Issuu on Google+

142 enero-febrero 2011

n. 142 - 6,95 €

fútbol 24 horas making gol televisión reportaje ces 2011 - TENDENCIAS TV espectadores

móviles - panorama rodaje 3d - edición match moving técnica cinematografía digital - reportaje ISE 2011


SUMARIO

nº142 Enero/Febrero 2011

26

30

36

42

34

40

48

12

PRIMER PLANO jUAN JOSÉ CARRETERO PÉREZ

26

REPORTAJE lo último en tecnología

30

REPORTAJE SUPERANDO récords

34

REPORTAJE BARCELONA HACE MÉRITOS

36

TENDENCIAS TV espectadores móviles

46

FUNDAMENTOS lápiz, celo e imaginación

48

PANORAMA RODAJE 3D

52

TÉCNICA ceros y unos de cine

56

EDICIÓN MATCH MOVING

58

MAKING SOBREDOSIS DE fútbol

Director de Cine Digital de Fotofilm Deluxe

El CES 2011 da a conocer lo nuevo en gadgets e imagen

ISE 2011 aumenta en número de expositores y visitantes

Tablets y smartphones, los protagonistas del MWC

La televisión, cada vez más nómada y ubicua

El grafeno, un premio Nobel en el lapicero

Los accesorios para la producción en tres dimensiones

Cinematografía digital (2ª parte)

24 trucos de magia por segundo

Cómo funciona un canal 24 horas temático y de pago

PROBAMOS 40 televisor philips 46pfl9705 42 centro multimedia wd tv live hub 44 ORDENADOR PORTÁTIL Macbook air 11 pulgadas 45 PLUGINS BUENA DEPTH CUE V2 Y ADEMÁS...

56 VídeoPopular es miembro de la European Imaging and Sound Association. Premios EISA.

58

04 ACTUALIDAD 14 NOVEDADES 64 AGENDA 66 BANDEJA DE SALIDA

ISSN: 1133-7079 - Depósito legal: B-44.189-82 Edita IDEAS EDITORIALES 3003, SL - C/ Tarragona, 84-90, 1º 8ª - 08015 Barcelona - 93 423 84 04 Editores: Jorge MARTÍN (publicidad@ideaseditoriales.com) y Artur PAZ - Redacción: info@ videopopular.es - José Óscar PLAZA, Celia LÓPEZ e Irene BALLESTAR - Publicidad: comercial@ ideaseditoriales.com - Santiago FERRER y Jorge MARTÍN - Suscripción: info@ideaseditoriales.com - Enric NAVARRO - Colaboradores: Juan PATRÓN, Ramón CUTANDA, Jaume FRESQUET, Juan Antonio GARCÍA, Carlos MEDINA, Verónica PALOMO, Luis Carlos PARDO, Javier PARDOS, Óscar TESTÓN

Imprime IMPRENTA PAGÈS, SA VídeoPopular no se hace responsable de la opinión de sus redactores y colaboradores. Queda prohibida la reproducción total o parcial de los artículos y de las ilustraciones sobre cualquier soporte, salvo autorización por escrito del editor. Reservados todos los derechos de reproducción para todos los países e idiomas. VídeoPopular es una marca registrada.


ACTUALIDAD Dos cámaras Canon, en BBC La BBC ha incluido las cámaras Full HD

Panasonic, con la producción en 3D Programa para impulsar la creación de contenidos

XF300 y XF305 de Canon en

con la cámara AG-3DA1 como parte de

su lista de

un programa europeo de producción

videocámaras

de contenidos. La firma insta a los ci-

homologadas

neastas a desarrollar un cortometraje

para realizar

creativo y se ofrece a comprar aquellos

produccio-

que cumplan con los requisitos esta-

nes en alta definición. Ambas fueron

blecidos en la página web www.panasonic-broadcast.com. La fecha límite

homologadas en junio de 2010 para ser utilizadas en producciones independien-

Panasonic desarrolla una iniciativa

para participar es el próximo 31 de

tes. Ahora, también podrán usarse en

para fomentar la creación de conteni-

marzo. Con esta iniciativa, Panasonic

producciones internas de la cadena bri-

dos en 3D. La compañía adquirirá pro-

busca apoyar e incentivar el uso de la

tánica, que se emitirán a través de sus

ducciones creativas realizadas en 3D

tecnología 3D en proyectos creativos.

diferentes canales en alta definición.

LG, la marca que más crece LG Electronics fue la firma de electróni-

PRISA TV vende su sede

Carlos de Vega es el nuevo director de Comunicación

ca de consumo que más creció durante 2010. La compañía experimentó un

PRISA ha vendido el edificio de Tres

crecimiento de un 22% respecto a 2009,

Cantos (Madrid) en el que desarrolla su

posicionán-

actividad audiovisual a FlaglandSpain,

dose, por

sociedad del fondo WP Carey en Espa-

segundo año

ña, que ha comprado el inmueble por

consecutivo,

80 millones de euros, firmando un con-

como la se-

trato de arrendamiento por 20 años.

gunda marca

Por otro lado, Carlos de Vega se ha

de electrónica de consumo del mer-

convertido recientemente en el nuevo

y CNN+ desde septiembre de 2004. Su

cado. Cambiar sus oficinas a la nueva

director de Comunicación del grupo.

nombramiento forma parte del proce-

sede corporativa y aumentar un 15% la

De Vega ha trabajado como corres-

so de reordenación de la comunicación

plantilla de LG España fueron algunos

ponsal en Estados Unidos de Cuatro

externa e interna del grupo.

de sus movimientos estratégicos.

El videoclub en casa Samsung ha llegado a acuerdos con va-

Canal+ emitirá contenidos de HBO En primavera llega la esperada ‘Juego de Tronos’

rias distribuidoras para crear Samsung Movies, un servi-

car a sus competidores y mantener el

cio de videoclub

nivel de calidad lo más alto posible. En-

que permitirá

tre los contenidos que emitirá destaca

a los usuarios

Juego de Tronos, la serie ambientada en la Edad Media basada en la saga de novelas Canción de hielo y fuego, de George R.R. Martin. Llegará a Canal+ en primavera. A lo largo del año, llegarán también las nuevas temporadas de Boardwalk Empire, True Blood y Hung. Mientras tanto, HBO ultima la miniserie Mildred Pierce y la serie Luck.

de televisión, smartphones, ordenadores portátiles y tablets acceder al mejor cine en cualquier momento

4

y lugar. A través de www.samsungmo-

Canal+ ha firmado un acuerdo con HBO

vies.es, los clientes pueden elegir una

para emitir en primicia todas las series y

película y reproducirla en los dispositi-

las mejores películas del canal de pago

vos durante el período de alquiler.

estadounidense. Canal+ busca desban-


SDI a analรณgico

Analรณgico a SDI

SDI a audio

Audio a SDI

SDI a HDMI

HDMI a SDI

Fibra รณptica

Generador de sincronismos

385โ‚ฌ

385โ‚ฌ

385โ‚ฌ

385โ‚ฌ

385โ‚ฌ

385โ‚ฌ

385โ‚ฌ

229โ‚ฌ

Los conversores 3 Gb/s SD y HD con audio analรณgico y digital mรกs avanzados del mercado. %QPฦ‚IWTCVWGUVWFKQEQPNQUEQPXGTUQTGUOยฝUCXCP\CFQU5รNQEQP NQU/KPK%QPXGTVGTUVGPFTยฝUGPVTCFCUTGFWPFCPVGUCWFKQCPCNรIKEQ [FKIKVCN#'5'$7GPLCEMFGUGNGEEKรPCWVQOยฝVKECFGUGรCNGU 5&*& [ 5&+  )DRU FG VGTEGTC IGPGTCEKรP *C[  HCPVยฝUVKEQU OQFGNQURCTCGNGIKTWPQRCTCECFCVKRQFGEQPXGTUKรP Selecciรณn automรกtica de SD y HD

Tecnologรญa SDI 3 Gb/s .QU /KPK %QPXGTVGTU KPENW[GP NC ร–NVKOC VGEPQNQIร‰C 5&+ FG  )DU RQT VCPVQ GUVยฝ RTGRCTCFQ RCTC NQU HQTOCVQU FG HWVWTQ )5&+ GU EQORNGVCOGPVG EQORCVKDNGEQPVQFQUVWUGSWKRQU5&+CEVWCNGU5&[*& Calidad Broadcast

.QU /KPK %QPXGTVGTU EQPOWVCP CWVQOยฝVKECOGPVG GPVTG VQFQU NQU HQTOCVQU FG 5& [ *& KPENW[GPFQ 2#. 065% K K 2UH 2UHRREQPNCRQUKDKNKFCFFGCรCFKTPWGXQU HQTOCVQUXKC75$

.QU/KPK%QPXGTVGTUGUVยฝPHCDTKECFQUDCLQNQUOยฝUGUVTKEVQUGUVยฝPFCTGU DTQCFECUV 2QFTยฝU WVKNK\CT OC[QTGU FKUVCPEKCU FG ECDNGCFQ ITCEKCU C UW DCLQ PKXGN FG LKVVGT [ C NC Oร‰PKOC UGรCN FG TWKFQ FG UWU ฦ‚NVTQU CPCNรIKEQU.QU/KPK%QPXGTVGTUUQPNQURTKOGTQUFGNOGTECFQSWG KPENW[GP5&+FG)DUGPVQFQUUWUOQFGNQU

Entradas SDI redundantes

Ocho increรญbles modelos

.CGPVTCFC5&+FGNQU/KPK%QPXGTVGTUGUTGFWPFCPVG5WDWENGFG UCNKFC5&+VGRGTOKVGKPVGTECNCTGN/KPK%QPXGTVGTGPVTGGSWKRQU5&+ %QPGEVCWPUGIWPFQECDNGCNCGPVTCFCTGFWPFCPVG[UKGNRTKOGTQ HCNNC GN /KPK %QPXGTVGT EQPOWVCTยฝ KPOGFKCVCOGPVG C NC UGIWPFC GPVTCFCOW[ร–VKNRCTCGXGPVQUGPFKTGEVQ

.QU/KPK%QPXGTVGTKPENW[GPVGEPQNQIKCUSWGPQGPEQPVTCTยฝUGPQVTQU EQPXGTUQTGU5WRTGEKQGUFGVCPUรNQaECFCWPQ'N)GPGTCFQT FGUKPETQPKUOQUVCPUรNQEWGUVCa

Audio analรณgico y digital AES/EBU profesional. .QU/KPK%QPXGTVGTUWUCPLCEMUGUVร…TGQGUVยฝPFCTFGWPFGRWNICFC RCTC NCU EQPGZKQPGU FG CWFKQ RTQHGUKQPCN DCNCPEGCFQ CPCNรIKEQ Q FKIKVCN #'5'$7 # FKHGTGPEKC FG QVTQU EQPXGTUQTGU PQ PGEGUKVCU ECTQUECDNGUCOGFKFC *Los precios no incluyen IVA

Mini Converters

385โ‚ฌ*

Sync Generator

229โ‚ฌ*

Mรกs Informaciรณn en www.blackmagic-design.com


ACTUALIDAD Gestión comercial pionera RTVCYL, la televisión autonómica de

Telson termina ‘También la lluvia’ La empresa conforma y corrige el color de la cinta

Castilla y León, ha adquirido COVI, el

Film Master de Digital Vision, distribui-

software de Activa Multimèdia de gestión comercial que contro-

do en España por Trigital. El sistema,

lará la publicidad en los

diseñado para el acabado de produc-

canales La Siete (cyl7) y

ciones audiovisuales, ofrece una solu-

La Ocho (cyl8). COVI per-

ción completa de Digital Intermediate (DI) con corrección de color primaria

mite gestionar los procesos comerciales de un

La compañía de servicios audiovisua-

y secundaria, efectos y conformado,

canal de televisión, desde la contratación

les Telson ha realizado el conformado

desde SD hasta 4K. También la lluvia,

de un anuncio hasta su cobro y emisión.

y la corrección de color de También la

interpretada por Luis Tosar y Gael Gar-

Es el único software en el mercado de

lluvia, la última película de Icíar Bo-

cía Bernal, ha sido elegida para repre-

sus categorías y busca convertirse en un

llaín. Telson ha utilizado el Nucoda

sentar a España en los Oscar.

estándar para las autonómicas.

Ovide equipa la BWR Ovide, la empresa especializada en

Sony renueva los equipos de TVE Actualizará los departamentos de la cadena

alquiler de material audiovisual, ha suministrado seis ópticas estabilizadoras

Después de adquirir tres unidades mó-

HDTV Canon HJ15ex8.5B KRSE-V, va-

viles mediante concurso público, Te-

rias cámaras Panasonic de formato P2 y

levisión Española ha adjudicado a Sony

otros accesorios

Profesional la renovación de los equipos

a la organización

de diferentes departamentos para conti-

de la Barcelona

nuar con su proceso de transición a la alta

World Race y a

definición. La compañía japonesa actuali-

TVE. Las ópticas

zará los equipos de los departamentos de

tres años, Sony suministrará más de 200

de Canon están

informativos, documentales, centros de

Camcorder XDCAM-HD y XDCAM-EX,

equipadas con el

producción y centros territoriales, reno-

más de 100 Deck PDW-F1600, 150 Drive

sistema estabilizador VAP-IS, ideales

vando los equipos de captación Betacam

PDW-U1, 25 editores de campo PDW-

para rodajes en exteriores. La regata,

SX y Betacam IMX. Durante los próximos

HR1 y 30 Camcorder de mano.

que empezó el pasado 31 de diciembre, será retransmitida a diario.

El líder en pantallas

TV3alacarta, en los Sharp Quattron

Los televisores ofrecerán los contenidos de la cadena

La compañía taiwanesa Chimei Innolux

6

se convirtió en

Televisió de Catalunya ha llegado a un

2010 en el primer

acuerdo con Sharp por el cual los te-

fabricante del

levisores Quattron con función Aquos

mundo de pan-

Net+ de la marca podrán reproducir

tallas planas de

todos los contenidos disponibles de

pequeño y mediano

TV3alacarta. En el portal web de la

tamaño, las de menos de 10’’ de ancho.

cadena autonómica los usuarios pue-

La firma, cuyos principales clientes son

den ver en directo la programación o

los fabricantes chinos de televisores,

volver a ver los programas ya emitidos,

aumentó su producción de pantallas

tales como informativos, magazines o

tráfico o la bolsa; y acceder a los con-

con la tecnología de diodo orgánico de

series. A través de sus widgets, Aquos

tenidos de páginas web como Myalbum

emisión de luz matriz activa (AMOLED)

Net+ permite también obtener infor-

o Dailymotion. Todo ello con la mejor

durante el año pasado.

mación de servicios como el tiempo, el

calidad de imagen y en formato 3D.


II Encuentro anual de FAPAE

Al acto asistió González-Sinde, la ministra de Cultura

Auge de los plasma

segundo encuentro anual del colectivo. En la velada estuvo presente la ministra de Cultura, Ángeles González-Sinde, quien defendió el papel del sector y la importancia de mantener la independencia de los creadores para que avan-

Durante 2009 y el primer semestre

ce la cultura. También intervinieron el

de 2010, la venta de televisores de

presidente de FAPAE, Pedro Pérez; el

plasma experimentó un aumento de

La Federación de Asociaciones de

director de la Academia de Cine, Eduar-

forma constante y progresiva, pese

Productores Audiovisuales de España

do Campoy; y el presidente de EGEDA,

a la situación de crisis económica a

(FAPAE) celebró el 16 de diciembre el

Enrique Cerezo, entre otros.

nivel mundial. El auge de la tecnología 3D es uno de los factores que explican este hecho.

Uveauve lleva el Sub-17 a Ruanda La compañía retransmitirá los partidos de la Copa

Primeras etiquetas Los televisores

El gobierno de Ruanda ha elegido a la

Quattron de

empresa española de producciones

Sharp serán los

Uveauve para retransmitir los parti-

primeros en llevar

dos del campeonato Sub-17 de la FIFA.

la nueva etiqueta

Los equipos de Costa de Marfil, Egipto,

energética de la

Gambia, Mali, Ruanda, Senegal, Burki-

UE, que informa

na Faso y Congo se enfrentarán para

sobre el consumo

clasificarse para la Copa Mundial Sub-

de los productos. La etiqueta podía

17 de la FIFA México 2011. Ruanda, an-

partidos de la competición. Uveproduc-

colocarse desde el pasado 20 de

fitrión del campeonato, ha contratado a

tion, su departamento de producción,

diciembre. A partir del 30 de no-

la compañía de producciones Uveauve

ha conseguido que el evento pueda

viembre de este año, llevarla será

para llevar a sus ciudadanos todos los

verse en ciento cincuenta países.

obligatorio.

Panasonic se une a dos proyectos 3D

Lanzado el Hispasat 1E

Presidirá el Comité Asiático de la International 3D Society Panasonic se ha unido a dos nuevos proyectos de carácter internacional con el propósito de posicionarse entre las empresas líderes del mercado en

Hispasat 1E, el nuevo satélite de

tecnología 3D. La compañía colabora-

comunicaciones del operador espa-

rá en el Centro de innovación 3D de la

ñol, se encuentra ya en el espacio,

Costa Oeste en Norteamérica y presi-

lanzado por el Ariane 5 ECA desde

dirá el Comité Asiático de la Internatio-

la Guayana Francesa. Con la puesta

nal 3D Society. Asimismo, la firma ha

en marcha de esta operación, el

incorporado en su Panasonic Hollywo-

trechar lazos con los estudios de cine,

grupo ampliará su capacidad en

od Laboratory, activo desde hace más

las emisoras y la industria del entre-

Europa, América y África, comple-

de quince años, un nuevo centro de

tenimiento y fomentar la creación de

tando su oferta de servicios.

innovación 3D. Con ello, pretende es-

contenidos 3D de alta calidad.

7


ACTUALIDAD La UEFA regresa a Digital+ Digital + volverá a emitir en exclusiva la

Ono y Cisco, con la nueva televisión Ofrecerán contenidos y servicios de vídeo

Champions League a partir de agosto de

ONO utilizará el modelo Cisco 8685DVB

2012 y por un periodo

HD-DVR Media Server, que le permitirá

de tres temporadas.

ofrecer una amplia variedad de conte-

El acuerdo al que la

nidos de entretenimiento y servicios de

plataforma ha llega-

vídeo, favoreciendo además la conver-

do con la UEFA fija la

gencia entre la televisión tradicional y

emisión en exclu-

la televisión por Internet. El dispositivo de Cisco permitirá a los usuarios hacer

siva de todos los partidos excepto uno del martes, que será ofrecido por un

ONO, la compañía de comunicación por

búsquedas en tiempo real y acceder a

operador en abierto. Por primera vez, la

banda ancha, ha elegido a Cisco como

contenidos a través de la televisión tra-

Champions podrá verse en España de

proveedor para implantar en nuestro

dicional, la televisión bajo demanda y el

forma simultánea y en alta definición.

país la televisión de nueva generación.

vídeo a través de banda ancha.

Las claves de la producción

Una grúa para el mejor vídeo

José Martínez Abadía y Federico Fernández Díez presentan el Manual del pro-

Kietacam y Más que Vídeo organizan un concurso online

ductor audiovisual, una guía completa dirigida a

Kietacam y Más que Vídeo han orga-

estudiantes y profesiona-

nizado un concurso para todos aque-

les del mundo audiovi-

llos que estén en posesión de una de

sual, que pretende ser

las grúas Kietacam-G compradas en

de ayuda para iniciados

Más que Vídeo o Kietacam. Se trata de

en el tema y trabajadores

publicar en YouTube o Vimeo un vídeo

que busquen reciclarse.

en el que se muestre el funcionamien-

Describe los procesos

to del producto. La duración y el tema

llevará una XliderCam Pro o una Kie-

de creación, realización, difusión y

son libres; el jurado, los propios par-

tacam 3 Pro. Los participantes comu-

explotación de los productos audiovi-

ticipantes. Cada uno puede enviar sus

nicarán a través de Facebook que han

suales y multimedia, además de ofrecer

votaciones a masquevideo@masquevi-

colgado su vídeo. La fecha límite para

información específica para guionistas,

deo.com. El que obtenga más votos se

presentarlos es el 28 de febrero.

periodistas, actores y espectadores.

Telemadrid ya ofrece HD Telemadrid ha empezado a producir

Overon, la única productora en Túnez La empresa ofreció sus servicios a más de 40 canales

contenidos en alta definición, convirtiéndose en la

La productora Overon ha sido la única

primera televisión

empresa internacional que ha ofrecido

pública madrileña

servicios de directo y de envío de imá-

en hacerlo. Tras

genes a todo el mundo con motivo del

renovar su estudio

cambio político en Túnez. Además de

2, el canal ofrecerá

ella, tan sólo la agencia de noticias tur-

cada día al menos

ca IHA ha cubierto las revueltas en el

cuatro horas de programación en alta

país africano y la marcha del presiden-

ta de ellos se concentraron el día 17,

definición. Los programas El Círculo,

te Ben Alí. Entre el 14 y el 24 de enero,

cuando Ben Alí abandonó el país. En

Alto y Claro, Madrid Directo y Hora

Overon, en colaboración con DJV, ha

España, ha proporcionado contenidos

Deportiva se emitirán en este formato,

realizado 350 servicios para más de 40

a Antena 3, Telecinco, TVE, laSexta,

además de otros espacios no diarios.

canales de diferentes países. Ochen-

TV3, ETB e Intereconomía.

8


‘Juan of the dead’, a finales de 2011

La película se ha rodado con equipos Red Mysterium X

AV Medios ilumina OPC

ciones, esta comedia de terror muestra la capital cubana invadida por una legión de zombies. Juan, el héroe de la historia, aparece para eliminar, por un módico precio, a los familiares afecta-

Juan of the dead, largometraje escrito y dirigido por el cubano Alejandro Brugués, verá la luz a finales de año. Coproducido por La Zanfoña Produc-

dos. El film se ha rodado durante ocho

AV Medios iluminó la fiesta de 25º

semanas en La Habana (Cuba) con dos

aniversario de la Organización

Red Mysterium X con ópticas Ultrapri-

Profesional de Congresos de Madrid

me, suministradas por Ovide. El repar-

(OPC), celebrada el 25 de noviem-

to cuenta con Alexis Díaz de Villegas,

bre. La empresa montó una pantalla

que encarna al protagonista; Andros

de 3x2 metros con un proyector de

Perugorría y Andrea Duro, entre otros.

8.000 lúmenes. Se encargó también del sonido y la microfonía de la sala.

Legalidad en emisiones futbolísticas Una abogada defiende el uso de tarjetas extranjeras

Siete años de HD española

Una abogada general del Tribunal de Justicia de la UE, Juliane Kokott, ha señalado que los acuerdos de exclusividad territorial para la retransmisión de partidos de fútbol en directo vulneran la libre

Se cumplen siete años desde que

prestación de servicios, resultando in-

Mediapro emitiera la primera

compatibles con el Derecho comunitario.

producción en alta definición en Es-

Así lo ha defendido la letrada, tras varios

zar tarjetas descodificadoras extranjeras

paña. Fue un partido de la Copa del

litigios iniciados por la Football Associa-

para retransmitir encuentros en el país

Rey entre el Real Madrid y el Eibar.

tion Premier League (FAPL), dedicada

es ilegal y ha iniciado procedimientos

Emitido en enero de 2004, supuso el

a comercializar los derechos de la liga

penales contra bares y pubs que utilicen

inicio de las producciones regulares

inglesa. La organización indica que utili-

tarjetas de otro país para tal fin.

de partidos en este formato.

Europa apuesta por la ficción española

Digital+, cuando quieras

Compra más de la mitad de los contenidos exportados El 60% de la producción audiovisual española que se exporta es comprada en los mercados europeos, según informa la Federación de Asociaciones de Pro-

Digital+ lanza Digital+ a la carta, un

ductores Audiovisuales de España (FA-

servicio que permitirá a los usuarios

PAE). Su directora de Relaciones Inter-

descargar, guardar y reproducir con-

nacionales, María José Vadillo, señala

tenidos en cualquier momento. Para

que el sector audiovisual español está

hecho son Los Serrano, que triunfaron

acceder al servicio, basta con tener

viviendo un buen momento y que “la

con su adaptación italiana, y Un paso

conexión a Internet de banda ancha y

producción realizada en España está

adelante, que tuvo su adaptación en Francia, el principal receptor europeo de las ficciones españolas.

conectar el router al descodificador

más reconocida internacionalmente que en el país”. Dos ejemplos de este

iPlus con un cable Ethernet.

9


ACTUALIDAD Nuevas soluciones de edición Avid ha creado dos nuevas solucio-

Lo último en sonido e iluminación AFIAL celebra la quinta edición de su convención

nes de edición de vídeo doméstico: Avid Studio y la versión 15 de Pinnacle Studio. El nuevo software Avid Studio ofrece biblioteca de medios integrada, un potente editor de contenidos, una colección de plug-ins profesionales, etc. Por su parte, la nueva versión de Pinnacle Studio incorpora función de archivado de recuperación, soporta más formatos y se ha optimizado para procesadores Intel.

