renewed in terms of layout, analytical tools and control as well as in fittings and equipment, with rational, leading-edge workstations. «As far as flexible is concerned DeFlorian reveals - and hence gravure printing, we are testing several new series of waterbased inks for internal

4/14 • 49


[

MARKE T I N G & DE SI G N

]

Dal progetto allo scaffale Con lo slogan “Concept to Consumer”, Sun Chemical e la casamadre DIC (il maggior produttore di inchiostri e pigmenti del mondo) mostrano a Interpack i prodotti e i servizi che li attestano come fornitori di soluzioni complete di packaging: dalla progettazione all’esposizione a scaffale. Allo stand C10 del padiglione 7a vengono dunque illustrate proposte in grado di affrontare le grandi sfide dei brand owner: l’impatto a scaffale, l’integrità del marchio, la normativa sulla sicurezza alimentare, la razionalizzazione dei costi… Progettazione. L’agenzia di servizi Sun Branding Solutions (SBS) darà dimostrazione di come creare packaging accattivanti, che “bucano” lo scaffale, garantiscono gli stessi colori del marchio, impiegano rivestimenti e inchiostri dagli effetti speciali e rispettano le normative sulla bassa migrazione. SBS è in grado di studiare la struttura di packaging più adatta alle esigenze specifiche di ciascun cliente, e mette a disposizione un efficace software per la gestione del ciclo di vita dell’imballaggio.

Integrità del marchio. A Interpack, gli esperti Sun Chemical illustreranno le diverse tecnologie e la vasta gamma di inchiostri di sicurezza, tra cui la soluzione per la codifica a infrarossi Verigard™ che addiziona piccole quantità di tag o marcatori chimici a inchiostri, vernici e rivestimenti, e si può utilizzare in qualsiasi processo di stampa e su qualsiasi supporto. Sicurezza alimentare. Sun Chemical collabora con i brand owner per garantire la conformità del loro imballaggio alle normative sulla sicurezza e l’alimentarietà, inclusi il regolamento PIM, il REACH, la direttiva sulla plastica e l’ordinanza svizzera. In gioco le best practice per la stampa di confezioni alimentari e le serie di inchiostri, rivestimenti e adesivi appositamente progettati per garantire i livelli minimi di migrazione. Sostenibilità a tutto campo. Sun Chemical propone sistemi di confezionamento che utilizzano adesivi per laminati barriera e inchiostri sostenibili, nonché vernici ideate per realizzare imballi più leggeri ed economicamente vantaggiosi, riciclabili, biodegradabili.

From the project to the shelf With the slogan “Concept to Consumer”, at Interpack Sun Chemical and its parent company DIC (the biggest producer of inks and pigments in the world) will be showing the products and the services that attest them as suppliers of complete packaging solutions: from design to display on the shelf. At stand C10 Hall 7a hence proposals capable of tackling the great challenges that lie before brand

al momento Deflorian non ravvede prospettive concrete nel breve e medio periodo, discorso diverso vale per le vernici barriera lanciate lo scorso anno e attualmente in fase di test pilotato presso alcuni utilizzatori. «Concepite per creare alternative più ecologiche e low cost agli accoppiati multistrato, e formulate in modo speci-

printing and subsequent lamination, designed and devised in the UK, that have already aroused the interest of several converters. We do not expect great volumes (most of the market has by now been equipped with solvent recovery systems), but it is an interesting niche from a technological point of view. Broader in turn the interest in UV, typically in the label sector, where we are growing thanks to the excellent

50 • 4/14

owners will be illustrated: shelf impact, brand integrity, food safety standards, cost rationalisation… Design. The Sun Branding Solutions (SBS) service agency will demonstrate how to create alluring packaging, that “pierces” the shelf, guaranteeing the same brand colors, special effects coatings and inks used in full respect of low migration standards. SBS is capable of studying the structure of the packaging most suited to the specified needs of each customer, and offers a software effective in managing the packaging lifecycle. Brand integrity. At Interpack the Sun Chemical experts will illustrate the different technologies and a vast range of safety inks, among which the Verigard™ infrared coding solutions, that entail adding small quantities of tags or chemical markers to inks, varnishes and coatings, where these can be used in any print process and on any substrate. Food safety. Sun Chemical cooperates with brand owners to guarantee conformity of their packaging to safety and food standards, including PIM, REACH regulations, the plastics directive and the Swiss decree. The best practices for printing food packaging and the series of inks, coating and adhesives especially designed to guarantee a minimum level of migration come into play. All round sustainability. Sun Chemical offers packaging systems that use adhesives for barrier laminates and sustainable inks, as well as varnishes made for creating lighter and more cost effective, recyclable and biodegradable packaging.

fico per le differenti applicazioni, hanno suscitato grande curiosità. Vogliamo procedere con grande attenzione sulla strada della validazione di questi prodotti che hanno il vantaggio di consentire una drastica riduzione delle scorte a magazzino di materiali barriera, ovvero aggiungere flessibilità e dare economicità all’attività di trasformazione».

performance we are getting on narrow web machines. In the second half of 2013 we acquired new market shares, that fuelled a double digit growth, and we will continue with our commitment in this direction». And if, as far as the printing of food packaging with UV inks is concerned, presently Deflorian does not see concrete prospects in the medium to short term, things are different for the barrier varnishes launched last year and

LA CULTURA DEL SERVIZIO Tecnologia e prodotti non sono, peraltro, i soli campi in cui si concentra l’attenzione della società. «Sul versante finanziario, stiamo lavorando a ridurre il livello di esposizione, migliorando il tempo medio di incasso, con la stessa determinazione con cui da qualche anno, per contenere il ri-

currently undergoing a piloted test phase with some users. «Conceived to create more ecological and lower cost alternatives to multilayer laminates, and formulated specifically for the different applications, they have aroused great curiosity. We wish to proceed with great care along the road to the validation of these products, that offer the advantages of a drastic reduction in barrier material warehoused stock, or that is making

converting activities more flexible and more cost effective».

THE SERVICE CULTURE Technology and products are not, what is more, the only field the company is concentrating on. «On the financial side, we are working to reduce our level of exposure, improving the days of sales outstanding, with the same determination with which some years

www.dativoweb.net


schio di insoluti, rinunciamo a forniture per importi complessivi anche rilevanti». Ma anche la cultura e la gestione dell’azienda sono temi cari a Deflorian: «Sistema di vendita, approccio al lavoro, mentalità: tutto deve adeguarsi a un mondo che cambia. Ecco perché, per restare competitivo in un contesto sempre più difficile dobbiamo puntare a strutture più agili e reattive, con persone dalla mentalità aperta, competenti, in grado di migliorare le modalità di relazione con l’esterno. Così, garantita la qualità del prodotto, assicurato il livello adeguato di servizio, portato a termine il progetto “consegne just in time” (oggi evadiamo il 97% degli ordini nei tempi richiesti dalla clientela), nel 2014 ci dedicheremo anche a migliore l’immagine dell’azienda, per comunicare con più chiarezza ed efficacia i vantaggi connessi all’utilizzo dei nostri prodotti». Q

back, to contain the risk of unpaid dues, we even waived supply agreements of considerable value». Company culture and management are also themes dear to Deflorian:«Sales system, work approaches, mentality: everything has to adjust to a changing world. Here is why, to stay competitive in an evermore difficult context we have to aim at more agile and reactive structures, manned by open-minded, competent people, capable of

www.dativoweb.net

improving the ways of relating to the outside. Thus, having guaranteed the quality of the product, ensured the right service level, having terminated the “just in time delivery” project (today we process 97% of orders in the times requested by the customer), in 2014 we will also dedicate ourselves to improving the image of the company, to communicate more clearly and effectively the advantages associated with the use of our products». Q

MA RKETING & DESIGN

]

WWW.CONCRETACOM.IT

[

Un vuoto pieno di protezione.

Se aspirate al massimo della protezione alimentare, pretendete il meglio della tecnologia per il vuoto che solo un leader di mercato può offrire. ServiceAir, solo prodotti ad altissima efficienza a basso consumo energetico che garantiscono prestazioni superiori ed una assistenza tecnica di primissimo livello che rafforza l’affidabilità e consolida la protezione. ServiceAir. Il massimo della tecnologia del vuoto.

4/14 • 51 ServiceAir Srl Via G. Bonomelli 9 - 20031 Cesano Maderno - MI - T 0362.1780967 F 0362.1780578 info@serviceair.it www.serviceair.it


NE WS

[

MA RKETING & DESIGN

]

What is Italian cosmetics worth Italians are not foregoing on purchasing cosmetics, essential for daily hygiene and personal well-being, but are moving towards cheaper price ranges or towards better value for money: this is why the value of the cosmetics market has decreased slightly, but not the volume of products sold. We publish a note from Fabio Rossello, President of Cosmetics Italia, on the performance of the Italian cosmetics market, which in 2013 exceeded 9.5 billion euros. The segment has registered a marginal decline in consumption (-1.2%) and an increase in exports by 11% to a value close to 3.2 billion euros. It is exports that are sustaining production (9.3 billion euros, +2.6%): for the first time exports have increased both in quantity and in value, reflecting the broader competitiveness gained by Italian companies. To confirm that a significant change in consumer buying habits is underway, direct sales to the home show an increase of 4.5%, exceeding 450 million euros. The herbalist shop is also putting in a positive trend (+2.8%, 409 million euro) and the chemists (+0.3%, 1,750 million euros) is also recovering. The reduced propensity by large user group to consume has influenced the decline in consumption of perfumery products (-3.8%) to a value of 2,100 million euros as well as in the professional channels: if professional beauty products registered a drop of 5.5% (242 million euro), those for the hairdressing fell by 8.4% (591 million euros). Large retailers, close to 4,300 million euros, are seen to be substantially stable (+0,1%) characterized by the sustained decline in sales in large surfaces (hypermarkets and supermarkets), offset by the growth of specialized chains and monobrands.

Quanto vale la cosmesi italiana Q Gli italiani non rinunciano all’acquisto del cosmetico, indispensabile per l’ igiene quotidiana e il benessere personale, ma si orientano verso fasce di prezzo più economiche o verso il miglior rapporto qualità-prezzo: ecco perché cala lievemente il valore del mercato cosmetico, ma non il volume dei prodotti venduti. Riportiamo una nota di Fabio Rossello, Presidente di Cosmetica Italia, relativa all’andamento del mercato cosmetico italiano che, nel 2013, ha superato i 9.500 milioni di euro. Il comparto ha registrato un calo dei consumi marginale (-1,2%) e un aumento delle esportazioni dell’11% per un valore vicino ai 3.200 milioni di euro. È l’export a sostenere la produzione, (9.300 milioni di euro, +2,6%): per la prima volta le esportazioni crescono sia in quantità che in valore, a testimonianza della più ampia competitività acquisita dalle imprese nazionali. A conferma che è in corso una significativa trasformazione nelle abitudini di acquisto del consumatore, le vendite dirette a domicilio registrano un aumento del 4,5%, superando i 450 milioni di euro. Anche l’erboristeria esprime una tendenza positiva (+2,8%, 409 milioni di euro) e in recupero risulta la farmacia (+ 0,3%, 1.750 milioni di euro). La ridotta propensione al consumo di ampie fasce di utenti hanno condizionato il calo dei consumi in profumeria (-3,8%) per un valore di oltre 2.100 milioni di euro e nei canali professionali: se i prodotti professionali per l’estetica registrano un segno negativo del 5,5% (242 milioni di euro), quelli per l’acconciatura calano dell’8,4% (591 milioni di euro). La grande distribuzione, prossima ai 4.300 milioni di euro, registra una sostanziale stabilità (+0,1%) caratterizzata dal sostenuto calo delle vendite nelle grandi superfici (iper e super), bilanciato dalla crescita delle catene specializzate e dei monomarca.

www.dativoweb.net

interpack 2014 08-14/05 | Padiglione 13 | Stand A31

0QPFKOGPVKECVGFKCNNCEEKCTGNCEKPVWTCFKUKEWTG\\C .CUGTKG+PPQƂNN)NCUU-*5 4KGORKOGPVQRKÕXGNQEGGUKEWTQFKƂPQCDQVVKINKGCNNnQTC Q

+NDGPEJOCTMPGNNCVGEPKECFKTKGORKOGPVQ

Q

'HƂEKGP\C GPGTIGVKEC CN OCUUKOQ NKXGNNQ s EGTVKƂECVC FCN 6¸8

Q

2WNKVWTC TCRKFC ITC\KG CNNn*[IKGPKE &GUKIP

2GT OCIIKQTK KPHQTOC\KQPK XKUKVCTG KN UKVQ www.khs.com QRRWTG UECPUKQPCTG KN EQFKEG 34 *N.: 2011 – EEA 02


[

MARKE T I N G & DE SI G N

]

NE WS

Ipack-Ima 2015: trade show with synergies Ipack-Ima SpA intensifies its undertakings to raise the international standing of the 2015 event, to involve the entire chain in coherent cooperation, with the objective of “acting as a system”. The agreement with the powerful PMMI, the U.S. Packaging and Processing Technologies Association, owner and organiser of Pack Expo, Expo Pack México, Pack Expo International, Pharma Expo, Pack Expo East, Expo Pack Guadalajara and Pack Expo Las Vegas trade shows, has now been made official. From now on Ipack-Ima SpA will be their exclusive representative for Italy, also helping to consolidate relations with the U.S., which is where Italian industry has always exported a considerable amount of its output and where demand has recently been seen to be picking up again. This is the latest in a long line of patiently pieced-together agreements which sees Ipack-Ima SpA setting up reciprocal relations with key international institutions, in line with its mission to support its exhibitors at a global level. The long list ranges from Expo 2015, which has recognised Ipack-Ima as sole leading food and non food processing and packaging trade show in Italy, to Unido (the UN’s Industrial Development Organisation for transition economies) with which Ipack-Ima has collaborated to launch the wide-ranging project East Afripack (Nairobi, 9-12th September 2014), the first trade show dedicated to processing, packaging and converting technologies in the vast and strategic East African Community (EAC) area. A big project, which also covers a cycle of planned conferences in India, Kenya and Indonesia, and which will come to a close with the Ipack-Ima 2015 summit. The “catalogue” of partners also includes the Italian Ministry of Agriculture and Forestry and that of Economic Development, the WFP (the UN’s World Food Programme) and the other UN Agriculture and Food agencies (FAO and IFAD), Ice-Agenzia for promotion abroad and internationalization of Italian companies and Promos, with which Ipack-Ima is working to identify and invite the “right” buyers for the 2015 event, as part of the Buyers’ Program. While continuing in their efforts in fostering “internal” relations within the business communities that will be rendezvousing in Milan on 19th-23rd May next year. Sector prepares for the big event. Ipack-Ima 2015 is in fact a sector event, involving food and non food processing and packaging companies. A highly synergic engagement created to give a voice to and empower the relevant sectors, also thanks the direct involvement of representatives of the supply chain, including distribution, in the organising committee. Emblematic the choice of chairman for Ipack-Ima 2015 - Marco Pedroni, Chairman of Coop Italia – who accepted the post both due to the critical role that packaging plays for his brand’s strategies as well as for the central role that the Milan event holds in the global market (not to mention its closeness to Expo 2015, where Coop Italia is a partner in the theme hall dedicated to the “Supermarket of the future”). In line with Ipack-Ima’s “holistic” approach, Pedroni has also often highlighted how cooperation between the different segments within the sector is one of the show’s strongpoints: a chance to work as a system - at last! - like the competitors Italian exports have to measure with on the international scene. With such a wide ranging project the different market business communities that meet up and recognise each other at the show cannot fail to get the right visibility. The “right” to stand out from the many solutions on offer inspired the concept of “vertical” fairs which define the areas and specific proposals of the fruit and vegetable (Fruitech Innovation), meat processing (Meat-Tech) and Dairy (Dairy Tech) sectors. Ipack-Ima’s range of events also covers converting and printing (Converflex and Grafitalia) as well as logistics (Intralogistica). Hence a total of seven shows will be amalgamating to give rise to next year’s big event that, based on the organisers’ estimates, will involve over 2,500 exhibitors and 100,000 visitors.

54 • 4/14

Ipack-Ima 2015: la fiera delle sinergie Ipack-Ima SpA intensifica le iniziative per rafforzare la valenza internazionale dell’appuntamento del 2015, e per coinvolgere tutta la filiera in una collaborazione coerente, con l’obiettivo di “fare sistema”. Q È ufficiale l’accordo con la potente Association for Packaging and Processing Technologies (PMMI) americana, proprietaria e organizzatrice delle fiere Pack Expo: Expo Pack México, Pack Expo International, Pharma Expo, Pack Expo East, Expo Pack Guadalajara e Pack Expo Las Vegas. D’ora in avanti Ipack-Ima SpA le rappresenterà in esclusiva nel nostro Paese, consolidando al contempo i rapporti con gli Stati Uniti, dove l’industria italiana dirige da sempre buona parte del proprio export e dove, negli ultimi tempi, assistiamo a una ripresa della domanda. Si tratta dell’ennesimo filo di una rete di accordi tessuti con pazienza, che impegna Ipack-Ima SpA in rapporti di reciprocità con le istituzioni internazionali che contano, coerentemente con la missione di sostegno dei propri espositori sulla scena globale. La lista è lunga e spazia dall’Expo 2015, che ha riconosciuto Ipack-Ima come unica fiera leader in Italia per le tecnologie del processing e del packaging food e non food, all’Unido (l’organizzazione delle Nazioni Unite per lo sviluppo industriale nelle economie in transizione) con cui Ipack-Ima ha dato vita a quel progetto di grande respiro che è East Afripack (Nairobi, 9-12 settembre 2014), prima fiera dedicata alle tecnologie per la lavorazione, il confezionamento e il converting nella grande e strategica area dell’East African Community (EAC). Un progetto articolato, a cui fa capo anche il ciclo di conferenze calendarizzate in India, Kenia e Indonesia, e che terminerà con il summit di Ipack-Ima 2015. Il “catalogo” dei partner comprende, fra gli altri, anche il Ministero delle politiche agricole alimentari e forestali, e quello dello Sviluppo economico; il WFP (World Food Program, programma alimentare mondiale delle Nazioni Unite) e le altre agenzie del Polo Agroalimentare dell’ONU (FAO e IFAD); l’Ice-Agenzia per la promozione all’estero e l’internazionalizzazione delle imprese italiane e Promos, con cui Ipack-Ima lavora a individuare e invitare i buyer “giusti” per l’evento del 2015, nell’ambito del Buyers Program. Senza mai trascurare i rapporti “interni” alle business community che si danno appuntamento a Milano il prossimo anno il prossimo 19-23 maggio. La filiera si prepara al big event. Ipack-Ima 2015 è, infatti, un appuntamento di filiera, che coinvolge le imprese del processo e confezionamento food e non-food. Si tratta, dunque, di un evento fortemente sinergico, concepito per dare voce e valore ai settori di riferimento, anche grazie al coinvolgimento diretto, nel comitato organizzativo, dei rappresentanti dell’intera supply chain, distribuzione compresa. Emblematica, al riguardo, l’assegnazione della presidenza di Ipack-Ima 2015 a Marco Pedroni, presidente Coop Italia, che ha accettato l’incarico sia per l’importanza che riveste l’imballaggio nelle strategie della sua insegna sia per la centralità dell’appuntamento milanese nel contesto internazionale (senza trascurare la vicinanza con Expo 2015, di cui Coop Italia è partner nel padiglione tematico dedicato al “Supermercato del futuro”). In sintonia con l’approccio “olistico” di Ipack-Ima, Pedroni ha anche più volte sottolineato come la collaborazione fra i diversi segmenti della filiera rappresenti un grande punto di forza della manifestazione: occasione per fare sistema finalmente! - come i competitor con cui il Made in Italy si confronta sulla scena internazionale. In un progetto così ampio, le Business Community dei diversi mercati che si riconoscono e incontrano in fiera non potevano non avere adeguata visibilità. Il “diritto” a emergere dall’insieme delle proposte in mostra ha ispirato la concezione delle manifestazioni “verticali” che definiscono gli spazi e le proposte specifiche delle filiere dell’ortofrutta (Fruitech Innovation), della lavorazione delle carni (Meat-Tech) e del lattiero-caserario (Dairy Tech). La compagine Ipack-Ima così definita si completa, infine, con il coinvolgimento del converting e della stampa (Converflex e Grafitalia) e della logistica (Intralogistica). Sono sette, quindi, le manifestazioni che si integrano per dare vita al big event dell’anno prossimo e che, secondo le stime degli organizzatori, coinvolgeranno oltre 2.500 espositori e 100.000 visitatori.

www.dativoweb.net


NE WS

Riscaldatori: nasce Leister Technologies Italia Q Leister Technologies entra in prima persona sul mercato italiano e inaugura a Segrate (MI) la filiale diretta. L’attività, avviata all’inizio di quest’anno, vede il gruppo svizzero leader nelle tecnologie per il calore di processo, impegnato direttamente nel nostro Paese dopo oltre 50 anni di collaborazione con lo storico distributore Mohwinckel. «L’obiettivo è ambizioso - dichiara Paolo Possa, direttore della filiale - e consiste anzitutto nel consolidare la posizione di Leister come partner ideale dei progettisti e dei costruttori di impianti industriali. Gli ingredienti ci sono tutti: una gamma prodotti completa e sempre all’avanguardia

grazie ai costanti investimenti in R&S, realizzata in Svizzera al 100% con una qualità senza paragoni, oltre al vastissimo knowhow accumulato in 60 anni di attività e, ultimo ma non meno importante, un team italiano di persone competenti e appassionate al loro lavoro». L’azienda sta lanciando in questo periodo Mistral System, ultimo nato nella famiglia dei riscaldatori ad aria calda. Progettato per garantire il massimo delle prestazioni nel funzionamento in continuo, grazie al motore brushless della soffiante, Mistral è in grado di rispondere alle esigenze specifiche di ogni singolo processo industriale. La versione top di gamma può operare gestendo i parametri di temperatura e volume d’aria tramite una propria elettronica integrata, oppure adottando un’interfaccia esterna. «Il tutto ad un prezzo molto interessante».

Krones si rafforza nel processo Q Krones, leader sul mercato globale del riempimento e confezionamento di bevande, ha acquisito il 100% della HST Maschinenbau GmbH che progetta e produce omogeneizzatori e pompe a pistone per il food & beverage. L’operazione è coerente con gli obiettivi di crescita nelle tecnologie di processo per succhi e latte, oltre che nelle attività di manutenzione e servizio in questo settore.

[

MA RKETING & DESIGN

]

Heaters: Leister Technologies Italia is born Leister Technologies enters onto the Italian market first hand by inaugurating its direct branch. Based at Segrate (MI), the activity, started up at the beginning of this year, sees the Swiss group, leader in heat process technologies, committing itself directly in Italy after over 50 years of cooperation with the historic distributor Mohwinckel. «The objective is ambitious - Paolo Possa, head of the branch, declares - and consists aboveall in consolidating the position of Leister as ideal partner of industrial system builders and designers. The ingredients are all there: a complete range of products as ever cutting edge thanks to constant investment in R&D, totally made in Switzerland, offering a quality without compare, as well a vast knowhow accumulated in 60 years of activity and, last but no less important, a skilled Italian team made up of people who know and love their job». In this period the company is launching Mistral System, the latest creation in a family of hot air heaters. Designed to guarantee max performance in continuous functioning, thanks to the brushless motor of the blower, Mistral is capable of responding to the specific needs of each single industrial process. The top version of the range can operate managing the parameters of temperature and air volume through bespoke integrated electronics, or by adopting an external interface. «Everything at a very interesting price».

Krones reinforces process Krones, leader on the global market of filling and packaging beverages, has bought 100% of HST Maschinenbau GmbH that designs and produces homogenizers and piston pumps for food & beverage. The operation is coherent with the company’s growth objectives in process technologies for juices and milk, as well as the service and maintenance activities in this sector.

L’arte di conservarsi bene. VERIMEC è una società del gruppo MASSILLY, leader europeo nella produzione di imballi in banda stagnata e capsule twist destinati al mercato alimentare. VERIMEC unisce alla qualità dei suoi prodotti la garanzia di un servizio accurato che applica supportando il cliente nella scelta del vaso giusto. Dal design alla capsula personalizzata, alla macchina più razionale ed efficiente; studiando il mastice adeguato alle esigenze di pastorizzazione o sterilizzazione, fino al preciso controllo del processo di chiusura. A garanzia che gli alimenti siano conservati ad arte.

Via Matilde Serao, 27 - 20081 Abbiategrasso (MI) Tel.+39 02.94960293 - Fax +39 02.94965658 - www.verimec.it - info@verimec.it I

www.dativoweb.net

T

A

L

I

A

4/14 • 55


[

INDUSTRY & MA NA GEMENT

]

Senza eSITazioni Continua la crescita del gruppo SIT nel mondo dell’imballaggio flessibile. Dati alla mano, è sorprendente come l’azienda di San Marino riesca a tenere in equilibrio, anno dopo anno, risultati e investimenti, innovazione e tradizione. Il segreto… energia e intelligenza e saper sognare con gli occhi ben aperti. Stefano Lavorini

avori in corso. In questo preciso avvertimento sta, probabilmente, la giusta chiave di lettura per comprendere come e perché la SIT di San Marino sia diventata una delle realtà di spicco nel settore della stampa e trasformazione di imballaggi flessibili per prodotti alimentari e non. Una frenetica e continua laboriosità e non solo in senso figurato. Lo scopro incontrando nella sede di Faetano, sotto il

L

monte Titano, la fondatrice e presidente Simona Michelotti e il direttore generale Claudio Carattoni, che mi raccontano, con accenti diversi, ma comunque con l’immancabile calore e garbo, dei tanti progetti che stanno portando avanti... La costruzione ex novo, ormai quasi ultimata, del reparto incisione: un’area di circa 4.500 metri quadri coperti compreso un magazzino automatizzato per lo stoccaggio di 24.000 cilindri.

Without heSITation The SIT group continues to grow in the flexible packaging world. Figures to hand, it is surprising how the San Marino based concern has managed to maintain the balance, year after year, between results and investments, innovation and tradition. The secret?... Energy and intelligence and the capacity to dream with ones eyes open. Stefano Lavorini

Work in progress. This specific indication probably enables one to understand how and why SIT of San Marino has become one of the leading lights in the flexible food packaging print and converting sector and beyond.

www.dativoweb.net

A frenetic and ongoing laboriousness and not only in the symbolic sense. This I discovered on meeting its founder and president Simona Michelotti and general director Claudio Carattoni in the company’s Faetano headquarters at the

Il reparto incisione, realizzato con criteri allo stato dell’arte, è stato volutamente dimensionato per coprire solo in parte il fabbisogno produttivo del Gruppo e questo per consentire la prosecuzione del rapporto di servizio e sviluppo tecnologico con fornitori esterni specializzati. E poi, sempre per restare in “campo edile”, i nuovi uffici della corporate, Sit Group a cui fanno capo i tre siti produttivi specializzati per prodotto/mercato: la SIT

foot of monte Titano. Who, while offering different insights, but with that unfailing warmth and garb of theirs, told me of the many projects they have underway. The complete reconstruction, now almost finished, of the engraving section: a covered area of 4,500 sqm including automated storage facilities for 24,000 cylinders. A state-of-the-art engraving section, purposefully scaled to enable the prosecution of service and relations and technological development with the company’s specialised external suppliers. And then, to still stay on the construction industry side of things, the new offices of the corporate SIT Group comprising the

three production sites specialised per product/market: SIT (San Marino) and SITITALIA (Pesaro), that uses gravure technology, as well as the SAREL PLAST (Stanghella, Padua), specialised in flexographic printing.

RECURRING FEATURES I return to SIT and as ever recognize, among the many changes, the elements that basically connote this concern, proving the importance, if experienced with conviction and not for convenience’s sake, of the ethical values upon which a company has been founded, but also of the strategies and the work programs, provided these are

4/14 • 57


[

IN D U S T RY & MA NA G E ME NT

]

Simona MIchelotti con Neni Rossini

Claudio Carattoni

(San Marino) e la SITITALIA (Pesaro), che utilizzano tecnologia rotocalco, nonché lo stabilimento SAREL PLAST (Stanghella, Padova) dove si stampa in flessografia.

CORSI E RICORSI Torno in SIT e riconosco sempre, tra i tanti cambiamenti, gli elementi connotativi di

well pondered and not improvised,. A continuum in no way a foregone conclusion, considering the evolution starting from 1967, when Simona Michelotti along with her father Romano first set up the company Rotostampa and then went on to found SIT in 1971: I remember her tale of the beginnings, as to how her being a woman led to her underestimation by some interlocutors and how this has even played to her advantage. And then, once the company had “grown up”, how reluctant she had been to leave her old office next to the production section, where according to her, the noise of the print machines and the smell of ethyl acetate strengthened

58 • 4/14

fondo di questa realtà, a riprova di quanto possano essere importanti i valori etici su cui si fonda l’impresa, se vissuti con convincimento e non per convenienza, ma anche le strategie e i programmi operativi, se ben ponderati e non improvvisati. Un continuum tutt’altro che scontato, considerando l’evoluzione a partire dal 1967, quando Simona Michelotti diede vita, con il padre Romano, prima alla società Rotostampa e poi, nel 1971, alla SIT. Ricordo la sua narrazione degli inizi, di come l’essere donna fosse stato oggetto di sottovalutazione da parte di alcuni interlocutori e di quanto, per certi versi, questo l’avesse avvantaggiata. E poi, una volta diventata “grande” l’azienda, con quanta riluttanza avesse accettato di lasciare il vecchio ufficio, contiguo al reparto di produzione dove, a suo dire, trovava forza e conforto nel rumore delle macchine da stampa e nell’odore dell’acetato di etile.

her and gave her a boost. Today, what remains of the past, as well as the values, is managerial expertise, passion and the quality of the human resources, because «it is the professionality and the motivation of the people who work in the company that makes the difference». Not to mention good common sense… that induced Michelotti to fund half the investment needed for the new buildings using her own and company financial resources… to keep out of the hands of the banks.

GROWING WELL As stated the Group’s activity centres on

Oggi, del passato, restano, oltre ai valori, managerialità, passione e qualità delle risorse umane perché «è la professionalità e la motivazione delle persone che operano in azienda a fare la differenza». E il buon senso… che ha indotto la Michelotti a finanziare con mezzi propri e societari la metà dell’investimento necessario per la nuova costruzione… tanto per non mettersi nelle mani delle banche.

CRESCERE BENE L’attività del Gruppo, come detto, è la stampa rotocalco e flessografica di film trasparenti e metallizzati, carta, ma anche accoppiamento, con e senza solventi, e trattamenti specifici per esigenze grafiche e di protezione del prodotto. Questa realtà è fortemente orientata alla total quality e agisce secondo norme di Good Manufacturing Practice (GMP), ma anche con attenzione all’etica, al rispetto umano, per l’ambiente e verso la realtà

gravure and flexographic printing on transparent and metalized film, paper, but also laminating with or without solvents and specific treatments for graphics and product protection. This concern is strongly total quality oriented and acts according to GMP standards, but also with an eye to ethics, respect for human beings, the environment and for society has a whole. Summing SIT’s value in figures: in a tricky market like that of these last few years, at the end of 2013 turnover was up 12%, reaching the level of 111 million euros, 50% made in Italy 50% abroad. Production, over 50% made in the Italian facilities, has exceeded 450 million sqm.

An enviable performance, the result of careful planning that has enabled them to attain the objectives set in the 2012/2016 program ahead of time. Very good, even beyond expectations, the performance of the gravure printing activities, to the point that at SITITALIA in the period 2012/2013 not one but two new print machines were installed, while in SIT work has for some time now been organized over four shifts. Here likewise flexographic printing has shown successful growth, having increased 30%, though without new machines, thanks to the interest demonstrated by both important Italian and foreign customers.

www.dativoweb.net


[

sociale. Di quello che “vale” la SIT dicono in sintesi le cifre: in un mercato non facile come quello di questi anni, l’esercizio 2013 ha chiuso con un fatturato in crescita dell’ 11%, raggiungendo quota 111 milioni di euro, di cui 50% in Italia e altrettanto all’estero. La produzione, realizzata per oltre il 50% negli stabilimenti italiani, ha superato i 450 milioni di mq. Performance invidiabili, frutto di un’attenta pianificazione che ha permesso di anticipare gli obiettivi stabiliti nel programma 2012/2016. Molto bene, addirittura al di là delle aspettative, l’andamento dell’attività connessa alla stampa rotocalco, tanto che in SITITALIA sono state installate nel biennio 2012/2013 non una, ma due nuove macchine da stampa, mentre in SIT la turnazione è organizzata già da tempo su quattro squadre. In questo contesto, non è da meno la cre-

Rather, today the objective is that of concentrating on this market segment at international level, with targeted investments already scheduled in the 2013/2018 program, aiming in particular at fostering greater efficiency and new developments as already done in the gravure print field, so as to best exploit the peculiarities of this technology (ink consumption, costs and footprint of the print systems, etc.).

LOOKING ABROAD San Marino, Italy, Europe…SIT’s market is fundamentally continental. The service component and the printed flexible packaging supply time can be considered

www.dativoweb.net

scita di fatturato relativa alla stampa flessografica, in aumento del 30%, senza nuove macchine, grazie all’interesse dimostrato da importanti clienti italiani ed esteri. Anzi, oggi, l’obiettivo è proprio quello di concentrarsi anche su questo segmento di mercato a livello internazionale, con investimenti mirati già previsti nel programma 2013/2018, puntando in particolare alla ricerca di efficienza e di nuovi sviluppi come già fatto nel campo della stampa rotocalco, in modo da sfruttare al meglio le peculiarità di questa tecnologia (consumi di inchiostro, costi e ingombri degli impianti di stampa, ecc.).

GUARDANDO OLTRE CONFINE San Marino, Italia, Europa… il mercato della SIT è fondamentalmente quello continentale. La componente di servizio e la tempistica nella fornitura di imballaggio flessibili stampati possono essere considerati dei limiti al processo di internazio-

a limit to the process of internationalisation, but at the same time also an obstacle to entering onto the markets of their Indian and Asian competitors. This fact though is experienced as an opportunity to be grasped:«To increase our proximity with the medium-to-large sized European companies, in 2013 we set up SIT EUROPE, based in Luxembourg, the first tile of a dedicated commercial network with MT personnel for the various countries/geographic areas» Claudio Carattoni explains with conviction. But there is more. Today competition is done on prices, but aboveall by creating

INDUSTRY & MA NA GEMENT

]

nalizzazione, ma parimente anche un ostacolo all’ingresso sul mercato di concorrenti indiani e asiatici. Questo dato di fatto è vissuto però come un’opportunità da valorizzare: «Per aumentare la nostra prossimità con le aziende medio grandi europee, abbiamo costituito nel 2013 la SIT EUROPE, con sede in Lussemburgo, il primo tassello di una rete commerciale dedicata con persone madrelingua per i diversi paesi/aree geografiche» spiega con convinzione Claudio Carattoni. Ma non solo. «Oggi la competitività la si fa sui prezzi, ma soprattutto creando processi di valore. Per questo abbiamo puntato su processi evoluti di supply chain, dall’implementazione di modelli di planning collaborativo con i nostri principali clienti e fornitori alla realizzazione di hub logistici, in collaborazione con un importante provider europeo, rispettivamente in Germania e in Francia.

value processes. For this we have aimed at evolved supply chain processes, from the implementation of cooperative planning with our main customers and suppliers to the creation of logistics hubs, in cooperation with an important European provider, respectively in Germany and France. Both internationalisation as well as valorizing service highlights the importance of optimising company processes and investing in manpower: in this sense the application and the respect of rules of behaviour agreed upon and shared with the workforce is fundamental». Capacity of vision and working

pragmatism enable SIT to think big and to set themselves even more ambitious objectives. Carattoni confirms:«We are investing in a project that will enable us to accompany our customers’ growth on the world markets, thanks to the competency we have built up solving their problems of packaging material procurement. It is no easy thing, but we have faith. In general - the CEO of SIT continues - I can say that I see it as positive that we can keep up with the changes affecting the world of end-users, and at times, even anticipate the same».

THE FUTURE IN MIND Objective of 2018: 170 million turnover,

4/14 • 59


[

IN D U S T RY & MA NA G E ME NT

] del settore: in particolare tutto quanto attiene a imballaggi attivi e intelligenti e alle nanotecnologie, senza trascurare gli aspetti legati alla nobilitazione dei supporti. Noi vogliamo arrivare a proporre alle aziende utilizzatrici, e in particolare al marketing, studi e ricerche, nonché nuove soluzioni di imballaggio. Progetti ad hoc che possono essere industrializzati non necessariamente in SIT. Un esempio: abbiamo messo a punto una vernice che restituisce un particolare effetto tattile al film, utilizzato per confezionare uova di Pasqua».

IN CONCLUSIONE

Tanto l’internazionalizzazione quanto dare valore al servizio mettono in evidenza quanto sia importante ottimizzare i processi aziendali e investire sugli uomini: in questo senso è fondamentale l’applicazione e il rispetto di regole di comportamento concordate e condivise con i lavoratori». Capacità di visione e pragmatismo operativo permettono alla SIT di pensare in grande e di darsi obiettivi ancora più ambiziosi. Carattoni conferma: «Stiamo investendo in un progetto che ci dovrebbe permettere di accompagnare i nostri clienti nella loro crescita sui mercati mondiali, risolvendo per loro conto, grazie alle competenze che abbiamo maturato, il problema dell’approvvigionamento dei materiali da imballo. Non è cosa facile, ma sono fiducioso. In generale - continua il DG della SIT - posso dire che vedo in positivo il fatto che riusciamo a stare al passo con i cambiamenti che investono il mondo degli end-user e, a volte, anche ad anticiparli».

with over 550 persons. SIT has clear ideas. It is not presumptuousness, but the awareness that it is always worth setting oneself objectives to be subjected to continuous checks and periodic revision. In this phase, for example, the undertakings for optimising the productive capacity of the current sites – that for gravure printing are already two as by now demanded by all the customers – while the building of the new works at Gualdicciolo (RSM) has been put off to 2015. But the qualifying aspect in which SIT continues to invest, and a lot, is still innovation, as Carattoni strives to

60 • 4/14

IN MENTE IL FUTURO Obiettivo 2018: 170 milioni di fatturato, con oltre 550 persone. In SIT hanno le idee chiare. Non c’è presunzione, ma la consapevolezza che vale sempre darsi degli obiettivi da sottoporre a continua verifica e a periodica revisione. In questa fase, ad esempio, sono stati privilegiati gli interventi per ottimizzare la capacità produttiva degli attuali siti - che per la stampa rotocalco sono già due come chiedono ormai tutti i clienti - mentre è stata differita al 2015 la costruzione del nuovo stabilimento di Gualdicciolo (RSM). Ma l’aspetto qualificante su cui la SIT continua a investire, e molto, resta l’innovazione, come non manca di sottolineare Carattoni: «Abbiamo un reparto di R&D con 9 persone specializzate impegnate a tempo pieno e stiamo valutando l’installazione di linee pilota per facilitare la realizzazione di test. Monitoriamo con attenzione l’evoluzione

underline:«We have an R&D section with a specialised personnel of 9 committed full time and we are evaluating the installation of pilot lines to facilitate the implementation of tests. We are carefully monitoring the evolution of the sector: in particular everything to do with active and intelligent packaging and nanotechnologies, without neglecting the aspects involving enhancement of substrates. We wish to be able to propose to user companies, and in particular to marketing offices, studies and research, as well as new packaging solutions. Special projects that may not necessarily be industrialised in SIT:

C’è poco da aggiungere, se non una suggestione che mi viene dal passato. Nelle “Vite parallele”, Plutarco metteva a confronto la storia di Teseo, ”fondatore della gentile e celebrata Atene” e di Romolo “padre dell’invitta e gloriosa Roma”. Ne emergeva, a suo dire, che il primo «mentre aveva la possibilità di regnare tranquillamente a Trezena… preferì di sua iniziativa partire da solo alla realizzazione di grandi cose; invece Romolo divenne semplicemente coraggioso per paura, come suona una celebre espressione di Platone, cioè per sottrarsi alla condizione di servaggio e alle punizione che lo minacciava …». Oggi, a distanza di lungo tempo, non parliamo più di Atene e Roma, ma di imprese. Ciononostante restano attuali le ragioni profonde che muovono le persone a tanto fare; forse non così nettamente identificabili, come nel mito, ma articolate e compenetrate tra loro in ragione della contingenza e delle occasioni. D’altronde siamo moderni… ma sono sempre energia e intelligenza le forze che costruiscono la realtà e, in definitiva, la storia personale e collettiva di tutti. Q

An example: we have devised a lacquer that gives film a particular tactile effect, used for packaging Easter eggs».

IN CONCLUSION There is little to be added, if not a suggestion that comes to me from the past. In “Parallel lives”, Plutarch compares the story of Theseus, “founder of the kind and celebrated Athens” and Romulus “father of the unvanquished and glorious Rome”. It emerged, in his opinion, that the first« while he had the possibility of reigning serenely at Troezene…preferred to depart alone on his own initiative to do great things; while Romulus simply

became brave through fear, citing a famous expression by Plato, that is to subtract himself from the condition of servitude and the punishment that threatened him…». Today, a long way off in time, we no longer speak of Athens and Rome, but of companies. All the same the deep reasons that spur people to exert themselves are still the same; perhaps not so clearly identifiable, as in the myth, but intricately compenetrated by contingency and opportunity. Indeed we are modern…yet as ever it is intelligence and force that build reality and, definitively, the personal and collective story of all. Q

www.dativoweb.net


&/1;

>ϰEĞdžƚ'ĞŶĞƌĂƚŝŽŶ >ĂƐƚĂŵƉĂŶƚĞŐůŽďĂůĞ ĐŚĞĨŝƐƐĂŶƵŽǀŝƐƚĂŶĚĂƌĚ ƉĞƌůĂƐƚĂŵƉĂƚĞƌŵŝĐĂ La CL4NX di SATO è la prima stampante veramente universale progettata in base alle necessità dell'operatore finale, ed è sapientemente realizzata per supportare nuove e esistenti applicazioni di stampa utilizzate in una vasta gamma di mercati verticali che richiedono una stampante durevole e affidabile per gli anni a venire. Tutte le caratteristiche meccaniche della stampante derivano da 33 anni di esperienza di SATO in termini di robustezza, affidabilità e semplicità di uso e manutenzione che ne fanno la macchina ideale per tutti gli ambienti operativi. L’ elettronica di ultima generazione progettata per questa macchina presenta capacità insuperabili nella gamma di riferimento: CPU Dual Core 800/800Mhz, con 2 GByte di memoria e display interattivo a colori con Menu in 30 lingue Interfacce multiple con selezione automatica: USB-A e USB-B, RS232, IEEE 1284, LAN e BluetootH standard, Wi-fi e RFID opzionali Font Interni Multinazionali Unicode e utilizzo di ulteriori TTF Unicode caricabili in memoria. Insieme ai menu multinazionali rende la CL4Nx ideale per installazioni WorldWide globali. Emulazioni con selezione automatica (SPBL, SZPL, STCL, SDPL e SIPL), Capacità di operare in Stand Alone con il sistema SATO AEP (Application Enable Printing), Driver Windows certificati, Cups per Apple e Linux e SAP ABAP. Testina Termica ad alta energia e alta resistenza per l’utilizzo su materiali più diversi e per una durata doppia rispetto ai modelli precedenti

OTTIENI PIU DETTAGLI SUL FUNZIONAMENTO E  E SULLE SPECIFICHE DELLA NUOVA SATO CL4NX SU

www.satoeurope.com


[

INDUSTRY & MA NA GEMENT

]

DALLA PRODUZIONE ALL’E-COMMERCE, CON ETICA CRESCERE NEL FOOD PACK Film plastici multistrato coestrusi rigidi e flessibili realizzati secondo standard di assoluto rigore. Impianti allo stato dell’arte e un servizio reso ancora più dinamico dal ricorso a tecnologie informatiche avanzate. E sopra a tutto, il valore dell’etica, imparato e fatto proprio in quasi mezzo secolo di storia imprenditoriale in costante divenire. Questa, in sintesi, è AMB SpA, produttore ai vertici del mercato europeo di materiali per imballaggio alimentare. Luciana Guidotti

el corso del tempo, AMB ha sempre dato prova di sapersi reinventare, confrontandosi con i temi più “caldi” dell’imballaggio alimentare e trovando ampie convergenze con il mondo accademico e della ricerca per sviluppare vera innovazione, nel segno della qualità e della sicurezza. Una strada, questa, segnata da investimenti costanti, espressione di un’imprenditorialità capace di mettere in relazione il futuro industriale della società con la cre-

N

From production to e-commerce, with ethics GROWING IN FOOD PACKAGING Multilayer coextruded rigid and flexible plastic film made according to the most rigorous standards. State-of-the-art systems and a service made even more dynamic by the resorting to cuttingedge IT. And aboveall, the value of ethics, learned and interiorised in almost half a century of entrepreneurial history constantly in the making. This, summing things up, is AMB SpA, producer at the top of the European food packaging materials market. Luciana Guidotti

In time AMB has always proven it is able to reinvent itself, tackling the “hottest” themes of food packaging and finding broad convergence with

www.dativoweb.net

the academic world and in the search for developing true innovation, seen in terms of quality and safety. A road this, marked by constant

scita culturale delle persone che lì operano, ma anche con uno sviluppo equilibrato del territorio a cui è legata da profondi legami. D’altronde, tutto nasce dal progetto originario della fondatrice di AMB, Renata Polano, che aveva l’obiettivo di creare un sistema virtuoso in grado di generare e distribuire risorse a tutti gli stakeholder. Merito, questo, degli attuali azionisti che, con caparbietà e competenza, non hanno mai perso la rotta tracciata nel 1969,

investments, expression of an entrepreneurship capable of relating the industrial future of the company to the cultural growth of the persons that work there, but also with a balanced growth of its surrounding territory to which it is bound by deep ties. Indeed everything has been born out of the original project of the founder of AMB Renata Polano, who had the objective of creating a virtuous system capable of generating and distributing resources to all stakeholders. Merit this of the current shareholders who, with stubbornness and competence, have never wavered from the course plotted in 1969,

even in a competitive environment like that of today’s chemical industry. During this long journey in the world of plastics AMB SpA has thus managed to constantly renew its enthusiasm following the evolution of the selfsame packaging and its customers. It was at the end of the eighties that the crucial changeover from the industrial to the food world was implemented. The company produces multilayer coextruded rigid and flexible plastic films and distributes its food market products the world over from its manufacturing site situated at San Daniele del Friuli (UD). In 2013 AMB registered a turnover of

4/14 • 63


[

IN D U S T RY & MA NA G E ME NT

] internazionale (la quota export 2013 è stata del 76,06% rispetto al 71,40% del 2012).

