Page 1

Geotechnical, civil, s t r u c t u r a l , e n v i r o n m e n ta l

Thursday, May 5, 2016

incrEDIBLE farmers’ market coming to Trail

Professional cook program in Nelson opens doors See page A3

See page A9

Bring Mom for a cupcake 12 served at

Concrete, steel and timber design Construction permitting Subdivision and project development 875 Farwell St., Trail, BC Phone: 250-448-7525 www.austinengineering.ca

Happy Mother’s Day!

in In-Store Enter tolowus a fabu Giftware t basket Specials gif At Playmor Junction, turn left behind the Credit Union

civil enGineerinG services

At DIG you’ll find the best range of unique Mother’s Day garden gifts including Gorgeous Baskets & Planters, Weeks Roses and Hummingbird feeders

Open 7 Days A Week

EXTENDED Mothers Day Hours: 9:30-5:30

Monday - Saturday 9-6 • Sunday 10-4

250-359-5926 • www.diggardencentre.com

Happy Mother’s Day

$12.99

Special $6.99 $10.99

Special

2000 Columbia Ave, Castlegar | (250) 365-7737 | www.canadiantire.ca www.canadiantire.ca


A2

Thursday, May 5, 2016 West Kootenay Advertiser

Community

Community projects improve access to healthy local food KOOTENAY — Interior Health, through the Community Food Action Initiative (CFAI), has recently provided a total of $60,000 to help build food security in four communities: City of Revelstoke, Regional District of Central Kootenay, Regional District of Kootenay Boundary, and Township of Oliver. The initiative is part of a province-wide strategy to increase food security programs and encourage British Columbians to make healthy food choices. “Food security exists when all people, at all times, have access to food that is nutritious and safe in order to maintain an active and healthy life - achieving food security is a community effort, said Rose Soneff, public health dietitian with Interior Health. “Local governments, businesses, farmers, organizations and citizens all have an important role to play and the CFAI program supports them to do that.” The CFAI provides grants of $15,000 annually to each community over the next three years to increase the community’s ability to contribute to the growth and development

of their local food system. The funding will help recipients develop and implement community-wide food security plans. The projects will address various aspects along the food system such as growing, distributing, accessing, marketing, celebrating and preparing food, as well as managing food waste. “We are pleased to partner with Interior Health to implement a plan that will ensure residents have access to locally grown food that can result in a healthier life,” said Diane Vaykovich, corporate officer with the Town of Oliver. “Our council is very aware of the significant value of agriculture in our community and we want to be a leader in British Columbia by developing a food security plan for our residents.” Recent attention on higher food costs has increased interest in food security in many communities. “Working with local governments helps ensure food security is considered as part of community planning for now and the future; whether that is within an official community

plan, a sustainability plan, land use policies, zoning and bylaw, or in economic development and municipal policies,” adds Soneff. CFAI is a collaborative effort between local communities, Interior Health’s public health dietitians, and the Ministry of Health. For more information about food security and community nutrition, visit interiorhealth. ca/YourHealth/HealthyLiving/ FoodSecurity.

$92

T

he Hyundai Elantra GT proves that a smaller car does not equal a bare-bones car. Innovative rear seats create extra cargo space. An available rearview camera is tucked behind a swiveling Hyundai badge. A panoramic sunroof brings the outside in. Add deft handling and plentiful power, and the Elantra GT offers large-scale comfort and performance. And with Dealer Invoice Pricing at Castlegar Hyundai, this substantial car is available for a surprisingly petite price until May 31. Financing, OAC, 96 months, 0.99%, bi-weekly, GST and PST not included in payment. $279 admin fee included. Total financed $20,410 including tax, total cost $21,240.

YOU PAY THE INVOICE PRICE! ON SELECT 2016 MODELS

NO WONDER THE COMPETITIONS IS OUTRAGED

offering smart choices

www.castlegarhyundai.com • 713 17th Street • 1-855-494-1268

DL#30959


West Kootenay Advertiser Thursday, May 5, 2016

A3

Thursday, May 5, 2016

Professional cook program in Nelson opens doors

2nd annual Peony show comes to Castlegar June 11

See page A9

See page A20

Trail’s incrEDIBLE farmers market coming to downtown next weekend SHERI REGNIER West Kootenay Advertiser

Yes, it’s incredible and edible — Trail’s first farmers market is coming to the downtown core next weekend. Going farm to table is a win-win for everyone from growers to families and local businesses, says Gina Ironmonger, promoter for incrEDIBLE trail and now, Trail’s incrEDIBLE Farmers Market. “What’s really important is that we are is a real farmers market, make it, bake it, grow it, or raise it,” Ironmonger said. “We are not in competition with existing businesses, the businesses can be part of it. And we are supporting the local food movement.” The venue is an extension of incrEDIBLE trail’s first foray which has city merchants and services growing edible landscapes in their storefronts, not flowers. “The farmers market is really another springboard of community gathering and experience,” Ironmonger shared. “It’s really a social event, an opportunity to talk not only with our farmers but all the businesses and service organizations on the green route who already grow food for passersby and the food bank.”

Trail council greenlighted the initiative in late April, and the group has since secured its preferred location right in the heart of the city. The 1300 block of Cedar Avenue will be closed to traffic including public transit from 9 a.m. until 1 p.m. on the 11 planned Saturday markets, beginning May 14. Aside from joining the BC Association of Farmers Market, planning the event, then asking the city for permission to close a major downtown street, incrEDIBLE volunteers had another hurdle to clear for the market to become reality. Ironmonger often hears that nobody is downtown on Saturday, especially in the summer. “Sometimes you have to have a reason to come downtown,” she cheerfully replies. “When you take a look at our whole area, communities together, you have a population of about 20,000,” the volunteer added. “And all those people aren’t at the lake.” Now that particulars are in place, incrEDIBLE trail is putting out a call to locals who sell all things fresh. “We are looking for a variety of vendors with a variety of products — including locally grown or processed fruits, vegetables, meat, poultry, dairy, eggs, baked goods and specialty foods,” Ironmonger said, also listing herbs, flowers, wines, brews, bath and beauty products and more. “We invite you to apply to become a vendor at this fun and exciting new market to grow your business,” she added. “If you are not a vendor, we invite you to come on down and shop for a wide selection of unique products, unparalleled freshness, fun atmosphere and the personal service found at our farmers market.” Promoting good nutrition through locally grown food is only one bonus, she continued. The farmers market can become an economic driver by

increasing foot traffic to all downtown businesses, some of which are struggling to stay afloat. “It’s really important to note the farmers market is make it, bake it, grow it or raise it,” Ironmonger explained. “So they are not in competition with the existing businesses, rather the businesses can be part of it. “And they are really excited and working on an already great relationship between the vendors and business community.” Those who make it, bake it, grow it and raise it, are also very keen on becoming part of Trail’s first farmers market. “When we did our research, we found many vendors also work and cannot do the weekday markets,” she said. “So they are also very excited to have a Saturday to come to the market and provide their products. Basically, by supporting the buy local movement, your dollars stay in the area while you invest in your family’s health through locally grown food.” The incrEDIBLE Farmers Market is the latest Trail project added to the volunteer group’s ongoing list of community ventures. Now in its third year, the green route’s edible landscapes are sprouting up well beyond downtown Trail. Greater Trail supporters raised funds for the incrEDIBLE Gulch Community Food Bank Garden that now in its second year, will add another four planters this summer. At the pinnacle of all growing Trail initiatives, however, is a behemoth - climate change. “Our area is projected to have 30 more frost free days by 2050,” says Ironmonger. “That means our area will become more important to the food basket especially as more demand is placed on province’s three main growing areas. So yes, the underlying initiative of all of this, is sustainable local agriculture.”

Cutout photo by Sheri Regnier


A4

Thursday, May 5, 2016 West Kootenay Advertiser

Now offering custom kitchens from

Merit Kitchens

As seen on Love It or List It Vancouver.

Morrissey Creek Building Supplies 2750 E. Almond Gardens Rd, Grand Forks, BC

250-442-2312

News City buys property to expand Riverfront Centre development TRAIL — Another downtown Trail property is slated for demo, clearing way for a larger library/ museum footprint. The city purchased the former Trail Trophies & Engraving site for $190,000 and plans for a mid-July tear down with the lot providing additional space in the development of the Trail Riverfront Centre. “Council is looking at this as a 50-year decision when we make this kind of commitment,” says Coun. Robert Cacchioni, the building committee’s chair. “We’ll only get the chance to do this once so we better do it right.” As planning the new facility’s size and layout progressed, Cacchioni says it became evident the existing structure at 1537 Bay Avenue would be greatly impacted by the proposed construction design. “Rather than spending a considerable amount of money to modify the structural integrity and reinstate the power and gas lines to the privately-owned structure on 1537 Bay Avenue,” he explained. “We realized

it would be cost effective to purchase the property and proceed with the demolition of the structure.” The extra space allows the new facility to be shifted slightly to the south, creating an outdoor plaza opportunity for the north side and enhancing the overall appeal of the building. “The integration between the building and the use of outdoor space is considered to be an important aspect of the facility,” Cacchioni added. “This concept also complements the revitalization recommendations outlined in the Downtown Plan; and, the additional space provides much greater opportunity to maximize the potential of the site as council continues to focus on the redevelopment of the Esplanade lands.” Design work continues and a schematic is now complete. The current timeline includes tendering the project in July and a grand opening in October 2017. The current design has changed considerably from the original concept, so the city plans to release the drawings to the public during Silver City Days.

With the 2016 Kia Sorento, you will never face that awkward question again. Kia Canada Inc. 180 Foster Crescent, Mississauga, Ontario L5R 4J5 Canada

Retail Incentives Bulletin Bulletin No: To: Subject:

NSD 16-064 Dealer Principles & General Managers May Incentive

WE’VE GOT Kia Canada YOU COVERED

is pleased to announce our biggest

*5-year/100,000 km worry-free “Drive to Surprise” comprehensive warranty.

With super-sized cargo space, flexible seating, a wider stance, longer wheelbase and room for seven people if required, no camping equipment, family pets, golf clubs, picnic coolers, or lonely children will be left behind. And with 0% financing and other big benefits available this month, the Kia Sorento will rd th May 3 toleave Juneyou 30 feeling , 2016 elated, not frustrated.

Date: CC: Western RSM and DSMs Region: Western Region

marketing campaign of the year! The

CASTLEGAR KIA

The Power to Surprise

sales event is our invitation to all in market shoppers to test drive and fall in www.castlegarkia.com | 1665 Columbia Avenue | (855) 539-5873

love with our Kia lineup. This month Kia will feature 0% financing on all 2016 models plus customers can win 1 of 30 Power to Surprise Experiences valued at $10,000. To further help close sales, take advantage of our Loyalty or Conquest program available on most Key Carlines.


West Kootenay Advertiser Thursday, May 5, 2016

A5

Entertainment

We need carriers in your area! Deliver the West Kootenay Advertiser one day a week and pad your pockets with a little extra cash! ROYAL MONKEY HOLDS COURT Hume Elementary student Mason MacKay played King Louie in his school’s production of The Will Johnson photo Jungle Book last week.

Contact us today!

250.364.1413 ex.206

West’s FASHIONS

SAL END E SAT URD S MA A Y 7 Y, TH

DON’T MISS OUT ON OUR

ANNUAL SPRING SALE ONLY 2 DAYS LEFT

DOWNTOWN CASTLEGAR WHERE FASHION IS ALWAYS IN STYLE

1217 3rd Street 250-365-2290

Visit Our Store Hours: Mon to Sat - 9 to 5:30 In-Store

• Travel: Mon. - Fri., 9 - 5:30, 250-365-7782 BC Reg. no. 23776

• Mattress Gallery: 250-365-2219


A6

Thursday, May 5, 2016 West Kootenay Advertiser

Place Names

Left: Two old Doukhobor communal homes still stand in Ootischenia, but this one on Hillcrest Rd. was demolished in the early 2000s. Right: A Doukhobor village in Ootischenia is seen ca. 1940s.

USED USED VEHICLES VEHICLES

FOR FOR SALE SALE

Ask usus about nancing plans. Ask aboutpre-owned pre-owned vehicle vehicle fi nancing plans.

VERYCOMPETITIVE COMPETITIVE RATES! VERY RATES!

2012 YUNDAI SANTA FE AWD 2012 H OUTBACK TOURINGmodel EDITION AWD sport very clean Just in! 38,000km Only 56,00 kms stk#2140-1

$21,995 22,995

$

2014 Legacy Sport AWD loaded, one owner,

2014 Legacy Sport AWD loaded, one owner, auto stk#2138-1 ..................................NOW $16,900 auto stk#2138-1 .......................................... $17,995 2014 Forester XT AWD turbo, loaded 2014 Forester XT AWD turbo, loaded stk#2118-1................................................... ...................................................$23,995 stk#2118-1 $23,995 2014 ToyotaRav4 Rav4 4WD 46,000km 2014 Toyota LELE 4WD onlyonly 46,000km stk#w5278 NOW stk#w5278........................................ .......................................... NOW$23,900 $23,900 2012 Subaru Impreza Sport 5dr, hatch, auto, 2010 Impreza LTD AWD fully loaded one owner. stk#2059.................................... $16,995 stk#w7642-1 .................................................$14,995 2011 Cruze LTZ loaded, white, automatic stk#W6498 .....................................JUST 2010 Forester Touring Package AWD IN $12,995 2010 Impreza LTD fully loaded one owner, 5 sped, allAWD maintenance records stk#w7642-1 .................................................. $14,995 stk#w2095-1 .................................................$17,995 2010 Forester Touring Package AWD 2010 Dodge 3500 CC 4x4 longbox, one owner, 5 Ram spd, all maintenance recordsdiesel, only 136,000km. stk#2130-1 .......................$33,995 stk#2095-1 .................................................... $16,995 2010 Dodge Ram 3500 CC 4x4 longbox, diesel, 2009 Pontiac G5 GT 2door, 5spd only 136,000km. stk#2130-1....................... $33,995 stk#W5869-1 .........................................NOW $6,900 2009 Pontiac G5 GT 2door, 5spd 2007 Outback 2.5i, AWD, only 95, 000 kms. $7,900 stk#1234-1 ...........................................NOW Very nice car. JustWagon in 2005 Impreza AWD 4 door hatch stk #2121-1....................................................$11,995 stk#W5222 ..................................................... $8,995 2004 NissanRav4 Pathfi nder 2006 Toyota LTD 4WDSE 4 4WD door auto stk#2025-2 ......................................................$6,995 stk#2158-1 .................................................... $8,995 2000 Chrysler Neon 4door, auto, only 2005 Impreza Wagon AWD 4 door hatch $22,995 106,000kms stk#2144-1 .............................. stk#W5222 ..................................................... $8,995 2003 Subaru Baja Ltd. AWD rare model, Only 93,000km, Loaded .................... $15,995 2004 Nissan Pathfistk#2098-2 nder SE 4WD auto 1998 Forester AWD one owner stk#2025-2 ......................................................$6,995 stk#2143-1 ......................................................$1,995 Plustaxes taxesand and$399 $399doc doc Plus feefee

SUMMIT SUBARU We Specialize in New & Used 4 Wheel Drives Across from Waneta Plaza Trail DL#10441

250-364-9988 or TOLL FREE 1-888-737-9988 www.summit.subarudealer.ca Your AUTHORIZED Subaru Dealership in the West Kootenay

Take It To The Top!