Distribución audiovisual

AFIAL, la Asociación de Fabricantes

Uno de los productos que atra-

de Importadores de Audio Profesional

jo a más curiosos fue la pizarra táctil

e Iluminación Espectacular, celebró

Greenboard, que integra pantalla LCD

La segunda fase

entre el 7 y el 9 de febrero la quinta

de 65”, un proyector, equipo de músi-

del proyecto

edición del Salón del Sonido, la Ilumi-

ca e interesantes funciones, como la

RAUDOS (Red

nación e Integración Audiovisual. El

Multi-touch, que permite escribir a dos

Interactiva Multiplataforma de Conte-

escenario elegido para esta 5ª Con-

personas al mismo tiempo.

nidos Audiovisuales), desarrollada por

vención AFIAL fue el Palacio de Cristal

En el estand de Biefec, la empresa

un consorcio de universidades, centros

de la Casa de Campo de Madrid, que

especializada en la realización y venta

tecnológicos y empresas, incluye entre

acogió a más de 50 expositores.

de productos para efectos especiales

La empresa especializada en sopor-

expuso sus lanzadores de confeti, má-

de un motor de búsqueda de vídeos

te de audio y vídeo profesional Roland

quinas de humo, de nieve y espuma, de

en Internet. Los usuarios pueden

Systems Group estuvo presente con su

burbujas, etc. Adagio.pro, que contó

ahora subir sus propios contenidos no

recién estrenado VR-5, un dispositivo

con el cantante El Pescao para ameni-

profesionales y compartirlos de forma

todo en uno que integra switcher de ví-

zar la jornada, nos mostró los produc-

gratuita con el resto de miembros de la

deo, mezclador de audio, reproducción

tos más destacados de las marcas que

plataforma, con los que también pueden

de vídeo, grabador, monitor de previ-

distribuye, como los sistemas de mi-

interrelacionarse a través de la nueva

sualización y salida para streaming en

crófono inalámbrico digitales HD-V de

red social que se ha creado.

una unidad compacta.

Line 6; el procesador digital 4 entradas

sus principales novedades la creación

/ 8 salidas Ti1048 de MC2 Audio, o el

PANTALLAS LED

Tampoco faltaron a la cita empresas

productos, entre los que destacan las

como Rosco Ibérica, Lexon, Microfusa

pantallas LED tanto flexibles en tela

o Altair, que durante tres días mostra-

Tubemogul refleja

tipo red como de aluminio de alta re-

ron los productos más novedosos de

que los contenidos

solución y bajo peso. También mostró

los sectores de sonido profesional, ilu-

audiovisuales de

sus cabezas móviles LED spot, wash y

minación de espectáculos, soluciones

los diarios online

gama PRO, así como equipos láser.

escénicas, tecnologías audiovisuales e

Más vídeo en diarios online Un reciente estudio de Brightcove y

aumentaron en

10

sistema Elements de HK Audio.

Jaleo acudió al salón con sus últimos

Silence Electroacústica expuso las

un 147% durante

últimas novedades de sus marcas re-

el año pasado,

presentadas, entre las que no podían

mientras que los canales de televisión

faltar la nueva pantalla LED 3D de Lux

lideraron el total de minutos visionados.

Evolution LED Tech; los proyectores de

El Online Video & the Media Industry

Stark, ni los amplificadores digitales,

Quarterly Research Report analizó una

las cajas acústicas de la serie CX y los

muestra de 2.000 sitios web de publica-

procesadores FF204 de Noise Control

ciones diarias y no diarias.

Audio.

integración audiovisual.


PRIMER PLANO Juan José Carretero Pérez, director de Cine Digital de Fotofilm Deluxe Por Carlos MEDINA, profesor de Imagen en el IES Puerta Bonita

BIO ¿Qué es el cine digital?

Para Deluxe, por ejemplo, era el paso

El director

Es el uso de equipos electrónicos (digi-

lógico, ya que el mercado de la distribu-

de Cine Di-

tales) en la producción, distribución y ex-

ción es una parte muy importante del ne-

gital de Fo-

hibición de una obra audiovisual, ya sea

gocio y teníamos que estar preparados.

tofilm

un largometraje, documental, etc., en vez

Comenzamos en 2007 y ahora somos

luxe España

del tradicional de 35 mm (cámaras y pro-

líderes en procesado analógico y digi-

se formó en

yectores) junto con material fotoquímico.

tal. Ha sido un proceso largo y duro, con

el

Institu-

muchas horas de I+D, muchas versiones

to

Oficial

¿Estamos preparados para producir y

beta… pero, al final, creo que tenemos un

RTVE. En sus más de 23 años de

disfrutar de imágenes digitales en las

equipo técnico y humano insuperable, lo

experiencia en el sector audiovisual,

salas de cine?

que nos permite contar con la confianza

ha trabajado en RNE, TVE, Atanor,

Sí. Llevamos haciéndolo más de 10 años,

de distribuidoras como Sony, Fox, Para-

Telson y Fotofilm Deluxe. En los úl-

primero en procesos de postproducción

mount o Universal, entre otras.

timos 15 años, ha procesado más de

digital y en los últimos años generando

300 películas.

materiales en soporte digital para su

¿Es el DCI el término de moda? ¿En qué

exhibición en salas comerciales dotadas

consiste realmente?

de esta tecnología. Nosotros hicimos el

Yo no hablaría de moda. DCI, que viene

¿En qué situación se encuentra el sec-

primer tráiler en este formato a finales

de Digital Cinema Initiatives, LLC, es una

tor de exhibición ante la llegada y la im-

de 2007, y el estreno de la primera pelí-

joint venture creada entre las grandes majors (Sony, Paramount, Universal, Disney, Fox y Warner Bros) para desarrollar una normativa para la creación, duplicado y exhibición de películas por medios digitales. Esta normativa, que ahora va por la versión 1.2, nos obliga a fabricantes de equipos, laboratorios y exhibidores a seguir una serie de pautas en todo lo referente a cine digital.

plantación del cine digital?

cula española, El patio de mi cárcel, en septiembre de 2008. Desde entonces, el cine digital ha ido creciendo de forma exponencial, y hoy por hoy, la gran mayoría de las producciones cuentan con copias de distribución tanto digitales como fotoquímicas para exhibición en cines. En 2001, Kodak concluye un seminario afirmando que “el formato digital ofrece

12

De-

Está haciendo un esfuerzo increíble por implementar esta tecnología. Sirva como referencia que hemos pasado de 35 salas digitales en 2008 a 835 a finales de 2010. A las salas de cine de toda la vida llegaban sacos con enormes latas de película de celuloide. ¿Qué llega ahora a las cabinas de proyección? Llega una caja, de un kilo de peso, con un

menor calidad, es más caro y no cuenta

¿Se está imponiendo un criterio econó-

disco duro que contiene la película, los

con las mismas garantías de cara al fu-

mico en la distribución digital del cine

tráilers, etc. Y por email, el cine recibe los

turo que la película fotográfica de toda

que pone en peligro la calidad y la con-

ficheros para desencriptar la película.

la vida”. ¿Qué ha sucedido para que en

servación de las películas?

2011 el cine digital sea realidad?

El cine digital no pone en peligro la cali-

Si dos de los grandes saltos evolutivos

Primero, la aparición de una norma que

dad a la hora de proyectar una película.

del cine han sido el sonido y el techni-

unificaba criterios. Segundo, la aparición

En cuanto a la conservación, no va a ser

color... ¿el cine digital se merece un ca-

de sistemas de proyección con calidad

un camino de rosas. La película tradicio-

lificativo de este calibre o le dejaría ese

suficiente para poder competir con la

nal tiene una vida de, al menos, 100 años,

laurel al cine estereoscópico?

película positiva. Tercero, el 3D. Y cuarto,

pero no sabemos cuánto dura un soporte

El cine estereoscópico no es nuevo, es

el abaratamiento de los costes de imple-

digital, ni qué tipo de soporte habrá en

nueva la forma de exhibir este tipo de

mentación de esta tecnología.

100 años. Posiblemente tendremos que

producciones, gracias en parte a la tec-

ir migrando las películas de un soporte

nología de los proyectores digitales. Por

¿Cómo se han adaptado los laborato-

a otro según evolucionen, lo cual no es

tanto, le daría el laurel al cine digital

rios cinematográficos convencionales

un gran problema porque los costes de

como tal, incluidas todas sus formas de

a los cambios producidos por la llegada

almacenamiento digital son mucho más

proyección (2K, 4K, 3D, etc), y lo compa-

del cine digital?

bajos que los de soporte fotoquímico.

raría con la aparición del color.


NOVEDADES Ligero y multifuncional lacie slim blu-ray

Compactas y con más opciones videocámaras y cámaras de fotos panasonic Panasonic ha presentado recientemente las últimas incorporaciones a su línea de videocámaras y a la serie Lumix de cámaras de fotos. De entre todos los productos, destacan los nuevos modelos de la serie de cámaras de

LaCie Slim Blu-ray es un nuevo sistema

vídeo 3MOS, la HDC-TM900, la HDC-

de almacenamiento óptico de gran ca-

HS900 y la HDC-SD900, que utilizan el

pacidad que permite reproducir, grabar

mismo sistema de alta calidad de las

y regrabar vídeo en alta definición. Se

cámaras profesionales. Permiten gra-

por cinco modelos: HDC-SD90, HDC-

alimenta a través del ordenador y pue-

bar imágenes en 3D de forma profesio-

TM80, HDC-HS80, HDC-SD80 y HDC-

de almacenar hasta 50 GB de datos.

nal colocando el complemento óptico

SD40. Los cuatro primeros incorporan

www.lacie.com

3D adicional (VW-CLT1), que captura

el nuevo estabilizador óptico O.I.S.

la visión del ojo izquierdo simultánea-

híbrido, que proporciona imágenes

mente a la del ojo derecho a través de

enfocadas de manera automática. La

su óptica binocular.

HDC-SD90 permite grabar imágenes

Reproducción de calidad divx plus hd Los dispositivos DivX

La firma ha lanzado también una

en 3D con el complemento VW-CLT1.

nueva gama de videocámaras compac-

Mencionar también la videocámara hí-

tas de alta definición, la 1MOS, formada

brida SDR-H100, con zoom óptico de 70x y gran angular de 33 mm.

Plus HD permiten

En cuanto a la línea Lumix de cáma-

reproducir archivos en formato DivX (.avi

ras de fotos, algunos modelos permi-

y .divx) y DivX Plus

ten grabar vídeo en la oscuridad sin ne-

(.mkv) con la mejor

cesidad de flash. Las hay sumergibles,

calidad de ima-

ultraresistentes y capaces de grabar

gen. La certificación se encuentra en

en Full HD. Otras incorporan la opción

reproductores Blu-ray, televisores HD,

de Vídeo Dividido, permitiendo eliminar

descodificadores TDT y dispositivos de

al momento las partes no deseadas.

almacenamiento multimedia.

902 15 30 60 | www.panasonic.es

www.divx.com/es

Imágenes más reales jvc everio gs-td1

De la web, al televisor iomega tv con boxee

JVC amplía su serie de videocámaras Everio HD con la nueva GS-TD1, la

Iomega prepara el lanzamiento de Iomega Tv con

primera cámara de consumo capaz de

Boxee, un dispositivo multimedia en red que permite

grabar en Real 3D Full HD. Gracias a

llevar la web al televisor, almacenando todo tipo de

sus dos bloques ópticos, a sus lentes

archivos. Puede realizar descargas directas de conte-

idénticas 3D HD GT y a sus dos sen-

nido en alta definición al televisor o conectar con los

sores CMOS retroiluminados de 3,32

amigos en redes sociales como Facebook o Twitter.

megapíxeles, puede capturar imágenes

Cuenta con conectividad inalámbrica integrada y has-

tridimensionales de manera real.

ta 2 TB de almacenamiento incorporado para guardar

902 39 39 29 | http://jsp.jvc-europe.com

vídeos, fotos y música. El dispositivo almacena y reproduce todo tipo de archivos desde la web mediante una biblioteca de aplicaciones populares, medios de difusión y cadenas por cable, convirtiendo el televisor en un auténtico centro de entretenimiento para toda la familia. http://go.iomega.com/es

14


Proyecciones en cualquier parte gama de proyectores portátiles de sanyo

Elegancia en HD Loewe connect led 26 El Connect Led 26 es el último modelo de

Sanyo, la empre-

televisor de Loewe, un producto que combi-

sa especializada

na elegancia y diseño con una gran calidad

en

de imagen en Full HD. Su diagonal de 66

electrónica

de consumo, da

cm hace que resulte perfecto en espacios

a

reducidos o como segundo televisor del

conocer

su

proyector móvil,

hogar. Reproduce y sintoniza contenidos en

un

dispositivo

HD y viene con tecnología Ethernet y la fun-

compacto capaz

ción Network Mediaplayer, permitiendo ac-

de ofrecer imá-

ceder a los contenidos almacenados en un

genes de alta ca-

ordenador o en cualquier otro dispositivo

lidad en cualquier lugar. El producto

llantes y un alto nivel de negro. Su

externo. Está equipado con un sintonizador

está disponible en varios modelos: el

sistema de refrigeración y elimina-

híbrido capaz de recibir la señal analógica

PLC-XK2200, que proporciona una lu-

ción de partículas de polvo garantiza

tradicional y la señal de TDT (DVB-T/C),

minosidad de 2.200 ANSI lúmenes; el

una larga vida útil y una alta calidad

ampliable en un futuro a DVB-S.

PLC-XK2600, de 2.600 ANSI lúmenes;

de imagen con un reducido coste de

www.loewe-es.com

y el PLC-XK3010, con 3.000 ANSI lú-

mantenimiento.

menes. Ofrecen una resolución XGA

Su instalación es sencilla y, en si-

en formato 4:3, pudiendo realizar pre-

tuaciones en las que el proyector no

sentaciones de 40 a 300 pulgadas de

se ajusta a la pantalla, la corrección

imagen en diagonal, y presentan una

automática keystone realiza los ajus-

alta relación de contraste de 2.000:1,

tes pertinentes.

generando imágenes en colores bri-

93 719 14 05 | www.sanyo.com

Entretenimiento interactivo

BeoVision 10 amplía su familia

playstation ngp

Televisor beovision 10 de 32”

Sony ha presentado recientemente el nuevo sistema portátil de próxima generación para PlayStation, que saldrá al mercado a finales de 2011. Su nombre provisional es NGP y, gracias a su conectividad a redes Wi-Fi y 3G, junto con di-

Bang & Olufsen lanza una nueva ver-

periférica basada en LEDs, conectivi-

versas aplicaciones, pondrá a disposición

sión de los televisores BeoVision 10.

dad Master Link y un módulo DVB-

del usuario la posibilidad de encontrar,

Se trata del modelo de 32 pulgadas,

HD. Está dotado de un sistema de

conectar, descubrir, compartir y jugar con

que completa la gama formada por

altavoces de dos vías que ofrece una

amigos, independientemente del lugar

los televisores de 40 y 46”. Utiliza el

gran calidad de sonido. Además, si se

en el que se encuentren. NGP tiene una

mismo chasis que las versiones an-

desea mejorar o se quiere aumentar

pantalla multi-táctil de 5” e incorpora

teriores del producto, con un tamaño

los graves, es posible conectar al te-

dos cámaras, sensores de movimiento y

más pequeño. Tiene una pantalla full-

levisor dos altavoces adicionales y un

brújula electrónica.

HD con tecnología de retroiluminación

subwoofer. www.bang-olufsen.es

91 585 85 85 | http://es.playstation.com/

15


NOVEDADES Enseñanza interactiva proyectores acer

El televisor se convierte en Smart TV LG St600 LG Electronics, la compañía dedicada a la fabricación de aparatos de electrónica de consumo, presenta un dispositivo que permite transformar de forma sencilla un televisor convencional en un sistema Smart TV. El ST600 se puede conectar a Internet, permitiendo a los usuarios navegar libremente,

Acer completa su serie de productos

acceder a vídeos, a música y a una amplia variedad de ser-

para el ámbito educativo con una gama

vicios en la red. Conectando el dispositivo al televisor, es posi-

de proyectores especialmente diseña-

ble acceder a una gran variedad de contenidos premium ofrecida por operadores

dos para el aula. Los modelos S5200 y

globales, además de disfrutar de una amplia oferta de programación y películas.

S5201 ofrecen imágenes nítidas a un

El ST600 es compatible con las aplicaciones LG diseñadas para televisión, que

metro de distancia. El modelo U5200, a

van desde cursos de idiomas a juegos y entretenimiento. 902 500 234 | www.lge.es

13 cm. 902 20 23 23 | www.acer.es

Todo desde el televisor cisco videoscape

Acceso a Twitter desde el sofá philips net tv

Cisco, compañía dedicada a las redes para

Net TV de Philips, la aplicación que

cios, permitiendo también el acceso a

Internet, presenta

hace posible el acceso a Internet a

Twitter sin necesidad de utilizar ningún

Cisco Videoscape,

través del televisor, amplía sus servi-

ordenador para ello. Net TV ofrece va-

una plataforma de

rias aplicaciones de ocio y contenido

televisión global con

en toda Europa. En España, cuenta con

la que los proveedo-

varios proveedores de contenidos loca-

res de servicios podrán ofrecer a sus

les, como TV3. Se prevé que a lo lar-

clientes todos los contenidos de la

go del año los servicios de contenidos

televisión tradicional y online, así como

en español vayan en aumento. NET TV

la posibilidad de interactuar con dife-

está disponible en los televisores LED

rentes redes sociales y aplicaciones de

de Philips de las series Ambilight 7000,

comunicación. 902 00 27 12 | www.cisco.es

8000, 9000 y en el Ambilight Cinema 21:9 Platinum. 900 800 655 | www.philips.es

Deslizamiento perfecto logitech wireless mouse Logitech presenta un ratón especial-

Para fotógrafos aficionados serie de trípodes Manfrotto compact

mente diseñado

16

para utilizarse

Manfrotto amplía su oferta de soportes para cámaras de foto y vídeo con

en superficies

la serie Compact, diseñada especialmente para aficionados. La gama

blandas, somo el

consta de cuatro productos fabricados en aluminio y de fácil trans-

sofá o la cama,

porte. El trípode MKC3-P02 está pensado para tomar fotografías de

además de en escritorios. Se trata del

forma precisa, mientras que los MKC3-H01 y MKC3-H02 pueden

Wireless Mouse M515, que presenta

utilizarse para realizar fotos y vídeos. Todos pueden colocarse a

una carcasa sellada que facilita su

diferentes alturas, desde los 44 cm hasta los 160 cm. Comple-

desplazamiento sobre tela, además

tando la serie está el monopie MMC3-02, que permite también

de impedir que el polvo afecte a sus

hacer fotos y vídeos. Presenta una unión para cámara universal

componentes.

y asa de seguridad. Práctico y compacto, resulta ideal para

93 419 11 40 | www.logitech.com/es-es

viajar. 902 40 20 60 | www.cimatfoto.com


Internet, también desde el televisor toshiba places

Cámaras para todos videocámaras canon Canon ha presentado su nueva gama de

A partir del segundo trimestre de

de ofrecer servicios online por televi-

productos, que incluye cinco cámaras

2011, Toshiba, la compañía japonesa

sión, adaptándola a la comodidad del

compactas y diez videocámaras con las

dedicada a la fabricación de apara-

usuario, como si estuviera viendo la

que obtener imágenes de gran calidad sin

tos electrónicos, ofrecerá conexiones

televisión normalmente”. “Ofrece una

renunciar a la mejor relación calidad-pre-

web y acceso directo a Internet en

oferta única y atractiva en el mercado

cio. La firma mejora la oferta de videocá-

televisores a partir de 32 pulgadas.

con la interfaz común para todos los

maras profesionales y de las especialmen-

Será a través de su portal Toshiba

dispositivos y el fácil intercambio de

te pensadas para aficionados. De la gama

Places, una plataforma en la que

contenidos”, añade.

profesional destaca la XA10, un modelo

los usuarios podrán acceder a todo

A Toshiba Places puede accederse

tipo de contenidos, servicios y apli-

desde portátiles, televisores o tablets.

de imagen y que cuenta con funciones de

caciones, dándoles la oportunidad

La interfaz, común a todos los dispo-

audio profesional. Para los aficionados,

de descargar archivos, comprar o

sitivos, está optimizada para cada uno

Canon lanza varios modelos de las series

compartir los diferentes materiales.

de ellos. Desde la plataforma, se pue-

Legria y Powershot, capaces de grabar en

El director de Marketing de produc-

de comprar música o películas, acce-

Full HD. 901 301 301 | www.canon.es

tos audiovisuales de Toshiba Euro-

der a una gran variedad de servicios

pa, Sascha Lange, destaca que “con

e incluso crear una red social privada

Toshiba Places rediseñamos la forma

propia. 902 122 121 | www.toshiba.es

compacto que ofrece una gran calidad

Diseño y flexibilidad metz caleo 47 led 100 twin r

Codificar vídeos a gran velocidad elgato turbo.264 hd

Caleo es la nueva serie de televisores de Metz, que combinan los materiales más

Elgato actualiza su anterior

sofisticados con una gran flexibilidad, una

dispositivo de codificación de

estética de vanguardia y tecnología punta.

vídeos, el Turbo.264, con el

Caleo 47 LED Twin R es el primer modelo

Turbo.264 HD, que permite

de la gama, un televisor fabricado en alu-

trabajar con contenido en alta

minio basado en un panel LCD Full HD con

definición. Se trata de un stick

retroalimentación por LEDs, que reduce el

de hardware que, conectado al

consumo de energía en un 40%. De diseño

Mac, codifica los vídeos a gran

intemporal, está dotado de un grabador

velocidad. El proceso se lleva a

personal de vídeo, un disco duro de 500 GB

cabo mediante el procesador del pro-

Los archivos de vídeo transformados

y tomas USB y DVI-I, ofreciendo una gran

pio Turbo.264 HD, por lo que el Mac

pueden verse en Mac, iPad, iPhone,

flexibilidad a nivel operativo.

queda libre para realizar otras tareas.

iPod o Apple TV. www.elgato.com

www.metz.de/es

17


NOVEDADES PRO Transferencias rápidas

Graba, guarda y reproduce

sandisk SDHC extreme uhs-i

r&s iqr

Sandisk lanza su nueva tarjeta de memoria flash, la SDHC

Rohde & Schwarz acaba de lanzar al

Extreme Pro UHS-I. Alcanza

mercado el grabador de datos I/Q digital,

una velocidad de lectura y

el R&S IQR. Gracias a la interfaz desa-

escritura de hasta 45 MB/s,

rrollada por la propia compañía, graba,

mejorando el rendimiento

almacena hasta 1 TB de datos y reprodu-

de la captura de imá-

ce señales digitales de RF sin pérdidas y

genes y transfeririendo

en tiempo real. Resulta de gran utilidad

rápidamente contenidos

en las áreas de broadcasting, telefonía

al ordenador. www.sandisk.com

móvil, industria aeroespacial, defensa y automoción. Combina velocidad, tamaño compacto y resistencia, lo que lo hace

Pizarras bien sujetas

ideal para drive tests en redes de radio-

dimasa neoko

difusión y telefonía móvil. En las medidas en equipos y componentes electrónicos,

entrada y una salida I/Q, cada una para

Dimasa, empresa especializada en

puede utilizarse para suministrar seña-

un máximo de 20 Mmuestras por segun-

distribución de material

les de medida previamente generadas.

do. Diseñado para utilizarse en aplicacio-

audiovisual, da a conocer

Presenta tres unidades de altura y está

nes estacionarias con memoria de disco

Neoko, su nueva línea de

disponible en dos modelos: el R&S IQR20

duro, cuenta con un paquete de memoria

soportes para pizarra.

y el R&S IQR100. El primero ofrece una

con un disco duro de una capacidad de al-

Polivalentes y funcionales,

macenamiento de 1 TB y una velocidad de

resultan especialmente

transmisión de datos que puede alcanzar

útiles en aulas de educa-

los 80 MB/s. El modelo R&S IQR100 es

ción y formación, oficinas

más completo que el anterior, con una

o salas de reuniones. Son

entrada y una salida I/Q capaz de manejar

compatibles con todos

100 muestras por segundo. Puede estar

los modelos de pizarra

equipado con un drive de estado sólido de

interactiva.

1 TB con una velocidad de transmisión de datos de hasta 270 MB/s.

93 462 06 04 | www.dimasa.es

www.rohde-schwarz.com

Funcionalidad y velocidad panasonic sdhc clase 10 Panasonic presenta su nueva gama de tarjetas SDHC Clase 10, con capaci-

Para gestionar vídeo de forma eficaz axis camera station 3.40

dad de 8 GB a 16 GB. Alcanzan una velocidad de transferencia de 60 MB/s

Axis anuncia la versión 3.40 de su Camera Station, un sistema de gestión de ví-

y ofrecen un proceso estable de gra-

deo pensado para monitorizar, grabar y visualizar sistemas de videovigilancia

bación de datos, incluso de contenidos

de hasta 50 cámaras por servidor. De uso sencillo, cuenta con aplicaciones que

en 3D y HD. Incorporan un Controlador

permiten la detección automática de cámaras, gestión de eventos y exportación

Súper Interligente para proteger los

de evidencias. Una de sus características destacadas es su alarma antimanipu-

datos guardados.

lación activa, capaz de detectar si las cámaras han sido movidas o cubiertas para

93 481 36 20 | www.panasonic.es

impedir que se capten imágenes o si han dejado de funcionar. Instalado en cualquier ordenador, permite visualizar y controlar los dispositivos desde Internet o la propia red corporativa. Resulta de gran utilidad en establecimientos comerciales, hoteles o colegios. 91 803 54 52 | www.axis.com

18


Luz de última generación

El primer switcher 3D

peli 9430sl y peli 9440 rals

marmitek connect420

Peli Products amplía su familia con

proporcionando ocho horas de brillo

Marmitek lanza el primer conmutador Full

dos nuevos productos: la 9430SL y la

máximo y 15 horas de autonomía total.