LO SGUARDO SUL FUTURO

anche in un ambiente competitivo come quello dell’industria chimica di oggi. Durante questo lungo viaggio nel mondo delle materie plastiche, AMB SpA è riuscita dunque a rinnovare costantemente il proprio entusiasmo, seguendo da vicino l’evoluzione del packaging stesso e dei propri clienti. È alla fine degli anni ‘80 che avviene il passaggio cruciale dal settore industriale a quello del food e, oggi, AMB Spa produce film plastici multistrato coestrusi rigidi e flessibili - studiati per mercato del food e distribuiti in tutto il mondo - dal suo sito produttivo di San Daniele del Friuli (UD). Nel 2013 l’azienda ha registrato un fatturato di oltre 70 milioni di euro e conta circa 165 dipendenti. Una sede modernissima, la consistente capacità produttiva, gli elevati standard qualitativi degli impianti e delle linee di produzione, l’alta specializzazione delle professionalità, fanno di AMB uno dei più competitivi fornitori di packaging a livello

over 70 million euros, counting 165 employees. Its ultra-modern site, its sizeable manufacturing capacity, the high quality standards of its equipment and production lines as well as its high specialisation and professionality make AMB one of the most competitive packaging suppliers at international level (the share of exports for 2013 was 76,06%, compared to the 71.40% of 2012).

A VIEW TO THE FUTURE The 1st of August AMB will celebrate its 45 years of activity and, for the

64 • 4/14

Il primo agosto 2014 AMB festeggerà i 45 anni di attività e, per l’occasione, la proprietà ha deliberato il 18 febbraio 2014 la trasformazione della società da Srl in Spa; contestualmente, il capitale sociale è stato portato a 1.050.000 euro. Coerentemente, il piano di sviluppo 2014-2015 messo a punto dall’azienda prevede di incrementare in modo sensibile la capacità produttiva, di migliorare le tecnologie di stampa e di ridurre i consumi energetici (ottenendo così Titoli di Efficienza Energetica). Tra le altre azioni previste, la creazione di un portale Big Data, l’adozione di sistemi di visione avanzati per la rilevazione dei difetti, studiati in collaborazione con l’Università di Udine e Padova, progetti di sviluppo intra UE di nuovi prodotti in partnership con fornitori di polimeri, resine e impianti, nonché laboratori di analisi. Infine, nel rispetto

occasion, the proprietorship deliberated on February 18th the change of status from Srl to SpA, while maintaining the existing company structure. On the same date the share capital was increased to 1,050,000 euros. Coherently, the development plan for 2014-2015 devised by the company expects to significantly increase its production capacity, to improve the print technology, reduce energy consumption (obtaining Energy Efficiency Certificates) as well as further improve the quality of printing. Among the other actions scheduled,

della filosofia “Zero Infortuni, Zero Difetti”, anche il lay out dello stabilimento sarà oggetto di miglioramenti. Il piano di investimenti prevede anche il potenziamento dell’organico, con l’assunzione di nuovi operatori. E, a testimonianza di una politica aziendale che riconosce nelle risorse umane un grande punto di forza, AMB continuerà a proporre corsi di formazione e a incentivare e sostenere le relazioni industriali e sindacali, con l’intento di migliorare costantemente le condizioni di lavoro e la condivisione dei risultati. Uno sviluppo, questo, finanziato tramite fondi agevolati regionali ed europei, con utili non distribuiti e con il mai venuto meno sostegno del sistema bancario italiano, sia per le linee di finanziamento a breve che a lungo termine. La piattaforma ambox.it e l’RFId Per tipologia di prodotto e servizio al cliente, AMB è tra i primi tre produttori di film per imballaggio di alimenti in Europa. La sua è, a tutti gli effetti, un’offerta completa, che spazia dai film rigidi per la termoformatura delle vaschet-

the creation of a Big Data portal, advanced vision systems for the detection of defects studied in collaboration with the University of Udine and Padua, inter EU development projects and new products in partnership with polymer, resin and system suppliers, as well as analysis laboratories, the improvement of all layouts in respect of AMB’s FCI driver: “Zero Accidents, Zero Defects”. The development plan, funded both through subsidized regional and European funds as well as by non distributed earnings, also provides for the hiring of at least 20 new operators.

The ambox.it platform and RFId In terms of type of product and customer service, AMB is among the three big food packaging film producers in Europe; it provides a complete offer, that goes from rigid films for thermoforming trays to flexible films for closure tops, up to printed film, produced to customer specifications and high quality standards. To further extend the company’s field of action, some sales and commercial strategies have been broached, that are showing great potential in the service area. We are speaking, first and foremost, of the

www.dativoweb.net


AMB: la produzione Foglie alta barriera per termoformatura - MAP Film rigidi e semi rigidi, multristrato, coestrusi e termolaminati, privi di colle e solventi, ideali per l’imballo di prodotto alimentari in atmosfera modificata con spessori da 150 a 1000 μ. I polimeri di base utilizzati per la loro produzione sono il poliestere amorfo (APET), il polietilene bassa densità (LDPE) E l’etilvinilalcool (EVOH). Le colorazioni più diffuse sono trasparente, bianco e nero e sono possibili tutti i colori della gamma pantone. Tutte le versioni sono stampabili fino ad 8 colori con tecnologia flexo ad acqua, tenendo conto in questo caso di uno spessore massimo di 500μ. Vengono utilizzate in prevalenza sulle machine FFS e sulle macchine termoformatrici per realizzare vaschette barriera di design, di grande impatto sugli scaffali della grande distribuzione e destinate a prodotti alimentari take-away. Possono essere utilizzati come fondo e come top termoformati. Foglie alta barriera per termoformatura - Vacuum Film flessibili, multistrato, coestrusi, privi di colle e solventi, ideali per l’imballo di prodotti alimentari sottovuoto, con spessori da 40μ a 200μ. I polimeri di base utilizzati per la loro produzione sono la poliammide (PA), il polietilene bassa densità (LDPE) e l’etilvinilalcool (EVOH). Si tratta in genere di film ad alta trasparenza, producibili in bianco, nero, rosso e altri colori su richiesta. Vengono impiegati sulle macchine FFS per realizzare confezioni sottovuoto di prodotti alimentari a media/lunga conservazione, presenti della grande distribuzione. Possono essere utilizzati come fondo e come top. Foglie flessibili alta barriera stampate e accoppiate Film flessibili, multistrato stampati e neutri, accoppiati con tecnologie solventless ad acqua, ideali per essere destinati all’imballo di prodotti alimentari in atmosfera modificata, sottovuoto e flowpack. I polimeri di base utilizzati per la loro produzione sono il poliestere biorientato (OPET), la poliammide biorientata (OPA), il polipropilene biorientato (OPP), il polietilene a bassa densità (LDPE), il polietilene a bassissima densità (LLDPE) e l’etilvinilalcool (EVOH). Sono film ad altissima trasparenza, realizzabili anche in bianco, in nero e in altre colorazioni richieste. Generalmente sono stampati con design sviluppati

www.dativoweb.net

dall’ufficio grafico AMB, in collaborazione con la grande distribuzione. L’utilizzo primario si rileva sulle macchine FFS e traysealer come coperchio e sulle flowpack per produrre sacchetti di ogni forma e tipo. Sono ideali nell’imballaggio della quasi totalità dei prodotti alimentari freschi a media e lunga conservazione presenti sul mercato. Foglie per laminazione e accoppiamento Film flessibili multistrato di ultima generazione, ideali per essere utilizzati da converter di film rigidi e flessibili, destinati in prevalenza all’imballo finale di prodotti alimentari, medicali e paramedicali. I polimeri di base utilizzati sono il polietilene bassa densità (LDPE), il polietilene a bassissima densità (LLDPE), il polipropilene (PP), la poliammide (PA) e l’etilvinilalcool (EVOH). Questi prodotti sono studiati per garantire prestazioni eccezionali in termini qualitativi e di affidabilità, così da garantire vantaggi produttivi ai clienti e agli utilizzatori finali. Sono utilizzati in prevalenza da grandi produttori di film rigidi estrusi e da stampatori specializzati, che necessitano di completare i propri prodotti applicando materiali con caratteristiche di scivolosità, pelabilità, antifog e anti U, altrimenti non ottenibili.

AMB: the production High barrier sheets for thermoforming - MAP Rigid and semi-rigid, multilayer, coextruded and thermo-laminated films, solventless and adhesive-free, suitable for packaging food products in modified atmosphere with thickness ranging from 150 to 1000 μ. The basic polymers used to produce these films are amorphous polyester (APET), low-density polyethylene (LDPE) and ethylene vinyl alcohol (EVOH). The most common colors are transparent, white and black, but all Pantone range colors are possible. All versions support printing in up to 8 colors with water-based flexographic technology, in this case with a maximum thickness of 500μ. The primary application of these products is with FFS machines and on thermoformers for the production of designer barrier tubs for an appealing shelf impact in retail, containing food products destined for take-away. High barrier sheets for thermoforming - Vacuum Flexible, multilayer and coextruded films, solventless and adhesive-free, suitable for vacuum packing food

products, with thickness ranging from 40μ to 200μ. The basic polymers used to produce these films are polyamide (PA), low-density polyethylene (LDPE) and ethylene vinyl alcohol (EVOH). These films are in general highly transparent, but can be produced as white, black, red and other colors by request. The primary application of these products is with FFS machines for producing vacuum packs for medium- to long-term preservation foodstuffs included in retail product lines. Printed and laminated high barrier flexible sheets Flexible, multilayer printed or plain films, laminated using solventless water-based technologies, suitable for packaging food products in modified atmosphere, vacuum or flowpacks. The basic polymers used to produce these films are bioriented polyester (OPET), bioriented polyamide (OPA), bioriented polypropylene (OPP), low-density polyethylene (LDPE), linear low-density polyethylene (LLDPE) and ethylene vinyl alcohol (EVOH). These highly transparent films can also e made white, black or in other colors by request. In general, they are printed with designs developed by AMB’s graphics department in collaboration with retailers. The primary application of these products is with FFS machines and traysealers as a cover and on flowpack machines for the production of bags of every shape and type. Virtually the entire market offer of fresh food products with medium and longterm shelf life can be packaged using these films. Sheets for lamination and bonding Latest generation multilayer flexible films suitable for application in converting rigid and flexible films destined primarily for the end packaging of food, medical and paramedical products. The basic polymers used to make these products are low-density polyethylene (LDPE), linear low-density polyethylene (LLDPE), polypropylene (PP), polyamide (PA) and ethylene vinyl alcohol (EVOH). These products are designed for high performance in terms of quality and reliability in order to guarantee production advantages to customers and end users. The primary application of these products is for major producers of extruded rigid films and specialized printers who need to finish their products by applying materials with low friction, peelability, antifog and anti-U properties, otherwise unobtainable.

4/14 • 65


[

IN D U S T RY & MA NA G E ME NT

]

L’IMBALLAGGIO? UN’OPPORTUNITÀ

te ai film flessibili per i top di chiusura, fino ai film stampati, prodotti secondo le specifiche richieste del cliente e di standard qualitativo elevato. Per ampliare ulteriormente il servizio al cliente, ha messo in campo alcune strategie di vendita e commerciali, che stanno rivelando grandi potenzialità sul piano del servizio. Parliamo, in prima battuta, della piattaforma sperimentale e-commerce “ambox. it”. Con un’attenzione particolare alle esigenze dei “micro-clienti”, AMB ha dato infatti vita a uno spazio e-commerce per facilitare gli acquisti immediati di piccole quantità di lotti standard con spedizione entro le 24 ore. Ma l’azienda ha razionalizzato anche la

“ambox.it” experimental e-commerce platform. Taking care of its “microcustomers”, AMB SpA has created an e-commerce place to facilitate the immediate purchase of small quantities of standard lots with shipment within 24 hours. The company has also rationalized its experience in “outbound” logistics, offering it to the market, while adopting ASIS services, dedicated to managing warehouses with RFid technologies. It is a system that not only enables stock management, storage lot optimization and the automatic issuing of autoreplenishment orders, it also

66 • 4/14

propria esperienza nella logistica “outbound”, mettendola a disposizione del mercato. In particolare, ha adottato i servizi ASIS, dedicati alla gestione dei magazzini con tecnologia RFId. Si tratta di un sistema che permette non solo di gestire le scorte, ottimizzare i lotti in giacenza, emettere in automatico gli ordini per l’autoreplenishment, ma fornisce gli elementi per gli adempimenti fiscali legati alla contabilità di magazzino, usualmente piuttosto complessa per i materiali di consumo. Il modello Asis è disponibile sia a bordo macchina o presso i magazzini dei clienti, sia presso i magazzini di Amb e dei suoi partner all’estero.

entails the fulfilment of warehouse accountancy fiscal obligations, usually fairly complex for consumables. The ASIS model is available both on board machine or at the customer’s warehouses as well as at AMB’s warehouses and those of its main partners abroad.

PACKAGING? AN OPPORTUNITY From preliminary studies to post sales, AMB shares its customers’ packaging problems turning them into an extraordinary opportunity. Certified ISO 9001:2000 and BRC-IoP, AMB SpA features for its

Dallo studio preliminare al post vendita, Amb condivide con il cliente il “problema” packaging trasformandolo in una straordinaria opportunità. Certificata ISO 9001:2000 e BRC-IoP, AMB SpA si distingue per la disponibilità nell’offrire al cliente la migliore assistenza in ogni fase: progettazione dell’imballo più adatto alle specifiche esigenze, studio del design e delle stampe personalizzate, progettazione delle strutture, riduzione dei costi, monitoraggio delle scorte a magazzino per il cliente, così da assicurare l’impiego del materiale entro i termini previsti, nonché il suo stoccaggio in luoghi idonei dal punto di vista igienico e climatico. Nel corso del 2013 ha avviato le procedure per ottenere la certificazione Oshas 18001 e la certificazione Ambientale ISO 14001 con registrazione Emas. Oltre ad avere in essere procedure di Risk Assessment e Risk Management per la tutela di tutte le controparti interessate, sempre nel 2013 AMB ha introdotto il Codice Etico: adottando la self regulation relativa alla Corporate Social Responsability, Amb è un’azienda etica e chiede il rispetto degli stessi criteri etici a fornitori e clienti. Non ha mai cessato di perseguire azioni di sostegno al mondo giovanile e a progetti culturali di ampio respiro, con contratti di sponsorizzazione o donazione e con una costante azione di supporto a bambini e ragazzi del territorio in cui opera. Insomma, per chiudere con un’affermazione cara al CEO, Bruno Marin «Non è finita finché non è finita». Q

readiness in offering best customer support in the design of the packaging that best suits the customer’s specific needs, design and personalised print studies, structural design, cost reduction, customer stock monitoring, to thus ensure a usage of materials within a given deadline, as well as storage in hygienically and climatically ideal facilities. During 2013 procedures for obtaining the OSHAS 18001 and ISO 14001 environmental certification along with EMAS registration were started up. 2013 witnessed the application within the

company of its own specific Code of Ethics. Adopting self-regulation on Corporate Social Responsibility, AMB is an ethical company and calls on its suppliers and customers to respect the same ethical criteria. The company has never ceased to pursue actions in support of youth and cultural projects, with sponsorship contracts or donations and with constant efforts to support children and young people on the territory in which it operates. To conclude with a statement dear to the CEO, Bruno Marin «It’s not over… until it’s over». Q

www.dativoweb.net


liberaadv.com

Among countless routes and stormy markets, only one single point of reference‌

one partner, one solution

Ronchi: A Guarantee of Competence and Reliability for Integrated Packaging Solutions We can study and realize integrated solutions, and test the whole line with the Customer before shipment inside our modern plant. As manufacturers of Bottle Unscramblers, Bottle Orienters, Puck Inserters, Filling Machines, Capping machines, Depuckers, we are the single partner for customized solutions suitable to satisfy any requirement of the packaging industry operators. A capillary network of sales and technical assistance all over the world ensures prompt and timely service, by providing full support for the Ronchi Customers in every country.

www.ronchipackaging.com


Every year, IMA dedicates 600,000 hours to research activities and 97% of IMA’s staff is hired on a permanent basis. The success of our automation is drawn from the expertise we foster on a daily basis, guaranteeing to all those who work with us the best conditions in which to express their talent.

Numbers are important. Especially when you figure them out.

Discover sustainable innovation INTERPACK 2014 | 814 May 2014 DÜsseldorf, Germany HALL 17

www.ima.it


VALUTAZI O NE DE I RIS CHI

[

A PRO PO SITO DI. . .

]

Il set off di materiali ÁHVVLELOLVWDPSDWL CONOSCERE PER VALUTARE Giflex e IrcPack hanno portato a termine un progetto relativo alla definizione di un metodo che consente di verificare la bontà del processo produttivo, la conformità delle materie prime utilizzate e fornisce uno strumento di controllo in caso di contenzioso. Proponiamo i risultati della ricerca focalizzata sulla valutazione del rischio di danno tossicologico e di danno sensoriale connessi al “set off”. Valter Rocchelli, Mara Baronciani

INQUADRAMENTO NORMATIVO La legislazione italiana ha da sempre tenuto in considerazione il rischio della contaminazione degli alimenti confezionati; la legge n. 283 del 1962 recitava infatti «I materiali ... non devono cedere sapori od odori che modifichino sfavorevolmente le proprietà organolettiche e rendano nocive le sostanze alimentari». Il principio rimane inalterato nei successivi atti legislativi, malgrado le evoluzioni tecniche e tossicologiche connesse con lo sviluppo di nuovi materiali ed è considerato anche negli atti legislativi comunitari. Infatti l’ultimo atto normativo quadro è il Regolamento 1935/2004 EC che, all’articolo 3 sancisce: «...i materiali e gli oggetti,...non trasferiscono ai prodotti alimentari componenti in quantità tali da: _) costituire un pericolo per la salute umana o `) comportare una modifica inaccettabile della composizione dei prodotti alimentari o r) comportare un deterioramento delle loro caratteristiche organolettiche». Il Regolamento CE n. 2023/2006 sulle buone pratiche di fabbricazione dei materiali e degli oggetti destinati a venire a contatto con prodotti alimentari, in relazione alle norme specifiche sulle buone pratiche di fabbricazione e nel caso di «Processi che prevedono l’applicazione di inchiostri da stampa sul lato di un materiale o di un oggetto non a contatto con il prodotto alimentare» stabilisce che: 1. Gli inchiostri da stampa applicati sul lato dei materiali o degli oggetti non a contatto con il prodotto alimentare devono essere formulati e/o applicati in modo che le sostanze presenti sulla superficie stampata non siano trasferite al lato a contatto con il prodotto alimentare: a) attraverso il substrato oppure b) a causa del set-off quando vengono impilati o sono sulle bobine, in concentrazioni che portino a livelli di sostanza nel prodotto alimentare non in linea con le prescrizioni di cui all’articolo 3 del regolamento (CE) n. 1935/2004; 2. I materiali e gli oggetti stampati in stato finito o semifinito vanno movimentati e immagazzinati in modo che le sostanze presenti sulla superficie stampata non siano trasferite al lato a contatto con il prodotto alimentare: a) attraverso il substrato oppure b) a causa del set-off quando vengono impilati o sono sulle bobine, in concentrazioni che portino a livelli di sostanza nel prodotto alimentare non in linea con le prescrizioni di cui all’articolo 3 del regolamento (CE) n. 1935/2004; 3. Le superfici stampate non devono trovarsi direttamente a contatto con il prodotto alimentare.

www.dativoweb.net

L’impianto normativo richiede quindi che gli inchiostri siano formulati e processati secondo GMP in modo tale che non cedano all’alimento sostanze in quantità tali da generare situazioni di non conformità all’articolo 3 del regolamento 1935/2004.

PROTOCOLLO PER LA VALUTAZIONE DEL SET-OFF In base a quanto riportato al paragrafo precedente è necessaria la valutazione del rischio di danno tossicologico, oggetto di questo articolo, e la valutazione del rischio di danno sensoriale, connessi al “set off”. Sulla base di questa esigenza IRCPACK e SEPACK-LAB hanno messo a punto, in collaborazione con Giflex, Gruppo di Assografici, che raggruppa i produttori di materiali flessibili, un protocollo di valutazione del set-off per film e laminati, stampati in rotocalco e/o flessografia, destinati a contenere alimenti. Il protocollo prevede: • un’ indagine analitica che utilizza metodi di screening per il monitoraggio, con apposite tecniche strumentali basate principalmente sulla gascromatografia/spettrometria di massa, dei composti organici volatili, semivolatili e non volatili contenuti negli inchiostri. L’indagine analitica viene focalizzata sia sul totale del materiale sia sul lato a diretto contatto con l’alimento; • un’elaborazione dei dati ottenuti per verificare la presenza di composti definibili “critici”, per natura o per quantità.

Giflex e il set off: le ragioni di uno studio L’associazione italiana delle aziende produttrici di imballaggi flessibili - Giflex guarda da sempre con un occhio di riguardo agli aspetti tecnici e normativi che riguardano la filiera del packaging alimentare. La necessità di rispettare a fondo i requisiti di legge e, in primo luogo, la volontà di garantire la sicurezza assoluta dei prodotti realizzati, ha portato il gruppo a investire risorse umane ed economiche in studi e ricerche pratiche, con l’obiettivo di fornire alle aziende associate strumenti efficaci per garantire gli elevati standard di sicurezza richiesti. In quest’ottica, la proficua collaborazione che lega Giflex a IRCPACK ha dato vita al progetto relativo alla messa a punto di un metodo di controllo in grado di rispondere ai requisiti del dettato legislativo riportato nell’allegato del Regolamento quadro della comunità Europea 2023/2006/CE, meglio noto come GMP. Il metodo consente di verificare la bontà del processo produttivo, la conformità delle materie prime utilizzate e fornisce un metodo di controllo in caso di contenzioso. Grazie alla professionalità e alle competenze degli autori di questo studio, nel corso dei lavori, è emerso che la qualità e la mole dei dati ricavati permetteva di dare all’intera ricerca un respiro più ampio, estendendo l’analisi anche ai modelli di valutazione del rischio in conformità con i più recenti orientamenti della disciplina dei materiali a contatto con gli alimenti. (Ing. Italo Vailati).

4/14 • 69


[

A P RO P O S I T O DI ...

]

VA L U TA Z I ONE D E I R I SCHI

In questo caso, l’esigenza espressa dal Giflex era che i metodi analitici previsti dal protocollo fossero utilizzabili industrialmente per i controlli di produzione, caratterizzati da semplicità di esecuzione, affidabilità dei dati, riproducibilità. Alle luce di queste esigenze - nonché sulla base dell’esperienza di studi precedenti sulle problematiche di interazione imballaggio/alimento, in particolare sulla valutazione di differenti tipologie di inchiostri da stampa - abbiamo messo a punto e validato i metodi analitici riportati nel seguito.

METODI ANALITICI Le tecniche strumentali impiegate per il monitoraggio di composti organici volatili, semivolatili e non volatili presenti nei materiali stampati e provenienti dagli inchiostri si basano sulla gascromatografia/spettrometria di massa. L’indagine analitica viene eseguita sia sul totale del materiale (analisi di screening di I livello) sia sul lato a diretto contatto con l’alimento, per verificare l’eventuale presenza di composti provenienti dagli inchiostri da stampa (analisi di screening di II livello). Analisi di screening di I livello. L’ampio spettro di composti da monitorare rende necessaria l’applicazione di due metodi che prevedono tecniche di campionamento diverse una finalizzata alla determinazione dei composti volatile e l’altra mirata ai composti non volatili. 1) Identificazione e valutazione semiquantitativa di composti organici volatili e semivolatili sul totale. Metodo di analisi: spazio di testa statico di un’aliquota di materiale condizionata in fiale da 20 ml a 125 °C per 30 minuti previa aggiunta di standard interno (clorobenzene). Il campionamento è stato effettuato mediante spazio di testa statico automatico seguito da analisi in gascromatografia/spettrometria di massa. Il metodo è conforme a: Norma UNI EN 13628-2 parte 2 - metodo industriale - Condizionamento del campione: 125 °C per 30 minuti. I solventi residui, eventualmente presenti, vengono quantificati con la Norma UNI. 2) Identificazione e valutazione semiquantitativa di composti organici semivolatili e non volatili sul totale del campione. Metodo di analisi: estrazione con solvente (n-esano: 10 ml) di 1 dm2 di campione, aggiunta di standard interno e analisi in gascromatografia/spettrometria di massa. Analisi di screening di II livello. Identificazione e valutazione semiquantitativa di composti organici semivolatili e non volatili sulla faccia interna del film, a diretto contatto con gli alimenti . Metodo di analisi: lavaggio di 2 dm2 di superficie interna mediante contatto breve (10 minuti per ciascun lato) con adeguato volume di n-esano contenente uno standard interno. Il solvente viene analizzato mediante gascromatografia/spettrometria di massa. Le condizioni riportate sono arbitrarie e rispondono soprattutto all’esigenza di avere risposte in tempi brevi. Il dato fornito può essere considerato risolutivo solo in determinate condizioni, come verifica della presenza/assenza di picchi. Nel primo caso potrebbe essere necessario un approfondimento con metodi di contatto normati, ad esempio isottano 2 gg a 20 °C o etanolo al 95% per 10 giorni; pertanto dovranno essere allestite vere e proprie migrazioni specifiche. In questi casi il dato, salvo naturalmente per i picchi non identificati, sarà quantitativo.

ESPRESSIONE DEI RISULTATI La reportistica prevede la presentazione dei cromatogrammi, opportunamente integrati, e relative tabelle che riportano:

70 • 4/14

• il tempo di ritenzione (TR) del picco che appare anche sul cromatogramma; • l’identificazione ottenuta mediante confronto degli spettri di massa con quelli presenti nella libreria (NIST-WILEY) gestita dal software del sistema analitico; • le qualità dell’identificazione, ossia l’indice di coincidenza tra lo spettro del picco e quello di confronto contenuto nelle librerie spettri utilizzate (massimo 100 - accettabile > 70); • valutazione semiquantitativa: i metodi non sono quantitativi ma per ottenere una stima delle concentrazioni dei composti rilevati nello spazio di testa o nei solventi di estrazione e lavaggio, abbiamo espresso, in μg/dm2 il dato di “valutazione semiquantitativa” attribuendo ai vari picchi (identificati e no), il fattore di risposta degli standard interni aggiunti calcolato sulla base dell’area dei picchi stessi. Ai piedi della tabella sono riportati: • sensibilità analitica con riferimento allo standard interno; • incertezza % sui dati semiquantitativi; • eventuali note che si riferiscono al cromatogramma o alle tabelle. La dicitura “non identificato” significa che lo spettro relativo al picco non è confrontabile con nessuno tra quelli presente nelle librerie spettri a disposizione del laboratorio. In questo caso il picco viene segnalato nella tabella come “non identificato” e vengono citati i principali ioni che caratterizzano il relativo spettro di massa. Valutazione semiquantitativa o quantitativa. Per quanto riguarda le analisi di screening di I livello l’output è, in primis, semi-quantitativo e riporta le concentrazioni dei composti rilevati ottenute applicando il fattore di risposta dello standard interno. Questo sistema di calcolo rappresenta un’approssimazione perché la “precisione” di un dato semiquantitativo è influenzata, nelle analisi di screening qui descritte, da diversi fattori: • l’acquisizione in “full scan - TIC” del rivelatore a selezione di massa è meno precisa, per la misura delle aree dei picchi, dell’acquisizione in “single ion monitoring – SIM” utilizzato nelle analisi quantitative; • differenza anche notevole di risposta fra i diversi composti e lo standard interno; • nell’analisi in spazio di testa va considerata anche la differente ripartizione matrice/spazio di testa. Tuttavia i sistemi analitici gas/massa utilizzati in Sepack-Lab permettono di acquisire contemporaneamente in “TIC” e in “SIM”. È quindi possibile, con la stessa analisi, avere uno screening qualitativo e semiquantitativo e nello stesso tempo un’analisi quantitativa di composti calibrati. Ad esempio l’analisi in spazio di testa fornisce anche un’analisi quantitativa dei solventi residui secondo la norma UNI EN 13628-2 parte 2 – metodo industriale e di altri composti eventualmente calibrati. Lo stesso accade per l’analisi dell’estratto in solvente del campione intero: in contemporanea al dato di screening è possibile fare una determinazione quantitativa di altri composti come plastificanti, fotoiniziatori, antiossidanti, scivolanti etc.

VALIDAZIONE DEI METODI La validazione dei metodi è stata eseguita mediante prove di ripetibilità, per ognuno dei metodi, eseguendo 10 repliche su alcuni campioni. Nelle tabelle 1, 2 e 3 sono riportati i risultati ottenuti, ma compaiono anche: TR = tempo di ritenzione del picco, Media = valore medio espresso in μg/dm2, m= deviazione standard, RSD% =deviazione standard relativa percentuale.

www.dativoweb.net


VALUTAZI O NE DE I RIS CHI

Tabella 1 - Prove di ripetibilità metodo per l’identificazione e la valutazione semiquantitativa di composti organici volatili e semivolatili sul totale. TR Identificazione picco MEDIA semiquantitativa m μg/dm2 5.42 Acetato di etile 7,7 2,0 8.65 Cloro benzene 2,8 (standard interno) 9.67 Idrocarburo alifatico 20,6 1,8 saturo ramificato

RSD% 26,2 -

RSD%

14,5 4,5 16,1 4,1 10,5 18,7

Inoltre, in un circuito ristretto a 4 laboratori, è stato eseguito un test interlaboratorio; ai partecipanti sono stati inviati 4 campioni di film da analizzare e una procedura operativa da seguire per applicare il protocollo per la valutazione del set off (da noi definito). Il numero esiguo di partecipanti non permette un’elaborazione statistica, pertanto i risultati, riportati a titolo di esempio nelle tabelle 4, 5 e 6 sono da considerarsi solo indicativi e di confronto fra i laboratori partecipanti. Tabella 4 - RING TEST campione 03: metodo per l’identificazione e la valutazione semiquantitativa di composti organici volatili e semivolatili sul totale. Valutazione Semiquantitativa μg/dm2 Identificazione picco Lab.1 Lab. 2 Lab. 3 Lab. 4 Cloro benzene (standard interno) 2,8 2,8 2,8 2,8 acetato di etile 36 22 20 28 n-propil acetato 5,7 3,8 2,8 7,6

www.dativoweb.net

A PRO PO SITO DI. . .

]

Tabella 5 - RING TEST campione 03: metodo per l’identificazione e la valutazione semiquantitativa di composti organici non volatili sul totale. Valutazione Semiquantitativa μg/dm2 Identificazione picco Lab.1 Lab. 2 Lab. 3 Lab. 4 Dipropil ftalato (standard interno) 25 25 25 25 Acetil tributil citrato 509 692 139 575 Non identificato (m/z = 155,173) 22 23 20 19

9,0

Tabella 2 - Prove di ripetibilità metodo per l’identificazione e la valutazione semiquantitativa di composti organici non volatili sul totale. TR Identificazione picco MEDIA m RSD% semiquantitativa μg/dm2  12.99 n-ottadecano 23,7 1,8 7,4 14.16 Di isopropil ftalato 25 14.72 Non identificato 18,9 0,8 4,6 (m/z = 97,126,155,173) 16.13 Acetil tributil citrato 94,2 16,8 16,1 17.08 Idrocarburo alifatico insaturo 14,6 1,3 9,0 19.71 Erucamide 94,4 9,6 10,1 36,00 Octadecil-389,5 4,5 5,1 (3,5 ditert butil-4-idrossifenil) propionato (Irganox 1076) Tabella 3 - Prove di ripetibilità metodo per l’identificazione e la di composti organici non volatili sul lato interno. TR Identificazione picco MEDIA m semiquantitativa μg/dm2 12.99 n-ottadecano 6,4 0,9 14.16 Di isopropil ftalato (standard interno) 12,5 14.72 Non identificato (m/z = 97,126,155,173) 10,3 0,5 16.13 Acetil tributil citrato 7,5 1,2 17.08 Idrocarburo alifatico insaturo 8,3 0,3 19.71 Erucamide 50,0 5,2 35.96 Octadecil-319,8 3,7 (3,5 ditert butil-4-idrossifenil) propionato (Irganox 1076)

[

Tabella 6 - RING TEST campione 03: metodo per l’identificazione e la valutazione semiquantitativa di composti organici non volatili sul lato interno. Valutazione Semiquantitativa μg/dm2 Identificazione picco Lab.1 Lab. 2 Lab. 3 Lab. 4 Dipropil ftalato (standard interno) 13 13 13 13 Acetil tributil citrato 166 112 77 122 Non identificato (m/z = 155,173) 12 6,4 10 6,4

VALUTAZIONE E INTERPRETAZIONE DEI RISULTATI La valutazione del set off non è una semplice analisi ma uno studio di valutazione del rischio piuttosto complesso e come tale va refertato. Presso le strutture IRCPack e Sepack-Lab è stata messa a punto una linea guida per la stesura delle relazioni tecniche relative a studi di set-off. Lo schema della relazione tecnica prevede, oltre ai dati essenziali di un report (laboratorio, richiedente, data di arrivo campioni, data di analisi, identificazione del campione), anche le seguenti informazioni: • descrizione dei metodi analitici applicati; • criteri di espressione dei dati; • cromatogrammi in corrente ionica totale; • tabelle dei composti rilevati con la rispettiva valutazione semiquantitativa; • indicazione della “sensibilità analitica” con riferimento allo standard interno usato; • incertezza % sui dati semiquantitativi. Fino a questo punto è un report delle analisi svolte. Da questo punto in poi la refertazione diventa una relazione tecnica relativa a una valutazione del rischio che prevede tre steps operativi: 1. Hazard Identification 2. Risk charaterisation 3. Risk evaluation Lo step n. 1 è relativo ai risultati delle analisi. Lo step n. 2 acquisisce informazioni sui composti identificati mediante un confronto con documentazioni normative e altro: liste positive del regolamento 10/2011 CE del DM21/3/73; opinioni EFSA; Inventory list e documenti COE; Normative extra CE come Ordinanza Svizzera 817.023.21, FDA etc.; Raccomandazioni, ad esempio BFR; Lista additivi alimentari autorizzati, ad esempio Regolamento di esecuzione UE n. 872/2012 della Commissione EC del 01/10/2012; Lista esclusione EUPIA, norma volontaria con la quale i produttori di inchiostri europei si impegnano a non utilizzare i composti elencati perché pericolosi per la salute; Data base composti cancerogeni. Lo step n. 3 valuta le informazioni acquisite con lo step n. 2. Complessivamente i composti rilevati ricadono in queste categorie. • Se il composto è identificato ed è presente in liste positive con una restrizione come migrazione specifica, si confronta la quantità riscontrata nel materiale con un’eventuale limite di migrazione specifica del composto; se il dato di migrazione specifica teorica (calcolato considerando una migrazione del 100%) è sotto il limite di migrazione specifica (LMS), la situazione è NON critica; al contrario risulta necessario verificare il rispetto del LMS monitorando la pre-

4/14 • 71


[

A P RO P O S I T O DI ...

]

VA L U TA Z I ONE D E I R I SCHI

Come redigere una Relazione Tecnica Le figure e le tabelle riportate offrono un esempio di “Relazione Tecnica”.

1) Risultati composti organici volatili e semivolatili - totale

TR Identificazione picco qual Valutazione semiquantitativa μg/dm2 5.43 Acetato di etile 91 350 * 13.11 clorobenzene (standard interno) 98 2,8 Limite di determinazione: 1 μg/dm2 Incertezza associata alla misura: ± 40% (*) dato quantitativo determinato in accordo con la Norma UNI EN 13628-2 parte 2.

Identificazione picco qual Valutazione semiquantitativa μg/dm2 Adipato ciclico di dietilenglicole * 26 Di propil ftalato (standard interno) 94 25 Acetil tributil citrato e suoi composti >90 136 di decomposizione in fase di analisi 18.62 Nitrile ** 20.05 Erucammide 91 48 26.57 Octadecil-3- (3,5 ditert butil-490 228 idrossifenil) propionato (Irganox 1076) Limite di determinazione: 5 μg/dm2 Incertezza associata alla misura: ± 30% (*) l’identificazione riportata non è prodotta da confronto con librerie ma da informazioni altrimenti ottenute. (**) nitrili: prodotti di decomposizione delle corrispondenti ammidi che si formano anche in fase di analisi. TR 13.26 14.26 16.75

3) Risultati composti organici non volatili - lato interno

2) Risultati composti organici non volatili - estratto totale

senza del composto nel lato interno e/o allestendo le prove di migrazione specifica con i simulanti previsti nel caso specifico. • Se il composto è identificato ma non è presente in alcuna lista positiva, bisogna in primo luogo escludere che sia CMR cioè cancerogeno, mutageno o tossico per la riproduzione oppure che sia nella lista di esclusione EUPIA. Un secondo livello di ricerca prevede il reperimento di dati tossicologici (tossicità acuta) già esistenti in base ai quali si possono fare le opportune valutazioni. Si deve tener conto, in ogni caso, che un composto non listato e non CMR, non può superare il valore di migrazione specifica di 0,01 mg/kg; questo valore di riferimento definisce la barriera funzionale di uno strato posto a contatto con l’alimento nei riguardi di composti non listati. • Se il composto non è listato ma è un additivo alimentare autorizzato, la sua eventuale presenza o migrazione non è da considerarsi critica. • Se il composto non è identificato significa che lo spettro relativo al picco non è confrontabile con nessuno tra quelli presente nelle librerie spettri. In questo caso non è possibile fare una valutazione dell’aspetto tossicologico; occorre quindi, se sussistono effettivi rischi di migrazione (presenza nel lato interno) capire da quale materia prima si origina (inchiostro, adesivo, supporto) e, di conseguenza, valutare la possibilità di identificazione con il produttore della materia prima in oggetto. Le conclusioni dello studio di valutazione del set-off verranno trat-

72 • 4/14

te in base alle considerazioni sui composti rilevati e segnaleranno la presenza o l’assenza di situazioni critiche dal punto di vista del rischio di danno tossicologico ed l’indicazione di eventuali azioni da intraprendere nel secondo caso. Ad esempio la presenza di un composto CMR non listato o di un composto presente nella lista di esclusione EUPIA rappresenta una situazione per lo meno critica se non in contrasto con il Reg. 1935/2004 CE art. 3. Nel caso specifico devono essere condotti approfondimenti analitici per verificare quale componente o fase del processo possa aver introdotto il composto e, di conseguenza, avviare opportune azioni per “eliminarlo”.

CONCLUSIONI Il protocollo di valutazione del set-off è stato applicato “sul campo” nell’ambito di uno studio richiesto da Giflex per conoscere e valutare la situazione del set-off su diverse tipologie di materiali flessibili stampati. Lo studio, eseguito in tre fasi, ha preso in considerazione 75 campioni di materiali flessibili, stampati in rotocalco o flessografia da circa 20 trasformatori; sono state considerate diverse strutture e combinazioni di materiali: monofilm, laminati duplici e triplici, stampa interna, stampa esterna. I risultati dello studio sono stati elaborati ed hanno evidenziato le considerazioni espresse nel seguito.

www.dativoweb.net


R I SK E VA LU ATION

4) Considerazioni sui risultati Le analisi eseguite mediante GC/MS con i metodi qui descritti hanno rilevato la presenza significativa dei seguenti composti: Acetato di etile: solvente. Pentametil eptano ed idrocarburi alifatici saturi ramificati: provenienti dal polimero poliolefinico. Acetil tributil citrato (CAS n. 77-90-7): plastificante utilizzato per gli inchiostri, contemplato nelle liste positive degli additivi per materie plastiche (reg. 10/2011 CE) con un LMS di 60 mg/kg espresso come somma di sostanze (restrizione di gruppo n. 32). Erucammide: additivo scivolante contemplato nelle liste positive sia a livello nazionale che CE senza restrizioni specifiche. Octadecil-3- (3,5 ditert butil-4-idrossifenil) propionato (Irganox 1076) (CAS n. 2082-79-3): additivo antiossidante presente nelle liste positive per le materie plastiche (reg. 10/2011 CE) con un LMS di 6 mg/kg o 1 mg/dm2. Nel solvente di lavaggio del lato interno sono stati rilevati i seguenti composti: erucammide e Irganox 1076. In base agli accertamenti analitici eseguiti e riportati nella presente Relazione Tecnica, non si evidenziano situazioni critiche per il rischio di danno tossicologico dovute a composti provenienti dalle materie prime utilizzate.

Composti organici volatili. A parte i solventi residui ovviamente presenti sono stati evidenziati anche idrocarburi alifatici provenienti dalle frazioni oligomeriche più volatili di film poliolefinici; in ogni caso non sono stati rilevati situazioni critiche afferenti a composti volatili. Composti organici non volatili. Le analisi hanno mostrato soprattutto la presenza di plastificanti utilizzati negli inchiostri; la maggior parte di questi plastificanti sono riportati nelle liste positive delle materie plastiche. Sono stati rilevati anche alcuni picchi “non identificati”; la maggior parte di essi, in una fase successiva, sono stati attribuiti, grazie alla collaborazione di tutta la filiera produttiva, a composti ben definiti provenienti da materie prime diverse dagli inchiostri. La ricerca effettuata ha confermato che i metodi utilizzati rispondono alle esigenze di semplicità, affidabilità e riproducibilità richieste.Tali metodi si sono rilevati peraltro idonei, seppur con qualche opportuna modifica richiesta dalla presenza di materiali diversi dalla plastica, anche per valutazione del set-off di materiali come carte e cartoni, rivestimenti come alluminio laccato e plastica rigida. In ultima analisi gli stessi metodi possono essere utilizzati per la valutazione del rischio di danno tossicologico, dovuto a composti organici, per qualsiasi tipo di materiale destinato al contatto con alimenti. Q

www.dativoweb.net

SPEA KING O F. . .

]

Set-off in printed flexible materials KNOWING TO EVALUATE Giflex and IRCPack have completed a project defining a method for verifying the adequacy of production processes and legality of raw materials used and supplies a tool for testing cases of contention. Below are the results of the research focused on risk evaluation of toxicological and sensory damage relating to set-off. Valter Rocchelli, Mara Baronciani

REGULATORY FRAMEWORK Italian legislation has always taken into consideration the risk of contamination to packaged foodstuffs; law n. 283 of 1962 states «The materials... cannot transmit tastes or odors that negatively affect the food’s organoleptic properties and render it harmful». This principle remained unchanged in subsequent legislative acts, in spite of technical and toxicological developments connected with the development of new materials, and it is also considered in EU legislation. Indeed, the latest regulatory law enacted has been EC 1935/2004, which, under article 3 stipulates that «...materials and objects,... must not transmit such quantities to the food product as to: _) constitute a danger to human health `) entail an unacceptable modification to the composition of the food products or r) entail a deterioration of their sensorial characteristics». Regulation (EC) 2023/2006 on good manufacturing practices for materials and objects destined to come into contact with food products, in relation to the specific regulations on good manufacturing practice and in the case of «Processes that entail the application of printing inks on the side of a material or object not in contact with the food product» establishes that: 1. Printing inks applied on the side of the materials or objects not in contact with the food product must be formulated and/or applied in such a way that the substances present on the printed surface are not transferred to the side in contact with the food product: a) through the substrate or b) by set-off in the stack or the reel, in concentrations that lead to levels of the substance in the food which are not in line with the requirements of Article 3 of Regulation (EC) No 1935/2004. 2. Printed objects and materials in finished or semi-processed form must be handled and stored in such a way that substances present on the printed surface are not transferred to the side in contact with the food product: a) through the substrate or b) by set-off in the stack or the reel, in concentrations that lead to levels of the substance in the food which are not in line with the requirements of Article 3 of Regulation (EC) No 1935/2004. 3. Printed surfaces shall not come into direct contact with the food product. The regulatory framework thus requires that inks be formulated and processed according to GMPs in such a way that they do not transmit substances in such quantities as to constitute non-compliance with article 3 of CE 1935/2004.