Greg Nesteroff photo Greg Nesteroff collection

Ootischenia among surviving Doukhobor place names GREG NESTEROFF West Kootenay Advertiser

One hundred forty-second in an alphabetical series on West Kootenay/Boundary place names The Castlegar suburb of Ootischenia has one of two Doukhobor place names that remain widely used in West Kootenay (Krestova is the other). The original form of the name, reportedly chosen by Peter (Lordly) Verigin was Dolina Uteshenaya, meaning “Valley of Consolation.” It was adopted soon after the Doukhobor migration to BC. “Having forfeited their lands in Saskatchewan, this spacious and beautiful valley was to become their new place of refuge,” Jon Kalmakoff writes in his online Doukhobor Gazetteer. “The valley, however, proved to be arid and unsuitable for agriculture without extensive irrigation, leading some to refer to it as Dolina Opustosheniye or the ‘valley of desolation.’” The earliest known reference is in a letter in Russian held by Simon Fraser University, dated Jan. 15, 1909, which reads: “A letter from Dolina Uteshenaya from Peter Verigin to all the brothers and sisters of Christian Community. This is to inform you, brothers and sisters, that we have safely arrived in Dolina Uteshenaya …” The earliest English transliteration yet discovered is in the Nelson Daily News of April 22, 1924: “Almost at the same time the two school houses in the Ootshenia colony became flaming masses.” Another spelling appeared in the same newspaper on Sept. 10, 1925: “Miss Mary Larsen is the teacher for the school actually at Brilliant and Miss A.B. Mackenzie the one at Ootchenia.” Yet another variation appeared on Nov. 10 of the latter year: “These schools include five buildings, one each at Brilliant, Atischenia …” In March 1932, newspapers reported on an explosion “in the Doukhobor settlement at Oteshenie.” Other transliterations have included Ootisheniye and Ootischeniya. The BC Geographical Names office adopted Ootishenia on Dec. 6, 1951 but changed it to Ootischenia on March 5, 1959. That’s the spelling used today by the road, fire department, and landfill. In the May 30, 1990 edition of Iskra, historian Bill Rozinkin suggested Ooteshenia as a more accurate transliteration. “Today, instead of the original Ooteshenia, we have directories, telephone books, post office addresses and highway signs calling it Ootischenia,” he wrote. “This is not correct. The name of the district or plateau is Ooteshenia, a Russian word meaning a place of consolation or solacement. The newly created word or name, Ootischenia, has no meaning, neither is it a word in the Russian or English vocabulary.

A gravemarker with a Russian epitaph is seen in the Ootischenia cemetery. Greg Nesteroff collection “The change in the name of Ooteshenia to Ootischenia first appeared in the late 1950s and early 1960s during Freedomite terrorist attacks on Ooteshenia Doukhobor community settlements. These attacks attracted many news reporters from across Canada and the US. In their stories, some reporters spelt Ooteshenia correctly while others incorrectly called it Ootechenia and Ootischenia. Why the latter replaced the originally officially is hard to understand.” While Rozinkin seemed to be correct about the source of the English spelling, he was off on the date. Ootischenia appeared as early as the Nelson Daily News of April 5, 1937: “Three guards were placed at other district schools — Crescent Valley, Tarrys, and Ootischenia, the last the scene of the lone bombing Sunday …” Additional examples of that spelling exist from 1939. Ootischenia is also a 2006 song by The Be Good Tanyas — singer Frazey Ford grew up there. (Despite the title, the name doesn’t actually appear in the lyrics.) For much more on Doukhobor place names around the world, visit doukhobor.org/gazetteer-intro.html.


West Kootenay Advertiser Thursday, May 5, 2016

A7

News

New ED for West Kootenay EcoSociety NELSON — West Kootenay EcoSociety has hired a new executive director, Montana Burgess, who starts on May 10. Burgess is the first female executive director hired and brings a decade of organizing and organizational development to the West Kootenay EcoSociety. “I’m looking forward to working with our community to achieve a future with clean air, water, and land, while supporting healthy food, green jobs, and thriving wild places,“ said Burgess. Burgess’ passion for her work came from growing up in a low-income family that ran a community coffee shop and roasting business in Kamloops, BC. “I didn’t have the opportunities other kids had because of our financial situation. I knew

what fairness and equity meant at a very young age. I’m very motivated by social justice. I also know the value of vibrant community because of my parents’ commitment to support organic, fair-trade and local foods, and to support local artists and activists at our coffee shop.” Burgess hopes to build on the work of out-going executive director, David Reid, to refine the programs and advocacy of the West Kootenay EcoSociety and build additional capacity, working with the staff, board of directors, and members. “My vision for the West Kootenay EcoSociety is to lead on advocacy for the Kootenay region using community organizing, strategic communications, and a dedication to community relationships with leaders and our grassroots

to deliver successful community projects and programs. The EcoSociety has proven our ability to organize around key environmental issues and take on important challenges,” said Burgess. “I’m very excited that we’ve hired Montana as our new executive director. Montana has been our community organizer for the past year, and I am excited to see her lead our great community work on conservation, climate and food issues in the West Kootenay,” said outgoing executive director, David Reid. West Kootenay EcoSociety’s AGM takes place on May 12 at 6 p.m. at Expressions Café in Nelson. The community is invited to the meeting to sign-up as members and meet the newexecutive director.

West Kootenay EcoSociety has hired a new executive director, Montana Burgess, who starts Submitted photo on May 10.

A

r

r

Loan

range

2016 GMC Yukon Denali

Our goal is 100% credit approval! We finance your FUTURE not your past!

2016 GMC Terrain

518 83

$

FINANCE FOR 8-3583-0

BY-WEEKLY

LEASE FOR 8-9398-0

2016 Silverado Double Cab 4x4

FINANCE FOR 8-6879-0

Best Deal

BY-WEEKLY

2016 GMC Acadia SLT AWD

230 11

$

BY-WEEKLY

236 40

$

LEASE FOR

320 10

$

8-1579-0

BY-WEEKLY

GUARANTEE! We will BEAT any other deal! All payments calculated include $295 doc fee, $5000 trade equity or equivalent cash down and taxes. Lease term of 36 months. Finance term of 84 months. All vehicles in stock at time of printing. O.A.C.

Visit www.kalawsky.com for over 100 new & used vehicles

C H E V R O L E T

B U I C K

G M C

1700 Columbia Avenue Castlegar | 1.250.365.2155 | 1.866.795.8242

Where you are more than a Customer…. You are Family!


A8

Thursday, May 5, 2016 West Kootenay Advertiser

DL#5413

2013 DODGE DART

ONE CAR LEFT! DEEPLY DISCOUNTED!

WAS $21,200

Never owned, still new-ish!

#13-113

Brad Perrier Sales & Leasing

Grant Mcken

General Manager

250.352.3542 1.800.663.7794 803 Baker Street, Nelson 704 Bakers St. Used Lot

www.nelsonchrysler.com sales@nelsonchrysler.com

NOW $15,900!

MINIVANS!

GRAND CARAVANS ONE FOR EVERY BUDGET

2010 GRAND CARAVAN

2010 GRAND CARAVAN

13,988

$

NOW ONLY

NOW ONLY

Stow’n Go,90,000 km, grey

#16-23AA

#15-111A

2014 GRAND CARAVAN

15,988

NOW ONLY

4.0L, Stow’n Go, 98,000 km, blue

#U1163

$

19,988

$

DVD, Stow’n Go, 52,000 km, red

SUV S ! GREAT SELECTIONS ALL PRICE RANGES!

2012 DODGE JOURNEY NOW ONLY

2011 GMC TERRAIN SLE

25,988

$

NOW ONLY

16,988

NOW ONLY

16-57a, AWD, 96,000kms

#U1160

$

R/T, AWD, 47,000kms

U1149a

2010 SUBARAU FORESTER 4X4

17,988

$

Teck Pkg, 124,000 km, green

2015 JEEP PATRIOT NORTH 4X4 NOW ONLY

$

22,988 37,000 km, blue

#U1152

TRUCKS! GOOD USED RAMS!

4X4

*Plus $395 doc fee and taxes.

2015 RAM 2500 CREW CAB NOW ONLY

#U1164

2011 RAM 1500 CREW SLT 4X4

38,998

$

Long box, 4X4

NOW ONLY

#15-30TT

26,988

$

Canopy, 102,000 km red

2008 HONDA RIDGELINE NOW ONLY

U1167a,

18,488

$

Just in! 128,000Kms

2014 RAM 1500 REG 2WD NOW ONLY

#1694A

$

23,988

Nice truck! Just in! 17,000 km

N E L S O N T O Y O TA . C O M

ON NOW! 2010 HYUNDAI SANTA FE LIMITED •0 down payment • Fully reconditioned

V6, 3.5l AWD, 123,000kms

• Professionally detailed • Carproof report • Full tank of fuel

WINTER TIRES &RIMS INCLUDED

2010 JETTA TDI

2.0L TDI, Comfortline, Auto, Only 44,000 kms BU1708A

BU1709A

S A L E $1 6 , 4 8 0 2015 RAV 4 LIMITED NEW!

2013 COROLLA SPORT

5sp 43,000 kms BU1673

RA1076

WINTER TIRES & ALLOYS INCLUDED

S A L E $1 4 , 4 8 0

S A L E $3 3 , 8 9 0

S A L E $1 3 , 4 8 0

2012 HIGHLANDER SPORT

2013 NISSAN ROGUE

2013 TOYOTA RAV 4 LE

Leather, heated seats, sunroof 101,000 km BU1717

WINTER TIRES & RIMS INCLUDED

S A L E $2 9 , 9 9 5

Special Edition, AWD, 90,000kms, Sunroof, Alloy wheels, Fog lights Bu1719

S A L E $1 8 , 4 9 5

AWD, Upgrade Package, 55,000kms, winter tires inc, 1 owner, bought and serviced at Nelson Toyota RA8070

S A L E $2 3 , 4 9 5

Vehicles may not be exactly as shown

250.352.2235 | 1.888.352.2235 2 3 2 4 Y M I R R O A D , N E L S O N B C | W W W. N E L S O N T O Y O TA . C O M


West Kootenay Advertiser Thursday, May 5, 2016

A9

Community

Selkirk College’s professional cook program a recipe for employment NELSON — Not many schools can promise a student will have a job at the end of their studies. This year, Selkirk College’s cooking program is offering its grads their choice of them. “Right now we have 16 students and more than 40 jobs to fill,” says Simon Parr, instructional assistant for professional cook (level one) at the Tenth Street Campus in Nelson. Parr says students in the recently finished term are being courted with “three or four” job offers each, with many employers recruiting on site during the school year. “It’s great, students can pick their own jobs, decide the path they want to take, what experience they want,” he says. It’s heady stuff to have opportunity like that for your students. Parr, who has taught at Selkirk College for 10 years, has seen this cycle before. The right place and the right time Parr says one of the reasons for the job demand in the hospitality industry is the low Canadian dollar, which is both bringing foreign tourists to British Columbia and keeping Canadian travellers at home. The resulting boom in the industry has resorts and restaurants struggling to attract skilled staff. Industry officials agree it’s a great time to be looking for work in tourism. “As economies shift up and down, tourism often benefits in both ways,” says Dennis Green, the director of industry workforce developmentfor go2HR, an organization that helps develop the hospitality industry in BC. “When there is an increase in economic activity, there is an increase in business travel. And in regions where there is a major change, such as a slowdown in natural resources, often communities look to tourism as a way to diversify the economy.” Because of this, Green says there are always lots of jobs in the sector, part-time or seasonal, as well as full-time jobs that can lead to long careers. “We are a growth industry, there are guaranteed jobs. There are not many areas like that now,” adds Parr. “It’s a win-win for us. There are huge numbers of people coming back to BC, to our region, looking for work and considering cooking school for retraining. Then when they get here, we get strong demand from

employers for cooks. So it’s a bit of a perfect storm for cooking.” Students in Selkirk College’s cooking program enroll in the BC apprentice cook program and may take the Cook 1 (28 weeks) and Cook 2 (14 weeks) qualifications leading toward the Interprovincial ‘Red Seal’ cook certification (that course is offered when demand warrants). Unlike many programs, Selkirk College offers students at all levels practical experience, either working in a cafeteria or preparing gourmet meals in the college’s training dining room or at gala events. They learn by working in real-world conditions, under pressure and feeding real customers. “This course is good for anyone who wants to be a chef,” says Daphne Bingley, who just completed her first year in the program. “In September we had students who did not know how to boil pasta. This course treats everyone as if they want to become a chef, but if you don’t put in the work you won’t take it out.” Bingley’s already landed a plum summer job, working in one of BC’s most prestigious restaurant s. But she’s being picky about her long-term goals. “I’m not promising anyone my time, I want to travel around and learn about the culinary industry,” she says. “When I can learn enough to be a decent chef or sous-chef I will return to one of the places I enjoyed and try to make a life there.” Demand is high for trained cooks The Selkirk College Professional Cook Training Program has seen several recruiters come through the kitchens at the Tenth Street Campus and some, like Bingley, have been hired on the spot. “We don’t have to go shopping for jobs for our students, employers are coming to us,” says Bob Falle, who’s overseen the cooking program for 20 years. “We find employers that come to us are quite serious about working with our students and understanding what their goals are.” George Salivaras is one of those employers. A graduate of Selkirk College’s cooking program himself (in 2002), he has made the trek from his restaurant in Castlegar, The Wandering Greek Oven, to meet with the second-year students. “It’s fun for me to talk to the students, I find it enjoyable to share the joy I have cooking,” he says.

Students in the Selkirk Collegea Professional Cook Program. Selkirk College photo

Salivaras has hired four students from Selkirk College, two this year. “It’s good for me to have staff who know how to do things, that know the basics,” he says. “I don’t have to explain everything.” Completing training opens up doors The local restaurant trade is only the start of opportunities, notes Falle. “Regionally we are fortunate for having high-end seasonal work opportunities for trained cooks,” he says. “There are winter heli- or sno-cat skiing, golf resorts, luxury hotels, it goes on. There is an endless demand for cooks in this province.” And these students aren’t being prepared for low-wage, dead-end jobs either. Back at the college kitchen where he’s overseeing the lunch prep, Simon Parr says a talented young chef with ambition can find themselves anywhere in the world. “It’s exciting, you can travel around, work on cruise ships, or five-star resorts anywhere in the world,” he says. “Those that work hard, in a couple of years can be a sous-chef or in an executive chef position. And that’s when the salaries really kick in. A pastry chef can make $85,000 a year.” But it’s not just money that’s important. Parr says the real reward is doing what you want in life. “I love it, I’ve been doing it 20 years,” says Parr. “I used to be an oil field worker, I made killer money, but I was bored out of my mind. I decided to follow my passion and I’ve never turned back from it.”

RED TAG DAYS CONTINUES AT

CASTLEGAR TOYOTA SCION!