HD con soporte 3D, el Connect420. Con él,

9440 RALS. La primera presenta una

Incorpora un mástil que puede girar

es posible conectar hasta cinco dispositi-

serie de LED diseñados con un haz

360º y alargarse hasta los 82 cm. El

vos HDMI al televisor, utilizando solamen-

de 10º. Su luz puede llegar a 183 m,

modelo 9430IR incorpora luz infrarro-

te un cable. Es una solución práctica para

ja para sistemas de visión nocturna.

mantener los cables ordenados y para

Por su parte, el sistema 9440 RALS está diseñado para iluminar áreas re-

dotar de más entradas HDMI al televisor. www.marmitek.com/es

motas. Con diez LED de última generación y una distribución del haz de luz de 120º, puede iluminar eficazmente áreas de gran extensión. 93 467 49 99 | www.peli.com

Cámara lenta y repetición

Información siempre accesible SONY OPSIGATE

newtek 3play Con 3Play, de NewTek, podrá

La organización y distribución de los

realizar producciones

contenidos digitales será una tarea

en alta definición

más sencilla gracias al nuevo sis-

en directo y repetir

tema Opsigate de Sony Profesional.

las mejores jugadas

Gracias a esta solución, los usuarios

en cámara lenta de

registrados pueden acceder a la infor-

manera instantánea, sin interrumpir en

mación digital desde cualquier lugar y

ningún momento la grabación. Compacto

visualizarlos en el navegador web sin

registrar vídeos, se crean automática-

y portátil, se puede conectar a cualquier

necesidad de un software adicional.

mente datos proxy de baja resolución

mezclador, lo que lo hace especialmente

Opsigate mantiene el formato original

que permiten obtener una vista previa

apto para utilizarlo en cualquier lugar.

de los archivos y, en el momento de

del material. 902 12 00 15 | www.sony.net

www.dotmedia.com.es


NOVEDADES PRO Compacta y versátil

La cámara robotizada más pequeña

JVC gy-hm750u prohd

q-ball

JVC Profesional presenta su última

Grau Luminotecnia presenta Q-Ball, un

novedad, la GY-

sistema de cámaras robotizadas broadcast

HM750U ProHD,

diseñado por Camera Corps. Es económico

una vídeocámara

y fácil de montar y poner en marcha, de for-

compacta ideal

ma que una persona puede controlar todo

para rodar en exteriores y en alta

el sistema en directo. Se basa en una cá-

definición todo tipo de contenidos,

mara con base en el bloque de Sony monta-

reduciendo el tiempo de edición.

da en una cabeza caliente en forma de bola

902 39 39 29 | http://jsp.jvc-europe.com

con las lentes integradas. Es el sistema más pequeño de cámara HD/SD Pan y Tilt que existe en el mercado. Cuenta con un zoom óptico de 10x y un movimiento suave de los motores Pan y Tilt, en una esfera sólida de aluminio resistente a las incle-

Compresión más rápida

mencias del tiempo con 15 mm de diámetro. 91 415 86 04 | www.grauluminotecnia.com

sorenson squeeze 7

Lo último para DJs avid torq 2.0 Avid actualiza Torq, la plataforma

para mezclar pistas

Sorenson presenta la última versión

abierta para actuaciones y produccio-

de música aplican-

de su kit de compresión de vídeo, el

nes creativas especialmente pensada

do efectos de audio

Squeeze 7. Lleva integrado el soporte

para DJs profesionales. El Torq 2.0 es

durante el crossfa-

para vídeo de alta definición, el Flash

un software con avanzadas caracterís-

de. Está equipa-

MX para pasar vídeos AVI, MOV y DV a

ticas profesionales, nuevas opciones de

do,

SWF, MPEG1, 2 y 4, QuickTime, Real-

workflow y remezcla y producción en

con workflows

Media y Windows Media. Está optimi-

tiempo real. Cuenta con cuatro platos

abiertos y flexi-

zado para Nvidia Cuda y cuenta con

virtuales con EQ, control de nivel, pre-

bles, base de datos e interfaz actuali-

aceleración por GPU, resultando hasta

escucha para auriculares y fundido cru-

zados, 13 efectos integrados, soporte

tres veces más rápido comprimiendo

zado. Viene con tecnología Traq Morph,

de efectos VST y opciones de grabación

vídeos que el Squeeze 6.

una innovación pendiente de patente

avanzadas. 91 762 86 00 | www.avid.com/es

además,

www.sorensonmedia.com

Edición de vídeo para HD

Mayor almacenamiento para clips

ultrascope 1.5

broadcast pix granite 1.3

Blackmagic Design

20

lanza la versión 1.5 de

Broadcast Pix actualiza la suite para producción en vivo Gra-

Ultrascope, el software

nite. Su versión 1.3 incluye una serie de mejoras para ofrecer

de monitorización para

clips en alta definición y reproducción de animaciones con

creativos y profesiona-

audio estéreo. Gracias a la incorporación del sistema Fluent

les del vídeo. La actua-

Clip Store, el acceso al material se hace de una forma más

lización es compatible

fácil e intuitiva. El nuevo almacenamiento puede guardar

con Mac y PC y permite monitorizar

hasta 120 horas de clips en alta definición (2 TB), soportan-

contenidos en SD, HD y 3 GB/s HD SDI.

do los formatos .mov y .mp4. Al Fluent Clip Store se accede

Muy útil para realizar controles de

desde el panel de control con los nombres de cada archivo

calidad, correcciones de color y otras

mostrados desde los PixButtons. Para importar los clips, se

labores de postproducción.

utilizan las Fluent Watch Folders, quedando ya preparados

www.blackmagic-design.com

para ser reproducidos. 93 405 24 77 | www.broadcastpix.com


La red en el reproductor sonata np30

Últimas existencias productos pro x Daiwa Ibérica anuncia que una serie de

La británica Cambridge Audio lanza un

productos Pro X serán discontinuados, de

nuevo modelo de su gama de reproduc-

forma que sólo estarán disponibles hasta

tores Sonata, el NP30. Tiene un diseño

que terminen las existencias. Entre ellos,

elegante y compacto, mide tan sólo 27

se encuentran diferentes modelos de

cm de ancho y su chasis es comple-

antorchas halógenas, adaptadores para

tamente metálico. Permite escuchar

alimentar antorchas, alimentadores para

música almacenada en el ordenador,

equipos, zapatas multiusos, adaptadores

unidades NAS, equipos conectados a

para cámaras JVC y adaptadores para

una red doméstica o dispositivos digi-

baterias para monitores JVC. Más infor-

tales como iPhone o iPad. Además, el

de forma inmediata a cualquier red do-

mación por teléfono o a través de la página

Sonata NP30 está preparado para acce-

méstica, ya sea por cable Ethernet o por

web de la empresa.

der a un amplio repertorio de servicios

vía inalámbrica. Sus contenidos pueden

96 313 51 36 | www.daiwaiberica.com

disponibles en Internet, como emisoras

gestionarse desde un iPhone, utilizando

de radio o streaming. A través de la

la aplicación específica para ello. Gra-

plataforma UuVol de Cambridge Audio

cias a la tecnología que incorpora, pue-

en la red es posible organizar todos los

de trabajar con los algoritmos de codi-

contenidos disponibles, explotando al

ficación/descodificación de audio más

máximo sus posibilidades.

utilizados, ya sean comprimidos o no.

Uno de sus grandes avances es que no

93 811 34 33 | www.cambridgeaudio.com

necesita estar conectado a un ordenador para desarrollar su potencial, su dispositivo UPnP le permite conectarse

PELI

I N F I N I TA S POSIBILIDADES PARA

IDEAS ILIMITADAS

Sistemas de iluminación avanzados Los nuevos Sistemas de Iluminación para Áreas Remotas (RALS) ofrecen soluciones luminosas para todas tus necesidades de trabajo. Increíblemente luminosos, silenciosos y cómodos de transportar. Protección a medida Con una gama de más de 40 maletas prácticamente indestructibles, PeliTM ofrece soluciones múltiples para proteger los equipos más valiosos.

21

RODOLFO BIBER, S.A.: C/ Salcedo, 8 • 28034 • Madrid, Spain • Tel. +34 917292711 • Fax +34 917293829 • info@robisa.es • www.robisa.es

TM


NOVEDADES PRO Alta resolución y brillo

El conversor de vídeo más completo

proyectores 8000 mitsubishi

extron usp 507 Extron Electronics propone una única

entrada del contenido y aplicando un

solución para la conversión de vídeo:

escalado de alto rendimiento. Tiene

su procesador de señal universal USP

salidas RGBHV y de par trenzado MTP

507. El dispositivo funciona como es-

estándar, con tarjetas de salida dispo-

Mitsubishi Electric lanza su nueva

calador, transcodificador de vídeo y

nibles para DVI, HD-SDI o conversor de

serie de proyectores 8000, formada

conversor de vídeo digital a analógico

vídeo. El USP 507 de Extron es perfecto

por los modelos XD8100D, WD8200U

con conversión opcional de analógico a

para aplicaciones que requieren com-

y UD8400U. Están pensados para las

digital. Lleva integrado un conmutador

patibilidad universal para aceptar casi

grandes proyecciones de carácter

con siete entradas pensado para hacer

cualquier formato de vídeo de entrada

profesional. Gracias a la Tecnología de

presentaciones. Soporta vídeo de orde-

y producir vídeo de alta calidad en el

Procesamiento de Luz Digital (DLP),

nador RGB, DVI, vídeo por componen-

dispositivo de visualización, incluyendo

ofrecen imágenes de alta resolución y

tes HDTV, S-vídeo y vídeo compuesto

eventos en directo, seguridad pública,

con un gran brillo.

y SDI/HD-SDI opcional, detectando

medicina y presencia televisiva.

934 14 23 40 | www.mitsubishielectric.es

de manera automática el formato de

www.extron.es

Más funciones de edición video mastering works 5 Pegasys anuncia el lanzamiento de TMPEGnc Video Mastering Works 5, la última actualización de su software de compresión y transcodificación de vídeo para Windows. Esta versión cuenta con nuevos filtros y funciones de edición, soportando los formatos MKV y Webm. www.pegasys-inc.com/es

TVE renueva sus equipos p2 hd de panasonic Durante los próximos tres

22

Limpieza y reciclado de cintas servicios cintaplus Cintaplus ofrece a sus clientes un ser-

en bordes, arrugas o pliegues, exami-

vicio de reciclado, evaluado, borrado y

na las cintas vírgenes o grabadas sin

limpieza de cintas BTC, BTC SP, BTC

afectar al material grabado y emite in-

Digital y BTC SX. Cada usuario deter-

formes de datos de defectos.

mina cuáles son los servicios a efec-

www.cintaplus.com

años, Panasonic suminis-

tuar, dependiendo de sus necesidades.

trará a Televisión Españo-

El proceso de limpieza y pulido se rea-

la equipos ENG para gra-

liza utilizando tres cintas limpiadoras

baciones de alta calidad en

especiales asistidas por un sistema

HD y para unidades informativas y

de succión para eliminar y absorber

corresponsalías. TVE adquirirá más de

de la superficie los residuos de polvo

270 equipos con tecnología de estado

depositados en la cinta. El proceso de

sólido P2 HD de Panasonic, sobre todo

borrado se hace a través del módulo de

camcorders AJ-HPX3100 y AG-HPX500,

borrado de la máquina RTI 4100, lle-

además de unidades de lectura AJ-

vando a cabo un borrado completo en

PCD2, grabadores portátiles AG-HPG20

todo el ancho de la señal de grabado

y Decks AJ-HPD2500.

de las cintas. En cuanto al proceso de

www.panasonic-broadcast.com

evaluado, permite localizar los daños


Cine para profesionales sony f35

Imágenes siempre claras proyectores epson Epson presenta su nueva serie de pro-

Sony ha ampliado recientemente su

Su diseño la hace compatible con

gama de cámaras para grabar en 35

muchos accesorios de cámaras de

diseñados especialmente para profesio-

mm. Entre ellas, destaca la F35, con

cine, lo que ofrece al usuario muchas

nales y centros educativos. Son los EB-93,

un diseño ergonómico y compac-

posibilidades. Si se conecta al gra-

EB-95, Eb-96W, EB-905, EB-915W y EB-

to similar a las cámaras de cine. Se

bador portátil SRW-1 HDCAM-SR, se

925. Gracias a su tecnología 3LCD, ofrecen

presenta con ópticas de montura PL

convierte en un sistema de grabación

imágenes nítidas en todas las condiciones

y puede utilizarse con ópticas para

portátil HD de gran calidad. Junto con

de luz, incluso en ambientes iluminados.

cámaras de cine sin realizar ninguna

la función SR-Motion del SRW-1, pue-

Su instalación y utilización es sencilla, e

modificación. Proporciona una salida

de realizar las operaciones de over-

incluye funciones inteligentes para crear

RGB 4:4:4 de ancho de banda com-

cranking y under-cranking, utilizadas

presentaciones más eficaces. Las imá-

pleto, ofreciendo una gran calidad de

en producciones cinemáticas y co-

genes pueden proyectarse directamente

imagen y color. Viene equipada con un

merciales, entre otras. Cuenta tam-

desde una memoria USB, una cámara o un

sensor CCD Super de 27 mm con una

bién con la función Select FPS, con la

disco duro portátil.

resolución 1920 x 1080, que cuenta

que grabar imágenes con frecuencia

93 582 15 89 | www.epson.es

con un filtrado RGB en bandas, ha-

de cuadro variable entre 1 fps y 50 fps

ciendo que los colores no se interpo-

en el modo 4:4:4.

len con los píxeles de al lado.

91 358 97 70 | www.sony.es

yectores de sobremesa y de instalación

Más formatos de compresión perfil h4:2:2p en sapec xavic

Publicar contenidos fácilmente spinetix fusion

Sapec, compañía especialista en soluciones para la transmisión de señales audiovisuales, incluye en los nuevos modelos de la familia Xavic el perfil de contribución H4:2:2P para compresión MPEG-4.

Crambo Visuales distribuye en España

requiere pago por software adicional.

Esta nueva incorporación permitirá a los

el nuevo software de Spinetix, Fusion.

Tampoco es necesario instalar ningún

productos Xavic realizar compresiones

Con su interfaz rápida y eficiente, per-

software en el ordenador para poder

en MPEG-4 y MPEG-2 con perfiles 4:2.0 y

mite a cualquier usuario crear, admi-

publicar contenidos.

4:2:2. Gracias al nuevo perfil, los equi-

nistrar y publicar contenidos de varios

91 185 10 34 | www.crambovisuales.es

pos Xavic serán capaces de cubrir las

formatos de forma sencilla y en poco

necesidades de contribución y distribución

tiempo. Está especialmente

de operadores de telecomunicaciones

diseñado para utilizarse

y cadenas de televisión. La novedad fue

en pequeñas y medianas

presentada en la feria IBC 2010, celebra-

empresas. Funciona en

da en Ámsterdam entre el 9 y el 14 de

los

septiembre.

dispositivos

Hyper

Media Player (HMP) y no

91 728 39 10 | www.sapec.es

23


NOVEDADES PRO Vídeo SD y HD por IP

El Sony Creatology Tour, en Madrid

teracue ENC-300

media RoadShow de Sony Sony Profesional estuvo en Madrid los días 8 y 9 de febrero ofreciendo un Media RoadShow con sus soluciones para los profesionales del mundo audiovisual. Se trata de otra parada del Creatology Tour, la iniciativa de la compañía japone-

La empresa alemana Teracue ha

sa para dar a conocer en varias ciudades

lanzado al mercado la nueva serie

del mundo sus últimas novedades. La

ENC-300 de codificadores H264 para

estereoscopia tuvo un papel protagonista

señales HDSDI y DVI. Esta nueva serie,

en la muestra de Sony. Se presentaron

que se suma a la ya existente ENC-200,

varias novedades al respecto, entre las

permite el transporte de la señal de

que destacan el adaptador de fibra óptica

vídeo SD o HD codificada en H264 por

HFDA-200, nuevas opciones de software

IP a mínimo bitrate.

para el MPE-200 para pasar de formato

sidades de cada vez más producciones

www.teracue.com

2D a 3D, una aplicación de camera stit-

cinematográficas y de ficción televisiva,

ching de unión de imágenes por mosai-

la compañía presentó sus nuevas cáma-

co de imágenes y un equipo de efectos

ras para captura digital con sensor Super

de vídeo con capacidad 3D para la serie

35 mm. La SRW-9000PL captura imagen

MVS-8000. Comprometida con las nece-

RGB completa, con rango dinámico am-

Compatibles con RED ONE BATERÍAS PRO-X

pliado y velocidad variable en su configu-

Pro-X ha creado

ración estándar. Sony presentó también

un conjunto de

otras camcorders de última generación,

baterías (RED

como las PMW-500, las primeras XDCAM

Series) y carga-

HD422 profesionales de la marca con

dor compatible

grabación de estado sólido; la PMW-320,

con las cámaras

para grabar llevándola al hombro; la

RED ONE. Con capacidad de 95, 190 y

PMW-350, que graba en tarjetas SxS, O

90 Wh (XP-Power), permiten visualizar

la PMW-EX1R, la última incorporación a

en la pantalla trasera de la cámara la

la serie EX1

información referente a la cantidad de

www.sony.es

energía que les queda. 96 313 51 36 | www.daiwaiberica.com

Compresión de vídeo HD JVC ka-as790g

24

Reproducción natural de los colores proyectores sharp

JVC anuncia su próximo lanzamien-

Sharp incorpora a su gama de proyectores de uso profesional dos nuevos mo-

to, el KA-AS790G ASI, un dispositivo

delos: el XG-P610X, con resolución XGA; y el XG-P560W, con resolución WXA. Su

de compresión de vídeo compatible

funcionamiento se basa en el sistema de proyección 3-Chip DLP, donde cada chip

con las videocámaras GY-HM790U y

procesa sólo uno de los tres colores (rojo, verde y azul) en los que se divide la

GY-HM750U ProHD. Comprime audio

luz blanca de la fuente de iluminación después de pasar por unos primas. Esto

y vídeo, creando una

permite ofrecer una reproducción de los colores más natural. Gracias al siste-

señal de MPEG-2 y

ma de doble lámpara, proporcionan

pasándola a formato

imágenes brillantes y definidas en cual-

DVB-ASI, sin gene-

quier ambiente, incluso con mucha luz.

rar pérdidas y sin

El usuario puede escoger entre cuatro

necesidad de utilizar

modos diferentes de funcionamiento de

adaptadores.

las lámparas, dependiendo de las nece-

902 39 39 29

sidades de cada momento.

http://jsp.jvc-europe.com

93 285 19 19 | www.sharp.es


Scan-converter económico y sencillo matrox convert dvi plus

Potente procesador de vídeo atlona at-line pro4

Matrox presenta su última novedad,

se embeba en la señal SDI. Su utiliza-

el Convert DVI, un scan-converter con

ción es sencilla, a través de una inter-

genlock pensado para profesionales

faz de usuario basada en PC. Arras-

de la radiodifusión. Con él, es posible

trando el ratón, se elige visualizar la

emitir de forma fácil y económica los

pantalla completa o una región de

contenidos basados en ordenador.

interés de cualquier tamaño. Incor-

Atlona actualiza su gama de procesadores

Puede resultar de gran ayuda en la

pora funciones premium, como filtro

de vídeo At-Line con el At-Line Pro4, inte-

realización de informativos diarios, ya

de reducción de parpadeo, modo un-

grado dentro de la nueva línea Signature

que permite crear emisiones de vídeo

derscan, ajustes personalizables con

de la marca. Se trata de un conmutador/

a partir de aplicaciones como Skype,

teclas de acceso directo asignables

escalador con salida HDMI y diez entradas

YouTube, Google Earth, videojuegos,

por el usuario, protección mediante

para dispositivos de AV. Incluye cuatro

sesiones del navegador web o vídeos

contraseña y modo autónomo. Cuan-

HDMI/DVI, tres VGA, una S-Video y una

de teléfonos móviles de periodistas

do los contenidos no procedan del

entrada de vídeo compuesto. Viene con un

no profesionales.

ordenador, sino de una cámara o un

buen número de conexiones para diferen-

A diferencia de otros scan conver-

dispositivo médico, el Matrox Convert

tes fuentes, que resultan de gran utilidad

ters HD-SDI con genlock, que pueden

DVI puede trabajar de forma indepen-

cuando el usuario tiene varias fuentes y

llegar a costar miles de euros, el de

diente del PC, proporcionando vídeo

solamente un monitor y proyector. Muy

Matrox resulta bastante económico,

SDI y analógico.

práctico para utilizarse en pantallas para

permitiendo que el audio del sistema

www.matrox.com/es

tiendas, centros educativos, lugares de culto, salas de juntas u otros lugares donde sea necesaria una señalización de vídeo de gran calidad. www.atlona.com

Nueva gama de productos autocue

Codificador de vídeos en HD media links MD2000-HD-GigE Autocue, la firma británica especializada

La compañía Media Links lanza al

10 msg, siendo el codificador capaz

en prompters y estabilizadores de cáma-

mercado su codificador/decodificador

de generar valores de bitrate desde

ra, presenta su nueva línea de productos.

de vídeo HD sobre Gigabit Ethernet, un

251 Mbps hasta 586 Mbps. La salida

Destacan sus servidores de vídeo basados

dispositivo que transporta las señales

D-GigE es compatible con diferentes

en Linux, con varios puertos bidireccio-

HD-SDI/SD-SDI/DVB-ASI sobre redes

equipos de red IP, y las señales de

nales HD/SD para la gabación y el playout

IP. La compresión en HD intraframe

varios dispositivos pueden añadirse

simultáneos. Otra de las novedades es

del códec emite una señal de vídeo

utilizando Switches IP estándar, com-

Glide, un estabilizador de cámara para

de alta calidad que puede ser trans-

partiendo equipos locales remotos.

DSLR y DV con sujeción profesional

portada sobre redes Gigabit Ethernet.

www.medialinks.com

de espuma de alta calidad. Asimismo,

Las señales SD y ASI se detectan

Autocue ha rediseñado los monitores de

de forma automática, siendo en-

sus prompters, volviéndolos más ligeros

tregadas transparentemente sin

y añadiendo un mecanismo de anclaje de

cambios. La codificación campo a

nuevo diseño, resultando especialmente

campo permite emitir la señal de

útil en trabajos intensivos Pan/tilt y para

vídeo con un retardo de menos de

pedestales robotizados. www.autocue.com

25


REPORTAJE

lo último en tecnología

El CES 2011 da a conocer lo nuevo en gadgets e imagen La última edición del International Consumer Electronics Show, la feria de tecnología más importante del mundo, celebrada en Las Vegas entre el 6 y el 9 de enero de 2011, ha dado a conocer las últimas tendencias en gadgets y electrónica de consumo. Los tablets, los smartphones y los televisores 3D han sido los grandes protagonistas de la muestra internacional.

Cuatro décadas ofre-

La Consumer Electronics Association

convertirse en la muestra de referencia

ciendo al público lo último en electróni-

(CEA), asociación dedicada a la promo-

del sector. Los organizadores se mues-

ca, mostrando las últimas novedades del

ción del crecimiento del sector de la

tran satisfechos con esta última edición,

sector y dando a conocer las tendencias

tecnología de consumo, ha sido la orga-

que ha reunido a 30.000 visitantes más

de la industria. El CES es la feria de re-

nizadora del evento. CEA representa a

que el año pasado. Gary Shapiro, CEO

ferencia en cuanto a tecnología de con-

más de 2.000 compañías especializadas

de la feria, señalaba que “el CES 2011

sumo a nivel mundial y la muestra más

en el diseño, desarrollo, fabricación, dis-

ha sido un evento mundial fenomenal

grande que se celebra en Estados Uni-

tribución e integración de productos de

que alcanza a todas las industrias tec-

dos. Una vez más, el Convention Center

electrónica de consumo. Los beneficios

nológicas y de entretenimiento a nivel

de Las Vegas ha acogido el encuentro,

que se obtienen en el CES se invierten

mundial”. Durante el transcurso de la

que ha reunido a 2.700 expositores de

posteriormente en el sector servicios,

muestra, un total de 22 CEOs han ofre-

más de 130 países. Un total de 140.000

fomentando de esta forma la formación

cido charlas y conferencias. Entre ellos

visitantes han pasado por el recinto de

técnica y el desarrollo de la industria

se encontraba Steve Ballmer, el director

la muestra, un espacio de 1.500 m2 en el

tecnológica.

ejecutivo de Microsoft, que en su inter-

Irene BALLESTAR.

vención informaba de los 8 millones de

que se dieron cita las principales marcas

26

de productos tecnológicos del mercado,

popularidad creciente

Kinect que la compañía ha conseguido

entre las que se encontraban tan sólo

El CES lleva celebrándose anualmente

vender desde su lanzamiento.

cuatro empresas españolas: MG Media,

desde el año 2004. Su popularidad ha ido

Los protagonistas indiscutibles del

Moovida, Safeling y ADN Acoustics.

creciendo con el paso de los años hasta

CES 2011 han sido los tablets y los


smartphones, aunque la muestra daba a conocer una amplia oferta de novedades de distintos sectores. La tecnología Bluetooth, los equipos de hardware y software, la tecnología de banda ancha, los sistemas de posicionamiento global, los electrodomésticos, las aplicaciones de Internet, la tecnología de vehículos, la fotografía y la imagen digital, la robótica, los sistemas de satélites, la tecnología Wi-Fi, los equipos de tecnología y la pequeña oficina tuvieron también su representación en la exposición, mostrando a

El CES 2011 reunió a 2.700 expositores y a 140.000 visitantes de diferentes partes del mundo.

los asistentes las últimas soluciones del dos con conexión 4G y tecnología de do-

en 3D que no necesitan la utilización de

ble núcleo. Motorola presentó sus tres

gafas. Destacaba también uno de los

Guerra de gadgets

nuevos modelos, entre los que desta-

últimos productos de Samsung, una cá-

El CES 2011 se convirtió en un auténtico

caba el Atrix 4G, con sistema operativo

mara de televisión de alta definición que

escaparate de lo que encontraremos en

Android. Otras marcas, como LG, HTC

convierte el televisor en un teléfono de

las tiendas en los próximos meses. Al

o Sony Ericsson también quisieron dar

gran pantalla con el que poder hablar a

igual que las últimas ferias del sector de

a conocer a los presentes sus últimas

través de Skype. Viewsonic presentaba

la tecnología y la electrónica de consu-

propuestas en teléfonos inteligentes.

el primer televisor con Boxee integrado,

mercado.

y HTC mostraba su HTC Media Link, un

mo, la cita se convirtió en el escenario en el que las principales marcas compe-

novedades en imagen

tían por acaparar las miradas de los visi-

El mundo de la imagen también estu-

tantes con sus nuevos tablets. Motorola,

vo presente en el CES, ofreciendo a los

HP, Samsung, Toshiba, Lenovo, Acer,

presentes la oportunidad de conocer lo

Microsoft o Asus aprovecharon la mues-

último en televisores 3D, sistemas de

tra para presentar las propuestas con

cine en casa, cámaras de vídeo en alta

las que pretenden hacer frente al iPad,

definición y accesorios varios, como ga-

el gadget más popular de su categoría.

fas de aumento o para ver la televisión

El Motorola Xoom consiguió desmarcar-

en 3D.

se de sus competidores, resultando ele-

Marcas como JVC, LG, Panasonic o

gido como mejor producto de la feria por

Sony presentaron sus televisores con

sus organizadores.

generador de red Wi-Fi para televisión.