SET-OFF EVALUATION PROTOCOL Valter Rocchelli, IRCpack srl Mara Baronciani, Sepack-lab Srl

In light of the information reported in the previous paragraph, it is necessary to evaluate toxicological damage risk, the object of this article, as well as sensory damage risk, which are both related to set-off. On the basis of this necessity, IRCPACK and SEPACK-LAB have developed, in collaboration with Giflex, a member of Assografici, which

english text

TR Identificazione picco qual Valutazione semiquantitativa μg/dm2 14.26 Di propil ftalato (standard interno) 94 12,5 18.62 Nitrile * 20.05 Erucammide 91 14 26.54 Octadecil-3- (3,5 ditert butil-4idrossifenil) propionato (Irganox 1076) 90 31 Limite di determinazione: 2 μg/dm2 Incertezza associata alla misura: ± 30% (*) nitrili: prodotti di decomposizione delle corrispondenti ammidi che si formano anche in fase di analisi

[

4/14 • 73


[

SP E AKI N G O F...

]

R I S K E VA L U AT I ON

Giflex and set-off: reasons for a study The Italian association of flexible packaging manufacturers – Giflex has always kept a close eye on the technical and legal issues that concern the food packaging supply chain. The necessity to fully comply with the requirements of law and, in first place, to voluntarily guarantee the absolute safety of products made, has led the group to invest human and economic resources in practical testing and research, with the objective of supplying associate concerns effective tools for guaranteeing the high safety standards required. In light of this, the fruitful collaboration between Giflex and IRCPACK has resulted in the development of a control method capable of responding to the provisions stipulated in the European Regulation (EC) 2023/2006, better known as GMPs. The method enables verifying the adequacy of a production process and the compliance of raw materials used and supplies a control method in cases of contention. Thanks to the professionalism and competencies of the authors of this study, during the course of the research, it emerged that the quality and mole of data collected enabled giving the entire study a broader scope, extending the analysis to the risk evaluation models in compliance with the most recent orientations of the laws on materials in contact with food products. (Eng. Italo Vailati)

Method of analysis: solvent extraction (n-hexane: 10 ml) of 1 dm2 sample, addition of internal standard and gas chromatography/mass spectrometry analysis. Level II screening analysis. Identification and semi-quantitative evaluation of semi-volatile and non-volatile organic compounds on the inner surface of the film. Method of analysis: washing of 2 dm2 of inner surface using short contact (10 minutes for each side) with an adequate volume of n-hexane containing an internal standard. The solvent is analyzed using gas chromatography/mass spectrometry. The conditions described are arbitrary and mainly correspond to the need for answers in short time. The results can be considered conclusive only under certain conditions, such as confirming the presence/absence of peaks. In the first case it could be necessary to carry out a closer investigation with standard contact methods, for example 2gg isooctane at 20 °C or 95% ethanol for 10 days; so specific migrations must be set up. In these cases, the result, except for unidentified peaks, of course, will be quantitative.

EXPRESSION OF THE RESULTS unites flexible materials producers, a protocol for set-off evaluation of rotogravure and/or flexographic printed materials, films and laminates destined for the packaging of foodstuffs. The protocol provides for: • an analytic study that employs screening methods to monitor, by means of special instrumental techniques based mainly on gas chromatography/mass spectrometry of volatile, semi-volatile and non-volatile organic compounds contained in the inks. The analytic study focuses on both the material as a whole and the surface in contact with the foodstuff; • an analysis of the data gathered in order to confirm the presence of compounds definable as “critical”, by nature or quantity. In this case, the need expressed by Giflex was that the analytic methods provided for by the protocol should be usable in industry for production controls characterized by ease of execution, reliability of data and repeatability. In light of these requirements, as well as on the experience of previous studies on issues of packaging/foodstuff interaction, in particular on evaluation of different types of printing inks - we have developed and perfected the analytic methods reported below.

english text

ANALYTIC METHODS

74 • 4/14

The instrumental techniques employed are based on gas chromatography/ mass spectrometry for monitoring volatile, semi-volatile and non-volatile organic compounds present in printed materials or deriving from the inks. The analytic study is performed both on the total quantity of material (level I screening analysis) and on the surface in direct contact with the foodstuff, to confirm any presence of compounds deriving from the printing inks (level II screening analysis). Level I screening analysis. The broad spectrum of compounds to be monitored for necessitates the application of two methods that involve different sampling techniques, one to determine volatile compounds and the other non-volatile compounds. 1) Identification and semi-quantitative evaluation of volatile and semi-volatile organic compounds in proportion to total. Method of analysis: static headspace of a conditioned sample of material in a 20 ml vial at 125 °C for 30 minutes following addition of internal standard (chlorobenzene). Sampling has been carried out using automatic static headspace followed by gas chromatography/mass spectrometry analysis. The method is in compliance with: UNI EN 13628-2 part 2 - industrial method - Sample conditioning: 125 °C for 30 minutes. Any residual solvents found to be present are quantified according to UNI regulation. 2) Identification and semi-quantitative evaluation of semi-volatile and non-volatile organic compounds in proportion to total.

Reports shall include presentation of chomatograms appropriately integrated, along with corresponding tables showing: • time retention (TR) of the peak that also appears on the chromatogram; • identification through comparison of mass spectrometries with those in the library (WILEY275K) managed by the analytic system’s software; • identification qualities, meaning the overlap between the peak spectrum and control one found in the libraries of used spectra (maximum 100 acceptable > 70); • semi-quantitative evaluation: the methods are not quantitative, but in order to obtain an estimate of the concentrations of compounds found in the headspace or in the extraction and wash solvents, we have expressed, in +g/dm2 the “semi-quantitative” evaluation, attributing to the various peaks (identified and unidentified) the response factor of the added internal standards calculated on the basis of the area of the peaks themselves. At the bottom of the table are reported: • analytic sensitivity with reference to the internal standard used; • % uncertainty of semi-quantitative data • any notes referring to the chromatogram or tables. The wording “unidentified” means that a peak’s spectrum is not comparable to any of those present in the spectrum libraries available to the laboratory. In this case the peak is flagged in the table as “unidentified” and the main ions that characterize its mass spectrometry are named. Semi-quantitative or quantitative evaluation. As far as concerns level I screening analysis, output is first of all semi-quantitative and reports the concentrations of compounds detected, obtained by applying the response factor of the internal standard. This system of calculation represents an approximation because the “precision” of a semi-quantitative datum is influenced, in the screening analyses here described, by various factors: • “full scan - TIC” acquisition of the mass selection detector is less precise, for measuring peak areas, than “SIM - single ion monitoring”, used in quantitative analyses; • there is also a considerable response difference between different compounds and the internal standard; • in the headspace analysis, the different proportions of matrix/headspace are also taken into consideration. However, the gas/mass analytic systems used by Sepack-Lab enable simultaneous “TIC” and “SIM” acquisition. It is therefore possible, with the same analysis, to have a qualitative or semi-quantitative screening and at the same time a quantitative analysis of calibrated compounds. For example, headspace analysis also supplies quantitative analysis of residual solvents and other compounds that may have been calibrated in accordance with industrial method standard UNI EN 13628-2 part 2. The same occurs for analysis of the solvent extract analysis of the total sample: at the same time as the screening data it is possible to make a

www.dativoweb.net


VALUTAZI O NE DE I RIS CHI

[

A PRO PO SITO DI. . .

]

quantitative determination of the other compounds as plasticizers, photoinitiators, anti-oxidants, lubricants, etc.

VALIDITY OF METHODS The methods have been authenticated through repeatability tests, for each method, in which 10 repetitions were performed on each sample. Tables 1, 2 and 3 show the results obtained, but also: TR = peak retention time, Average = average value expressed in +g/dm2,m= standard deviation, RSD% =relative standard deviation percentage.

Table 1 - Method repeatability tests for identification and semi-quantitative evaluation of volatile and semi-volatile organic compounds in proportion to total. TR Peak identification AVERAGE m RSD% (semi-quantitative μg/dm2) 5.42 Ethyl acetate 7,7 2,0 26,2 8.65 Chlorobenzene 2,8 (internal standard) 9.67 ramified saturated aliphatic hydrocarbons 20,6 1,8 9,0 Table 2 - Method repeatability tests for identification and semi-quantitative evaluation of non-volatile organic compounds in proportion to total. TR Peak identification AVERAGE m RSD% (semiquantitativa μg/dm2) 12.99 n-octadecane 23,7 1,8 7,4 14.16 Diisopropyl phthalate 25 14.72 unidentified 18,9 0,8 4,6 (m/z = 97,126,155,173) 16.13 Acetyl tributyl citrate 94,2 16,8 16,1 17.08 Unsaturated aliphatic 14,6 1,3 9,0 hydrocarbon 19.71 Erucamide 94,4 9,6 10,1 36,00 Octadecil-389,5 4,5 5,1 (3,5 di-tert-butyl4-hydroxyphenyl) propionate (Irganox 1076) Table 3 - Method repeatability tests for identification and semi-quantitative evaluation of non-volatile organic compounds on the inner surface. TR Peak identification AVERAGE m RSD% (semiquantitativa μg/dm2) 12.99 n-octadecane 6,4 0,9 14,5 14.16 Diisopropyl phthalate 12,5 (internal standard) 14.72 Unidentified 10,3 0,5 4,5 (m/z = 97,126,155,173) 16.13 Acetyl tributyl citrate 7,5 1,2 16,1 17.08 Unsaturated aliphatic 8,3 0,3 4,1 hydrocarbon 19.71 Erucamide 50,0 5,2 10,5 35.96 Octadecyl-319,8 3,7 18,7 (3,5 ditert butyl4-hydroxyphenyl) propionate (Irganox 1076)

BEING PART OF INNOVATION Fieramilano, 19-23 maggio 2015 ipack-ima.com

IPACK-IMA, la più completa mostra delle tecnologie e dei materiali per il processing e il packaging del settore alimentare e non alimentare, vi invita a partecipare all’appuntamento mondiale che darà il via a una grande svolta in amEito ȴeristico Nell’edizione del 2015, IPACK-IMA vedrà il deEutto delle sue nuove ȴere correlate e altamente specializzate - Meat-Tech, Fruitech Innovation e Dairytech – sviluppate per valorizzare tre importanti business community del settore Iood che compongono la grande IPACK-IMA Connected events:

Nello stesso luogo e date saranno inoltre presenti tre ȴere di grande richiamo internazionale: Converȵe[, *raȴtalia e, per la prima volta, Intralogistica Italia, in collaborazione con Deutsche Messe Uno scenario unico a livello mondiale reso ancora più eccezionale dalla concomitanza con ([po 2015 Non perdete la straordinaria edizione di IPACK-IMA 2015: con il suo insieme unico di tecnologie e innovazioni si preannuncia il luogo migliore dove Iare business Co-located with:

Promossa da:

Furthermore, in a small circuit of 4 laboratories, an inter-laboratory test was carried out; participants were sent 4 samples of film to analyze and an operational procedure to follow in order to apply the set-off evaluation protocol (as defined by us). The small number of participants does not permit statistical analysis, and so the results reported under tables 4, 5 and 6 are considered merely indicative and comparative among participant laboratories.

www.dativoweb.net

This event is being covered by professional packaging journalists from IPPO

Con il patrocinio di:

UNITED NATIONS INDUSTRIAL DEVELOPMENT ORGANIZATION

Organizzata da:

Ipack-Ima spa - Corso Sempione, 4 20154 Milano - Italy tel +39 023191091 - fax +39 0233619826 e-mail: ipackima@ipackima.it - www.ipackima.it

4/14 • 75


[

SP E AKI N G O F...

]

R I S K E VA L U AT I ON

Technical Report

3) Results non-volatile organic compounds - internal side

The diagrams and tables shown offer an example of “Technical Report”.

1) Results for volatile and semi-volatile organic compounds - total

TR TR

Peak identification

qual

Semiquantitative Evaluation μg/dm2 350 * 2,8

5.43 Ethyl acetate 91 13.11 Chlorobenzene (internal standard) 98 Limit of determination: 1 μg/dm2 / Uncertainty of measure ± 40% (*) quantitative figure determined in observance of UNI Standard EN 13628-2 part 2. 2) Results of non-volatile organic compounds – total extract

Peak identification

qual

14.26 Dipropyl phthalate (internal standard) 94 18.62 Nitril * 20.05 Erucamide 91 26.54 Octadecyl-3-(3,5-ditertbutyl90 4-hydroxyphenyl) propionate (Irganox 1076) Limit of determination: 2, μg/dm2). / Uncertainty of measure: ± 30% (*) nitrils: decomposition products of the corresponding amides which are formed also in the analysis phase.

Semiquantitative Evaluation μg/dm2 12,5 14 31

4) Comments on the results

TR

Peak identification

qual

Semiquantitative Evaluation μg/dm2 26 25 136

13.26 Ciclical diethylene glycol adipate * 14.26 Dipropyl phthalate (internal standard) 94 16.75 Acetyl tributyl citrate and its decomposition >90 compounds in the analysis phase 18.62 Nitril ** 20.05 Erucamide 91 48 26.57 Octadecyl-3-(3,5-ditert butyl-4-hydroxyphenyl) 90 228 propionate (Irganox 1076) Limit of determination: 5 μg/dm2 / Uncertainty of measure: ± 30% (*) the identification reported is not produced by comparison with libraries but from information obtained otherwise (**) nitrils: decomposition products of the corresponding amides also formed in the analysis phase.

76 • 4/14

The analysis performed by GC/MS with the methods described here have pointed out the significant presence of the following compounds: Ethyl acetate: solvent. Pentamethyl heptane and branched chain saturated aliphatic hydrocarbons: from the polyolefin polymer. Acetyl tributyl citrate (CAS no. 77-90-7): plasticizer used for inks, as contemplated in the positive lists of additives for plastics (reg. 10/2011 CE) with an LMS of 60 mg/kg expressed as the sum of substances (group restriction No. 32). Erucamide slip additive contemplated in the positive lists at both national and EC level without specific restrictions. Octadecyl-3-(3,5-ditert butyl-4-hydroxyphenyl) propionate (Irganox 1076) (CAS no. 2082-79-3): antioxidant additive present in the positive list for plastics (reg. 10/2011 CE) with an LMS of 6 mg/kg or 1 mg/dm2. The following compounds were detected in the internal side washing solvents: erucamide and Irganox 1076. Based on the analytical tests performed and reported in this Technical Report, there are no critical situations for the risk of damage due to toxicological compounds from the raw materials used.

www.dativoweb.net


R I SK E VA LU ATION

Lab. 4 2,8 28 7,6

Table 5 - RING TEST sample 03: method for identification and semi-quantitative evaluation of non-volatile organic compounds in proportion to total. Semi-quantitative evaluation in μg/dm2 Peak identification Lab.1 Lab. 2 Lab. 3 Lab. 4 Dipropyl phthalate (internal standard) 25 25 25 25 Acetyl tributyl citrate 509 692 139 575 Unidentified (m/z = 155,173) 22 23 20 19 Table 6 - RING TEST sample 03: method for identification and semi-quantitative evaluation of non-volatile organic compounds on the inner surface. Semi-quantitative evaluation in μg/dm2 Peak identification Lab.1 Lab. 2 Lab. 3 Dipropyl phthalate (internal standard) 13 13 13 Acetyl tributyl citrate 166 112 77 Unidentified (m/z = 155,173) 12 6,4 10

Lab. 4 13 122 6,4

Evaluation and interpretation of findings Set-off evaluation is not a simple analysis but a rather complex evaluative study of risk and as such should be drawn up in a report. IRCPACK and Sepack-Lab have developed guidelines for drafting technical reports on set-off studies. The layout of the technical report includes, in addition to essential report features (laboratory, sponsor, sample arrival date, analysis findings, sample identification) also the following information: • description of analytic methods applied; • criteria for expressing data; • chromatograms in total ionic current; • tables of compounds detected with corresponding semi-quantitative evaluation; • indication of “analytic sensitivity” with reference to the internal standard used; • % uncertainty of semi-quantitative data. Up to this point it is a report on analyses carried out. From this point onward it becomes a technical report on risk evaluation that involves three operational steps: 1. Hazard identification 2. Risk characterization 3. Risk Evaluation Step n. 1 relates to the findings of the analysis. Step n. 2 involves acquiring information on the compounds identified through comparison of regulatory and other documentation: positive lists of (EC) 10/2011 of DM21/3/73; EFSA opinions; COE inventory lists and documents; non-European regulations such as Swiss Ordinance 817.023.21, FDA, etc.; recommendations, for example BFR; List of permitted food additives, for example the EU regulation n. 872/2012 of the European Commission on 01/10/2012; EUPIA exclusion list, a voluntary regulation with which European ink producers commit to not use the compounds listed because they pose a threat to human health; carcinogenic compound database. Step n. 3 evaluates the information acquired during step n. 2. All compounds fall under one of the following categories: • If the compound is identified and is present in a positive list with a restriction such as specific migration, the quantity detected in the material is compared with any specific migration limit listed for the compound; if the theoretical

www.dativoweb.net

SPEA KING O F. . .

]

specific migration value (calculated by assuming 100% migration) is below the specific migration limit, the situation is NOT critical: on the contrary, it is necessary to confirm respect of the SML by monitoring the presence of the compound on the inner surface and/or by conducting specific migration tests with the necessary simulations for the specific case. • If the compound is identified but is not present in any positive list, it should firstly be ruled out as a possible CMR (carcinogenic, mutagenic or reprotoxic), and confirmed absent from the EUPIA exclusion list. A second level of research entails gathering already existing toxicological data (acute toxicity), on the basis of which the appropriate evaluations can be made. It should be kept in mind, in any case, that an unlisted non-CMR compound cannot exceed a specific migration value of 0.01 mg/kg; this reference value defines the functional barrier of a layer in contact with foodstuffs for unlisted compounds. • If the compound is unlisted but is a permitted food additive, any presence or migration is not to be considered critical. • If the compound is unidentified, it means that the peak spectrum is not comparable with any of those included in the spectrum libraries. In this case, it is not possible to evaluate toxicity and is therefore necessary, if effective migration risks persist (presence on inner surface), to understand in which raw material it originates (ink, adhesive, support) and, consequently, evaluate the possibility of identification with the producer of the raw material in question. The conclusions of the set-off evaluation will be treated according to considerations on the compounds detected and will flag the presence or absence of critical risk of toxicological damage and the indication of any actions to be undertaken in the latter case. For example, the presence of an unlisted CMR compound or a compound on the EUPIA exclusion list represents an at least critical situation, if not one of non-compliance with Reg. (EC) 1935/2004 art. 3. In that case, further analyses must be carried out in order to confirm which component or process phase could have introduced the compound and, consequently, to take any actions to “eliminate” it.

CONCLUSIONS The set-off evaluation protocol has been applied “in the field” in the context of a study sponsored by Giflex to identify and evaluate the set-off situation of various types of printed flexible materials. The study, executed in three phases, considered 75 samples of flexible materials, rotogravure or flexographically printed by approximately 20 converters; the various structures and combinations of materials were taken into consideration: monofilm, double and triple laminates, printing inside, printing outside. The findings were processed and show evidence for the considerations expressed below. Volatile organic compounds. Other than expected residual solvents, aliphatic hydrocarbons were also found, deriving from oligomeric fractions more volatile than polyolefin films; in no case were critical situations having to do with volatile compounds found. Non-volatile organic compounds. The analyses mostly showed the presence of plasticizers used; most of these plasticizers are found in positive lists of plastic materials. A few “unidentified” peaks were also detected; most of these were subsequently attributed to well-defined compounds deriving from raw materials other than the inks, thanks to a collaboration with the entire production chain. The research conducted has confirmed that the methods used respond to needs of simplicity, reliability and repeatability. Such methods have also proven suitable, albeit with appropriate changes required by the presence of materials other than plastic, as well as for the set-off evaluation of materials like paper and cardboard, coatings like lacquered aluminium and rigid plastic. The same methods can be used to evaluate the risk of toxicological damage due to organic compounds, for any type of material destined for contact with foodstuffs. Q Valter Rocchelli, IRCpack srl Mara Baronciani, Sepack-lab Srl

english text

Table 4 - RING TEST sample 03: method for identification and semi-quantitative evaluation of volatile and semi-volatile organic compounds in proportion to total. Semi-quantitative evaluation in μg/dm2 Peak identification Lab.1 Lab. 2 Lab. 3 Chlorobenzene (internal standard) 2,8 2,8 2,8 Ethyl acetate 36 22 20 n-propyl acetate 5,7 3,8 2,8

[

4/14 • 77


SunUno Solimax

Chi ha migliorato la produttività utilizzando un sistema di inchiostri multiuso? Io l’ho fatto.

T PE P, OP A,

or pp Su

st io ch In

ti

ri

afi gr so es Fl

OP

a

pe

e

rL

Ro

o rn te es in pa am St

F/G

Sun Chemical Group S.p.A. Via Achille Grandi, 3 - 6 20090 Settala Fraz. Caleppio (MI) www.sunchemical.com

am

to

in

ca

az

lc

io

og

ne

ra

fia

working for you.


[

E N VIRO NMENT & LEGISLATIO N

]

R-PET: da bottiglia a bottiglia Imbottigliatori di acqua minerale e riciclatori hanno creato un consorzio volontario che dà vita a una filiera chiusa, per recuperare più PET e produrre materia prima seconda con caratteristiche di alimentarietà. Si chiama Coripet, e mette in campo idee originali che coinvolgono la GDO e premiano il consumatore virtuoso. L.G., E.P.

lontano, ormai il tempo in cui “la” plastica era “cattiva”: robusta, sì, impermeabile e leggera, ma anche “artificiale” (e perciò stesso almeno un po’ nociva), per non dire del suo infausto destino di rifiuto indistruttibile… Oggi parliamo di plastiche, al plurale, ciascuna con le proprietà e applicazioni specifiche e tutte da recuperare per essere valorizzate il più possibile. Alcune più di altre, come il PET che, adeguatamente selezionato e riciclato, torna a essere materia prima con le stesse caratteristiche e funzionalità di quella vergine ma con costi ambientali ridotti (emissioni di CO2 otto volte inferiori e altro ancora). Una risorsa preziosa, dunque, ma scarsa, ancor più

È

da quando la normativa che autorizza l’impiego (fino al 50%!) di PET riciclato nel packaging a diretto contatto con gli alimenti ha aperto nuovi sbocchi. È da questa considerazione che, due anni fa, un pool di imbottigliatori e riciclatori ha dato vita al consorzio italiano per il recupero di PET. Si chiama Coripet e si propone di alimentare un circolo virtuoso di produzione-utilizzo-recupero di bottiglie PET con i requisiti di purezza richiesti. Una filiera chiusa, dunque, come già ne esistono per altri materiali, che integri il circuito pubblico di raccolta differenziata governato, per la parte packaging, dal sistema Conai. Messi a punto norme tecniche e procedure, struttura e strumenti,

R-PET: from bottle to bottle Mineral water bottlers and recyclers have created a voluntary consortium that will effect a closed supply chain in order to recover more PET and produce raw materials with food safe properties. Called Coripet, the new consortium brings to the table original ideas to involve supermarkets and award virtuous consumers. L.G., E.P. It’s been a long time since “Plastic” was “bad”: robust, yes, impermeable and light, sure, but also “artificial” (and for this very reason at least a little harmful), not to mention its nefarious destiny as a non-biodegradable piece of trash... Today one speaks of plastics, plural, each with specific properties and applications and all of them recyclable to make the most of the material. A few

www.dativoweb.net

more than others, like PET, which, appropriately selected and recycled, reverts to raw material with the same properties and functionality of the original, but with reduced environmental costs (CO2 emissions eight times lower, among other things). A precious but scarce resource, then, even more so since new regulations authorizing the use (up to 50%) of

il nuovo consorzio ha ormai avviato anche la fase industriale e già vede i primi risultati confermare la correttezza delle valutazioni e delle idee alla base del progetto.

MA C’ERA BISOGNO DI UN ALTRO CONSORZIO? I principi e la logica che hanno ispirato la nascita del Coripet ci vengono spiegati dal suo presidente, Giancarlo Longhi: un presidente scelto, non certo a caso, fra i padri fondatori del circuito nazionale di recupero dell’imballaggio, poi impegnato direttamente nella sua gestione, come direttore generale in Conai. «In Italia il riciclo di PET oscilla ormai da tempo attorno al 40% dell’immesso al

recycled PET in packaging in direct contact with foodstuffs has opened new outlets. It’s from this consideration that, two years ago, a pool of bottlers and recyclers formed the Italian PET recovery consortium called Coripet, which seeks to feed a virtuous cycle of production-use-recovery of PET bottles with the necessary purity requirements. It would be a closed supply chain, then, like those that already exist for other materials, integrating the public circuit of separated waste collection, whose packaging component is governed by the Conai system. Now that it has developed technical regulations and procedures, a structure and tools, the

new consortium has also implemented the industrial phase in its plan and is already seeing the first fruits confirming the correctness of the evaluations and ideas at the root of the project.

BUT WAS ANOTHER

CONSORTIUM NEEDED?

The consortium’s president, Giancarlo Longhi, explained the principles and logic that inspired the foundation of Coripet: a president selected, not by chance, from among the founding fathers of the national circuit of packaging recycling, later directly involved in its management as acting manager of Conai. «In Italy, PET recycling has been hovering for a long time around 40% of

4/14 • 79


[

E N V I RO N M E N T & L E G I SL AT I ON

]

consumo - spiega Longhi - mentre in diversi paesi del Centro e Nord Europa varia fra l’80 e il 100%, permettendo di reinserire sul mercato notevoli quantità di materiale prezioso. Anche l’industria italiana ne ha bisogno ma, per quanto riguarda il confezionamento di acqua, non può attingere al circuito della raccolta tradizionale, per ovvie carenze di tipo quantitativo e qualitativo. Per farsene un’idea basta considerare che nel 2012 in Italia circolavano 453.000 t di imballaggi di PET, di cui soltanto 186.000 sono state riciclate; la differenza di 267.000 tonnellate rappresenta, dunque, la ricchezza che l’attuale sistema di raccolta non riesce a intercettare. E non si tratta solo di volumi: nelle “campane” per la raccolta differenziata della plastica il consumatore conferisce tutti i tipi di contenitore, anche di prodotti chimici e detergenti, che quindi, per legge, non si possono reimpiegare nella produzione di bottiglie di bevande (Decreto del Ministero della Salute n. 113/ 2010). I requisiti stabiliti dalla normativa, infatti, mirano a garantire la purezza del materia-

that put on the market for consumption - Longhi explains while in various countries of Central and Northern Europe this figure is between 80 and 100%, enabling re-insertion into the market of remarkable quantities of this precious material. Italian industry also needs it, but as far as water packaging goes, it cannot reach the traditional recycling circuit due to obvious quantitative and qualitative gaps. To have an idea, just consider that in Italy in 2012 453,000 t of PET packaging was in circulation, of which 186,000 was recycled; the difference of 267,000 tons thus represents the wealth which the current collection system is not able to intercept

80 • 4/14

And it’s not just a matter of volumes: in the bell-shaped separated collection containers the consumer discards all container types, even from chemical products and detergents, which by law cannot then be used for beverage bottles (Health Ministry Decree n. 113/2010). The requirements established by the law, in fact, aim to guarantee the material’s purity - a maximum share of pollutants of 5% is permitted – and traceability, or, more properly, the “chain of custody” documenting the entire journey, from its origins, of the bottle to be recycled. In order to reach these objectives, experience teaches, specialized circuits like ours are needed».

le - è ammessa una quota massima di inquinanti del 5% - e la tracciabilità o, più propriamente, la “catena di custodia” che documenta l’intero percorso, sin dalle origini, della bottiglia da riciclare. Per raggiungere questi obiettivi, l’esperienza insegna, ci vogliono circuiti specializzati, come il nostro».

ATTORI E OBIETTIVI (PREMIARE LA VIRTÙ) Coripet è costituito da tre dei quattro riciclatori italiani dotati del marchio EFSA (European Food Safety Authority), e parliamo di realtà come Aliplast, Dentis e Valplastic, omologati quindi a produrre R-pet idoneo al contatto alimentare. Si sono consorziati con un rilevante gruppo di produttori di acque minerali - marchi come San Pellegrino, Ferrarelle, Lete, Norda, Maniva e altri ancora – che rappresentano un buon 35-40% del mercato nazionale (unico grande assente, San Benedetto che “corre da solo” con un circuito proprio, Ndr). Alla base del loro sodalizio c’è un progetto che mira a recuperare la maggior

ACTORS AND OBJECTIVES (REWARDING VIRTUE) Coripet is comprised of three of the four Italian recyclers holding the EFSA (European Food Safety Authority) seal, namely Aliplast, Dentis and Valplastic, authorized to produce R-pet suitable for food contact. They have formed the consortium together with a large group of mineral water producers - brands like San Pellegrino, Ferrarelle, Lete, Norda, Maniva and others - which represent 35-40% of the national market (with one conspicuous absence, San Benedetto, which “runs solo” with its own circuit, Editor’s note). A the foundation of this solidarity is a project that aims to recovery the greatest possible quantity of water

bottles in order to make them available to recyclers, and finally, users who now enjoy another source for documented and remunerated cost raw materials. Thanks to an original idea that has enabled involving a major third party actor, until now rather hesitant to commit firsthand to recovery operations: supermarkets. «Because the environmental credit that funds separate waste collection remains tied to Conai - and naturally our members also pay it - Coripet has conceived a system that pays for itself but without imposing additional costs. We have therefore identified super- and hypermarkets as ideal locations for returning used bottles and established a mechanism of incentives that

www.dativoweb.net


quantità possibile di bottiglie di acqua, per metterle a disposizione dei riciclatori e, infine, degli utilizzatori che dispongono così di una fonte ulteriore di materia prima, a “costo remunerato” e documentato. Grazie a un’idea originale, che ha permesso di coinvolgere un terzo grande attore, fino ad oggi piuttosto restio a impegnarsi in prima persona in operazioni di recupero: la GDO. «Poiché il Contributo Ambientale che finanzia la raccolta differenziata del packaging (CAC) resta appannaggio del Conai - e naturalmente lo pagano anche i nostri consorziati - Coripet ha ideato un sistema che si regge sulle proprie gambe senza imporre oneri aggiuntivi. Abbiamo quindi identificato i super e gli ipermercati come luoghi ideali per la restituzione delle bottiglie usate, e stabilito un meccanismo di incentivi che incoraggiasse il comportamento virtuoso dei consumatori. Per questo, invece che imporre una cauzione su ogni bottiglia di bibita acquistata, come accade ad esempio in Germania, recuperata all’atto della restituzione, abbiamo preferito un sistema “premiale”: il cittadino che riporta la bottiglia vuota al supermercato convenzionato riceve un buono spesa, un punto fedeltà o quant’altro l’insegna distributiva ha deciso di mettere in campo. Il retail viene a disporre così di un nuovo e inedito strumento di marketing e fidelizzazione che, alla prova dei fatti, ha dato risultati ancora migliori delle aspettative, dimostrando quanto sia potente il mix fra l’incentivo economico dello sconto e la gra-

encourages virtuous consumption habits. For this reason, rather than add a deposit to every beverage bottle purchased, as happens in Germany, for example, a deposit which is then returned when th bottle is recovered, we have opted for an “awards” system: the citizen who returns the empty bottle to the supermarket will receive a coupon, loyalty point or whatever else the distribution brand decides to offer. In such a way, retail enjoys a new marketing and loyalty tool, which in practice has proven more effective than the highest expectations, demonstrating how powerful is the combination of the economic incentive of a discount with the gratification of directly contributing to resolving an ecological problem».

www.dativoweb.net

tificazione che nasce dal contribuire direttamente a risolvere un problema ecologico».

PRIMI RISULTATI DEL PROGETTO Il circuito Coripet si avvale di una strategia semplice e ormai consolidata anche all’estero, Francia in primis. Il punto vendita ospita la macchina per la raccolta delle bottiglie, fornita dal consorzio. La più grande, della dimensione di un’automobile, ha una capacità di 9.000 contenitori al giorno ed è pensata per gli ipermercati; la più piccola, da 1.500 bottiglie, serve le superfici inferiori. Il consumatore vi porta le bottiglie vuote e integre (non schiacciate) in modo che la macchina possa leggere il codice a barre registrando così, in automatico, tutte le informazioni necessarie alla tracciabilità. Le bottiglie vengono compattate e assemblate in balle di piccole dimensioni (30x30) e grande peso specifico (di poco inferiore a quello del vetro), che il camion Coripet passa a ritirare per avviarle poi al riciclo, senza transitare da un centro di selezione, perché la raccolta è già mono materiale. «In Lombardia, Piemonte e Campania, dove abbiamo avviato la raccolta sperimentale, abbiamo recuperato in pochi mesi circa 2.000 t di bottiglie. Le cifre più importanti si sono registrate in Campania dove la grande disponibilità della popolazione e un partner eccellente come DecòMulticedi hanno consentito di avviare a riciclo oltre 24 t di PET post consumo, ovvero oltre 2,5 milioni di bottiglie in meno di sei mesi. Oggi, sempre in Campania,

INITIAL RESULTS OF THE PROJECT The Coripet circuit employs a simple strategy widely used abroad, especially France. The POP hosts the bottle collection machine, supplied by the consortium. The biggest one, about the size of a car, has a capacity of 9,000 containers per day and is designed for hypermarkets; the smallest, for 1,500 bottles, services smaller surfaces. The consumer brings the empty bottles in good condition (not crushed), so that the machine can read the barcode and automatically record all information necessary for traceability. The bottles are compacted and assembled in small bales (30x30) of high specific weight (slightly less than glass), which the Coripet truck picks up to then ship for

sono attive circa 30 delle 60 postazioni installate in fase di start up e, con l’aiuto di nuovi partner e della stessa Multicedi contiamo di potenziare la presenza del consorzio nel resto d’Italia. Con altre ricadute positive. Le attività di Coripet offrono nuovi stimoli tecnologici all’industria italiana del riciclo e contribuiscono, innegabilmente, ad aumentare la sensibilità dei cittadini alle problematiche ambientali: in concreto e “sotto casa” dimostrano come i rifiuti possano trasformarsi in risorsa. I Comuni e le Province più sensibili (ma stranamente mancano le Regioni che pure hanno tutto l’interesse ad appoggiare iniziative sperimentali e progetti alternativi di riciclo) apprezzano e iniziano ad accordare il patrocinio a un’iniziativa che dà lustro alla comunità e rafforza li progetto collettivo di raccolta differenziata». Q

recycling, without transiting through a selection center, since the recycling material is already mono-material. «In Lombardy, Piedmont and Campania, where we have implemented experimental collection, we managed to recover approximately 2,000 t of bottles in just a few months. The most significant quantities were recorded in Campania, where the disposition of the population and an excellent partner such as DecòMulticedi enabled sending more than 24 t of post-consumption material for recycling and, with the help of new partners and Multicedi itself, we plan to enhance the consortium’s presence in the rest of Italy. There are also other positive

repercussions. Coripet’s activities offer new technological stimuli to the Italian recycling industry and contribute unequivocally to enhancing citizens’ environmental sensitivity: in a straightforward manner and “down the block,” they show how waste can be transformed into a resource. The most alert municipalities and provinces (but oddly with the absence of regional governments, which also have every reason to support experimental initiatives and alternative recycling programs) appreciate the project and are beginning to agree to sponsoring an initiative that brings prestige to the community and strengthens the collective separate collection effort». Q

4/14 • 81


[

E N V I RO N M E N T & L E G I SL AT I ON

]

IMBALLAGGIO METALLICO: strumento di marketing I contenitori in acciaio e in alluminio permettono di valorizzare al meglio i prodotti. Totalmente riciclati, offrono molti vantaggi in ambito produttivo. La testimonianza di Mirato. Comunicazione editoriale a cura dell’Associazione irato è uno dei principali protagonisti nel mercato dell’igiene e bellezza: realtà industriale dalle caratteristiche tutte italiane ma di respiro sempre più internazionale, è in grado di soddisfare le richieste più specifiche e diversificate. La notorietà dei marchi è un suo fondamentale punto di forza e brand come Malizia, Intesa, Splend’Or, Geomar, Clinians e Breeze possono contare sull’immediato riconoscimento e fidelizzazione di un’ampia base di consumatori. Interpellato da ANFIMA*, Alberto Pollini, direttore commerciale e marketing Mirato spiega come il packaging sia un vero e proprio strumento di marketing.

M

sempre di più uno strumento di marketing, capace di rendere più attraenti i prodotti, ovviamente senza dimenticare la funzionalità delle confezioni. I contenitori in acciaio e alluminio permettono una valorizzazione estrema del prodotto, sia in termini di decoro che cromatica. Le infinite possibilità di decoro e di comunicazione e la preziosità del pack in acciaio e in alluminio ci hanno permesso di enfatizzare le caratteristiche, di valorizzare e differenziare concetti di prodotto. È il caso di Malizia (linea completa di deodoranti destinati a un target giovane femminile e maschile) o di Intesa, sia per

Intesa Pour homme, la linea completa di prodotti per il trattamento viso/corpo destinata nello specifico al vasto pubblico maschile, sia per Intesa Sex Unisex. L’imballaggio come strumento di marketing, quindi. Ma ci sono anche altri vantaggi? Non solo la gradevolezza o la ricchezza del packaging sono le variabili vincenti degli imballaggi metallici, ma anche la tutela dell’ambiente. Mirato è da sempre attenta sia all’innovazione di prodotto per i mercati in cui opera sia anche alla salvaguardia ambientale. I pack in acciaio e alluminio portano molti vantaggi in tal senso: sono totalmente riciclati, all’infinito, senza alcuna perdita di qualità e prestazioni. Anche i consuma-

Nei settori dei prodotti per l’igiene del corpo e la cura della persona, il mercato è in rapida e continua evoluzione. Quali sono le strategie di Mirato e quanto è importante il packaging per attrarre e conquistare i consumatori? Nell’ambito della nostra strategia commerciale, oltre al ricorso agli strumenti di comunicazione del marketing mix (campagne pubblicitarie e promozionali) rivolgiamo particolare importanza al packaging, capace di attrarre e conquistare consumatori. Con forme, colori e grafica sempre in evoluzione, l’imballaggio è

Metal packaging: a marketing tool Steel and aluminium containers enable bringing out the full potential of a product’s value. These completely recyclable packaging types offer many advantages in production. A testimonial by Mirato. Editorial communication by the Association

Mirato is one of the major players in the market of hygiene and beauty: an industrial manufacturer that is Italian through and through but ever increasingly international in scope, able to meet the most diverse and particular requests. One of the concern’s fundamental

82 • 4/14 1-2/14

strengths lies in brand identity, and brands like Malizia, Intesa, Splend’Or, Geomar, Clinians and Breeze can count on immediate recognition and the loyalty of a broad base of consumers. Interviewed by ANFIMA*, Alberto Pollini, commercial and marketing director of

Mirato, explains how packaging represents an important marketing tool. In the sectors of bodily hygiene and personal care products, the market is rapidly and continually evolving. What are Mirato’s strategies, and how important is packaging to attracting and winning over consumers? In our commercial strategy, in addition to the communication tools of the marketing mix (advertising and promotional campaigns), we hold packaging as particularly important. It is capable of attracting and winning over consumers. With constantly changing shapes, colors and graphics, packaging is increasingly becoming a marketing tool capable of

rendering the products more attractive, without of course foregoing the container’s functionality. Steel and aluminium containers enable conveying the product’s value, by means of both decoration and color. The infinite decorative and communication possibilities and the refinement of the steel or aluminium packaging have enabled us to emphasize a product’s properties, communicate its value and set apart product concepts. This is the case of Malizia (a complete line of deodorants targeting young men and women) or Intesa, both in the case of Intesa Pour Homme, the complete product line for face/body care specifically targeting the large male market, as well as that of Intesa Sex Unisex.

www.dativoweb.net


[

E N[ VIRO INDUSTRY NMENT&&MA LEGISLATIO NA GEMENT N

]

Il metallo, materiale permanente Acciaio e alluminio sono risorse disponibili in modo permanente, ovvero possono essere riciclati all’infinito senza perdere le loro qualità intrinseche. Grazie al riciclo del metallo è possibile risparmiare fino al 75% (acciaio) e fino al 95% (alluminio) dell’energia utilizzata per produrre materia prima. Riciclare il metallo avvia un ciclo infinito di riciclo: un imballaggio metallico può diventare, ad esempio, una moto, che a sua volta può diventare un nuovo imballaggio metallico, e così via, per un numero infinito di volte. Per maggiori informazioni: www.empac.eu/it Metal, a permanent material Steel and aluminium are resources that are available on a permanent basis, which is to say they can be recycled indefinitely without losing their intrinsic properties. Recycling metal makes it possible to save up to 75% (steel) and 95% (aluminium) of the energy used in order to produce the raw material. Metal recycling kicks off an infinite cycle of recycling: a metal packaging can become, for example, a motorcycle, which in its turn can become a new metal packaging, and so forth, for an infinite number of times. For more information: www.empac.eu/it

8-14 MAY 2014 DÜSSELDORF HALL 8a / D12

tori sono sempre più attenti alle tematiche ambientali, sia in termini di prodotto che di riciclabilità. E dal punto di vista produttivo? Mirato è una realtà industriale di primaria importanza, e utilizzando recipienti in acciaio e alluminio riesce a ottenere numerosi vantaggi in ambito produttivo e qualitativo, primi fra tutti il peso e le velocità elevate delle linee. I contenitori metallici, inoltre, non hanno la necessità di imballaggio secondario e sono logisticamente efficienti. E, come detto, altri punti di forza sono la notevole possibilità di differenziazione e la totale riciclabilità. Q

Packaging serves as a marketing tool, then. But are there other advantages? The winning attributes of metal packaging lies not only in the attractiveness or uniqueness of the packaging, but also in environmental concerns. Mirato has always kept a watchful eye on product innovation for markets in which environmental protection is a factor. Steel and aluminium packaging carry many advantages in this sense: they are completely recyclable, ad infinitum, with no loss of quality or performance. Consumers are also increasingly aware of environmental issues, both in terms of products and of recyclability.

www.dativoweb.net

*ANFIMA (www.anfima.it) è l’Associazione aderente a Confindustria che raggruppa i fabbricanti di imballaggi metallici italiani.

And as far as concerns production? Mirato is a major industrial player, and by using steel and aluminium containers, the concern manages to achieve numerous advantages in terms of production and quality, first and foremost considering weight and the lines’ high speed. The metal containers, moreover, do not require secondary packaging and are logistically efficient. And, as mentioned earlier, other strong points are the remarkable possibilities of differentiation and total recyclability. Q *ANFIMA (www.anfima.it) is the Confindustria association that brings together Italian metal packaging manufacturers.

4/14 • 83 3/14


Much more than simple technology

Cama Group è leader nella fornitura di sistemi d’imballaggio secondario ad alta tecnologia ed investe costantemente in soluzioni innovative, grazie al suo attivo dipartimento di R&D. L’azienda ingegnerizza linee complete applicando il consolidato motto: “Tecnologia con Valore Aggiunto”. www.camagroup.com - commerciale@camagroup.com

Düsseldorf - Germania 08-14 Maggio Hall 13 - Stand 13C31


FO O D

[

MATERIA LS & MA CHINERY

]

Nuovo: PET con elevata barriera all’ossigeno PRODUZIONE E AMBIENTE Arcoplastica fa ricerca e pensa “sostenibile”: per il confezionamento alimentare in atmosfera protettiva ha infatti messo a punto un PET additivato che può sostituire i multistrato tradizionali. I vantaggi? Alte prestazioni, massima trasparenza e il grande plus del facile recupero e riciclo dei contenitori monomateriale. allo studio e realizzazione della materia prima, alla progettazione e costruzione dello stampo, fino alla produzione di contenitori finiti per il food e il non food: la Arcoplastica (Andezeno, TO) è una delle poche realtà europee a gestire l’intero processo produttivo incentrato sull’estrusione e termoformatura di materie plastiche. Da anni ai vertici del comparto, con le ultime proposte conferma la propria vocazione all’innovazione in chiave “green”. Ce ne parla Marco Torta, responsabile commerciale della società piemontese. «1.220 tonnellate di plastica, ovvero, 40

D

milioni e 680 mila bottiglie di acqua: tanto è stato il materiale recuperato e immesso nuovamente sul mercato da Arcoplastica sotto forma di R-PET solo nel 2013. Un risultato, questo, reso possibile da un approccio che punta a incrementare di anno in anno il nostro impegno nei confronti delle tematiche ecologiche». Obiettivo dell’azienda è infatti di migliorare quanto possibile le performance ambientali dei propri sistemi di confezionamento, investendo risorse e competenze in un massiccio impiego di materiale riciclato. Ma non solo: Arcoplastica continua a investire nello studio di nuove strutture e di packa-

New: PET with high oxygen barrier PRODUCTION AND ENVIRONMENT Arcoplastica carries out research and thinks “sustainably”: for protective atmosphere food packaging it has in fact devised an additivised PET that can replace traditional multilayer materials. The advantages? High performance, max transparency and the great pluspoint that monomaterial containers are easy to recover and recycle. From the study and devising of the raw material to the design and building of the mould, up to the production of finished containers for the food and non food segments: Arcoplastica (Andezeno, TO) is one of the few European concerns that controls the entire plastics extrusion and thermoforming centered production process. Heading the segment for years now, with its latest proposal the company

www.dativoweb.net

confirms its vocation to green innovation. We spoke to Marco Torta, sales head of the Piedmontese company. «1.220 tons of plastics, that is to say, 40 million and 680 thousand mineral water bottles: this the amount of material recovered and newly placed on the market by Arcoplastica under the form of R-PET and this only in 2013. A result this, enabled by an approach that aims at increasing our commitment to

ging biodegradabili, nella progettazione di confezioni più leggere e innovative dal punto di vista formale e strutturale con l’obiettivo di ridurne ulteriormente l’impatto ambientale a parità di prestazioni meccaniche.