2016 TOYOTA COROLLA LE PRICE:

2016 iM by TOYOTA

$22,420 LEASE: $107

$22,245 LEASE: $110

/BI WEEKLY

/BI WEEKLY

$0 Down Payment! • • • •

Heated Front Seats LED Headlamps Air Conditioning Back Up Camera & more!

• Lease/Finance Rates Start at 0% PLUS Receive $1,000 Toyota Rebate!! • 7,500 Aeroplan Miles with Purchase! • 250 Aeroplan Miles with Test Drive!

Payment & Price plus Taxes. Payment & Price include $295 Undercoating & $295 Admin Fee. 60 month Toyota Lease. 20,000 km/yr. Total Due at Delivery $120 or Equivalent Trade In. Total Paid $13,920 plus Taxes. Rate 0.99%. Buyout $8,258 plus Taxes. On Approved Credit. Model: 2016 BURLEC AA.

PRICE:

$0 Down Payment! • • • •

Dual Zone Climate Control Back Up Camera Remote Keyless Entry 17” Alloy Wheels

• Lease/Finance Rates Start at 0% PLUS Receive $1,500 Toyota Rebate!! • 15,000 Aeroplan Miles with Purchase! • 250 Aeroplan Miles with Test Drive!

Payment & Price plus Taxes. Payment & Price include $295 Undercoating & $295 Admin Fee. 60 month Toyota Lease. 20,000 km/yr. Total Due at Delivery $124 or Equivalent Trade In. Total Paid $14,285 plus Taxes. Rate 1.49%. Buyout $9,788 plus Taxes. On Approved Credit. Model: 2016 KARJEC AB.

1530 COLUMBIA AVENUE CASTLEGAR 1.855.539.1826 | WWW.CASTLEGARTOYOTA.COM Add $295 Admin Fee to Pricing Displayed here.


A10

Thursday, May 5, 2016 West Kootenay Advertiser

Community RILKOFF’S STORE MONDAY - SATURDAY 8:30 - 6

SUNDAY 9 - 5

Grocery • Garden Centre • Fruit & Produce • Locally Grown

Okanagan Grown Spartan

Fresh Local

59

Asparagus

¢

Apples Long English

Hanging Baskets

Cucumbers

125 $ 49 Tomatoes 1 $

299

$

/lb

each

/lb

Great Gift for MO M!

Wow! $25

12”

Beef Steak

THIS WEEK ONLY

/lb

MOTHER’S DAY 1 DAY SALE!!!

Okanagan Grown Gala

Apples

59

Large Inshell Raw

¢

Sunflower $ 39 Seeds 1 /lb

/lb

Long English

Cucumbers

Fruit Trees

95 $ 25 Tomatoes 1 $ 99 1 Cucumbers

5 OFF

¢

$

each

Rose Bushes

/lb

Mini

SPRING FLINGS INTO CASTLEGAR

from reg. price

TOV

Reg. $23.99

/lb

$

1999

A bouncy house with a slide was a favourite stop for kids at Castlegar’s Spring Fling Saturday. The well attended event featured street hockey, kids’ games, live entertainment and vendors.

Mother’s Day Event

Sunday, May 8 • 10 am - 4 pm Traditional East Indian Brunch Samosa, Pakora, Chickpea Curry, Tea and more will be served! Funds raised will be donated to the local Food Bank, Border Bruins and Habitat for Humanity

Betsy Kline photo

HANGING BASKET DRAW WILL TAKE PLACE 250-442-2510 4415 Hwy 3 West of Grand Forks

2016 FORESTER LEASE/FINANCE 24 MOS., AS LOW AS

0.5

%

**

OR

STARTING FROM

28,190

$

CASH CREDIT

1,500

$

‡Ratings are awarded by the Insurance Institute for Highway Safety (IIHS). Please visit www.iihs.org for testing methods. *Pricing applies to a 2016 Forester 4-dr Wgn 2.5i MT (GJ1XO) with MSRP of $28,190 including Freight & PDI ($1,675), Documentation Fee ($395), Tire Levy ($25) and Air Conditioning Fee ($100). Taxes, license, registration and insurance are extra. Dealers may sell for less. Dealer order/trade may be necessary. Model shown is a 2016 Forester 4-dr Wgn 2.5i Limited AT w/ Tech (GJ2LPE) with MSRP of $35,795. Taxes, license, registration and insurance are extra. Vehicle shown solely for purpose of illustration, and may not be equipped exactly as shown. **0.5% lease/finance rates available on all new 2016 Forester models for a 36-month term. Financing and leasing programs available through Toyota Credit Canada Inc. on approved credit. †$1500 Cash incentive is available on all new 2016 Forester models. Cannot be combined with Subaru Canada supported lease/finance rates or lease payment offers. **/†Offers valid until May 15, 2016. See your local Subaru dealer or visit www.western.subarudealer.ca for complete program details.

SUMMIT SUBARU

www.summit.subarudealer.ca We Specialize in New & Used 4 Wheel Drives! Across from Waneta Plaza Trail DL#10441

Phone 364-9988 or Toll Free 1-888-737-9988 “Your AUTHORIZED Subaru Dealership in the West Kootenay” TAXES AND $399.00 DOC FEE EXTRA

“Take It To The Top!”


West Kootenay Advertiser Thursday, May 5, 2016

A11

SPRING TRUCK SWAP SPRING CAR, TRUCK, CUV, SUV SWAP ACT NOW 2795 Highway Dr • Trail, BC | 8000 Hwy 3B • Trail, BC

SPRING TRUCK SWAP 230 157 ‘15 FORD F150 CREW CAB 4X4 $

43,449

32,949

BW(3)

$750 CASH 38,242 CAD

DO YOU LOVE YOUR TRUCK AS MUCH AS THE DAY YOU BOUGHT IT? #

2016 FORD F150 4X4

TAKE A TEST DRIVE!

• Air conditioning • Skid plates • 3.5 litre V-6

25 GIFT

stk. GKE27648

29,995

$

196 BIWEEKLY

WITH EVERY QUALIFIED TEST DRIVE & APPRAISAL¥

2016 FORD FOCUS SE

stk.#GL265270

SHARE TO FACEBOOK FOR UP TO $2,000 IN

17,749

23,948

$

OR

2015 F250 CC 45,995 332 2013 GMC SIERRA 250 47,995 347 NOW $ 2013 EXPLORER #15394 ..................................................... 29,995 $211 BIWEEKLY NOW $ 2012 F150 CC #4681 72KMS......................................... 36,995 $299 BIWEEKLY 2012 EXPLORER #7645 ........................................................ NOW $31,995 $257 BIWEEKLY 2012 FOCUS #05951 ............................................................... NOW $14,995 $111 BIWEEKLY 2010 F150 #40957 .................................................................NOW $21,995 $200 BIWEEKLY 2009 ESCAPE XLT #09790 101KMS ..............................NOW $14,777 $127 BIWEEKLY 2013 FLEX SEL AWD #07880 58KMS ...................... NOW $27,995 $195 BIWEEKLY 2011 F150 CC 4X4 LARIAT #15035 ....................... NOW $33,945 $329 BIWEEKLY 2014 FUSION TITANIUM HYBRID #16940 ................ NOW $27,995 $195 BIWEEKLY 2013 F150 CC 4X4 XTR #71291 77KMS................ NOW $34,995 $249 BIWEEKLY 2010 CHARGER 4DR #46555 64KMS ......................... NOW $18,888 $169 BIWEEKLY 2014 ESCAPE 4X4 TITANIUM #40012 19KMS .....NOW $31,995 $225 BIWEEKLY 2010 NISSAN VERSA 5DR HATCH #52980 .............. NOW $10,995 $91 BIWEEKLY

^

60FORD BIWEEKLY AM 99 TO CLAIM YOUR PRIZE!

2015 FORD F150 4X4 CC XLT

Herb Amaral Sales Manager 250-231-2520

Discounted 12,000

$

• 1.855.534.4061

37,869

$

243 BIWEEKLY

2012 CHEV SUBURBAN 4DR 4X4 29,995 239 2011 FIESTA 4DR 8,995 69 2011 HYUNDAI SONATA GLS 4DR 13,888 118 2013 ESCAPE SE 4X4 24,888 173 NOW $ 2011 F150 CC 4X4 XLT #68211 60KMS .................. 29,995 $279 BIWEEKLY NOW $ 2013 EXPLORER 4X4 LIMITED #72661 71KMS... 38,995 $278 BIWEEKLY NOW $ 2013 EXPLORER 4WD XLT #64750 128KMS ......... 33,995 $242 BIWEEKLY 2005 HARLEY DAVIDSON SOFTTAIL #69613 ......................................... NOW $11,888 2013 FOCUS 4DR SE #9019 27KMS ................................. NOW $14,777 $96 BIWEEKLY 2006 F150 CC 4X4 XLT #11331 139KMS ............................................. NOW $13,995 2015 FOCUS 4DR SE #59615 ...................................... NOW $19,995 $135 BIWEEKLY 2013 ESCAPE SEL 4X4 #8906 39KMS...................... NOW $27,888 $194 BIWEEKLY 2011 FOCUS SE 4DR #56022 60KMS.............................. NOW $11,888 $99 BIWEEKLY 2010 MAZDA 3 #3110 .............................................................NOW $9,995 $81 BIWEEKLY 2011 F150 CC 4X4 XLT #80867 ............................... NOW $34,995 $328 BIWEEKLY 2007 FOCUS HATCHBACK #7867 116KMS ............................................. NOW $6,995 2012 F150 S/C XTR 4X4 #25823 61KMS .............. NOW $32,995 $264 BIWEEKLY 2013 MAZDA 3 #00520 45KMS...................................... NOW $15,888 $108 BIWEEKLY

Dennis Bedin Financial Services Manager

AMFORD.com 2795 Highway Dr, Trail DLN #7336 LIKE US ON

A.M.FORD

• Trailer tow package • Rear1 camera 234 5678 • Pro trailer backup assist

0.99% for 84

months MSRP 45,874

1234 5/31/16

Discounted $6,192

$

Milo Papanek Sales & Leasing 250-367-0059

Darrin Kissock Sales & Leasing 250-364-0202

Kelly MaurielloZaytsoff Sales & Leasing 250-364-8101

39,682

Discounted $5,951 MSRP $31,900

$

240 BIWEEKLY stk.#FUC30429

$

25,949

$

159 BIWEEKLY

2006 IMPALA 4DR #90878 111KMS............................................................ NOW $8,995 2015 ESCAPE SE AWD #47708 13KMS .....................NOW $29,888 $210 BIWEEKLY 2008 FUSION 4DR SE #67638 142KMS ..........................NOW $6,988 $49 BIWEEKLY 2012 FUSION SE #79077 75KMS .................................... NOW $14,995 $119 BIWEEKLY 2013 ESCAPE #18908 ..........................................................NOW $23,995 $169 BIWEEKLY 2013 FOCUS 4DR #7256 ...................................................... NOW $13,995 $89 BIWEEKLY 2012 HYUNDAI ACCENT #67676 .................................... NOW $12,995 $95 BIWEEKLY 2011 FOCUS 4DR SES #71571 ....................................... NOW $13,888 $118 BIWEEKLY 2009 KIA RIO #82891 ........................................................................................... NOW $7,995 2008 FOCUS 4DR SES #6912 ........................................................................ NOW $9,995 2012 FLEX SEL AWD #19252 40KMS ........................... NOW $27,995 $218 BIWEEKLY 2014 F150 CC XLT #96489 ............................................. NOW $36,995 $253 BIWEEKLY 2014 F150 CC XLT #66074 ............................................ NOW $33,995 $242 BIWEEKLY 2013 ESCAPE SE 37KM#60492 ............................................... NOW $23,995 166BIWEEKLY 2010 FUSION SEL#0704 .............................................................. NOW $16,995 150BIWEEKLY 2009 MAZDA 5 WGN #43683 ....................................................NOW $11,995 100BIWEEKLY 2008 KIA SPORTAGE LX# 99086.............................................. NOW $10,888 109BIWEEKLY

.ca

Richard Marsh Sales & Leasing 250-921-7424

AM FORD

250-364-0202

stk.#GKD61339

• Chrome package • Power set • Navigation • 201A package

2016 F150 stk#27648 payment is biweekly .99% for 84 months, 2016 Fiesta payments biweekly 3.99% for 96 months, 2016 F150 stk#GKD61339 payment is biweekly .99% for 84 months, 2016 Focus payment is biweekly .99% for 84 months. New F150 stk#29413 payment is biweekly 3.49% for 84 months, Escape payment biweekly 5.89% for 96 months. Payments include taxes and $689 admin fee (includes Safetivity 4 in 1 Protection) $3000 down or trade equity OAC. 2015 F150 STK#FDK73609 Payment is biweekly 3.49% for 84 months.

DJ Ashman Sales Manager

UP TO

NEW FORD ESCAPE SE

2015-2013 84 month amortization. 2012: 72 months amortization. 2009-2011: 60 months amortization. 2008: 48 months amortization. 5.89% APR. All payments are bi-weekly with $3000 cash down or trade equity. Taxes & $689 admin fee (includes Safetivity 4 in 1 protection) not included. OAC.

Dan Ashman Dealer Principal 250-364-0202

1,000 BACK

2016 $ FORD F150 4X4CASH CC XLT

All images are for display purposes only. No two offers can be combined. One offer per customer only, limit two vehicles per household. At time of printing all vehicles were available. Vehicles may not be exactly as shown. Dealer retains all rebates, discounts, and incentives in order to achieve prices and payments shown in this flyer. All dealer rebates, discounts, factory incentives, prices and interest rates subject to change or end without notice as new Retail Incentive Programs are announced. $ Vehicle offers end Thursday, March 31, 2016. (^) Up to $1,000 Cash Back available with purchase, on approved credit. Cash back amount added to vehicle amount financed. Must fit lender criteria. See dealer for details. (1) Must be current Costco member. Certain conditions may apply. See dealer for full offer details. (2) 0% APR purchase financing for up to 84 months on select new model purchases to qualified retail customers, on approved credit. Rate/Term varies by model/option package purchased. Example: $25,000 purchase financed at 0% APR for 48/ 60/ 72/ 84 months, monthly payment is $520.84/ $416.67/ $347.22/ $297.62, cost of borrowing is $0 or APR of 0% and total to be repaid is $25,000. Down payment on purchase financing offers may be required based on approved credit from Ford Credit Canada Limited. (3) All vehicles use all Ford of Canada applicable rebates and include freight. All biweekly payments include rebates to dealer, taxes and $689 admin fee extra, on approved credit. All prices exclude taxes and $689 admin fee. Dealer installed options not included. Stk#FKE32544, 84 month finance payment @ 3.49%, $0 down, Cost of Borrowing (CB): $4,831.61, Total Obligation (TO): $42,575.26; Stk#GL265270, 96 # month finance payment @ 5.89%, $0 down, CB: $12,219.31, TO: $60,032.96; Stk#GKD61339, 84 month finance payment @ 0.99%, stk. $0 down,FKD73609 CB: $1,610.21, TO: $47,245.38; Stk#GR129413, 96 month finance payment @ 4.99%, $3,000 down, CB: $5,835.35, TO: $32,782.88; Stk#GBB10353, 96 month finance payment @ 4.99%, $3,000 down, CB: $6,816.23, TO: $38,288.64; Stk#GUC13506, 96 month finance payment @ 4.99%, $3,000 down, CB: $6,811.43, TO: $38,263.68. See dealer for full details. (4) No Payments for up to 180 days, on approved credit with purchase of select models. Interest may/will accrue during payment deferment. See dealer for full offer details. Although every precaution is taken, errors in price and/or specifications may occur in print. We reserve the right to correct any such errors without prejudice or penalty to ourselves. We are not responsible for typographical errors, nor are we responsible for late receipt of mail. Contact dealerships knowledgeable and professional sales consultants for any question or more information.