Los organizadores están satisfechos de esta edición, que ha reunido a 30.000 visitantes más que el año pasado

imagen 3D. Sharp y Toshiba se desmar-

LG daba a conocer su Smart Box, un sis-

Compartiendo protagonismo con los

caban del resto y sorprendían a los asis-

tema para permitir a un televisor con-

tablets estaban los smartphones, los

tentes con la presentación de sendos

vencional conectarse a Internet y acce-

nuevos móviles multifuncionales dota-

prototipos de televisores con imagen

der a todo tipo de servicios y contenidos online. Los reproductores Blu-ray tuvieron también su parte de protagonismo, de la mano de firmas como Panasonic, Samsung y Philips. Por último, cabe mencionar la presencia de las cámaras fotográficas y de vídeo. Casio sorprendía con Tryx, una videocámara que permite un giro de pantalla de 360º que fue premiada por su peculiar diseño. JVC y Sony dieron a conocer sus cámaras para grabar en 3D; Panasonic presentaba su videocámara para grabar en full HD, y Kodak estuvo presente en la muestra con su Playsport, una cámara todoterreno pensada

La feria dio a conocer las últimas propuestas en tecnología y electrónica de consumo.

incluso para grabar debajo del agua.

27


REPORTAJE el mejor producto del ces 2011 Se trata, sin duda, del gran protagonista del CES 2011. Escogido por los expertos como mejor producto de la muestra, el Motorola Xoom es un tablet con conectividad 3G que presenta una pantalla capacitiva de 10,1 pulgadas con una resolución de 1280 x 800 píxeles. Con una carcasa de acabado mate, mide 12,9 mm de grosor y pesa 720 gramos. Cuenta con un procesador de doble núcleo, 1 GB de memoria ram, 32 GB de memoria interna y

la posibilidad de sumar otros 32 a través de su ranura para MicroSD. Tiene dos cámaras, una de cinco megapíxeles para grabar en HD a 720p y doble flash LED, y otra de dos megapíxeles en su parte frontal. Dispone también de varios puertos MicroUSB, MicroHDMI, MicroSD y jack de audio de 3,5 mm. Las características del Motorola Xoom se completan con una batería de larga duración, que puede reproducir archivos de vídeo durante diez horas.

los tablets, centros de atención Los tablets acapararon todas las mi-

el concurso ‘Last Gadget Standing’.

radas de los asistentes al CES 2011.

Panasonic dio a conocer sus tablets

Las principales marcas aprovecha-

Viera, pensados para servir de apoyo

ron el encuentro para presentar sus

para ver contenidos en sus televiso-

prototipos, que estarán en el merca-

res Viera, y que permiten cambiar el

do en los próximos meses. El Moto-

canal del televisor o ver la televisión

rola Xoom fue elegido como mejor

en una pantalla alternativa. Por su

producto de la feria, aunque no fue el

parte, Blackberry apuesta por su

único modelo que consiguió llamar

Playbook, un dispositivo ligero capaz

la atención de los visitantes. El Ico-

de grabar y reproducir vídeo en alta

nia de Acer, un tablet multitáctil con

calidad y que se conecta automática-

doble pantalla de 14”, fue premiado

mente a cualquier terminal Blackbe-

como dispositivo más novedoso en

rry para usarlo como módem.

smartphones para todos los gustos

28

Los smartphones tuvieron también

ción en el consumo. Sony Ericsson

una buena cuota de protagonismo en

lanza Xperia Arc, un dispositivo lige-

la muestra de Las Vegas, que sirvió

ro y compacto dotado de una cámara

de escaparate para mostrar a los

de ocho megapíxeles que graba ví-

presentes las últimas tendencias en

deo en alta definición. Motorola, por

dispositivos inteligentes. LG propo-

su parte, propone Cliq 2, un teléfono

ne el Optimus Black, un teléfono de

Android con teclado físico completo y

reducido tamaño y gran pantalla con

diseño innovador. La firma america-

cámara frontal de dos megapíxe-

na Vizio prepara el salto al mercado

les. Cuenta con una nueva pantalla,

de su primer teléfono, Via Phone, do-

NOVA, que gracias a su nivel de brillo

tado con una pantalla de 4 pulgadas,

de 700 nits facilita la visión en cual-

cámara de 5 megapíxeles y cámara

quier situación y permite una reduc-

frontal para videoconferencias.


televisores con imagen 3d y full hd Muchas fueron las compañías que

imagen, amplio ángulo de visión y

quisieron dar a conocer en el CES

consumo reducido. Panasonic mos-

sus televisores con imagen en 3D y

tró a los asistentes su amplia gama

alta definición. Toshiba se desmarcó

de pantallas de plasma 3D Full HD,

de sus competidores con sus tele-

que van desde las 42 a las 152”. Sam-

visores 3D en los que no es nece-

sung presentó su serie de televisores

sario utilizar gafas para verlos. JVC

Led Smart, con diseños innovadores,

presentó sus últimas novedades en

pantallas de gran tamaño y capaces

el mundo de la imagen, como pro-

de reproducir imagen de calidad en

cesadores de imagen 3D, capaces

2D, 3D y HD. En cuanto a Sony, con-

de pasar de dos a tres dimensiones,

firmó su apuesta por la conectividad

y monitores polarizados para ver en

sin cables con su gama de televiso-

3D, LG exhibió sus monitores LED,

res Bravia, que pueden conectarse a

de diseño estilizado, gran calidad de

Internet por Wi-Fi.

las videocámaras se reinventan Las cámaras de vídeo, que parecen

sonic adelantó el lanzamiento de sus

estar en decadencia debido a la fuerte

tres nuevos modelos de cámaras de

competencia de los tablets y los telé-

vídeo, capaces de ofrecer imagen de

fonos móviles con cámara integrada,

calidad utilizando un sistema propio

demostraron que no están ni mucho

de las cámaras profesionales. Sony

menos acabadas. Tryx, la propuesta

amplía su gama de cámaras Bloggie

de innovador diseño de Casio, cuen-

con las Bloggie HD, Bloggie Touch y

ta con un sensor de 12 megapíxeles

Bloggie 3D, que puede grabar vídeo

de tipo CMOS, procesador de doble

e imágenes 3D y mostrarlas en una

núcleo y pantalla de tres pulgadas.

pantalla 3D visualizable sin gafas.

JVC apuesta por la imagen en tres

Kodak, pensando en los más aventu-

dimensiones con su cámara Everio,

reros, presenta PlaySport y PlayFull,

con grabación real 3D Full HD. Pana-

sus nuevas cámaras todoterreno.

auge de los reproductores blu-ray Los aficionados a las sesiones de cine

viceversa. Panasonic lanza una serie

en casa tienen un amplio abanico de

de reproductores Blu-ray 3D Full HD

opciones para reproducir sus pelícu-

y sistemas de Home Cinema para ver

las con la máxima calidad. Samsung

contenidos en alta calidad de imagen

tiene varias propuestas innovadoras

y sonido. Por su parte, Philips presen-

en este sentido. Sus últimos repro-

ta su nuevo modelo de reproductor, el

ductores Blu-ray tienen un excelente

BDP7580, que solo necesita un cable

funcionamiento, interfaz y servicios.

de alimentación para funcionar. Está

El modelo BD-D7500 es ultradelga-

dotado con tecnología Wireless HDMI,

do, mientras que el Samsung D6900

que permite recoger contenido y lle-

puede controlarse a través de un te-

varlo al propio televisor, convirtién-

léfono móvil Ambos vienen con co-

dose, por el momento, en el primer

nexión Wi-fi n y el sistema SoC para

reproductor de sus características

convertir contenidos de 2D a 3D y

capaz de hacerlo.

29


REPORTAJE

superando récords

ISE 2011 aumenta en número de expositores y visitantes La última edición de la Integrated Systems Europe (ISE), celebrada en Ámsterdam entre el 1 y el 3 de febrero, cerró superando todas las expectativas. Más de 34.000 visitantes pasaron por el Ámsterdam RAI, en el que estuvieron presentes más de 700 expositores, cien de los cuales acudían por primera vez a la feria de audio y vídeo profesional.

El pasado 3 de febrero

con dos pabellones nuevos y un total de

damente delgado, de forma que apenas

se clausuraba la feria de audio y vídeo

26.650 m2. Aun así, hubo compañías que

se apreciaban las junturas entre ellos. El

profesional más importante a nivel euro-

se quedaron fuera de la feria por falta de

resultado era un vistoso espectáculo que

peo, la Integrated Systems Europe (ISE).

espacio. En cuanto al número de visitan-

acaparó todas las miradas de los visitan-

Durante tres días, se presentaron las

tes, este también se vio incrementado.

tes del estand.

últimas tendencias en señalización digi-

En total, 34.870 profesionales acudieron

Con su pantalla de 120 m2, Sanyo fue

tal y sistemas integrados audiovisuales.

a la cita, lo que supone un 22% más que

otra de las empresas que destacó en la

Este año, un total de 715 expositores es-

el año pasado. Antes de la feria, los or-

ISE. A través de ella, se mostraba una

tuvieron presentando sus novedades, un

ganizadores habían hablado ya de una

proyección en 360º con una resolución

11% más que el año pasado. De ellos, 150

demanda “sin precedentes”, tanto por

de 14.370 x 1.080 píxeles. Por su parte,

eran primerizos en el encuentro, fruto de

parte de expositores como de visitantes.

Samsung Electronics presentó su nueva

la inclusión de nuevos sectores de activi-

Sin duda, estaban en lo cierto.

serie de pantallas y monitores profesio-

Irene BALLESTAR.

dad en la muestra. Empresas de domóti-

30

nales, entre los que cabe mencionar la

ca, inmótica, comunicaciones unificadas,

los grandes atractivos

interactiva SUR40 para Microsoft Sur-

digital signage, visualización, control de

Uno de los principales atractivos de

face, desarrollada conjuntamente con

iluminación, tecnología IP y GUI (interfaz

la última edición de la ISE era un cubo

Microsoft.

gráfica de usuario) estuvieron presentes

formado por 64 monitores Sharp de 60”.

La feria acogía también la entrega de

en ella. El área de exhibición era un 20%

Pertenecientes a la serie PN-V601 de la

los InAvation Awards, los premios que

más grande que en anteriores ocasiones,

marca, cuentan con un marco extrema-

reconocen a las empresas más innova-


doras en diferentes categorías. Christie, uno de los patrocinadores del evento, se hizo con el galardón al ‘Producto de señalización digital más innovador’ gracias a MicroTiles, la tecnología de visualización capaz de crear un lienzo digital virtualmente continuo y en casi cualquier tamaño. Displax Interactive Systems se

ISE no solo quiere ser un escaparate, sino una plataforma de encuentro para profesionales A lo largo de tres días, la feria recibió la visita de más de 34.000 profesionales.

llevó el ‘Premio a Proyecto’ por la iniciativa Meditel de la empresa en Marruecos. PZ Cussons fue reconocido con el premio

CEDIA realizaron exámenes de certifica-

ven nuevos productos, sino que también

a la ‘Instalación AV Corporativa más Inno-

ción in situ. El programa de conferencias

se benefician de verlos en el contexto de

vadora’. Por su parte, Global Immersion

llegó a triplicarse y se habilitó una zona

desarrollo de mercado y de aplicaciones

se hizo con el galardón a la ‘Instalación

para facilitar el networking entre los pro-

más amplios. Esta no es una feria de

de Ocio/Entretenimiento más Innovado-

fesionales que acudieron al encuentro.

aparatos, es una plataforma en la que los

ra’ con Our Dynamic Earth, un dispositivo

Con el eslogan Todas las conexiones

participantes pueden reunirse y tratar

capaz de proyectar los fenómenos natu-

que necesitas (All the connections you need), la muestra dejaba claras sus intenciones. No sólo quería ser un escaparate de productos, sino también una plataforma de encuentro para los profesionales que se acercaron a ella. En palabras del director general de la ISE, Mike Blackman, los visitantes “no solo

nuevas formas de aplicar las innovacio-

rales más espectaculares del mundo.

más que una feria La ISE presentaba este año varias novedades. Por primera vez en su historia, la muestra albergaba un cine 3D para disfrute de los visitantes. InfoComm y

nes tecnológicas de manera que se proporcione a los clientes valor añadido”.

popularidad creciente En general, las ferias no están pasando precisamente por su mejor momento. Sin embargo, la ISE no solo ha sabido mantenerse a flote en el contexto actual, sino que ha experimentado una tendencia de crecimiento que, según las previsiones de sus organizadores, seguirá en aumento en el futuro. El interés de los profesionales que acuden a la cita anual no solo no ha decaído, sino que se espera que siga creciendo. Una muestra del interés que despierta la feria es que el día 3 de febrero, el último de la edición de este año, permaneció abierta dos horas más de lo habitual. La organización decidió ampliar el horario de apertura hasta las seis de la tarde para dar más tiempo a los visitantes para ver toda el área, más extensa que en anteriores ediciones. Mike Blackman señala que “la ISE siempre ha sido una feria con gran actividad

La muestra contaba con un cine 3D y un sector dedicado al networking.

hasta el último minuto”.

31


REPORTAJE gestionar espacios

otra forma de ver películas Kaleidescape estaba en la ISE dando protagonismo a una de sus últimas novedades: un servidor para discos de formato Bluray. El producto permite cambiar de disco sin necesidad de moverse del sofá, a la vez que

Varias empresas estuvieron en la

reduce el tiempo de espera a la

feria presentando dispositivos de

hora de cargar una película. Tiene ca-

control de espacios. Creston Ibéri-

pacidad para hasta cien discos y, con su sencilla y elegante interfaz, convierte la

ca dio a conocer su gama Prodigy,

elección de algo para ver en toda una experiencia. Con el sistema de Kaleidesca-

una línea de productos de domótica

pe, los discos Blu-ray se inician en segundos, dejando atrás los menús de inicio y

y audio/vídeo que serán distribuidos

acelerando el proceso de visionado. La rapidez se combina con una alta resolución

en exclusiva por Crambo Visuales.

de los contenidos, proporcionando imágenes de alta calidad. El sistema incorpora,

Los dispositivos de Prodigy ofrecen un control total y simplificado

además, otros detalles, como la posibilidad de leer una pequeña sinopsis de las películas guardadas.

en cualquier espacio, permitiendo tener la música, las luces, los termostatos y la seguridad al alcance del usuario, en cualquier momen-

cartelería digital

to. Todos los productos de la gama están pensados para trabajar de

Tecco también quiso estar presente en la última

forma conjunta, sin que tengan que

edición de la ISE. Esta vez, mostrando a los asisten-

realizarse instalaciones ni cablea-

tes la versión 2.0 de Aracast, su sistema de gestión

do. También AMX estuvo presen-

e información respaldado en diferentes ámbitos de

tando su dispositivo de control de

aplicación. La suite Aracast es una combinación de

espacios, el Resource Management

software, hardware y servicios, especialmente diseña-

Suite. Se trata de un paquete de

da para utilizarse en campañas de marketing y como

software para la gestión y progra-

publicidad dinámica, aunque también puede resultar

mación de salas, espacios y equi-

de utilidad en otros mercados. La última versión in-

pamientos, como sistemas audio-

corpora nuevas funciones, como la inserción directa

sivuales, de iluminación, ventanas

de textos de última hora, las transiciones con efectos entre plantillas, reloj digital,

con tratamientos motorizados y

rotación de objetos 2D y mejoras en la interfaz de trabajo del gestor, además de

sistemas de HVAC.

entradas opcionales de TDT y vídeo compuesto, y señal de vídeo por streaming.

nuevas experiencias visuales Fue, sin duda, uno de los grandes atractivos de la ISE 2011. El cubo gigante tridimensional, construido con 64 monitores de 60” de Sharp, supo llamar la atención de todos los visitantes. Los 64 monitores utilizados para construir la estructura del cubo son de la serie PN-V60, unos modelos con un marco tan delgado que las juntas entre unos y otros son apenas perceptibles. Otras marcas estuvieron también exhibiendo sus últimas propuestas en imagen. Sanyo presentaba su monitor estándar PID-47NE1 de 47”, pensado para utilizarse en salas de conferencias, escaparates o aeropuertos, ofreciendo imágenes brillantes y de alta resolución. La firma Christie daba a conocer MicroTiles, unos cubos modulares de visualización digital que pueden apilarse y agruparse como bloques de construcción para crear un lienzo digital de cualquier tamaño y forma.

32


Amplia oferta de proyectores En cuanto a proyectores, un buen número de compañías quisieron mostrar al público de la ISE sus últimas propuestas. Mitsubishi aprovechó la feria para lanzar su gama de proyectores 8000, ideados especialmente para grandes proyecciones de ámbito profesional. Con su tecnología de Procesamiento de Luz Digital (DLP), generan imágenes de alta resolución y con un brillo de calidad. Gracias a su lámpara dual, pueden proyectar durante 4.000 horas sin interrupciones. Christie dio a conocer los seis modelos nuevos de la serie Mirage 3D DLP, de gran rendimiento y compatibles con los estándares 3D HDMI 1.4. Destaca el Mirage WU12K-M, con tres fuentes diferentes de estéreo 3D: un reproductor Blu-ray para películas, una PlayStation 3 con sus juegos y una tercera entrada de una cámara 3D con reproducción en tiempo real. Canon presentaba cinco modelos nuevos para su serie LV ultraportátil. Van desde el nivel más básico, preparado para red y con bajos costes de explotación, hasta el modelo más potente, con 4.000 lúmenes de brillo. BenQ se especializa en el ámbito de la enseñanza con sus últimos modelos. Sus seis nuevos proyectores de alcance ultracorto permiten visualizaciones en 3D. Sobresale el PointDraw MP780ST, con opciones interactivas. Epson mostraba también en la ISE sus nuevas propuestas en proyectores para el ámbito educativo. Además, lanzaba sus últimas propuestas dirigidas al entorno profesional y corporativo, modelos que incluyen características especiales para hacer presentaciones de forma sencilla. Por último, mencionar el nuevo proyector estrella de Sanyo: el PLC-HF15000L. Con 15.000 ANSI lúmenes y una resolución de 2K, es capaz de proporcionar imágenes de alta resolución. Además, gracias a su tecnología QuaDrive y a la función edge blending, permite que varios proyectores de este tipo creen conjuntamente proyecciones panorámicas gigantes de 360º.

cine en casa Varias marcas mostraban a los visitantes de la ISE sus últimas propuestas para disfrutar de una película y convertir su visionado en toda una experiencia. Mitsubishi daba a conocer su última novedad en Home Cinema, el HC9000D, Se sitúa entre los más potentes del mercado actual, proporcionando al espectador la más alta calidad de imagen full HD con imágenes en tres dimensiones. Por su parte, AWE debutaba en la feria con los productos de Kinetik Labs. Destaca su gama de productos orientados al entretenimiento, entre los que se encuentran el Sonix Multiroom Audio Server, capaz de generar sonido para tres zonas independientes, o su servicio de videoclub en casa.

33


REPORTAJE

BARCELONA HACE MÉRITOS Tablets y smartphones, los protagonistas del MWC 2011

El pasado mes de febrero, Barcelona se convirtió durante cuatro días en el escaparate mundial de las últimas tendencias en comunicaciones móviles. Más de 60.000 personas visitaron la edición con más asistencia de este congreso, que tuvo a los tablets y los smartphones como los auténticos protagonistas.

LOS MÁS ESPERADOS

Samsung puede ejecutar múltiples apli-

do mes de febrero una nueva edición

Los grandes triunfadores de esta edición

caciones a la vez, recorrer la web car-

del Mobile World Congress, el mayor

fueron los tablets y los smartphones. Así,

gando páginas y contenidos Flash a gran

encuentro mundial de la industria de

entre las novedades más esperadas es-

velocidad, jugar como si tuviéramos una

las comunicaciones móviles, y lo hizo

taban las segundas versiones de los pro-

videoconsola y ver películas en HD.

batiendo récords. El recinto ferial de

ductos estrella de Samsung: el Galaxy S

Mucha expectación levantó también

Montjuïc recibió la visita de más de

y el Galaxy Tab. El nuevo Galaxy S II tiene

el LG Optimus 3D, el primer teléfono con

60.000 personas, un 20% más que en la

pantalla de 4,27” SuperAmoled Plus y

pantalla 3D que no necesita gafas y que

edición anterior, que también se celebró

un rápido procesador de doble núcleo.

es capaz de hacer fotos en tres dimen-

en la capital catalana. Según datos de

Captura vídeo en full HD a 1.080 píxeles

siones. En el terreno de los tablets, LG

GSMA, asociación organizadora del con-

y cuenta con dos cámaras, una de 8 me-

también ha apostado por la tecnología

greso, entre los asistentes había más de

gapíxeles con flash led y otra frontal de 2

estereoscópica con el lanzamiento del

30.000 altos cargos de empresas de 200

megapíxeles. Galaxy Tab II, por su parte,

Optimus Pad, que tiene una pantalla de

países, de los cuales, 3.000 eran directo-

es un tablet de 10,1” que funciona con

8,9 pulgadas capaz de reproducir 3D,

res generales. Más de 2.900 periodistas

el nuevo Android Honeycomb. Para sa-

pero que requiere gafas bicolor (inclui-

se acreditaron para cubrir los nuevos

carle el máximo partido a este sistema

das) para lograr el efecto. Incorpora dos

productos, tecnologías y servicios que

operativo, integra el chip Tegra 2 de Nvi-

cámaras de 5 megapíxeles, como el Op-

mostraron los más de 1.400 expositores

dia –que también estuvo presente en la

timus 3D, y cuenta con procesador de

que no quisieron faltar a la cita.

feria–, gracias al cual el nuevo tablet de

doble núcleo Nvidia Tegra 2, conexión

Celia LÓPEZ.

34

Barcelona acogió el pasa-


3G, WiFi y 32 GB de memoria de alma-

Optimus 7, la BlackBerry Torch 9800 y

dan controlar los juegos de la Xbox 360.

cenamiento.

el Samsung Galaxy S.

Asimismo, causó un gran revuelo la

Sony Ericsson mostró el esperado

Microsoft sí que acudió a la cita para

alianza entre Microsoft y Nokia, por la

Xperia Play, un smartphone con vocación

presentar las novedades de su sistema

que el fabricante finlandés incorporará

de consola de juegos portátil, mientras

operativo Windows Phone 7, que a par-

mayoritariamente el sistema operativo

que HTC presentaba Flyer, su primera

tir de ahora incluirá Internet Explorer 9

Windows Phone 7 y el navegador Bing a

tableta con sistema operativo Android,

para móviles, con soporte para acelera-

sus teléfonos móviles.

cámaras delantera y trasera, y pantalla de 7 pulgadas. Además de este tablet, HTC, que fue reconocida en los premios Global Mobile Awards 2011 como el mejor fabricante de dispositivos, dio a conocer cinco smartphones: los nuevos Desire S, Wildfire S e Incredible S, y dos teléfonos sociales, bautizados como Salsa y Chacha, que permiten acceder a Facebook pulsando un botón.

Tampoco quisieron faltar al congreso

Los buenos resultados afianzan a Barcelona como firme candidata a las ediciones de 2013 y 2017

Motorola con el tablet Xoom, Blackberry con Playbook, ni Dolby Digital, que mostraba en su estand un gran home cinema conectado a un Nokia N8.

firme candidata Este aluvión de novedades y los buenos resultados de asistencia contribuyen a afianzar la candidatura de Barcelona a volver a ser la capital del móvil en 2013 y

EL MEJOR MÓVIL DEL AÑO

ción gráfica y para HTML5; integración

2017, a la que también optan París, Mi-

A pesar de que Apple no contó con es-

de Twitter; multitarea, y la posibilidad

lán o Múnich. Pero pase lo que pase, lo

tand en el Mobile World Congress, su

de acceder al almacenamiento de do-

que sí está claro es que en 2012, entre el

iPhone4 no se quedó sin protagonismo,

cumentos online de SkyDrive. Durante

27 de febrero y el 1 de marzo, Barcelona

ya que fue elegido como el mejor dispo-

el evento también se anunció que Win-

volverá a convertirse en el escaparate de

sitivo móvil del año, un galardón al que

dows Phone 7 se combinará con Kinect,

las últimas tendencias en comunicacio-

también optaban el HTC Desire, el LG

lo que permitirá que los teléfonos pue-

nes móviles.