PIÙ SVILUPPO, MENO MATERIALI Tassello importante della strategia ambientale di Arcoplastica è rappresentato dalle attività volte a ridurre le tipologie di materiali immessi sul mercato. Per questa ragione, l’azienda ha scelto di utilizzare nei propri processi produttivi il PET come materia prima principe e ha, quindi, sviluppato per il confezionamento in atmosfera protettiva una nuova tipologia di PET additivato, con una spiccata barriera all’ossigeno, perfettamente paragonabile a quella offerta dai

environmental themes year in year out». The company’s objective is to in fact improve the environmental performance of its own packaging systems as much as possible, investing in resources and skills in a massive use of recycled material. But there is more: Arcoplastica continues to invest in the study of new structures and biodegradable packaging, in the design of lighter packs that are innovatory in terms of structure and shape, with the objective of even further reducing the environmental impact of the same without affecting the sturdiness of the pack.

MORE GROWTH, LESS MATERIAL A key feature of Arcoplastica’s environmental strategy is its aim to reduce the types of materials placed on the market. This is also why the company has chosen to use PET in its production processes as its main raw

material and has consequently developed a type of additivised PET for packaging in protective atmosphere, with a strong oxygen barrier, perfectly comparable to that offered by multilayer materials. «The oxygen barrier offered by our material - Marco Torta explains depends on the capacity to locate and block the passage of the oxygen molecules and its performance is comparable to that of barriered polylaminate material, such as PET laminated with PE-EVOH-PE. We are beginning to use this new material in cooperation with our customers, active in the food and sliced cold cut meats-, fresh pasta and cheese sector, for the very reason that our single layer barrier PET offers a true and proper added value to the product packaging: with the traditional transparency guaranteed by PET in fact, it combines the features of

4/14 • 85


[

MAT E RI ALS & MA CHI NE RY

]

being made of only one polymer. Practically speaking - Torta concludes - we have created a new generation of completely recyclable containers».

A COMPETITIVE CHOICE Choosing a pack totally made out of PET simplifies sorting and recycling during the production phase, thus enabling the total use of production waste with a consequent increase in efficiency and cost effectiveness. «Having managed to further exploit and revalue a material already perfectly inserted in recycling processes such as PET - Marco Torta continues - is an achievement which we are particularly proud of: hence good ecological results can also be added to the product’s competitive lever». The use of new monolayer barriered material is only part of our company’s efforts to safeguard the environment. Being able to consider ones production waste not as such but rather as an important resource means that every day Arcoplastica is able to recover and reuse large amounts in full respect of established technological and food safety regulations. «We have attained ISO 9001 and ISO 14001 as well as BRC/IOP certification» Torta reminds us, winding up by saying «We are lastly also regularly committed to reducing consumption of resources through the use of state-of-the-art, high productivity machines and equipment with high energy efficiency and performance requisites. Arcoplastica also regularly sensitizes its staff and suppliers on environmental matters». Q

Confronto permeabilità vassoi PET/EVOH vs RELIFE 10°c Top film barriera EVOH

materiali multistrato. «La barriera all’ossigeno offerta dal nostro materiale - spiega ancora Marco Torta - dipende dalla capacità di individuare e bloccare il passaggio delle molecole di ossigeno e le sue prestazioni sono confrontabili con quelle dei materiali poliaccoppiati barrierati, come il PET laminato con PE-EVOH-PE. Stiamo iniziando a utilizzare questo nuovo materiale in collaborazione con i nostri clienti, attivi nel settore food degli affettati, della pasta fresca e dei formaggi, proprio perché il nostro film PET monostrato barrierato offre un vero valore aggiunto al packaging del prodotto: alla tradizionale trasparenza garantita dal PET, infatti, unisce la caratteristica di essere costituito da un solo polimero. In pratica - conclude Torta - abbiamo creato una nuova generazione di contenitori, completamente riciclabili».

UNA SCELTA COMPETITIVA Scegliere una confezione totalmente com-

Intubettatrice lineare a sbalzo

(Macchina brevettata)

Formula M.T.L. M.T.L. 400

M.T.L. 100/2

posta da PET semplifica la differenziazione e il riciclo durante il processo produttivo, consentendo così di riutilizzare completamente gli sfridi, con un conseguente aumento di efficienza ed economicità. «Essere riusciti a valorizzare ulteriormente un materiale già inserito perfettamente nei processi di riciclo come il PET - prosegue Marco Torta - è un traguardo del quale siamo particolarmente orgogliosi: alla leva competitiva, infatti, si aggiunge il buon risultato dal punto di vista ecologico». L’impiego del nuovo materiale monostrato barrierato integra le azioni che da sempre l’azienda conduce a salvaguardia dell’ambiente. Non ritenendo i propri sfridi di lavorazione un rifiuto bensì un’importante risorsa, ogni giorno Arcoplastica ne recupera un quantitativo elevato dal ciclo produttivo e li riutilizza nel pieno rispetto delle caratteristiche tecnologiche e di alimentarietà imposte dalla normativa vigente. «Abbiamo ottenute le certificazioni ISO 9001; ISO 14001 e siamo certificati secondo lo standard BRC/IOP» ricorda al proposito il responsabile, che conclude «Siamo infine regolarmente impegnati a ridurre il consumo di risorse anche attraverso l’adozione di impianti e macchinari allo stato dell’arte e ad alta produttività, con requisiti elevati di efficienza energetica e di rendimento. Senza contare che Arcoplastica svolge un’attività costante di formazione e sensibilizzazione su tematiche ambientali nei confronti di dipendenti e fornitori». Q

● ● ● ● ● ● ● ● ● ●

costruzione modulare macchina in linea con telaio in acciaio inox ideale per confezionamento in camera sterile collegabile con qualsiasi macchina astucciatrice innovativo sistema di alimentazione tubetti magazzino tubetti di grande capacità estrema facilità di intervento regolazione con sistema elettronico cambio formato con sistema elettronico disponibile nella versione a doppia testata (alluminio polietilene e polifoil insieme) ● uscita tubetti in posizione orizzontale ● produzione da 1500 a 24000 pezzi/h

NIMA-ERRE.TI Modelli disponibili M.T.L. 100 M.T.L. 100/2 M.T.L. 200 M.T.L. 200/2 M.T.L. 300 M.T.L. 300/2 M.T.L. 400 JUMBO M.T.L. 500

NOVITÁ 86 • 4/14

Packaging s.r.l.

M.T.L. 100

Via Emilio Annoni, 7 20037 Paderno Dugnano (MI) Italia Tel. +39 0299043680 ric. aut. Telefax +39 0299043877 www.nimaerreti.it e-mail: info@nimaerreti.it www.dativoweb.net


We take good care of all your needs FO O D

DEDICATO AI PRODUTTORI DI LATTINE PER BEVANDE Al prossimo Metpack (Essen, 6-10 maggio 2014) gli esperti Henkel presentano le ultime novità della multinazionale per la produzione il trattamento, il rivestimento e il riciclo di lattine, tubetti, contenitori e fusti. Sotto i riflettori, i lubrificanti e i detergenti a marchio Bonderite per la produzione di lattine in due pezzi per bevande. In particolare, la nuova linea di post lubrificanti Bonderite L-FM 8300 e 8400 potenzia le prestazioni del lubrificante, assicurando un maggiore spazio nel processo di formazione della lattina, insieme a una maggiore durata degli utensili e minori sbavature sulle lattine finite. L’esperienza ha anche mostrato che questi prodotti migliorano la produttività (si riduce la percentuale di strappi) e facilitano la pulizia. Henkel presenta anche la serie C-IC-700 di prodotti per la pulizia delle lattine, più economici e con meno agenti chimici, e il facilitatore di risciacquo M-PT ME-77, di nuova tecnologia, dal drenaggio accelerato e con spiccate caratteristiche di eco-compatibilità ed efficacia.

[

MATERIA LS & MA CHINERY

]

Capsule, controlli e altre proposte QTecnologia Made in Sacmi a Interpack dove, in uno spazio espositivo di 540 mq (hall 8, stand 8AE03), verrà fra l’altro presentata la pressa a compressione per la produzione di capsule in plastica CCM a 32 cavità, che si caratterizza per le basse temperature di estrusione e i relativi vantaggi sul fronte dei consumi di energia e della produttività. Corredata dall’innovativo stampo “COOL+”, che rende il processo di raffreddamento più efficiente, la CCM32 produrrà in fiera chiusure per bevande gasate con un tempo ciclo vicino ai 2 secondi (è presentata come la più competitiva al mondo). Il controllo qualità Sacmi CVS3000 a due telecamere integrato, garantisce al 100% la conformità dei tappi prodotti. A Interpack anche Colora Cap, il nuovo sistema di stampa digitale on line ad alta definizione su capsule; la nuova etichettatrice modulare Formsleeve+ che forma la sleeve direttamente in macchina; i sistemi di visione in linea PVS (preforme) e CHS (capsule); la formatrice TF 70 modulare, che produce tutti i formati di plateaux.

Dedicated to beverage can producers During next Metpack (Essen, May 6-10th 2014), Henkel specialists will be presenting their innovations for the production, treatment, coating and recycling of cans, tubes, containers and drums. During the event, Henkel will be showcasing innovative lubricants and cleaners under the Bonderite brand for the manufacture of two-piece beverage cans. In particular, the new range of Bonderite L-FM 8300 and 8400 post lubricants enhance performance, providing more latitude in the can forming process coupled with extended tool life and reduced bleed-through on the finished cans. Practical experience has also shown that they help to increase productivity by reducing tear-off rates, and facilitate cleaning. Henkel also presents the Bonderite C-IC-700 series of cleaners for can manufacturing, which plus are less chemicals and lower overall cleaning costs, and the Bonderite M-PT ME-77, a new final rinse mobility enhancer, very “eco”, whose new technology provides better water drainage properties.

Packaging solutions since 1984

Capsules, checks and other proposals Technology Made in Sacmi at Interpack where, in a display area of 540 sqm (Hall 8, stand 8AE03), the company will among other things be presenting its compression press for the production of CCM 32 cavity plastic caps, which features a low extrusion temperature and relative advantages in terms of energy consumption and productivity. Accompanied by the innovative “COOL+” mould, which makes the cooling process more efficient, at the fair the CCM32 will produce closures for carbonated drinks with a cycle time of 2 seconds (presented as the most competitive in the world). The twin integrated camera Sacmi CVS3000 quality control guarantees 100% compliance of product caps. Sacmi will also be showing Colora Cap, the new online digital high definition printing system for capsules, the new modular labeling Formsleeve+ which forms the sleeve directly in machine; the in line PVS (preforms) and CHS (capsules) vision systems; the TF 70 modular forming machine that produces all crate formats.

www.dativoweb.net

www.sipro.vr.it - info@sipro.vr.it tel. +39 045 508822 4/14 • 87


[

MAT E RI ALS & MA CHI NE RY

]

F OOD

Pesatura e controllo: novità a Interpack QUno stand articolato in quattro aree, dedicate ad altrettanti ambiti applicativi seguiti nel tempo con particolare dedizione, e molti nuovi prodotti, caratterizzano la presenza di Ishida a Interpack. Diverse pesatrici multiteste - per dolci, snack, prodotti granulari, ortofrutta e altro ancora -; un sistema a raggi X in grado di rilevare anche gli ossi più piccoli in carni e pollame; un sistema integrato pesatrice-imbustatrice per snack; gli ultimi traguardi tecnologici nelle linee complete di confezionamento per carne e pollami freschi, sono le novità principali in mostra a Düsseldorf. La multinazionale offre, così, un saggio dell’expertise che le ha permesso di acquisire una posizione di spicco sul mercato globale delle attrezzature per la pesatura e il controllo di qualità, e delle linee compete per snack e alimenti freschi. Qualche esempio significativo? Fra i molti, la nuova e flessibile pesatrice a 32 teste della serie RV, in grado di miscelare fino a otto prodotti diversi nella stessa busta ma utilizzabile anche per il riempimento hi-speed di un prodotto singolo, o per la gestione ad alta velocità di dolciumi, noci, surgelati, o multiprodotto. Oppure l’ultima versione circolare della nota Cutgate, che raggiunge più elevati traguardi di velocità e accuratezza nella pesatura e confezionamento di prodotti granulari, ma anche le versioni entry level di altre macchine per vari tipi di prodotto.

PACKAGING ON THE GO PER DOLCIUMI Stora Enso e AR Packaging hanno sviluppato un nuovo tipo di confezione per cioccolato e dolciumi, declinabile in forme diverse e con differenti sistemi di chiusura, dedicata al consumo nomade. Realizzati con materie prime rinnovabili al 100%, questi contenitori impiegano cartoncino Cupforma Special di Stora Enso accoppiato in volta a PE generato dalla canna da zucchero, che fornisce la necessaria protezione al contenuto; infine, sono stampati in offset. Il più promettente sarà presentato a Interpack, agli stand di Stora Enso (hall 9 B20-1) e AR Packaging (hall 11 A07).

Weighing and control: innovations at Interpack A stand divided into four zones, each one dedicated to application areas followed over time with dedication, and many new products, characterize the presence of Ishida at Interpack. Several multi-head weighers - for sweets, snacks, granular products, fruit and vegetables and more - and an X-ray system that can detect even the smallest bones in meat and poultry; an integrated system-bagging weigher for snacks; the latest technological achievements in complete lines for packing fresh meat and poulty, are the main new features on show at Düsseldorf. Thus the multinational offers a sample of the expertise that has enabled it to gain a leading position on the global market of weighing and quality control equipment and complete lines for snacks and fresh food. Some meaningful examples? Among the many, the new and flexible 32 headed RV series weigher, able to mix up to eight different products in the same pouch but also usable for hi-speed filling of a single product, or for the hi-speed handling of confectionery, nuts, frozen foods or multiproduct. Or the latest circular version of the known Cutgate, that reaches higher speeds and accuracy in weighing and packing granular products, but also the entry-level versions of other machines for various product types.

Packaging on the go for confectionery Stora Enso and AR Packaging have developed a new type of pack for chocolates and sweets, declinable in different forms and with different closing systems, dedicated to consumption on the go. Made with totally renewable raw materials, these containers are made using cartonboard Cupforma Special Stora Enso in turn coupled to PE generated from sugar cane, which provides the necessary protection for the contents; lastly, they are printed in offset. The most promising will be presented at Interpack, at the stands of Stora Enso (Hall 9, B20-1) and AR Packaging (Hall 11, A07).

88 • 4/14

www.dativoweb.net


[

MAT E RI ALS & MA CHI NE RY

]

F OOD & BE V E R AG E

L’IMPORTANZA DEI MATERIALI QUADRO NORMATIVO Cosmetico e alimentare: due settori all’apparenza lontani che, con l’evolversi delle norme che disciplinano l’utilizzo dei materiali per l’imballaggio e la valutazione delle componenti suscettibili di mutare la natura del prodotto, stanno in realtà trovando numerosi punti di contatto. Anche grazie al contributo di Giancarlo Melato di Cosmetica Italia*, un aggiornamento sulle regole di riferimento in ambito europeo che disciplinano prodotti, materiali da imballaggio e macchine. A cura di Riccardo Ceredi www.fraunhofer.de

na premessa, in questo caso, è d’obbligo. Lo scopo ultimo delle normative applicabili all’ambito cosmetico e alimentare è la tutela della salute del consumatore, che dev’essere garantita dal rispetto di alcune norme: dall’osservanza delle restrizioni su taluni ingredienti alla limitazione nell’impiego di coloranti e conservanti, fino alla pubblicazione di informazioni chiare e fruibili sull’etichetta del prodotto.

U

* Relatore al seminario tecnico organizzato da Ucima e Istituto Italiano Imballaggio, mercoledì 12 febbraio 2014 a Villa Marchetti (Baggiovara, MO), con l’obiettivo di fornire un quadro normativo aggiornato a livello nazionale, europeo e mondiale in materia di materiali a contatto con alimenti, prodotti farmaceutici, cosmetici, ecc.

LA LEGISLAZIONE EUROPEA Per quanto riguarda il cosmetico, l’ultima normativa entrata in vigore in ambito comunitario è la 1223 del 2009. Disciplina innumerevoli aspetti, dalla valutazione sulla sicurezza del prodotto alle restrizioni sull’utilizzo di determinati materiali, e introduce alcune novità rispetto al passato, riordinando disposizioni già presenti nella direttiva 76/768. In ambito alimentare, si fa invece capo alla normativa 1935 del 2004, anch’essa in-

* Speaker at the technical seminar organized by Ucima and Istituto Italiano Imballaggio, Wednesday, February 12th, 2014 at Villa Marchetti (Baggiovara, MO), with the objective of supplying an updated national, European and global regulatory framework for materials in contact with food, pharmaceutical products, cosmetics, etc.

The importance of materials NORMATIVE FRAMEWORK Cosmetics and food: two apparently quite different sectors that, with changes to the legislation governing the use of packaging materials and the evaluation of components that can affect a product’s intrinsic properties, find themselves sharing numerous points of contact. With contributions from Giancarlo Melato of Cosmetica Italia*, an update on the most important European regulations governing products, packaging materials and machinery. By Riccardo Ceredi In this case a preliminary statement is obligatory. The ultimate goal of regulations applying to the cosmetics and food sectors is consumer protection, which must be guaranteed by compliance with certain standards: from observation of restrictions on certain ingredients to the limited use of

90 • 4/14

artificial coloring and preservatives, to supplying clear and usable information on the product label.

EUROPEAN LEGISLATION As far as concerns cosmetics, the latest European law to go into effect is EC 1223/2009, governing countless issues,

centrata su fattori quali l’attenzione ai materiali utilizzati. Di primaria importanza, per entrambi i settori, risulta essere la tracciabilità di processi, materiali e macchinari impiegati dai vari fornitori (con l’eccezione dei consumatori finali), secondo la modalità del “one step back-one step forward”: in pratica, ogni attore della filiera dev’essere a conoscenza di ciò che riguarda chi viene prima e chi dopo, facendosi carico della raccolta della documentazione di conformità e, allo stesso tempo, attenendosi alle norme di buona fabbricazione.

IL PRODOTTO E IL PACKAGING Ambito cosmetico. Esistono liste di sostanze che, come disciplinato dall’articolo 14 della normativa CE 1223/2009, non possono essere utilizzate per la prepara-

from product safety assessment to restrictions on the use of particular materials, and introducing a few innovations that reorganize provisions already laid out in directive 76/768. As for food, EC 1935/2004 also focuses on factors such as materials used. Of the utmost importance to both sectors is the traceability of processes, materials and machinery used by the various suppliers (with the exception of end users), according to the principle of “one step back, one step forward”: in practice, every actor in the supply chain needs to know about what comes before and after them, taking responsibility for collecting compliance documentation and, at the same time, respecting good manufacturing practice.

PRODUCT AND PACKAGING Cosmetics. There are lists of substances that, as stipulated in article 14 of CE 1223/2009, cannot be used in the making of products. At the same time, there are lists of permitted coloring agents, preservatives and UV filters. Substances classified as CMR (carcinogenic, mutagenic and toxic for reproduction), according to appendix VI, part 3 of CE 1272/2008, constitute a specific case. The use of these substances is prohibited. In any case, CMR substances can be used exceptionally in cosmetics products if, subsequent to their classification as CMRs, they are shown to comply with four conditions: in order to follow the safety provisions of CE 178/2002 of the European Parliament and Council, which

www.dativoweb.net


[

MATERIA LS & MA CHINERY

]

Prodotti cosmetici e alimentari: come vengono definiti per legge Per “prodotto alimentare” si intende qualsiasi sostanza o prodotto trasformato, parzialmente trasformato o non trasformato, destinato ad essere ingerito, o di cui si prevede ragionevolmente l’ingerimento, da parte di esseri umani, comprese le bevande, le gomme da masticare e qualsiasi sostanza, tra cui l’acqua, intenzionalmente incorporata negli alimenti nel corso della loro produzione, preparazione o trattamento. Per “prodotto cosmetico” si intende invece qualsiasi sostanza o miscela destinata a essere applicata sulle superfici esterne del corpo umano (epidermide, sistema pilifero e capelli, unghie, labbra, organi genitali esterni) oppure sui denti e sulle mucose della bocca allo scopo esclusivamente o prevalentemente di pulirli, profumarli, modificarne l’aspetto, proteggerli, mantenerli in buono stato o correggere gli odori corporei.

zione dei prodotti. Allo stesso tempo, esistono elenchi che contengono i coloranti, conservanti e i filtri UV ammessi. Un discorso specifico riguarda le sostanze classificate come CMR (cancerogene mutagene e tossiche per la riproduzione), ai sensi dell’allegato VI, parte 3 del regolamento (CE) n. 1272/2008, il cui utilizzo è vietato. Tuttavia le suddette sostanze possono essere eccezionalmente impiegate nei prodotti cosmetici se, successivamente alla loro classificazione come sostanze CMR, risultano conformi a quattro condizioni: alle prescrizioni relative alla sicurezza di cui al regolamento (CE) n. 178/2002 del Parlamento europeo e del Consiglio, che stabilisce i principi e i requisiti generali della legislazione alimentare; se non sono

establishes the general guidelines and requirements of food legislation, no adequate alternative substances are available, the application is performed for a particular use of the product category with a known exposure and, finally, they have been evaluated by the SCCS (Scientific Committee on Consumer Safety). Furthermore, the unintended presence of small amounts of a prohibited substance resulting from impurities of the natural or synthetic ingredients, from the manufacturing process, from storage or due to migration from the packaging (technically inevitable in spite of compliance with good manufacturing practice) is permitted as long as in compliance with article 3, which stipulates that only safe products can be put on the

www.dativoweb.net

disponibili sostanze alternative adeguate,; se l’applicazione è fatta per un uso particolare della categoria di prodotti con un’esposizione conosciuta e, infine, se sono state valutate sicure da SCCS (Scientific Committee on Consumer Safety). Inoltre, la presenza involontaria di una quantità ridotta di una sostanza vietata, derivante da impurezze degli ingredienti naturali o sintetici, dal procedimento di fabbricazione, dall’immagazzinamento o dalla migrazione dall’imballaggio (tecnicamente inevitabile nonostante l’osservanza di buone pratiche di fabbricazione) è consentita a condizione che sia conforme all’articolo 3, che prevede l’immissione in commercio solo di prodotti cosmetici sicuri. All’atto pratico, questo apre una finestra sulla presenza di sostanze teoricamente vietate, a patto che

market. In practice, this opens a window for the presence of substances in theory prohibited, as long as the best practices for guaranteeing their containment have been carried out during production. On the other hand, the reduced presence of these substances (for example, a few heavy metals like nickel) can be exploited by manufacturers as a marketing strategy, much as products with no preservatives are emphasized in the food sector. Food sector. A lot of importance is given to materials, specifically those destined to come into contact with the product, among which plastic, rubber, aluminium and steel, whose use is governed by the above mentioned CE 1935/2004, which concerns both materials that enter directly

Cosmetics and food products: how they are defined by law For “food product” is meant any substance or product converted, partially converted or non converted, to be ingested, that may be reasonably to be ingested, by humans, including beverages, chewing-gum and any substance, including water, intentionally incorporated in the foodstuffs during their production, preparation or treatment. For “cosmetics products” is meant any substance or mixture for application to the external part of the human body (epidermis, pilipherous system and hair, nails, lips, genitals) or on the teeth or on the mucose of the mouth for the exclusive or main purpose of cleaning, perfuming, modifying the appearance, protecting or maintaining the same in a good state or for the correction of bodily odours.

into contact with the product (for example the packaging) and those subject to do so in an indirect manner. The latter specification is very significant and includes cases in which a transfer of material substances (and objects) to food products can occur under - the law reads - “normal or foreseeable” conditions of use. This implicates machine builders as much as customer concerns, meaning that it is necessary to pay particular attention not only to primary but also secondary packaging phases. Indeed, starting from the premise that “0 migration” (the case in which a product is not even minimally altered by external agents) is a nearly impossible to reach condition, not only the materials used directly for wrapping the product have to be

considered, but also secondary packaging and those machine parts that, in one way or another, may come into contact with the food, transferring undesired elements to the product. Consider, for example, the case of a filling machine with a dirty nozzle or, in the case of secondary packaging, a “contaminated” box in contact with a product with a porous packaging. Thus, while in the realm of food what is fundamental is research on packaging materials and, more generally, all materials that can communicate with (or simply transfer elements to) the food product during the industrial process, in cosmetics (which also strictly observes the above) a further point requires careful attention: the presence of potentially harmful substances in the products contained.

4/14 • 91


[

MAT E RI ALS & MA CHI NE RY

]

F OOD & BE V E R AG E

GMPs. Since the unintended presence of substances can influence a product’s safety, this eventuality must be minimized as much as possible, in accordance with good manufacturing practices. In the case of the cosmetics sector, attention is once more geared principally toward the product. ISO 22716 is the regulation that supplies guidelines for production, control, storage and shipping of cosmetics products and has been specifically designed for the cosmetics industry. It offers organizational advice and procedures for management of human, technical and administrative factors that influence product quality, to be followed from the moment a raw material/container enters the facility to when the product comes out, applying to all production, packaging, control, storage and shipping activities relating to a cosmetic product (with the consequent involvement of multiple departments within a concern). In terms of building criteria for machinery involved in the packaging process, it’s essential that they be easy to clean and, if necessary, sanitize and maintain. Furthermore, the machine needs to be designed in such a way as to prevent contamination and assembled in such a way

durante il processo produttivo, siano state rispettate le migliori procedure per assicurarne il contenimento. Per contro, la presenza ridotta di sostanze di questo tipo (per esempio, alcuni metalli pesanti come il nichel), viene sfruttata dalle aziende produttrici come arma di marketing. Allo stesso modo in cui, in ambito alimentare, vengono enfatizzati i prodotti senza conservanti. Ambito alimentare. Viene data grande importanza ai materiali, nello specifico a quelli destinati a venire a contatto col prodotto, tra cui plastica, gomma, alluminio e acciaio, il cui utilizzo è disciplinato dal so-

pra citato regolamento CE n. 1935/2004, che riguarda sia i materiali destinati a entrare direttamente in relazione con il prodotto (per esempio l’imballaggio) sia quelli suscettibili di farlo in maniera indiretta. Quest’ultima specifica risulta molto rilevante e comprende i casi in cui possa avvenire un trasferimento di sostanze da materiali (e oggetti) verso i prodotti alimentari, in condizioni di impiego - recita la legge “normali o prevedibili”. Questo tanto per i costruttori di macchine quanto per le aziende clienti, il che significa che è necessaria un’attenzione particolare non solo nelle fasi di packaging primario ma anche in quelle secondarie. Infatti, partendo dal presupposto che la “migrazione 0” (ossia il caso in cui un prodotto non venga minimamente alterato da agenti esterni) è una condizione quasi impossibile da raggiungere, si devono prendere in considerazione non solo i materiali utilizzati direttamente per l’incarto, ma anche agli imballaggi secondari e quelle parti della macchina che, in un modo o nell’altro, possono venire a contatto con l’alimento, trasferendo componenti indesiderate sul prodotto. Si pensi, per esempio, al caso in cui una macchina riempitrice abbia un ugello sporco o, nel caso del packaging secondario, a un cartone “con-

dalla marcatura al controllo con voi... in linea!

SIS.MA S.r.l. Via Guido Rossa, 42 40033 Casalecchio di Reno (Bologna) Italy Tel. 051.6132681 r.a. Fax 051.6132139 sisma@sisma1990.com www.sisma1990.com

Attiva da oltre vent'anni, SIS.MA S.r.l., specializzata nella codifica ed identificazione, propone le apparecchiature ink-jet di propria produzione, COMPACT & FLEX ad alta definizione per la stampa di caratteri alfanumerici, logos e barcodes su superfici porose. PRODUZIONE SIS.MA

GAMMA MACROLINE – INKJET DOD

C-Touch Unit

Caratteristiche Teste di Stampa (IP54) - 4 versioni: 107,4/70/53,7/16,5mm. Risoluzione verticale 200dpi; - Velocità di stampa: fino a 32 mt/min a 180dpi. Caratteristiche Unità Centrale (IP54) - Windows-based Control Unit in acciao Inox con Display LCD TFT 12” a colori; - Software Grafico, orologio-datario con batteria tampone; predisposizione per 2 teste di stampa; - Connessioni: Ethernet, USB, Seriale e VGA per monitor esterno. I/O encoder/allarmi.

92 • 4/14

IMPORTANTE: Spurgo automatico con recupero ink; Sistema di riscaldamento ink nel serbatoio www.dativoweb.net testa (per ambienti freddi); Sistema “anti-shock” per preservare l'integrità della testa.


FO O D & B E V E R AG E

taminato” a contatto con un prodotto dotato di imballaggio traspirante. Quindi, se in ambito alimentare risulta fondamentale la ricerca sui materiali d’imballaggio e, più in generale, su tutti quelli che possono entrare in relazione (o anche solo trasferire componenti) nel corso del processo industriale, nel cosmetico (altrettanto attento agli aspetti di cui sopra) è necessario considerare un ulteriore elemento: la presenza di componenti potenzialmente dannose nel prodotto contenuto. Le GMP. Poiché la presenza involontaria di sostanze può influire sulla sicurezza del prodotto, quest’eventualità dev’essere ridotta al minimo, per quanto possibile, secondo le buone pratiche di fabbricazione. Nel caso del settore cosmetico, l’attenzione è ancora una volta principalmente al prodotto. L’ISO 22716 è la norma che fornisce le linee guida per la produzione, il controllo, l’immagazzinamento e la spedizione dei prodotti cosmetici, ed è stata specificatamente studiata per l’industria cosmetica. Offre consigli organizzativi e pratici per la gestione dei fattori umani, tecnici e amministrativi che influenzano la qualità del prodotto, che andrebbero seguiti da quando una materia

prima /contenitore entra in stabilimento a quando il prodotto esce, applicandosi a tutte le attività di produzione, confezionamento, controllo, stoccaggio e spedizione di un cosmetico (con il conseguente coinvolgimento di molti comparti aziendali). In relazione ai criteri costruttivi delle macchine coinvolte nel processo di confezionamento, è fondamentale che esse possano essere pulite con facilità e, se necessario, igienizzate e mantenute agevolmente. Inoltre, la macchina dev’essere progettata in modo da prevenire la contaminazione ed assemblata in modo che le componenti siano protette dai contaminanti dell’aria (polvere e umidità). Infine, il materiale di costruzione deve essere compatibile con i prodotti e gli agenti di pulizia e igienizzanti. Anche il posizionamento all’interno del contesto produttivo è importante: la macchina dovrebbe infatti essere collocata in modo da far sì che la movimentazione di materiali, attrezzature mobili e personale non presenti rischi per la qualità. Per quanto riguarda l’alimentare, è il regolamento CE n. 2023/2006 a stabilire le norme relative alle buone pratiche di fabbricazione (GMP) per i gruppi di mate-

[

MATERIA LS & MA CHINERY

]

that the components can be protected from contaminants in the air (dust and humidity). Finally, the building material needs to be compatible with the products and cleaning and sanitizing agents. The position of the machine within the production process is also important: the machine should be placed in such a way that handling of the materials, mobile tools and personnel does not present risks to quality. As far as concerns the food sector, CE 2023/2006 establishes the rules of good manufacturing practices for groups of materials and objects destined to come into contact with foods, and applies to all sectors and all phases of production, converting and distribution of materials and objects, excluding extraction and supply of raw materials. That means that each phase of processing must be carried out under observance of GMPs, except for the production of raw materials. At the same time, emphasis is placed on the importance of establishing a traceable and controlled supply chain. From here derive the concepts of selection of material and choice and qualifications of the supplier, important for managing the production process, which are related to preventive assessment, also on the part of the

DÜSSELDORF, FROM 8TH TO 14TH MAY 2014. We will celebrate together 40 years of excellence by Marchesini Group.

HALL 8A www.dativoweb.net STAND F05 - G03

MARCHESINI GROUP Via Nazionale 100 40065 - Pianoro - Bologna - Italy T. +39 051 651 87 11 WWW.MARCHESINI.COM

4/14 • 93


[

MAT E RI ALS & MA CHI NE RY

]

F OOD & BE V E R AG E

riali e di oggetti destinati a venire a contatto con gli alimenti, e si applica a tutti i settori e a tutte le fasi di produzione, trasformazione e distribuzione di materiali e oggetti, ad esclusione della estrazione e fornitura delle sostanze di partenza. Ciò significa che ogni fase della lavorazione deve essere eseguita in ambito GMP, ad esclusione della produzione delle materie prime. Allo stesso tempo, viene posto l’accento sull’importanza di istituire una filiera tracciabile e controllata. Da qui nascono i concetti di selezione dei materiali e di scelta e qualifica del fornitore, importanti per la gestione del processo produttivo, legati alla preventiva valutazione, anche da parte delle aziende costruttrici di macchine, dei fornitori in grado di soddisfare tali richieste. Le forniture dovrebbero infatti essere dettagliate in appositi accordi contrattuali, dove siano chiaramente definite le responsabilità del fornitore e del converter. La documentazione: attestati di conformità ed etichette. In ambito alimentare, il regolamento 2023/2006/CE impone l’istituzione di un sistema documentale completo; è infatti obbligatorio predisporre documentazione atta a dimostrare la con-

machine builders, suppliers able to satisfy such requests. Supply deals should be laid out in detailed contracts in which the responsibilities of supplier and converter are clearly stated. Documentation: certificates of compliance and labels. In the food sector, CE 2023/2006 provides for establishment of a complete documentation system; it is in fact compulsory to supply documentation to prove the sector operator’s compliance with the GMP system to the specifications of the law, through preparation of special registration and operational documents. GMP documentation also includes the Declaration of Compliance: materials and objects used must be accompanied by a written declaration stating their compliance with governing laws. Article 16 of CE 10/2004 in particular governs the

94 • 4/14

formità del sistema GMP dell’operatore del settore alle richieste del Regolamento, attraverso la preparazione di appositi documenti di registrazione e documenti operativi. Tra la documentazione delle GMP rientrano anche le Dichiarazioni di Conformità: i materiali e gli oggetti impiegati devono infatti essere corredati da una dichiarazione scritta che attesti la loro concordanza alle norme vigenti. L’articolo 16 del regolamento 10/2004/CE disciplina nello specifico la dichiarazione di conformità, e stabilisce che essa è sempre obbligatoria e va emessa e rilasciata a favore di tutti i clienti. Stabilisce inoltre che l’utilizzatore (in questo caso l’impresa alimentare) è tenuto a riceverla e conservarla, oltre a dover valutare l’idoneità tecnologica del materiale acquistato. Si tratta di un documento che ha anche implicazioni contrattuali e che deve essere redatto da una o più persone interne all’azienda che abbiano un’ottima conoscenza tanto della legislazione di riferimento, quanto degli aspetti tecnici e produttivi che sovrintendono, nonché delle applicazioni del prodotto finito. È inoltre fondamentale un know how sulle leggi vigenti nei Paesi esteri di destinazione delle merci: ad esempio la conformità alla legislazione UE per i materiali e oggetti a contatto con gli alimenti è diversa dalla conformità richiesta dalla legislazione degli Stati Uniti d’America, disciplinata dall’FDA (Food and Drug Administration). Nel cosmetico, fatte salve le dovute procedure di buona fabbricazione, ancora una volta viene posto l’accento sulla sicurezza del prodotto. Il Regolamento cosmetico 1223/2009 prevede che sia

declaration of compliance and establishes that it is always compulsory and should be made public and issued to all customers. It also establishes that the user (in this case the food enterprise) is held to receive and preserve it, in addition to assessing the technological suitability of the material acquired. This document also has contractual implications and must be drafted by one or more people from within the concern that have excellent knowledge of both governing legislation and the technical and production issues at play, as well as of the applications of the finished product. Also fundamental is knowledge of applicable law in foreign countries where the products will be exported: for example compliance with EU law for materials and objects in contact with foods is different from the compliance required by US law, established by the FDA (Food and Drug Administration).

raccolta un’adeguata documentazione informativa su ciascun prodotto e che, prima dell’immissione sul mercato, esso sia sottoposto a una specifica valutazione della sicurezza da parte di un esperto qualificato. Questa deve infatti contenere una descrizione del prodotto cosmetico che consenta di risalire in maniera chiara alla relazione sulla sicurezza e alla descrizione del metodo di fabbricazione. Inoltre, l’allegato I del regolamento 1223/2009 riporta gli elementi che devono essere presenti obbligatoriamente nella relazione sulla sicurezza del prodotto cosmetico. Per aiutare le aziende a realizzare al meglio tale relazione la Commissione, il 25 novembre 2013, ha pubblicato una decisione con le linee guida che descrivono in modo più dettagliato quanto occorre inserire. In primo luogo, vengono definite le caratteristiche microbiologiche accettabili delle materie prime (sostanze o miscele) e del prodotto finito. Inoltre, vengono considerati i casi relativi alla presenza di sostanze indesiderate nel prodotto, nella fattispecie le “impurezze” (quando la sostanza indesiderata si trovi nelle materie prime) e le “tracce” (laddove essa sia presente nel prodotto finito). Si prendono in esame anche i materiali per il confezionamento, considerando i casi in cui siano presenti tracce di sostanze vietate. Vengono definite e rilevate le caratteristiche pertinenti del materiale da imballaggio, con particolare riferimento alle loro caratteristiche di purezza e la stabilità. Tra i vari scopi, vi è anche quello di evitare il potenziale rilascio di sostanze dall’imballaggio, o comunque evitare che queste possano portare a un deterioramento del prodotto successivamente al contatto. Q

In cosmetics, aside from due procedures of good manufacturing, once again the emphasis is placed on product safety. CE 1223/2009 provides for collection of adequate informational documentation on each product and, before the product is put on the market, a specific assessment of the product’s safety by a qualified expert. This assessment must include a description of the cosmetic product that lays out a clearly readable report on safety and a description of the manufacturing process. Furthermore, appendix I of CE 1223/2009 lists elements that must be included in the cosmetic product safety report. In order to help concerns draft this document most effectively, the Commission published a decision on November 25th, 2013 with the guidelines describing in detail what needs to be included. Firstly, the acceptable microbiological

properties of raw materials (substances or mixtures) and the finished products must be defined. Moreover, cases relating to the presence of undesired substances in the product are to be taken into consideration, specifically “impurities” (when the undesired substance is found in the raw materials) and “traces” (when it is present in the finished product). The decision also examines packaging materials, considering cases in which traces of prohibited substances are present. The relevant properties of packaging material are defined, with particular reference to its purity and stability characteristics. Among the various purposes of this documentation, one is to prevent the potential for the packaging to release substances or otherwise prevent that these can lead to a deterioration of the product following contact.Q

www.dativoweb.net


TECHNOLOGY INSIDE

FOLD WRAPPING G

B BOTTLE OTTL OT TLE TL E FILLING FILL LLIING

F FLOW L WRAPPING G

BOTTLE FILLING

FLEX F LEX LE XP POUCH OUCH

TEA BAGGING

CAPSULE FILLING

FLEX POUCH

8-14 MAY 2014 HALLE 6 BOOTH D-31/E-57

ACMAVOLPAK, a member of the Coesia Group, is a leading business in the development and commercialization of packaging machinery and integrated packaging solutions for the Fast-Moving Consumer Goods Industry, backed by a strong technological know-how in Flexible Pouch Form-Fill-Seal, Wrapping, Flow Wrapping, Bottle Filling, Capsule Filling and Tea Bagging sectors. ACMAVOLPAK works constantly in partnership with its customers in co-creating and producing innovative packaging lines, in order to satisfy and even exceed their expectations.

A Company of

www.acmavolpak.com


[

MAT E RI ALS & MA CHI NE RY

]

COS MOP H AR MA

I QUATTRO “PIÙ” DEL 2014. Il premio della categoria “Medical device per la diagnostica” è stato assegnato al sistema per patologie oculari Eyerprim della Opia Technologies & Groupe JBT (foto 1). Opi è riuscita a integrare la sottile membrana per la biopsia oculare in un sistema complesso di 11 componenti, 8 dei quali stampati a iniezione ad altissima precisione. Vince il premio alla “Qualità della vita” Nanopass® di Terumo (foto 2), presentato come l’ago per siringhe più sottile e indolore del mondo, realizzato con una tecnologia particolare (non a ineizione) e con un bordo asimmetrico per una penetrazione delicata. La prima menzione, in “Medicina omeopatica”, riguarda il dispositivo conta-granuli Pillstick di Plastifrance. Ha conquistato i giurati per la sua semplicità: richiede una sola mano, eroga un granulo ad ogni pressione, è dotato di dispositivo di apertura-chiusura facile e guaina tamper-evident, e viene realizzato in diversi colori. La seconda menzione, per i “Farmaci veterinari” va alla Virbac per il FlexiBag & FarmPack (foto 4): un packaging primario che assicura ergonomia e scurezza alla somministrazione manuale di trattamenti per animali. Cuore della soluzione, una sacca flessibile da 8 litri in materiale multistrato ad alta barriera, che impedisce il contatto del farmaco con l’aria anche dopo l’apertura. Lo zainetto che la contiene è stato studiato da un designer specializzato in progetti ergonomici, in modo che il veterinario abbia entrambe le mani libere durante la somministrazione.

Numeri in crescita e innovazione alla ribalta per l’edizione 2014 della mostra internazionale del packaging farmaceutico Pharmapack Europe. I vincitori degli awards.

Pharmapack punta sul 13 e vince Q Con 342 espositori provenienti da 30 Paesi (l’anno scorso erano 280 da 28 Paesi) e oltre 3.100 visitatori (in aumento del 2% e provenienti da 62 paesi), chiude il 13° Pharmapack Europe (Parigi, 12-13 febbraio 2014). Cresce ancora, dunque, la mostra-convegno di UBM Canon, dedicata al packaging e alla gestione dei prodotti farmaceutici, biofarmaceutici e per la salute. Cresce anche la portata internazionale della manifestazione, che oggi vanta un 44% di visitatori non francesi. Secondo le analisi degli organizzatori, l’operatore “tipo” proviene da imprese che producono farmaci, materiali di imballaggio, medical devices, cosmetici e profumi e servizi di formulazione e confezionamento, e svolge perlopiù la funzione di direttore generale, responsabile acquisti, project manager, scienziato e tecnico, addetto commerciale. Si conferma, inoltre, anche quest’anno l’importanza del côté “culturale” di Pharmapack Europe, nata come occasione di aggiornamento professionale, con oltre 40 conferenze di relatori autorevoli dell’industria e delle istituzioni scientifiche e legislative. Gli immancabili awards all’innovazione ne amplificano l’eco e testimoniano la vitalità di un settore di continua evoluzione. Quest’anno i vincitori sono due, affiancati da altrettante “menzioni speciali”.

Growing numbers and innovation in the limelight at the 2014 edition of the international pharmaceutical packaging show Pharmapack Europe. The award winners.

Pharmapack plays 13 and wins The 13th Pharmapack Europe (Paris, February 12th-13th, 2014) counted 342 exhibitors hailing from 30 different countries (last year there were 280 from 28 countries) and more than 3,100 visitors, a 2% increase, hailing from 62 countries. UBM Canon’s show/conference, dedicated to the packaging and management of pharmaceutical, biopharmaceutical and health products thus continues to grow, as well as the event’s international scope, as it currently boasts 44% of visitors hailing from outside France. According to the organizers’ calculations, the “typical” operator works for an enterprise supplying

96 • 4/14

pharmaceuticals, packaging materials, medical devices, cosmetics, perfumes, formulation services or packaging, and is generally a managing director, acquisitions manager, project manager, scientist/technician or sales representative. This year Pharmapack Europe’s “cultural” edge has also been confirmed; founded as an event for professional updates, the event features more than 40 conferences with authoritative speakers representing industry and scientific and legislative institutions. The inevitable awards for innovation draw attention from further afield and testify

to the vitality of a continually evolving sector. This year there were two winners, alongside another two special mentions. 2014 winners. The award for the category “Medical device for diagnostics” was given to the Eyerprim system for eye disorders by Opia Technologies & Groupe JBT (photo 1). Opi managed to integrate the thin membrane for ocular biopsy with a complex system of 11 components, 8 of which ultra high precision injection moulds. The award for “Quality of life” goes to Nanopass® by Terumo (photo 2), presented as the world’s smallest and most painless syringe, made using special (non-injection) technology and with an asymmetrical edge for delicate penetration. The first special mention, in “Homeopathic medicine” was Plastifrance’s Pillstick granule-counter.