140 BIWEEKLY

PRE-OWNED VEHICLES

WWW.AMWINNER.CA

BRING THIS NEWSPAPER AD TO AM FORD TO CLAIM YOR PRIZE!

All images are for display purposes only. No two offers can be combined. One offer per customer only, limit two vehi-cles per household. At time of printing all vehicles were available. Vehicles may not be exactly as shown. Dealer retains all rebates, discounts, and incentives in order to achieve prices and payments shown in this flyer. All dealer rebates, discounts, factory incentives, prices and interest rates subject to change or end without notice as new Retail Incentive Programs are announced. Vehicle $offers end Thursday, March 31, 2016. *A contest will be held with respect to the Grand Prize. Contest Begins Tuesday, March 15, 2016 and ends Thursday, June 30, 2016. No invitation/flyer and/or direct mail piece presented after this time will be valid. In order to be entitled to claim your prize, you must be at the least the age of majority as of March 1, 2016 and attend in person at AM Ford, 2795 Highway Drive, Trail, BC (“Event Headquarters”) on or before Thursday, June 30, 2016 and present/surrender your mailpiece, and answer a skills testing question. All winning prizes shall be determined by AM Ford, in their sole and absolute discretion. The Grand Prize is $25,000 in Cash. For full contest rules and regulation, see AM Ford or go on-line to www.AMWinner.ca. Winner is re-sponsible for all taxes, fees, and all registration,$according to the rules of dealership and the Canada Revenue Service. **Discounts, Services or Products worth up to $2,000 MSRP 49,869 ($1,000 Without Facebook Share). Purchase may be required. Certain conditions may apply. Redemption is at sole discretion of dealer. Amounts may vary per product, service or discount. (†) Example Based on the Canadian Black Book Value, utilizing a 1.0 to 1.0 CAD to USD currency conversion equivalent ratio, example: 1 CAD VS 1 USD = 1.22 CAD at time of print. Currency Exchange rate can change without notice. Certain conditions may apply. Cash Back available with purchase, on approved credit, customer can increase amount financed in lieu of vehicle discounts. Amount of cashback varies by make/model body purchase. Trade-in: Vehicle value to be determined by dealer, minus reconditioning cost and/or excessive kilometers. Any negative amount will be applied toward purchase of sale vehicle, on approved credit. Available on select units, see dealer for details. See NOW $may apply. See dealer $ for full offer BIWEEKLY dealer for details. (^) Up to $1,000 Cash Back available with purchase, on approved credit. Cash back amount added to vehicle amount financed. Must fit lender criteria. See dealer for details. (1) Must be current Costco member. Certain conditions details. (2) #65993 0% APR purchase financing for up to 84 months on select new model purchases to qualified retail customers, on approved credit. Rate/Term varies by mod-el/option package purchased. Example: $25,000 purchase financed at 0%............ APR for 48/ 60/ 72/ 84 months, monthly payment is $520.84/ $416.67/ $347.22/ $297.62, cost of borrowing is $0 or APR of 0% and total to be repaid is $25,000. Down payment on purchase financing offers may be required based on approved credit from Ford Credit Can-ada Limited. (3) All vehicles use allNOW Ford $of Canada applicable and include $ rebates BIWEEKLY #7920Stk#FKE32544, 120KMS84......................................... freight. All biweekly payments in-clude rebates to dealer, taxes and $689 admin fee extra, on approved credit. All prices exclude taxes and $689 admin fee. Dealer installed options not included. month finance payment @ 3.49%, $0 down, Cost of Bor-rowing (CB): $4,831.61, Total Obligation (TO): $42,575.26; Stk#GL265270, 96 month finance payment @ 5.89%, $0 down, CB: $12,219.31, TO: $60,032.96; Stk#GKD61339, 84 month finance payment @ 0.99%, $0 down, CB: $1,610.21, TO: $47,245.38; Stk#GR129413, 96 month finance payment @ 4.99%, $3,000 NOW $ for full details. (4)$ No Payments BIWEEKLY down, CB: $5,835.35, TO: $32,782.88; Stk#GBB10353, 96 month finance payment @ 4.99%, TO:BIWEEKLY $38,288.64; Stk#GUC13506, 96 month finance payment @ 4.99%, $3,000 down, CB: $6,811.43, TO:................ $38,263.68. See dealer for up to #84289 NOW $$3,000 down, CB: $6,816.23, $ 65KMS, DIESEL 180 days, on approved credit#85129 with purchase of select models. Interest..................... may/will accrue during pay-ment deferment. See dealer for full offer details. Although every precaution is taken, errors in price and/or specifica-tions may occur in print. We reserve the right to correct any such errors without prejudice or penalty to ourselves. We are not responsible for typographical errors, nor are we responsible for late receipt of mail. Contact dealerships knowl-edgeable and professional sales consultants for any question or more information. NOW $ $ BIWEEKLY #65211 46KMS ....................... NOW $ $ BIWEEKLY DL#7336 #05651 DIESEL .................

$

1.855.534.4061 OR

FOR YOUR CHANCE TO WIN!

#

$

INSTANT PRIZES

SO YOU CAN PAY LESS.

BRING NEWSPAPER AD TO

$

VINCENTRIC WINNER LOWEST TOTAL COST OF OWNERSHIP, LOWEST DEPRECIATION, & LOWEST FIXED COST IN IT’S CLASS

OR WALK-IN WITH YOUR ACCESS CODE 652743

OR WALK-IN WITH YOUR ACCESS CODE 652743 FOR YOUR CHANCE TO WIN! (1)

• Automatic INSTANT PRIZES!** • Rear view camera .99% • Power seat • Trailer Tow DL#7336 for 84 • Remote start • Running Boards months www.AMWinner.ca 2795 Highway • Protection pkg. Dr • Trail, BC | 8000 Hwy 3B • Trail, BC

0

LOG IN:

(2)

6.5 L /100 K M

$CARD!

29,963

STK#GUC13506

$ LOG 2016 FORD FIESTA IN: www.AMWinner.ca stk. GMI66141 1,000

KM

Discounted $6,124

(3)

$ CALL IN:

PLUS WIN INSTANT PRIZES!** TOWARDS MOST NEW 2015/16 VEHICLES*

$

OR

TO PAYOFF YOUR PURCHASE & LEASE HOLIDAY DEBT! FINANCING AVAILABLE!

ELIGIBLE COSTCO MEMBERS RECEIVE

PAY OFF YOUR ‘15 FORD ESCAPE TITANIUM AWDDEBT! HOLIDAY

179 WIN BW PLUS

STK#GBB10353

• Air Conditioned • 7 air bags • 5 Speed

ONLY 5 STAR SAFETY RATED SUPER CREW TRUCK!

TO 39,995

$

(4)

45,874

$

STK#GKD61339

OR

NO PAYMENTS FOR 180 DAYS! CALL IN: 1.855.534.4061

*AVAILABLE ON SELECT MODELS.

FOR 84 MONTHS WITH $0 DOWN

$

VINCENTRIC WINNER

(3)

UP TO

U.S. Currency Equivalent

Cross Border Cash Back = $4,765(†)

WIN 25,000 29,981* IN CASH! $ $179 BW

%

BW(3)

OR

‘15 FORD EDGE SEL AWD

0%

BONUS

$

23,948

ACT NOW

you top U.S. dollars for your pre-owned $ or selling out vehicle.† Whether you are trading 25,932 right, do not miss this opportunitySTK#GR129413 to get thousands more by taking advantage of the Canadian - U.S. Dollar conversion.

WIN $25,000 0.99 259 IN CASH!

$

MSRP:

STK#GL265270

OR quality

33,477 CAD

MSRP 36,119

$

$

Canadian Black Book Value

$

0.99%

FOR 84 MONTHS WITH $0 DOWN

OR

$

DO YOU LOVE YOUR TRUCK STK#FKE32544 AS MUCH AS THE DAY for pre-owned inventory Due to high demand within the United YOU BOUGHT IT? States (U.S.) market, U.S. auto ‘16 FORD FUSION brokers are seeking quality pre-owned vehicles forSE ONLY 5 STAR SAFETY immediate export into the U.S. market. $ RATED SUPER 154 BW(3) AM Ford, will have U.S. auto brokers bidding to pay CREW TRUCK!

Example: 2013 Ford F-150 Super Crew 4x4

L

$

‘16 FORD F150 CREW CAB 4X4 XLT

WE PAY MORE SO YOU CAN PAY LESS.

With this program, you will be able to trade in your current vehicle for any new Ford or pre-owned vehicle, and get paid the most possible for your trade.†

$ 10.6 /100

3.49%

FOR 84 MONTHS WITH $0 DOWN

OR

CASH $

‘16 FORD FOCUS

BW(3)

MSRP:

C R O S S B O R D E R

www.AMWinner.ca • 1.855.534.4061

AM Ford can save and restore your life with: ICE Health Records

Adam Farias Sales & Leasing 250-826-7523

Identity Theft Protection with 256 Encrypted

Private eVault

Pat Moran Sales & Leasing 250-921-5626

Missing Person Alerts

Mike Boisvert, financial services

AMFORDplus Waneta Plaza, Trail DLN #307770 FOLLOW US ON

1-800-961-0202

@AM_FORD


A12

Thursday, May 5, 2016 West Kootenay Advertiser

News

Selkirk College pioneer educator receives recognition

CASTLEGAR — Life changed for Craig Andrews when he landed a job teaching History at Selkirk College in 1968. And for the 31 years that

followed, the innovative and energetic educator made an impact that helped change the lives of all the people he touched. At the Selkirk College

Tuesday All Seats $7

Graduation 2016 Ceremony on April 22, Andrews was honoured for his tireless work with students, colleagues and communities across

the region when he received the Distinguished Educator award. “The opportunity I got to be at Selkirk College was the biggest moment of my career because everything flowed from there,” Andrews says. “I’m a hugely lucky man to have had an opportunity to work at such a place.” And Selkirk College was hugely lucky to have Andrews’ passion for post-secondary education over a diverse threedecade career. “Craig welcomed and respected students, recognized their challenges and achievements, engaged and empowered them, and appreciated their contributions to the college,” wrote nominators Denise Chernoff, Carol Andrews and John Armstrong. “An educator of educators, Craig always empowered others, creating opportunities for his teams to learn and in doing so, laid the foundations for the future.” Though his impact on

Kootenay Centre Cinemas Showline 304-2224

3D Features $10

1940 6th Avenue, Castlegar www.tribute.ca

1-866 604-2224

May 6th - May 12th Captain America 3: Civil War PG: violence, coarse languages 2D 6:45 & 9:30pm

Captain America 3: Civil War PG: violence, coarse languages 3D 6:45 & 9:30pm

The Huntsman: Winters War PG: violence, frightening scenes 7:05pm

The Boss

14A: coarse & sexual language 9:25pm

Mother’s Day

PG: coarse language 7:00 & 9:25pm

Jungle Book 3D

PG: may frighten young children 7:00 & 9:25pm

MATINEES

Saturday May 7th & Sunday, May 8th CAPTAIN AMERICAN 3: CIVIL WAR 2D/3D 12:45 & 3:30 THE HUNTSMAN: WINTERS WAR, MOTHERS DAY, JUNGLE BOOK 2D 1:00 & 3:25 Please call showline for complete listings. Shows are subject to change without notice

Adult/Youth $10 Child/Senior/Matinee/Tues $7 3D - Adult/Youth $13 3D - Child/Senior/Matinee/Tues $10

At the Graduation 2016 Ceremony on April 22 at the Castlegar Campus, Craig Andrews was given the honour of Distinguished Educator. Andrews (middle right) is pictured here with Selkirk College President Angus Graeme (left), Selkirk College Board of Governors Vice Chair Danica Lee (middle left) and Selkirk College Vice President of Education & Students Neil Coburn (right).  Selkirk College photo today’s Selkirk College is massive, former Selkirk College President Leo Perra says it’s Andrews’ passion that stands out the most. “Craig always had a gleam in his eye and he always brought enthusiasm and energy to his responsibilities,” says Perra, who was president at Selkirk College for 20 years between 1980 and 2000. “He is a caring individual and he took an interest in his staff, students and colleagues. He took on new activities willingly and carried

them out with diligence and passion.” Always one to shy away from the spotlight, Andrews never imagined he would end up on the stage at graduation as a Distinguished Educator. “I never thought for a minute that I would ever get nominated, you just go along and do your job,” says Andrews. “I’m really honoured and tremendously proud to be amongst a group of people who have been nominated who I think are some of the greatest people that Selkirk

College had.” Andrews impacted countless lives of learners, educators and community members over his 31 year career at Selkirk College. During that time, Andrews says there was never a day where he didn’t look forward to sharing his passion for learning with others. “I never looked that far down the road, I just take life as it comes,” he says about his legacy. “I didn’t have a strategic plan for myself, I simply loved what I was doing.”

THE UNOFFICIAL TRUCK OF THE WEST KOOTENAY

2016 TOYOTA TACOMA 2016 TOYOTA TACOMA ACCESS CAB TRD OFF ROAD 4X4

2016 TOYOTA TACOMA D-CAB TRD SPORT 4X4

PRICE:

RECEIVE 10,000 AEROPLAN MILES WITH PURCHASE! • 6 Speed Manual Transmission • Heated Front Seats • Navigation System

• All Terrain Tires • Bilstein Shock Absorbers

$39,695 LEASE: $199 /MONTH!

Payment & Price plus Taxes. Payment & Price include $295 Undercoating & $295 Admin Fee. 60 month Toyota Lease. 20,000 km/yr. Total Due at Delivery $3,304 or Equivalent Trade In. Total Paid $28,716 (includes $2,750 Down Payment) plus Taxes. Rate 4.99%. Buyout $17,878 plus Taxes. On Approved Credit. Model: 2016 SZ5ANM AA.

PRICE:

RECEIVE 15,000 AEROPLAN MILES WITH PURCHASE! Upgrade Package includes: • Power Moonroof • Sport Tuned Suspension • Blind Spot Monitor • Smart Key with Remote • Navigation System Entry

$43,385 LEASE: $240 /MONTH!

Payment & Price plus Taxes. Payment & Price include $295 Undercoating & $295 Admin Fee. 60 month Toyota Lease. 20,000 km/yr. Total Due at Delivery $270 or Equivalent Trade In. Total Paid $31,310 plus Taxes. Rate 4.99%. Buyout $20,059 plus Taxes. On Approved Credit. Model: 2016 DZ5BNT CA.