LG presentó el Optimus 3D (arriba). La aplicación Manga on Mobile permitirá leer los mangas en el teléfono móvil (abajo).

Microsoft presentó las novedades de Windows Phone 7 (arriba). Dolby Digital mostró un home cinema alimentado por un Nokia N8 (abajo).

35


TENDENCIAS TV

Espectadores móviles La televisión, cada vez más nómada y ubicua

Las formas de consumir televisión se han diversificado en los últimos años, lo que ofrece a los espectadores más posibilidades de disfrutar de ella. Gracias a los móviles con 3G, los tablets y los smartphones, con las aplicaciones desarrolladas por los propios canales, se puede acceder a una amplia variedad de contenidos en cualquier sitio.

Verlo todo y en todas

ración, brindan a los usuarios de estos

se, su consumo se ha disparado en los

partes. Conocer las últimas noticias,

la oportunidad de acceder a una gran

últimos años. El estudio analizaba el au-

recuperar los contenidos más desta-

variedad de contenidos, de una manera

mento de usuarios de televisión en dis-

cados e incluso ver la programación

sencilla, rápida y, en la mayoría de oca-

positivos móviles en España, Alemania,

en directo, en cualquier momento y en

siones, gratuita.

Italia, Francia y Reino Unido. En 2010,

Irene BALLESTAR.

cualquier lugar. Y no solo eso. Hacerlo,

36

los consumidores europeos de esta tec-

además, de forma gratuita. Al menos,

cada vez más adeptos

nología aumentaron en un 66% respec-

en la mayoría de los casos.

El consumo de televisión en el móvil no

to a 2009, pasando de 7.292.000 usua-

Y es que gracias a los móviles con

ha dejado de crecer desde su aparición.

rios a 12.122.000. En España, se pasó de

tecnología 3G y a las aplicaciones idea-

Un informe realizado por la Fundación

890.000 consumidores a 1.691.000. Los

das para tal fin, es posible no perderse

Telefónica en 2008 señalaba que en Es-

resultados están estrechamente vincu-

nada de lo que pasa en televisión, aun-

paña había ya más de 250.000 personas

lados al éxito de los teléfonos inteligen-

que estemos a kilómetros de distancia

abonadas a este tipo de servicios. La ci-

tes, que permiten acceder a un sinfín de

del salón de casa. En la era de Inter-

fra suponía un aumento en el número

aplicaciones de lo más variado.

net, cuando los usuarios pueden elegir

de consumidores, contrastando con el

cuándo consumir los contenidos, fideli-

estancamiento de los servicios de tele-

antes de las ‘apps’

zar a la audiencia supone todo un reto

visión por cable y satélite.

No obstante, antes de la aparición de

para las cadenas de televisión. Por ello,

Otro informe, publicado en 2010 por

los smartphones, se desarrollaron otras

y aprovechando las posibilidades que

comScore, revela que, aunque la televi-

formas de disfrutar de la televisión en

ofrecen los teléfonos de última gene-

sión móvil aún está lejos de consolidar-

el móvil. En 2005 tuvo lugar el lanza-


miento de MobiTV, una plataforma para ver televisión en el teléfono móvil que

Lo que ofrece cada canal

no llegó a España. El servicio ofrecía la posibilidad de visionar varios canales de

RTVE

televisión, como FOX Sports, Discovery,

La corporación pública ofrece aplicaciones gratuitas para iPhone y Android con las que poder ver la televisión en directo o el telediario en un formato reducido de cuatro minutos, escuchar las emisoras de RNE o conocer el estado de las pistas de esquí. Para iPhone e iPad está disponible la aplicación Clan TVE, con contenidos infantiles interactivos.

Comedy Time, TLC o CMC. La iniciativa, que supuso el estreno de la televisión en este tipo de dispositivos, no la incorporó ninguna operadora española. Un año más tarde, se llevaba a cabo en Madrid y Barcelona una prueba piloto en la que se proveía a 500 personas de un Nokia 7710 y un dispositivo diseñado para recibir la señal de televisión en el móvil. En el proyecto trabajaban Telefó-

Antena 3

nica Móviles, Nokia y Abertis Telecom,

Para dispositivos de Apple, Antena 3 da la posibilidad de acceder a las últimas informaciones con la aplicación Antena 3 Noticias. También es posible escuchar en directo los programas de Onda Cero, además de conocer todo sobre sus contenidos y protagonistas. En los móviles Vodafone también es posible ver la televisión en directo.

Aunque la televisión móvil aún está lejos de consolidarse, su consumo se ha disparado en los últimos años

TV3 La aplicación del canal autonómico catalán para iPhone e iPad permite acceder a la emisión en directo de TV3, recuperar contenidos ya emitidos y consultar la programación. Existen también aplicaciones de los programas más populares del canal, como Crackòvia o APM?, y el juego El gran dictat, pensado para mejorar la ortografía.

en colaboración con TVE, Telecinco, Sogecable, Telemadrid, TV3 y Antena 3. Las personas seleccionadas para realizar la experiencia pudieron disfrutar durante tres meses de 15 canales de televisión, además de contenidos interactivos y otros servicios asociados al móvil. Movistar no tardó en ofrecer el servicio a sus clientes. En 2007, la operadora se adelantó a su competencia directa lanzando una oferta exclusiva. Por cinco euros al mes, los abonados podían disfrutar de 42 canales temáticos, como CNN, Cartoon Network, MTV, Calle 13 o SciFI. Vodafone y Orange desarrollaron más tarde servicios similares. Recien-

Telecinco La aplicación de la cadena española disponible para iPhone e iPad permite ver sus programas y series más destacados, en directo o no. Resulta un tanto impopular, ya que es necesario pagar para tener acceso a los contenidos que ofrece, y tampoco resulta posible ver toda la programación del canal.

temente, Movistar ha puesto en marcha Imagenio Móvil, un servicio que permite a los usuarios de tablets y smartphones ver 25 canales temáticos en directo y alquilar películas por una cuota de cinco euros al mes. Cabe señalar también la experiencia llevada a cabo por laSexta en 2007. Por primera vez en España, un canal de televisión emitía en directo y de forma

LaSexta Desde los móviles iPhone es posible acceder a los contenidos de la cadena privada. Con la aplicación de laSexta, los usuarios pueden ver en directo o en el momento que elijan todos los programas de la cadena, incluidos los partidos de la Liga BBVA. También pueden recuperarse los vídeos más destacados y consultar la programación.

simultánea un partido de fútbol –el del

37


TENDENCIAS TV cargarse una sencilla aplicación. Si se trata de ver programación en directo, el freeware SPB TV, desarrollado por SPB software, nos permite sintonizar canales televisivos digitales de todo el mundo. El SPB TV está disponible para móviles iPhone, Android, BlackBerry, Windows Mobile y Symbian, y presenta diferentes funciones, como la previsualización rápida del canal o una guía de programación. Aplicaciones como Zattoo Live Tv permiten visionar desde un terminal móvil diferentes canales generalistas y temáticos, como Intereconomía, VEO, La 1, laSexta, Cuatro o Telecinco. Determinadas funciones son, eso sí, de pago. Las propias cadenas de televisión El freeware SPB TV, disponible para iPhone, Android, BlackBerry, Windows Mobile y Symbian, permite sintonizar canales televisivos digitales de todo el mundo.

han querido sumarse a la experiencia, desarrollando aplicaciones para teléfonos de última generación a través

Sevilla contra el Bucarest, correspon-

12.150. El lanzamiento de Gol Televisión

de los cuales es posible acceder a sus

diente a la Copa de la UEFA– a través de

ha supuesto un aumento en el número

contenidos. Muchas de ellas están dis-

su señal analógica y digital de televisión,

de suscriptores a este servicio.

por su página web y para los abonados al servicio telefónico de Orange. Hoy, las

aplicaciones gratuitas

operadoras de telefonía móvil ven cómo

No obstante, la llegada de los smart-

crecen en número de usuarios los ser-

phones ha cambiado sustancialmente

vicios de televisión en el móvil. Movistar

la forma de ver televisión a través del

tiene más de 150.000 clientes abonados

móvil. Ya no es necesario contratar el

al servicio; Vodafone, 103.000, y Orange,

servicio a la operadora, basta con des-

oferta internacional

Ya no es necesario contratar el servicio a la operadora, basta con descargarse una sencilla aplicación

ponibles únicamente para iOs (iPhone), Ver televisión a través del móvil se

aunque también hay algunas que pue-

está convirtiendo en una actividad

den utilizarse con móviles con siste-

cada vez más popular en Europa y

ma operativo Android. La descarga de

Estados Unidos. Los canales ofre-

las aplicaciones suele ser gratuita, así

cen cada vez más opciones y con-

como el acceso a los contenidos. A tra-

tenidos para ser visionados a tra-

vés del móvil, los usuarios tienen a su

vés de smartphones. La cadena de

alcance una amplia variedad de conte-

noticias BBC ofrece a sus espec-

nidos. Las últimas noticias y los vídeos

tadores visionar sus ocho canales

más populares pueden verse en cual-

en streaming durante las 24 horas

quier momento y lugar, personalizando

del día. La aplicación de CNN para iPhone da a conocer las últimas noticias, infor-

al máximo la experiencia. Cada canal

mación sobre el tráfico y la previsión meteorológica. Destaca la aplicación iReport,

busca distanciarse de los demás, ofre-

con la que la cadena fomenta el periodismo ciudadano y la comunicación bidireccio-

ciendo contenidos diferenciados.

nal. Con la aplicación desarrollada por el canal estadounidense NBC, es posible ver

En este sentido, laSexta fue la prime-

las series más populares de la cadena actualmente en emisión, como The Office o

ra cadena comercial en permitir a los

Heroes; y las más clásicas, como El Equipo A o Battlestar Galactica. El año pasado,

usuarios de móviles seguir sus infor-

Fox Mobile presentó la plataforma BitBop, con la que puede accederse a una amplia

mativos en directo. La 1 ofrece informa-

variedad de series y películas de la cadena privada por diez dólares al mes.

tivos de cuatro minutos para mantener siempre al día a los usuarios. La auto-

38


nómica TV3 cuenta con una aplicación para mejorar la ortografía catalana. Con las aplicaciones de RTVE y Antena 3 es posible sintonizar RNE y Onda Cero, respectivamente. Telecinco ha optado por ofrecer sus contenidos previo pago de una pequeña cantidad, se emitan en directo o no.

A través del móvil, los usuarios tienen a su alcance una amplia variedad de contenidos, como vídeos o noticias

Algunas aplicaciones para smartphones permiten al consumidor visionar contenidos en directo de forma sencilla y durante las 24 horas del día.

camino en el mundo de la televisión

logía aún no está lo suficientemente de-

móvil en terminales Android. El disposi-

sarrollada para hacer de la idea una

Lo que vendrá

tivo diseñado para móviles permitiría

realidad, ya que el diseño de Google Tv

Además de las cadenas de televisión y

navegar por Internet y buscar los conte-

está pensado solamente para los chips

las operadoras de telefonía móvil, otras

nidos a visionar. Conectado con redes

x86 de Intel. De momento, se anuncia la

plataformas quieren aprovechar las po-

sociales como Facebook o Twitter, sería

llegada de una versión compatible con

sibilidades que ofrecen los teléfonos

posible interactuar con otros usuarios e

ARM, que podría ejecutarse desde ter-

inteligentes para visionar televisión a

incluso leer sus críticas sobre un deter-

minales Tegra 2, como el LG Optimus

través de ellos. Como Google Tv, que,

minado vídeo o programa. La iniciativa

2X con salida HDMI. Durante los próxi-

después de haber llegado a los televiso-

podría suponer otro paso adelante en la

mos meses veremos si el proyecto se

res, se ha propuesto también abrirse

televisión móvil. No obstante, la tecno-

lleva finalmente a la práctica.

tv3alacarta, EN LA VANGUARDIA ESPAÑOLA Y EUROPEA EN VOD El pasado 26 de enero, la Corporació Catalana de Mitjans Audiovisuals organizó una presentación en el Centro Cultural Blanquerna, en Madrid, para dar a conocer a varios medios de comunicación, entre ellos esta revista, su apuesta multiformato por el vídeo bajo demanda a través de TV3alacarta. Desde que la televisión pública catalana arrancó este servicio, en 2007, las horas vistas a través de este servicio se han multiplicado por 12, pasando de las 765.017 horas de 2007 a las 9.681.437 de 2010, lo que demuestra la fuerza de esta apuesta, pionera en España y de referencia en toda Europa. En lo que respecta a los dispositivos móviles, y sin centrarnos en los netbooks o ultraportátiles y en otras fuentes ubicuas como la consola Sony PSP, que puede conectarse fácilmente a una Sony PS3 y aprovechar su servicio de televisión a la carta, la apuesta de la Corporació Catalana de Mitjans Audiovisuals por los dispositivos de Apple, iPhone, iPod Touch e iPad a través de aplicaciones específicas descargables de manera gratuita desde la App Store no tiene marcha atrás, y abre la puerta a la llegada de estas aplicaciones a otros sistemas operativos móviles como Android o Windows Phone.

39


PROBAMOS

Televisor Philips 46PFL9705 Un deleite audiovisual para los amantes de la HD La marca holandesa cuenta con un televisor de 46” preparado para ofrecer la mejor calidad de imagen. Su sistema Ambilight de retroiluminación y las funciones Perfect Pixel HD Engine, el Led Pro y la potencia de sonido convierten el visionado de contenidos en toda una experiencia.

José Óscar PLAZA.

De unos años hacia aquí,

Philips se ha mostrado con capacidad suficiente como para reaccionar a la feroz competencia imperante en el mercado de los televisores. Gracias a iniciativas como el lanzamiento del Cinema 21:9 LED, logró que todas las miradas repararan en ella a pesar de que el empuje asiático en general, y surcoreano en particular, somete al mercado a una evolución impresionante, jalonada ya en 2010 con la irrupción, con todas las de la ley, de la televisión 3D. Llegados a este punto, Philips no ha querido quedarse atrás, y muestra de ello es este modelo de la serie PFL9705 de 46”, el 46PFL9705, galardonado en la pasada edición de los premios EISA, organización europea de la cual esta revista forma parte, como el mejor televisor LCD-TV del año. Entre las razones esgrimidas, figuraban la “excelente compensación del movimiento”, el “vivo

En este caso, las series 9000 lucen la

un contraste de 10.000.000:1 excelente;

dinamismo de la imagen”, el “gran con-

variante Ambilight Spectra 3, cuyas com-

la tecnología Perfect Natural Motion,

traste” en blancos y negros, así como

binaciones de colores se ajustan mejor,

que asociada a la tasa de refresco de

“una buena reproducción de audio”, y la

según la marca, a los mostrados en pan-

pantalla de 400 hercios proporciona

“conexión inalámbrica a internet”.

talla y a las escenas en movimiento. Lo

unas imágenes en movimiento fluidas y

cierto es que, bajo nuestra experiencia

claras (excelente la experiencia, en este

con el televisor, la sensación inmersiva

sentido, al disfrutar de un partido de fút-

Por supuesto, este no es más que

resultó excelente, y le confiere al visio-

bol en HD en este televisor).

un avance relativo a sus capacidades,

nado una amplitud y una espacialidad

pero son otros muchos los argumentos

dignas de todo encomio.

TECNOLOGÍA PUNTERA

40

A pesar de ser un tope de gama que, por su propia filosofía, debe ir acom-

que lo convierten en un producto gana-

Por otro lado, varias son las tecno-

pañado de un sistema de cine en casa

dor. Para comenzar, la madurez de la

logías punteras de la marca que hacen

acorde, la 46PFL9705 funciona muy bien

tecnología Ambilight, que después de

aquí acto de presencia: el procesador de

en el plano sonoro, lo que eventualmen-

un tiempo de rodaje ya es connatural a

imagen Perfect Pixel HD, capaz de mo-

te a algunos usuarios les puede valer.

Philips y se revela ya no como un argu-

ver 500 millones de píxeles por segundo

Claramente se trata de una infraexplo-

mento de compra, sino como una de las

y ofrecer una imagen en alta definición

tación de sus posibilidades (videojuegos

razones principales que un usuario de

realmente excepcional; el panel LED

y películas en alta definición, por ejem-

Philips esgrime para seguir confiando

Pro, que incorpora iluminación trasera

plo), pero lo cierto es que sus altavoces

en la marca, ya que se suele decir que

avanzada para un mejor tratamiento del

frontales de cúpula y los woofers trase-

cuando pruebas el sistema Ambilight,

color, con negros que realmente lo son,

ros ofrecen un óptimo rendimiento, am-

difícilmente te acostumbras a otro tele-

y blancos que también parecen blancos,

parado también en unos 30 vatios RMS

visor.

con un consumo de energía moderado y

que se nos antojan ya con cierta dinámi-


ca, sobre todo para emisiones musicales en TDT. Pero si el televisor se dedica a la

Tv (limitada) a la carta con net tv

plasmación de películas y videojuegos en HD, la mejor experiencia inmersiva

A diferencia de las series meno-

ha de venir con la introducción de un

res de la marca, aquí Philips va un

equipo de cine en casa.

paso más allá y ofrece no una entrada Ethernet, sino WiFi integra-

alta definición increíble

do, con lo que ya no tenemos que

Ya entrados en materia, no ha de

preocuparnos de situar el router

resultar ninguna sorpresa que la alta

junto a él para disfrutar de su fun-

definición luce en este televisor de una

ción Net TV.

manera colosal. Probamos con fiche-

Lamentablemente, en España, más allá de servicios comunes como el tiempo,

ros MKV directamente conectados a su

vídeos de Youtube o Twitter, carecemos de televisión a la carta de nivel, y la poca

entrada USB, tanto en 720p como en

que existe (laSexta) no cuenta con un widget dedicado para la marca. Sí que dis-

1080p, así como con Blu-ray (la magní-

frutamos, en cambio, de acceso a TV3alacarta, el excelente canal de contenidos

fica Malditos Bastardos, de Quentin Ta-

online de Televisió de Catalunya, los que entendemos el idioma. Echamos en falta

rantino) y un videojuego a 1080p en PS3

otros canales presentes en plataformas como Sony PlayStation 3 (TVE, Antena 3,

como Virtua Tennis 3 y las sensaciones

laSexta), así como un videoclub online de nivel, al estilo de los presentes en otros

fueron excelentes, magníficas. Se nota

países, como Videoland (Países Bajos), Video Futur (Francia y Bélgica) y Film2Ho-

que este televisor está concebido para la

me (Escandinavia).

alta definición. La TDT, contra lo que se pudiera pensar por medidas y naturaleza del panel,

mes, y no nos referimos (que también) a

no se ve mal, pero ni el mejor chip de

la telebasura conceptual, sino a la tec-

procesamiento de imagen puede sub-

nológica.

sanar las lagunas y las deficiencias de

Por último, el televisor está prepara-

los canales digitales españoles, que en

do para las emisiones en 3D, gracias al

algunos casos realizan emisiones infa-

adaptador opcional PTA02

PROS Calidad de imagen y sonido en HD Ambilight en todo su esplendor Wi-Fi integrado

CONTRAS Net TV falto de widgets “jugosos” 3D opcional

LA FICHA Pantalla: LED de 46 pulgadas Resolución: 1.920 x 1.080p Refresco: 400 Hz Contraste dinámico: 10.000.000:1 Luminosidad: 500 cd/m2 Wi-Fi: 802.11 B/G/N Sonido: 30 WRMS Sintonizador TDT-HD: Sí Conexiones: 4 HDMI, 2 euroconectores, USB, Ethernet DLNA, conexión PC, Wi-Fi MediaConnect. Peso: 23 kg Dimensiones: 67,1x108,8x6,9 cm Precio: 2.300 euros

900 800 655 | www.philips.es

41


PROBAMOS

Centro Multimedia WD TV Live Hub Un reproductor HD para múltiples formatos Western Digital lanzaba a finales del año pasado su nuevo centro multimedia para reproducir música, imágenes y vídeo en alta definición. Cuenta con 1TB de capacidad en su disco duro y puede reproducir archivos desde otros dispositivos. Un todoterreno multimedia.

José Óscar PLAZA.

Hace un par de años

aproximadamente, el lanzamiento del Western Digital WDTV Media Player causó sensación en todo el mundo. Sus prestaciones, poco o nada vistas en otros aparatos de la época, y su precio, menos de cien euros, resultaban idóneas para muchos usuarios que buscaban alimentar sus televisores HD: un pequeño aparato reproductor sin disco duro asociado, con dos entradas USB, salida HDMI y compatibilidad MKV se convirtió en el sueño húmedo para muchos.

ANTECESORES DE ÉXITO Al salir primero, dio dos veces, y solo Asus, con su OPlay, le pudo seguir la estela ya cierto tiempo después. Mientras

TV Live Hub, que VideoPopular ha tenido

Su conexión resulta muy rápida y

tanto, el Western Digital WDTV Media

la oportunidad de probar a conciencia.

sencilla. Una vez arrancado, nos apa-

Player forjó a su alrededor una comu-

Se trata de un centro multimedia que,

rece en pantalla un elegante menú

nidad de fieles los más avanzados de la

por un PVPR de 249 euros, ofrece esta

que juega con las transparencias y

cual hicieron sus pinitos en su persona-

vez sí almacenamiento de 1 terabyte;

los fondos temáticos para ofrecer un

lización y añadieron ciertas funciones,

acceso a internet y a determinados ser-

acceso muy, pero que muy intuitivo.

como la conexión Ethernet, que el hard-

vicios mediante widgets; reproducción

Dicha interfaz se basa en un desa-

ware original no contemplaba, a través

de vídeos, música y fotos y puerto Ether-

rrollo en XML conocido como Mochii,

de una de las entradas USB, y potencia-

net para configurar una red doméstica

y lo cierto es que está a la altura de

ron su interfaz de origen con nuevas y

y ofrecer ciertos servicios multimedia

las prestaciones del aparato: una na-

atractivas funciones, como el acceso a

y multiroom. Cuenta, además, con sa-

vegación fluida y eficiente, con una

bases de datos de carátulas y sinopsis

lidas HDMI 1.4, de vídeo componente y

traducción al castellano perfecta.

de cine.

de vídeo compuesto, además de salida

La prueba del algodón llega cuan-

Fue un tiempo después cuando llegó

digital de audio óptico, con lo que puede

do sometemos al reproductor de vídeo

su sucesor, el WDTV Live, que bajo una

conectarse con cualquier amplificador

a toda clase de archivos, sobre todo

carcasa muy parecida incorporaba, esta

para configurar un completo sistema de

MKVs en alta definición con diferentes

vez sí, el acceso vía Ethernet. Y todo, por

cine en casa.

bitrates: la conclusión es obvia, cono-

menos de 110 euros. Western Digital

42

ciendo los precedentes de la marca

volvía a dar la campanada, no solo con

EXCELENTES ACABADOS

con la línea WDTV: ningún fichero se

este producto, sino con todos los aso-

Su aspecto exterior es elegantísimo,

le resiste. Y todo, gracias la adopción

ciados de la marca que, a buen seguro,

gracias a unos acabados excelentes en

de un chip de procesamiento de vídeo

vivieron un subidón de ventas, como la

un negro mate, cepillado, en su parte

como el Sigma Designs SMP 8654AD,

línea de discos duros MyBook.

superior, que contrasta con el atractivo

un todoterreno que maneja la alta

Recientemente, a finales de 2010, la

negro piano de su franja frontal, y sus

definición en sus múltiples formatos

marca presentó una nueva evolución,

contenidas medidas, a pesar de alojar en

como el que oye llover: sin apenas

esta vez bautizada como Western Digital

su interior un disco duro de 2,5” y 1Tb.

esfuerzo.


El mando a distancia en dotación resulta cómodo al tacto gracias a su su-

CAPACIDAD MULTIFORMATO

perficie gomosa, que ayuda en pos de un óptimo agarre. Las funciones a las que

Cuando uno se topa con un repro-

permite acceso son claras y sencillas,

ductor de estas características,

y su uso no resulta nada engorroso. El

resulta más sencillo preguntarse

aparato resulta compatible con el man-

por cuáles son los formatos que no

do del WD TV Media Player y del Live,

reconoce, antes de repasar los que

más pequeño pero también con menos

sí que reproduce.

opciones.

Por poner unos ejemplos, el Western Digital TV Live Hub se atreve has-

WIDGETS DE ACCESO A LA RED

ta con los BD-ISO (ripeos de Blu-ray sin menús) y con su equivalente en formato DVD,

En cuanto a los servicios de red precon-

los DVD-ISO (menús incluidos). En cuanto a MKV, el chip Sigma Designs 8654 se basta y

figurados, el aparato ofrece acceso los

se sobra para reproducir cualquier fichero por pesado que sea, incluidos los High@L5.1,

videoclubs online Netflix y Blockbuster

la prueba del algodón para muchos reproductores, que se suelen atragantar con este

On Demand, que solo operan en Estados

tipo de codificación.