Le candidature ai Pharmapack Awards 2015 vanno presentate entro la fine dell’anno (pharmapack@ubm.com).

The system won over the jury with its simplicity: requiring just one hand, it dispenses one granule for every press of the button, it is equipped with easy open/closure and a tamper-evident sheath and is made in various colors. The second mention, for “Veterinary drugs” went to Virbac for its FlexiBag & FarmPack (photo 4): a primary packaging that guarantees ergonomic and safe manual administration of animal medicine. The heart of the solution is a flexible 8-liter bag of high barrier multi-layer material that prevents contact between the drug and the air, even after opening. The backpack that contains it was developed by a designer specialized in ergonomics to leave the veterinarian with two free hands. Nominations for Pharmapack Awards 2015 should be submitted by the end of the year (pharmapack@ubm.com).

www.dativoweb.net


Ready. Set. Code

/ D29 4 1 l l Ha

la nuova Serie SmartLase C

Potenzia la tua linea d’imballaggio. SmartLase C il massimo controllo della qualità di codifica e dei tuoi costi di produzione alla velocità che ti serve indipendentemente da tasso, dimensione o substrato.

Codifica ad elevato constrasto con oltre 100.000 prodotti/ora

Tasso di disponibilità fino al 99,9% con perfetta integrazione

Durata della vita dei codificatori superiore del 30%

Contattaci adesso www.markem-imaje.it

Modelli d lli su misura i per l’industria alimentare e delle bevande

T. 02/440712.1

F. 02/440712.72

italy@markem-imaje.com


CO SMO PHAR MA

[

MATERIA LS & MA CHINERY

]

In fiera con nuove

macchine e nuovi sistemi Combinazione vincente di tradizione e innovazione, MG2 presenta a interpack alcune delle sue ultime soluzioni dedicate al processo farmaceutico e al packaging. Eccole in rapida carrellata. corredata di gruppi opzionali come lettori di codici a barre, videocamere, stampanti ink jet, etichettatrici (per etichette prestampate o P&A) e stazione di scarto. ACE CT/400 è un sistema track & trace che effettua la marcatura e la verifica a fine linea di astucci farmaceutici. Stampa e verifica fino a 400 astucci /min e, grazie all’ingombro ridotto può essere integrato in qualsiasi linea di confezionamento esistente o nuova. MG2 può fornire soluzioni track & trace anche per linee di confezionamento di flaconi o prodotti fardellati. TF60 è una formatrice, riempitrice e chiuditrice completamente elettronica, caratterizzata da grande flessibilità e da ottime performance produttive, in grado di utilizzare diversi tipi di cartone pressato o canettato, con velocità fino a 60 cicli/min, a seconda del formato scatola e della tipologia di alimentazione prodotto.

G

GSL10 è un’incartonatrice orizzontale che forma, riempie e chiude scatole americane. Tratta fino a 10 cartoni/min, in funzione del formato del cartone e della disposizione del prodotto al suo interno. Può essere

SELEKTA/W è la nuova pesatrice e selezionatrice di compresse e capsule che MG2 ha realizzato fondendo l’esperienza sul doaggio di queste forme con il cuore tecnologico del proprio sistema di controllo peso MultiNETT. In funzione del tipo di prodotto, SELEKTA arriva a controllare fino a 500.000 unità/h, con grande accuratezza. È di semplice utilizzo e manutenzione; per il cambio formato è sufficiente sostituire due serie di particolari, facilmente smontabili. La macchina è proposta anche in versione SELEKTA/CW, che svol-

On show with new machines and new systems Winning combination of tradition and innovation, MG2 will be attending interpack introducing some of its latest novelties dedicated to pharmaceutical process and packaging. Here is a foretaste. GTF60 is a forming/filling/closing machine, fully electronic, featuring great flexibility and excellent production performances, suitable to use different kinds of pressboard or line boards. The machine can reach a production speed up to 60 cycles/minute, depending on box size and type of product feeding system. GSL10 is a horizontal case packer suitable to form, fill and close RSC cases, either by means of tape or hot-melt glue, with a speed of up to 10 cases per minute, depending on case size and product arrangement. GSL10 can be

98 • 4/14

equipped with several product feeding solutions, as well as some optional units such as bar code readers, videocameras, ink jet printers, labellers (for pre-printed labels or P&A) and reject stations. The ACE CT/400 Track & Trace is a marking and verification system which has the ability to print a unique identifying 2D-Data Matrix code onto cartons and simultaneously to read, verify and constantly monitor the code printing quality of each carton. Using the smallest foot-print, the ACE CT/400 prints and verifies up to 400 cartons per minute and can be integrated into any existing or new

ge pure la funzione di conteggio. FlexaLAB a contenimento è l’evoluzione del modello di opercolatrice da laboratorio. Il sistema di contenimento adottato si caratterizza per il concetto di isolatore sollevabile, grazie al quale la macchina mantiene la prerogativa di intercambiabilità di differenti gruppi di dosaggio, e che permette di soddisfare la classe di contenimento di più alto livello, la OEL5, garantendo una concentrazione di sostanza attiva al di sotto di 1 μg per metro cubo. TEKNA è l’opercolatrice che integra tradizione e innovazione. Facilmente accessibile e dall’ingombro ridotto, risponde alle necessità di chi vuole produrre capsule dure contenenti polvere anche in bassi dosaggi senza compattazione, compresi i casi in cui sono presenti requisiti di contenimento e/o Wet-in-Place/WiP/CiP. L’alto grado di innovazione, performance e affidabilità è caratterizzato anche dalla presenza di serie del sistema di controllo in processo al 100% del peso netto MultiNETT e dalla connotazione “No capsule - No dosage”. Q

packaging line. MG2 can also supply track & trace solutions for packaging lines for bottles or bundles. SELEKTA/W is the new check-weigher and sorting machine for tablets and capsules designed by MG2, mixing its experience in handling these solid forms with the technological heart of MultiNETT weight control system. Depending on the product, SELEKTA can check up to 500.000 units/hour, with an incredibly high accuracy level. Easy to use and maintain, size change-over is quickly performed by replacing two sets of parts, which can be easily disassembled. SELEKTA/CW is another version available, which performs weighing, sorting as well as product counting, and it can be integrated to a line suitable to pack tablets or capsules into bottles. FlexaLAB for containment is the evolution of the well-known MG2’s capsule filler for laboratories. The

containment system features a particular liftable isolator concept, which allows the machine to keep its peculiarity to change different dosing units, satisfying also the highest containment class, OEL5, guaranteeing a concentration of active substance - less than 1 μg per cubic metre. TEKNA is the capsule filler which integrates tradition and innovation. Easily accessible and with a small optimized footprint, the machine can perfectly meet the requirements of customers who want to produce hard shell capsules filled with powder (even low dosages without compactation), also when containment and/or Wet-in-Place/WiP/CiP requirements are needed. The high level of innovation, performance and reliability is also confirmed by the presence as standard of the 100% in-process net weight control system MultiNETT and the “No capsule - No dosage” concept of the dosing unit. Q

www.dativoweb.net


Want to build machines that produce customers? Our end user customers are always looking for solutions that help them to optimise product quality, machine safety and productivity. At the same time, machine builders like you are looking for new customers for your machines. That’s why we’ve developed the Connection Point, a new sales support initiative helping you to generate new business with our end user customers, at Interpack 2014.

Find out more about our Connection Point programme at:

http://www.rockwellautomation.com/ rockwellautomation/events/interpack Copyright © 2014 Rockwell Automation, Inc. All Rights Reserved.

SECONDRY IMAGE AREA

2014


AT THE SAME TIME

30-31 OCTOBER

w

w

w.

ehe

dg-congr

.o ess

rg


CO SMO PHAR MA

[

MATERIA LS & MA CHINERY

]

Innovazione delle linee e qualità del packaging ergami presenta a Interpack 2014 la macchina riempi tubetto TF200, progettata con il nuovo approccio in linea, attraverso un sistema orbital track che riceve i tubetti vuoti in verticale per poi riempirli e chiuderli. Questo consente alla macchina di essere costruita a balcone (balcony designed), fornendo all’operatore la possibilità di accedere a tutte le parti e garantendo così estrema facilità di pulizia, in accordo agli standard GMP. Inoltre i sistemi di chiusura per tubetti di plastica e alluminio possono essere montati affiancati, così da essere comodamente intercambiabili, senza dovere

B

installare o disinstallare altri componenti durante i cambi formato.

OGNI MOVIMENTO

REGOLATO DA SERVOMOTORE

La pista orbitale della TF200 contiene bussole porta-tubetto magnetiche, a sgancio rapido e garantito, alimentate in verticale e poi ruotate per la centratura della stampa sul tubetto. Subito dopo, se richiesto, vi è la possibilità di integrare una stazione di pulizia che opera tramite soffio e aspirazione di aria compressa. Dato che la pista ruota a ciclo continuo, i porta-tubetti consegnano i tubi già pronti per il riempimento.

Innovation in packaging lines and quality

Per le linee di confezionamento più innovative, Bergami si avvale della collaborazione di Bosch Rexroth, sviluppando soluzioni tecnologiche universalmente riconosciute per le caratteristiche di funzionalità e affidabilità. Il sistema di dosaggio è regolato da servo-azionamenti, che forniscono la possibilità di programmare a display la gamma di volume dosabile da 3 a 350 ml ed elevano i porta-tubetti all’altezza dei due ugelli di riempimento. Al cambio formato, tutte le variabili specifiche del prodotto

or uninstall other components during format change.

EVERY MOVEMENT CONTROLLED BY SERVOMOTOR

For its most innovative packaging lines, Bergami avails itself of the collaboration of Bosch Rexroth, developing technological solutions universally recognized for their performance and reliability. At Interpack 2014 Bergami will be presenting its TF200 tube filling machine, designed with the new in-line approach, that operates via an orbital track system that receives the empty tubes vertically, then proceeding to filling and closing them. This allows the machine to be balcony

www.dativoweb.net

designed, enabling access to all the parts and thus ensuring extreme ease of cleaning in accordance with GMP standards. In addition, closure systems for plastic and aluminum tubes can be mounted side-by-side so as to be easily interchangeable, without having to install

The orbital track of the TF200 has fully guaranteed quick-release magnetic tube holder sockets, fed vertically and then rotated to center the print on the tube. Immediately after that if required a cleaning station can be attached that operates through blowing and suction of compressed air. Given that the lane rotates in a continuous cycle, the tube-carriers deliver the tubes ready for filling. The metering system is regulated by

servo-drives, which enable the programming by display of the 3 to 350 ml range of the metered volumes and that raise the tube-carriers to the height of the two filling nozzles. At format change, all specific product variables such as humidity, temperature and viscosity can be changed using a simple and functional graphic interface. The metering system, together with hot air welding stations for plastic or laminate tubes and with folding grippers for aluminum tubes, is supported by an upper frame adjustable via handwheel, in order to handle tubes of different lengths. The filled tubes advance along the lane

4/14 • 101


[

MAT E RI ALS & MA CHI NE RY

]

COS MOP H AR MA

Bergami in breve

Bergami in brief

La società Bergami (Altedo, Bologna) è una realtà consolidata nel settore della progettazione e costruzione di macchine automatiche per l’imballaggio: i mercati di riferimento sono principalmente il cosmetico e farmaceutico, con oltre il 90% della produzione esportato all’estero. In oltre 30 anni di attività la ditta bolognese ha venduto più di 1000 macchine in 45 diversi paesi, installate presso grandi gruppi internazionali. L’offerta tecnologica si articola in macchine per il riempimento e la chiusura tubetto, sistemi per l’astucciamento verticale e orizzontale per medie e alte velocità, avvolgitrici e fardellatrici per prodotti singoli e multipli e infine cartonatrici automatiche e palettizzatori. Grazie all’esperienza maturata negli anni, Bergami fornisce inoltre ai propri clienti linee complete di confezionamento, avvalendosi di partner di settore e garantendo l’integrazione con i propri macchinari. Fin dagli inizi degli anni Novanta, le macchine sono state progettate in conformità agli standard GMP. Si tratta di sistemi compatti, flessibili e funzionali, tutti balcony designed, così da garantire facilità di pulizia e manutenzione. Le soluzioni tecniche adottate, sia in campo meccanico che elettronico, sono improntate alla massima funzionalità, consentendo cambi formato eseguibili in pochi minuti da un solo operatore. In un’ottica di total customer care, Bergami garantisce ai propri clienti assistenza giornaliera, con un’offerta completa che include aggiornamenti hardware e software, manutenzione, ricambi e inspection audit con tecnici specializzati. Per soddisfare le crescenti richieste produttive nei settori storici ma anche per ampliare il proprio orizzonte di mercato verso i settori food, non-food e tabacco, l’azienda si trasferirà nel 2015 in una sede più ampia (sempre in località Altedo), continuando a investire in progettazione e innovazione.

Bergami Srl (Altedo, Bologna) is a consolidated concern in the automatic packaging machine design and building sector: their main markets centre on cosmetics and pharmaceuticals, with over 90% of the group’s output exported abroad. In over 30 years of activity the Bolognese concern has sold more than 1000 machines in 45 different countries, installed with big international groups. Their technological offer features tubefilling and closing machines, medium to high speed vertical and horizontal cartoning machines, wrapping and bundling machines for single and multiple products and lastly automatic casepacking and palletising systems. Thanks to the experience built up over the years, Bergami has also been supplying its customers complete packaging lines, availing itself of partners in the sector and guaranteeing interaction with its own machines. Since the beginning of the nineties, their machines have been designed in compliance with GMP standards. These are compact, flexible and functional systems, all balcony designed, so as to guarantee easy cleaning and maintenance. The technical solutions adopted, both in the engineering mechanics and electronics field, feature max functionality, enabling format changes to be carried out in but a few minutes by a single operator. In view of total customer care, Bergami guarantees its customers daily assistance, with a complete offer that includes hardware and software updates, maintenance, spare parts and inspection audits with specialised techniques. To satisfy growing production demands in its traditional sectors but also to extend its horizon to the food, non-food and tobacco sectors, the company will transfer in 2015 to a larger premises (still in the Altedo area), continuing to invest in design and innovation.

quali umidità, temperatura e viscosità possono essere modificate mediante una interfaccia grafica semplice e funzionale. Il sistema di dosaggio, insieme alle stazioni di saldatura ad aria calda per tubetti di plastica o laminati e a pinze pieghevoli per tubetti di alluminio, è supportato da un telaio superiore regolabile tramite volantino, in modo da gestire tubetti di diversa

lunghezza. I tubetti riempiti avanzano lungo la pista per essere poi trasferiti delicatamente in posizione orizzontale nell’alimentatore della macchina astucciatrice. È possibile inoltre che i tubetti vengano prelevati e inseriti in automatico nella catena cassetti dell’astucciatrice. Questa opzione pick & place previene il rischio di sfregamento e garantisce il cor-

retto orientamento dei tubetti. La procedura di cambio formato viene guidata mediante un’interfaccia grafica realizzata per immagini, in modo da facilitare l’operatore riducendo l’intera operazione di cambio formato a circa 10 minuti. Il punto di forza della TF200 è l’assenza di movimentazioni meccaniche comandate da camme tradizionali, ormai obsolete: ogni caratteristica di movimento può essere impostata e regolata dalla programmazione del servo-motore corrispondente.

PARTNER IN AUTOMAZIONE Uscire dallo standard, sviluppare la tecnologia specifica per ogni progetto grazie all’utilizzo delle più moderne componentistiche meccaniche ed elettroniche, migliorare ogni giorno l’efficienza delle macchine e ridurre

and are then gently transferred to a horizontal position in the cartoning machine feeder. The tubes can also be taken and inserted automatically in the cartoning machine drawer chain. This pick & place option prevents the risk of rubbing and ensures the proper orientation of the tubes. The format change procedure is guided via an image based graphic interface so as to facilitate the operator, reducing the entire format change operation to about 10 minutes. The strength of the TF200 is the absence of mechanical movements controlled by

102 • 4/14

traditional cams, by now obsolete: Every feature of the movement can be set and adjusted by programming the corresponding servo motor.

PARTNER IN AUTOMATION To go beyond the standard, developing technology specific to each project by using the most modern mechanical and electronic components, improve daily efficiency of the machines and to minimize operator presence during the production phases: All these activities represent a challenge for those who today want to play a leading role in the

packaging industry. To innovate their applications Bergami has turned to Bosch Rexroth, leading technology partner in developing solutions for the packaging machine sector. The higher level of quality of basic components achieved by Bosch Rexroth following a continuous presence in different automation sectors, is in fact an intrinsic value for Bergomi, who can offer its customers a final product universally recognized for its characteristics of functionality and reliability.

Another determining factor in the choice of the automation platform has been the technical cooperation with the Bosch Rexroth application engineers, focused on the research and implementation of innovative solutions designed to specific manufacturer requirements.

A FLEXIBLE PLATFORM The Indraworks development environment conforms to IEC61131, includes several function blocks dedicated to typical automatic machine functions, allowing a significant reduction in the development time of

www.dativoweb.net


CO SMO PHAR MA

al minimo la presenza dell’operatore durante le fasi di produzione: tutte queste attività rappresentano una sfida per chi, oggi, vuole rivestire un ruolo di primo piano nel settore dell’imballaggio. Per innovare le proprie applicazioni, Bergami si è rivolta a Bosch Rexroth, partner tecnologico leader nello sviluppo di soluzioni per il settore delle macchine per imballaggio. Il superiore livello di qualità dei componenti di base, raggiunto da Bosch Rexroth in seguito a una presenza continuativa nei diversi settori dell’automazione, costituisce infatti un intrinseco valore aggiunto per il costruttore, che può offrire ai clienti finali un prodotto universalmente riconosciuto per le caratteristiche di funzionalità e affidabilità. Altro elemento determinante nella scelta della piattaforma di automazione, è stata la collaborazione tecnica con gli application engineer di Bosch Rexroth, orientata alla ricerca ed implementazione di soluzioni innovative e progettate sulle specifiche richieste del costruttore.

UNA PIATTAFORMA FLESSIBILE L’ambiente di sviluppo Indraworks, conforme agli standard di programmazione IEC61131, include diversi blocchi funzione dedicati a funzionalità tipiche delle macchine automatiche, consentendo una significativa riduzione dei tempi di sviluppo delle applicazioni. Bergami ha saputo scegliere al meglio tra le caratteristiche di scalabilità software e hardware della piattaforma IndraMotion, impiegando i diversi controlli della piattaforma MLC (MLC25/MLC45/MLC65) in base alla complessità e al numero di assi richiesti dalle diverse applicazioni. Anche nella scelta dei servoazionamenti Bergami si è avvalsa dell’offerta più completa nel settore dell’automazione messa a dispo-

www.dativoweb.net

sizione da Bosch Rexroth. L’impiego dei motori con servo azionamenti integrati della serie IndraDrive Mi, con funzioni di sicurezza che variano dal SafeTorqueOff alle funzioni SafeMotion, oltre alla possibilità di un collegamento diretto tra il motore e nodi di IO remotati in campo, ha consentito la massima riduzione degli ingombri interni al quadro elettrico, nonché un significativo risparmio nel cablaggio. Per applicazioni low cost, con ridotto numero di assi o che non richiedano la presenza di un controllore motion, i servo azionamenti compatti della serie IndraDrive Cs sono oggi la soluzione più flessibile e conveniente presente sul mercato: grazie alla ampia interfacciabilità verso i più comuni bus di campo (Ethernet IP, Profinet IO. Profibus DP e CANopen), è possibile realizzare applicazioni a costo ridotto semplicemente interfacciando i servo azionamenti al plc di macchina. Per questo motivo Bosch Rexroth ha inserito le novità presentate da Bergami (Interpack, Hall 16 stand 16B04) nel percorso Innovation Tour, una presentazione speciale dedicata a tutte le soluzioni innovative sviluppate in collaborazione con Bosch Rexroth (Interpack, Hall 06 stand D62), che sarà promosso in anteprima in fiera. Q

[

MATERIA LS & MA CHINERY

]

applications. Bergami was able to select the best among the scalability characteristics of software and hardware of the IndraMotion platform, using the various MLC platform (MLC25/MLC45/MLC65) controls, depending on the complexity and the number of axes required for the different applications. Also in the choice of servodrives Bergami has taken advantage of the Bosch Rexroth’s comprehensive offer. The use of servo motors with integrated Mi IndraDrive series with safety features that range from SafeTorqueOff to SafeMotion functions, also enabling direct connection between the motor and IO nodes remoted in the field, has allowed the maximum reduction of bulk inside the electrical control panel, as well as a significant saving in wiring. For low-cost applications, with reduced number of axes or that do not require the presence of a motion controller, the compact servodrives of the IndraDrive Cs series are today the most flexible and cost-effective on the market: thanks to extensive interfacing towards the most common fieldbuses (Ethernet IP, Profinet IO. Profibus DP and CANopen), applications can be built at a reduced cost simply by interfacing the servodrives to the machine PLC. And this is why Bosch Rexroth has introduced the novelties presented by Bergami (Interpack, Hall 16, Stand 16B04) in its Innovation Tour, a special presentation dedicated to all the innovative solutions developed in cooperation with Bosch Rexroth (Interpack, Hall 06, Stand D62), which will be previewed in a promotional launch at the fair. Q

4/14 • 103


Prêt à Porter

Zenith è il partner ideale per i professionisti della distribuzione alimentare. Cuocere, imballare, conservare, trasportare il cibo, ecco i molteplici usi dei contenitori d’alluminio. Zenith offre una vasta gamma di soluzioni assortimento di oltre 150 referenze, a partire dalle classiche “vaschette” ZENITH s.r.l. Strada Provinciale BS 668 - 25025 Manerbio (Brescia) Tel.: +39 030 9938152 - Fax: +39 030 9382231

www.zenithalluminio.it info@zenithalluminio.it


[ gni giorno, le richieste della clientela spingono l’ufficio progettazione di Omas a studiare nuove soluzioni, migliorando aspetti e caratteristiche delle macchine. È il caso della nuova Rotary Machine, monoblocco rotativo a movimenti continui. Dal design innovativo e una linea di facile pulizia, è proposta per velocità fino a 170bpm e fino a 240bpm. Grazie agli elevati standard qualitativi, ai movimenti meccanici precisi, alla solida struttura delle parti a contatto con il prodotto 316L o materiali approvati FDA (completamente smontabili e sanitizzabili) è adatta per essere utilizzata in ambito cosmetico e farmaceutico, con versioni da installare anche in area sterile o con flusso laminare. Viene proposta in due modelli. GRC Rotary Capper è il monoblocco rotativo di tappatura in versione a 6 e 8 teste di chiusura, con 1-2-3 torrette per differenti tipi di applicazione. GRFC - Rotary Filler and Capper, invece, è il monoblocco rotativo di riempimento e tappatura, nella versione a 4-6-8 ugellli di riempimento per prodot-

O

A DV ERTO RIA L

]

OMAS: l’evoluzione aziendale e tecnologica Omas Tecnosistemi inaugura una nuova sede produttiva in Canton Ticino (CH), rendendo così più efficiente la logistica e la distribuzione della produzione. Focus sui monoblocchi rotativi. ti liquidi e densi, disponibile con stazione di dosaggio volumetrico a siringhe con valvola a sfera, con valvola rotante con siringhe rotanti. Omas rende disponibili numerose opzioni a richiesta: scarto flacone difettoso con controllo dell’avvenuta operazione, servomotori per regolazione elettronica della testa di chiusura, regolazioni automatiche altezze stazione di dosaggio e stazione di chiusura, gestibili da pannello, memorizzazione ricette e impostazione automatica della macchina, sistema di lavaggio, protocolli di validazione IQ-OQ-PQ-DQ FDA-CFR21, certificazione materiali con tracciabilità.

Nel corso del tempo è stato osservato un incremento di richieste di entrambi i modelli in differenti versioni, forniti a importanti brand dell’industria farmaceutica italiana ma anche internazionale o, ancora, per l’industria chimica. È il caso del modello GRFC - Rotary Filler and Capper, consegnata a una società leader brasiliana per il riempimento e tappatura di colla vinilica (foto 1). Lo stesso modello in versione Atex, è stato consegnato a marzo 2014 in Arabia Saudita, per il riempimento di profumi in fiale (foto 2+QR CODE).

Omas: the evolution of business and technology Omas Tecnosistemi inaugurates a new production plant in Canton Ticino (CH), thus making logistics and distribution of production more efficient. Focus on their rotary monoblocs. Every day customer demands drive the Omas design office to study new solutions, improving aspects and features of their machines. This is the case with their new continuous motion rotary monobloc. With its innovative design that also makes it easy to clean, it is proposed for speeds of up to 170bpm and 240bpm.

www.dativoweb.net

Thanks to its high quality standards, the precise mechanical movements, to the solid structure of the product contact parts in 316L or FDA approved materials (that can be fully disassembled and sanitized), the system is suitable for use for cosmetics and pharmaceuticals, with versions that can also be installed in sterile areas or with laminar flow.

In time an increase in demand for both models in different versions has been observed, supplied to important brands of the Italian pharmaceutical industry but also to international or chemical industry brands. This is the case of GRFC - Rotary Filler and Capper model, delivered to a leading Brazilian chemical company for vinyl glue filling (photo 1). The same model was delivered in March 2014 to Saudi Arabia for filling perfumes in vials ( photo 2+QR CODE).

Two models are offered. The GRC - Rotary Capper is a 6 and 8 closing head monobloc, with 1-2-3 turrets for different types of application. The GRFC - Rotary Filler and Capper is a 4-6-8 nozzle monobloc for filling liquid and dense products, available with ball valve syringe (rotating syringe and valve) volumetric metering station. Omas offers many options on request: removal of faulty flacons with checking of successful outcome, servo motors for electronic adjustment of the locking head, automatic adjustment from

control panel of metering station and closing station height, store of formulas and automatic machine setting, cleaning system, IQ-OQ-PQDQ FDA-CFR21validation protocols, plus material certification with traceability. FOR INFO Omas Tecnosistemi Srl Unipersonale Via Edison, 39 20023 Cerro Maggiore (MI) Interpack Pad 16 Stand C47 info@omastecnosistemi.it www.omastecnosistemi.it

4/14 • 105


!()*+*()

                     

               

 !

! "#$%&'

 

!      "# $!  


CO SMO PHAR MA

[

MATERIA LS & MA CHINERY

]

Astucciatrice alternata per il cosmo-farma Q Ha al proprio attivo 45 anni di impegno nella progettazione e costruzione di macchine automatiche per l’imballaggio farmaceutico e cosmetico: Famar Packaging continua e rafforza la collaborazione con aziende hi-tech del comparto, abbinando alle macchine per il confezionamento di fluidi, creme e polveri le proprie astucciatrici alternate e continue e i relativi fine linea (fardellatrici, cartonatori, palettizzatori), così da offrire ai clienti linee complete di riempimento e confezionamento. Anche quest’anno, insieme a Omas Tecnosistemi, partecipa alla fiera Interpack (Düsseldorf, 8-14 maggio 2014) dove esporrà l’astucciatrice alternata mod. A1 (velocità meccanica 120 astucci/min) in linea con una riempitrice di flaconi prodotta da Omas Tecnosistemi. La semplicità di utilizzo, la rapidità di cambio formato e la possibilità di installare differenti tipi di alimentazioni automatiche in base al tipo prodotto da confezionare rendono le astucciatrici mod. A1 molto versatili e adatte a svariate applicazioni in ambito cosmetico/farmaceutico. Ricordiamo infine che Famar Packaging è costruttore di livello mondiale di blisteratrici e termoformatrici per cassonetti, messe a punto in particolare per confezionare fiale, e flaconi e siringhe.

Intermittent cartoning machine for cosmo-pharma 45 years of dedication to the design and construction of automatic packaging machinery for pharmaceuticals and cosmetics: Famar Packaging carries on and strengthens its partnership with hi-tech concerns in the sector, supplementing packaging machinery for fluids, creams and powders with its own intermittent and continuous cartoning machines and end of line systems (bundlers, casepackers, palletizers), in such a way offering its customers complete filling and packaging lines. Once again this year, together with Omas Tecnosistemi, the concern participates in the Interpack fair (Düsseldorf, 8-14 maggio 2014), where it will show an intermittent model A1 cartoning machine (mechanical speed 120 cartons/min) in line with an Omas Tecnosistemi vial filling machine. The system’s ease of use, quick format changeover and compatibility with installation of various types of automatic feed systems, according to the product to be packaged, make the A1s extremely versatile and adapted to a wide variety of applications in the cosmetics/pharmaceutical sector. Worth noting, finally, is that Famar Packaging is a global builder of blister machines and thermoforming machines, developed in particular to package vials, and flacons and syringes.

www.dativoweb.net

4/14 • 107


[

MAT E RI ALS & MA CHI NE RY

]

COS MOP H AR MA

A new reclosable monodose Handy, ergonomic and competitive, Lameplast’s new 0.6 ml monodose made for pharmaceuticals, cosmetics and medicinals comes in five vial resealable strips. Technologically advanced and covered by patent it weighs less than standard containers of the same volume, reducing the use of resources and combining cost-effectiveness and environmental friendliness. The ergonomic shape of the new packaging item ensures ease of use as well as optimum dispensing in constant doses of all types of fluid (liquid, gel or cream), even for elderly people or with limited hand sensitivity. The hole, smooth and without sharp edges, enables product application even in the most delicate areas of the body, such as the eyes and mucous membranes. The materials used comply with ophthalmicparenteral sector standards and can be sterilized by gamma irradiation. Lastly, the high cap flap lends itself to personalisation and can also expanded with the application of a gusset on one or both sides of the strip.

Practical and stylish deo stick Attractive curved lines and a wide body for easy handling feature in the packaging of the new Garnier Mineral women’s and men’s deodorant stick. Made by RPC BramlageWiko with millimetric precision for L’Oreal in injection moulded PP, with a white slender design for the lady’s and a shorter, more compact shape for the men’s product. Both with eye-catching labels.

108 • 4/14

Un nuovo monodose richiudibile Q Pratico, ergonomico e competitivo, il nuovo monodose da 0,6 ml, realizzato da Lameplast per farmaci, cosmetici e dispositivi medici. Viene proposto in strip da cinque flaconcini richiudibili, è tecnologicamente all’avanguardia e brevettato; avendo un peso inferiore rispetto ai contenitori di analogo volume, riduce l’utilizzo di risorse e coniuga, dunque, economicità e rispetto dell’ambiente. La forma ergonomica garantisce praticità d’uso nonchè la fuoriuscita ottimale e in dosi costanti di tutti i tipi di fluido (liquido, in gel o in crema), anche alle persone anziane o con limitata sensibilità alle mani. Il foro, liscio e senza bave taglienti, consente l’erogazione del prodotto anche in zone delicate del corpo, come occhi e mucose. I materiali impiegati rispettano le normative del settore oftalmico-parenterale e possono essere sterilizzati a raggi gamma. Infine, il tappo dall’aletta alta ben si presta alla personalizzazione, che si può anche ampliare con l’applicazione di un tassello su uno o su entrambi i lati dello strip.

PRATICITÀ E STILE PER I DEO STICK Piacevoli linee ricurve e un corpo ampio, comodo da maneggiare, caratterizzano il packaging del nuovo deodorante in stick maschile e femminile Garnier Mineral. RPC Bramlage-Wiko l’ha realizzato per L’Oréal, con precisione millimetrica, in PP stampato a iniezione, con una silhouette bianca e snella nella versione per Lei, più compatta e forte per Lui. Entrambe decorate con etichette che catturano l’occhio.

www.dativoweb.net


Il Gruppo Gerosa offre soluzioni di imballaggio per prodotti alimentari con laminati da 2 a 4 strati e stampa fino a 12 colori con cilindri incisi al laser.


[

MAT E RI ALS & MA CHI NE RY

]

M U LT I M A RK E T

Flessibili e dedicate ai beni di largo consumo AcmaVolpak (gruppo Coesia) espone a Interpack alcune delle ultime soluzioni sviluppate per il settore dei beni del largo consumo, con particolare attenzione ai comparti tea and coffee, beverage, home e personal care, confectionery e bakery. ra le numerose novità in mostra, ricordiamo la flowpacker Acma Sp1 e la macchina Volpak SC140 per buste di tipo flessibile, tipici esempi di una filosofia costruttiva che ricerca tanto le massime prestazioni quanto l’efficienza energetica e l’affidabilità. E ancora, Acma M888 per il confezionamento multi-stile di cioccolatini, Enflex STD-22 per stand-up pouches e la Volpak SI-280. Premiere per T4 Modula, soluzione sviluppata da

T

Tecnomeccanica per il confezionamento di tè in busta. infine, una linea completa per il caffè composta dalla riempitrice e confezionatrice di capsule Qi e da un’inedita Mini Wrapper.

ACMA SP1 IN DETTAGLIO L’offerta di Acma si declina in tre differenti tipi di flowpacker: Sp0 (pensata principalmente per l’incartamento di saponi), Sp1 ed Sp2 (dedicate nello specifico al comparto alimentare, tra cui il cioccolato, caramelle e i prodotti da forno). Le flowpacker serie SP di Acma consentono il confezionamento a media e alta velocità di prodotti singoli o mul-

Flexible and dedicated to fast moving consumer goods AcmaVolpak, part of the Coesia Group, will exhibit at Interpack some of its latest solutions for fast moving consumer goods sectors, including tea & coffee, bakery, beverages, food, confectionery & chocolate products, home and personal care. Among the many novelties on show, the company will present the Acma Sp1 flowpacker and the horizontal form-fillseal machine Volpak SC-140. The two machines are a perfect examples of AcmaVolpak construction approach, which aims to merge high end

110 • 4/14

performances with great efficiency, energy saving and reliability. Other solutions on show will be the Acma M888 multy-style wrapping machine, the Enflex STD-22 for stand-up pouches and Volpak SI-280. First time on show also for the T4 Modula,

tipack, con saldatura a caldo o a freddo: il gruppo rotativo trasversale può essere fornito anche in versione “longdwell”, che con il movimento traslatorio durante la saldatura, consente di lavorare ad alta velocità materiali particolarmente resistenti che devono garantire la massima ermeticità della confezione. Il sistema di svolgimento del film di incarto è corredato da un gruppo per la giunzione automatica che consente la rapida sostituzione della bobina senza fermo macchina. Per la versione top di gamma (Sp2, 120 m di film al minuto) Acma ha brevettato un dispositivo per il tensionamento pneumatico del film che garantisce al contempo massime performance e interruzione dello svolgimento in caso di assenza prodotto. I sistemi modulari di distribuzione progettati da Acma permettono la gestione ottimale dei prodotti in arrivo, disposti a ranghi allineati dalla linea di processo.

VOLPAK SC-140 IN DETTAGLIO Con la serie SC, Volpak presenta la nuova gamma di macchine HFFS, in grado di ottimizzare il rateo di produzione di grandi lotti. La serie SC è basata

Tecnomeccanica’s new solution for packaging tea in filter bags. Last but not least, a complete packaging line for coffee capsules, which will consist of a series of fully integrated machines: the Qi for capsule filling and the MiniWrap.

ACMA SP1 IN DETAIL ACMA’s offer includes three different models of flow packers: SP0 (devised mainly for wrapping soap bars), SP1 and SP2 (specifically dedicated to the food segment, including chocolates, sweets and bakery products). The flowpackers of ACMA SP series pack single products or multipacks at medium and high speeds, with hot or cold sealing system:

the rotary sealing unit can also be supplied in the “long-dwell” version, which thanks to its traversing movement during the sealing phase, allows to process particularly resistant materials at high speed that have to guarantee a totally airtight seal of the package. The wrapping film unwinding system is equipped with an automatic splicer, so that the reel can be replaced quickly without having to shutdown the machine. For the top of the range version (Sp2,120 m of film a minute) Acma has patented a device for the pneumatic stretching of film that at the same time guarantees max performance and no product no unwind. The modular

www.dativoweb.net


su due piattaforme per la produzione di pouch, con capienza da 500 a 1500 ml, e in grado di coprire l’ampia gamma di esigenze nel mercato dei pouch flessibili. I clienti possono raddoppiare i propri livelli di produzione, beneficiando di importanti risparmi: nei consumi energetici, nelle spese di manutenzione, in termini di costo del packaging e di ingombri. La macchina usa un sistema lineare per la formazione e la chiusura del pouch, che ne garantisce l’integrità e la qualità. La movimentazione continua, assieme alla costruzione modulare e alla presenza di stazioni indipendenti per l’apertura, il riempimento, la tappatura e la chiusura del pouch, contribuiscono a garantire la qualità del prodotto finito. SC è disponibile in due varianti, a seconda del formato e del volume del pouch, e può essere predisposta per l’utilizzo con prodotti liquidi o per prodotti asciutti, in entrambi i casi dotati o meno di sistema di chiusura richiudibile. Q

distribution system designed by Acma enables the optimum management of the incoming product, set out in lined by the processing line.

VOLPAK SC-140 IN DETAIL With the SC series, Volpak presents the new range of HFFS machines with continuous motion technology doubling the production rates. The Volpak SC series is based on two platforms, for pouches up to 500 ml and 1500 ml capacity, that cover the needs of the world-wide market for flexible pouches. Customers can double their production capacity benefitting from important savings in energy, maintenance,

www.dativoweb.net

packaging cost and space. The machine also uses a linear pouch forming module, guaranteeing the seal integrity and quality of the pouches produced. The single fill station and the gentle handling of the pouches are key to optimize the filling conditions for any type of product. Finally, the top seal turret allows operating in optimum conditions, and is designed to accommodate pouches with or without caps. SC is available in two versions, depending on the format and volume of the pouches and in many configurations: for liquid products with or without reclosable caps and for dry products with or without re-closable zippers. Q

4/14 • 111


[

MAT E RI ALS & MA CHI NE RY

]

M U LT I M A RK E T

Innovativi, consapevoli, capaci Q A Interpack l’innovazione del Gruppo IMA sarà sempre più visibile. In uno spazio di circa 3.000 metri quadri nella Hall 17, i visitatori verranno guidati alla scoperta dei dettagli e della tecnologia di alta precisione delle macchine automatiche e delle linee complete per il processo e il confezionamento di prodotti farmaceutici, cosmetici, alimentari, tè e caffè. Alla fiera tedesca il Gruppo IMA presenta dunque un ampio ventaglio di soluzioni in grado di soddisfare tutte le richieste del mercato, puntando sugli avanzamenti tecnologici delle soluzioni per il processo e il confezionamento, espressione delle varie divisioni del Gruppo.

IMA Industries. Le società e le divisioni di IMA Industries, il settore non farmaceutico del Gruppo IMA, presentano gli ultimi sviluppi orientati al mercato per il confezionamento di tè, caffè, latticini, cibi preparati, chewing-gum e caramelle, cosmetici e toiletteria. • La Divisione Tea & Coffee esporrà le nuove macchine ad alta velocità per il confezionamento del tè in sacchetti filtro a doppia camera non termosaldabile con filo annodato: la C24-E, flessibile e user-friendly, garantisce una tecnologia per il fissaggio del filo dalle prestazioni straordinarie mentre la C24-T, semplice e compatta, offre un rapporto qualità/prezzo imbattibile.

• Da Corazza, la nuova FF4, una dosatrice-avvolgitrice ad alta velocità per il confezionamento di formaggio fuso, cremoso o fresco, progettata e prodotta secondo i criteri tecnologici più avanzati, sarà in linea con la SF100, astucciatrice automatica per il confezionamento di porzioni triangolari di formaggio fuso in scatole di forma rotonda. • GIMA presenta la FCW300, astucciatrice veloce da fustellato steso per il confezionamento di chewing-gum e caramelle, che garantisce bassi costi di approvvigionamento rispetto agli astucci preincollati ed estrema flessibilità in termini di forma e di dimensioni delle confezioni.

Innovation, awareness, ability At the forthcoming edition of Interpack, IMA’s innovation will be even visible. In a space of around 3,000 square metres in Hall 17, visitors will be guided in discovering the high precision details and technologies of automatic machines and complete lines for processing and packaging pharmaceutical, cosmetics, tea, coffee and food products. The IMA Group will hence present a wide range of solutions to meet all the requirements, focussing on new cutting-edge technological advances of the solutions for the processing and packaging, expression of the various realities of the Group. IMA Industries. The companies and divisions part of IMA Industries, the non-pharmaceutical sector of the IMA Group, will introduce their latest developments and highly marketoriented solutions for the packaging of tea, coffee, dairy and convenience food, chewing-gum and candies, cosmetics and toiletries.

112 • 4/14

• Tea & Coffee Division will be showcasing the new high speed tea bag packaging machines for non heat-sealable double chamber filter bags with knotted string: the flexible and user-friendly C24-E, which guarantees ultra high-performance knot technology for tea bags, and the C24-T, the simple and compact

• Per quanto riguarda il fine linea, la Divisione BFB espone la nuova incartonatrice ad alta velocità WA30, idonea al confezionamento di ogni tipo di prodotto partendo sia dalle fustelle sia dai cartoni preincollati: una soluzione intelligente e adattabile per ogni esigenza di incartonamento. IMA Pharma. Si riconferma leader mondiale nella progettazione e produzione di macchine automatiche per il processo e il confezionamento di prodotti farmaceu-

tici, grazie all’alto profilo tecnologico e alla capacità di offrire soluzioni personalizzate alle richieste più sofisticate. • La divisione IMA Active espone la nuova ADAPTA 200, opercolatrice dalla flessibilità inimitabile. Le sue unità di dosaggio possono essere facilmente rimosse e sono reversibili/intercambiabili; ciò permette di ottenere velocemente diverse configurazioni della macchina e diverse combinazioni di riempimento. ADAPTA è progettata per dosare 3 prodotti in una singola capsula, e fino a 5 su richiesta del cliente, mantenendo la velocità di produzione di 200.000 capsule/ora. È caratterizzata, inoltre, da ineguagliabili capacità

solution offering the IMA top quality with an unbeatable value for money. • From Corazza, the new FF4, high speed dosing & wrapping machine for the packing of processed, cream or fresh cheese, designed and manufactured according to the highest technology criteria, will be in line with the SF100, cartoning machine for triangular portions of processed cheese in round boxes. • GIMA will present the FCW300, horizontal flat blanks cartoning machine for the packaging of chewing-gum and candies, which ensures lower procurement costs compared to a pre-glued carton and an extremely flexibility in terms of packaging shapes and product sizes.

• As concern to the end of line solutions, on display from BFB Division, the new high speed case packer WA30, suitable to pack any kind of products into a shipper starting from flat-blank as well as pre-glued cases, intelligent adaptable for case packing requirements. IMA Pharma thus reconfirms itself as world leader in the design and manufacture of automatic machines for the processing and packaging of pharmaceutical products thanks to a high technological profile and the ability to offer tailor-made solutions to satisfy the most sophisticated requests. • IMA Active division will show the new ADAPTA 200 capsule filler featuring an inimitable flexibility. Its dosing units can

www.dativoweb.net


di controllo in linea della produzione che può essere totalmente controllata, anche in caso di combinazione di più prodotti, grazie alla verifica individuale del dosaggio del prodotto, inclusa la possibilità di autoregolare i parametri di lavorazione. • La divisione IMA Life presenta un’innovazione rivoluzionaria nei sistemi di carico e scarico di flaconi negli impianti di liofilizzazione industriali. Con il “DA VINCI”, IMA

Life si conferma uno dei pochi produttori al mondo a progettare, produrre e testare un’intera gamma di sistemi collaudati. • Un’anteprima per la divisione IMA Safe: Swiftpack SP 2-4, macchina contatrice multicanale per compresse e capsule. Grazie all’esperienza di oltre 80 macchine Swiftpharm installate in tutto il mondo, IMA Safe Swiftpack ha ora sviluppato la SP 2. Dimensioni ridotte, maggiore velocità di produzione, contatrice e nastro di trasporto integrati e controllati da un’unica interfaccia (HMI). Il nuovo design permette che le operazioni di cambio formato e pulizia siano ancora più semplici e veloci. Q

• IMA Life division will present the latest breakthrough in loading/unloading vials into industrial freeze dryers: with “DA

VINCI”, IMA Life confirms itself as one of the few suppliers in the world that designs, manufactures and tests a full range of proven systems. • IMA Safe division will launch the new Swiftpack SP 2-4. Discover the new SP 2-4 multi channel electronic counter for tablets and capsules on display for the first time at Interpack 2014. With the experience gained of having over 80 SWIFTPHARM machines supplied throughout the world, IMA Safe Swiftpack has now developed the SP 2. Along with a smaller footprint and increased output, the counter and integrated conveyor are both controlled from a single HMI. Quick changeover components and the tabletop design, further improve the machine’s ease of cleanability. Q



/





www.dativoweb.net

/   

,



-

be easily removed and are reversible/ interchangeable giving the possibility of a plug and play shift between different machine configurations and filling combinations. ADAPTA is designed to dose 3 products into the same capsule (up to 5 upon request), without affecting the production speed of 200,000 capsules/hour. ADAPTA has an indisputable efficiency as far as in-process control is concerned. Total production control can be achieved, even in case of products combination, for each single product dosage including possible self-adjustment of machine working parameters.

