Issuu on Google+

Thursday January 16, 2014 (Vol. 39 No. 5)

V O I C E

O F

W H I T E

R O C K

A N D

S O U T H

S U R R E Y

w w w. p e a c e a r c h n e w s . c o m

Holding court: Three south-end teams – Southridge, Lord Tweedsmuir and Tamanawis – have moved on to the second round of the Surrey RCMP Basketball Classic. i see page 27

Mayor warned last summer of potential disaster, as BNSF pursues talks with Semiahmoo First Nation

Train-trestle replacement still awaits Alex Browne Staff Reporter

BNSF is still negotiating with Semiahmoo First Nation for access to build a longawaited replacement for the Little Campbell River railway bridge in South Surrey. And the company’s desire to get the $1.3-million project underway as soon as possible is unchanged, according to Burlington Northern Santa Fe Railroad spokesperson Gus Melonas.

“We’re continuing to pursue the discussion process,” he told Peace Arch News Tuesday, standing by statements made last August that the company had hoped to get started on the project before the end of 2013. “We’re hoping to expedite a remedy,” Melonas added, but declined to elaborate further. Semiahmoo band councillor Joanne Charles has not return PAN’s request for comment. The decaying bridge – originally constructed

in 1921, with an 80-foot steel replacement span constructed in the early 1940s – sits on a BNSF-owned right of way through the Semiahmoo First Nation reserve. While ongoing maintenance work can be done from the rail bed, construction of a new bridge will require the building of a temporary road onto Semiahmoo First Nation property, plus access for driving pilings. Corrosion of the bridge drew safety criti-

cism last summer from Bill Brehl, teamsters Canada Rail Conference Maintenance of Way Employees Division president, and BC NDP leader Adrian Dix. Following the disastrous derailment in Lac-Mégantic, Que., White Rock Mayor Wayne Baldwin wrote to Transport Canada last July with the city’s concerns about the condition of the bridge. i see page 4

Skyline highlights White Rock’s shoreline is serene yet eerie in this time-exposure captured last week from across the bay, from the Semiahmoo Resort in Blaine. Gord Goble photo

Councillor frustrated after White Rock agrees to lease former church building to private business

City rental ‘already decided behind closed doors’ Tracy Holmes Staff Reporter

A decision to lease out a building on White Rock’s civic campus to a commercial entity puts the city in competition with the businesses it purports to support. So says Coun. Helen Fathers, who made the strong statements Monday, prior to voting against giving third and final reading to zoning amendments that enable the 1174 Fir St. building in question to be used for professional or semi-professional purposes.

“There are dozens and dozens of empty vacant properties awaiting the possibility of a leasing tenant,” Fathers said, reading from a prepared statement. “It is council’s job to help build our core and town centre by encouraging business into these vacant spots. We should not be in competition with them. Do we desperately need these funds from the tenant so badly that our city would fold without them?” The building – the former home of the First Church of Christ, Scientist – was pur-

chased in 2010 for $1.6 million, completing the city’s ownership of the entire block occupied by its civic, police, fire and library services. The city took full possession in February 2012, and voted last May to direct staff to proceed with $200,000 in upgrades. Determining the best use for the building became the source of controversy last summer, after council voted by a narrow margin (4-3) in July to shift their chambers into the space – in support of a motion by Fathers – then reversed the decision in September after

Coun. Bill Lawrence withdrew his support. Couns. Larry Robinson and Al Campbell had also supported moving the chambers. Following the September rethink, Robinson and Fathers – questioning the legality of the move – called for a special council meeting to get to the bottom of what transpired. While they withdrew that call in short order, Fathers followed with a motion for a second legal opinion on the September decision. That, too, was defeated by a 4-3 vote. i see page 10

Independent & Assisted Living Community for Seniors VISIT US ON THE WEB: REAL ESTATE • STRATA MANAGEMENT www.hughmckinnon.com COMMERCIAL MANAGEMENT HOUSE RENTALS 604-531-1909

Largest Suites, Best Value on the Peninsula! 15366 17th Avenue White Rock

604-531-1160


2 www.peacearchnews.com 2 www.peacearchnews.com

Thursday, January 16, 2014 Peace Peace Arch Arch News News

news

Houses of worship worth paying attention to

Evolution of church lots T

he possible worship facilities. redevelopment of First Many mainline Protestant United Church in White congregations, in particular, Rock may be a template for have diminishing congregations redevelopment of other underand face a host of fixed charges. utilized properties in Surrey and These include maintenance, White Rock. which can be a costly item in an A proposal that older building. Frank Bucholtz the White Rock I’m aware of numerous congregation is studying churches that have would see the existing already run into this church demolished and problem in Surrey. replaced by multi-family Two, North Surrey housing, which would United Church and include a small church Fleetwood United facility. Church, have been sold The congregation has to other churches. fewer members than it The United Church once did and the church also operated Camp facility, built about Kwomais at Ocean Park 60 years ago, is more for almost 100 years, spacious than currently and several years ago needed. sold the property to In addition, it sits on a prime Surrey. It has since become a piece of property near White wonderful park, and it is most Rock City Hall, and there would fortunate that the property be no shortage of buyers or remains accessible to the public. tenants if it was replaced by a It could just as easily have been residential development. developed for large homes, Some members of the and few members of the public congregation do not like the would then get to enjoy the idea, and some community views available there. members also have concerns. This situation also applies to First United is a gathering place community halls. The former for the community and there is Green Timbers Community no other facility of its type in Hall, which sat on a prime piece White Rock, although there are of property on 88 Avenue, was plenty of good-sized churches in sold and the property was taken South Surrey. over by a Sikh temple society. The smaller Christian Science Other community halls often Church, located nearby, has sit on larger pieces of property, already been taken over by the yet have few volunteers to city. maintain them. In some areas of Surrey, While some have been taken churches are sitting on prime over by the city, such as the pieces of real estate, and are Elgin Hall, others face a more property-rich and cash-poor. uncertain future. This is despite the fact that they Churches rarely get much do not pay property taxes for credit these days for the role

they play in society, but they often directly or indirectly are involved in a host of social programs. Surrey Food Bank, for example, was established by members of several churches. The founding meetings were held at North Surrey United Church, and numerous churches and their members continue to play a key role in keeping the food bank operating. A number of other programs have also been started or continue with the active support of churches. Sometimes they take place on church property, and sometimes they take place elsewhere. This is one reason why churches get property tax exemptions – they are considered to be agencies that benefit the community. Many people in today’s society have little interest in religion, and that is their right. At the same time, indifference to the plight of churches with larger properties and declining memberships may mean that both the physical look of the community (with a possible replacement of larger churches), and the charitable activities of church members, change drastically in the next 10 years. This will be particularly true if property vaues remain as high as they are at present. The direction taken by First United Church is one worth paying attention to, as it may be indicative of the future. Frank Bucholtz writes Thursdays for the Peace Arch News. He is the editor of the Langley Times.