1530 COLUMBIA AVENUE CASTLEGAR 1.855.539.1826 | WWW.CASTLEGARTOYOTA.COM Add $295 Admin Fee to Pricing Displayed here.


West Kootenay Advertiser Thursday, May 5, 2016

A13

PROUDLY CANADIAN SINCE 1971

TAKE UP TO

60%

AS-IS FURNITURE! SCRATCH & DENT APPLIANCES DISCONTINUED ELECTRONICS!

tent sale

OFF

PLUS DO NOT PAY FOR 18 MONTHS WITH NO INTEREST*

LOWEST PRICE EVER!

UP TO

2 -Pc. Paris Linen Look Fabric Sectional

new

HOT BUY!

499

25% OFF

High Efficiency Front Load Laundry Team NOW ONLY!

NOW ONLY!

$

LOVESEAT $479 CHAIR $399 ITEM CODE: URBANGSB

APPLIANCES MARKED DOWN!

20% OFF !

73" Chenille Condo Size Sofa

OUR ORIGINAL PRICE ON CLEARANCE ITEMS IN THE TENT!

1279

$

AVAILABLE IN OPPOSITE CONFIGURATION ITEM CODE: PARISGSL

DINNING AND BEDROOM PACKAGES AND INDIVIDUEL ITEMS

Dalton Counter Hight Dining Package

1597

$

ITEM CODE: SAM5000LD

After Discount

20%-25% OFF

OUR TICKET PRICE

fL Huge NOW $2299 28-cu. Capacity Stainless

Adell Counter Hight Dining Package

ITEM CODE: FGH82866F

Steel French Door Fridge

Steel True NOW $1199 Stainless Connection Range TEM CODE:CGEF3059

YOUR CHOICE

749

$

5 - PC. INCLUDES TABLE AND 4 DINING CHAIRS ITEM CODE: 11551PPK5

no exceptions

Integrated Stainless

TEM CODE: FG1D2474F Steel Dishwasher

749

$

5 - PC. INCLUDES TABLE AND 4 DINING CHAIRS ITEM CODE: ADELGCP5

60% OFF ALL SIZES 55% OFF ALL SIZES no exceptions

NOW $799

YOUR CHOICE ITEM CODE: FRIC3004

SAVE $1281

SAVE $1320

SAVE $300

+ 2 FREE PILLOWS

new!

Burberry Eurotop Queen Mattress Set QUEEN SET ITEM CODE: BRBRYFQP REG. $1099.97

SAVE $700

399

$

After Discount

Dovington Eurotop Queen Mattress Set QUEEN SET ITEM CODE: DYNGTNQP REG. $1599.97

SAVE $900

699

$

After Discount

Allure Eurotop Queen QUEEN SET Mattress Set ITEM CODE: ALLUREQP REG. $2329.97

1048

$

After Discount

Amor Hybrid Queen Mattress Set ITEM CODE: AMORLFQP REG. $2399.97

QUEEN SET

1079

$

After Discount

Aura 2 Queen Mattress Set QUEEN SET ITEM CODE: AURA2FQP REG. $1699.97

1399

$

After Discount

*O.A.C. with The Brick Card Platinum account (the Account). Minimum Purchase (excluding taxes) of $250 is required. No interest accrues during the Promotional Period. Any Brick delivery charges, GST (5%), PST or HST (if applicable), Merchant Fee (not applicable in Quebec) and other fees or charges that apply to your Purchase (e.g. environmental fees) are required by The Brick to be paid at the time of the Purchase. Any fees or charges financed on your Account, including the Merchant Fee, will form part of your Purchase under the Promotional Offer (the Offer) .If the minimum payment on the Account during the Promotional Period is not made, the Offer will end and the annual interest rate (“Preferred Rate”) of 29.9% will then apply on any unpaid balance owing under the Offer at that time until it is paid in full. Take More Than 3 Years To Pay (39 Equal Monthly Payments, No Interest): Merchant Fee is $149.95. The minimum payment for this Offer is based on a special repayment factor of 2.564% of the amount of the Purchase for a 39 month Promotional Period. Details for a Sample Transaction on your Credit Card Product for the Take More Than 3 Years To Pay (39 Equal Monthly Payments, No Interest) Offer : Sample Purchase amount (including taxes): $2000.00, Merchant Fee $149.95 (4.75%) and interest charges (at time of Purchase): $0.00. Total interest charges & Merchant Fee: $149.95. Total Purchase amount including Merchant fee, interest charges and taxes over first 39 months $2,149.95. (Annual Fee for Card not shown in this sample transaction.). Annual Fee (Quebec Only): A $35.00 Annual Fee applies on the Primary Card ($0 each Authorized User Card). An Account Statement will be provided monthly and cover a billing period (statement period) of 28-33 days. In Quebec, a 25 day grace period applies to the Balance, and outside Quebec, a 25-day grace period applies to any Purchase that appears on your statement for the first time. The balance under this Offer may be paid at any time before the Promotional Period ends. Monthly payments may be rounded to next whole dollar. See your Cardholder Agreement for more information about the Offer including the fees and charges that apply. ‡Product may vary by location and may not be exactly as illustrated. We reserve the right to limit quantities by store and per purchase. To receive bonus offer or discount, complete package must be purchased and kept. +This offer cannot be combined with any other discount or free gift purchase, sale, or other promotion, unless otherwise specified. ∆ Excludes discounted, clearance, “Hot Buy” deals, promoted offers, iComfort, ComforPedic, and Tempur-Pedic. Minimum mattress set purchase $799.00. ++An Electronic Recycling Surcharge will be added where applicable. Receive an amount equal to the price of the extended warranty towards your next furniture or mattress purchase. Product and service availability, pricing and selection and promotional offers may vary by store. For terms and conditions visit www.thebrick.com. See in store for complete details. Offer effective May 3 - 12, 2016, unless otherwise indicated.

Like us on Facebook!

The Brick Castlegar 250-304-2700 Castlegar at Columbia and 44th Monday- Friday 9am-6pm • Saturday 9am - 5pm | Sunday 11am - 5pm facebok.com/

Check the flyer out online at thebrick.com or call The Brick Castlegar @ 250-304-2700 for questions/orders.


A14

Thursday, May 5, 2016 West Kootenay Advertiser

News

Caroline Adderson offers critique sessions at Elephant Mountain Literary Festival NELSON — Every writer benefits from feedback, especially when it comes from someone accomplished in the craft. This year, 10 writers will receive one-on-one critiques with Elephant Mountain Literary Festival’s 2016 writerin-residence Caroline Adderson. The Holley Rubinsky Memorial Blue Pencil Sessions run July 7 and 8 at the Nelson Public Library. Writer and teacher Holley Rubinsky passed away in 2015. An awardwinning author, Holley was a mover and shaker

in her beloved community of Kaslo where she mentored, encouraged and cajoled the very best from the writers who sought her guidance. Her generous bequest allows Elephant Mountain Literary Festival to offer these “blue pencil” sessions with a senior writer for a nominal fee. Caroline Adderson is the author of four novels and two story collections, including A History of Forgetting, Sitting Practice, and Ellen in Pieces, as well as a number of novels for young readers. She wrote the

screenplay for the film Tokyo Cowboy, which stars Nelson’s Cultural Ambassador Hiromoto Ida. Caroline’s work has received numerous national and international prize nominations. A two-time Ethel Wilson Fiction Prize and threetime CBC Literary Award winner, Caroline was also the recipient of the 2006 Marian Engel Award for mid-career achievement. As an advisor, Caroline critiques fiction, creative nonfiction, writing for children, and screenwriting. In addition to

Caroline Adderson.  the Blue Pencil Sessions there will be a free public

Cassandra Matichuk photo

talk on the writing craft on Wednesday, July 6

at 8 p.m. at the Nelson Library. “My connection to Holley goes back to the start of my writing career when she was on faculty at the Banff Centre and I was a participant,” says Caroline. “An original in voice and spirit, she was devoted to nurturing new talent. It’s an honour to be asked to lead the first Holley Rubinsky Memorial Blue Pencil Sessions.” Registration opens May 16, and places will be awarded on a first come, first served basis. Registered writers are

asked to submit a project description and up to 2,500 words in advance, which is followed up with a 40-minute one-on-one discussion. The 5th annual Elephant Mountain Literary Festival runs July 7 – 10 in Nelson. This year’s featured presenters include Caroline Adderson, J.B. McKinnon, Bill Richardson, Briony Penn, Richard Cannings, Grant Lawrence, and Jill Barber. For information, course registration, and event tickets go to www.emlfestival.com.

Practicing Selkirk College School of Environment what we preach & Geomatics students share research — parents and CASTLEGAR — Earlier this month, Selkirk College Castlegar Campus was abuzz with students from the Recreation Fish & Wildlife, Forestry, Integrated Environmental Planning, and Geographic Information Systems programs carrying posters and cue cards ready to share research with their classmates. Second and third year students of the School of Environment & Geomatics presented their findings from applied research projects in a day-long student conference. “It’s a great celebration of what they’ve done over the last nine months,” says School of Environment & Geomatics Chair Brendan Wilson. “Students have worked extremely hard and have answered some really interesting and important questions.” There were 82 presenters filling classrooms and lecture theatres around the college on April 6 in the 14th year of the student conference. Talks ranged in topics from whether fracking coincided with earthquakes in Northern British Columbia, presented by Chelsea Mathieson to the effectiveness of partial cutting in the Harrop Proctor Community Forest presented by Dylan Tripp and Devin Dake-Outhet. Francis Morrell presented his site suitability analysis of cities in British Columbia in relation to snow and quality of life and Jeffery Ness spoke on the best solutions for small business when it comes to drones and remote data collection. Students often chose their topics based on discovery during summer employment, lab work completed during school and personal interest. Then they went out and tackled a broader question. Presentations were as wide-ranging in topic as the students participating. Integrated Environmental Planning student Avery Deboer-Smith has been working in water conservation with municipalities and regional districts for over a year. She presented findings from researching the water level, snow water equivalent and temperature changes in reservoirs of the Columbia Basin. Her talk was entitled “Blue Gold.” “I wanted to find a way to get all this really convoluted data into a beautiful map that was really easy to understand for everyone in the community to inspire them to make

screen time

School of Environment & Geomatics chair Brendan Wilson welcomed students to share their applied research at the 14th year of the SEG Conference held in Castlegar last month. Selkirk College photo

changes in their lives to use less water,” she says. “It’s a valuable resource in our area and a lot of people may not realize last summer we had some serious issues with water shortages.” Deboer-Smith has taken her passion for water conservation beyond the student conference and is helping host Water, Drought & Climate Change Forum in Nelson. At Selkirk College, she enjoyed the day with her fellow students and the experience of presenting. “It’s about seeing people’s reactions to something like this,” she says. “The students seemed interested in learning more and joining me in being a part of this.” Wilson says applied research plays a big role in answering community and workplace-based questions and to recognize how this factors into the education and the future careers of students is important. “It’s an introduction for students, to help them get a sense of what it’s like to present applied research projects in front of a group

of their peers,” he says. “It also gives them a sense of what it’s like to go to a scientific conference. There were a lot of concurrent sessions and a full day of really interesting talks. It’s a similar format to what they would experience out in the workplace or in their further academic careers.” Selkirk College partner Applied Science Technologist & Technicians of British Columbia came on board for the conference offering up a generous prize to a student with the best presentation from each program. “This is a great incentive and it highlights the level at which these students are actually providing information,” Wilson says. The conference wrapped up with a keynote speaker. Dr. Rachel Holt from Nelsonbased Veridian Ecological spoke to about her passion for the land, its biodiversity and her work in helping to create a better, scientific-based way to manage and preserve the critical habitat elements of the Great Bear Rainforest.

By Julie Lewis I was home with my children after school one day. They were eating a snack and I was thinking about all the little “to-dos” that are part of running a household. I was texting their father about what to have for dinner when my nine year old came to me with a request “just a minute, darling” I said. Two minutes later I was emailing someone about one of the to-dos when my six year old came to me with a request — “just a minute, honey” I said. I finished the email opened up one of my favourite social networking sites, when I heard a loud “Mom!” It was then I remembered my children’s unmet requests. The research is pretty clear that when children spend too much time looking at electronic screens (TV, tablets, smart phones, gaming devices etc.) it can interfere with their development. Many parents know this and put limits on the amount of time their children spend looking at screens. But what about the amount of time us parents spend looking at screens — does that affect our kids? Digital information (emailing, texting and social networking) has become such a part of our daily lives that it is easy to lose track of how often it captures our attention and how much of the “here and now” we are missing. Babies and children live in the here and now. Babies are born ready to learn and they need their parents to input the data (with spoken words, songs, games, ideas, etc.). Children learn through real life and the discussions about real life they have with parents and caregivers. Talking and interacting with children is an essential part of helping them develop speech and language skills. This doesn’t mean parents have to play and interact with their children all day long. It’s okay for children to play by themselves some of the time. However, it is critical that children have some time every day really connecting with a parent. Relationships are built and grow when we respond to each other. I’ve decided I want to keep my own screen time to moments that I have planned to use it and not because my mind took me there by habit. So, tomorrow after school I am going to sit with my kids at the table as they eat their snack and leave my computer and phone in another room. After that, I will take some time to check my email and get the to-dos done. Then the kids and I are going to the park and I’m leaving my phone at home. Julie lewis is a registered speech language pathologist with Interior Health


West Kootenay Advertiser Thursday, May 5, 2016

A15

Browse more at:

To advertise in print: Call: Nelson 250-352-1890 • Trail 250-368-8551 • Castlegar 250-365-6397 Email: classifieds@nelsonstar.com Self-serve: blackpressused.ca Career ads: localworkbc.ca

Services

Services

Contractors

Household Services

HANSON DECKING West Kootenay Agent for Duradek 250-352-1814

Legal

A-1 FURNACE & Air Duct Cleaning. Complete Furnace/Air Duct Systems cleaned & sterilized. Locally owned & operated. 1-800-5650355 (Free estimates)

Legal

A division of

INDEX IN BRIEF FAMILY ANNOUNCEMENTS COMMUNITY ANNOUNCEMENTS TRAVEL EMPLOYMENT BUSINESS SERVICES PETS & LIVESTOCK MERCHANDISE FOR SALE REAL ESTATE RENTALS AUTOMOTIVE ADULT ENTERTAINMENT LEGAL NOTICES

AGREEMENT It is agreed by any display or Classified Advertiser requesting space that the liability of the paper in the event of failure to publish an advertisement shall be limited to the amount paid by the advertiser for that portion of the advertising space occupied by the incorrect item only, and that there shall be no liability in any event beyond the amount paid for such advertisement. The publisher shall not be liable for slight changes or typographical errors that do not lessen the value of an advertisement. Used.ca cannot be responsible for errors after the first day of publication of any advertisement. Notice of errors on the first day should immediately be called to the attention of the Classified Department to be corrected for the following edition. Used.ca reserves the right to revise, edit, classify or reject any advertisement and to retain any answers directed to the Used.ca Box Reply Service and to repay the customer the sum paid for the advertisement and box rental.