9  / -

4/14 • 113 )3/


[

MAT E RI ALS & MA CHI NE RY

]

Flow packs and vertical packaging machines: new features Tecno Pack brings to Interpack the experience built up in 30 years of R&D and presents (hall 5, lane J 22) the latest mechanical and electronic technologies implemented in flow packaging, pillow pack, carton and end-of-line machines. High speed, controlled atmosphere, automation covering the entire packaging cycle feature in Tecno Pack’s solution and enable them to devise, construct and install complete state-of-the-art lines for packaging all types of products (in particular for the bakery segment). In the spotlight. Based at Schio (VI) and operative at international level, Tecno Pack will be showing a line for a US customer at the fair. Entirely made in stainless steel, and with IP 65 washdown electrical system, the line automatically packs precooked “pastry” of various shapes, subsequently positioned by robots inside the cartons. At the stand too a second line for the automatic packaging in flowpack of baked products, coupled to an automatic secondary grouping system. Lastly, the new FV210 electronic multiaxial cantilevered packaging machine served by a 14 headed radial balance, associated with a second FV025 machine fitted with volumetric doser, provides visitors with a sample of the expertise built up in terms of vertical packaging. On the FV210 Tecno Pak has installed an innovatory system enabling the production - in a single machine and with simple format changes - of block bottomed cushion packs, with four side seals and a double block bottom, up to the sophisticated DoyPack bags made through the rotation of the cut-n-sew unit.

Flow pack e confezionatrici verticali: novità Q Tecno Pack porta a Interpack l’esperienza maturata in 30 anni di R&S e presenta (hall 5, corsia J 22) le ultime tecnologie meccaniche ed elettroniche implementate nelle macchine per l’imballaggio in flow pack, pillow pack, cartoncino, end of line. Alta velocità, atmosfera controllata, automazione completa di tutto il ciclo del packaging caratterizzano le soluzioni Tecno Pack e mettono l’impresa in grado studiare, realizzare e installare linee complete e allo stato dell’arte per il confezionamento di tutti i tipi di prodotto (in particolare per il backery).

Sotto i riflettori. Basata a Schio (VI) e operativa a livello internazionale, Tecno Pack espone in fiera una linea destinata a un cliente statunitense. La stessa linea interamente realizzata in acciaio inox, e con impianto elettrico IP 65 wash down, è dedicata al confezionamento automatico in flow pack di “pastry” precotti di varia forma, poi posizionati da robot all’interno dei cartoni. Allo stand, anche una seconda linea per il confezionamento automatico in flow pack di prodotti da forno, abbinata a un sistema anch’esso automatico di raggruppamento secondario. Infine, la nuovissima confezionatrice verticale FV210 elettronica multiasse a sbalzo servita da una bilancia a 14 testate radiali, associata a una seconda macchina FV025 dotata di dosatore volumetrico, fornisce al visitatore un saggio dell’expertise maturata in fatto di confezionamento verticale. Sulla FV210 Tecno Pack ha installato un sistema innovativo che permette di ottenere - in un’unica macchina e con semplici cambi formato - buste a cuscino, a fondo quadro, a quattro saldature laterali e doppio fondo quadro, fino alla sofisticata busta DoyPack eseguita per mezzo della rotazione del gruppo tagliacuce.

 







+DOO% ZZZLPEDOOLW

ZZZPHVSLFLW 114 • 4/14

www.dativoweb.net


1RQULQXQFLDUHDOODWXDÀ  ORVRÀ  D motori con elettronica integrata I nostri

si adattano a tutte le tecnologie e a qualsiasi protocollo

„ „ „ „ „ „ „ „ „

www.servotecnica.com info@servotecnica.com

sempre attenti al movimento

Progettazione, installazione e messa in servizio semplificate Eliminazione del cablaggio tra motore e azionamento Nessun disturbo elettromagnetico Nessun ingombro nell’armadio elettrico Modularità delle macchine e relativa espandibilità a posteriori Semplicità di individuazione guasti e ripristino immediato dell’asse Funzioni di sicurezza integrata Gestione I/O a bordo asse, intelligenza decentralizzata Grado di protezione fino a IP65


MULTI MAR K E T

[

MATERIA LS & MA CHINERY

]

Lo scanner 3D soddisfa tutta una nuova gamma di specifiche, come il controllo di qualità con i nuovi parametri volume, peso o altezza d’impilamento. The 3D scanner allows new requirements to be defined, including quality assurance parameters such as volume, weight, or stack height.

Con l’ultimo update del transmodulo TLM la slitta è stata accorciata e dotata di un LED per l’indicazione del modo d‘esercizio. As part of the latest TLM transmodule update, the transport carriage has been shortened and equipped with an LED display for the operating status.

bot TLM. Anche il numero delle parti elettroniche è stato notevolmente ridotto.

Sempre più flessibile la tecnologia di confezionamento proposta da Gerhard Schubert GmbH. Il nuovo in fiera.

TLM: la prossima A

Interpack 2014 Gerhard Schubert GmbH presenta in anteprima l’ultima generazione di TLM. Tra le diverse innovazioni: il prototipo della prima macchina confezionatrice senza armadio elettrico, lo scanner tridimensionale che costituisce una pietra miliare nell’elaborazione delle immagini e i transmoduli, aggiornati sia nella veste esterna che all’interno. In esposizione allo stand 14A06, Hall 14: tre linee picker e un impianto di confezionamento TLM con cartoni shelf ready per aerosol e cambio utensili automatico.

PIÙ INTELLIGENZA, MECCANICA RIDOTTA Nello sviluppo dei nuovi progetti la Schubert segue sempre il principio di combinare un software intelligente con una meccanica ridotta al minimo. Una filosofia immediatamente visibile anche nella macchina confezionatrice senza quadro elettrico che, già al primo sguardo, mostra una linea del telaio notevolmente assottigliata. Nella serie TLM, là dove era in precedenza posizionato l’armadio elettrico, in futuro ci sarà bisogno di molto meno spazio perché il servoamplificatore è situato all’interno del controllo decentrato del ro-

The packaging technology by Gerhard Schubert GmbH is more and more flexible. Premiere on show.

TLM: the next generation The latest TLM generation by Gerhard Schubert GmbH will be a premiere at interpack 2014. Among the new features: a prototype of the world’s first packaging machine without a switch cabinet, the launch of 3D scanners as a milestone for product image processing and both the housing and the inner workings of the transmodules. Schubert will exhibit a total of three TLM picker lines and a TLM packaging line at trade

www.dativoweb.net

fair stand 14A06 in Hall 14. The packaging line utilises automatic tool change to produce shelf-ready cartons of aerosol cans.

MORE INTELLIGENCE, LESS MECHANICS With all of its innovative projects, Schubert pursues the principle of combining intelligent software with reduced mechanical systems. This approach is also embodied in the packaging

I vantaggi. Già allo stato attuale del progetto, Schubert ha aumentato l‘efficienza nella produzione e nella configurazione degli impianti mentre i clienti beneficiano di una manutenzione più semplice. Infatti, visto che ogni funzione può causare un disturbo, la riduzione dei pezzi riduce anche i possibili guasti.

LA NUOVA DIMENSIONE DEL SISTEMA VISION Con lo scanner 3D, Schubert rende possibile una visione spaziale: ottenendo il profilo in altezza viene riprodotta la forma tridimensionale del prodotto da confezionare. Lo sviluppo si basa sulla visione stereoscopica (lo scanner rileva due viste del prodotto da due diverse angolazioni). La riproduzione dell’altezza avviene con una risoluzione di 0,5 mm su un settore misurato di 60 mm di altezza. Questa tecnologia eleva il controllo di qualità a un nuovo livello perché lo scan-

machines without switch cabinets. The more narrow head section of the TLM machine, which itself is known as “robot heaven”, is a visible indication that conventional electrical systems have been eliminated. In the future, less room will be required where Gerhard Schubert originally placed the control cabinet when launching the TLM series. This is due to the fact that the servoamplifiers are part of the TLM robot within a decentralized controller system and no longer take up space in the control cabinet. In addition, the number of electronic parts has been significantly reduced. The advantages. Schubert already achieves higher efficiency in

manufacturing and configuring the lines in the current stage of development. Customers benefit from lower maintenance expenditures. Because each function can also malfunction, having fewer components means a lower susceptibility for error.

NEW PERFORMANCE DIMENSIONS FOR THE VISION SYSTEM The 3D scanner from Schubert realizes spatial perception. The resulting height profile reflects the three-dimensional shape of the product to be packaged. This development is based on the stereoscopic approach, which means that the scanner captures two views of each product from different viewing

4/14 • 117


[

MAT E RI ALS & MA CHI NE RY

]

M U LT I M A RK E T

Flessibili e per qualsiasi prodotto Le macchine confezionatrici esposte da Gerhard Schubert forniscono un’idea della gamma di impianti offerti dalla società tedesca. Il prototipo della macchina confezionatrice senza armadio elettrico lavora sacche per infusioni, e proietta il costruttore tedesco nel mondo farmaceutico, per il quale è attivo il nuovo team Schubert Pharma. L’impianto di confezionamento per l’incartonamento di bombolette aerosol, dopo la fiera, verrà consegnato al cliente. I visitatori possono dunque visionare dal vivo la funzione di cambio degli utensili automatico. L’impianto, che comprende solo quattro macchine parziali, lavora bombolette aerosol di quattro dimensioni diverse e forma i cartoni shelf ready in quattro formati differenti (vassoio di cartone con coperchio). Portata: 320 prodotti/min. La linea picker, che raggruppa le bottiglie sui transmoduli con i robot TLM-F44, illustra invece le numerose opzioni offerte all’industria delle bevande. La macchina ha una portata di 12.000 bottiglie all’ora e mostra l’handling dei prodotti senza accumuli. Combinazione di struttura compatta ed elevata flessibilità. Un’altra linea picker raggruppa barrette di cioccolata sui transmoduli TLM. La macchina ha una portata di 600 barrette/min e mostra come gli impianti TLM siano in grado di manipolare i prodotti in modo molto flessibile ed estremamente delicato.

Flexible for all products The four packaging machines displayed will give an impression of the broad range that Schubert offers. The packaging machine prototype without switch cabinets processes infusion bags as its product. Members of the new Schubert Pharma expert team will be available to consult customers from the pharmaceutical industry. The packaging line for cartoning aerosol cans will be delivered to a customer after interpack. With this exhibit, trade fair visitors can obtain information regarding the function of the automatic tool change. The line comprises just four sub-machines. It currently processes aerosol cans of four different sizes and makes shelf-ready cartons in four different dimensions (cardboard tray plus lid). The output is 320 products per minute. A picker line which groups bottles on transmodules using TLM-F44 robots conveys an impression of the diverse options for the beverage industry. The trade fair machine runs with an output of 12,000 bottles/ hour and demonstrates product handling without any backup. It combines a compact design with high flexibility. Another picker line groups chocolate bars on TLM transmodules. The trade fair machine runs with an output of 600 bars per minute and visualises how TLM lines handle products both flexibly and extremely gently.

angles. In doing so, it realises a height resolution of 0.5 mm in a measuring range of 60 mm height. This advancement has facilitated numerous application options. This technology has raised quality assurance to a new level of performance. The 3D scanner opens up attractive control parameters such as volume, weight and stack height. The Vision System tolerates belt soiling, as long as it remains below a certain height threshold, which allows products to be detected under difficult conditions. The first TLM picker line with a 3D scanner has already been put into operation by a candy manufacturer in Belgium.

118 • 4/14

La linea picker raggruppa bottiglie e raggiunge una portata di 12.000 bottiglie/h, mostrando come funziona l’handling dei prodotti senza accumuli. The TLM picker line groups bottles, running with an output of 12,000 bottles/hour. It visualises how TLM lines handle products without any backups.

Il cambio degli utensili automatico permette di effettuare il cambio del formato al tocco di un pulsante. Gli utensili vengono sostituiti e riposti ordinatamente negli appositi scaffali, tutto automaticamente. The automatic tool change enables sizes to be changed at the press of a button. While doing so, tools are packed in tool cabinets automatically and neatly.

ner 3D permette di inserire nuovi parametri di controllo quali il volume, il peso e l’altezza d’impilamento. Il sistema Vision tollera le impurità presenti sul nastro, se queste restano sotto una certa soglia di altezza, permettendo così di riconoscere i prodotti anche in condizioni particolarmente difficili. La prima linea picker TLM con scanner tridimensionali è già in esercizio presso un produttore di dolciumi belga.

TRANSMODUL CON TALENTO Dall’introduzione nel 2009, sono circa 3000 i transmoduli montati su impianti di confezionamento TLM (top loading machine). Trasportano prodotti e scatole su macchine TLM standard e su linee picker oppure fungono da slitte trasportatrici degli utensili di imbutitura o durante il cambio degli utensili automatico. Anche lo sviluppo delle nuove riempitrici TLM è stato possibile soltanto grazie ai transmoduli. L’ultimo aggiornamento del Transmodul TLM prevede che la slitta sia accorciata e dotata di un LED per l’indicazione del modo d’esercizio. Il controllo elettronico si basa ora sul modulo Uni 5. I valori

TRANSMODULE WITH TALENT Since the transmodule was introduced in 2009, around 3,000 of these transport robots have been put into use in TLM (top loading machine) packaging lines worldwide. They convey products and boxes in TLM standard machines or picker lines, act as carrier carriages for the deepdrawing tools, or facilitate automatic tool change. The transmodule ultimately made it possible to realise the new TLM filling machines. As part of the latest TLM transmodule update, the transport carriage was shortened and equipped with an LED

Una linea picker raggruppa barrette di cioccolata sui transmoduli TLM. La macchina ha una portata di 600 barrette al minuto e dimostra come gli impianti TLM siano in grado di manipolare i prodotti in modo flessibile e delicato. A TLM picker line groups chocolate bars on TLM transmodules, running with an output of 600 bars/minute and visualising how TLM lines handle products both flexibly and gently.

massimi di accelerazione e velocità sono già stati migliorati notevolmente, ma Schubert ha già in serbo il prossimo progetto per questo robot trasportatore intelligente: il Transmodul che fa le curve, aggiungendo un ulteriore grado di libertà nella progettazione del layout degli impianti rendendo alcune interfacce inutili e la struttura più compatta.

VMS: POTENZIATA

LA TRASMISSIONE DEI DATI

Novità anche nel controllo delle macchine confezionatrici VMS. La quinta generazione dei moduli VMS comunica infatti via sercos, sistema bus Ethernet standard che oltre alla trasmissione dei dati in tempo reale garantisce anche la trasmissione deterministica dei segnali (16.000 segnali al millisecondo e 10 milioni di bit dati al secondo. Q

display to indicate the operating status. The transmodules’ control electronics are now based on a Uni 5 assembly, the current controller assembly of the latest generation of the Schubert packaging machine controller. The values for maximum acceleration and speed have been significantly increased. Furthermore, Schubert has already announced the next conceptual product for the intelligent transport robots: transmodules that can move along curves. Negotiating curves allows even more freedom when designing the layout.

Unnecessary interfaces are eliminated and the line’s compactness increases.

VMS: IMPROVED PERFORMANCE FOR DATA TRANSFER

There is also news regarding the VMS packaging machine controller. The fifth generation of VMS modules now communicate via Sercos rather than via the signal bus. As a standardized, real-time-capable Ethernet bus, Sercos provides advantages in data transfer while at the same time guaranteeing the deterministic transfer of signals (16,000 signals per millisecond and 10 million data bits per second). Q

www.dativoweb.net


Obiettivo: incollare. Scopri l’eccellenza di Robatech per UNAªPRODUZIONEªSEMPREªPIáªEFlCIENTEª e “verde”. Robatech è sinonimo di innovazione, alta tecnologia ed ecocompatibilità. Sistemi industriali di incollaggio veloci, precisi ed BGkEBCJMJ QFSMFJOEVTUSJFEFMQBDLBHJOH QSJOUJOH FEJMJ[JBF lavorazione del legno. Risultato: elevato risparmio energetico, riduzione dei costi aziendali.

VISIT US AT BOOTH 11-F68

Robatech Italia Srl. u.s. Via Lepanto, 400 IT- 47521 Cesena – (FC) T +39 0547 631700 F +39 0547 631881 info@robatech.it www.robatech.it


[

MAT E RI ALS & MA CHI NE RY

]

M U LT I M A RK E T

Filling and capping at the fair Ronchi Mario SpA will not miss the important appointment with Interpack where, on its booth E-01 in Hall 8A will display a few of the most interesting machines in its production. One such machine is the filling-capping monoblock mod. EXACTA/RM 18/6 equipped with mass-type flow-meters, servo-driven scroll and a 6-head capping station equipped with brushless motors. Renowned the world over, the filling machines of the EXACTA series represent the ideal solution for the cosmetic, chemical, pharmaceutical and food industries. Also on show the pump placer mod. SIRIO/PT 8T suitable to handle both spray and trigger pumps , with 8 capping heads driven by brushless motors to servo-control the rotation of each single head as well as their vertical motion (electronic cam): this new application studied by Ronchi ensures the highest level functionality, high flexibility in handling both “ common” caps and pumps, regardless whether these are dispenser or trigger style.

Evolution in packaging Individual machines and complete lines radically renovated with state-of-the-art technologies. At Interpack Rovema shows its expertise in the field of packaging and reliability of solutions for all work phases, from metering to casepacking. Rovema brings the best of its proposals to Interpack (Hall 15, Stand B25), starting with the new BVC vertical machines and its better known and more distributed packaging machines, re-configured and optimized to ensure the highest level of performance. In addition a corner will be dedicated to service, with information on technical assistance, operator training and offers for retrofitting machines and lines more than 10 years old. Top of the range in three models. The new series of BVC vertical packaging machines, designed to ensure maximum productivity, has been cared for in every detail to carry out, even at high speeds, sophisticated functions such as between jaw product recognition (Sense and Seal) as well as high quality welding. Thanks to an innovative structure, the machines enable the fast and easy performing of cleaning operations, thus always ensuring high line hygiene. Synergies with added value. The proven SBS double block bottom packer will be on display at Interpack in line with RSE box casepacker, enriched with unique technical details. This solution guarantees longer welding times while maintaining the very high speed of 100 bpm; the welding parameters are adjustable from the display; machine monitoring, in real time, occurs through the continuous processing of operational data. In turn, the very compact EF2 casepacker is striking for its simplicity and rapidity of format change (the user can store formats, retrieving them when necessary). Along with the SBS it forms a complete packaging line, proposed as an ideal solution for all users where efficiency and economy are essential. Powders in bag-in-box. Last but not least the company offers a second packaging line, composed of the new vertical BVC combined with continuous CMH-C cartoning machine. Rovema thus confirms its expertise in bag-in-box solutions for powder products, offering high packaging quality and hermetic sealing, now a must for any packager, in one single solution.

120 • 4/14

Riempimento e tappatura in fiera Q Ronchi Mario SpA non manca all’importante appuntamento con Interpack, dove espone (Hall 8, stand E-01) alcune tra le macchine più significative della sua produzione. È il caso del monoblocco di riempimento e tappatura mod. EXACTA/RM 18/6, equipaggiato con flussimetri di tipo massico, coclea servomotorizzata e tappatore a 6 teste servocomandate da motori brushless. Affermate in tutto il mondo, le riempitrici della serie EXACTA costituiscono la soluzione ideale per l’industria cosmetica, chimica, farmaceutica e alimentare. In fiera anche il tappatore mod. SIRIO/PT 8T, in grado di trattare tanto pompette spray quanto pompette trigger, con 8 teste tappanti dotate di motori brushless sia per la loro rotazione che per la loro movimentazione verticale (cam elettronica). La nuova applicazione studiata in casa Ronchi garantisce un altissimo grado di funzionalità, elevata flessibilità nel trattare sia tappi “comuni” che pompette, siano esse dispensers o triggers.

Evoluzione nel packaging Q Macchine singole e linee complete rinnovate in modo radicale con tecnologie allo stato dell’arte. A Interpack Rovema mostra la sua competenza in materia di confezionamento e l’affidabilità delle soluzioni per tutte le fasi operative, dal dosaggio all’incartonamento. Rovema porta a Interpack (hall 15, stand B25) il meglio delle sue proposte, a partire dalle nuove macchine verticali BVC e dalle confezionatrici più note e diffuse, ottimizzate e ri-configurate per garantire il livello massimo di prestazione. Inoltre, dedica un corner ai servizi, con informazioni sull’assistenza tecnica, il training degli operatori e le offerte per il retrofit di macchine e linee con più di 10 anni. Top di gamma in tre modelli. La nuova serie di confezionatrici verticali BVC, progettata per garantire la massima produttività, è curata in ogni dettaglio per svolgere, anche alle alte velocità, funzioni sofisticate come il riconoscimento del prodotto tra le ganasce (Sense and

Seal) e una saldatura di altissima qualità. Grazie a una struttura innovativa, le macchine permettono di eseguire le operazioni di pulizia in modo facile e veloce, garantendo così sempre l’alto grado di igienicità della linea. Sinergie a valore aggiunto. L’affermata confezionatrice a doppio fondo quadro SBS è in mostra a Interpack in linea con un’incartonatrice per casse americane, arricchita di dettagli tecnici unici nel loro genere. Questa soluzione garantisce tempi di saldatura più lunghi pur mantenendo la velocità assai elevata di 100 bpm; i parametri di saldatura sono poi regolabili dal display e il monitoraggio della macchina, in tempo reale, avviene mediante l’elaborazione continua dei dati di esercizio. A sua volta, l’assai compatta incartonatrice EF2 colpisce per la semplicità e la rapidità del cambio formato (l’utilizzatore potrà memorizzare i formati, richiamandoli quando necessario). Insieme alla SBS costituisce una linea di confezionamento completa, proposta come soluzione ideale per tutti gli utilizzatori che impostano la propria produzione su criteri di efficienza ed economicità. Polveri in bag-in-box. Completa il quadro delle innovazioni una seconda linea di confezionamento, composta dalla nuova verticale BVC abbinata a un’astucciatrice continua CMH-C. Rovema ribadisce così la propria competenza nelle soluzioni bag-in-box per prodotti in polvere, offrendo in un’unica soluzione l’alta qualità delle confezioni e le saldature ermetiche a cui nessuno oggi può rinunciare.

www.dativoweb.net


È la somma che fa il totale!

Qual è la soluzione capace di mettere in relazione le esigenze di modularità hardware, fondamentale per i costruttori di macchine automatiche, e la richiesta di efficienza energetica, sempre più rilevante per gli utilizzatori finali? La risposta di Bosch Rexroth è nel nuovo approccio Cabinet-free, che viene presentato a Interpack (Hall 06 stand D62) come evoluzione della tecnologia di azionamento integrato a bordo motore introdotta da Bosch Rexroth a partire dal 2006. L’evoluzione tecnologica ha consentito di superare ampiamente i limiti nel numero massimo di assi collegabili su una stessa linea, nonché l’aumento della potenza continuativa disponibile sul cavo ibrido (sul quale viene distribuito sia il segnale di sincronizzazione che la potenza ai motori): la disponibilità di un alimentatore esterno al quadro con certificazione IP65 nonché la maggiore potenza continuativa disponibile alla soluzione “near-the-motor” consentono di realizzare le più comuni architetture di automazione delle mac-

chine di confezionamento con dispositivi di potenza completamente remotati dal quadro elettrico. Questa soluzione si traduce in un vantaggio immediato per l’utilizzatore finale che, tramite la riduzione del calore disperso all’interno del quadro e alla possibile eliminazione dei sistemi di condizionamento, può realizzare un concreto risparmio nei consumi elettrici. La modularità della soluzione Cabinetfree si estende alle funzioni di sicurezza integrate, articolate in due proposte distinte. La prima proposta riguarda la soluzione SafeTorqueOff, con comandi cablati, e la possibilità di suddividere una linea in più “zone” di sicurezza, ciascuna regolata da uno specifico segnale di attivazione in modo del tutto indipendente dalle altre. La proposta più completa offre invece le funzioni di sicurezza incluse nel pacchetto SafeMotion, con attivazione mediante bus certificato quale CIP Safety on Sercos. A completamento delle specifiche richieste da una piattaforma modulare, Bosch Rexroth

offre una soluzione in cui il motore con azionamento a bordo può estrarre il collegamento verso un nodo fieldbus remoto, per il collegamento in campo di unità di IO o di altri attuatori su uno dei profili disponibili come interfaccia di comando MultiEthernet (Sercos III, Sercos Over EtherCat, Profinet IO o Ethernet IP). La disponibilità della soluzione “nearthe-motor”, ovvero dell’azionamento remotato in campo, offre la possibilità di pilotare motori terze parti o motori speciali (coppia, lineari, asincroni anche in open loop) garantendo la massima flessibilità nell’architettura macchina. Ma i vantaggi per gli utilizzatori finali non si limitano al risparmio energetico: la significativa riduzione dei cablaggi, dovuta alla presenza di un collegamento da motore a motore in una topologia di tipo daisy-chain, e la possibilità di sostituire facilmente il gruppo motore-azio-

English version at www.dativoweb.net/en/content/bosch-rexroth-cabinet-free

Advertorial

Cabinet-free technology: modularità ed efficienza energetica delle macchine automatiche namento in caso di anomalia, riducono notevolmente le attività di ripristino funzionalità a causa di guasti, riducendole a un intervento puramente meccanico di sostituzione del componente. La modularità intrinseca nella soluzione cabinet-free è una garanzia per una futura espandibilità delle linee stesse, con la possibilità di includere nel collegamento su cavo ibrido sia l’attivazione delle funzioni di sicurezza integrate che il collegamento di blocchi di unità IO remotati.

MORE INFO

Packaging and Processing Bosch Rexroth Italia infopackaging@boschrexroth.it www.boschrexroth.com/packaging

4/14 • 121


[

A U T O M AT I O N & CONT R OL S

]

Sicurezza integrata per applicazioni di qualunque dimensione Q Con SafeLOGIC, B&R offre il sistema di sicurezza più completo e con le massime prestazioni attualmente disponibile sul mercato. Le funzioni fornite solitamente dal controllore hardware vengono suddivise tra il normale PLC, i moduli di ingressi di sicurezza e le unità HMI: un risultato ottenuto senza sacrificare alcuno dei benefici della tecnologia di sicurezza integrata. La soluzione B&R offre dunque i vantaggi di un PLC integrato basato su bus a un prezzo in grado di competere con le soluzioni tradizionali basate sulla tecnologia a relè separati. Per l’utente i vantaggi sono numerosi ed evidenti, prima fra tutte una progettazione coerente delle macchine e una diagnostica completa per una maggiore disponibilità delle stesse. SafeLOGIC-X offre quindi i vantaggi di una soluzione di sicurezza integrata con una vastissima scelta di prodotti avanzati, come moduli di I/O digitali sicuri, moduli di I/O analogici sicuri, moduli di ingressi sicuri per temperature, controllo di movimento con sicurezza, diagnostica integrata, integrazione sicura delle linee e opzioni macchina sicure. La programmazione della soluzione SafeLOGIC-X viene eseguita tramite l’editor SafeDESIGNER in Automation Studio, esattamente come nella versione hardware. Le applicazioni di sicurezza sono scalabili e possono essere configurate per sistemi di ogni dimensione. Il sistema SafeLOGIC-X consente inoltre di configurare le apparecchiature di sicurezza su un terminale di visualizzazione utilizzando le opzioni delle macchine, esattamente come nelle soluzioni basate sull’hardware. I tecnici che provvedono alla messa in servizio e all’assistenza possono implementare facilmente le eventuali modifiche, senza dover utilizzare alcun dispositivo di programmazione esterno orientato alla sicurezza.

Touch ecoPanel: gamma più ampia Q VIPA Italia introduce i pannelli operatore Touch ecoPanel TP610LC da 10” e TP615LC da 15”: robusti, veloci, rapidi da configurare, consentono di dare una visibilità maggiore alle applicazioni di automazione che richiedono HMI con tecnologia Touch Screen e si aggiungono ai modelli da 4,3” e 7”. Dispongono di un robusto case in alluminio e sono dotati di processore Cortex-A8 1 GHz, Ram di 256 MB, Flash interna da 128MB e interfacce di comunicazione Ethernet, seriali (RS232/485/422), USB, MPI/DP. Senza rinunciare alla qualità, i nuovi pannelli uniscono i vantaggi di un’interfaccia semplificata user-friendly e di un’elevata convenienza economica alle potenzialità di Movicon HMI (un ambiente di sviluppo per progetti la cui piattaforma di destinazione va da Windows CE fino a Windows 7 e permette l’utilizzo di variabili illimitate, con la possibilità di importare in automatico le variabili dal PLC grazie alle preinstallate librerie di driver per i PLC VIPA). Altre caratteristiche importanti: datalogging, gestione eventi a tempo, logica IL integrata (soft PLC), editor con grafica vettoriale completo di librerie oggetti e simboli, funzioni avanzate di animazione grafica, completa gestione allarmi ed eventi, gestione di import/export delle ricette, networking TCP-IP integrato, gestione integrata dei trend con funzioni avanzate di data analysis, gestione completa di utenti e password.

Integrated safety for applications of any size With SafeLOGIC, B&R offers the most comprehensive and highest performing safety system available on the market. Now SafeLOGIC-X brings Integrated Safety Technology to smaller applications as well. The functions normally provided by the hardware controller are shared by the standard PLC, safe input modules and HMI units. This is accomplished without sacrificing any of the advantages of Integrated Safety Technology. B&R’s new solution offers the advantages of an integrated busbased PLC at a price that can compete with conventional solutions based on separate relay technology. The many benefits for users are clear: a consistent machine design and consistent diagnostics for increased machine availability.

122 • 4/14

SafeLOGIC-X offers users all the advantages of an integrated safety solution with an enormous selection of state-of-the-art products: safe digital I/O modules, safe analog I/O modules, safe temperature inputs, safe motion control, integrated diagnostics, safe line integration and safe machine options. The SafeLOGIC-X solution is programmed in Automation Studio just like the hardware-based version using the SafeDESIGNER editor. The safety applications are scalable and can be configured to accommodate systems of any size. When safe input and output modules are added, the existing code can simply be reused as-is on a SafeLOGIC controller. SafeLOGIC-X also allows safety equipment to be configured on a visualization terminal using machine options, just like the hardware-based solution.

Commissioning and service technicians can implement changes easily, without having to use any external safety-oriented programming devices.

Touch Ecopanel: wider range VIPA Italia introduces the 10” HMI Touch Ecopanel TP610LC and 15” TP615LC: sturdy, fast, quick to configure, they enable greater visibility for automation applications that require HMI with touchscreen technology and join the already existing 4.3” and 7” models. They feature a robust aluminum case and are equipped with Cortex-A8 1 GHz, 256 MB Ram, 128MB internal flash, and Ethernet, serial (RS232/485/422), USB, MPI/DP communication interfaces. Without sacrificing quality, the new panels combine the advantages of a simplified user-friendly and cost-

effectiveness of a high potential for Movicon HMI (a development environment for projects whose target platform ranges from Windows CE up to Windows 7 and that enables the use of unlimited variables, with the possibility of automatically importing the PLC variables thanks to the pre-installed driver libraries for VIPA PLCs). Other important features: datalogging, event and time handling, integrated IL logic (soft PLC), editor with vector graphics complete with objects and symbols libraries, advanced graphic animation, full alarm and event management, management of recipe import/export, integrated TCP-IP networking, integrated management of trends with advanced data analysis function, complete management of users and password.

www.dativoweb.net


La soluzione decentralizzata per il controllo assi

Creiamo spazio a nuove possibilità ` ACOPOSmotor i motori con azionamento integrato per architetture di macchina modulari. ` Eliminazione del quadro elettrico. ` Classi di potenza da 500 W a 4 kW. ` Tecnologia safety SIL3 completamente integrata su bus e basata su standard openSAFETY: STO, SOS, SS1, SS2, SLS, SMS, SLI e SDI. ` Un’unica soluzione per CNC, robotica e movimentazione, per massimizzare la produttività del sistema.

Perfection in Automation

www.br-automation.com


[

A U T O M AT I O N & CONT R OL S

]

New Features for Expert Vijeo Citect Schneider Electric announces the release of StruxureWare™ Expert SCADA Vijeo Citect v7.40, a new version of its integrated software for industrial automation and control systems, enhanced with features that improve, simplify, and make SCADA systems more timely and efficient. Expert Vijeo Citect is now part of the StruxureWare suite and software applications, a complete platform that allows customers to view, measure, manage efficiency at all levels. Designers will notice significant improvements in some areas, starting with the better structure of object-based references (as the software supports machine component syntactic items in graphics and in scripting). Intuitive too the Equipment Editor interface, in which it is easier to configure templates and hierarchical instances for machine components. By simplifying the process, the editor shortens the engineering phase and minimizes the learning curve for engineers who design the system. But operators on SCADA systems will also benefit from the new release. The new templates are designed in fact to provide a “familiar” user experience, and have features similar to those of many other commonly used software applications. They are also optimized for resolutions adopted for large screens. Expert SCADA Vijeo Citect v7.40 connects to EcoStruxure™ Web Services, enabling web based inter-operability between this software and other products from Schneider Electric and its partners. Customers have at their disposal an instrument of exceptional power and fluidity to share data between their various software applications in real-time.

124 • 4/14

Nuove funzionalità per Expert Vijeo Citect Q Schneider Electric annuncia il rilascio di StruxureWare™ SCADA Expert Vijeo Citect v7.40, nuova versione del suo software integrato per l’automazione industriale e i sistemi di controllo, arricchita di funzionalità che migliorano, semplificano, rendono più attuali ed efficienti i sistemi SCADA. Expert Vijeo Citect fa ora parte delle suite e applicazioni software StruxureWare, una piattaforma completa che consente ai clienti di visualizzare, misurare, gestire l’efficienza a tutti i livelli. I progettisti noteranno importanti miglioramenti in alcune aree, a partire dalla migliore struttura delle referenze basate su oggetti (in quanto il software supporta item sintattici per i componenti delle macchine nella grafica e nello scripting). Intuitiva anche l’interfaccia Equipment Editor, in cui è più semplice configurare templates e istanze gerarchiche per i componenti delle macchine. Semplificando il processo, l’editor riduce la durata della fase di engineering e riduce al minimo i tempi di apprendimento per gli ingegneri che progettano il sistema. Ma anche gli operatori sui sistemi SCADA trarranno beneficio dalla nuova release. I nuovi template sono progettati infatti per garantire un’esperienza di utilizzo “familiare”, e hanno caratteristiche simili a quelle di tante altre applicazioni software di uso comune. Sono inoltre ottimizzati per le risoluzioni adottate negli schermi di grandi dimensioni. SCADA Expert Vijeo Citect v7.40 si connette a EcoStruxure™ Web Services, abilitando l’interoperabilità web based tra questo soft w a re e g l i a l t r i p ro d o t t i d i Schneider Electric e dei suoi partner. I clienti hanno a disposizione uno strumento di eccezionale potenza e fluidità per condividere in tempo reale i dati fra le loro varie applicazioni software.

www.dativoweb.net


[

A DV ERTO RIA L

]

Esaware è HMI, IPC, I/O e SCADA: l’avanguardia dell’automazione industriale. Ecco perché è nata e come rivoluzionerà questo settore.

L’ Efficienza genera Sostenibilità rienza lavorativa senza precedenti. Il suo design intuitivo e immediato favorisce il massimo grado d’interattività. La libreria

Esaware: la sintesi dell’efficienza. Abbiamo dato vita alle nostre idee realizzando una gamma di soluzioni hardware e software che si adatta a ogni applicazione con la più naturale versatilità. Una linea completa di prodotti e soluzioni mirate. Crew: il cervello di Esaware. Il software che rende possibile un’espe-

Efficiency creates Sustainability Esaware is HMI, IPC, I/O and SCADA: the avant-garde of industrial automation. Here’s why we created it and how it will revolutionize this sector.

ESA Automation: Experience and innovation. Our job is to make yours easier. That is what we aim our research as well as the commitment of our experts at. Today the challenge is not only to achieve the latest technology, but to make it accessible, of immediate usage and most of all sustainable.

www.dativoweb.net

Esaware: synthesis of efficiency. We brought to life our ideas in order to achieve a range of hardware and software solutions that fit each application with the most natural versatility. A complete line of products and focused solutions. Crew: Esaware’s brain. With this unique software your work

di oggetti grafici vettoriali offre la massima personalizzazione e il suo Runtime permette una fluida interconnettività con ogni dispositivo Android, iOS e Windows Mobile smartphone o tablet. E v e r y w a re : C re w è o v u n q u e “everywhere”. La nuova piattaforma che sfrutta una semplice connessione internet e permette di programmare, controllare e assistere ogni vostra applicazione da remoto in totale sicurezza, ovunque si trovi nel mondo.

Federico Varotti HMI and SW Division Marketing Manager ESA Automation

Interoperabilità, flessibilità e apertura. Esaware è un prodotto studiato ad hoc sulle vostre esigenze. Una scelta che semplificherà il vostro lavoro.

experience will be the best ever. The intuitive and smart design allows the highest degree of interactivity. A library of graphic vectorial objects offers the best customization ever, while its Runtime guarantees a fluid interconnectivity with every Android, iOS and Windows Mobile smartphones and tablets. Everyware: Crew is “everywhere”. The new platform that allows you to remotely program, monitor and assist every application in a totally safe way, wherever it is and using a simple internet connection.

Interoperability, flexibility and openness. Esaware is a product designed specifically to suit your needs. The choice that will simplify your work. MORE INFO

www.esa-automation.com

4/14 • 125

Advertorial

ESA Automation: esperienza e innovazione. Il nostro lavoro è rendere più agevole il vostro. È a questo che dedichiamo la nostra ricerca e l’impegno dei nostri esperti. Oggi la sfida non consiste solo nella realizzazione dell’ultima tecnologia, ma nel renderla accessibile, di utilizzo immediato e soprattutto sostenibile.


[

A U T O M AT I O N & CONT R OL S

]

Ingombri ridotti del 50% e una velocità eccezionale per la stazione di confezionamento proposta da KEBA, equipaggiata con delta robot da “configurare anziché programmare”.

Un robot con Intelligent Motion

Q Grazie al nuovo delta robot ABIflexx Wide offerto da KEBA, le stazioni di confezionamento risultano supercompatte. Il suo design asimmetrico permette infatti di progettare layout unici, dove le singole meccaniche vengono sistemate molto vicine fra di loro. Altro vantaggio della versione Wide è la particolare forma ovale dell’area di lavoro, che rende possibile prelevare in modo ottimale i prodotti con un incremento della produttività. Il design e la meccanica FDA approved fanno sì che questo robot sia particolarmente adatto al settore alimentare.

Intelligent Motion: velocità e risparmio energetico. L’Intelligent Motion è un insieme di funzionalità all’interno del controllo Robotico KeMotion, a garanzia di prestazioni elevate (sino a 220 pezzi/min per un ciclo ISO). Il “look-ahead” consente, in particolare, di fare un controllo predittivo dei movimenti nello spazio, il che comporta la possibilità di ottimizzare la velocità, l’accelerazione, il jerk ma anche i movimenti della cinematica, che possono così essere calcolati e ottimizzati in anticipo tenendo conto dei limiti fisici. In questo modo vengono evitate le sollecitazioni meccaniche “inutili”, e il risultato finale è una riduzione dei consumi energetici del 10% circa unito a un incremento del 15% di prestazioni e produttività. Le vibrazioni del robot sono dunque drasticamente ridotte, il che comporta la maggiore durata dei componenti meccanici e costi di manutenzione molto contenuti.

Bulk down 50% and exceptional speed for KEBA proposed wrapping station, equipped with the delta robot to be “configured rather than programmed”.

Intelligent Motion robot Thanks to the new ABIflexx Wide delta robot offered by KEBA, wrapping stations can now be super compact. Its asymmetrical design in fact enables the devising of unique layouts, where single mechanical parts are set very close to each other. Another advantage of the Wide version is its special oval shape of the work area, that enables the optimum pick-up of products, offering an increase in productivity. The FDA approved design and mechanics make this robot

126 • 4/14

particularly suited for the food sector. Intelligent Motion: speed and energy saving. Intelligent Motion is a mix of functionalities within the KeMotion Robotic control, guaranteeing high performance (up to 220 pieces/min for an ISO cycle). In particular its “look-ahead” feature enables a predictive control of movements in space, which enables the optimisation of speed, acceleration, sharp jerks as well as kinematic movements, that can thus be calculated and optimised ahead

Semplice da personalizzare. Il sistema comprende la cinematica ABIflexx e il controllo KeMotion KEBA, forniti come componenti separati, che il cliente finale potrà integrare su macchine e linee di produzione a proprio piacimento. Inoltre il software per la visualizzazione KeStudio ViewEdit permette di adattare e/o creare pagine grafiche sulla base delle richieste del cliente e del design aziendale. La stessa piattaforma HMI comprende pannelli fissi e mobili. KeMotion mirato per il packaging. Le soluzioni KEBA si distinguono per le prestazioni altissime e la rapida messa in servizio. «Per noi - affermano i responsabili della società -“easy to use” significa installare la macchina nel giro di poche ore. Nel nostro sistema sono già presenti più di 30 cinematiche, gestione dei sistemi di visione, funzionalità di trigger, tracking, multipick advance, e altro ancora. Grazie ai numerosi wizard, nel giro di pochi step di apprendimento, è possibile utilizzare funzionalità di alto livello in un vero ambiente robotico. Configurare anziché programmare non è più teoria; con il nostro KeMotion è già realtà».

of time considering the physical limits. In this way “useless” mechanical wear is avoided, resulting in an approx 10% reduction in energy consumption combined with a 15% increase in performance and productivity. Robot vibrations are drastically reduced, which enables the longer life of the mechanical components and savings on maintenance costs. Simple to personalize. The system comprises ABIflexx kinematics and KeMotion KEBA control, supplied as separate components, that the end customer may integrate on machines and production lines to suit their given needs. On top of that the KeStudio ViewEdit display software enables the graphic pages to be draughted

to customer and company design demands. The same HMI platform comprises fixed and mobile panels. KeMotion aimed for packaging. The KEBA solutions stand out for their extremely high performance and rapid commissioning times. «For us - the company heads state - “easy to use” means offering a machine that can be installed in just a few hours. Our system comprises more than 30 kinematics, management of the viewing system, trigger-, tracking, multipick and yet other functions. Thanks to the numerous wizards, in just a few learning steps, high level functionalities in a true robotic environment can be used. Configuring instead of programming is no longer just a theory; with our KeMotion it is already a reality».

www.dativoweb.net


[

Un Connection Point per l’automazione Q Con la sua consolidata esperienza di settore, i suoi prodotti e i servizi all’avanguardia, Rockwell Automation sarà protagonista a Interpack 2014 grazie alla presenza di costruttori di sistemi-OEM, che presenteranno 215 macchine nuove e tecnologicamente avanzate, equipaggiate con soluzioni di automazione, motion, processo, soluzioni di sicurezza basate su prodotti Allen-Bradley di Rockwell Automation. L’approccio Rockwell Automation rispecchia l’obiettivo ufficiale della manifestazione di quest’anno: coprire l’intera catena di creazione del valore, dalla produzione all’identificazione di prodotti e materiali di imballaggio, attraverso il confezionamento e la distribuzione, fino alla garanzia della qualità e la tutela dei consumatori. Il contesto competitivo nel quale operano oggi le aziende del packaging richiede macchine che si integrino facilmente con le infrastrutture dell’intero sito produttivo. È molto sentita l’esigenza di attrezzature flessibili ed efficienti, che aumentino l’agilità aziendale, ottimizzino la produttività e aiutino gli utenti finali a soddisfare gli obiettivi di sostenibilità riducendo nel contempo il costo totale di proprietà. Per il successo delle operazioni produttive diventa fondamentale trovare il partner giusto. Per questo motivo i costruttori di macchine in tutto il mondo stanno progettando macchine equipaggiate con soluzioni Rockwell Automation, sia per avere un vantaggio competitivo sia per renderle il più attrattive per gli utilizzatori finali. Nel corso della manifestazione, Rockwell Automation contribuirà quindi a promuovere e consolidare le relazioni tra costruttori e produttori di macchine, agendo da punto di convergenza tra le esigenze dei clienti e le soluzioni innovative, collaudate e ad alte prestazioni, offerte da un gruppo riconosciuto di costruttori di macchine. Inoltre, presso il suo stand (hall 06, stand A61) Rockwell Automation si affida alla multimedialità per mostrare le tecnologie in azione (già operative pagine dedicate all’evento su www.rockwellautomation.com).

www.dativoweb.net

A UTO MATIO N & CO NTRO LS

]

A connection point for automation With consolidated experience in the sector and cuttingedge products and services, Rockwell Automation will be a protagonist at Interpack 2014 thanks to the presence of OEM systems builders that will present 215 new and technologically advanced machines, equipped with automation, motion, process and safety solutions based on Rockwell Automation’s Allen-Bradley product line. Rockwell Automation’s approach reflects the official objective of this year’s Interpack: to cover the entire value chain, from production to product identification and packaging materials, by way of packaging and distribution along the way, all the way to quality assurance and consumer protection. The competitive environment in which packaging concerns operate today requires machines that can be easily integrated with the infrastructure of the entire production site. There is a high demand for flexible and efficient equipment that enhance a concern’s versatility, optimize productivity and help end users meet sustainability targets while at the same time reducing total property costs. Finding the right partner becomes vital to the production process’s success. For this reason, machine builders worldwide are designing machinery equipped with Rockwell Automation solutions, both for the sake of competitive advantage and to make them more attractive to end users. During the course of the event, then, Rockwell Automation will promote and consolidate relations between machine manufacturers and builders, acting as a point of convergence between customers and innovative, tested and high performance solutions, offered by a high profile group of machine builders. Furthermore, the concern’s stand (hall 06, stand A61) will make use of multimedia in order to demonstrate the technologies in action (there are dedicated web pages at www.rockwellautomation.com).