...and franklyy

TIDES at White Rock Beach • Sat., Jan. 18

• Sun., Jan. 19

• Mon., Jan. 20

TIME

Ht./m

Ht./ft.

TIME

Ht./m

Ht./ft.

TIME

Ht./m

Ht./ft.

TIME

Ht./m

06:59 12:31 16:58 23:55

4.1 3.0 3.5 1.1

13.5 9.8 11.5 3.6

07:19 13:06 17:45

4.1 2.8 3.4

13.5 9.2 11.2

00:27 07:40 13:43 18:35

1.3 4.1 2.6 3.3

4.3 13.5 8.5 10.8

01:00 08:05 14:25 19:30

1.4 4.2 2.4 3.2

{

MEXICO • COSTA RICA • THAILAND • AUSTRALIA NEW ZEALAND • BRAZIL • INDIA • CHILE INDONESIA • SOUTH AFRICA • MALAYSIA PERU • ARGENTINA

For Great Rates with no service charge go to:

CURRENCY EXCHANGE LTD. 15223 RUSSELL AVENUE (1/2 block east of Johnston Road) 604-542-4266 • www.expressgoldltd.com

WINE & DINE in SOUTH SURREY Jan. 17th - 31st THREE COURSE DINNER - $18 STARTER: ORGANIC GREENS, WARM TOMATO TART

MAIN: CLASSIC CHICKEN AND RIBS

SWEET: PECAN PIE A LA MODE WITH CARAMEL BOURBON SAUCE

Dine In Only

• Fri., Jan. 17

THIS THURS. FLYERS

It’s Time for a Holiday in the Sun!

Menu is available from 5pm till close during the two weeks. Reservations Recommended.

Available exclusively at:

Ht./ft.

4.6 13.8 7.9 10.5

Memphis Blues BBQ House Grandview Corners • 50-2443-161A Street

604-531-8005

• M&M Meat Shops* • Buy Low Foods* • Future Shop* • Rexall* • I.G.A.* • Save-On Foods* • Rexall* • Shoppers Drug Mart* • Safeway* • Walmart* • PriceSmart Foods* • Rona* • Canadian Tire* • Sears* • Ashley Furniture* • Michael's* • JYSK Linen 'n Furniture* • Clancy Meats* • London Drugs*

W W W. M E M P H I S B L U E S B B Q . C O M @MEMPHISBBQHQ

MORE FLYERS ONLINE ☞

FACEBOOK.COM/MEMPHISBLUESBBQHOUSE

IF YOU DO NOT RECEIVE THE ABOVE FLYERS, PLEASE CALL DISTRIBUTION DEPARTMENT AT 604-542-7430 *Not distributed in all areas.

2013

ELANTRA L

12,995

$

OWN IT FOR

ALL-IN PRICING

3150 King George Blvd., Surrey ††

www.whiterockhyundai.com

604.538.7022

GET

0

%†

FINANCING FOR UP TO 84 MONTHS ON OTHER ELANTRA SEDAN MODELS

INCLUDES PRICE ADJUSTMENTSΩ, DELIVERY & DESTINATION.

Limited model shown

OR

DL#31129


Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 3 3 www.peacearchnews.com

news

Port Metro Vancouver predicts no overall increase to rail traffic if coal facility approved

Train comments fail to calm White Rock Tracy Holmes Staff Reporter

The suggestion that a new direct-transfer coal facility in Surrey would not increase train traffic was met with incredulity by White Rock council members Monday. The statement came from Port Metro Vancouver’s director of environment, Darrell Desjardin, during a presentation on the port and the Fraser Surrey Docks proposal. “Overall, from 2008, you would not see an increase in rail traffic,” Desjardin said, explaining the increase would simply return volumes to those seen six years ago. Coun. Helen Fathers and Mayor Wayne Baldwin both disputed the assertion. “I’m not sure how you can say there won’t

be an increase in train traffic,” Fathers said. “We’ve already seen an increase since 2008,” Baldwin said. “Not a minor one, a major one.” The $15-million direct-transfer facility eyed for 11060 Elevator Rd. has been the subject of considerable angst since it was announced in September 2012. Port officials are reviewing the application and could make a decision on the project at any time. If approved, the facility would handle two million metric tonnes of coal in its first year of operation, increasing to four million tonnes annually within five years. Last month, White Rock’s director of engineering, Greg St. Louis, said that translates to a potential increase in the number of

trains travelling through White Rock to 320 in year one and 640 after that. Regarding Desjardin’s no-increase statement, PMV’s vice-president of planning and operations Peter Xotta clarified it referred specifically to traffic coming to Fraser Surrey Docks: “The volume would certainly not surpass what they’ve experienced at this facility in the past.” Baldwin said his community’s concern is with what’s coming through White Rock. “That’s where we need to see some environmental assessment,” he said. The port-ordered assessment, released in November, has been criticized by health officials as failing to meet “even the most basic requirements of a health-impact assessment.”

St. Louis has said it “did not provide any useful information on the environmental impacts of transporting coal through the City of White Rock.” Xotta said Monday that Fraser Surrey Docks has been “given some direction” as a result of discussions with health authorities. “I can assure you if there are shortcomings… we will be asking them to do additional work,” he said. Council later voted to support city staff participation on an independent interagency committee focused on reviewing the direct-transfer facility. The resolution was in response to an invitation by Delta Mayor Lois Jackson, whose council voted last month to initiate and co-ordinate the committee.

Irish fest approved

Jig is up, after all Tracy Holmes Staff Reporter

Evan Seal photo

Surrey MLAs – from left, Harry Bains, Bruce Ralston, Sue Hammell – join NDP Leader Adrian Dix at a news conference in Newton Wednesday.

New Democrats host news conference, after last month’s murder in Newton

Surrey MLAs call for police backup Kevin Diakiw Black Press

Better services for people with mental-health and addictions issues, regulations on drug recovery homes, a community court and better housing are all part of the Surrey Accord being pitched by local NDP politicians. MLAs Sue Hammell, Harry Bains and Bruce Ralston – joined by NDP Leader Adrian Dix – proposed the Surrey Accord at a news conference at the Newton Cultural Centre on Wednesday. The call came weeks after the brutal killing of hockey mom Julie Paskall, who was attacked while she was waiting for her 16-year-old son outside the Newton Arena Dec. 29. The slaying galvanized the Newton community and prompted calls for more police and a fix for many of the social issues in the community. Dix said Surrey RCMP are swamped with calls involving people with mental-health problems and addictions. Bains (Surrey-Newton) said the city has one of the highest crime rates in B.C., yet ranks 31st in number of police officers per capita.