DISCRIMINATORY LEGISLATION Advertisers are reminded that Provincial legislation forbids the publication of any advertisement which discriminates against any person because of race, religion, sex, color, nationality, ancestry or place of origin, or age, unless the condition is justified by a bona fide requirement for the work involved.

COPYRIGHT Copyright and/or properties subsist in all advertisements and in all other material appearing in this edition of Used.ca. Permission to reproduce wholly or in part and in any form whatsoever, particularly by a photographic or offset process in a publication must be obtained in writing from the publisher. Any unauthorized reproduction will be subject to recourse in law.

ON THE WEB:

Announcements

Cards of Thanks ST.JUDE NOVENA May the Sacred Heart of Jesus be adored, glorified, loved and preserved throughout the world now and forever. Sacred Heart of Jesus, pray for us. St.Jude, Help of the Hopeless, pray for us. Say this prayer nine times a day, for nine days. It has never been known to fail. Publication must be promised. Thank you St.Jude. CC

Coming Events Public Notice: A.A. meetings, Grand Forks Valley Group of Alcoholics Anonymous. MONDAY 8pm. (Closed Study) at Catholic Church Rectory. 7269 9th St.; WEDNESDAY (Men’s Closed) 8pm at Anglican Church rear basement, 7252 7th St; THURSDAY and SATURDAY (Open) 8pm also at Anglican Church. Ph: 250-4428907 or 250-442-8797. Saturday Country Market May 7 - Sept 30-, 9-2. Jack Goddard Mem. Arena. Baking, Crafts, Artisans, Produce, Jeweler, Clothing, Carving, and more.

Information

Announcements

Employment

Services

Personals

Help Wanted

Financial Services

ROSE’S MASSAGE Feel good all over 250-512-1046

Lost & Found FOUND: Key on beaded key chain @Colombo Lodge park, last week of April. Please call Trail Times office to claim 250368-8551.

LOST: Crescent Valley Recycling easy grabber Blue & Silver By the recycling bins in Crescent Valley 250 399-4253 LOST: Friday Apr 22nd 1 loose key call Melanie at 250 352-9876

Travel

Travel Bonners Ferry Day Trip May 17, 2016 Call West’s Travel 1-877-365-7782 Myrt 250-368-7371 BC Reg.No.23776

250-584-4618 CANCEL YOUR TIMESHARE. NO Risk Program STOP Mortgage and Maintenance Payments Today. 100% Money Back Guarantee. FREE Consultation. Call Now. We Can Help! 1-888-356-5248

Tigz TEA HUT Experience Creston BC May Tea of the Month: NEW Fruit & Herbal Tea “CHERRY BANA” 10% off all sizes FREE shipping on all loose tea orders over $75 in BC & AB www.tigzdesigns.com

Business Opportunities CANADA BENEFIT GROUP - Do you or someone you know suffer from a disability? Get up to $40,000 from the Canadian Government. Toll-free 1-888-511-2250 or www.canadabenefit.ca/free-assessment GET FREE VENDING MACHINES. Can Earn $100,000.00 + Per Year. All Cash - Locations Provided. Protected Territories. Interest Free Financing. Full Details CALL NOW 1-866-668-6629. Website: WWW.TCVEND.COM

Education/Trade Schools

Creston Valley Blossom Festival needs vendors for the Street Fair Saturday May 21, 2016

START A NEW CAREER in Graphic Arts, Healthcare, Business, Education or Information Tech. If you have a GED, Call: 855-670-9765

Space is limited To book your space or to book a table call

Bridget Currie 250-428-5585 crestontaps@shaw.ca W W W. R O N S M AC H I N E TOOLS.CA - We offer you Great household accessories, over 5 million automotive parts, fishing & gun stores, thousands of tools, world class medical info on nutrition & lifestyle habits and the causes of type two diabetes, high blood pressure, arthritis, etc. Badminton, golf, tennis,and other sports supplies & MUCH MORE.

MAKE AN ANNOUNCEMENT

Help Wanted ARE YOU EXPERIENCING FINANCIAL DISTRESS? Relief is only a call away! Call Shelley Cameron Estate Administrator at 250-979-4357 today, to set up your FREE consultation in Nelson. Donna Mihalcheon CA, CIRP 35 years experience BDO Canada Limited Licensed Insolvency Trustee Suite 400 -1631 Dickson Avenue, Kelowna, BC V1Y 0B5

PAID IN ADVANCE! Make $1000 A Week Mailing Brochures From Home! No Experience Required. Helping home workers since 2001! Genuine Opportunity. Start Immediately! www.MailingProject.net

Medical Health HIP OR KNEE REPLACEMENT? Arthritic Conditions/COPD? Restrictions in Walking/Dressing? Disability Tax Credit $2,000 Tax Credit $20,000 Refund. Apply today For Assistance: 1-844-453-5372.

“We care about your hair loss”

Capilia Hair & Scalp Centre Thinning hair or hair Loss Dandruff, dry or oily scalp Psoriasis & Eczema Chemotherapy/radiation therapy Wigs & hair systems for men & women 3019 Hwy 3 250-428-0354 www.hairandscalpcentre.ca

Financial Services

WHERE DO YOU TURN

GET BACK ON TRACK! Bad credit? Bills? Unemployed? Need Money? We Lend! If you own your own home - you qualify. Pioneer Acceptance Corp. Member BBB. 1-877-987-1420 www.pioneerwest.com

NEED A LOAN? Own Property? Have Bad Credit? We can help! Call toll free 1 866 405 1228 www.firstandsecondmortgages.ca

dĂŬĞŶŽƟĐĞƚŚĂƚƚŚĞ'ůŽďĂůZŝĚŝŶŐĚǀĞŶƚƵƌĞƐ/ŶĐ͘;dƌĂŶƐ ĂŶĚŶĚƵƌŽ^ĞƌŝĞƐͿ͕ŚĂƐĂƉƉůŝĞĚƚŽƚŚĞDŝŶŝƐƚƌLJŽĨ&ŽƌĞƐƚƐ͕ >ĂŶĚƐĂŶĚEĂƚƵƌĂůZĞƐŽƵƌĐĞKƉĞƌĂƟŽŶƐ;D&>EZKͿ͕<ŽŽƚĞŶĂLJ ZĞŐŝŽŶ͕ĨŽƌĂ>ŝĐĞŶĐĞŽĨKĐĐƵƉĂƟŽŶĨŽƌŽŵŵĞƌĐŝĂůZĞĐƌĞĂƟŽŶ ŵŽƵŶƚĂŝŶďŝŬŝŶŐƉƵƌƉŽƐĞ͕ƐŝƚƵĂƚĞĚŽŶWƌŽǀŝŶĐŝĂůƌŽǁŶůĂŶĚ͕ ĐŝƌĐĂ'ŽůĚĞŶ͕ZĞǀĞůƐƚŽŬĞ͕ZŽƐƐůĂŶĚĂŶĚEĞůƐŽŶ͕͕ĂŶĚ ĐŽŶƚĂŝŶŝŶŐϭϬϯ͘ϮϮŚĞĐƚĂƌĞƐŵŽƌĞŽƌůĞƐƐ͘ dŚĞ>ĂŶĚƐ&ŝůĞĨŽƌƚŚŝƐĂƉƉůŝĐĂƟŽŶŝƐϰϰϬϱϲϳϮ͘tƌŝƩĞŶ ĐŽŵŵĞŶƚƐĐŽŶĐĞƌŶŝŶŐƚŚŝƐĂƉƉůŝĐĂƟŽŶƐŚŽƵůĚďĞĚŝƌĞĐƚĞĚƚŽ &ƌŽŶƚŽƵŶƚĞƌ͕ϭϵϬϮdŚĞĂƚƌĞZŽĂĚ͕ƌĂŶďƌŽŽŬsϭϳ'ϭŽƌ ĞŵĂŝůƚŽ͗ƵƚŚŽƌŝnjŝŶŐŐĞŶĐLJ͘ƌĂŶďƌŽŽŬΛŐŽǀ͘ďĐ͘ĐĂ͘ŽŵŵĞŶƚƐ ǁŝůůďĞƌĞĐĞŝǀĞĚďLJD&>EZKƵƉƚŽDĂLJϮϱ͕ϮϬϭϲ͘D&>EZKŵĂLJ ŶŽƚďĞĂďůĞƚŽĐŽŶƐŝĚĞƌĐŽŵŵĞŶƚƐƌĞĐĞŝǀĞĚĂŌĞƌƚŚŝƐĚĂƚĞ͘ WůĞĂƐĞǀŝƐŝƚƚŚĞǁĞďƐŝƚĞĂƚ ŚƩƉ͗ͬͬĂƌĨĚ͘ŐŽǀ͘ďĐ͘ĐĂͬƉƉůŝĐĂƟŽŶWŽƐƟŶŐͬŝŶĚĞdž͘ũƐƉї^ĞĂƌĐŚї ^ĞĂƌĐŚďLJ&ŝůĞEƵŵďĞƌ͗ϰϰϬϱϲϳϮĨŽƌŵŽƌĞŝŶĨŽƌŵĂƟŽŶ͘ ĞĂĚǀŝƐĞĚƚŚĂƚĂŶLJƌĞƐƉŽŶƐĞƚŽƚŚŝƐĂĚǀĞƌƟƐĞŵĞŶƚǁŝůůďĞ ĐŽŶƐŝĚĞƌĞĚƉĂƌƚŽĨƚŚĞƉƵďůŝĐƌĞĐŽƌĚ͘ĐĐĞƐƐƚŽƚŚĞƐĞƌĞĐŽƌĚƐ ƌĞƋƵŝƌĞƐƚŚĞƐƵďŵŝƐƐŝŽŶŽĨĂ&ƌĞĞĚŽŵŽĨ/ŶĨŽƌŵĂƟŽŶ;&K/Ϳ ƌĞƋƵĞƐƚ͘sŝƐŝƚŚƩƉ͗ͬͬǁǁǁ͘ŐŽǀ͘ďĐ͘ĐĂͬĨƌĞĞĚŽŵŽĮŶĨŽƌŵĂƟŽŶƚŽ ůĞĂƌŶŵŽƌĞĂďŽƵƚ&K/ƐƵďŵŝƐƐŝŽŶƐ EKd͗dĞŶƵƌĞƉƉůŝĐĂƟŽŶŝƐĨŽƌƚŚĞƵƐĞŽĨƚŚĞƚƌĂŝůƐŝŶƚŚĞ ƐŚĂĚĞĚĂƌĞĂƐŝŶƚŚĞŵĂƉďĞůŽǁ͘ŽŶƚĂĐƚŵĞŐĂŶΛƌŝĚŝŶŐďĐ͘ĐŽŵ ŝĨLJŽƵŚĂǀĞĂŶLJƋƵĞƐƟŽŶƐŝŶƌĞŐĂƌĚƐƚŽƚŚĞŵĂƉ͘

CRESTON, BC

Services

1-855-527-4368

BLOSSOM FESTIVAL

FOR

rholmes@waldun.com or call Ross or Angie at 604-462-8266

Apply at:www.credit700.ca

INTERIOR HEAVY EQUIPMENT SCHOOL. Hands-On Tasks. Start Weekly. GPS Training! Funding & Housing Avail! Job Aid! Already a HEO? Get certification proof. Call 1-866-399-3853 or go to: iheschool.com

VENDORS WANTED

WALDUN FOREST PRODUCTS Located in Maple Ridge, BC, needs experienced Shingle Sawyers. F/T positions with excellent wage and benefit packages. Qualified applicants can email their resume to:

Open 7 days/wk. 8am - 8pm

Employment

Bought and sold. 2% Better rates than the bank. GF Pawnshop. 225 Central 250-442-5552

Personal Care

$750 Loans & More NO CREDIT CHECKS

Compassionate end of life resources and support.

Boundary Area Volunteer Driver Program. Transportation for medical appointments.

Required by RK Fresh Fruit and Garden Centre Ltd. Full time work, includes; weeding, picking vegetables & packing. Wages $10.59/hr, work until the end of Nov. 4415 Rilkoff Frontage Rd. Grand Forks Fax resume: 250-442-5384

FOUND: Rubber Crocodile green USB, Memorix, 8GBFC-PLI in Selkirk Vet parking lot 2 weeks ago call 352-7193

Boundary Community Hospice Association

250-443-2162 ------------------------------

SEASONAL FARM LABOURERS

$$$----US Currency---$$$

Land Act: Notice of Intention to Apply for a Disposition of Crown Land

TO LEARN WHAT’S ON SALE?

YOUR NEWSPAPER:

The link to your community

Business/Office Service KOOTENAY MOVING Long distance household moving. Coast to Coast, in Canada.

Small Ads Get

BIG

30 years experience.

Results

778-834-4345

Career Opportunities

Career Opportunities

GRADING SUPERINTENDENT

Interoute Construction Ltd. is seeking a Grading Superintendent for the Kootenay Region. ICL Ltd. is a division of Terus Construction Ltd., a leader in the construction industry in British Columbia and the Yukon Territory. Reporting to the Division Manager/Area Managers, the Grading Superintendent oversees the execution and coordination of grading projects with respect to technical requirements, budget and timelines. The Grading Superintendent is required to plan, organize, and supervise employees on grading projects. This position is primarily a ŵeld role. The ideal candidate will possess: • A minimum of 5 years of experience on Grading Projects • Ability to read and understand projects specs, Plans, Drawings and contract documents. • The ability to work well with others, “people skills”. • Good communication skills both verbal and written. • Valid class 5 driver’s license and clean current drivers abstract. • Computer skills: Outlook, Excel, Word. :HRIIHUDFRPSHWLWLYHFRPSHQVDWLRQDQGEHQHŵWVSDFNDJH,QDGGLWLRQ WKHFRPSDQ\RIIHUVPDQ\GHYHORSPHQWRSSRUWXQLWLHVWKURXJKWDLORUHG WUDLQLQJSURJUDPV)RUDIXOOMREGHVFULSWLRQDQGsubmit your resume SOeDse Yisit our Zebsite Dt ZZZterusFoQstruFtioQFD ICL Ltd. would like to thank all applicants for submitting their resume. However, only applicants selected to be interviewed will be contacted. The job posting closes on May 16th.

TRY A CLASSIFIED


A16

Thursday, May 5, 2016 West Kootenay Advertiser

Services

Merchandise for Sale

Merchandise for Sale

Rentals

Household Services

Fruit & Vegetables

Misc. Wanted

KOOTENAY DUCT CLEANERS Duct Cleaning EVERYONE can afford $250 whole home $150 mobile home No hidden costs! Professional & Insured Locally owned & operated Toll free 1.844.428.0522

FRESH ASPARAGUS NOW AVAILABLE Sutcliffe Farms Creston, BC Place your order to ensure availability Pickup location right at the farm! 1252 Indian Road (off Lower Wynndel Rd)

Property Management

Moving & Storage STEEL STORAGE CONTAINERS FOR SALE OR RENT jentonstorage@gmail.com

604-534-2775

www.sutcliffefarms.com sutcliffefarms@gmail.com

250-428-2734

Garage Sales Grand Forks: 7731 - 21st St. Fri. & Sat., May 6 & 7, 8 am 1 pm. Multi Family Yard sale, Fri & Sat, May 6&7, 9-4 ,Rivershore Trailer court, 7151 Hwy 3, Beside Johnny’s Motel

Paving/Seal/ Coating

Yard sale- May 6&7- 8-4 6989 -2nd St., Lots of stuff and some garden plants.