4/14 • 127


E L'UNICA CERTEZZA PER AVERE IL MASSIMO DA INTERPACK


SIMOTION: elevate performance e precisione per macchine packaging

piega


SINAMICS S120M: nuovo servo azionamento decentrato... centrato su ogni singola esigenza!

ageip


[

A UTO MATIO N & CO NTRO LS

]

Gli azionamenti Siemens Sinamics S120 gestiscono le diverse motorizzazioni della cigarette maker ad alto contenuto tecnologico SMK, realizzata da SASIB.

Insieme per migliorare S ASIB è un marchio storico che, dal 1937, produce macchinari per i diversi settori dell’industria del tabacco: dalla produzione e confezionamento di sigarette, ai filter tubes per sigarette senza tabacco. Entrata nel Gruppo Coesia nel 2011, SASIB ha intrapreso un percorso di rinnovamento tecnologico del proprio portafoglio macchine, sviluppando nuove applicazioni per rispondere alle richieste di media velocità. La cigarette maker SMK è il primo esempio con cui prende forma il nuovo portfolio tecnologico di SASIB che, attraverso l’ottimizzazione e lo sviluppo di nuovi modelli, vuole consolidare la propria leader-

ship nelle fasce di media e bassa velocità oltre che nel settore dei prodotti speciali, soddisfando così le esigenze sia dei grandi gruppi sia dei produttori indipendenti. High tech a medie e basse velocità SMK è dunque la cigarette maker a più alto contenuto tecnologico nella categoria delle macchine low & medium speed, ossia fino a 8.500 sigarette al minuto, e costituisce un’autentica novità per questa fascia di mercato. Nata da una progettazione totalmente nuova, si avvale di innovazioni tecnologiche che hanno portato la macchina a rispondere ai più elevati standard di qualità e flessibilità attualmente richiesti, ponen-

The various motorizations of SASIB’s super high-tech SMK cigarette maker controlled by Siemens Sinamics S120 drives

Together to improve SASIB is a historic brand that since 1937 has been producing machinery for the different sectors of the tobacco industry: from cigarette production and packaging to filter tubes for tobacco free cigarettes. Having joined the Coesia Group in 2011, SASIB embarked on the technological renewal of its machine portfolio, developing new applications to meet demands for medium speed.

www.dativoweb.net

The SMK cigarette maker is the first example in SASIB’s new technology listing. The company, through the optimization and development of new models, wants to consolidate its leadership in the medium and low speed range as well as in the special products sector, thus meeting the needs of both the large groups as well as those of the small independent producers.

dola al vertice di questa fascia di velocità e in grado di soddisfare sia i requisiti dei mercati evoluti sia di quelli emergenti. Per aumentare la qualità, si è lavorato a diversi livelli nella progettazione della macchina: dalla revisione della tramoggia di ingresso del tabacco (hopper) - la più larga di questa fascia - per ottenere un trattamento più delicato delle fibre del tabacco e una sua migliore distribuzione nelle sigarette, all’utilizzo di assi elettrici al posto dei tradizionali assi meccanici. Per questo importante upgrade tecnologico SASIB ha utilizzato gli azionamenti Siemens Sinamics S120 in grado di gestire diversi tipi di motorizzazioni: mo-

High tech at low and medium speed SMK is thus the most hi-tech cigarette maker in the low& medium speed category of up to 8,500 cigarettes per minute, and a true novelty for this market segment. Born out of totally new design, it draws on technological innovations that allow the machine to meet the highest quality and flexibility standards, placing it at the top of its speed range, capable of satisfying both evolved and emerging market requisites. To increase quality, the machine design has been overhauled on various levels: from the revision of the tobacco infeed hopper - the largest in this range - to attain a more delicate treatment of the

tobacco fibres and a better distribution of the same in the cigarettes, to the use of electrically driven axles instead of the traditional mechanical ones. For this important technological upgrade SASIB has used Siemens Sinamics S120 drives, capable of handling different types of motors: brushless motors but also pumps (via a specific Sinamics G120P inverter) or synchronous motors, integrating them in the control system. In addition, the DC-bus structure has enabled the elimination of the braking resistors and the regeneration of the excess energy in the network by decentralizing power in three physically separate electrical panels belonging to a single Simotion

4/14 • 131


[

A U T O M AT I O N & CONT R OL S

]

tori brushless ma anche pompe (tramite un inverter specifico, Sinamics G120P) o motori sincroni, integrandole nel sistema di controllo. Inoltre la struttura a DCbus ha consentito di eliminare le resistenze di frenatura e di rigenerare l’energia in eccesso in rete, decentralizzando la potenza in tre quadri elettrici fisicamente separati facenti capo ad un’unica cpu di controllo Simotion D445-2. Grazie a Profinet IRT (Isochronous Real Time), è stato possibile realizzare una struttura di motion control con master distribuito per sincronizzare i vari gruppi di assi dislocati nei tre quadri elettrici; questo ha permesso una perfetta sincronizzazione di tutte le fasi del ciclo produttivo della macchina. Gestire la sicurezza e la flessibilità La SMK racchiude in sé molte altre innova-

D445-2 controlled CPU. Thanks to Profinet IRT (Isochronous Real Time), a motion control structure with distributed master to synchronize the various axle groups located in the three electrical panels has been made, thus enabling a perfect synchronization of all machine production cycle stages. Managing safety and flexibility The SMK encloses many other technological innovations, such as safety management via Integrated Safety, ie the use of certified safety functions found in electronic devices such as drives and dedicated CPUs, instead of the traditional electromagnetical system. The safety

132 • 4/14

zioni tecnologiche, come la gestione della sicurezza tramite la Safety Integrated, ossia l’utilizzo delle funzioni di sicurezza certificate presenti nei dispositivi elettronici quali azionamenti e cpu dedicate, al posto del tradizionale sistema elettromeccanico. La gestione della sicurezza è perfettamente integrata nell’automazione di macchina a partire dal plc Simatic S7 319-F che garantisce l’esecuzione del software progettato dagli ingegneri SASIB, mentre la comunicazione Profinet trasmette i segnali relativi alla Safety Integrated sullo stesso bus di campo alla periferia Simatic che fa convivere sullo stesso hardware I/O sicuri con quelli standard e comunicazione TCP/IP con il PC e i sistemi di ispezione. Robusta, affidabile e “user friendly”, la SMK non offre solo un’elevata qualità di prodotto, ma anche una grande flessibilità, grazie al disegno innovativo dei gruppi di macchina che le consentono di essere utilizzata per la produzione, oltre che di sigarette standard, anche per i formati slim e superslim. L’utilizzo di PC industriali Siemens 477D garantisce l’integrazione con i sistemi di ispezione e controllo della qualità della sigaretta SASIB rendendo la SMK una cigarette maker in grado di rispondere alle richieste più stringenti dei produttori del mercato. La topologia elettronica della SMK, insieme alle funzionalità ad alte prestazioni richieste dall’applicazione, trovano in Profinet la soluzione perfetta. Profinet infatti gestisce in maniera nativa vari pro-

management is fully integrated in the machine automation starting from the Simatic S7-319 F PLC that guarantees the execution of the software designed by SASIB engineers, while the Profinet communication transmits Safety Integrated signals on the same fieldbus to the Simatic periphery to enable a cohabitation on the same hardware of the safe I/Os with the standard ones and TCP/IP communication with the PC and inspection systems. Robust, reliable and “user friendly” the SMK not only features a high quality product, but also great flexibility, thanks to the innovative design of the machine units that allow it to be used

tocolli di comunicazione sullo stesso hardware permettendo di controllare applicazioni motion control ad alte velocità sincronizzando assi brushless dislocati in armadi differenti grazie al protocollo IRT (Isochronous Real Time), facendo passare sullo stesso bus altre informazioni a priorità più bassa senza dover prevedere gateway o dispositivi specifici. L’ufficio R&D di SASIB è già all’opera per incrementare l’ottimizzazione sia del sistema meccanico che elettronico della macchina, sfruttando appieno le potenzialità dell’elettronica Siemens, utilizzando la versione di Profinet V2.3 a 32us, con l’obiettivo di ridurre i consumi elettrici (per la gestione dei motori, l’alimentazione degli impianti, i sistemi di raffreddamento, la generazione del vuoto per l’aria compressa) migliorando nel complesso le performance della SMK. Q

for the production, in addition to standard cigarettes, of the slim and superslim formats. The use of Siemens 477D industrial PCs provides integration with the SASIB cigarette inspection and quality control systems, enabling the SMK cigarette maker to meet the most stringent market demands. The electronic topology of the SMK, together with the high performance capabilities required by the application, make Profinet the perfect solution. Profinet in fact natively runs various communication protocols on the same hardware, allowing control of the motion control applications at high speed, synchronizing brushless axes

located in different cabinets thanks to IRT (Isochronous Real Time) protocol, running other information with a lower priority on the same bus, without having to resort to gateways or specific devices. SASIB’s R&D office is already working to further optimize both the machine’s mechanical and electronic system, fully exploiting the potential of the Siemens electronics using the Profinet V2.3 32US version, with the aim of reducing electricity consumption (in running the motors, powering the systems, the cooling systems, compressed air vacuum generation), improving the performance of the SMK overall. Q

www.dativoweb.net


[

A U T O M AT I O N & CONT R OL S

]

Un pick&place per l’alimentare I robot a cinematica parallela Veltru proposti da K.L.A.IN.robotics, e i relativi supporti applicativi, permettono ai system integrator di realizzare con semplicità operazioni complesse di pick&place. a gennaio 2014 K.L.A.IN.robotics distribuisce sul mercato italiano il robot Veltru che trova applicazione nel packaging primario e secondario, tipicamente nell’industria alimentare ma anche cosmetica e farmaceutica. Un problema applicativo piuttosto comune ne illustra funzionalità e vantaggi, spiegando le ragioni del suo gradimento da parte del mercato. Può essere raccontato così.

D

Il valore di una ventosa. Un’azienda specializzata in prodotti da forno si trovava in difficoltà. Le tortine alla crema per hotellerie che aveva appena lanciato sul mercato avrebbero dovuto diventare uno dei suoi cavalli di battaglia e invece i reclami fioccavano. Infatti, nonostante avesse investito in una macchina per il confezionamento di nuova generazione, non tutto il packaging risultava sottovuoto e, di conseguenza, i dolci arrivavano al cliente finale danneggiati. La causa? Durante il riempimento dell’involucro, effettuato manualmente, delle piccole quantità di crema entravano in contatto

con la confezione sporcando i bordi da saldare e impedendo così la corretta sigillatura della pellicola di rivestimento». La soluzione è arrivata dal costruttore della confezionatrice, che ha proposto al cliente di automatizzare la fase di carico in modo da assicurare una qualità costante della produzione. Il limitato periodo di ammortamento e la prospettiva di risolvere un problema così rilevante hanno giocato a favore di questa opzione che, però, doveva affrontare vari ordini di difficoltà, relativi alla manipolazione dei prodotti, alla necessità di tempi ciclo ridotti e alle limitazioni di spazio che consentivano l’impiego di solo un robot. Qui è entrata in gioco l’esperienza di Veltru AG come costruttore di robot a cinematica parallela, che ha realizzato “la quadratura del cerchio” proponendo l’impiego di una ventosa contactless. Grazie ad essa il prodotto viene movimentato tramite un getto d’aria, che lo mantiene sospeso riducendo al minimo le occasioni di contatto, mentre la macchina di confezionamento lavora con un ciclo intermittente.

Pick&place for the food sector The Veltru parallel kinematic robots and corresponding application supports proposed by K.L.A.IN.robotics enable system integrators to create complex pick&place operations through a simple process. Since January 2014, K.L.A.IN.robotics has been distributing on the Italian market the Veltru robot, which has applications in primary and secondary packaging, typically in the food industry, but also in cosmetics and pharmaceuticals. A rather common operational problem illustrates its functionality and advantages, explaining why the market has responded so positively to this new product. The story can be told as follows. The value of suction. The manufacturer of baked goods was beside himself. The

134 • 4/14

cream tarts for hotels that he had just launched on the market were meant to be the ace up his sleeve, but to his surprise he found himself drowning in complaints. In fact, although he had invested in a latest generation packaging machine, not all the pastries were packaged in a perfect vacuum, and consequently arrived to the end customer damaged. The reason for this arose during the manual filling phase, when small quantities of cream came into contact with the packaging, getting on the edges and compromising the seal of

Cinematica e comunicazione. Il robot Delta può essere a ragione definito come il robot a cinematica parallela di maggior successo. Sviluppata nei primi anni Ottanta da Reymond Clavel presso l‘ETH di Losanna, questo tipo di cinematica si è diffusa rapidamente nei settori più diversi, dall’informatica (ad esempio nella realizzazione dei mouse per applicazioni 3D) al medicale. Ai più sono noti soprattutto i robot per le industrie manifatturiere, dove dei pick&place con tempi ciclo ridottissimi non si può più fare a meno. I robot, infatti, ben si prestano a effettuare movimenti dinamici e vengono impiegati in ambiti in cui è necessario manipolare molti prodotti singolarmente, sia per ordinarli quando si presentano alla rinfusa sia quando richiedono manipolazioni accurate, dunque tipicamente nell’handling e nel confezionamento primario e secondario di beni di consumo, alimentari in primis. In questi casi la robotica ha l’unico scopo di collegare i diversi processi e garantire il flusso dei materiali; spesso, però,

the film coating». The solution was offered by the packaging machine manufacturer, who suggested that the customer automate the filling phase in order to guarantee uniform production quality. The limited amortisation period and hopes of quickly solving such a crucial problem weighed in favor of this option, which, however, entailed various obstacles having to do with product manipulation, the need for reduced time cycles and limited space making possible the use of just one robot. At this point the experience of Veltru AG came to the table. The builder of parallel kinematic robots managed to square the circle by proposing the use of a contactless suction cup. This solution made it possible to move the products by means of an air jet that keeps them

suspended, reducing to a minimum any possible contact, while the packaging machine works in an intermittent cycle. Kinematics and communication. The Delta robot enjoys the rightful title of the most successful parallel kinematic machine on the market. Developed during the early eighties by Reymond Clavel at the ETH in Lausanne, this type of kinematic machine quickly spread to the most diverse sectors, from IT (for example in the creation of mouses for 3D applications) to medical products. Especially well-known are the robots used in the manufacturing industries, in which pick&place systems with extremely reduced time cycles are indispensable. Indeed, these robots are adept at performing dynamic motion and are used in applications in which it is necessary to

www.dativoweb.net


nonostante l’elevato dinamismo e numero di cicli, un solo robot non è sufficiente e il lavoro viene dunque suddiviso tra più macchine. In entrambi i casi, la capacità e l’efficienza di comunicazione tra i vari robot è di fondamentale importanza. Elogio della semplictà. K.L.A.IN.robotics (www.klainrobotics.com) e Veltru AG mettono a disposizione dei costruttori di macchine e impianti dei moduli di robot e software concepiti come unità preintegrate. L’azionamento si basa qui su ambiente CoDeSys V3, dunque su Soft-SPS: non solo gli specialisti del settore, ma anche i tecnici adibiti all’assistenza delle macchine possono acquisirne dimestichezza in tempi brevi. La programmazione su piattaforma sia del Motion Control sia della logistica e delle unità periferiche, nonché della comunicazione e delle modalità d’uso, facilitano il compito degli ingegneri gestionali. Ad essi Veltru offre tanto dei moduli relativi alle varie funzionalità, sotto forma di biblioteche compilate, quanto un’applicazione campione completa,

manipulate many individual products, both to order them when they arrive in a jumble and when they require precise manipulations, and thus typically in handling and primary and secondary packaging for consumption goods, food first and foremost. In such cases, robotics has the sole purpose of linking the various processes and guaranteeing the flow of materials; often, however, in spite of his high dynamicity and number of cycles, a single robot does not suffice, and the work is thus distributed among several machines. In both cases, high capacity and efficiency of communication between robots is fundamental. In praise of simplicity. To builders of machinery and installations K.L.A.IN. robotics (www.klainrobotics.com) and

www.dativoweb.net

come base di formazione e di progetto in Source Code. Una caratteristica degli azionamenti così concepiti risiede nella possibilità di effettuare la simulazione logica completa di alcuni moduli anche senza hardware, dunque prima che l’impianto venga fisicamente costruito. E per le linee di prelevamento formate da più robot, si possono ottimizzare strategie di prelevamento off-line. Gestire situazioni complesse. Un progetto recente prevede che, alla velocità di 600 pz/min, dei prodotti vengano dapprima confezionati e successivamente imballati in cartoni, in posizioni diverse, tramite caricatore laterale. Lo spostamento delle confezioni sul caricatore laterale avviene per mezzo di robot Veltru D12H, il cui azionamento coordina anche l’intera logistica, dalla confezionatrice al caricatore in questione. La dinamica è questa: le confezioni vengono immesse su catene e subito raggruppate. I robot prelevano i prodotti con una pinza a quattro griffe dalla catena che lavora in modalità intermittente, e li

Veltru AG make available software and robot modules designed as preintegrated units. The drive system is based on a CoDeSys V3 environment, then Soft-SPS: not only sector specialists, but also machine assistance technicians can quickly acquire mastery. Platform programming of both motion control and logistics and peripherals, as well as communication and instructions, facilitates the task of management engineers. Veltru offers them a variety of modules for various functions in the form of compiled libraries, as well as a complete sample application, as a training tutorial and source code project. A characteristic of drives so conceived lies in the possibility of executing a complete logical simulation of some modules even without hardware, and thus before the facility is physically built. And for picking

posizionano sul caricatore laterale. Nel caso in cui il robot non sia in posizione di ricezione, riempie un nastro di accumulo e può riprendere a prelevare dalla stazione di alimentazione, compensando così i piccoli gap di produttività delle singole macchine (load balancing). Molti i vantaggi di questa soluzione. La programmazione aperta, grazie all’impiego di funzionalità di base già testate, permette di realizzare, in tempi molto ristretti, anche diverse funzioni speciali. Inoltre, la catena di raggruppamento viene controllata dal Controller C10 del robot Veltru che ne segue, così, correttamente le accelerazioni; anche l’azionamento del buffer e il relativo ampliamento, comprensivo di logica pick&place, avviene in toto su Veltru Soft SPS. Ogni robot comunica agli altri gli spazi vuoti che sono stati riempiti sul caricatore laterale; in questo modo non si deve seguire un modello di posizionamento predefinito e il breve fermo di un robot può essere compensato dagli altri, garantendo il rendimento ottimale dell’intero impianto. Q

lines formed by multiple robots, picking strategies can be optimized offline. Managing complex situations. A recent design involves, at a speed of 600 pcs/min, products that are first wrapped and then packed in boxes in variable positions by a lateral loader. Veltru D12H robots transport the packagings, their drive mechanism also coordinating the entire logistics, from packaging machine to the loader in question. The dynamic is as follows: the packaged products are put on chains and then immediately divided into groups. The robots pick the products from the intermittent motion chain with a four-claw gripper and positions them on the lateral loader. If a robot is not in the receptive position, it fills a accumulation belt and can restart to picking from the feed

station, thus compensating for those small gaps in productivity of single machines (load balancing). There are many advantages to this solution. Open programming, thanks to the use of tested basic functions, enables quickly creating various special functions. Furthermore, the grouping chain is controlled by a C10 Controller of the Veltru robot that is thus able to correctly follow its accelerations; the drive of the buffer and corresponding expansion, including pick&place logic, is controlled entirely through Veltru Soft SPS. Each robot alerts others to gaps filled by the lateral loader; in such a way, it is not necessary to follow a pre-set positioning model, and a stalling robot can be compensated by the others, guaranteeing optimal yield of the entire facility. Q

4/14 • 135


[

AUT O M AT I O N & CONT R OL S

]

Giunti rotanti: soluzioni per bus di campo base Ethernet Q Servotecnica propone diverse configurazioni di collettori rotanti, che soddisfano le più svariate necessità di mercato (ma con un occhio di riguardo alle esigenze del packaging): dai compatti SRC 032 ideali per la lettura di termocoppie fino alle soluzioni in grado di supportare i moderni bus di campo su base Ethernet (EthernetIP, EtherCAT, Profinet, ecc..) oltre alla contemporanea trasmissione di potenza elettrica. Grazie all’utilizzo di cavi “ibridi” per il trasporto su singolo cavo di alimentazione e bus di campo, le nuove versioni permettono inoltre di sfruttare i vantaggi introdotti dalle moderne soluzioni di motori con elettronica integrata di diversi costruttori, fornendo una soluzione plug & play completa di connettori. La gamma si completa grazie alla possibilità di accoppiare giunti pneumatici e idraulici adatti anche al passaggio di agenti aggressivi per operazioni di CIP e SIP e l’uso di materiali certificati FDA. Per ulteriori info: www.servotecnica.com.

[

A UTO MATIO N & CO NTRO LS

]

Rotary joints: solutions for Ethernet-based fieldbuses Servotecnica offers various configurations of slip rings which meet the diverse demands of the market (though particularly catering for packaging needs): from the compact SRC 032 ideal for reading thermocouples up to solutions able to support modern field buses based on Ethernet (EthernetIP, EtherCAT, Profinet, etc. ..) in addition to the simultaneous transmission of electric power. Through the use of “hybrid” cables for the transport along a single cable of power and fieldbus, the new versions also enable the exploitation of benefits introduced by modern motor solutions with integrated electronics from different manufacturers, providing a plug & play solution complete with connectors. The range is completed with the ability to join pneumatic and hydraulic couplings also suitable for the passage of aggressive agents for CIP and SIP operations and the use of FDA approved materials. For more info: www.servotecnica.com.

Corrosion resistant gearboxes

Riduttori resistenti alla corrosione Q Spesso gli assi degli impianti alimentari, del settore farmaceutico o di confezionamento devono essere sottoposti a lavaggi ripetuti, talvolta eseguiti con getti a bassa pressione. Per queste industrie, dove le condizioni igieniche rivestono un ruolo fondamentale, WITTENSTEIN alpha ha messo a punto la linea di riduttori “Corrosion Resistant” con grado di protezione IP65, in grado di resistere a lavaggi frequenti, anche con detergenti fortemente corrosivi. Il “segreto” risiede nelle interfacce, interamente realizzate in acciaio inossidabile, e nella carcassa esterna rivestita con una vernice bi-componente - salvo che per il centraggio, che viene nichelato per mantenere le tolleranze prescritte (g6). Anche l’albero o la flangia in uscita sono realizzati in acciaio inossidabile e la lubrificazione è di tipo “food grade”, cioè a grasso compatibile con gli alimenti, come prescritto dalla normativa NSF. Sono disponibili in versione “corrosion resistant” sia i riduttori epicicloidali che per quelli angolari di WITTENSTEIN alpha.

www.dativoweb.net

Often food-, pharmaceutical industry or packaging system axes need to be subjected to repeated washings, sometimes performed by spraying at low pressure. For these industries, where hygiene conditions play a key role, WITTENSTEIN alpha has developed a line of corrosion resistant gearboxes with IP65 grade protection, able to withstand frequent washing, even with highly corrosive cleaners. Their “secret” resides in the interfaces, made entirely of stainless steel, and in the outer casing coated with a bi-component lacquer - except for the centering, which is nickelplated to maintain the prescribed tolerances (g6). Even the shaft or the outfeed flange are made in stainless steel and the lubrication is food grade, that is comprised of food compatible grease, as laid down in NSF standards. Both WITTENSTEIN alpha’s planetary as well as angular gearboxes are available in corrosion resistant versions.

4/14 • 137


[

A U T O M AT I O N & CONT R OL S

]

Sysmac, valore aggiunto alle macchine Q Omron supera i test di Entrec con la piattaforma Sysmac. Quando il costruttore belga Entrec ha sentito l’esigenza di un sistema di controllo per il retro-fit delle sue flow-wrapper, ha sfidato Omron a sviluppare una soluzione basata sulla piattaforma di automazione Sysmac. Entrec ha fornito una macchina smontata che i tecnici Omron hanno dovuto rendere completamente funzionante. Il responsabile di progetto Omron, Edwin Denissen, dice che la sfida ha consentito di accumulare esperienza preziosa, consentendo di dimostrare il pieno potenziale del sistema di controllo Sysmac: «Abbiamo incrementato ulteriormente la nostra conoscenza delle possibilità della piattaforma di automazione Sysmac per il controllo delle macchine flow-wrapper e tutte le nostre teorie sul suo potenziale sono state confermate». Alfred Hofstede di Entrec ha invece commentato: «L’approccio e la determinazione di Omron di far funzionare la macchina corrisponde perfettamente alla nostra filosofia. L’affidabilità è fondamentale nel nostro settore, quindi non possiamo permetterci alcuna concessione». Con Omron fra i suoi partner per i sistemi di controllo, Entrec potrà offrire ai suoi clienti presenti e futuri l’opportunità di una maggiore flessibilità. Tutta la storia è on line su http://industrial.omron.it/it/solutions/packaging/ customer-references/entrec.

Servoazionamenti programmabili Q Moog estende la gamma di servoazionamenti modulari monoasse o multiasse programmabili, con funzioni di sicurezza opzionali, conformi alla norma EN 61800-5-2. Il nuovo modello dispone anche di un PLC di sicurezza, che permette di implementare nel servoazionamento una soluzione di sicurezza completa. In questo modo non è richiesto un complesso safety PLC esterno, garantendo tempi di reazione più brevi. La funzionalità di sicurezza integrata è completa e liberamente programmabile per gestire in modo sicuro e funzionale le macchine. Software con moduli pre-programmati peri diversi sensori.

Sysmac, added value to machines Omron passes the Entrec tests with its Sysmac platform. When the Belgian constructor Entrec felt the need for a control system to retrofit its flow wrapper, it challenged Omron to develop a solution based on the Sysmac automation platform. Entrec provided a disassembled machine that the Omron technicians had to make completely functional. The Omron project head, Edwin Denissen, says that the challenge enabled the accumulation of precious experience, enabling the demonstration of the full potential of the Sysmac control system:«We further increased our knowledge of the possibilities of the Sysmac automation platform for the control of the flow-wrapper and all our theories on its potential have been confirmed». Alfred Hofstede of Entrec in turn commented: «The approach and the determination of Omron to get the machine working corresponds perfectly to our philosophy. Reliability is fundamental in our

138 • 4/14

sector, hence we cannot concede anything on this side». With Omron among the partners for its control system, Entretec will be able offer its present and future customers the opportunity of a greater flexibility. The entire story is on line at http://industrial.omron.it/it/ solutions/packaging/customerreferences/entrec.

Programmable servodrives Moog extends its range of modular monoaxial or multiaxial programmable servodrives, with optional safety functions, in compliance with standard EN 61800-5-2. The new model also has a safety PLC that enables the implementation of a complete safety solution in the servodrive. Thus a complete external safety PLC is not required, guaranteeing shorter reaction times. The integrated safety function is complete and freely programmable enabling safe and functional machine management. Software with pre-programmed modules for the various sectors of application.

www.dativoweb.net


[

Girth ring per grandi sistemi rotativi Q Sew-Eurodrive introduce sul mercato i girth ring realizzati per la trasmissione del moto in sistemi rotativi di grandi dimensioni. La loro caratteristica principale è la modullarità che consente di ottenere notevoli vantaggi a livello produttivo, logistico ed economico. I girth ring di Sew-Eurodrive, infatti, non sono realizzati in un pezzo unico ma in più settori di uguali dimensioni, che possono essere prodotti su macchinari standard con notevoli risparmi in termini di costo e tempi di consegna. Per la stessa ragione, anche la movimentazione durante la messa in opera risulta più agevole e rapida rispetto a quella richiesta da un girth ring intero; inoltre, in caso di danneggiamento del girth ring, è sufficiente sostituire solo il settore interessato, con evidenti economie. Un ulteriore vantaggio si riscontra durante il trasporto, con tempi e costi di spedizione molto più contenuti rispetto a quelli richiesti da un girth ring in pezzo unico. Caratteristiche tecniche. Sew-Eurodrive produce girth ring con diametri standard compresi tra 4 e 16 metri, ma la modularità della costruzione consente di ottenere diametri maggiori. La larghezza massima è di 600 mm, con una potenza al pignone di 2500 kW; gli ingranaggi sono disponibili con modulo da 20, 25, 30 e 40 mm e altri valori a richiesta. L’utilizzo di ghise austemperate (ADI) conferisce a questi girth ring proprietà meccaniche superiori e un’elevata resistenza all’usura. Il produttore fornisce il singolo pezzo così come il “pacchetto” completo comprendente pignone, riduttori, giunti, motori e basamenti, oltre naturalmente a tutta la consulenza necessaria.

Girth ring for large rotary systems Sew-Eurodrive introduces the girth rings made for motion transmission in large rotary systems to the market. Their main feature is theur modularity that enables significant advantages in terms of production, logistics and economising. Indeed Sew-Eurodrive girth rings are not made in one piece but in several sectors of equal size, which can be produced on standard machines with considerable savings in terms of costs and delivery times. Similarly handling during their implementation is also easier and faster than that required by a whole girth ring; in addition, in the event of damage to the girth ring, only the sector concerned need be replaced, with obvious savings. A further advantage is seen in terms of

www.dativoweb.net

A UTO MATIO N & CO NTRO LS

]

BUILDER OF COMPLETE PACKAGING LINES

- Quality and reliability - Economical estimates - Cycle speed - Functional for various products - Easy installation

transport, with times and costs much lower than those required by a one piece girth ring. Technical characteristics. SewEurodrive produces girth rings with standard diameters between 4 and 16 meters, but the modular construction allows for larger diameters. The maximum width is 600 mm, with pinion power of 2500 kW; the gears are available in 20, 25, 30 and 40 mm modules with other dimensions on request. The use of austempered cast irons (ADI) gives these girth ring superior mechanical properties and high wear resistance. The manufacturer supplies the single piece as well as the complete “package”, including pinion, reduction units, couplings, motors and stands, and of course all the consultancy needed. Via del Lavoro 14 - 41042 Spezzano (MO) ITALY 4/14 • 141 www.dativoweb.net Tel: +39 0536 920144 - Fax: +39 0536 920145 e-mail: info@lanciasrl.it - web: www.lanciasrl.it


[

Stampante termica globale SATO lancia CL4NX, la nuova e rivoluzionaria serie di stampanti termiche industriali di codici a barre e cambia gli standard del settore. CL4NX di SATO: ideale per tutti gli ambienti di produzione industriali e/o difficili, stoccaggio, logistica della supply chain, ma anche per le applicazioni in ambito sanitario e nel retail. Grazie alle svariate proprietà multinazionali standard è anche facilmente configurabile e scalabile per implementazioni a livello globale. SATO CL4NX ideal for all difficult areas and/or industrial production, storage, supply chain logistics, but also health and retail applications. Via the various standard multinational properties the machine is also easy to configure and scale for implementation worldwide. For more information on the CL4NX, see www.satoeurope.com/il

Q Leader nella stampa di codici a barre, etichettatura e soluzioni EPC / RFID, SATO ha messo a punto CL4NX. Si tratta della sua prima stampante veramente universale, ideata in base alle necessità dell’operatore finale e realizzata in modo sapiente per supportare nuove o esistenti applicazioni utilizzate in una vasta gamma di mercati verticali, che richiedono una stampante durevole e affidabile per anni di uso intenso. La CL4NX è progettata per essere facile da usare e da mantenere e chiunque ne apprezzerà le caratteristiche dal giorno in cui inizierà a usarla. Offre livelli di operatività user-friendly altissimi, con display a colori da 3,5 pollici, menu in 30 lingue selezionabili dall’utente e tutorial video a display che guidano all’uso e alla manutenzione; semplice anche la sostituzione della testa e il rullo di stampa senza il ricorso ad attrezzi. Al tempo stesso è molto robusta e compatta (costruita interamente in alluminio pressofuso è ai massimi livelli della classe industriale). La speciale testina di stampa offre una qualità di stampa elevatissima su un’ampia gamma di materiali di consumo, anche alle alte velocità e con durata doppia rispetto al normale.

avere tutte le font interne Multinazionali Unicode 8 e 16, come pure un supporto per il caricamento di font TTF. Le opzioni di connessione allo stato dell’arte sono improntate alla massima funzionalità e flessibilità di comunicazione. La macchina offre interfacce standard USB, LAN, RS232, Parallela, Bluetooth, USB Host, connettore di I/O e, unica opzione, la scheda Wi-Fi certificata Cisco. Tutte in ricerca automatica, basta connettere e stampare. La connettività è inoltre garantita dalla disponibilità di Driver windows Certificati, driver Cups per Mac e Linux e SAP ABAP. Inoltre il sistema SATO AEP (Application Enabled Printing) permette di creare tramite un sistema di sviluppo proprietario applicazioni che controllano tutte le operazioni e interazioni di stampa, per realizzare applicazioni stand alone dalle più semplici alle più complesse. Da ultimo scalabilità ed espandibilità delle opzioni tra cui e sistemi per etichettatura RFID / NFC.

L’elettronica è un plus. Su CL4NX è l’elettronica a fare la differenza: è infatti la prima macchina di questa classe a utilizzare una CPU Dual Core 800/800Mhz con 2 GigaByte di memoria standard, per velocità di elaborazione e throughput di stampa ben al di sopra dei risultati ottenuti da stampanti termiche industriali top di gamma. L’ampia memoria permette inoltre di

Etichettatrici industriali: tecnologia in mostra QA Interpack (hall 14, stand D 09) gli staff di P.E. Labellers e Packlab sono a disposizione dei visitatori per illustrare le quattro etichettatrici in mostra e offrire la consulenza relativa alle loro molteplici applicazioni. Sotto i riflettori, accanto alla versatile Modular e all’etichettatrice da bobina Rollmatic, l’ultima nata di casa P.E. Labellers ovvero l’innovativa sleeveratrice modello Maya, progettata per applicare etichette tubolari con retrazione su contenitori di qualsiasi materiale, forma e dimensione, che sarà possibile vedere in funzione. Packlab presenta, invece, l’etichettatrice lineare autoadesiva Wing REP FBW 60, una macchina dalle prestazioni superiori, caratterizzata da stazioni autoadesive con regolazione assi altezza-profondità che, grazie ai motori installati direttamente sui due assi, possono essere comandate elettronicamente, ciascuna dal proprio tastierino LCD. Questa configurazione consente anche di regolare il cambio formato automatico dal pannello HMI (optional). Anche di questa macchina sono organizzate demo live.

www.dativoweb.net

LA BELING & CO DING

]

A thermal global printer SATO launches CL4NX, the new revolutionary series of thermal industrial barcode printers and changes the sector standards. Leader in printing barcodes, labels and EPC/RFID solutions, SATO has devised CL4NX, the first truly universal printer, conceived on the basis of the needs of the final operators and skilfully made to support new or existing applications used in a vast range of vertical markets, where a longlasting and reliable printer capable of standing up to years of intense use is demanded. The CL4NX has been designed to be simple to use and to maintain as any first-day user will surely confirm. It offers high rates of userfriendliness, with 3.5 inch color display, user selected menu in 30 languages and video display use and maintenance tutorial; simple too the tool-less replacement of the printhead and print roller. The machine is sturdy and compact; entirely built in diecast aluminium, it is at the top of its industrial class. The special printhead offers a very high print quality and a broad range of consumables, also operating at high speeds and lasting double that of a normal head. The electronics, a pluspoint. On the CL4NX it is the electronics that makes the difference: it is in fact the first machine of this class to use a Dual Core 800/800Mhz CPU with standard 2 GigaBytes memory, for print processing and throughput well above the results obtained by top range industrial thermal printers. Its extensive memory means that all Multinational Unicode 8 and 16 fonts as well as a support for the loading of TTF fonts are available internally. The state-of-the-art connection options feature max. functionality and communication flexibility. The machine also offers standard USB, LAN, RS232, Parallel, Bluetooth, USB Host, I/O connectors and, as a sole option, the Cisco certified Wi-Fi board. Everything is on automatic search, one only has to connect up and print. The connectivity is what is more guaranteed by the availability of Certified Windows Drivers as well as Cups for Mac and Linux and SAP ABAP. As well as that the SATO AEP (Application Enabled Printing) system enables the creation of applications through a proprietory system that controls all the print operations and interactions, as well as enabling the creation of the simplest to the most complicated stand-alone applications. Lastly, the system offers option scalability and expandibility including RFID/NFC labeling systems.

Industrial label printers: technology on show At Interpack (Hall 14, Stand D 09) the staff of P.E. Labellers and Packlab will be available to visitors to illustrate the four labeling machines on display and offer consultancy as to their multiple applications. In the spotlight, next to the versatile Modular and the Rollmatic reel-fed labeling machine, the latest creation from P.E. Labellers, the innovatory Maya sleever, designed to apply tubular shrink labels on containers of any material, shape and size, that will be operational at the fair. Packlab will in turn be presenting the Wing REP FBW 60linear self-adhesive labeller, a high performance machine, with self-adhesive stations with adjustable height and depth of axis that, thanks to the motors installed directly on the two axes, can be controlled electronically, each from its own LCD keypad. This configuration also enables the adjustment of the automatic format change from the HMI panel (optional). This machine will also be demoed live.

4/14 • 143


Sinfonia meccanica dell’assemblaggio: non abbiamo mai cambiato la nostra passione!

w w w.tecmes-italia.com

. . . . da 20 a 200 cicli al minuto

Ci misuriamo sulla produzione promessa...


[

Gamma completa di stampanti industriali EIDOS progetta e produce i propri sistemi, investendo con costanza in R&S. I suoi ricercatori sono giovani ingegneri e fisici che, in azienda, trovano il giusto ambiente per evolvere e creare tecnologia di alta qualità e innovazione, grazie alle solide basi inter ne. Nel 2014 la società compie 40 anni: anni di esperienza e di capacità collaborativa ampiamente riconosciuta in Italia, che fanno di Eidos un’azienda ad alta vocazione europea.

Q Eidos SpA porta a Interpack 2014 (Hall 5, stand 5G02) tutti i suoi sistemi industriali per la codifica degli imballi e della produzione. Per la stampa diretta su film la grande famiglia Swing non teme confronti, con modelli specifici per ogni tipo di macchina confezionatrice, sia a movimento continuo che intermittente: Swing 2ie è apprezzata per la robustezza, Swing 2ce per la

LA BELING & CO DING

]

cadenza elevatissima (fino a 350 stampe/min); le Swing serie X, per grandi aree, multipista e multipasso (stampano fino a 520x128 mm), sono perfette per termoformatrici e tappatrici, superando tutti i problemi legati ai vecchi codificatori meccanici. Per l’etichettatura Eidos propone i print&apply Printess: l’ultimo modello realizzato, Printess 8, stampa e applica etichette giganti in formato A4, una dimensione poco sviluppata da altre stampanti industriali per linee automatiche. Printess è un sistema modulare e integrato, che utilizza applicatori intercambiabili e, dato che sono state standardizzate moltissime applicazioni, risulta in grado di etichettare in qualsiasi condizione. In fiera avranno spazio anche l’applicatore Wedge, nato per l’etichettatura dei fardelli, e il Blow, caratterizzato da altissima cadenza. Allo stand sarà in funzione anche Coditherm, stampante digitale per la codifica diretta su oggetti. Unica nel suo genere, funziona con un metodo di stampa molto sofisticato (come tutti i prodotti Eidos basato sul principio del trasferimento termico) ed è disponibile a un costo accessibile a produttori di svariate categorie merceologiche: il nuovo modello portato a interpack ha il trasferitore con riscaldamento a raggi infrarossi. Coditherm può variare i dati anche a ogni ripetizione, per questo è ideale per minuterie, contenitori plastici, piccoli lotti o campionature.

Il ritorno della carta gommata Q A Interpack i prodotti della Imballaggi P.K. saranno esposti allo stand Hade Heinrich Donseifer KG, partner dell’azienda vigevanese dal 1969. In particolare, lo staff di Imballaggi P.K. sarà in fiera per presentare la gamma completa di umettatrici per carta gommata Better Packages™, a leva ed elettroniche, distribuite in Italia con successo crescente. Infatti, poiché è composta unicamente da materie rinnovabili, la carta gommata sta tornando in auge in quanto garantisce, oltre alla perfetta chiusura del pacco, anche la sua completa riciclabilità. Di più, questo sistema di chiusura è preferito dalle aziende che vogliono assicurare una consegna integra e ordinata delle proprie scatole - primo e impattante “biglietto da visita” di ogni produttore - senza effrazioni ma anche con un occhio alla sostenibilità, in quanto evita il ricorso a nastri adesivi, reggette e materiali termoretraibili. In mostra a Düsseldorf anche la serie di piccole incollatrici per etichette e fogli di carta con colla a freddo EME, tutte prodotte in Italia da P.K. Fra queste, la “sempreverde” EME180N, incollatrice elettrica per piccole applicazioni di etichettatura e contrassegni di Stato; modelli più larghi e semiautomatici come la EME230AN, per l’applicazione manuale di un’etichetta per volta; la BTL210 che etichetta direttamente su corpi cilindrici. Nel catalogo P.K. anche i dispenser per etichette autoadesive della Hade, elettrici e manuali, di varie larghezze.

Full range of industrial code printers Eidos will be attending Interpack 2014 (Hall 5 stand 5G02) with all its industrial code printers for packaging and manufacturing. For directly printing on film the large Swing family is peerless. There are specific models for all types of packaging machines, of the continuous or intermittent type. The Swing 2ie is known for its rugged construction and the Swing 2ce is characterised by a remarkably fast printing capacity (up to no less than 350 prints a minute). The Swing X series machines, for large areas in multi-track and multi-pass configurations (printing dimensions up to 520x128 mm), are perfect for heat-shrink packing and capping machines and solve all the problems of old mechanical code printers. For labelling needs, Eidos suggests a Printess print & apply machine. The most recent model - the Printess 8 - prints and applies giant A4 size labels. Very few automatic line

www.dativoweb.net

industrial printer manufacturers can compete. It is a modular, integrated system which uses interchangeable applicators. With so many standardised applications, it can be said that the Printess range can print in any condition. Other devices which will be on display at the event will be the Wedge applicator designed for labelling cardboard trays, and the Blow, characterised by a very high production rate. On show also the Coditherm digital printer for printing codes directly on objects in action. This machine is unique and employs a very sophisticated printing method (like all Eidos products, it implements thermal transfer technology and is suitable for all types of manufacturing needs, given its accessible cost). The new model showcased here will have an infrared heating transfer head. The Coditherm can change data even at every pass, making it perfect for small items, plastic

containers, small batches and samples. Proud designers and manufacturers of their systems, EIDOS constantly invests in research and development. EIDOS places the focus on its sound foundations to foster the right environment for the research team formed by young engineers and physicists to develop and create highquality technology and innovation. Celebrating forty years of business experience and consolidated industrial partnerships in Italy in 2014, Eidos is today a company with a genuine European vocation.

Gummed paper is back At Interpack P.K. Imballaggi’s products will be on display at the stand of Hade Heinrich Donseifer KG, partners of the Vigevano based company since 1969. In particular, the staff of P.K. Imballaggi will be at the show to present the full range of lever and electronically operated Better Packages™gummed paper dispensers, distributed in Italy with increasing success. Indeed, made up as it is entirely of renewable materials, gummed paper is back in

favor in that as well as perfect closing of the package, it also ensures complete recyclability. Moreover, this closing system is preferred by companies that want to ensure a tidy and integral delivery of their boxes - the first and most impressive “calling card” of any producer - untampered but also with an eye to sustainability, inasmuch as adhesive tape, straps or heatshrink material is required. On show at Düsseldorf too the series of small cold EME glue paper label and sheet gluing devices, all produced in Italy by P.K. Among these, the “evergreen” EME180N electric gluer for small labeling applications and official State stamps; wide and semi-automatic models like the EME230AN for the manual application of one label at a time; the BTL210 that labels directly on cylindrical bodies. P.K.’s catalogue also includes Hade’s electrical and manual selfadhesive label dispensers in their various widths.

4/14 • 145


[

L AB E LI N G & CODI NG

]

Sustainable labels, efficient adhesive tapes Specialised in the production and print of BOPP adhesive tapes, labels and film, Irplast will be presenting the most innovatory developments of its product offer at Interpack (hall 07 stand 70C14). Labels - MICRON19TM, PP label of only 19 microns, particularly high performance and “sustainable”: ideal for food & beverage and detergents, already adopted by leading German bottlers. - Pre-glued shrink labels: pre-adhesivised in the reel, proposed as an alternative to the shrink sleeve for containers with a form that requires a medium-low degree of shrink (in the photo, Label TapeShrink on tinplate can - Friesland Campina). The advantages: low cost management, high productivity of application, sustainability, also thanks to the elimination of the hot glue station, with consequent saving of adhesive and energy, and reduction of fumes and stops for cleaning. Adhesive tapes - Tamper: tamper evident tape available in various colors on request; ensures safety and integrity of the packaging and protection against pilfering; - AirtapeTM: latest generation tape, with a thickness of only 19 microns, ideal for multisectorial packaging; - Poly+TM: matt acrylic adhesive tape, thickness and weight increased (35 micron, 24 g/mq), which provides excellent tack and adhesion.