“In 2013, Surrey had 25 homicides, compared to six in Vancouver,” Bains said, adding 2012 stats show Surrey has just 137 police officers per 100,000 residents. “Cities such as Vancouver, New Westminster, West Vancouver, Delta, Port Moody and Langley all ranked better.” Bains said Surrey residents often complain that police response times are incredibly slow, if there’s a response at all. “(This) points to one direction,” he said. “Police resources are overstretched and need help.” The Surrey Accord, he said, would find resources and examine policing models that would see more boots on the ground. The MLAs are also calling for the creation of a community court. “Community courts are an efficient access to the justice system and a problem-solving approach to criminal behaviour,” Bains said. He notes Surrey was promised one of the courts six years ago, but it has yet to materialize. Hammell (Surrey-Green Timbers) said Surrey RCMP senior staff have told her that the amount of time officers spend responding to calls involving people with mental illness is

similar to that of Vancouver, where 21 per cent of calls involve someone who is mentally ill. It’s important to ensure health resources are adequate to support the need, she said, noting the number of unregulated drug and alcohol recovery homes in this city is astounding. “Fifty-five houses have been regulated and 45 more are on the dock to be regulated,” she said. Ralston (Surrey-Whalley) said that as regulations fall into place, more provincial investment will be required for supportive housing. He said people quite reasonably expect all levels of government to work together. “And that’s what we’re proposing,” Ralston said, adding the MLAs proposing it are longtime Surrey residents with a stake in a solution. Mayor Dianne Watts, who was not at the press conference, said the problems and some of the solutions outlined by the NDP MLAs are also part of her own Crime Reduction Strategy, created by the city in 2006. She said she welcomes help with the issue. “Certainly, there needs to be a comprehensive strategy from all levels of government in terms of how to deal with it,” Watts said.

City of White Rock staff who last month opposed a Marine Drive businessman’s application to host a St. Patrick’s Day event are now supporting the festival. But conditions imposed on the beer-garden function – eyed by Paul McDonough of Jimmy Flynn’s Celtic Snug – were criticized by one councillor as excessive; in particular, a demand that the city be reimbursed $1,050 for the lost payparking revenue. “It seems like we’re trying to do everything not to do the event,” said Coun. Helen Fathers, following additional concerns expressed by Coun. Louise Hutchinson around the potential for the festival to draw an unsavoury crowd. Hutchinson said that while she liked aspects of the event, she is worried about security. “White Rock has a history of attracting young people from outside our area… who hear about a party and come and wreck it,” she said. “The proponent has to be aware this element is still there.” McDonough had proposed the event to build on the success of last year’s Irish Heritage Month, which returns in March. Monday, leisure services director Eric Stepura said he has heard concerns from White Rock RCMP regarding policing the beer garden. Also, that council policy prevents staff from supporting a request to waive the $1,050 fee. The revenue loss was one of the reasons the event was initially opposed, along with the anticipated impact to businesses that rely on the lot’s proximity for “people with disabilities and ladies who wear high heels,” Stepura said. Fathers motioned for the fee to be waived on the understanding that funds raised would be donated to charity. Council voted instead to approve the event subject to the conditions, and encourage McDonough to apply for a grantin-aid to cover the fee.


4 www.peacearchnews.com 4 www.peacearchnews.com

Thursday, January 16, 2014 Peace Peace Arch Arch News News

news

Safety monitored i from page 1 “To say it is in bad shape is a gross understatement,” he wrote. “Should this bridge fail while being crossed by a freight train carrying dangerous goods… it would be extremely disastrous to our residents and natural environment.” The city’s worries haven’t diminished since then, city manager Dan Bottrill said Tuesday. “That hasn’t changed – we’re still concerned about bridge safety, and its close proximity to the City of White Rock,” he said. Melonas has said both BNSF and Transport Canada are actively involved in monitoring the bridge’s safety, and the company is confident, followFile photo ing “third-party” inspections, that Little Campbell River trestle. the bridge is able to withstand the current tonnage of trains. But he has also noted the bridge – crossed daily by 11-15 freight trains plus Amtrak passenger trains – has been earmarked for replacement since 2011. Maintenance performed in August, after a June inspection by Canadian Professional Engineers, included replacement of a cracked girder bearing and span bracing, and substitution of steel shims for hardwood shims. BNSF plans to replace the single span with two 40-foot steel spans, with construction estimated to last four months – and Melonas has said daily train schedules would be maintained during the process of building the replacement bridge. Melonas said Tuesday he also stood by earlier statements that the company “has had engineering plans, environmental permits and a Canadian contractor ready to rebuild the main span of the bridge, once we can gain access to the property.”

… yo u r l i fe s t y l e d e s t i n at i o n 1959 - 152ND ST., SOUTH SURREY Beauty & the Best Bertolucci Pizza Captain Gift & Fashion C & K Courtesy Cleaners Concord Interiors Danica’s Bistro International Gems Jay’s Clocks & Watch Repair Kiki’s Restaurant Peace Arch Veterinary Hospital Pikanik Rewind Soundworks Music School Teezers European Hair Studio The Inside Story White Rock Eyecare Q

Q

Q

Q

Q

Q

Q

Q

Q

Q

Q

Q

Q

Q

Q

Q

SPECIAL… 3 COURSE MEALL

19.95

$

person stitutions • Dinner Only • Dine-in

• No Sub

Kiki’s Restaurant

Introducing Bite of the Rock 2014 Jan 20 - Feb 13 Experience a taste of our locally sourced, farm to table fare. Three courses for $35 Call ahead to make a reservation 604-538-9373 15021 Marine Drive • White Rock

~ Plenty of Free Parking ~ 604-536-8244

#118 - 1959 - 152ND ST. • OPEN AT 11 AM

#104 - 1959 152nd ST. • 604-538-4466

25 Years at Windsor Square

FREE Fatburger with Cheese with the purchase of a Fatburger with Cheese (and a fountain drink)

available exclusively at

Fatburger White Rock 152nd St. & 17th Ave. One coupon per customer. Cannot be combined with any other offer or discount. Does not include specialty toppings or add-ons. Coupon must be presented at time of order. Valid at Fatburger White Rock. Expires January 30, 2014

FREE Fatburger with Cheese with the purchase of a Fatburger with Cheese (and a fountain drink)

available exclusively at

Fatburger White Rock 152nd St. & 17th Ave. One coupon per customer. Cannot be combined with any other offer or discount. Does not include specialty toppings or add-ons. Coupon must be presented at time of order. Valid at Fatburger White Rock. Expires February 13, 2014

JOIN OUR SENIOR SOUTHRIDGE STUDENTS FOR PEER MATH TUTORING Under the guidance of Southridge math teacher Mr. Max Sterelyukhin Q Q

Mondays 4:00 – 6:00 All grades are welcome

Q Q

Attendance by donation All donations to charity

Email:mathforall@southridge.bc.ca for more information Location: Southridge School - 2656 160th Street Surrey, BC Alderdice Library Senior School (rear building)

Admissions office 604.542.2345 www.southridge.bc.ca

SOUTHRIDGE SCHOOL

2656 160th St. Surrey


Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 5 5 www.peacearchnews.com

news

Tracy Holmes photo

Michelle Pedersen, president of the newly formed society that is organizing the 2014 sea festival, listens as vice-president Brian Hagerman addresses White Rock council on plans for the August celebration.