NOTICE

Misc. for Sale

BLACKTOP NOW! NO JOB TOO SMALL

Driveways & Parking Lots 1-888-670-0066

FREE ESTIMATES! CALL NOW!

POWER PAVING SERVING ALL THE KOOTENAYS

2005 Okanogan Camper, 9ft.. Sofa+2 chairs+2 foot stools, woman’s bike, mans bike, old electric organ. 250-442-5793 2 - 4hp Sears outboard motors. $200. 4 x 8 air hockey table, $100. Rebuilt turbo 400 transmission, $600. 250-4434775 3/4 yr old peony plants, 2 Palliser swivel recliner chairs & ottomans coffee table, 2003-5 Chevy 5th wheel tail gate. 250-442-3653 Affordable Steel Shipping Containers for sale/rent 20’ & 40’ Kootenay Containers Castlegar 250-365-3014 Ariens riding mower, like new $1500. Truck canopy- long box, silver gray,$500. 250447-9322 or 250-443-4233. Dresser, Queen size bed & mattress, new Webber electric barbecue, oak buffet & hutch, portable infrared heater, 2 burner camp stove. 250-442-0373. Electric, 4 wheel scooter with charger. $1,000 obo. 250-442-3598 For Sale: Bicycles and parts, Campers. 250-442-0318 Grand Forks: Composted manure, delivery available. Holstein steers for sale. 250-4425372.

www.spca.bc.ca

Pets & Livestock

Livestock 18 yr old Paint Gelding, good manners, sound, $800. Eamor saddle and tack $500. Owl Mountain Ranch. 250-447-9442

Merchandise for Sale

Farm Equipment John Deere Tractor Model 40, runs well, looks great, 3 P.H. & PTO, c/w rear blade. Asking $3,500. 250-442-0957

Firearms 4 boxes left of .270 Winchester or Federal ammunition. $100 for all 4 boxes 250-443-3132.

WANTED: RIFLES, shotguns, restricted weapons, reloading equipment, decoys or any other shooting related items. Fully licensed. Glen 250-428-6750

Food Products BC INSPECTED GRADED AA OR BETTER LOCALLY GROWN NATURAL BEEF Hormone Free Grass Fed/Grain Finished Freezer Packages Available Quarters/Halves $4.95/lb Hanging Weight Extra Lean Ground Beef Available TARZWELL FARMS 250-428-4316 Creston

Kubota T1670 lawn tractor. Well maintained, very good condition, 15 HP, OHV air cooled gas engine, Hydrostatic transmission, 3 cutting blades, 44 inch cut, blower and grass catcher, snow plowing blade and chains. Asking $2,400. 250-442-2656. REFORESTATION NURSERY SEEDLINGS of hardy trees, shrubs, & berries for shelterbelts or landscaping. Spruce & Pine from $0.99/tree. Free Shipping. Replacement guarantee. 1-866-873-3846 or www.treetime.ca

Rockwell Beaver table saw, $100. De Walt 5” palm sander, $70. Ridgid router combo set, $100. Craftsman 1/4” router, $30. Router table, $80. Delta miter saw, $20. Gratus 5 speed drill press, $60. Lamello Cobra biscuit joiner with one box of 0-10&20 biscuits, $190. Mastercraft mig & flux core welder, $225. Lincoln electric welding helmet, $85. Wait 7000 furnace humidifier, $100. 250-442-5593 Treadmill for sale, Good Working Condition, $75. 250-442-5533 Utility trailer, 4x8’ plywood box, $500. Rear wheeldrive lawn mower, electric start, $250. 250-447-6549 Windows: 2-2x4 frosted $5 each. 3-3x5 $15 each. 1-3x4 $10. Patio door, 6ftx80, sliding $25. Engine stand $60. Engine dool $30. Creeper $15. 250-442-1248

Misc. Wanted 999 COINS & BARS. 250-864-3521, I want to buy your coin collection also buying everything gold or silver. Todd’s Coins 250-864-3521

Wanted to rent a wheel chair van + driver for few hrs, Sat May 14 & Sun 15th to go from Grand Forks to Greenwood. Phone: 250-642-6105/Victoria Wanted, Van or Camper Van, Manure spreader and rotary mower for small tractor, concrete well rings. 250-447-9193 We buy gold! Rings, chains, bracelets, etc. Cash paid by value (weight and karat). Even broken jewelry and scrap gold. Picture ID required. Grand Forks Pawnshop, 225 Central. 250-442-5552.

WHERE DO YOU TURN

TO LEARN WHAT’S ON SALE?

YOUR NEWSPAPER:

The link to your community

Real Estate Houses For Sale Grand Forks: across from hospital, fixer upper. On treed & serviced lot. 250-442-2804

Lots RV Lots for sale on Kootenay Lake located on the west arm two kilometres from the Balfour Ferry, prices starting at $65,000. Call 1-877-352-9172, email zane@balfourresort.com or visit balfourresort.com

Mobile Homes & Parks Grand Forks: Must sell mobile on lg lot, has rental suite. 3010 First Rd. $89,000obo. 250-442-2300. Evenings only.

Rentals Apt/Condo for Rent Bella Vista, Shavers Bench Townhomes. N/S, N/P. 2-3 bdrms. Phone 250-364-1822 Ermalinda Estates, Glenmerry, spacious 1-2bdrms. Adults only. Secure building w/elevator. N/S, N/P. Ph.250-3641922 E.TRAIL, 2BDRM Gyro park, heat, hot water & cable incl. $675/mo. 250-362-3316 Francesco Estates, Glenmerry,spacious 1-3bdrms. Adults only (45+). Secure building w/elevator. N/S, N/P. Ph. 250368-6761 Fruitvale 1 & 2bd suites W/D, F/S. refs. $550 to 700/mo + util 250 921 9141 Grand Forks: avail. March 1. Bridgeview Place. Brand new, executive style, 1 BR and 1 BR and den apartments for rent, NS, NP, RR, $750 to $950/month + util. Call Julie 250-447-6313 or 250-4440450. TRAIL, spacious 1&2bdrm. apt. Adult building, perfect for seniors/ professionals. Cozy, clean, quiet, comfortable. Nicely renovated. Must See. 250-368-1312, 250-364-0352

Commercial/ Industrial Commercial &/or Retail space in downtown area of Grand Forks 250-442-2276 / 250-442-6800 Grand Forks: Bridgeview Place: Two commercial spaces for rent. 860 sq. ft. and 790 sq. ft. rent: $550 - $650 + utils. Contact Julie at 250-444-0450 email:obrien.julie3@gmail.com

Homes for Rent Grand Forks: 3bdrm house, close to dwntwn, recently renoed, 5 apply’s, N/S, $875 + utils. Avail June 1st. 403-710-3050 Grand Forks: Avail Immed 2 bdrm home in Clifton Estates mature tenants only. $1100/m+util. 250-443-9058

PUZ Z LE

Rentals

Grand Forks

1 bdrm + den mobile 4 appl’s private setting $675 1 bdrm apt 3 appl’s $675 utilities inc. 2 bdrm apt 2 appl’s $825 close to dwntwn utilities inc. 2 bdrm apt 4 appl’s dwntwn $900 utilities inc. Unique office space dwntwn $250 utilities inc.

Greenwood

1 bdrm home 4 appl’s $550 TERM NEGOTIABLE ON PRIME INDUSTRIAL COMMERCIAL or OFFICE SPACE IN GRAND FORKS N/S, N/P, References. Ken: 250-442-2632 Ron 250-442-7636 ken.dodds@yahoo.ca Grand Forks Realty Ltd.

Rooms for Rent Grand Forks: room in 3 bdrm house, utils inc, furnished, near Overwaitea, $400. For sale older mobile home on 5 acres, $180,000. Also place to park your motor home or camper, $330/m, power hook up, etc, 5 min from town. 250442-0122

Shared Accommodation GRAND FORKS: Shared accommodation: Must be a responsible, employed person, RR, NP, NS., Laundry/utils. included $450/m. 250-584-9710

Suites, Upper Grand Forks: Very spacious 1 BR, utils inc. W/D, WiFi, deck, NS, NP. $700/m. 250-4422049.

Townhouses GRAND FORKS. 3 bedroom townhouse. N/P, Fridge/Stove, Washer/Dryer, Refs. req’d. $900/mo. Call (403)479-8712

AEROBIC ALDOLASE AQUATHERAPY ARTHRITIS ASPIRATION AUTOIMMUNE BENDING BURSA CARTILAGE CHONDROITIN CHRONIC CORTISONE

DEGENERATIVE ENDORPHINS EXERCISE FIBROMYALGIA GLUCOSAMINE GOUT INFLAMMATORY ISOMETRICS JOINT LUPUS MASSAGE MEDITATION

MOTION OCCUPATIONAL PAINFUL PHYSICAL RANGE RELIEF RHEUMATOID STEROIDS STIFFNESS STRENGTH THERAPY

Want to Rent Looking for a 2-3 bdrm house, in GF area. NP. NS. 250-442-2499 / 250-584-4070

WEEKLY

Transportation

Auto Services Wanted to rent a wheel chair van + driver for few hrs, Sat May 14 & Sun 15th to go from Grand Forks to Greenwood. Phone: 250-642-6105/Victoria

Cars - Domestic 1998 & 1999 Buick, $1,200 & $2,700. Low km, lady driven, call evenings. 250-442-2300 1999 Honda CRV, AWD, 310K, 4 cyl auto, runs like new, $2,700. 1998 Mazda MPV 4 wheel drive, seats for 8 people, one owner, 195K, V6 auto, fully loaded, $3,700. 250-442-0122

Recreational/Sale 1990 Pace Arrow RV, 37ft, new batteries & tune up, fully loaded, great for vacation property, work site, travelling. Arizona room. Low mileage. $10,000, will consider offers, serious buyers only. 250-4423071 1992 Wilderness -5th wheel, 25.5 ft. Reasonable offers. 250-442-3707 2002 4x4 GMC Sierra, excellent cond., $5,000 obo. Free canopy included. 250-4422479 26 ft. 2008 Cougar trailer w/push out, queen bed, excellent condition, asking $14,500. 250-442-5289.

Trucks & Vans 2005 Dodge Grand Carivan, 220, 000km, one owner, clean, $4,500obo. 250-442-2552

Boats World’s Finest FISHING BOATS

Weldcraft, Hewescraft, Lund, Godfrey Pontoons Mark’s Marine, Hayden, ID 1-888-821-2200 www.marksmarineinc.com

ARIES - Mar 21/Apr 20

LIBRA - Sept 23/Oct 23

Things seem to be in high gear this week, Aries. Others around you are just as boisterous, and it may even seem manic. Exercise a little extra patience to get through.

Libra, no matter how hard you try to get yourself heard, others just aren’t ready to listen. Perhaps you have to try a new approach to making your voice heard?

SCORPIO - Oct 24/Nov 22 TAURUS - Apr 21/May 21 Taurus, you have been hiding something and it’s time you let your feelings out in the open this week. Pay attention to how others react to the news.

Scorpio, you may find yourself in trouble this week because you keep on starting new things without finishing others. Pretty soon you will have a list of unfinished business.

GEMINI - May 22/Jun 21

SAGITTARIUS - Nov 23/Dec 21

If you crave adventure, Gemini, then it could be time to host a party or see if friends want to go out on the town. Staying home mulling over all of the options will get you nowhere.

Restlessness can get the better of you this week, Sagittarius. Just don’t jet off on some spur-of-the-moment trip to try to channel your energy. You have things to handle first.

CANCER – Jun 22/Jul 22

CAPRICORN - Dec 22/Jan 20

This week’s contradictory cosmic energy will not help you when making decisions, Cancer. It is entirely up to you and your gut instincts to make the right decisions.

Finding yourself in the middle of a sticky situation has you trying to discover a solution to a complicated problem, Capricorn. You might need to distance yourself for a little while.

LEO - Jul 23/Aug 23 Leo, do not ignore the inner voice that is trying to tell you to take life more seriously. It can’t be all fun and games. Buckle down at work and set a plan into action.

VIRGO - Aug 24/Sept 22 Circumstances beyond your control will make work a little more stressful than you had anticipated, Virgo. Bide your time and soon the week will be over.

AQUARIUS - Jan 21/Feb 18 A disagreement with a friend or family member could turn your schedule upside down for a little bit, Aquarius. You’ll get back on track soon enough and resolve your issues.

PISCES - Feb 19/Mar 20 Pisces, getting your finances in order will take more than balancing your checkbook. It might be time to make some cuts and follow a budget.


West Kootenay Advertiser Thursday, May 5, 2016

A17

Arts

Kootenay artists to show collection at Touchstones NELSON — Touchstones Nelson will feature 38 paintings of twelve artists of the West Kootenay Chapter of the Federation of Canadian Artists (FCA) from May 13 to May 18. The work, selected by jurors Susie Cipolla SFCA, Tatjana Mirkov-Popovicki SFCA, and Fran Alexander AFCA, is a collection of various mediums including oil, acrylic, and watercolour. The twelve artists represented in the exhibit are: Elaine Alfoldy, Creston; Lucy Bates, Fruitvale; Darlene Dautel, Grand Forks; Brigitte Desbois, Nelson; Sandra Donohue, Robson; Helena Edmison, Trail; Robyn Gold, Winlaw; Alison Graeme, Nelson; Stephanie Gauvin, Rossland; Sandra Irvine, Nelson; Astrid Pinkerton, Robson; and Barbara Pistak, Rossland. FCA prizes were awarded as: FCA First Prize to Elaine Alfoldy of Creston for “Sunflowers in a Jar,” (watercolour);

FCA Second Prize to Stephanie Gauvin of Rossland for “Sparkle,” (acrylic); and FCA Third Prize to Brigitte Desbois of Nelson for “Shutty Beach Bench Early Evening,” (oil). FCA Awards of Excellence were given to Lucy Bates of Fruitvale for “Drinnon Pass,” (oil); Sandra Donohue of Robson for “Knock, Knock,” (watercolour); and to Astrid Pinkerton of Robson for “Rialto Fountain” (watercolour). Join and meet the artists at the opening reception at Touchstones Nelson, 502 Vernon St. from 7 p.m. to 8:30 p.m. Hours for Touchstones Nelson are: mid season to mid-May: Wed. to Sat. 10 a.m. to 5 p.m., open late Thurs. to 8 p.m., and Tues. and Sundays 11 a.m. to 4 p.m. The Federation of Canadian Artists, founded in 1941, is a community of artists and art lovers. The FCA head office and gallery are located in Vancouver, on Granville

May 15, 2016

Find the WALK in your community. Register now to end MS

mswalks.ca

Island where bi-monthly juried exhibits by emerging and signature artists are featured. Its mission is to promote the passion and pleasure of the visual arts through exhibition, education and communication. The FCA, a non-profit organization has chapters throughout Canada. More information about the FCA membership, exhibits,

and workshops can be found on its website artists.ca. The WKCFCA, formed in May 2001, includes thirty members in the West and East Kootenays, and the Okanagan. Meetings are held four times a year. Their aims are to encourage artistic and professional growth through critiques, and demos at

meetings, and workshops instructed by local, national and internationally known artists. For more information about the West Kootenay Chapter of the FCA, contact Sandra Donohue at 250365-7084. An opening reception will be held on Friday, May 13 from 7 to 8:30 p.m. Refreshments will be served.