146 • 4/14

Etichette sostenibili, nastri adesivi efficienti Q Specializzata nella produzione e stampa di nastri adesivi, etichette e film in BOPP, Irplast presenta a Interpack (hall 07 stand 70C14) gli sviluppi più innovativi della propria offerta. Etichette - MICRON19TM, etichetta in PP di soli 19 micron, particolarmente performante e “sostenibile”: ideale per il food & beverage e la detergenza, è già stata adottata anche da alcuni fra i principali imbottigliatori tedeschi. - Pre-glued shrink labels: preadesivizzate in bobina, proposte come alternativa alle shrink sleeve per i contenitori con una forma che richiede un grado di termoretrazione mediobasso (nella foto, Label Tape Shrink su lattina in banda stagnata - Friesland Campina). Molti i vantaggi: economicità di gestione, alta produttività di applicazione, sostenibilità, anche grazie all’eliminazione della stazione della colla a caldo, con conseguente risparmio di adesivo ed energia, e riduzione dei fumi e dei fermi per pulizia. Nastri adesivi - Tamper: nastro adesivo antieffrazione disponibile, su richiesta, in vari colori; garantisce sicurezza e integrità degli imballi proteggendoli dai tentativi di manomissione o effrazione; - AirtapeTM: nastro adesivo di ultima generazione, con spessore di soli 19 micron, ideale per imballaggi multi settoriali; - Poly+TM: nastro adesivo acrilico opaco, di spessore e grammatura maggiorati (35 micron, 24 g/mq), che garantisce ottimo tack e adesività.

www.dativoweb.net


Hall 06 stand C27


JANUS with integrated Muting function and Muting sensors

A guideline for safety in the packaging industry.

Safety Detection Control


[

END O F LINE & HA NDLING

]

Con BTG verso il futuro Cama Group porta a Interpack (Hall 13 - Stand C31) la propria esperienza e una grande novità: un diverso e originale concetto di macchina, espresso nella cosiddetta Break-Through Generation. eader di settore e apprezzato da molti anni per la qualità e le prestazioni dei suoi sistemi di imballaggio secondario, Cama Group porta a Interpack il frutto della ricerca che ha portato a progettare macchine di nuova concezione: la Break-Through Generation. Rinomata per il lean design delle sue macchine e dei suoi robot, nel corso degli ultimi dieci anni gli ingegneri dell’azienda italiana hanno progettato macchine conformi al TPM, ottenendo risultati eccellenti non solo in termini di soluzioni tecniche

L

ma anche di accessibilità e costruzione igienica. Oggi, le macchine Break-Through di Cama vanno oltre il concetto di TPM, avvicinandosi sempre più alla filosofia Six Sigma, obiettivo comune delle aziende più avanzate che ricercano nell’efficienza la chiave del proprio successo. La sicurezza dell’operatore è sempre al primo posto nella progettazione delle nuove macchine e l’accessibilità resta un punto chiave, come di consueto per Cama, insieme a un maggior livello di sanificazione. In fiera. A Düsseldorf, Cama mostrerà dunque un nuovo concetto di astucciatrice, chiamata CL 175, che secondo i progettisti offre il massimo della flessibilità. Il sistema dà risposta a coloro che cercano una macchina in grado di lavorare a diverse velocità, con prodotti di varie dimensioni e con varianti importanti, come la dimensione del cartone. Nell’ambito della robotica, Cama esporrà un’unità all’avanguardia dove 12 robot Dettaglio del robot Delta Triaflex di Cama, che preleva e deposita barrette di cioccolato Detail of Cama’s Delta Triaflex robot, that picks up and deposits chocolate bars.

With BTG towards the future To Interpack (Hall 13 – Stand 13C31) Cama Group will be bringing its longstanding experience and a startling new feature: a different and original machine concept, expressed in the so-called Break-Through Generation. Sector leader and for many years now appreciated the world over for the quality and performance of its secondary packaging solutions, Cama Group will be attending Interpack with the fruits of the research that have led it to a new concept machines: the Break-Through Generation. Renowned for the lean design of its machines and robots, over the last ten years the Italian company’s engineers

www.dativoweb.net

have been designing TPM machines, attaining excellent results not only in terms of technical solutions but also in accessibility and sanitization. Today Cama’s Break-Through Machines have gone beyond the TPM concept, moving closer to the Six Sigma philosophy, common objective of the most advanced companies that see efficiency as the key to success. In the new machine design, operator safety

Nella foto un buon esempio del lean design di Cama, antecedente la Break-Through Generation: secondo il management del gruppo, fra poco, sembrerà appartenere al passato. In the photo a good example of Cama’s lean design, preceding the Break-Through Generation: according to the group’s management soon to be considered outdated.

Delta lavoreranno insieme, provando così l’efficienza del carico in co-flusso, ora portato al massimo rendimento grazie al lavoro congiunto di ingegneri elettronici e meccanici. Cama ha anche annunciato di aver realizzato, insieme a SPS (PFM Group), una ruota per la gestione e distribuzione dei prodotti ad altissima velocità, offrendo così un nuovo, importante dispositivo per linee di imballaggio chiavi in mano e confermando al contempo la bontà della sinergia tra le due aziende. Assieme alle macchine di nuova concezione, allo stand Cama sarà in funzione il classico wrap-around, conosciuto e apprezzato in tutto il mondo per flessibilità, efficienza ed ergonomia. Ma dopo aver visto la Break-Through Generation di Cama in azione, avvertono i responsabili, tutte le altre macchine sembreranno obsolete. Q

is the key factor. And, characteristic to Cama, accessibility, along with increased sanitization, is mainstay. At the fair. At Düsseldorf Cama will be showing a new Side Loading concept, identified as CL 175, according to Cama’s engineers offering maximum flexibility. The system is a response to those who are looking for a machine which is able to work at different speeds, with products of different sizes and with important variations, such as carton dimensions. On the Robotics side, Cama will show a state-of-the-art loading unit, where 12 Delta type robots work together proving the highly sophisticated Co-Flow loading

system, now offering maximum performance, a joint achievement of the electronic and mechanical engineers. Cama also announced the release of a high speed Star-Wheel system strategic for packaging machines developed together with SPS (PFM Group), with which Cama has successful, longstanding working relations. Together with their new concept machines, Cama’s stand will also feature its traditional wrap-around casepacker, known and appreciated the world over for its flexibility and lean design. Once you have seen the Cama Break-Through Generation up and running, company heads claim, all other machines will just seem out-of-date. Q

4/14 • 149


[

Aetna Group a Interpack Q È una lunga tradizione quella che lega Aetna Group e Interpack, e anche per l’edizione 2014 della fiera le aziende del Gruppo propongono al mercato importanti innovazioni (hall 12, stand F15). Rotoplat Serie 8 è la proposta di Robopac, dotata del Multilevel Control, l’innovativa soluzione hardware e software che permette la scomposizione del prodotto in 5 diversi livelli tutti regolabili in spessore, per ognuno dei quali è possibile regolare il tiro del film, il prestiro (solo su carrelli motorizzati), i giri di rinforzo, la velocità di rotazione del piatto, la velocità del carrello, il tipo di cordonatura del film e addirittura la presenza o meno del pressore di contenimento. Robopac Sistemi presenta il restyling della famiglia di bracci rotanti Helix: non solo un’operazione estetica per ridurre gli ingombri e facilitare l’uso, ma una vera e propria razionalizzazione della gamma assieme a numerose soluzioni che permettono importanti risparmi nel consumo dei materiali e nella manutenzione. Ne è un esempio l’anteprima mondiale della tecnologia TPM Ready, un approccio olistico per ottimizzare al massimo la manutenzione sulla macchina riducendo gli stop, le difettosità, e i break down. Da Dimac arriva St@r Master, evoluzione della famiglia di termofardellatrici St@r, che contiene importanti innovazioni in molte componenti, dall’alimentazione alla configurazione, dal gruppo porta bobina e svolgitura film al tunnel di termo-retroazione. Nello stand Aetna Group anche la nuova incastonatrice/fardellatrice TC300 Prasmatic, la soluzione più modulare, universale e flessibile per produzioni di media velocità nel confezionamento a fine linea. Con un design completamente rinnovato, prevede un telaio tubolare autoportante e ampi portelli scorrevoli: caratteristiche che agevolano l’accesso e le operazioni di manutenzione, oltre a conferire una completa visibilità degli organi in movimento e del ciclo di lavoro.

END O F LINE & HA NDLING

]

Aetna Group at Interpack Aetna Group is bound to Interpack by a long tradition, and in this edition too the Group companies propose important innovations to the market (hall 12, stand F15). Rotoplat Series 8 is the Robopac proposal, featuring the Multilevel Control, the innovative hardware and software solution that allows the breakdown of the product in 5 different levels all with adjustable thickness and for each of these you can adjust the pull of the film, the prestretch (only on motorised trolleys), the reinforcement rotations, the plate rotation speed, trolley speed, the type of creasing of the film and even the presence or not of the containment pressure roller. Robopac Systems presents the restyling of the Helix rotating arm family. Not only an aesthetic operation to reduce bulk and facilitate use, but a real rationalization of the range along with a number of solutions that allow significant savings in the consumption of materials and in maintenance. One example is the world premiere of TPM Ready technology, a holistic approach in order to optimize the maintenance on the machine to a max by reducing stoppages, flaws, and breakdowns to a bare minimum. Dimac will be showing St@r Master, the evolution of the St@r shrinkwrapper family, which contains important innovations in many components, from food to configuration, from the reel bearing unit and unwinding of film to the shrink tunnel. At the Aetna Group stand also the new TC300 Prasmatic wrapping/bundling machine, the most modular universal and flexible solution in end-of-line packaging for mid speed production, with a completely new design and includes a free-standing tubular frame and large sliding panels: characteristics that facilitate access and maintenance operations, in addition to giving a complete visibility of the mechanical moving parts and of the workcycle.

=:M>FBNG:E>O:>OBLHEE>O>KHBEFHG=H È uno slogan molto impegnativo, ma: • La personalizzazione, il nostro punto di appoggio • La gamma delle macchine, la nostra leva • La soddisfazione dei nostri clienti, la forza. • Con questi tre elementi possiamo sollevare i vostri problemi di confezionamento. Il crescente numero di clienti e la loro soddisfazione, sono la prova della qualità e bontà delle macchine che produciamo. • Riempimento • Tappatura • Etichettatura • Scatolatura • Pallettizzazione, ci pongono in grado di fornire sia singole macchine che linee complete.

La lunga esperienza del nostro personale nel settore, ci permette di arrivare dritti al miglior compromesso per soddisfare le vostre esigenze di confezionamento. www.dativoweb.net

Località SELVAPIANA,4 50068 RUFINA (FI) - ITALIA Tel. +39 055 9560023 Fax. +39 055 8325008 www.zetasrl.org - info@zetasrl.org

4/14 • 151


[

A DV ERTO RIA L

]

Incollaggio con Freedom™ In occasione di Interpack 2014, Nordson Corporation propone il nuovo sistema di incollaggio Freedom™.

Serbatoio di esigue dimensioni. Con il sistema Freedom™ il serbatoio è ridotto ad

appena 400 ml, con conseguente abbattimento dei consumi energetici e riduzione delle carbonizzazioni. Si consuma energia solo quando occorre.

Gli applicatori Miniblue II sono totalmente isolati, hanno un tempo di commutazione minimo (2 ms) ed il loro ciclo di vita supera i 100 milioni di cicli.

Sistema di alimentazione automatico. Altra innovazione del sistema Freedom™ è il nuovo sistema di alimentazione automatica dell’adesivo. Il principale vantaggio deriva dalla fusione istantanea dell’adesivo effettivamente necessario.

Potenziali risparmi confermati. Molti clienti sono rimasti stupiti ed entusiasti del nuovo sistema e hanno confermato sia il risparmio energetico che di adesivo.

Integrazione con macchinari. Libertà di installazione e dai limiti di integrazione sulle linee di produzione. Risparmio di spazio grazie al limitato ingombro dovuto al montaggio verticale. Controllo efficiente. L’unità di fusione Freedom™ è dotata del sistema di controllo dell’applicazione EcoBead, con cui è possibile ottenere un risparmio di adesivo dal 30% al 60%. Per semplicità d’uso e per il monitoraggio dei processi, il fusore è dotato di un pannello touch screen Optix da 7” che mostra dati diagnostici dettagliati. Freedom™ utilizza applicatori pneumatici ampiamente collaudati della serie MiniBlue II noti per la loro eccezionale resistenza. Attualmente sono disponibili moduli Miniblue II a sfera o ad ago.

Freedom™adhesive system Nordson Corporation will show the new Freedom™ system at Interpack 2014 trade show. The Freedom Integrated Hot Melt Packaging Solution combines Nordson’s innovative, tankless Freedom™ Series hot melt dispensing equipment with Henkel’s high-performance Technomelt® certified, family of adhesives to help customers contain costs, simplify operations and increase productivity, reliability, and sustainability. Customers employing the Freedom™ Solution derive value in the form of six freedoms, typically recover equipment cost in less than 12 months and enjoy continued cost savings over the life of the system. Specifically, the six freedoms include: • freedom from adhesive availability concerns ;

www.dativoweb.net

• freedom from downtime associated with char and contamination; • freedom from manual adhesive filling; • freedom from parent machine mounting and integration limitations; • freedom from confusing controls and diagnostics; • freedom from excessive adhesive use. Small reservoir. The Freedom™System has a small reservoir holding just 400 ml , this means that when so little material needs to be kept in a molten state, energy consumption is reduced and the opportunity for charring is also reduced. With Freedom™ energy is expended only

when it’s required. Automatic Feeding System. Another innovation of Freedom™ System is the automatic adhesive filling system. The main benefit inherent in this tankless, adhesive application system is the instant “melt-on-demand” principle. Machine integration. Freedom from parent machine mounting and integration limitations. Saves machine space with vertical footprint and mounting. Efficient control. In addition, the Freedom™ Melter has an electronic control unit incorporating the EcoBead application control system, which enables to achieve adhesive savings that may be in the range between 30 and 60%. For simple operation and process monitoring, the melter is also equipped with a 7” Optix Touch Screen Panel, which provides detailed diagnostics of the processing sequence.

The dispensing guns also have a proven track record and they have made a name for themselves as the “endurance sprinters” or pneumatic applicators of the MiniBlue II series. The modules are now available with either ball or needle seat. They are fully insulated, work with a minimal switching time of 2 ms and achieve a service life of more than 100 million switching cycles. Savings potential confirmed. Many customers are extremely impressed with the new hotmelt application system that confirms energy and adhesive savings.

Per ulteriori informazioni sul sistema Freedom™ For more information on Freedom™ system

Nordson Nordson Italia SpA Tel. 02-216684.1 www.freedomhotmelt.com

4/14 • 153

advertorial

La soluzione integrata Freedom™ abbina l’innovativo applicatore di adesivo hot melt Nordson senza serbatoio alla famiglia di adesivi certificati Henkel Technomelt® a prestazioni elevate. Si tratta di un aiuto concreto ai clienti, che potranno contenere i costi, semplificare le operazioni e incrementare produttività, affidabilità e sostenibilità. I clienti che si affidano alla soluzione Freedom™ beneficiano di “sei gradi di libertà”, con la possibilità di recuperare i costi dell’apparecchiatura in meno di un anno e di beneficiare di continui risparmi durante l’intero ciclo di vita del sistema. In sintesi, i sei gradi di libertà: • libertà dai problemi legati alla disponibilità degli adesivi; • libertà dai tempi di fermo macchina dovuti alla carbonizzazione e contaminazione dell’adesivo; • libertà dal riempimento manuale dell’adesivo; • libertà di installazione sulla macchina principale senza alcun limite di integrazione; • libertà da comandi e diagnostica complessi; • libertà dagli sprechi di adesivo.


[

C OMP ON E NTS & O THER EQ UIPMENTS

]

Con WE2111, ammissibile alla verifica con interfacce ultramoderne, HBM impone standard di precisione e funzionalità.

With WE2111, admissible for verification with ultra-modern interfaces, HBM imposes standards of accuracy and functionality.

Indicatore di pesatura digitale

Digital weighing indicator

Q Con l’introduzione del nuovo indicatore di pesatura digitale WE2111, HBM risponde nello specifico ai requisiti sempre più elevati richiesti dall’utenza industriale. Anche le interfacce USB ed Ethernet rientrano nello standard, così come la conformità a tutte le direttive in vigore. In tempi in cui la concorrenza internazionale si fa sempre più accesa, gli utenti di bilance a uso industriale e di bilance per autocarri esigono dagli strumenti massima velocità e precisione di misura, nel rispetto di tutte le clausole in vigore. A tale scopo HBM ha sviluppato l’indicatore di pesatura WE2111, evoluzione del WE2110, leader di mercato dal 1997; la nuova soluzione unisce ai vantaggi del modello precedente gli adattamenti ai requisiti più recenti ed è progettato in vista di ulteriori sviluppi. Di regola, può anche sostituire il modello precedente nei sistemi esistenti. Il vantaggio principale offerto dal nuovo indicatore di pesatura consiste nelle interfacce Ethernet e USB, che ne permettono l’integrazione in processi di sistemi sovraordinati. Componenti del firmware non soggetti all’obbligo di taratura possono essere aggiornati ufficialmente tramite USB, rispettando così le direttive attuali (i più recenti requisiti WELMEC, direttiva 2009/23/CE). Ulteriore punto di forza è rappresentato dalla memoria dati ammissibile alla veri-

L’indicatore di pesatura digitale WE2111 risponde ai più elevati requisiti industriali. The WE2111 digital weighing indicator meets the highest industrial requirements.

fica, che offre massima sicurezza anche agli utilizzatori più esigenti dato che rende possibile la rintracciabilità dei valori di pesatura richiesta per legge e, quindi, di mantenere un’adeguata documentazione della qualità. Con questa soluzione, HBM impone uno standard di precisione e funzionalità.

HBM Test and Measurement Fin dalla fondazione nel 1950, la società tedesca Hottinger Baldwin Messtechnik (HBM Test and Measurement, www.hbm.com) si è costruita una reputazione di livello mondiale, protagonista tecnologico nel mercato delle misurazioni e prove. HBM offre prodotti per la catena di misurazione completa, dalle prove virtuali a quelle fisiche. Presente in oltre 80 paesi, ha sedi di produzione in Germania, USA e Cina.

With the introduction of the new WE2111 digital weighing indicator HBM specifically responds to the increasingly high requirements from the user industry. The USB and Ethernet interfaces are also within the standard, the same as the compliance with all applicable directives. At a time when international competition is becoming fiercer, users of industrial scales and weighing instruments for trucks require maximum speed and accuracy in compliance with all the provisions in force. For this purpose, HBM has developed the WE2111 weighing indicator, evolution of the WE2110, market leader since 1997; the new solution combines the advantages of the previous model with adaptations to the latest requirements and is designed with a view to further developments. As a rule, it can also replace the previous model in existing systems. The main advantage offered by the new weighing indicator consist of the Ethernet and USB interfaces, which enable integration into higher-level system processes. Firmware components not subject to official calibration can be updated via USB, thus respecting the existing directives (the latest WELMEC requirements, Directive 2009/23/EC). Another strength is the data verification memory, which offers maximum safety even with the most demanding users, enabling the traceability required by law of weighing values and, hence the maintainment of adequate quality documentation. With this solution HBM imposes a standard of precision and functionality. HBM Test and Measurement Since it founding in 1950, the German company Hottinger Baldwin Messtechnik (HBM Test and Measurement, www.hbm.com) has built a world-class reputation as a technological protagonist in the measuring and testing market. HBM offers products for the complete measurement chain, from virtual to physical testing. Operating in more than 80 countries, the company has production facilities in Germany, USA and China.

L.A.I.M. produce angolari di cartone pressato riciclabile angolare tacchettato adatto soprattutto per proteggere i bordi delle bobine, sanitari, e oggetti di forme sia tonde che ovali, e irregolari, sia neutri che personalizzati tesi e tacchettati e cartone ondulato (cannetè) onda media da imballo, impiegato in particolare nella protezione di particolari meccanici, di precisione, vetro, ecc. e nei luoghi dove vengono eseguiti lavori di verniciatura, imbiancatura, restauri e simili. Gli angolari di cartone pressato, completamente riciclabili, rappresentano la principale attività della L.A.I.M. Questi prodotti sono stati sviluppati dopo una attenta e ampia ricerca di mercato, condotta da esperti, che ha evidenziato la tendenza a un sempre maggiore utilizzo di imballaggi realizzati con materiali ecologici e interamente riciclabili, come alternativa ad altri tipi di angolari prodotti con materiali misti, di difficile smaltimento o alto impatto ambientale. L.A.I.M. è costantemente impegnata, in collaborazione con l’ENEA di Pisa, nella ricerca di nuovi materiali per la realizzazione di imballaggi innovativi, e nel costante miglioramento della qualità della propria produzione.

www.dativoweb.net

L.A.I.M. S.R.L. Via Provinciale Sud 293 • 56020 S. Maria a Monte (PI) ITALIA Tel. +39 0587 707073 • Fax +39 0587 707093 www.imbalaim.it • e-mail: imbalaim@tiscali.it

4/14 • 155


)LWIRUSURƂWDELOLW\ Muller Martini VSOP Stampa offset con sleeve a formato variabile La tecnologia della rotativa VSOP fornisce i mezzi per trarre vantaggio dalle diverse tendenze del PHUFDWRGHOSDFNDJLQJLPEDOODJJLRƃHVVLELOHHWLFKHWWH VKULQNVOHHYHHWLFKHWWHDGHVLYHHWLFKHWWH FDUWDFROOD,0/ZUDSDURXQG SLHJDWXUDGLFDUWRQHHLPEDOODJJLRGLOLTXLGL Müller Martini – your strong partner.

ZZZPXOOHUPDUWLQLFRP Telefono +39 02 26237 1


[

C OMP ON E NTS & O THER EQ UIPMENTS

]

Gluing systems and lines

Sistemi e linee di incollaggio Q Intercoll offre un’ampia gamma di sistemi d’incollaggio, articolata nelle tre grandi famiglie per adesivi a caldo, per adesivi a freddo e linee automatiche complete. I fusori e dosatori di hot-melt, per colle a granulo o pressure sensitive, possono essere manuali e automatici e vengono integrati con varie teste a cordolo, spalmatura, zero cavity e spray. Insieme al fusore vengono forniti anche i tubi elettroriscaldati per il trasporto della colla dalla vasca di fusione alla pistola o alle teste con moduli. Intercoll completa l’offerta con l’attrezzatura per il carico automatico della colla in granuli e mette a disposizione un’ampia scelta di ricambi, compatibili con tutte le marche. L’ultima rappresentanza acquista è relativa al fusore InvisipacTM della Graco, insignito di un Visionary Award 2013 e caratterizzato da una struttura priva di serbatoio con caricatore automatico: riduce il tempo necessario a raggiungere le alte temperature e assicura prestazioni eccellenti anche con adesivi entry level. Intercoll offre, inoltre, sistemi d’incollaggio per adesivi a freddo, PUR, poliammidici, e relativi accessori. In catalogo: controlli di livello MC, estrusori a vite, N2002 PUR, sistemi di distribuzione a siringa e serbatoi in pressione, sistemi per l’estrusione di silicone con piatti prementi, spalmatrici a rullo per colle a caldo e a freddo, sbobinatore con spalmatura. Infine, la società bergamasca fornisce linee automatiche complete per le applicazioni più varie, dal packaging all’arredamento, passando per l’automotive, la cosmetica e molto altro. Intercoll (Trescore Balneario, BG), che è dotata di officina e laboratorio interni, commercializza i prodotti di una quindicina di fornitori accuratamente selezionati per qualità e convenienza.

Intercoll offers a wide range of adhesive systems, that come under three major categories for hot-melt as well as cold application adhesives and complete automatic lines. The hot-melting and metering devices for pressure sensitive or granule glues can be manual or automatic and are integrated with various curbing-, coating-, zero cavity and spray heads. The melter is supplied together with electro-heated tubes for the transport of the glue from the melting tank to the gun or the module heads. Intercoll completes the offer with the equipment for automatic loading of the glue granules and offers a wide range of spare parts, which are compatible with all brands. Their last representational assignment is the InvisipacTM by the company Graco, which won a Visionary Award 2013 and features a tankless structure with autoloader: it reduces the time needed to reach the high temperatures and ensures excellent performance even with entry level adhesives. Intercoll also offers adhesive systems for cold adhesives, PUR, polyamides, and related accessories. Their catalogue also includes: MC level controls, screw extruders, PUR N2002, syringe distribution systems and pressure vessels, silicon extrusion systems with push plates, coater rollers for hot melt and cold application glues, unwinder spreader. Lastly, the Bergamo based company provides complete automatic lines for the most varied applications, from packaging to furniture, going by way of the automotive industry, cosmetics and much more. Intercoll (Trescore Balneario, BG), which has its own workshop and laboratory, markets the products of some fifteen suppliers carefully chosen for quality and cost-effectiveness.

Saldatrice automatica per buste pre-made Automatic pouches making machine

Saldatrice automatica per buste medicali Automatic medical pouches making machine

SA-V SA-M

Düsseldorf, 08-14 May 2014 www.elba-spa.it

www.dativoweb.net

Hall 11 - Stand D11

4/14 • 157


[

CO M P O N E N T S & OT HE R E QUI PME NT S

]

Rulliere modulari: anteprima mondiale Alla Hannover Messe di aprile 2014, la nuova linea di rulliere modulari per la movimentazione folle realizzate da Elesa SpA. Q Le nuove rulliere per la movimentazione folle di Elesa sono sviluppate per realizzare agevolmente e in tempi ridotti piani di scorrimento o di contenimento, e trovano impiego in diverse applicazioni fra cui i sistemi di stoccaggio e prelievo e le macchine per imballaggio. Gli elementi di scorrimento che ne costituiscono i componenti principali sono disponibili in versione a rulli o a sfere. Gli elementi a rulli (RLT-U) sono realizzati in tecnopolimero a base poliammidica nera, che assicura un’elevata capacità di carico, o in poliuretano termoplastico grigio, particolarmente idoneo alla movimentazione di prodotti delicati, che presenta caratteristiche anti-traccia e di elevata resistenza agli urti. Gli elementi a sfere (RLT-S), invece, sono in tecnopolimero a base acetalica bianca, e sono ideali per la movimentazione omnidirezionale. L’assemblaggio dei componenti negli appositi profili d’alluminio anodizzato è reso particolarmente agevole dalla speciale sezione del profilo, che rende possibile gli incastri senza necessità di viti o altri elementi di fissaggio. Questa caratteristica permette una facile sostituzione delle rulliere, evitandone lo smontaggio integrale, permettendo anche di riutilizzare il profilato d’alluminio. Le speciali performance tecniche dei materiali impiegati per i componenti consentono, inoltre, di minimizzare gli attriti,

favorendo la scorrevolezza e la silenziosità ed eliminando la necessità degli interventi di manutenzione per la lubrificazione. Un’altra qualità importante di questi manufatti è l’elevata resistenza alla flessione sotto carico, garantita dal profilo portante di alluminio anodizzato, che consente di installare le rulliere anche in condizioni di non completo appoggio e senza la necessità di elementi portanti ulteriori. Le rulliere Elesa si adattano alle applicazioni più diverse grazie all’ampia gamma di accessori componibili in tecnopolimero a base poliammidica (dai freni alle sponde di contenimento, dalle testate ai supporti e alle squadrette…) che contribuiscono a migliorarne posizionamento, funzionalità e sicurezza. Specializzata nella produzione di componenti normalizzati di plastica e metallo per l’industria meccanica, Elesa nasce a Monza nel 1941 e oggi opera in oltre 60 paesi, con 11 filiali dirette e un export al 60%.

Modular roller conveyors: a world premiere At the Hannover Messe (7th-11th April 2014) Elesa SpA presents its new line of modular idle roller conveyors

Elesa’s new idle roller conveyroes have been devised to easily and speedily implement slider or containment beds, and are used in various applications including storage and retrieval systems as well as packaging machines. The sliding elements, which constitute the main components, are available in roller or ball bearing versions. The roller elements (RLT-U) are made of polyamide based black techno polymers, which provide a high load capacity, or in grey thermoplastic polythene, particularly suited to the handling of delicate products, which have anti-trace characteristics and a high bump and crash resistance. The bearing elements (RPT-S), however are in white acetal resin, and are ideal

158 • 4/14

for omni-directional movement. The assembly of the components in the special anodized aluminum profiles is made particularly easy by the special section of the profile, which enables joining without the need for screws or other fasteners. This feature enables the easy replacement of the Elesa rollers without having to remove them entirely, while also enabling the reuse of the aluminum profile. The special technical performance of the materials used for the components what is more enables friction to be minimised, favoring smooth, quiet operativity, and eliminating the need of maintenance work in order to apply lubricants. Another important quality of these products is the high resistance to bending under load, guaranteed by

Visione industriale ad alta velocità Q Image S presenta la famiglia di telecamere EoSens CXP di Mikrotron che, grazie alle prestazioni e funzionalità avanzate, risponde alle esigenze di impiego più complesse e sofisticate in tutti i settori, da quello industriale a quello cinematografico. L’interfaccia CoaXPress ad alte prestazioni integrata nella telecamera per il trasferimento di dati in tempo reale raggiunge velocità fino a 25 GBit/s su distanze fino a 100 metri. Trasferimento di dati, comunicazione e controllo del PC e dell’alimentatore passano attraverso un unico cavo. Le dimensioni sono di soli 80x80x53 mm e l’ottica prevede un attacco a C. Queste caratteristiche agevolano l’integrazione dei sistemi e il successivo funzionamento. La risoluzione elevata dei nuovi modelli di telecamera consente, ad esempio, di acquisire anche i dettagli più piccoli di componenti che viaggiano ad alta velocità. L’area di interesse (ROI) aumenta il grado di flessibilità applicativa e consente di raggiungere velocità fino a 100.000 fotogrammi/sec. Il controllo dell’immagine con l’otturatore globale fornisce immagini nitide e senza distorsioni.

the carrier profile of anodized aluminum, which allows the installation of the rollers even in conditions of partial support and without the need for additional carriers. Elesa roller conveyores adapt to different applications thanks to the wide range of polyamide based technopolymer modular accessories (from brakes to containment sides, from the heads to supports and brackets ...) that help to improve the positioning, functionality and safety of the same. Elesa, specialized in the production of standardized components in plastic and metal for the mechanical engineering industry, was set up in Monza in 1941 and today operates in over 60 countries worldwide, with 11 direct subsidiaries exporting 60% of its output.

High-speed industrial vision Image S presents the family of EoSens CXP cameras by Mikrotron that, thanks to their advanced performance

and features, meet the needs of the most complex and sophisticated use in all sectors, from industry to cinema. The CoaXPress high performance interface integrated in the camera for the transfer of data in real time reaches speeds of up to 25 GBit/s over distances up to 100 meters. Transfer of data, communication and control of the PC and the power supply pass through a single cable. The size is only 80x80x53 mm and the lens has a C attachment. These features facilitate the integration of systems and the subsequent operation. The high resolution of the new models of camera allow, for example, to acquire even the smallest details of the components that travel at high speed. The area of interest (ROI) increases the degree of application flexibility and enables speeds of up to 100,000 frames/sec to be reached. The image control with global shutter provides sharp images without distortion.

www.dativoweb.net


[

CO N T E N T S

]

4 /2 0 1 4

Enti, aziende e associazioni citate su questo numero A ACMA HEADQUARTERS ................. 110 ACQUA MINERALE SAN BENEDETTO.. 24 AETNA GROUP SPA ........................ 151 ALTROCONSUMO ............................. 23 AMB SPA ........................................... 63 AMORIM CORK ITALIA SPA ............... 29 ANFIMA .............................................. 82 ARCOPLASTICA SRL ......................... 85

CORIPET ............................................ 79 COSMETICA ITALIA - ASS. NAZ. IMPRESE COSMETICHE .............. 53, 90

B B&R AUTOMAZIONE INDUST. ... 10, 122 BERGAMI SRL ......................... 101, 102 BOSCH REXROTH SPA ......................... 101, 121

E EIDOS SPA ....................................... 145 EIOM .................................................. 16 ELESA SPA ...................................... 158 ESA ELETTRONICA SPA .................. 125

C CAMA 1 SPA .................................... 149 CO.IND. S.C. ...................................... 24 COESIA SPA .................................... 131 CONAI ............................................... 23 COOP ITALIA SOC. COOP ................. 24

F FAMAR PACKAGING SRL ................ 107 FDA - FOOD AND DRUG ADMINISTRATION .............................. 94 FERRARELLE SPA ............................. 30 FIERE DI PARMA SPA ........................ 14

D DAVIDE CAMPARI MILANO SPA ........ 35 DECO INDUSTRIE SCPA .................... 25 DEUTSCHE MESSE AG ..................... 18 DIMAC (AETNA GROUP SPA)........... 151

G GERHARD SCHUBERT GMBH ........ 117 GIFLEX ............................................... 69 GOGLIO SPA...................................... 26 GRACO BVBA .................................. 157 H HBM ITALIA SRL .............................. 155 HENKEL ITALIA SPA........................... 87 I ICIMEN DUE SRL ............................... 26 ILLYCAFFÉ SPA .................................. 28 IMA INDUSTRIA MACCHINE AUTOMATICHE SPA......................... 112 IMAGE S SRL ................................... 158 IMBALLAGGI P.K. SAS ..................... 145 INTERCOLL SNC ............................. 157 IPACK-IMA SPA ...................... 18, 23, 54 IRCPACK SRL .................................... 69 IRPLAST SPA ................................... 146 ISHIDA EUROPE LTD. ........................ 88 ISTITUTO ITALIANO IMBALLAGGIO ......................... 8, 23, 90

K KEBA AG ......................................... 126 KLAIN ROBOTICS SRL .................... 134 KRONES SRL..................................... 55 L LAMEPLAST GROUP ....................... 108 LEISTER TECHNOL. ITALIA SRL ........ 55 M MESSE DÜSSELDORF GMBH ............. 8 MESSE FRANKFURT ITALIA SRL ....... 16 MG2 SRL ........................................... 98 MIRATO SPA ...................................... 82 MOOG ITALIANA SRL ...................... 138 N NEWBOX SPA .................................... 28 NORDMECCANICA SPA ...................... 8 NORDSON ITALIA SPA ..................... 153 NOVACART SPA ................................ 28 O O-I MANUFACTURING ITALY SPA ...... 29 OMAS TECNOSISTEMI SRL..... 105, 107 OMRON ELECTRONICS SPA ........... 138 ORIEX COMMUNICATION .................. 44 P P.E. LABELLERS SPA ....................... 143 P.E.T. ENGINEERING SRL .................. 30 PFM PACKAGING MACHINERY ....... 149 POLITECNICO DI MILANO DIPARTIMENTO INDACO ................... 23 R ROBOPAC SISTEMI (AETNA GROUP SPA)....................... 151 ROCKWELL AUTOMATION SRL ...... 127 RONCHI MARIO SPA ....................... 120 RPC ................................................. 108 ROVEMA ITALIA SRL........................ 120

Every product has its packaging, you have

DativoWeb Our undertakings on paper and on the web dativoweb.net/italiaimballaggio Magazine dedicated to users of packaging materials and machines…

dativoweb.net/converting Magazine dedicated to cellulose and flexible packaging converters…

dativoweb.net/packbook Products, machines and services for packaging and converting: the best of our Database

dativoweb.net/book Books on packaging design and packaging, also purchasable online

Our undertakings on the web

S SACMI IMOLA S.C. ............................ 87 SAINT-GOBAIN VETRI SPA VERALLIA ........................................... 35 SAREL PLAST .................................... 58 SASIB SPA ....................................... 131 SATO GERMANY GMBH .................. 143 SCATOLIFICIO CRISTINA SRL ........... 30 SCHNEIDER ELECTRIC SPA ............ 124 SEALED AIR SRL ............................... 32 SEPACK LAB SRL .............................. 69 SERVOTECNICA SPA....................... 137 SEW EURODRIVE SAS .................... 141 SIEMENS SPA .................................. 131 SIT ITALIA SPA ................................... 58 SIT SPA ............................................. 57 SMURFIT KAPPA ITALIA SPA ............. 32 SPS ITALIANA PACK SYSTEMS ....... 149 STORA ENSO ITALIA SRL .................. 88 SUN CHEMICAL GROUP SPA............ 47 T TECNO PACK SPA ........................... 114 TETRA PAK ITALIANA SPA ................. 35 TUYAP FAIR AND EXHIBITIONS ORGANIZATION INC. ......................... 18

WEBMAGAZINE by

dativoweb.net/packmedia Updates on design, packaging, labeling, converting…

dativoweb.net/database Products and producers of packaging and converting machines and services

dativoweb.net/calendar International B2B events and fairs

dativoweb.net/service Consulting to improve communication on paper and on the web

Online reference point for information on the packaging, bottling, labeling and converting sectors… Features, opinions, news, statistics and trends in the sector. via Benigno Crespi 30/2 - 20159 Milano Italy tel. +39 02 69007733 - fax +39 02 69007664 info@dativo.it - www.dativoweb.net

U UBM CANON ..................................... 96 UCIMA ............................................... 90 UNILEVER ITALIA ............................... 32 V VELTRU AG ...................................... 134 VENDITALIA SERVIZI SRL .................. 14 VIPA ITALIA SRL ............................... 122 W WITTENSTEIN SPA........................... 137


[

A D V E RT I S E RS

]

4 /2 0 1 4

NSERZIONISTI ADVERTISERS INSERZIONISTI ADVERTISERS A ACMA HEADQUARTERS ............... 95 AETNA GROUP ............................ 138 AMB................................................ 13 APP ITALIA ..................................... 46 ARCOPLASTICA .............................. 3 ATC ITALIA ..................................... 37 B B&R AUTOMAZIONE INDUSTRIALE............................... 123 BECKHOFF ...................................... 9 BOCEDI ............................................ 4 BOSCH REXROTH ....................... 121 C CAMA GROUP ............................... 84 CARCANO ANTONIO ..................... 11 CIBUSTEC 2014 ........................... 100 CONTITAL....................................... 52 CPR SYSTEM ................................. 22 D DINAMIC SERVICE....................... 124 E ELBA............................................. 157 ELESA .......................................... 136 EMBALLAGE 2014 ....................... 142 ESA ELETTRONICA .................... 125 ESSEGI 2 ........................................ 88 ETIPACK ......................................... 17 EURASIA PACKAGING 2014........ 152 F FAMAR PACKAGING ........................ 8 G G.B. GNUDI BRUNO ................. 20-21 G.N.C............................................ 116

GENERAL SYSTEM PACK ............. 25 GERHARD SCHUBERT ............. 42-43 GEROSA GROUP ......................... 109 GRACO .......................................... 34

N NIMA ERRE.TI PACKAGING........... 86 NORDSON ITALIA ........................ 153 NUOVA ERREPLAST .................... 108

I I.G.C. ................................................ 7 IFP PACKAGING .......................... 107 IMA ................................................. 68 IMAGE S ......................................... 56 IMBALL ......................................... 114 IMBALLAGGI P.K. ......................... 127 INTERNOVA PACK ......................... 15 IPACK-IMA 2015 ............................ 75 IRPLAST ......................................... 12 ISHIDA EUROPE .......................... 128

O OMRON ELECTRONICS ..........II Cop.

K KHS ................................................ 53 KLAIN ROBOTICS ....................... 146 L L.A.I.M. ......................................... 155 LABELPACK ................................... 23 LAMEPLAST GROUP ..................... 27 LANCIA ......................................... 141 LEISTER TECHNOLOGIES ITALIA ................ 10 LINEARTECK ................................ 111 LIVE-TECH .................................. 140

M MARCHESINI GROUP.................... 93 MARKEM-IMAJE ............................ 97 ME.RO .......................................... 137 MG2 .............................................. 106 MININI IMBALLAGGI ...............III Cop. MONDI PACKAGING ..................... 19 MÜLLER MARTINI ........................ 156

Per abbonarsi a ItaliaImballaggio/To subscribe Nome e cognome Name and surname............................................................................ Funzione all’interno della società Job function ........................................................................................ Società Company ............................................................................................ Settore di attività della società Primary company business ................................................................ Indirizzo Address .............................................................................................. CAP Città Post Code ............................................Town ...................................... Provincia Stato Province ..............................................Country .................................. Tel........................................................Fax ........................................ Codice fiscale .................................................................................... Partita Iva International Vat number ....................................................................

162 • 4/14 www.packmedia.net

Abbonamento annuale: Annual subscription:

Italia € 60,00 Estero € 96,00 Italy € 60,00 Aboad € 96,00

Autorizzo ad addebitare l’importo sulla carta di credito I authorize you to deduct the sum from my credit card n. ................................................................................

P P.E. LABELLERS ..................... 33, 103 PACKLAB .................................... 103 PHARMA TRADE .......................... 133 PILOT ITALIA .................................. 89 R REER ............................................ 148 ROBATECH ITALIA ....................... 119 ROBOX ......................................... 113 ROCKWELL AUTOMATION............ 99 RONCHI MARIO ............................. 67 ROVEMA ITALIA ............................. 61 RPC CONTAINERS ........................ 39 S SATO .............................................. 62 SCANDOLARA ............................. 161 SCHNEIDER ELECTRIC ................. 41 SERVICE AIR .................................. 51 SERVOTECNICA .......................... 115 SEW EURODRIVE ............................ 6 SIEMENS ............................... 129-130 SIPRO ............................................. 87 SIS.MA ........................................... 92 SIT GROUP ............................ IV Cop. SPS IPC DRIVES 2014 ................. 150 STORA ENSO ITALIA ..................... 31 SUN CHEMICAL GROUP ............... 78 T TECMES ....................................... 144 TECNO PACK ............................... 159 TGM-TECNOMACHINES ............. 139 V VALMATIC ...................................... 83 VENDITALIA SERVIZI ................... 154 VERIMEC ........................................ 55

Data di scadenza/Expiring date ...................................................... Titolare/Card holder ............................................................................ Data di nascita/Date of birth .............................................................. Firma/Signature ........................................................................ Data/Date .......................................................................................... Pagamento a mezzo bollettino sul c/c postale 57798183 Bonifico bancario/Bankers draught € Intestato a/Made out to: Edizioni Dativo S.r.l - Banca Popolare di Sondrio, Ag. 15, Via G. Murat 76, 20159 Milano - Abi 05696 cab 01614 c/c 000002533X86 - Cin: B - Iban: IT/91/B/05696/01614/000002533X86 Spedire via fax/Send by fax +39/02/69007664; e-mail: info@dativo.it

W WIDE RANGE ................................ 29 Z ZANASI ......................................... 147 ZENITH ......................................... 104 ZETA ............................................ 151

Garanzia di riservatezza Il trattamento dei dati personali che la riguardano, viene svolto nellʼambito della banca dati della Edizioni Dativo Srl e nel rispetto di quanto stabilito dalla Legge 675/96 sulla tutela dei dati personali. Il trattamento dei dati, di cui le garantiamo la massima riservatezza, è effettuato al fine di aggiornarla su iniziative e offerte della società. I suoi dati non saranno comunicati o diffusi a terzi e per essi lei potrà richiedere, in qualsiasi momento, la modifica o la cancellazione, scrivendo allʼattenzione del Responsabile Dati della Edizioni Dativo Srl. Solo se lei non desiderasse ricevere comunicazioni, barri la casella a fianco.

www.dativoweb.net

1-2/13 • 1

www.dativoweb.net


To rely on a leading company in the ďŹ eld of packaging, skilled partner able to offer the best packaging solutions through a careful and targeted advising. To optimize the business distribution through tailor-sewn products, developed with professionalism and passion beyond seventy years. To equip with Big Bags, ideal tools for any material that can ensure security and protection at all stages of storage and transport.

Be Minini: space to the contents, right in shape. m

i

n

i

n

i

.

i

t


www.studioag.sm 14377

Il nostro film, come il cinema italiano, fa storia Our film, like Italian cinema, makes history

dal 1971 - since 1971

S I T, A M AT T E R O F P E O P L E Vi aspettiamo a: Looking forward to meeting you:

SIT - Stampa Imballaggi Trasparenti Strada del Sabattino, 62 Faetano 47896 RSM Phone: 0549 876 211 Fax 0549 996 444 Country Code (+) 378 drop 0549 SITITALIA - Flexible Packaging Via Pierini, 14/16 61122 Pesaro (PU) Italia Phone: (+) 39 0721 20511 Fax (+) 39 0721 201987 SAREL PLAST Strada Statale 16, 20 (Km 31) 35048 Stanghella (PD) Italia Phone:(+) 39 0425 4588 Fax (+) 39 0425 459010

www.sitgroup.sm

HALL 10 STAND C42

Italiaimballaggio 4 - 2014 Special Cover  

ItaliaImballaggio. rivista per gli utlizzatori e produttori di materiali, macchine, attrezzature, imballaggio