January Warehouse Sale

Buy any Whirlpool or Maytag 3 piece kitchen package and receive 10% OFF our lowest Sale Price!

Save $1000!

when you buy this package.

Group seeks $70k for sea fest Tracy Holmes Staff Reporter

from council (Coun. Larry Robinson was absent) – Mayor Wayne Baldwin commended Hagerman and Pedersen for the society’s efforts “to fill the void.” Baldwin said the festival’s history has been a significant

factor in its survival through recent years’ struggles with sponsorship and a declining number of volunteers. “If it weren’t for the success of the past sea festivals it would’ve died a long time ago,” he said.

A request for $70,000 from the City of White Rock to help breathe life into the next sea festival has been referred to staff. Organizers of the 2014 waterfront event Taking Care ofLOCATION Families One Generation toBANK theFINANCIAL Next SAME TEAM — SAME — PROUD TO BE PART OF NATIONAL – bolstered by its FAMILY WEALTH MANAGEMENT WITH OVER 30 YEARS OF EXPERIENCE. milestone 65th year – made the funding request Monday evening. The majority of the money, $50,000, would be used to build a city float, and the balance would go towards hosting a torchlight parade, explained Brian Hagerman, vicepresident of the newly formed society that’s putting the festival The together. 604.541.4925 604.542.2824 SHEWFELT Mc MILLAN Group Hagerman and society www.shewfeltmcmillan.ca president Michelle National Bank Financial is an indirect wholly-owned subsidiary of National Bank of Canada which is a public company listed on the Toronto Stock Exchange (NA: TSX). National Bank Financial is a member of the Canadian Investment Protection Fund. Pedersen appeared as a delegation to give the politicians an early look at what is planned for trampoline jumps years of experience trained instructors games and rides the August long weekend event. Initially intending to ask for $65,000, the amount was increased at the last minute to ensure a “buffer” for the parade, Hagerman told Peace During the Grand Opening Celebrations, Arch News Tuesday. families are invited to the gym to meet “It’s not exceeding the staff, explore the amazing new facility, what it will cost, that’s register for classes and birthdays, play for sure,” he said. “Every and have fun! dollar will be carefully managed.” Dates Times In appealing to council, 9am-1pm & 4pm-6pm Thursday, January 9 Hagerman noted the 9am-1pm Friday, January 10 9am-4pm Saturday, January 11 festival has survived “all 9am-1pm Sunday, January 12 kinds of ups and downs.” Closed Monday, January 13 At the same time, 9am-1pm & 4pm-6pm Tuesday, January 14 “it’s one of the things 9am-1pm & 4pm-6pm Wednesday, January 15 that make White Rock 9am-1pm & 4pm-6pm Thursday, January 16 special,” he said. 9am-1pm Friday, January 17 The float, he said, 9am-4pm Saturday, January 18 is something the 9am-1pm Sunday, January 19 city would own and the society would Perfect for kids 6 weeks to 13 years look after, including taking it to events in other communities to Free Lifetime Membership showcase White Rock. Plus 1/2 Off Your First Month’s Tuition! “We believe the city Valid only at My Gym Surrey and prior to Grand Opening. really misses out, as do White Rock Youth Millions of kids agree. Ambassadors, in not having a float,” he said. (604) 249-5437 Prior to referring #103 2429 152nd St. • Surrey, BC V4P 1N4 the request to staff – a surrey@mygym.com mygym.com/surrey suggestion that received /MyGymSurrey @MyGymSurrey unanimous support

765,000

30

1,540

20,000,000

Grand Opening in Surrey!

19 cu ft stainless bottom mount refrigerator - Sealed Glass Shelves - Pull out Freezer Drawer - Removable door bins

6.2 cu ft stainless convection smoothtop range - 10 year warranty on elements - Energy Efficient Self Clean - Even Air Convection

Stainless Tall tub dishwasher with food chopper - 50 Decibels - Stainless Food Chopper - 10 year warranty on Chopper and Racks

Save up to $500 on the pair + Buy 1 pedestal, get the 2nd for FREE!* #1 Rated Front Load Laundry Pair with a 5.0 Cu Ft Washer Capacity, Power Wash equipped with Steam Option. 7.5 Cu Ft Dryer with Stainless interior, Steam and Sensor Dry.

15% off all Wall Oven & Cook tops when purchased at the same time.* *Excludes floor models

Big discounts on last year’s models, clearouts and floor stock. See them at maytagstorebc.com or come in. *SEE US FOR DETAILS In-home service to most brands of appliances

13664-104th Ave, Surrey • 604-581-4307

Mon-Fri: 9:00 - 5:30; Sat: 9:00 - 5:00 www.maytagstorebc.com


opinion

6 www.peacearchnews.com 6 www.peacearchnews.com

Thursday, January 16, 2014 Peace Peace Arch Arch News News

Peace Arch News Published at South Surrey by Black Press Ltd.

editorial

An ‘A’ for effort

A

dvocates of a pilot project in Surrey School District elementary schools – designed to explore different ways for teachers to report a child’s academic progress – make a good case that there are constructive alternatives to the traditional report-card approach. But we won’t give them a pass on the most contentious aspect of the project – setting aside the time-tested letter grade. While the Utopian zeal to find a better way is commendable, this comes perilously close to throwing out the proverbial baby with the bathwater. What’s wrong with keeping letter grades, alongside the more conscientious summaries? Anyone who has been through our school system as a student and/or parent will recognize that the bald letter grade misses the finer points of an individual’s progress. Too often excellent work, heartening development and delightful expression is flattened, minimized, even suppressed by rigid alphabetic tyranny. Even attempts to shade the picture with pluses and minuses are inadequate substitutes for thorough evaluation. Tests and exams are not a fail-safe measure of what a student actually knows and understands, and offer scant recognition of individual’s learning strengths and weaknesses. And it’s frightening to contemplate how many positions of responsibility, in our 21st century world, are occupied by people who gained their qualifications by dint of cramming, regurgitating the opinions of others without developing any facility for critical thinking, and taking tests that have long since been all but forgotten. And yet, given the realities of that world – and the place we are preparing for our children in it – it seems unfair to deprive them of a key tool for progress. Even given the shortcomings of a traditional letter grade, it has endured because we need a short form of evaluation, as well as more comprehensive forms. It’s the reason that hotels and restaurants and movies receive star ratings – in the real world, few take time to read and balance all reviews. We worry, as well, about what will happen when a young student who has never received such a “summative” grade collides with more senior environments that demand them. Reform education by all means – but don’t threaten our children’s progress, or crush their expectations, through asymmetrical reform.