Georama has been Kootenay Gardeners #1 choice for plants for 46 years and running! We have a beautiful selection of herb, vegetable and berry plants ready to go! New at gardening? Let our excellent staff help you. Just a short, scenic drive 5 min West of Nelson on Granite Road www.georamagrowers.com • 250-352-3468 Mon to Sat 8-5:30 • Open Sundays 10-4


A18

Thursday, May 5, 2016 West Kootenay Advertiser

Literary arts

Convergence Writers’ Weekend May 13 to 14

SILVERTON — Some West Kootenay environmentalists have found a unique way of joining the audience converging on Silverton, BC to attend the Convergence Writers’

Weekend May 13 to 14. Members and supporters of Kootenays for a Pipeline-Free BC will leave Nelson, BC May 12 to cycle through the Slocan Valley in time to

arrive in Silverton for the evening opening event of the writers’ weekend. The weekend features two well-known environmental authors participating in talks, workshops and

panel discussions on the theme of “The Spirit in the Landscape.” “It’s great we can ride to the Convergence weekend in Silverton,” said ride co-organizer

Standard Challenger 6 speed...

Shanna Fritz Sales

Keith Wiley. “The gathering’s topic is a lot of what riding the Kootenay Loop is about: feeling the spirit of this beautiful place.” Wiley, a co-host of Kootenay Co-op Radio’s

Put your name on it!!!

Chris Wenger

Sarah Youngson

Sales

Our Parts Department is Open Saturdays 9am - 4pm

EcoCentric program, helped organize two previous “Bikes Not Pipes” tours of the Nelson-New Denver-Kaslo-Nelson loop to protest the proposed Enbridge and

Business Manager

Trail Waneta Junction 250-368-8295 1-888-303-6343 www.kootenaychrysler.com

sales@kootenaychrysler.com

Gary Ashley

Sales Manager

When you’re in the Kootenays, you’re in Kootenay Chrysler Country!

At Kootenay Chrysler, we don’t sell you a car, we help you buy one.

DL. No. 5888

Kinder Morgan pipelines in 2014 and 2015. “Self-powered transport is going to be a bigger part of our clean energy future, and we can enjoy it now,” Wiley said. “This year’s tour is about a wonderful ride through a beautiful landscape and about keeping in mind that we’re moving to a new future.” Headline speakers at Silverton are Sharon Butala of Calgary, best known for her 1994 memoir of Saskatchewan ranch life, The Perfection of the Morning, and J. Edward Chamberlin of Halfmoon Bay, BC, whose If This Is Your Land, Where Are Your Stories?: Finding Common Ground (2003) explores how stories and songs locate people, including aboriginal groups worldwide, within a landscape. More information about the Convergence Writers’ Weekend, including how to register, is available at www.heartsrest.com/ convergence/convergence-writers-retreat The Bikes Not Pipes ride will leave Nelson at noon May 12 and overnight in Winlaw, arriving at Silverton the next day. Following the close of the Convergence Writers’ Weekend, the tour will leave Silverton on May 14, overnight in Kaslo, and reach Nelson on May 15. More information, including how to participate, is available from Wiley at 250-7772020, John Alton at 250777-1504, or email: noenbridgepipeline@gmail. com. Wiley stresses that riders are welcome to join in at any stage of the ride. The sponsoring organization for the Bikes Not Pipes tours, Kootenays for a Pipeline-Free BC, is a Nelson advocacy group that raises awareness about the dangers of oil pipeline development and other environmental threats. Previous Convergence Writers’ Weekends were held in New Denver in 2012 and 2013. Financial support for this year’s convergence has come from the ProVision Fund of the BC Conference of the United Church, Area H of the Regional District of Central Kootenay, and the Columbia Basin Trust.


T:10.25”

West Kootenay Advertiser Thursday, May 5, 2016

Drive to Surprise

TEST DRIVE & WIN 1OF 30

%

ALL +

FINANCING ON

2016s

11 ! ALL-NEW

LEASE FROM

POWER TO SURPRISE EXPERIENCES

TEST DRIVE FROM MAY 5TH TO 15TH AND RECEIVE A $60 GIFT °

≈ TO BE USED IN THE DEALERSHIP

2016

LX AT

109

$

1.9%

$2,985 DOWN AT

BI-WEEKLY ≠

Best Family Car

10,000

§

$

Φ

DAYS ONLY

A19

APR FOR 60/MO ≠

INCLUDES $500 COMPETITIVE BONUS** OR LOYALTY BONUS¶

T:14”

AVAILABLE FEATURES: HEATED FRONT & REAR SEATS NAVIGATION SYSTEM Optima SX AT Turbo shown‡

BEST CANADIAN RESIDUAL VALUE IN ITS CLASS 3 YEARS IN A ROW

5-Star Safety Ratings More Stars. Safer Cars.

2016

2016 Forte SX AT shown‡

SEDAN LX MT

WELL-EQUIPPED FROM

INCLUDES

12,495 5,067

$

* $

*

IN CASH DISCOUNTS

INCLUDES $500 COMPETITIVE BONUS** OR LOYALTY BONUS¶ AND $67 DEALER PARTICIPATION*

Soul SX Luxury shown‡

LX AT

LEASE FROM

99

$

$1,375 DOWN AT

BI-WEEKLY ≠

0.9%

APR FOR 48/MO ≠

AVAILABLE FEATURES: HEATED FRONT SEATS PANORAMIC SUNROOF

AVAILABLE FEATURES: HEATED FRONT & REAR SEATS REARVIEW CAMERA

kia.ca/drivetosurprise

Offer Ends May 31

Castlegar Kia

1665 Columbia Avenue, Castlegar, BC V1N 1J1 (250) 365-0321

Offer(s) available on select new 2016/2017 models through participating dealers to qualified retail customers who take delivery from May 3 to 31, 2016. Dealers may sell or lease for less. Some conditions apply. See dealer for complete details. Vehicles shown may include optional accessories and upgrades available at extra cost. All offers are subject to change without notice. All pricing includes delivery and destination fees up to $1,725, $22 AMVIC, $100 A/C charge (where applicable). Excludes taxes, licensing, PPSA, registration, insurance, variable dealer administration fees, fuel-fill charges up to $100, and down payment (if applicable and unless otherwise specified). Other lease and financing options also available. Φ0% financing on all 2016 models. Available discount is deducted from the negotiated purchase price before taxes. Certain conditions apply. See your dealer for complete details. Representative Financing Example: Financing offer available on approved credit (OAC), on a new 2016 Forte Sedan LX MT (FO541G) with a selling price of $17,562 is based on monthly payments of $565 for 24 months at 0% with a $0 down payment and first monthly payment due at finance inception. Offer also includes $4,000 discount ($3,500 loan credit and $500 competitive bonus** or loyalty bonus¶). Cost of borrowing is $0 and total obligation is $17,562. Other taxes, registration, insurance and licensing fees are excluded. ≠Representative Leasing Example: Lease offer available on approved credit (OAC), on the 2016 Optima LX AT (OP741G)/2016 Soul LX AT (SO752G) with a selling price of $25,362/$21,742 (includes $0 lease credit discount and $500/$0 competitive bonus** or loyalty bonus¶) is based on bi-weekly payments of $109/$99 for 60/48 months at 1.9%/0.9%, with $0 security deposit, $2,985/$1,375 down payment and first bi-weekly payment due at lease inception. Total lease obligation $14,224/$10,279 with the option to purchase at the end of the term for $9,122/$10,643. Lease has 16,000 km/yr allowance (other packages available and $0.12/km for excess kilometres). *Cash Purchase Price for the new 2016 Forte Sedan LX MT (F0541G) is $12,495 and includes a cash discount of $5,067 (including $500 competitive bonus** or loyalty bonus¶ and $67 dealer participation). Dealer may sell for less. Other taxes, registration, insurance and licensing fees are excluded. Cash discounts vary by model and trim and are deducted from the negotiated selling price before taxes. **$500/$750 competitive bonus offer available on the retail purchase/lease of any new 2016 Forte, 2016 Sorento, 2016 Sportage, 2017 Sportage, 2016 Optima, 2016 Rio, 2016 Rio5 and 2016 Rondo/2016 Sedona and 2016 Optima Hybrid from participating dealers between May 3 and May 31, 2016 upon proof of current ownership/lease of a select competitive vehicle. Competitive models include specific VW, Toyota, Nissan, Mazda, Mitsubishi, Hyundai, Honda, GM, Ford, Jeep, Pontiac, Suzuki, Saturn, Chrysler, Chevrolet, Subaru, BMW, Mercedes-Benz, Lexus, Land Rover, Infiniti, Acura, Audi, Lincoln, Volvo, Buick and Jaguar vehicles. Some conditions apply. See your dealer or kia.ca for complete details. ¶$500/$750 loyalty bonus offer available on the retail purchase/lease of any new 2016 Forte, 2016 Sorento, 2016 Sportage, 2017 Sportage, 2016 Optima, 2016 Rio, 2016 Rio5 and 2016 Rondo/2016 Sedona and 2016 Optima Hybrid from participating dealers between May 3 and May 31, 2016 upon proof of current ownership/registration of Kia vehicle. Some conditions apply. See your dealer or kia.ca for complete details. ≈$60 gift will be awarded in the form of 20,000 Kia Member Rewards Dealer Points which can be redeemed at the participating Kia dealership in Canada where the customer took the test drive. $60 gift can be used towards the purchase of parts, services, accessories or maintenance. In order for the points to be awarded, customers must have a Kia Member Rewards account. The Kia Member Rewards Program is open to any licensed driver with a Canadian mailing address and enrollment in the Program is free for the purposes of this promotion. Further details about the Program and Dealer Points are available at kia.ca/member-rewards. °Your local dealer may be closed May 15. Visit kia.ca/find-a-dealer for dealership hours. §No Purchase Necessary. Enter by taking a test drive at a participating dealer or online at kia.ca/drivetosurprise. Open to Canadian residents over the age of majority. Contest begins May 3, 2016 and ends June 30, 2016 at 11:59 pm ET. 30 Prizes will be awarded (10 to Quebec residents, 20 to residents of rest of Canada). Each prize consists of winner’s choice of a trip experience up to $10,000, or $10,000 towards a Kia vehicle purchase/lease. Complete contest rules in dealership or at kia.ca/drivetosurprise. ‡Model shown Manufacturer Suggested Retail Price for 2016 Optima SX AT Turbo (OP746G)/2016 Forte SX AT (FO748G)/2016 Soul SX Luxury (SO758G) is $35,195/$26,695/$27,495. The Bluetooth® wordmark and logo are registered trademarks and are owned by Bluetooth SIG, Inc. ALG is the industry benchmark for residual values and depreciation data, www.alg.com. Government 5-Star Safety Ratings are part of the National Highway Traffic Safety Administration’s (NHTSA’s) New Car Assessment Program (www.SaferCar.gov). Information in this advertisement is believed to be accurate at the time of printing. For more information on our 5-year warranty coverage, visit kia.ca or call us at 1-877-542-2886. Kia is a trademark of Kia Motors Corporation.


A20

Thursday, May 5, 2016 West Kootenay Advertiser

Community

Castlegar hosts 2nd annual Peony Show

CASTLEGAR — Flower lovers are in for a treat as the Canadian Peony Society BC Yukon Division will be hosting a peony show on June 11 at the Castlegar Community Complex. This will be Castlegar’s second show — last year’s popular event saw over 300 entries, some from as far away as Regina. This year’s show is planned a little earlier in the hopes that locals can just go out into the yard, cut their blooms, and enter them into the show. The show is an amateur, entry level show in which everyone is invited to participate. Entries must be delivered on Friday, June 10. There are about 60 classes and four ribbons per class will be awarded. Last year quite a number of the entries were from out of the region, and organizers would really love to see locals walk away with a lot of the ribbons this year. “We need the locals to buy in and help us make a fabulous show,” said organizer Holly Pender-Love. “One bud, one arrangement, ten or fifteen flowers, we don’t care. We want them to feel that the show belongs to Castlegar.” The show will be held at the Castlegar Community Complex and along with the competitions, will also feature seminars and workshops. Seminars will begin at 10 a.m. on Saturday, June 11 and cover such topics as basic peony care, floral designs using peonies, flower selections to compliment your peonies and how to get seven weeks of bloom out of your peonies. Even if you are not a gardener, the show itself is something you won’t want to miss. Starting at noon on June 11, a ribbon will be cut, and the public will be welcome to

One of the many beautiful entries in last year’s peony show. Larry Doell photo

view not just the winners, but all of the entries. Admission is free. When the show is over, any owners wishing to take home their entries will be allowed to collect them, and then all remaining blooms will be up for sale at 6 p.m. If you would like more information about the show including information on how to cut your peonies early and store them for the show or how to ship peonies, contact Holly Pender-Love at hplove8@telus.net. Sponsors of the event include Castlegar Communities in Bloom, Castlegar Garden Club, Castlegar Chamber of Commerce, the City of Castlegar, RDCK Areas I and J and Columbia Basin Trust.

Two of last year’s BC Yukon Canadian Peony Society show winners. Larry Doell photo

IS YOUR VEHICLE BEACH READY?! Stay cool this summer

Optimize your performance

Refresh your ride

• Air conditioning Health Check • A.C performance test. • Check a/c drive belt for wear and proper tension • Check system for signs of leaks • Deodorize and disinfect A.C ducts Plus receive • Check cabin filter a free gift • Pressure wash condenser

• Fuel System Service Specials • 15% Off Throttle Body Service • Helps morning start times • Promotes smoother acceleration and better response time • Helps fuel Mileage

• Full exterior hand wash and dry including door jams and sills • Vacuum interior and wipe dash • Clay bar/ fallout removal to smooth out paint • Complete Vehicle Machine Wax to shine and protect (will not remove scratches)

All for $9495

A $25.00 saving

Plus receive a free gift

• $10.00 off Fuel Injection System Cleaning • A two-step 360° fuel system cleaning process • Restores efficiency to the EFI system. • Oxygen sensors and catalytic converter safe. • Helps improve fuel economy. • Controls moisture produced by condensation in the fuel system.

19995

Cars $

• Light fabric clean and small spot removal (see your advisor for specific spots) • Clean all windows and mirrors

Plus receive a free gift

21995

Trucks and SUVs $

All specials exp 05/31/16. Please present coupon at time of arrival.

1530 COLUMBIA AVENUE CASTLEGAR 1.855.539.1826 | WWW.CASTLEGARTOYOTA.COM

West Kootenay Advertiser, May 05, 2016  

May 05, 2016 edition of the West Kootenay Advertiser

West Kootenay Advertiser, May 05, 2016  

May 05, 2016 edition of the West Kootenay Advertiser