Unidos. La radio Pandora se encuentra

Tampoco los subtítulos en sus múltiples codificaciones representan problema alguno

en la misma situación; ninguno de los

para este dispositivo, compatible con toda clase de ficheros (SRT, ASS, SSA, SMI y SUB)

tres aparece en la versión europea que

y sensible a todas las peculiaridades del castellano (tildes, ñ, etcétera), además de con-

se comercializa en España. De más uti-

figurables en color, tamaño o posición.

lidad son los widgets de YouTube (para subir y ver vídeos), Flickr (para subir y

PROS

ver fotos) y Facebook (como red social),

con el aumento de los tiempos de trans-

pero todo cobra sentido si nos hacemos

ferencia que supone. Y es que una de las

con un teclado (preferiblemente ina-

operaciones más lentas que pudimos

Reproducción de múltiples formatos

lámbrico) desde el cual operar y entrar

realizar con este aparato fue el traspaso

Conexión con otros dispositivos

información a cualquiera de estas apli-

de información de un disco duro exter-

Diseño ligero y compacto

caciones. También cuenta con otros ser-

no a la unidad interna de 1 Terabyte, un

vicios menos importantes, como Live365

proceso que se nos antojó demasiado

(radio), Accuweather (meteorología) y

lento, no sabemos si por la velocidad del

MediaFly (podcasts).

procesador, pero sospechamos que si

No cuenta con WiFi ni USB 3.0 No compatible con iTunes y similares.

Y vamos con los hándicaps, porque

incorporara USB 3.0 y se vinculara con

los tiene. Para empezar, la ausencia de

otra unidad de almacenamiento provista

un navegador de internet, más allá de

del mismo estándar, nuestra impresión

los widgets predeterminados, lo deja en

sería radicalmente diferente.

CONTRAS

LA FICHA

situación de inferioridad con respecto

También sorprende en el Western Di-

a otros dispositivos de salón, como los

gital TV Live Hub la ausencia de WiFi en

Resolución vídeo: Hasta 1080P.

HTPCs, que además suelen rondar pre-

forma nativa. Sí que es cierto que pode-

Voltaje de entrada CA: 100-240 VCA.

cios similares en sus configuraciones

mos acoplarle una llave que nos propor-

Frecuencia de entrada CA: 50-60 Hz.

más básicas. Además, aunque no re-

cione acceso inalámbrico, pero supon-

Conexiones: Dos puertos USB, salidas

sulta necesario para disfrutar de 1080P,

dría un aumento de su coste y perder

HDMI, A/V compuesto, Gigabit Ethernet,

sorprende que Western Digital no haya

una de las entradas USB, que precisa-

Vídeo por componentes y audio óptico.

incorporado alguna entrada USB 3.0,

mente no sobran

Formatos de vídeo compatibles: Avi, Mpg/

Capacidad de almacenamiento: 1 TB

Mpeg, Vob, Mkv, TS/TP/M2T, Mp4/Mov, M2TS, WMV9. Servicios Internet: Netflix, Blockbuster, YouTube, Facebook, Pandora, Flickr, Live365, Mediafly, AccuWeather. Idioma: Multilenguaje. Dimensiones: 154x198x31,7 mm Precio: 249 euros. www.westerndigital.com

43


PROBAMOS

MacBook Air 11 pulgadas La potencia de un Mac en tamaño compacto Con 1,7 cm de ancho en su parte más fina y poco más de un kilo de peso, el MacBook Air de 11” ofrece todas las prestaciones de un Mac con unas dimensiones ultrarreducidas. Aunque está pensado especialmente para navegar por la web, realizar trabajos de ofimática y reproducir archivos, también responde correctamente en la edición de fotografías y vídeos.

José Óscar PLAZA.

En 2009, Steve Jobs,

mandamás de Apple, señaló que los netbooks “no son realmente buenos en nada”. Obviamente, sí que tienen su público y sus prestaciones suelen ser suficientes para quienes apuestan por la movilidad y tareas básicas de ofimática y navegación por internet. Un año después, a finales de 2010, Jobs anunciaba en la Keynote del 20 de octubre el lanzamiento de la revisión de los MacBook Air, con tamaños de 11,6 y 13 pulgadas. Más que de un netbook, hablamos

(a 1,4 GHz en esta versión más básica).

aquí de un ultraportátil por su calidad y

Sin embargo, la unión de este procesa-

sus prestaciones. La marca de Cuperti-

dor con los dos gigabytes de RAM y los

no ha conseguido con el MacBook Air un

64 gigabytes de almacenamiento en uni-

Dimensiones reducidas

ordenador con un rendimiento excelente

dad SSD (estado sólido) ofrecen un ren-

Alto rendimiento de las aplicaciones

bajo un chasis ligerísimo, que apenas

dimiento espectacular, solo un poco por

Trackpad multitáctil

sobrepasa el kilogramo de peso (1,06 kg)

debajo de un MacBook Pro.

y que funciona como un tiro.

La clave está en la unidad SSD, que

PROS

CONTRAS

Cuando Jobs presentó las caracte-

proporciona acceso inmediato a las apli-

rísticas de esta máquina, muchos se

caciones y permite arrancar la máquina

Poco espacio en disco

echaron las manos a la cabeza al ver

en tan solo un segundo si la tenemos en

Ralentización en tareas pesadas

que Apple recurría a un procesador en

reposo, estado en que su batería aguan-

teoría caduco como el Intel Core 2 Duo

ta hasta 30 días

FLASH, LA CRIPTONITA DEL MACBOOK AIR

LA FICHA Pantalla: Panorámica retroiluminada por LED de 11,6 pulgadas. Procesador: Core 2 Duo de Intel a 1,4GHz,

Cabe señalar que, de inicio, el nave-

3 MB de caché de nivel 2 integrada.

gador Safari no soporta Flash, una

Memoria: 2 GB de SDRAM DDR3 a 1.066

tecnología esta que se comporta en

MHz en placa (máximo 4 GB).

alianza con un MacBook Air como la

Conexiones: Dos puertos USB, Mini

criptonita con Superman: dejándole

DisplayPort, MagSafe, auriculares,

sin fuerzas para seguir. Y es que, en

micrófono.

nuestras pruebas, hemos pasado de

Vídeo digital: Salida DVI, salida VGA,

contar con una autonomía cercana

salida DVI de doble canal y salida HDMI.

a las seis horas a quedarnos con algo menos de dos. Las últimas informaciones

Autonomía: 5 horas, 30 días en reposo.

apuntan a que Adobe está trabajando en una versión de Flash adaptada a los reque-

Dimensiones: 1,7x29,95x19,2 cm.

rimentos de la idiosincrasia de Apple. Más les vale si no quieren perder más cuota

Peso: 1,06 kg.

de mercado con HTML 5. 902 151 992 | www.apple.com/es

44


Buena Depth Cue v2 DigiEffects actualiza su pack de efectos para After Effects Buena Depth Cue v2 es un paquete de seis plugins de fácil uso, ya que no cuentan con engorrosas opciones de configuración, que, en unos casos, ofrecen funciones no disponibles por defecto en After Effects y, en otros, facilitan el trabajo reduciendo considerablemente el número de horas necesarias para lograr el efecto deseado.

Ramón Cutanda.

El plugin Depth permi-

te generar con gran rapidez y sencillez máscaras de grises de los elementos de una escena, según su posición en el eje Z, que podremos usar luego con el plugin Lens Blur, incluido en After Effects. Rack Focus nos permite centrar el punto de interés de una escena mediante cambios de enfoque controlados que, de otro modo, son bastante complicados de lograr. Falloff Lighting, por su parte, permite que la luz de los focos creados con AE se comporte como si fuera luz natu-

de una foto o vídeo 2D para recrear luego

ral, es decir, disminuyendo su intensidad

un escenario 3D en el que poder mover

con el cuadrado de la distancia en lugar

una cámara virtual. Hay ciertas limita-

de mantener una intensidad constante,

ciones, pero las posibilidades son real-

Posibilidades creativas

como sucede por defecto. Este plugin

mente interesantes. Por último, Flipside

Precio del paquete

permite, además, usar otros comporta-

permite asociar con facilidad caras b a

Facilidad de uso

mientos de luz personalizados.

objetos planos, como tarjetas o papeles,

Atmosphere, como su nombre sugiere, permite añadir atmósferas a una es-

sin el problema de la separación entre

PROS

CONTRAS

objetos de un píxel.

cena para recrear humo o niebla y, así,

En la web oficial hay versiones de

acrecentar la sensación de profundidad

prueba y numerosos proyectos de ejem-

de campo. Camera Mapper facilita enor-

plo y videotutoriales para ver este pack

memente la tarea de separar elementos

en acción

Sin versión ni soporte en castellano Documentación escasa en algunos plugins

LA FICHA

LOS PLUGINS, TAMBIÉN POR SEPARADO

Requisitos: After Effects 7 o posterior.

Cuatro de los seis plugins que com-

After Effects CS5 para trabajar en 64 bits.

ponen Buena Depth Cue v2 (Atmos-

OS X 10.4 o posterior.

phere, Depth, Camera Mapper y Fallof

XP Professional SP2 o posterior.

Lighting) están disponibles de forma

Para Mac: Procesador G4, G5 o Mac Intel.

independiente, mientras que Rack

Para PC: Intel Pentium 4 o AMD Athlon XP

Focus y Flipside únicamente están

o posterior.

disponibles adquiriendo el paquete

Mínimo de 2 Gbytes de RAM para todos

completo, cuyo precio, por cierto, es

los sistemas.

inferior a lo que costarían los cuatro plugins independientes si se compraran por

Precio: 199 dólares (nueva licencia).

separado. En diciembre, DigiEffects anunció un cambio en su estrategia de mercado

Actualización: 99 dólares.

y, además de los plugins de Buena Depth Cue, ya es posible adquirir de forma independiente otros plugins incluidos en sus otros paquetes Delirium y Damage.

+01 910 473 5169 | http://digieffects. com/product/buena_depth_cue

45


FUNDAMENTOS

lápiz, celo e imaginación El grafeno, un premio Nobel en el lapicero

Tome un lápiz y haga una raya en un trozo de papel. El trazo que ha dibujado está formado, en parte, por el material que les ha valido el premio Nobel de Física del año 2010 a los científicos Andre Geim y Konstantin Novoselov de la universidad de Manchester: el grafeno. Por Luis Carlos PARDO, doctor en Ciencias Físicas por la UPC luis.carlos.pardo@upc.edu

Imaginemos un laboratorio de investigación puntera en nuevos materiales. Durante los últimos 30 años, muchos científicos habían intentado crear una lámina ultrafina de carbono de un grosor de un único átomo. Algunos de ellos, sin éxito, partiendo trozos de grafito una y otra vez hasta crear láminas finas, pero no tan finas como las que buscaban. Nuestros visionarios científicos lo intentan de nuevo y se disponen a realizar el experimento con materiales de última generación: un lápiz y celo. Para conseguir una capa monoatómica de carbono, Andre Geim y Konstantin Novoselov tomaron un trozo de grafito como el que se utiliza para fabricar los lápices. Adhirieron cinta adhesiva a este bloque de manera que al arrancarla se quedaron pegadas algunas capas de grafito. Repitiendo el proceso una y otra vez consiguieron crear capas de grafito

El grafeno está compuesto por átomos de carbono que constituyen un entramado con forma de panal de abeja. El material resultante es 200 veces más resistente que el acero.

cada vez más finas. El análisis de la sustancia final demostró que se trataba, en

bierta la molécula que lleva su nombre.

entre átomos de la naturaleza y están

parte, de películas de carbono del gro-

Remontándonos aún más en el tiempo,

presentes, por ejemplo, en todos los

sor de un sólo átomo: el grafeno.

el carbono es la base de los plásticos

derivados del carbono. Para entender

De hecho, esta es la última sorpre-

omnipresentes hoy en día. De hecho,

cómo funciona este pegamento hay que

sa que nos ha dado el carbono, pero no

incluso la naturaleza escogió este ma-

fijarse en la nube de electrones que se

la única. El premio Nobel del año 1996

terial para formar todos los seres vivos

mueve alrededor de cada átomo.

se concedió a Kroto, Curl y Smalley por

que conocemos. ¿Qué tiene de especial

sus investigaciones sobre moléculas gi-

el carbono?

gantes de carbono, algunas de ellas con

46

Para unir dos átomos por medio de un enlace covalente, éstos comparten algunos electrones exteriores de su nube. Si

forma de balón de futbol. Esta molécula

Montando el puzzle

la nube de electrones resultante de esta

gigante de carbono fue nombrada fule-

Una gran parte de la materia está cons-

unión es más estable que la de los áto-

reno en honor al arquitecto Buckmins-

tituida por átomos que se enlazan unos

mos aislados se forma una molécula,

ter Fuller. Éste utilizó las mismas es-

con otros gracias a lo que se conoce

quedando entonces fuertemente unidos.

tructuras para crear cúpulas altamente

como “enlaces covalentes”. Son los res-

Además este pegamento es direccional,

resistentes, antes de que fuera descu-

ponsables de las uniones más fuertes

de manera que podemos imaginar un


átomo como una pieza de puzzle tridimensional. En el caso del carbono, esta

El premio IG Nobel

pieza puede adoptar tres formas diferentes. En compuestos como el CO2 los

La revista Annals of Improbable Research (Anales

átomos de oxígeno se alinean dejando al

de investigación improbable) ha creado los pre-

carbono en medio. En el diamante, en

mios Ig Nobel, una sátira de los premios Nobel

cambio, la pieza tiene forma de pirámide

que se da a investigaciones científicas, cuando

tetrahédrica, de manera que se puede

menos, curiosas. Andre Geim ha tenido el honor

unir con cuatro átomos de carbono for-

de ser el primer ganador de este galardón y del

mando una compleja estructura tridi-

premio Nobel dado por la Real Academia de las

mensional. En el caso del grafeno, un

Ciencias de Suecia. El premio Ig Nobel se lo con-

átomo de carbono está en el centro de

cedieron por sus experimentos de levitación de

un triángulo, en los vértices del cual hay

ranas con imanes. De hecho, en la ceremonia de

otros tres átomos de carbono. Al repetir

concesión del premio Nobel mencionó su premio

este triángulo se forma una estructura

Ig Nobel, sacando una conclusión de él: no te tomes tu investigación científica

en forma de panal de abeja, creando un

demasiado seriamente.

material 200 veces más resistente que el

Se ha demostrado que la conductividad del grafeno es más alta que la de cualquier metal conocido

El carbono dispone de cuatro elec-

cho, se ha demostrado que la conducti-

trones para formar uniones, por lo tan-

vidad del grafeno es más alta que la de

to, si forma enlaces dobles como en el

cualquier metal conocido.

caso del CO2, comparte dos electrones con cada átomo de oxígeno. Si forma

Pantallas plegables

una estructura tetrahédrica como en el

El grafeno está formado, por lo tanto,

caso del diamante, comparte entonces

por una capa de átomos de carbono

un electrón con cada átomo de carbono

unidos de tres en tres de manera cada

vecino. El caso más interesante sucede

uno cede un electrón que le sobra al

acero. Pero lo que hace interesante este

cuando forma una estructura con tres

enlazarse con sus vecinos. La conduc-

material son sus propiedades eléctricas,

vecinos, como en el grafeno. Entonces

tividad eléctrica excepcional que le con-

y para entenderlas tenemos que volver

sólo se utilizan tres de los cuatro elec-

fiere esta estructura hace que al pasar

de nuevo a los electrones responsables

trones, quedando el cuarto libre para

la corriente el material se caliente muy

de los enlaces.

poder conducir la electricidad. De he-

poco. Por si fuera poco, las monocapas de grafeno se pueden deformar, son resistentes y son transparentes. Esto ha permitido crear los primeros leds orgánicos (OLED) que utilizan como ánodos grafeno, de manera que ya es posible construir pantallas plegables. El grafeno también se ha propuesto como una alternativa al silicio, que es altamente contaminante. Según algunos, la posibilidad de crear transistores más rápidos y más pequeños con este material amenaza incluso con cambiar el nombre de

Ya se han creado los primeros led orgánicos (OLED) que utilizan ánodos de grafeno, lo que permite construir pantallas plegables.

silicon valley por el de graphene valley. La vida está basada en el carbono, pero parece que en los próximos años también la electrónica estará basada en este material. Y todo gracias al trabajo de dos visionarios que jugaron con mina de lápiz y celo. Y es que, como decía Einstein, “la imaginación es más importante que la sabiduría”.

47


PANORAMA

RODAJE 3D

Las tres dimensiones reclaman su espacio en los hogares Asociada tradicionalmente a la industria cinematográfica, la tecnología 3D ha traspasado los límites de la gran pantalla para irrumpir con fuerza en el mundo de la televisión. Películas, corridas de toros, conciertos y partidos de fútbol en 3D reclaman su espacio en la pequeña pantalla mientras los fabricantes de equipamiento profesional se afanan por lanzar productos que allanen el camino a la hora de rodar en tres dimensiones.

Celia LÓPEZ.

En una época en la que mu-

chos auguran malos tiempos para la industria cinematográfica, el séptimo arte se ha visto obligado a reinventarse y cada vez son más los que apuestan por las tres dimensiones para seguir llevando espectadores a las salas. Pero el cine estereoscópico no es algo nuevo. Ya en 1922 los cines de Los Ángeles proyectaron la primera película en 3D, The Power of Love, que aunque no tuvo mucho éxito entre el público, sí que despertó el interés por la producción en tres dimensiones. La Segunda

Bwana Devil (1952), de Arch Oboler, Los crímenes del museo de cera (1953), de André de Toth, o la más conocida Crimen perfecto (1954), de Alfred Hitchcock. No obstante, las salas no estaban adaptadas y los fallos de sincronización provocaban dolores de cabeza a los espectadores, por lo que el cine en 3D volvió a quedar nuevamente en el olvido. Con el paso de los años se siguieron haciendo tímidos intentos de resucitar el 3D, aunque el verdadero impulso al cine tridimensional no llegó hasta 2009, con la taquillera Avatar, de James Cameron.

en los hogares. La televisión del futuro también apuesta por la tridimensionalidad, y los grandes eventos deportivos se postulan como los grandes impulsores. El pasado año ya pudimos disfrutar en 3D del torneo de tenis Roland Garros, que se convirtió en la primera emisión esteoroscópica de un gran evento deportivo de Europa. El fútbol y los toros tampoco quisieron permanecer ajenos a la revolución tridimensional y algunos privilegiados pudieron vibrar en tres dimensiones con los goles de sus selecciones en el Mun-

Guerra Mundial supuso un freno a las

48

que viene pisando fuerte para imponerse

producciones tridimensionales, que vol-

eventos deportivos

dial de Sudáfrica o ver corridas de toros

vieron a vivir una época de auge en los

Pero el mundo 3D no se ha quedado en

como si estuvieran en la plaza.

años 50, con el rodaje de películas como

las fronteras de la gran pantalla, sino

El mundo de la música también ha


descubierto el filón del 3D y ya hemos podido disfrutar en relieve de los direc-

3D también para VIDEOaficionados

tos de Enrique Bunbury y de Alejandro Sanz, o de los videoclips en tres dimen-

jvc gs-td1

siones de grupos como Radiohead o Si-

JVC lanzará en breve la GS-TD1, que graba

niestro Total.

vídeos tridimensionales en Full HD. Para ello, usa dos lentes y dos sen-

grabar en 3d

sores CMOS de 3,32 megapíxeles, que

Hasta hace poco, para grabar en tres

permiten capturar dos imágenes HD a

dimensiones eran necesarias dos cá-

1.910 x 1.080i de forma simultánea. Cuen-

maras, una para la visión de cada ojo,

ta también con una pantalla LCD de 3,5”, que permite visualizar las imágenes en

que se colocan sobre rigs que permiten

3D sin necesidad de gafas especiales. 902 39 39 29 | http://jsp.jvc-europe.com

controlar las ópticas, la convergencia y la separación de las cámaras. El pasado año, Panasonic Broadcast

sony hdr-td10

allanó el camino de la tridimensionali-

Sony también contará en su catálogo con vi-

dad con el lanzamiento de la AG-3D1, la

deocámaras 3D, como la compacta Bloggie

primera videocámara profesional que

3D o la más ambiciosa HDR-TD10, que incor-

integra una doble óptica, ofreciendo así

pora dos lentes Sony G, dos sensores CMOS

la posibilidad de grabar imágenes Full

HD 3D con una sola cámara.

Exmor R y dos procesadores de imagen BIONZ. También dispone de zoom óptico de 10x, memoria flash de 64 GB y ranura SD. Su pantalla LCD táctil de 3,5 pulgadas permite ver las imágenes tanto en 2D como

Los fabricantes han invertido grandes esfuerzos en desarrollar productos para facilitar el rodaje

en 3D, sin necesidad de utilizar gafas. Se estima que su precio rondará los 1.500 dólares (1.110 euros). 902 40 21 02 | www.sony.es

Panasonic HDC-SDT750 La apuesta doméstica de Panasonic es la HDC-SDT750, que dispone de un componente óptico para grabar imágenes en

Los fabricantes de equipamiento pro-

3D. Con un precio de 1.499 euros, esta

fesional han invertido grandes esfuerzos

videocámara cuenta con el sistema 3MOS,

en desarrollar productos que faciliten el

que proporciona imágenes de 7,59 megapíxeles efectivos (2,53 x 3); grabación

rodaje y la postproducción en 3D, como

1.080/50 para imágenes impactantes; modo iA; sistema de estabilizador óptico Hy-

rigs, ópticas, procesadores, mezclado-

brido O.I.S., etc. 93 425 93 00 | www.panasonic.es

res audiovisuales o monitores. El sector de la electrónica de consumo tampoco se ha quedado a la zaga. En los últimos tiempos, ha proliferado el lanzamiento de televisores 3D que intentan trasladar la experiencia tridimensional a cada vez más hogares, aunque lo cierto es que todavía son muy pocos los afortunados que cuentan con uno de estos aparatos en casa. Hasta el momento, uno de los mayores detractores era la necesidad de utilizar gafas de obturación activa, pero esta limitación tiene los días contados. Toshiba ya ha anunciado que este 2011 llegarán al mercado los primeros televisores 3D que no necesitarán gafas. Sin duda, una gran noticia para una tecnología que esta vez sí que ha vuelto para quedarse.

49


PANORAMA Para un control completo de las cámaras

VISUALIZACIÓN

inition bolt side-by-side 3d rig

Para profesionales

Este rig profesional de Inition puede ubicar una amplia gama de cámaras, desde

PANASONIC BT-3DL2550 Panasonic diseñado

las pequeñas Iconix y Toshiba IK-HD1 hasta cámaras profesionales tan populares ha es-

como la HDV y la XDCAM EX. Permite un completo control de ambas cámaras (alineación y balanceo) para

pecialmente

la alineación y corrección de la geometría.

este

Viene con dos zapatas rápidas Ronford

monitor

LCD 3D FULL

Baker y puede montarse sobre un trí-

HD de 25,5 pul-

pode estándar o sobre una steadycam.

gadas para un uso profesional. Con

www.inition.com

una pantalla de 1920 x 1200 IPS, este monitor cuenta con un filtro polarizador XPOL e incluye 2 gafas 3D BTPGL10G con polarización pasiva.

Rango interaxial: 60-120 mm Axis ajustables: 3 Axis motorizables: 2 Zapatas: 2 Ronford Baker

Requerimientos de trípode: Con capacidad mínima de 10 kg Precio: 8.671,21 euros

93 425 93 00 | www.panasonic.es

Una visión perfecta

Mezclar las dos cámaras en tiempo real

sony LMD-2451TD

jvc IF-2D3D1

Este

monitor

Además de llevar a cabo la conversión de vídeos 2D a 3D en tiempo real, el pro-

de 24” cuenta

cesador de imagen IF-2D3D1 se utiliza durante las grabaciones 3D para mezclar

con

pantalla

los canales de vídeo izquierdo y derecho, permitiendo el visionado 3D en la misma

LCD con reso-

localización del rodaje y acortando así los tiempos de producción. Está montado

lución WUXGA

sobre una robusta carcasa metálica de 1 unidad de rack y es compatible con la

(1.920 x 1.080

mayoría de formatos de

píxeles), que ofrece un excelente án-

señal en alta definición.

gulo de visión. Incorpora la tecnología

902 513 660 | www.jvcpro.es

ChromaTRU de Sony para el ajuste de color, un filtro micro-polarizador acoplado al panel LCD y viene con gafas 3D con filtro polarizador circular.