?

question week of the

Our fascination with house value

A

dmit it, you probably caught your and backgrounders that provide general breath for a moment when you information about assessments in the reached into your mailbox and province and the assessment process, grasped that brown envelope from BC the eight charts and graphs that plot Assessment in your fingers. the various property trends In newsrooms large and small around the province and the 11 Mario Bartel across the province, the news “greatest hits” that list the toprelease announcing this year’s valued residential properties for assessment information arrived British Columbia and each of the in email inboxes on Jan. 2 like regions. manna from heaven.  It’s an extraordinary That’s because, for some media, communications effort that is the days around the Christmas the culmination of the work that and New Year’s holidays are goes in every year to create the amongst the slowest for news.  assessment roll. Most people are taking a break BC Assessment’s 632 full-time from their usual concerns, and employees in 16 offices spend civic officials and bureaucrats the year poring over data from don’t return calls because they’re various sources, including away. photographs, footprint sketches, And editors know, in these dog days, location, amenities in the area, plans for nothing attracts eyeballs like stories about new development and market demand lavish real estate and how everyone’s to assign a value to 1,954,445 properties property investment measures up. in the province. The company even has BC Assessment, bless them, does its specially equipped vans stationed in some very best to help that process along. communities that drive along every street Their 10 regional offices prepare no snapping photos of every property. More fewer than 42 news releases that break than 87 per cent of those properties are down the assessment rolls to more classified as residential. specific geographical areas so newsrooms The decisions assessors make touch and readers can easily access the everyone in the pocketbook one way or information that’s most relevant to them.  another, as regional and municipal taxing That’s in addition to the two fact sheets authorities apply their property tax rate

other words

Rita Walters Publisher

200 - 2411 160 Street., Surrey, B.C. V3S 0C8 Phone: 604-531-1711 Circulation: 604-542-7430 Classified: 604-575-5555 Fax: 604-531-7977 Web: www.peacearchnews.com

Will you take part in a rejuvenated White Rock Sea Festival, Aug. 1-4? Vote online at www.peacearchnews.com

Lance Peverley Editor

Marilou Pasion Circulation manager

Member CCNA

James Chmelyk Creative Services manager

2010 WINNER

Last week we asked...

Are flu shots a good idea?

yes 62% no 38% 90 responding

to assessed values to come up with your annual property tax bill. Even if you’re a renter and never paid much mind to assessment notices or property tax rates, a portion of your monthly rent cheque will end up going to help your building’s owner pay property taxes. This year’s assessment roll will be the basis upon which more than $6.2 billion is raised in property taxes, money that helps pay for schools, local roads, municipal services like garbage collection, and sewers and recreational facilities. Heck, a bit of that money even goes to pay for BC Assessment, which is supported by property tax levies. In fact, in 2011 the assessment process cost each property $40.25. Of course, BC Assessment doesn’t generate all this information just to make it easy for newspapers to fill space. Tim Morrison, the company’s acting manager of communications, says it’s all about making as much data readily available so property owners can easily understand their assessment. That’s why only about 1.2 per cent of assessments were appealed last year, down from 1.5 per cent a few years ago. “Every year we have to work at reinventing ourselves as a place of information,” says Morrison. And the hunger for that information seems insatiable, says Morrison.  “People are curious. There are certain things people talk about and real estate is one of those in B.C. It’s heightened when we release the assessment rolls every year.” Mario Bartel is a reporter at the Burnaby-New West NewsLeader. The Peace Arch News is a member of the British Columbia Press Council, a self-regulatory body governing the province’s newspaper industry. The council considers complaints from the public about the conduct of member newspapers. Directors oversee the mediation of complaints, with input from both the newspaper and the complaint holder. If talking with the editor or publisher does not resolve your complaint about coverage or story treatment, you may contact the B.C. Press Council. Your written concern,  with documentation, should be sent within 45 days to B.C. Press Council, 201  Selby Street, Nanaimo, B.C., V9R 2R2. For information, phone 888-687-2213 or go to www.bcpresscouncil.org


Peace Arch Arch News News Thursday, January 16, 2014 Peace

letters

www.peacearchnews.com 7 7 www.peacearchnews.com

Peace Arch News

Subsidies for drivers, too

Display of compassion

Editor: Re: PAN online question of the week, Jan. 2-8. I am quite disappointed to see that 79 per cent responded ‘no’ to the question: “Should drivers subsidize public transit through gas hikes?” However, I find that the way the question was worded was somewhat misleading, in that it positions this debate as a commuters-versusdrivers question, where commuters seem to benefit from a long list of government subsidies. The fact is that drivers are heavily subsidized by all taxpayers in the construction and maintenance of streets, roads and highways. While these subsidies also benefit people who take the bus, bus commuters also use gas for their transportation and will also end up paying for the higher gas taxes, as these costs will be ultimately reflected in ticket prices. People who choose to drive should be happy to see the expansion of public transit, as it takes people off the road and decreases congestion and the need to spend yet more tax dollars on roads. In the end, no matter what, there is no such thing as a free ride for anyone and we should all work together to develop the best combination of private and public transit solutions. Sylvie Peltier, White Rock

Editor: Last Wednesday, at 4:30 p.m., my son and I were enjoying a meal at the White Spot Restaurant at 152 Street and 17 Avenue in South Surrey on a dark, rainy afternoon. We were distracted when the darkness was lit up with flashing emergency lights at the intersection. A police vehicle was blocking the intersection, and we immediately thought the worse – that a pedestrian had been struck while in the crosswalk. We soon realized, however, that everyone was fine and that one of our elderly citizens was having difficulty crossing the street in a timely manner. The light had turned red, and this person was only halfway across the street. A police officer had blocked the

intersection with his vehicle, put the emergency lights on and was safely assisting the elderly person across the street. It was very heartwarming to witness this act of kindness. Thank you to this officer for your compassion. Too often we see people do nothing and just go on about their day. My son – who happens to be developmentally delayed, and has limited communication skills – is always very concerned when he sees emergency vehicles and will always ask me “what happened?” So, as usual, when he saw the flashing emergency lights, he was concerned. Once I realized what was happening, I told him that the policeman was helping someone get across the street. My son replied in his limited capacity, “Aw, he’s a good man.” Darlene Jensen and Jace Greenhalgh, White Rock

Quietly paying for Interpol Open letter to MP Russ Hiebert. I would like you to explain to your constituents why the taxpayers of this great country are paying $8,000 per month for apartment rental – in addition to an annual salary of more than $230,000 – to the former commissioner of the RCMP, William Elliot, who is now sitting in New York acting as a “special representative of Interpol to the United Nations.” His arrangement was made by a hush-hush order-in-council in 2011. At the same time, you might also explain why we are picking up the tab for the new Internet reality series, 24 Seven, featuring Prime Minister Stephen Harper. Should not the Conservative party be paying for this blatant propaganda? Terry Garvey, Surrey

Follow Delta’s lead on parking An open letter to Surrey council. Last week I was given my second parking ticket at my local medical clinic, after reaching the end of my one hour that I had paid for. This was the result of my medical consultation starting late and going longer than expected. In no way am I criticizing our medical experts for this overrun, as they provide sterling services that are difficult to schedule with the wide variety of situations involved. What was shocking to discover was Imperial Parking have the authority to demand a $60 payment in seven days – or $80 if paid later – for a small infraction. I sincerely request council to pass a bylaw banning parking fees on lots associated with provision of medical services throughout Surrey. This type of restriction on gouging medical “victims” has already been passed by Delta council, demonstrating strong public leadership. If Surrey council is not brave enough to take on these parking monsters, then please consider a bylaw that would force these companies to have their fees and penalty charges in Surrey reviewed annually and approved by council or city staff before implementation. I ask other citizens, taxpayers and voters to join me in urging Surrey to follow Delta’s public spirited restrictions on medical parking. Herbert Spencer, Surrey

“ “

quote of note

`

Too often we see people do nothing and just go on about their day.a Darlene Jensen & Jace Greenhalgh

write: 200 - 2411 160 Street, Surrey, B.C. V3S 0C8 File photo

Improvements to Surrey Memorial Hospital were among last year’s accomplishments, writes David Mitchell.

Prudent with health-care funds Editor: As we move into 2014, I think it’s a good time to thank all Fraser Health staff, physicians and volunteers, who work tirelessly to meet the health needs of the people that live in our region. During the past year, Fraser Health’s 12 hospitals saw 615,000 emergency visits, 15,000 births, and one million patient days. We also saw increases in our residential care, home health, mental health and substance use, and other community services. The demand for health care continues to increase, which isn’t surprising, given we provide service to one of the fastest- David Mitchell growing regions in Canada, with a population of 1.7 million, a third of all British Columbians. This past year we opened a new emergency at Surrey Memorial Hospital, the second largest in Canada, and one that serves our entire region with a dedicated pediatric emergency and specialized care for mental health and substance use provided in a separate zone. We look forward to opening the rest of the critical care tower this June. It will feature a new and expanded

intensive-care unit, a specialized stroke unit and additional beds to meet the need for hospital care by our growing population in Fraser Health. We are proud of this $512-million project, which represents the largest single capital investment in B.C. health care. In addition to continuing investments in all our hospitals, the health-care system needs to evolve from one focused on hospital services to one that places more emphasis on services in the community and the home. With the right supports, we believe that home can be the best place to recover from illness or injury, to manage chronic conditions, and to live out final days. Late last year, the minister of health asked me to co-chair a strategic and operational review of Fraser Health. I welcome this opportunity to work with health leaders across B.C. to identify potential strategies that will make for an even better – and sustainable – healthcare system, not only in Fraser Health, but across B.C. I am proud that Fraser Health is committed to providing quality care, while having one of the lowest administrative costs of any health region in Canada. We will continue to be prudent with the public funding we receive. Thank you for entrusting your care in us. David Mitchell, Fraser Health board chair

fax: 604.531.7977

email: editorial@ peacearchnews.com

questions? 604.531.1711

Submissions will be edited for clarity, brevity, legality and taste. (please include full contact information, including address)


8 www.peacearchnews.com 8 www.peacearchnews.com

news

Marine paving job to cost 1.5M When it came to voting on a contract to pave four blocks of White Rock’s Marine Drive, Coun. Helen Fathers wanted to know the work would take care of the popular strip’s “wonkiness.� Assured it would, Fathers joined her peers in giving unanimous approval Monday to awarding the $1.5-million contract to Imperial Paving Ltd. The project will address the stretch of Marine between High Street and Bishop Road. In a report to council, director of engineering Greg St. Louis explained the rehabilitation follows completion of storm and sanitary

sewer-system upgrades along the stretch. That $1.3-million (including tax and contingency) project was awarded to Pedre Contractors Ltd. in the fall of 2012. At $1,488,872 (plus GST), Imperial Paving’s bid was the lowest received. St. Louis said the project is about $623,000 under budget. The work is scheduled to get underway early next month and take about 80 days. Coun. Al Campbell, who is an Imperial Paving employee, declared a conflict and did not participate in Monday’s vote. Coun. Larry Robinson was absent. – Tracy Holmes

Thursday, January 16, 2014 Peace Peace Arch Arch News News

Waterproof Hearing Aids ilable! NOW ava

Completely waterproof for continuous immersion, and fully dust protected for uncompromising sound quality and safety.

Call for your in-store demo!

Are you eating right for your retina?

free batteries for life!* College of Speech and Hearing Professionals of BC

your y to book n! a d o t s u ll Ca evaluatio eye health *Free batteries for the life of your hearing aids. For a limited time only. Limit one promotion per purchase. Not valid on 3rd Party billing including: Worksafe, Veterans Affairs, MHR and First Nations. Some conditions apply, see in-store for details. +0M`V\Ă„UKHSV^LYHK]LY[PZLKWYPJLVUHUPUZ[VJRUL^PKLU[PJHSP[LTMYVTHU(\[OVYPaLK*HUHKPHU KLHSLYUV^VY^P[OPUKH`ZVM`V\YW\YJOHZLQ\Z[ZOV^\Z[OLWYPJLHUK^L^PSSTH[JOP[

Dr. Melanie Sherk* Dr. Tracy A. Ertel* Dr. Sally Donaldson*

Visit us at Semiahmoo Shopping Centre White Rock or call 604-541-8599

Dr. Cindy Anderson* Dr. Tracey A. Curry* Dr. Natasha Grewal

102 - 1656 Martin Drive, White Rock

604-536-4999

www.whiterockoptometry.com Serving the Peninsula for 30 years!

*Optometric Corporation

www.cvoh.ca

The Wiens Family

We want you to ‘like’ us. Join Peace Arch News on Facebook and receive local news updates online. Visit peacearchnews.com and click on the Facebook link. And don't forget to follow us on Twitter, too, for regular tweets. www.twitter.com/whiterocknews

HATE CPAP?

?