Entradas: 2 entradas HDSDI 3 GB/sg con salida en bucle (capacidad 1080 p) y 1 HDMI Salidas: 2 salidas HDSDI 3 GB/sg y 1 HDMI Alimentación: AC120 - 240 V

Consumo: 10 W (aprox.) Dimensiones: 430 x 49 x 242 mm Peso: 2,9 kg Precio: 26.100 euros

902 40 21 02 | www.sony.es

Experiencia 3D en el PC

Alineamiento de rigs 3D

nvidia 3d vision pro

DSC LABS FAIRBURN 3D Senior

Pensando en los profesionales, Nvi-

Diseñada por el veterano cinematógrafo B. Sean Fairburn, en colaboración con

dia ha creado 3D Vision Pro, una

DSC Labs, esta carta está especialmente pensada para el alineamiento de rigs

combinación de gafas inalámbricas

3D. Incluye alineamiento horizontal y vertical, guías de foco en las esquinas, anillo

de obturador activo, concentrador de

de disparidad de zoom, corrección de

comunicaciones por RF y software

keystone, escala horizontal en cm y

avanzado que convierte numerosas

pulgadas, mini escala de grises con

aplicaciones al formato 3D.

true-black, detectores de orienta-

www.nvidia.es

ción, guías de foco en el centro para el zoom cerrado, ChromaDuMonde, R rojo y L azul para detección de ojos, etc. www.dsclabs.com Dimensiones: 40 x 60 cm Peso: 1,10 kg

50

Precio: 1.093 euros


Grabador y reproductor en miniatura CONVERGENT DESIGN NANO3D

El Nano3D combina dos unidades NanoFlash sincronizadas, lo que permite configurar un sistema de

edición 3d Mezclador de audio y vídeo panasonic AG-HMX100E

registro o reproducción estereoscópica en campo. El NanoFlash es un grabador-reproductor en miniatura de señales HD, SD-SDI y HDMI. Graba en formato Quicktime o MXF bitrates desde 18 Mbps a 280 Mbps y sobre tarjetas Compact Flash. Otras funciones son la grabación en loop, Time Lapse, 7 segundos prebuffer, etc. www.convergent-design.com

Panasonic nos trae este mezclador audiovisual digital, compatible con los

Capacidad: hasta 64 GB (Compact Flash) Formato de grabación: MPEG2 4:2:2 Salidas y entradas de vídeo: Dual-Link HD SDI

Frecuencia de muestreo: 48 KHz Dimensiones: 75 x 95 x 107 mm Peso: 900 g Precio: 6.949 euros

formatos SD, HD y 3D. Con un precio de unos 5.100 euros, cuenta con pantalla LCD de 5,7” y está equipado con las funciones esenciales de los conmutadores de vídeo, los generadores de efectos de vídeo digital y las mesas

Un proyector de gama alta

projection design F10 AS3D

de mezclas. Incluye conexiones DVI-I para PC, salidas DVI-I para programa y multipantalla, entrada de micro,

F10 AS3D proyecta imágenes estereoscó-

auxiliar dual, salidas de audio (em-

picas tridimensionales activas con una ve-

bebido y analógico), etc. No funciona

locidad de refresco de 120 fotogramas por

con configuraciones mixtas HD y SD,

segundo, ofreciendo así una imagen sin par-

59,94 Hz y 50 Hz o 1080i y 720p.

padeos ni cambios de color ni de ángulo de

93 425 93 00 | www.panasonic.es

visión. Gracias a su tecnología DLP con una resolución de 1.400 x 1.050 píxeles y su compatibilidad con hasta 1.080 p, este proyector 3D estéreo portátil es una excelente opción para quienes buscan un alto rendimiento. www.projectiondesign.com

Edición profesional CINEFORM NEO3D

Resolución: 1.400 x 1.050 píxeles Luminosidad: 2.000 lúmenes ANSI (aprox.) Velocidades de refresco: 96-120 Hz Relación de contraste: › 3000 : 1

Colores: 30 bits (10 bits por color) Dimensiones: 268 x 300 x 104 mm (con lente) Peso: 3,5 kg (con lente de zoom) Precio: 15.100 euros

Conversión a gran angular Zunow WDA-06P kit

Desarrollado para cine 3D, broad-

Zunow ha creado el conjunto de lentes de conversión a gran angular para la

net, este software permite la edición

cámara Panasonic AG-3DA1. El kit WDA-06P, que incluye dos lentes sincroni-

y postproducción en tiempo real con

zadas fabricadas en cristal de alta calidad, ha

mínimas pérdidas de calidad. Ofrece

sido diseñado para ampliar el rango de dis-

corrección de color no destructiva y

tancias que permite la cámara. La AG-3-

manipulación de las imágenes en el

DA1 normalmente necesita una distancia

módulo First Light. Con versiones

de trabajo de 2 a 3 metros, pero, gracias a

para Windows y Mac, es compati-

estas lentes, la distancia mínima para que

ble con todas las aplicaciones que

el efecto 3D sea confortable se reduce a

soporten archivos Quicktime o Avi,

los 45 cm. www.zunow.tv

incluyendo Adobe CS3, CS4 y CS5;

cast, Blu-ray y distribución por Inter-

Apple Final Cut Studio; Avid Media Distancia mínima al objeto: 45 cm Factor: x0.6 Actuación con zoom: Sí

Peso: 200 g Precio: 1.430 euros

Composer 5; Sony Vegas, etc. Cuesta unos 2.500 euros. www.cineform.com

51


TÉCNICA

CEROS Y UNOS DE CINE Cinematografía digital (2ª parte)

La digitalización del cine es ya una realidad palpable. Las cámaras de cine son completamente digitales y, como resultado, sus imágenes están formadas por ceros y unos. Silencio, cámara, acción. Las imágenes de ‘lo digital’ ya están convenciendo a la industria desde el momento mágico de la captación del plano. Por Carlos MEDINA, profesor de Imagen en el IES Puerta Bonita y especialista en Tecnología Digital en el Máster en Cinematografía Digital, Nuevos Formatos y Medios Audiovisuales de la ECAM (Madrid).

En un artículo del número 138 de VídeoPopular ya comentamos que la cinematografía digital es presente, que ha venido para quedarse y que, según avanza, se convierte en pasado. El director francés Jean-Luc Godard ya banalizó sobre la importancia de lo digital: “Cómo es posible que todavía se pueda hablar de rodaje. Cuando en poco tiempo todo sea digital, el término será aún más ridículo”. Una fecha: junio de 2000, Star Wars: Episodio II - El Ataque de los Clones. Fue la primera película importante realizada utilizando cámara y cinta de vídeo digitales de alta definición, a 24 fotogramas por segundo, en vez de celuloide. Fue el principio de la revolución hacia lo digital, pero todavía no estábamos preparados. Hablar de cine digital supo-

52

‘Star Wars: Episodio II - El Ataque de los Clones’ fue el principio de la revolución hacia lo digital

Ha sido fundamental la aparición de nuevos diseños de sensores, basados en tecnología CMOS y/o CCD.

diferenciaba dos velocidades de adap-

resolución de las imágenes (número de

tación al entorno digital: por una parte,

líneas por milímetro o píxeles horizon-

la producción (rodaje) y, por otra, la dis-

tales por verticales; a mayor número de

tribución y la exhibición. En la actuali-

líneas o píxeles, más detalle). En este

dad, la primera está más que asentada

sentido, ha sido fundamental la apa-

y solamente nos queda disfrutar de los

rición de nuevos diseños de sensores,

resultados.

basados en tecnología CMOS y/o CCD,

El cine basado en procesos de pro-

y, sobre todo, el tamaño, concretamente

ducción sobre celuloide supone un an-

Súper-35, que marca la gran diferencia

ne obtener unos resultados próximos a

helo del pasado, pero sigue siendo fun-

con las cámaras de vídeo (ver cuadro de

lo que el cine en celuloide es capaz de

damental tenerlo como referencia para

la página siguiente).

ofrecernos. Jessica Izquierdo Castillo,

obtener un cine digital adecuado y con

El principio de la descomposición de

en su tesis doctoral Distribución y ex-

garantías de mantener al espectador

la luz en los colores primarios, lo que

hibición cinematográficas en España. Un estudio de situación del negocio en la transición tecnológica digital (2007),

cerca de la gran pantalla.

se conoce como señal RGB (Red=Rojo,

Uno de los parámetros que el cine

Green=Verde y Blue=Azul), es otro de los

digital debe ofrecer con garantías es la

avances imprescindibles para entender


que la imagen electrónica sea de mayor calidad.

2K VERSUS 4K

El tercer aspecto a tener en cuenta es el método de exploración utilizado en

El término 2K supone 2.048 x 1.080 píxeles por cada frame (recomendación DCI). El

la formación de la imagen. En este caso,

muestreo es RGB 4:4:4 con profundidad de color mínima de 10 bits, utilizado para el

solamente se pueden considerar cerca-

escaneo de la película 35 mm y muy frecuentemente para la exhibición de películas

nas al cine aquellas imágenes obtenidas

en las salas.

por un escaneo progresivo (designadas con la letra “p”, progressive scan).

Los parámetros exigidos para la producción en cine digital se empiezan a establecer como mínimo en los 4K, como formato de imagen, con 4.096 x 2.160 píxeles

Con estos avances, las nuevas gene-

por cada frame (recomendación DCI), cuatro veces el área de 2K. Y, por lo tanto,

raciones de cámaras se pueden conside-

aumenta su consideración para ser el sucesor de la copia estándar de exhibición (35

rar claramente de cinematografía digi-

mm, ‘paso universal’) y convertirse en el formato de máster digital de cine.

tal, pero es necesario generar, procesar

Uno de los parámetros que el cine digital debe ofrecer con garantías es la resolución de las imágenes

Pero el futuro nos va a ir descubriendo imágenes con mayor “K”. Tipo Resolución Muestreo

2K DCI

2K DOG

4K DCI

4K DOG

2.048 x 1.080

2.048 x 1.556

4.096 x 2.160

4.096 x 3.112

RGB

RGB

RGB

RGB

Bits

12

12

12

12

Frame Rate

24

24

24

24

color que tenía la película tradicional. Lo

realidad de la producción cinematográ-

y almacenar esta señal RGB, la más

que se ha denominado “look y feel cine-

fica (grandes, medianas o pequeñas pro-

pura que nos dan los sensores. El mejor

matográfico”.

ducciones).

analógica-digital basada en la técnica

CUESTIONES POR RESOLVER

cenadas en distintos soportes digitales

de muestreo 4:4:4, con una cuantifica-

Pero todas las cámaras de cinemato-

(cintas, discos duros, memorias de es-

ción de 10 bits (o superior) lineales o

grafía digital tienen una doble cuestión

tado sólido, etc.), lo que en el cine todos

logarítmicos, la única respuesta válida

que resolver. Por una parte, el procesa-

conocemos como la película, ese ma-

para proyectar en pantalla grande con

miento de la señal obtenida, y, por otra,

terial flexible sobre el que se aplica la

una calidad de imagen suficiente, así

el almacenamiento de los datos digitales

emulsión fotosensible. Normalmente se

como para que pueda ser manipulada

obtenidos. Los avances en la electrónica

usan dos tipos generales de soportes de

en posproducción con suficiente rango

y la aparición de nuevos procesadores

película: el triacetato de celulosa (ace-

de intervención.

han dado como resultado formatos de

tato) y un polímero de poliéster sintético

Una señal RGB nativa y sin compre-

grabación distintos: algunos dedicados

conocido como ESTAR.

sión permitirá obtener un alto rango

exclusivamente al cine digital, y otros

Los soportes en cine digital son fun-

dinámico, alto contraste y una colorime-

adaptados a tipos de cámaras diferen-

damentales para soportar el número de

tría más próxima a la representación del

tes, permitiendo una adecuación a la

información digital necesario, y es, qui-

Estas señales procesadas son alma-

procesamiento actual es una conversión

Modelo de cámara

Sensor

Formato de grabación

5K Red Epic X S35

1x CMOS Súper 35 - 13.800.000 píxeles

REDCODE

4K Red One

1x CMOS Súper 35 - 12.000.000 píxeles

REDCODE

Genesis

1x CCD Super 35 - 12.400.000 píxeles

HDCAM SR

Arri Alexa A-EV

1x CMOS Súper 35 - 5.310.000 píxeles

ARRIRAW - SXS ProRes 4:4:4

Arri D-21

1x CMOS Súper35 - 6.220.000 píxeles

HDCAM SR

Sony F35

1x CCD Súper 35 - 2.000.000 píxeles

HDCAM SR

Sony SRW 9000 PL

1x CCD Súper 35

HDCAM SR

Sony PMW F3

1x CMOS Súper 35

XDCAM EX

Sony NXCAM

1x CMOS Súper 35

AVCHD

1x CMOS FF35 - 21.100.000 píxeles

H.264 (.MOV)

Canon EOS 5D MARKII

53


TÉCNICA pulado en un ordenador, donde tendrá lugar la verdadera construcción de una escena. En un breve plazo de tiempo, la producción se convertirá en el primer estadio de la post-producción”. Esto es, quizás, el gran cambio, la mayor novedad del cine en la actualidad. Jorge La Ferla, en el libro Cine (y) digital, expresa el estado en el que se encuentra el cine. “De este modo, la dirección de fotografía, la captura del sonido y la actuación, entre otros, se ven radicalmente sacudidos por esta digitalización del aparato cinematográfico. Y frente a

Solo ofreciendo calidad técnica y de contenidos se puede lograr que el espectador no abandone el CINE

estos cambios radicales y de las nuevas posibilidades que ellos acarrean, existen dos posibilidades: ocultarlos o usarlos zás, donde más limitaciones tienen los

UN GRAN ABISMO

equipos VTR/MTR de la cámara, dado

El cine de “ceros y unos” es un cine cu-

La digitalización en el cine ya no

que tienen que ser capaces de mover

yos principios tecnológicos a día de hoy

está en procesos separados y sin con-

un peso digital muy elevado por cada

son más próximos a los procesos utili-

tinuidad, sino que es un todo, donde

imagen.

zados en el entorno del vídeo y la televi-

se encuentran beneficios industriales,

Fue en el evento del NAB de Las Ve-

sión, pero sus resultados y parámetros

reducción de costes, integración con

gas del año 2001 cuando comenzó la

técnicos ponen de manifiesto el abismo

otros sectores y disciplinas y, cómo no,

cinematografía digital (producción, dis-

existente entre ambos. El cine es y será

creatividad y valores estéticos que están

tribución, exhibición, investigación, etc.),

el espectáculo de la gran pantalla, de la

presentes desde el primer eslabón de la

mientras que 2011 se puede señalar

sala oscura, del placer de las sensacio-

cadena de producción: la propia cámara

como el año que supone su consolida-

nes en el ver y el escuchar. Solamente

de cine digital.

ción. Lo digital ha invadido nuestras vi-

ofreciendo calidad técnica y de conteni-

das con un conjunto de términos, abre-

dos se puede lograr que el espectador

viaturas y denominaciones que suponen

no abandone el CINE, con mayúsculas.

¡Bienvenidos, ceros y unos de cine! Nota: Agradecimiento especial a EPC

la codificación de las imágenes y del so-

Como señala Lev Manovich en su

por las fotografías cedidas para este

nido con unos valores y unas asignacio-

libro ¿Qué es el cine digital?, “en la ci-

artículo. Fundada en 1987 por Eduardo

nes técnicas. En un principio extrañas,

nematografía digital, las tomas filmadas

Pérez Climent, la empresa lleva 20 años

pero cada vez más asumidas en nuestro

no serán el último estadio sino, simple-

ofreciendo servicios de alquiler de equi-

vocabulario.

mente, el material base para ser mani-

pos para la industria audiovisual.

Cine Analógico Tamaño del sensor

Resolución (en píxeles)

54

con fines creativos”.

Cine Digital

Vídeo HD

Negativo 35mm

Super-35 (24,4 mm x 13,7 mm)

2/3” e inferior (1” = 2,54 cm)

= › 3.000 (ancho)

2k (2.048 x 1.556) en Full Frame 3k (3.072 x 1.728) 4k (4.096 x 3.112) en Full Frame 5k (5.120 x 3.890)

1080p (1.920×1.080) 1080i (1.920×1.080) 720p (1.280 x 720)


GET CONNECTED WITH EISA...

JOIN EISA ON FACEBOOK - Watch us gathering news - Discover why we award our winners - Learn how to make your own movies -


EDICIÓN

match moving 24 trucos de magia por segundo

Hoy en día resulta prácticamente imposible encontrar un anuncio, serie o película en los que la ‘realidad’ no haya sido modificada o que no contenga algún elemento CGI (gráfico generado por ordenador). Los magos cuentan con su varita mágica y sus rápidas manos para generar sus trucos; los editores de vídeo, con su imaginación y el software. Por Ramón CUTANDA ramon.cutanda@videoedicion.org

‘Match Moving’ y ‘Motion Tracking’ son dos términos ingleses que no se suelen traducir al castellano y cuyos significados vienen a ser, respectivamente, “igualación de movimiento” y “seguimiento de movimiento”. Aunque son dos conceptos diferentes, están tan interrelacionados que suelen usarse como sinónimos, ya que, cuando seguimos algún punto de referencia de un vídeo, normalmente, es porque queremos igualar ese movimiento. El primer paso de cualquier edición es la selección de planos. Cuando ya tenemos todos los planos con el orden y duración que queremos, llega la hora de darle a la edición final un aspecto personalizado. Para lograrlo, necesitaremos realizar una gradación de color y, a menudo, usaremos varios filtros de vídeo para conseguir diversos efectos, como el aspecto de película antigua o de televisor de los 80, parpadeos, bordes personalizados, etc. También es habitual la inclusión de gráficos generados por ordenador (CGI) de todo tipo, desde texto simple hasta el complejo robot asesino

Con las técnicas de Match Moving y Motion Tracking se pueden insertar gráficos creados por ordenador en un vídeo con la posición, la orientación y el movimiento correctos.

más maléfico, pasando por generadores de partículas (fuego, polvo, líquidos, et-

personajes aparezcan rojos como toma-

Crear máscaras es tremendamente

cétera).

tes, necesitaremos proteger de alguna manera todas las zonas en las que la piel de los personajes sea visible. A esta protección de zonas se le llama máscara y, aplicando máscaras, podremos aplicar filtros únicamente a zonas específicas de la imagen sin que otras queden afectadas.

sencillo. Seleccionamos en el editor de

Selección de zonas El problema que surge con la gradación de color y con los filtros es que, por defecto, se aplican a toda la imagen. Si queremos darle un color más cálido a una escena, pero no queremos que los

56

vídeo que usemos la herramienta máscara y, clic a clic, taparemos todas las zonas a proteger. Puede ser entretenido, pero es sencillo. El problema de esta técnica artesanal es que un vídeo tiene, al menos, 24 fotogramas por segundo (en el caso del cine). Es posible animar


a mano unos pocos segundos, pero esta técnica es absolutamente inviable en se-

Software para Match moving

cuencias de larga duración. Hay aplicaciones de alto nivel, como

añadir CGI

Boujou y 3D Equalize, que, con un

Incorporar elementos no presentes en

precio de unos 7.500 euros, son de

la escena original supone un problema

uso exclusivo de grandes producto-

muy similar. Imaginemos que tenemos

ras. Algo parecido sucede con PF-

una escena editada en la que queremos

Track, que, por 4.500 euros, sigue

insertar una pegatina con un grafiti en la

sin estar al alcance de muchos.

tapa de un portátil. Es bastante fácil in-

Por un precio mucho más accesi-

troducir ese nuevo elemento en nuestro

ble para productores independientes, pero también con herramientas avanzadas,

vídeo deformándolo para adaptarlo a la

contamos con programas como Mocha (desde 568 euros) o Syntheyes (desde 288

superficie elegida. El problema aparece

euros). Por último, tenemos Voodoo Camera Tracker, que, a pesar de ser gratuito,

cuando el objeto modificado (la tapa del

cumple muy dignamente. Casi todos cuentan con versiones demo y están disponi-

portátil) o la cámara se mueven durante

bles para Windows, Mac y Linux.

la escena, ya que en ese caso tendremos que modificar a mano la posición de ese vídeo en todos los fotogramas de la se-

mos logrado la animación de la máscara

IGUALAR EL MOVIMIENTO

cuencia, lo que supone, al menos, 24 va-

o elemento CGI insertado mucho más

Cuando se emplea la técnica Match

riaciones por segundo.

fácil y rápidamente que haciéndolo a

Moving, o igualación de movimiento, en

mano fotograma a fotograma.

lugar de analizar sólo uno o dos puntos,

Motion Tracking

Al seguimiento de uno o varios pun-

como sucede en el Motion Tracking, se

La tarea de tratar la imagen por zonas

tos de referencia a lo largo de una toma

analizan decenas de puntos. Con toda

e insertar gráficos generados por or-

(en el ejemplo anterior, la tapa del por-

esa información, algunos softwares (ver

denador se simplifica enormemente

tátil) se le conoce como Motion Tracking

cuadro) son capaces de recrear la ubica-

cuando usamos uno o varios puntos de

(seguimiento de movimiento). Todos los

ción de los elementos de la escena en un

referencia en el vídeo y replicamos su

programas de composición, como After

escenario virtual tridimensional y crear,

movimiento en las máscaras que hemos

Effects, Motion, Combustion o Nuke (al-

asimismo, una cámara virtual que igua-

aplicado o en los objetos CGI que hemos

gunos de los más usados), cuentan con

lará el movimiento de la cámara original

insertado. En el ejemplo anterior, elegi-

una herramienta de Motion Tracking.

en dicho escenario virtual. En ese esce-

ríamos las esquinas de la tapa del por-

El Motion Tracking únicamente fun-

nario tridimensional podremos aplicar

tátil como puntos de referencia y asocia-

ciona correctamente cuando la cámara

máscaras y objetos con total precisión,

ríamos el movimiento de todas ellas a

y/o las máscaras y elementos inserta-

como un tatuaje en la piel de un perso-

las de la pegatina del grafiti que hemos

dos se mueven en 2D. El vídeo es, a fin

naje o una nave espacial.

insertado. Así, cada vez que una esquina

de cuentas, plano, sin profundidad, de

Suena complejo... porque lo es. No re-

del portátil cambia de posición, la esqui-

modo que el Motion Tracking no tiene en

sulta sencillo recrear un entorno 3D par-

na de la pegatina también lo hará, y de

cuenta los movimientos en el eje z, el de

tiendo de un vídeo 2D. De hecho, no es

idéntica manera. De ese modo, habre-

la profundidad.

posible lograr un buen resultado de forma automática y tendremos que echarle una mano al software de Match Moving que usemos indicándole algunos datos adicionales, como el tipo de objetivo usado y cuáles de los puntos analizados forman parte de un mismo plano o están alineados en cada uno de los ejes xyz. Afortunadamente, estas técnicas no son exclusivas de grandes productoras, ya que, con paciencia y ganas de aprender, cualquiera puede usarlas. Y es que incluso existen herramientas como Vodoo Camera Tracker y Blender, que permiten

Algunos softwares son capaces de recrear la ubicación de los elementos de la escena en un escenario virtual tridimensional.

crear escenarios 3D e imágenes 3D fotorrealistas de forma gratuita.

57


MAKING

sobredosis de fútbol Cómo funciona un canal 24 horas temático y de pago

La TDT de pago nació en España en verano de 2009 cuando nadie la esperaba, y fue Gol Televisión, el canal impulsado por Mediapro, el que abrió camino para su implantación, demostrando que los españoles están dispuestos a pagar por ver la televisión si reciben contenidos de calidad. Gol Televisión, poco tiempo después, es un canal consolidado y con buenas perspectivas porque es multiplataforma y no lo fía todo a la TDT. Finales de agosto de

nas operadoras de telecomunicaciones,

tons, máximo responsable del canal, es

2009. Arranca la Liga española de fút-

habida cuenta de que la TDT de pago no

emitir tres partidos de Liga de Primera

bol y los seguidores de la competición

se aprobó en España hasta, justamente,

división cada semana, uno de los cua-

no saben dónde van a poder seguir los

el 13 de agosto de 2009, deprisa y co-

les siempre será del Real Madrid o del

partidos. El pago por visión (PPV) al que

rriendo, con desmentidos incluso por

Fútbol Club Barcelona, por una cuota

muchos se habían acostumbrado con Di-

parte del propio Gobierno y de su vice-

mensual de alrededor de 15 euros. Este

gital + ha pasado a mejor vida a costa de

presidenta, María Teresa Fernández de

precio se sitúa muy por debajo de lo que

una fórmula ideada por Jaume Roures,

la Vega.

los usuarios estaban acostumbrados a

José Óscar PLAZA.

el poseedor de los derechos televisivos,

58

pagar, puesto que Digital +, la platafor-

entonces, de 20 de los 22 equipos de

LLEGA LA TDT DE PAGO

ma de televisión por satélite, emitía en

Primera y Segunda división e impulsor,

Pero, a punto de empezar la Liga españo-

exclusiva un partido cada domingo por la

tan solo un año antes, de un canal te-

la, el Gobierno aprueba la TDT de pago,

noche y, para acceder a los nueve par-

mático de pago llamado Gol Televisión.

y Gol Televisión pasa a alcanzar grandes

tidos restantes, excepto al que emitían

En aquel momento, tan solo unos pocos

cotas de popularidad. La idea que mane-

la FORTA y laSexta la noche del sábado,

tenían acceso al canal través de algu-

jan el propio Roures y José Joaquín Bro-

había que abonar 12 euros en PPV.


Solo un fenómeno de masas como el fútbol podía popularizar en tan poco tiempo la TDT de pago. Y es que cabe recordar la marea de usuarios que buscaron e, incluso en algunos casos, pagaron a precio de oro los primeros decodificadores que la marca Engel Axil puso a la venta por aquel entonces, tanto tarjetas

El director de Gol Televisión, José Joaquín Brotons, recuerda la soledad de los inicios en verano de 2008

PCMCIA para adaptadores CAM de acceso condicionado como sintonizadores externos con conexión de Euroconector y ranura para tarjeta de pago. De aque-

Jaume Roures (izquierda), propietario de Mediapro, casa matriz del canal, y José Joaquín Brotons, director de Gol Televisión, en una rueda de prensa.

llos días queda la anécdota de ver al propio Roures en el palco del Camp Nou

otras marcas a la comercialización de

nal. Un año antes de que se pusiera en

para ver jugar en directo al FC Barcelo-

dichos aparatos, como Gigaset. Toda la

marcha la TDT de pago, concretamente

na contra el Sporting de Gijón, ya que ni

polémica acrecentó la fama del canal.

el 24 de junio de 2008, Brotons recibió

él mismo pudo conseguir un sintoniza-

el encargo de Mediapro de volver a Bar-

dor, en un intento de calmar los ánimos.