Dr. Michael Layton can help. Better Sleep, Better Health, Better Life! #210 - 15321 - 16th Ave., Surrey 778-736-0116

1-855-43-SNORE

15% off your treatment Now-Jan. 28/14


Peace Arch News Thursday, January 16, 2014

www.peacearchnews.com 9

Always Fresh Savings! Extra Lean Ground Beef All Size Packages $6.35/kg

Lactantia Salted Butter 454g

On Sale

2

88 Per lb

3

4Each9

Tulips Blueberries

Assorted Colours 5 Stem Bunch

On Sale

Olympic Yogurt No Fat or Plain 650g or Krema Greek Style 500g Excludes Krema 0% Fat Varieties

Grown in Chile 18oz./510g Pack

On Sale

2

8Bunc8h

On Sale

5

8Each8

On Sale

50 When you buy 2

Where's your Sockeye from?

2 5 $

for

Johnstone Strait BC Wild Sockeye Salmon Fillets

In partnership with Pacific Salmon

Previously Frozen $12.20/lb

Commission, Department of Fisheries and Hub City Processing in Nanaimo, this sustainably caught, Johnstone Strait,

On Sale

BC salmon is exclusively available at

2

Thrifty Foods. There is NO compromise

69

to delicious, BC Sockeye Salmon.

Specials in Effect until Tuesday, January 21st, 2014

Per 100g


10 www.peacearchnews.com 10 www.peacearchnews.com

news

HUGE CLEARANCE

Thursday, January 16, 2014 Peace Peace Arch Arch News News

Tax hike approved S A L E % White Rock residents will see their property-tax bills increase by 3.25 per cent this year, following council’s approval Monday of the 2014-2018 financial plan bylaw. “The impact that that has is $96 on an average detached single-family home, and $35 on an average strata property in the city,” financial services

director Sandra Kurylo told PAN. The bump is two per cent lower than the 5.25 per cent increase that staff had initially recommended. The 3.25 per cent figure was arrived at by finding $378,000 in savings and/or new revenue; in part, through deferring the start dates of two recommended new staff positions.

IT company ID’d as tenant i from page 1 A decision on the amendments had been stymied Dec. 16 by a split vote, when Coun. Louise Hutchinson was absent. With Robinson absent this week, Campbell asked to again postpone the vote. Baldwin declined. The amendments passed 4-2, with Fathers and Campbell opposed. Baldwin told Peace Arch News after the meeting that Robinson’s absence didn’t affect the outcome of the vote. Delaying the vote would have been costly, Baldwin added, noting a fiveyear $400,000 lease is in the process of being finalized with an IT company, formerly Prizebox Entertainment. Company CEO Tracy Wattie told PAN by email Tuesday that Prizebox is now Brabeia Inc.

Regarding leasing the building, Wattie said only that “we are happy with whichever outcome the city council determines is best for our community.” City manager Dan Bottrill would not confirm a tenant, citing ongoing lease negotiations. In protesting commercial use of the building, Fathers criticized the “backwards” process. She told council that a member of the public was advised of the incoming tenant on Dec. 17. “The decision to rent the building and tenant has already been decided behind closed doors,” she said. “This is everything that’s wrong with politics in general, but  especially in White Rock – the constant retrofitting of ideas and concepts to suit the needs of city hall and political viewpoints.”

70off

up to

• Cosmetic & Family Dentistry • Smile Design - Tooth Whitening & Veneers • Root Canal Therapy • Extractions • Cast gold restorations

at:

New patients always welcome!

Lots of L & XL

Peninsula Village

Dr. Hansen Liang “Our aim is to provide a caring & comfortable dental experience for our patients.”

604.536.5555

#225 - 1959-152 St. • 604-531-3344 WINDSOR SQUARE

Find Independence with the perfect fit

MOBILITY

DAYS % 25 Saturday, January 11th to Saturday, January 25th Sa

OFF

RESPITE & SHORT TERM STAY PROGRAM

MOBILITY ITEMS*

Mobility items include: Canes, Walkers, Rollators, Scooters, Transport Chairs, Manual Wheelchairs, and their accessories

When staying home alone isn’t an option… Let Christina Place be “Your Home Away from Home” We offer a safe, clean, comfortable furnished suite for your respite stay. Meals, snacks, recreation, 24 hour emergency response and light housekeeping with flat linen service are all provided… along with smiles and hugs and great support from staff.

To arrange a personal visit, please contact Ellen at 604.541.4663 1183 Maple Street, White Rock, BC

Peace of mind for families. retirementconcepts.com

Our knowledgeable staff will be here to answer your questions, assess your needs and help you find the mobility device that fits you and your lifestyle perfectly.

KINGSGATE MALL 370 East Broadway, Unit 202 (604) 876-4186

LANGLEY CROSSING 6339 - 200th Street, Unit 304 (604) 514-9987

CENTRAL PLAZA 15182 North Bluff Road (604) 538-3400

NORDEL CROSSING 12080 Nordel Way, Unit 135 (604) 597-2097

CAPRI CENTRE MALL 1835 Gordon Drive (250) 717-1850

VICTORIA 1561 Hillside Avenue (250) 370-2984

* Offer valid from Saturday, January 11th to Saturday, January 25th, 2014. Not valid in conjunction with custom or special ordered items, previously purchased merchandise, rentals and any other offers. 25% discount is based on our regular prices for selected mobility products. Some exclusions apply. See cashier for details.

DIAMOND HEALTH CARE CENTRE 2790 Oak Street (604) 739-4645 PENTICTON PLAZA 1301 Main Street, Unit 709 (250) 492-7592 www.shoppershomehealthcare.ca


perspectives

Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 11 11 www.peacearchnews.com

…on the Semiahmoo Peninsula

Charity donates custom tricycle to White Rock family

The story of a boy and his bike Sarah Massah

A

Staff Reporter

ll seven-year-old Jack McGinn wanted for Christmas was his two front teeth. At least that’s what grandpa Gordon jokes when Jack smiles, showing off his pearly whites. And it might be true, seeing as the White Rock Elementary student received his ultimate dream present of a slick, cherry-red tricycle in the summer of 2012.  It’s a pretty hard gift to top. The custom-built ride would be a welcomed present for any little boy. But for McGinn, who has Global Developmental Delay and was recently diagnosed with autism, the tricycle – gifted to him from Variety the Children’s Charity – has provided him with the opportunity to enjoy a favourite childhood pastime, just like his peers. Jack – who will be appearing on the annual Variety Show of Hearts Telethon Jan. 25-26 – was first diagnosed at three months old, after friends and family repeatedly commented on how his head would fall back when they were holding him. “Finally, I was getting tired of people asking me so I took him to the doctor,” mom Julie said. “Right away, when he picked him up, he knew. His muscle tone was low. And as soon as I heard that, your heart kind of sinks.” Following the doctor’s visit, Jack was referred to a pediatrician and, after three months of tests and blood work, the family received his diagnosis. As a result of the Global Development Delay – caused by an extra copy of part of chromosome 15

Jack McGinn, 7, rides his custom trike with his grandfather, Gordon Tansley (near right). The trike, given to him from Variety the Children’s Charity in 2012, replaced the one his grandmother, Diane (far right), made him, which he outgrew. Contributed photos

RICE! P F L HA MET GOURKEN CHICASTS BRE

Happy together LOOK FOR OUR FLYER IN TODAY’S PAPER!