LOS SOLITARIOS INICIOS

celona (trabajaba por aquel entonces en

El caso es que Engel Axil dio la primera

El director de Gol Televisión, José Joa-

Madrid) para encargarse de la creación

y bien fuerte, puesto que no fue hasta

quín Brotons, conocido periodista de-

de un canal temático de fútbol. Tan solo

un tiempo después cuando se sumaron

portivo, recuerda los orígenes del ca-

dos meses después, a finales de agosto de 2008, el canal emitió por primera vez

originales promociones de navidad

durante 24 horas seguidas. Y entremedio, se contrató a gente y se habilitó una nave completamente vacía, la que es hoy

En su corta vida como canal, Gol

la sede de Mediapro en Barcelona, en el

Televisión se ha forjado ya una

distrito 22@.

merecida fama como ideador de

Pero durante ese año de espera a la

grandes campañas de marketing

llegada de la TDT de pago, el canal vi-

para la Navidad, momento en el

vió, en palabras de Brotons, “en cierta

que el número de abonados da un

soledad”, ya que solo se emitía a través

espectacular salto adelante.

de las plataformas de IPTV de Euskal-

Si en 2009 fue el mítico delan-

tel, Ono y Orange, lo que sirvió, por otro

tero brasileño Romario el que, ca-

lado, para afianzar la apuesta y poner en

racterizado como el rey Baltasar,

marcha todo el engranaje para que, lle-

nos sugirió Gol Televisión como

gado el momento de asomarse a la TDT,

regalo navideño, en 2010 los protagonistas han sido el futbolista Andrés Iniesta y el

el canal contara con cierto rodaje.

oso Tima, cuya relación de amistad se ha convertido en un referente para muchas

En palabras de Brotons, la llegada de

personas; no en vano, tras su lanzamiento en diciembre, el vídeo del spot se con-

Gol Televisión respondía a una pregunta

virtió durante tres días en el más visto de España y en el séptimo a nivel mundial en

que flotaba en el ambiente: “¿Por qué

Youtube, y alcanzó en pocas fechas más de 150 mil referencias en Google y casi siete

está dispuesto a pagar el televidente?”.

mil comentarios en el perfil de Facebook del propio Iniesta.

Dos años y medio después de su dubitativo arranque, la plataforma cuenta con

59


MAKING 17 y sub-20, y amistosos de selecciones internacionales. Fútbol, fútbol y más fútbol. “Esto es un canal para frikis”, como reconoce el propio José Joaquín Brotons, cuando se le pregunta por el público objetivo del canal, aunque añade que Gol Televisión “es un canal de televisión que da fútbol; no es un canal de fútbol”. La prioridad son las competiciones españolas, como han dado a conocer diversas encuestas que el canal ha realizado entre sus abonados, que lo que más valoran son la Liga BBVA, la Liga Adelante y la Copa del Rey, por delante de la Liga de Campeones y la Premier League, de ahí que la programación se adecue a los gustos de sus seguidores. A día de hoy, toda esta programación se emite no solo por la TDT, sino también a través de varios operadores de cable, como Ono, Telecable, Euskaltel, Jorge Nazar, Toni Padilla, Marcos López y Nico Rodríguez son algunos de los especialistas en fútbol que aparecen regularmente en las tertulias de Mundo Gol.

R, Aotec, Iseca y Orange TV, así como a través de televisión por IP (Imagenio), y mediante las redes móviles Movistar, Vo-

más de un millón y medio de abonados

peticiones internacionales de clubes,

dafone y Orange. Además, su propia web

en cualquiera de sus fórmulas (TDT,

Gol Televisión dispone de los derechos

(www.goltelevision.com) emite también

IPTV, plataformas móviles). La respues-

de emisión de la UEFA Champions Le-

diversos partidos en formato de pago por

ta a la pregunta es obvia.

ague hasta 2012, la Copa Libertadores y

visión. Y hay que mencionar también el

A principios de 2011, Gol Televisión

la Copa Sudamericana. También emiten

paquete Gol Bar, que ofrece la misma

emite unos 70 partidos en directo al mes,

regularmente partidos de clasificación

programación pero con una tarifa dife-

a unos 0,30 euros por partido, con cuatro

para torneos internacionales de selec-

rente (más alta) a los restauradores y

partidos de la Liga BBVA como plato es-

ciones como, actualmente, la Eurocopa

hosteleros que utilicen el fútbol como

trella y atracción principal de la cadena.

2012, así como los Sudamericano sub-

atractivo para fidelizar a su clientela. A

Pero una cadena temática de fútbol que emite las 24 horas del día ha de contar con unos derechos televisivos suficientes para nutrir a sus abonados con lo que más valoran, esos 70 directos al mes. Así, Gol Televisión, gracias a la política de adquisiciones de Mediapro, cuenta a día de hoy con la emisión de cuatro partidos de la Liga BBVA cada jornada, más otros cuatro que pueden verse en formato de pago por visión (aunque no, obviamente, por TDT); dos partidos de la Liga Adelante, y varios encuentros de diferentes ligas, como la Premier League (Inglaterra), Ligue 1 (Francia), Scottish Premier League (Escocia), Liga ZON Sagres (Portugal), Jupiler Pro League (Bélgica), Serie A (Ecuador) y Primera A (Colombia), además de los torneos de Copa del Rey (España), Copa de Alemania y Copa de Brasil. En cuanto a com-

60

En el área de Traffic, perteneciente a Mediapro, se gestiona la recepción de las distinas señales de los partidos sobre los que la productora tiene derechos.


estos establecimientos se les envía incluso la revista Gol Bar, que confecciona la redacción de Gol Televisión con el apoyo en materia de diseño de los profesionales del diario Público, cuyo accionista de referencia también es Mediapro. Actualmente, el 23% de los socios del canal están abonados a través de la TDT

Más de 100 profesionales fijos y unos 75 freelancers componen la estructura de Gol Televisión

Premium; un 13%, a través de las empresas distribuidoras de cable; un 46%, a través de IPTV, y el 18% restante, a través de la telefonía móvil.

UN EQUIPO MULTIDISCIPLINAR

El departamento de Traffic de Mediapro gestiona todas las emisiones que llegan desde muchos estadios de todo el mundo.

Y es que, en el caso de Gol Televi-

realización, transmisiones, continuidad, producción y web.

La programación es lo que trasciende

sión, hablamos de una plantilla de unos

ante los ojos del espectador, pero detrás

100 profesionales fijos, que se com-

Una muestra de esta organización la

de un canal temático que emite las 24

plementa con la aportación puntual de

da el hecho de que cada jueves se reúnen

horas del día y los 365 días del año ha de

unos 75 profesionales freelance, y todos

los responsables de las áreas señaladas

haber un equipo muy bien coordinado,

organizados bajo una estructura com-

para decidir la parrilla del siguiente fin

donde cada uno de sus integrantes sepa

partimentada en los departamentos de

de semana y la programación de la se-

bien qué ha de hacer.

dirección, comunicación, programación,

mana siguiente. Un vistazo rápido a los estudios de la cadena permite ver la

PRIMERAS EXPERIENCIAS EN 3D

delimitación de las diferentes funciones de cada área. Una muestra de ello la encontramos en la emisión de su informa-

A finales del pasado mes de no-

tivo diario, obviamente dedicado al fút-

viembre, coincidiendo con el en-

bol. Para su elaboración, intervienen en

frentamiento en partido de Liga

sus estudios unas nueve personas, entre

entre el FC Barcelona y el Real

el editor, el productor, los operadores de

Madrid, Mediapro, a través de su

la televisión y los realizadores.

sociedad Media Sports Marke-

Un paseo por las instalaciones de Gol

ting, realizó la primera emisión

Televisión permite contemplar los dis-

de un partido de fútbol en 3D en

tintos perfiles profesionales presentes:

España.

los productores, que se encargan de la

La idea de Mediapro es realizar

logística de las distintas retransmisio-

estas emisiones, normalmente

nes; los redactores, un buen núcleo de-

en salas de cine 3D de distintas ciudades, y que sean sufragadas con el patrocinio

positario del espíritu más futbolero del

de las marcas comerciales, por lo que no están abiertas al público en general y sí a

canal; los loggers, que son los encarga-

los invitados por estas marcas patrocinadoras. A medio plazo, el objetivo es que las

dos de destripar los partidos y que pasen

salas de cine, ávidas de espectadores por el problema de la piratería, acojan al gran

a formar parte del archivo de imágenes

público que quiera disfrutar de los partidos desde otra perspectiva: alta definición,

del canal, y que suelen ver dos partidos

tres dimensiones y sonido envolvente.

a la vez (con repeticiones desde diversos ángulos) que deben etiquetar con varias

61


MAKING palabras clave para que, luego, el resto de profesionales de la casa pueda localizar las imágenes referenciadas; los técnicos de continuidad, auténticos artífices de que las emisiones del canal no decaigan durante las 24 horas del día; los supertécnicos, que siempre están prestos a intervenir en cualquier problema técnico que aparezca, y la gente de realización, grafismo y posproducción, que cuecen y enriquecen los contenidos audiovisuales emitidos.

JUVENTUD Y POLIVALENCIA En un canal ininterrumpidamente, el ritmo de trabajo, evidentemente, es alto, y los profesionales que forman parte, además de ser competentes, han de ser

La edición de un informativo diario obliga a que una decena de personas se coordine a la perfección para que nada falle.

polivalentes. En el caso de los redactores, deben manejarse con soltura para

así como disponer de un histórico de la

de las caras visibles de la cadena, como

montarse sus propias piezas informati-

programación, resulta clave para que, a

lo son también Jose Sanchís, Jordi Do-

vas. De ahí que acudan al Medium Media

nivel documental, el canal no se resienta

mínguez, Ricardo Rosety, Carolina Gar-

Manager, el programa que almacena to-

ni un ápice.

cía, Manel Lozano, Rodrigo Fáez y Rafa Macia, entre otros; comentaristas de

das las imágenes emitidas y logueadas, prestas para ser rescatadas como so-

CARAS Y VOCES CONOCIDAS

fútbol internacional como Jorge Nazar,

porte visual para dichas piezas, y acaben

El equipo de Gol Televisión es esencial-

Nicolás Nardini o Paul Giblin; comenta-

en la herramienta Clean Edit, que les

mente muy joven y está formado por

ristas de fútbol nacional como Antonio

sirve para aunar las imágenes y la locu-

auténticos enfermos del fútbol. En su

Maceda, Antonio Pinilla, Juan Manuel

ción, además de los fragmentos musi-

pantalla, el espectador ya comienza a

Lillo o Jordi Lardín; y narradores como

cales elegidos para amenizar dichos re-

reconocer las caras y las voces de mu-

Miguel Ángel Román, Lluís Izquierdo o

portajes. El acceder a las imágenes por

chos profesionales: entre los redacto-

Josep Maria Deu.

palabras clave e intervalos de tiempo,

res, Áxel Torres (ver recuadro) es una

Que se trata de un grupo de profesionales joven y activo da buena cuenta su actividad, que no ha sido impulsada por el canal pero que los dirigentes ven con buenos ojos, en redes sociales como Twitter, donde varios de ellos intervienen frecuentemente comentando la actualidad futbolera, lo que de paso redunda en una mejor imagen de marca de Gol Televisión. Periodistas como Miguel Ángel Román, Lluís Izquierdo, Jordi Domínguez, Xavi Riera o Ricardo Rosety rondan los dos mil seguidores; Rodrigo Fáez, los tres mil; José Joaquín Brotons se asoma a los nueve mil seguidores, mientras que Áxel Torres va por los más de 26 mil seguidores. “Twitter se ha convertido en una herramienta para periodistas, y es mucho más ágil que Facebook. Y el perfil de nuestros profesionales, tan joven, favorece esa interacción”, apunta al res-

Un nido de ordenadores puebla la redacción de Gol Televisión, en el edificio Imagina de Mediapro, en el distrito barcelonés del 22@.

62

pecto José Joaquín Brotons. Lo que no es óbice para que Gol Te-


levisión cuente también con sus propios canales 2.0, que sus impulsores se pre-

LA FIGURA Del periodista franquicia

ocupan de fomentar con la introducción de concursos y promociones, así como

Los más aficionados al fútbol

la constante alusión a las intervenciones

internacional lo veneran. La pre-

de los telespectadores en, por ejemplo,

sencia de Áxel Torres en Gol Te-

levisión, más allá de su increíble

programas de debate como Mundo Gol.

aportación

Gol Televisión y muchas de sus caras conocidas se muestran muy activos en las redes sociales

como

enciclopedia

andante que es, resulta un guiño a los futboleros, una manera de decirles que en Gol Televisión se habla su mismo lenguaje. Colaborador en medios como Radio Marca, Áxel Torres es a Gol Televisión lo que Julio Maldonado a Digital +: la referencia en materia de fútbol internacional. Aunque quizá Torres vaya un paso más allá que el popular Maldini en la cadena de Prisa, ya que también conduce la tertulia nocturna de Mundo Gol, casi siempre centrada en el fútbol nacional, y viaja por la geografía española entrevistan-

LOS RETOS TÉCNICOS

do, junto a José Joaquín Brotons, a diversos entrenadores. Y lo que más le llena: un

Gol Televisión produce toda su progra-

programa propio, Planeta Áxel, que es un referente en fútbol internacional.

mación en HD, 16:9 y multicanal, lo que quiere decir que tecnológicamente está a la vanguardia: alta definición en todos

de la TDT de pago no conllevó la adop-

genio, el canal necesitaría un múltiple

los programas de producción propia

ción de la alta definición, lo que se tra-

específico, y habría que renovarse el

y en la mayoría de sus ligas de fútbol,

duce en que el parque de decodificado-

parque de decodificadores... Sin embar-

formato panorámico y emisiones multi-

res es, a día de hoy, prácticamente SD al

go, los retos del futuro en cuanto a inno-

canales en varios idiomas incluso, con

100%. Y para poder disfrutar de Gol Te-

vación siguen presentes: pronto apare-

posibilidad de seleccionar el audio de

levisión en formato nativo, algo que solo

cerá una aplicación para iPad/iPhone

la Cadena Cope como narración de los

pueden hacer algunos abonados de Ima-

que permitirá incluso el PPV.

partidos. A este empuje tecnológico de primer orden contribuye el disponer de todo el material que recibe la sección de Traffic de Mediapro, de donde se rescatan muchas de las emisiones y también las imágenes nunca vistas de los partidos, que luego sirven para la confección de secciones como ‘Edición Limitada’. El área de Traffic de Mediapro, que convive puerta con puerta con las instalaciones de Gol Televisión en el edificio Imagina, es un arsenal tecnológico envidiable, con una tabla de sonido espectacular importada de Alemania, conversores de SD a HD y de NTSC a PAL, Matriz SDI, recepción y envío de las señales de los partidos vía fibra ópticas (desde los estadios españoles) o satélite (desde los campos del resto del mundo)... Tecnológicamente, Mediapro está preparada para afrontar nuevos retos, como la emisión regular en 3D, pero lo cierto es que las circunstancias no acompañan, ya que la aprobación deprisa y corriendo

Ricardo Rosety y Xavi Riera son algunos de los conductores de los informativos de la casa, dedicados, claro está, al fútbol.

63


AGENDA MARZO festival de cine film & cook

festival de málaga de cine español

presentará 29 películas procedentes de todo

26 marzo - 2 abril

el mundo. En la sección competitiva partici-

Málaga | www.festivaldemalaga.com

parán 10 documentales, tanto de realizadores

11-13 marzo

consagrados, como el austriaco Peter Ts-

Barcelona | www.filmandcook.com

cherkassky, como de nuevas promesas, como

El cine y la gas-

Clio Barnard. Durante el festival también se

tronomía

celebrarán actividades paralelas, como talle-

se

dan

cita en la primera

res, seminarios y conciertos.

edición del festival Film & Cook. Además de proyectar películas, cortos y documentales,

se

realizarán charlas y

El certamen de cine vuelve con las últimas

mesas redondas y se ofrecerán degustaciones

producciones hechas en nuestro país y toda

gastronómicas.

una serie de ciclos, homenajes y conferencias.

Padre nuestro (1985), de Francisco Requeiro,

sonimagfoto

es la Película de Oro de esta decimocuarta

23-27 marzo

edición.

Barcelona | www.sonimagfoto.com Nueva edición de una feria histórica, en la

PLAY-DOC

que se presentarán las últimas tendencias del

30 marzo - 3 abril

sector de la fotografía y el tratamiento digital

Tui (Pontevedra) | www.play-doc.com

de imágenes. Se celebrarán jornadas técnicas

El Festival Internacional de Documentales de

y workshops para profesionales.

Tui, Play-Doc, celebra su séptima edición, que

CONVOCATORIAS

shots 2011

X

Madrid | www.scifiworld.com.es/shots

CREATRIVAS

8ª muestra de cine de lavapiés

Límite de entrega: 18 marzo

Rivas Vaciamadrid (Madrid)

Barcelona | www.lavapiesdecine.net

El Festival Internacional de Cortometrajes

www.rivas-vaciamadrid.org

Límite de entrega: 15 marzo

Fantásticos de Scifiworld cumple este año

Límite de entrega: 23 marzo

barrio

su tercera edición. Podrán participar corto-

En la décima edición

madrileño recibe ya los

metrajes de este género hechos por realiza-

de

proyectos

dores noveles.

que se celebrará en-

El

certamen

del

participantes.

CONCURSO

este

DE

concurso,

Se aceptarán todo tipo

tre el 1 y el 9 de

de trabajos, ya sean lar-

abril, pueden compe-

gometrajes, cortometrajes,

tir cortometrajes de

videoarte,

ficción de nacionali-

etc.

Deberán

ser entregados personalmente.

CORTOMETRAJES

dad española de una duración máxima de 30 minutos, cuyo formato final de proyección

cinema jove 2011

sea 35 mm.

Valencia | www.cinemajove.com Límite de entrega: 15 marzo/15 abril

64

concurso de relatos de cine del

El 26º Festival Internacional Cinema Jove de

cinestrat 2011

festival de huesca

Valencia tiene abierto su plazo de inscrip-

Alicante, Valencia, Lima

Huesca | www.huesca-filmfestival.com

ción. Pueden participar largometrajes y cor-

www.cinestrat.es

Límite de entrega: 1 abril

tometrajes de directores noveles producidos

Límite de entrega: 21 marzo

Después de cerrar la convocatoria para el

a partir de enero de 2010. Quedan abiertas

La 5ª edición del festival de cine documental

concurso de cortometrajes, fijada para el 1

también las inscripciones para el 26º En-

se centra en la educación. Pueden participar

de marzo, el Festival de Cine de Huesca

cuentro Audiovisual de Jóvenes (hasta el 15

las cintas sobre esta temática producidas a

abre el plazo para participar en el concurso

de abril).

partir del 21 de diciembre de 2009.

de relatos cortos sobre el mundo del cine.


ABRIL

nab 2011

sci-fi-london 2011

9-14 abril

23 abril - 2 mayo

12º festival de cine de las palmas

Las Vegas (Estados Unidos)

Londres (Reino Unido)

1-9 abril

www.nabshow.com

www.sci-fi-london.com

Las Palmas de Gran Canaria

Las Vegas acogerá una nueva edición del NAB

Décima edición de este

www.festivalcinelaspalmas.com

Show, la mayor exposición mundial dedicada

festival dedicado al cine

Con 11 ediciones a sus espaldas, este ulti-

a los medios electrónicos de comunicación.

fantástico y la ciencia fic-

ma los preparativos del nuevo certamen, en

Además de mostrar lo último en tecnología,

ción. Además de proyectar

el que compiten producciones de diferentes

en este evento también se presentará una

películas, cortos y docu-

países.

amplia variedad de programas educativos.

mentales,

se

ofrecerán

charlas y debates e inclu-

mipdoc 2011

tribeca film festival 2011

so se harán demostraciones en el Science

2-3 abril

20 abril - 1 mayo

Fact, su particular laboratorio de ciencia.

Cannes (Francia) | www.mipworld.com

Nueva York (Estados Unidos)

Vuelve el salón de distribución de la industria

www.tribecafilm.com

de los documentales, un escaparate con los

MAYO

últimos trabajos en este formato y un punto de

DOCUMENTA MADRID 11

encuentro entre compradores y productores.

6-15 mayo Madrid | www.documentamadrid.com El Festival Internacional de Documentales de El festival cofundado por Robert de Niro ce-

Madrid llega a su octava edición, en la que no

lebra su décima edición. Durante más de una

solo se ofrecerán proyecciones, sino también

semana, se proyectarán largometrajes y corto-

otras actividades paralelas, como seminarios,

metrajes llegados de todo el mundo.

talleres, exposiciones, mesas redondas, etc.

actúa 2011

LUMIX AWARD 2011

cortos documentales, largos documentales y

www.intermonoxfam.corg

www.lumixaward.com

películas de animación. El tema principal de

Límite de entrega: 18 abril

Límite de entrega: 30 abril

los trabajos será de corte social.

Intermón Oxfan organiza la 6ª edición del Festival Internacional de Cortos, que este

XII festival de cine de pamplona

año tiene como temática la crisis. Los cortos

www.festivalcinepamplona.com

finalistas se proyectarán del 31 de mayo al

Límite de entrega: 30 junio

10 de junio en 10 ciudades: A Coruña, Bar-

Ya se pueden presentar los cortometrajes,

celona, Bilbao, Guadalajara, Las Palmas de

largometrajes y documentales que quieran

Gran Canaria, Madrid, Sevilla, Toledo, Valen-

participar en la XII edición de este festival,

cia y Zaragoza.

que se celebrará en Navarra entre el 1 y el 8 de octubre. Las diferentes categorías de este

cuéntalo en 90 segundos

Panasonic celebra la 9ª edición de sus pre-

concurso son: Alternatif, Cortico Navarro, Va-

Almería | www.cuentaloen90segundos.es

mios de fotografía digital, en esta ocasión

lor Visual y Educatif.

Límite de entrega: 29 abril

bajo el lema “Vida laboral”. Tanto aficionados

La Escuela de Imagen

como profesionales pueden enviar imágenes

y Sonido EISO ya ha

que capturen puestos de trabajo extraordina-

convocado

rios, inusuales, extremos y desconocidos.

la

quinta

edición de este festival de cortometrajes,

iii filme sozialak bilbao 2011

que se celebrará entre

Bilbao | www.kcd-ongd.org

el 1 y el 4 de junio.

Límite de entrega: 1 junio

La gala tendrá lugar

La 3ª edición del Festival de Cine Invisible de

en el Auditorio Munici-

Bilbao está ya en marcha. Pueden presentar-

pal Maestro Padilla la noche del 4 de junio.

se largometrajes y cortometrajes de ficción,

65


BANDEJA DE SALIDA

Qué será, será... el móvil flexible

La Fuerza protege tus archivos Con motivo del 30º aniversario de Star Wars, Mimoco lanzó una serie de memorias USB de 4GB basadas en sus personajes. En la quinta edición, los modelos de Darth Vader y el Stormtrooper tienen sorpresa. www.planetapluton.com El diseñador interactivo Kristian Ulrich Larsen ha ideado el prototipo de un teléfono móvil inteligente de pantallas flexibles, el Flip Phone. Es el smartphone del futuro, disponible en color negro y con bandas LED de cinco colores diferentes. Basado en tecnologías Amoled, está compuesto por tres pantallas flexibles recubiertas de una capa de Gorilla Glass, que forman un dispositivo de diseño sofisticado y exclusivo que puede comportarse de diferentes maneras. Permitirá la instalación de múltiples aplicaciones y podrá utilizarse para leer libros, como despertador, para realizar videoconferencias o escuchar música. Está basado en el sistema operativo Android.

A no perderse

Torrente 4: crisis letal El ratón más inteligente Apple ha patentado una nueva aplicación para su Magic Mouse. Se trata de una pequeña pantalla táctil situada en la parte superior del ratón, que permitirá interactuar con las aplicaciones de Mac OS X de varias formas. Con una interfaz intuitiva, el periférico nos ayudaría a ejecutar tareas simples.

El próximo 11 de marzo se estrena Torrente 4: crisis letal, la última secuela de la saga dirigida y protagonizada por Santiago Segura. La cinta, en formato 3D, contará con los cameos de Belén Esteban, Paquirrín, Ana Obregón, ‘El Kun’ Agüero y Cesc Fábregas, entre otros. www.torrente4.com

Cinéfilos siempre conectados Filmaster, la red para cinéfilos creada por Musielak Borys y Adam Zielinski en 2008, abre su propia API, que permitirá seguir a los usuarios según sus gustos de cine. En marzo, el portal lanzará una aplicación para iPhone y Android.

El tiempo pasa

NINTENDO 3DS Más de veinte años han pasado desde que se lanzara en Japón la primera Game Boy. Hoy, está a punto de salir al mercado la Nintendo 3DS, la última versión de la consola que permitirá ver vídeos y hacer fotos en formato 3D. Entre otras novedades, incluye la Nintendo 3DS Store, con la que descargar juegos y aplicaciones mediante la conexión Wi-Fi. Los más nostálgicos podrán divertirse con los juegos de la Game Boy Original, disponibles en la nueva plataforma.

66


we hear all

we SEE all

we AWARD the best

YOUR ASSURANCE FOR QUALITY EISA is the unique association of 50 special interest magazines in audio, home theater, in-car electronics, mobile electronics, photo and video, from 19 European countries. Every year the EISA jury rewards the best products available in Europe with the EISA Award. The quality of the winners is undeniable, having been independently reviewed in our member magazines and voted for, collectively, by its 50+ expert editors. All EISA winners may use the official EISA logo - it’s your assurance of outstanding product quality.

www.eisa.eu


<ネガティブ>

(1&,1(6'(2&78%5(

ZZZJDKRROHHVFRP

Una experiencia extraordinaria de cine en 3D.

Los Sharp AQUOS con tecnología Quattron 3D. Con AQUOS Quattron 3D, Sharp ha reinventado los TV LCD: la tecnología Quattron de 4 colores trabaja con un cuarto subpixel –amarillo- que en combinación con la tecnología 3D resulta en una imagen 3D más brillante y aún más vibrante. Disfrute la televisión en una nueva dimensión. Ya disponible en su distribuidor Sharp. Tiene que verlo para creerlo. www.sharp.eu

O N L Y I N C I N E MA S


Vídeo Popular 142