LID EAST TH A SO ne MADE WI E CHICKEN BR s Florenti Caesar ALL-WHIT igiana s : s Parm s Swiss from & Cheese Choose Broccoli ally s Kiev s Individu oz Sold 170 g/6

9 9 2 SAVE

1

each

Surrey - White Rock 3189 King George Blvd. (Redwood Square) 604-541-4200

RICE! HALF P

$

being attached in each cell – Jack is non-responsive and has the mental capacity of a one to two year old, grandfather Gordon Tansley explained. However, each day brings a little more progress, especially with the help of his family, who encourages his love of singing – even when it’s Christmas carols in June – and the tricycle, which was custom-made for him through Motion Specialities B.C. and paid for by Variety after months of work from Gordon and his wife, Diane. “I couldn’t have done it without them,” Julie said. The single mom of two – older brother, Liam, is 11 – noted that the amount of time needed to go through the proper channels in order to get the bike would have been too much for her to take on. When Jack was two, his grandparents took an old bike and attached straps so that Jack could ride it. However, he soon outgrew the bike and the cost for another proved to be too expensive. But after two years without having a bicycle to ride on, Diane and Gordon were determined to get Jack pedaling again. “It took quite a while. The doctor has to fill out forms and then you have to pull up financials. It’s an endurance race,” Diane said, noting the family shelled out a few extra dollars to have the bike painted red. With the tricycle, Jack’s able to participate in play, just like the other children at his school. “It’s really helped lighten the load,” Diane said. “I’m not sure if he really processes it with the other kids thinking, ‘hey, I’ve got my bike, I’m like you,’ but others see it, they see he can get around. “And once he’s on there, just try and catch him.”

Surrey - Boundary 6350 120th Street

$

s ss iss wiss w Sw Swis S

T S IN EFFEC ALL PRICE JAN. 17 TO FRI., 2014. JAN. 23, THURS.,

(Boundary Park Plaza) 604-592-0988 www.mmmeatshops.ca


12 www.peacearchnews.com 12 www.peacearchnews.com

business

Businesses nominated Finalists in the 2013 South Surrey and White Rock Chamber of Commerce Business Excellence Awards have been announced. The ceremony, Jan. 30 at Hazelmere Golf & Tennis Club, will honour businesses in various categories. In the category for one to seven employees, finalists are Lifelong Health, New Beauty Institute and Common Cent Bookkeeping & Tax. Peninsula Runners, Singer Olfert Financial Group and Ocean Promenade Hotel are nominated in the eight to 14 employee category. In the category for businesses with 15 or more employees are Westminster Savings Credit Union, White Rock Veterinary Hospital, Investors Group and Hugh & McKinnon Realty Ltd. Nominated for New Business of the

Year are Jan’s on the Beach, Brabeia Inc. and 23Seven Performance & Conditioning Studio. Individuals honoured at the awards include Douglas Charles of Penguin Meat Supply, John A. Makepeace of Jade West Engineering Co. Ltd. and Alan Schill of Schill Insurance in the Business Person, Self-Owned category; and Karen Donald of The Shops at Morgan Crossing, Michael Stuart of Hazelmere Golf & Tennis Club and Greg Timm of Pacific Customs Brokers for Business Person, Corporate. Non-profit organizations nominated include Sources, White Rock South Surrey Hospice Society and the Peace Arch Hospital Auxiliary Society. Tickets for the event are available at www.sswrchamberofcommerce.ca – or call 604-536-6844 ext. 204.

Thursday, January 16, 2014 Peace Peace Arch Arch News News

Fine Dining By the Sea

Want Results?

Call an outstanding agent...

RON WISEMAN

A U T H E N T I C I TA L I A N R xE xS xT xA xU xR xA xN xT Plenty of FREE Parking

2 Dinner Entrees $28.95

SAVE UP TO $14

(up to max. $20.50 value per dinner) ANY EVENING

Your choice of: Wild Salmon, Basa, Chicken, Veal Dishes and many more. To avoid confusion at billing, coupon MUST be presented before ordering - 1 coupon per couple and limited to a max. of 3 coupons per table. Cannot be used with any other promotion. No separate bills.

Expires Sun., Feb. 2, 2014

®

Colonial Pacific

604-541-4888

15791 Marine Drive • 531-6261

Closed Mondays. Open Tues.-Sun. from 5 pm VISIT OUR WEBSITE: www.labaiarestaurant.com

Call for Civic Grant Applications The City of White Rock is accepting applications for the 2014 Civic Grants. Annually, City Council awards a limited amount of funds to recipients performing work in the community that either benefits the residents of the City or brings favourable publicity to the City, thereby raising awareness and strengthening civic pride. If you are interested in applying for a grant, both the application and associated policy are available on the City’s website at www.whiterockcity.ca or in the Financial Services Department at White Rock City Hall, 15322 Buena Vista Avenue, White Rock, B.C., during regular office hours from 8:30 am to 4:30 pm, Monday through Friday, except Statutory Holidays. For further information, please contact 604-541-2100. Submission Deadline: All applications must be received by 4:30 pm, Friday, February 14, 2014.

Developer’s Public Information Meeting 15521 Russell Avenue The City of White Rock has received an application for a Development Variance Permit to reduce setbacks for the construction of an emergency generator facility at 15521 Russell Avenue (Peace Arch Hospital). A public information meeting is scheduled for Thursday, January 23, 2014 from 6:30 pm to 7:30 pm in meeting rooms #1 and #2 at the Peace Arch Hospital, 15521 Russell Avenue, for the public to view this application. The meeting will be an open house format with displays of the proposed development.

www.whiterockcity.ca

We want you to ‘like’ us. Join Peace Arch News on Facebook and receive local news updates online. Visit peacearchnews.com and click on the Facebook link. And don't forget to follow us on Twitter, too, for regular tweets. www.twitter.com/whiterocknews


Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 13 13 www.peacearchnews.com

lifestyles

e m o c l e W

Surrey couple wins $5 million Dereje Kinfe knew it would happen one day. So when the Surrey man finally won the lottery last week, he did exactly as he had promised and paid his wife a visit at her workplace. “I always told her, one day I’m going to win big and then I will come to your work and tell you,” said Kinfe, 44. His wife, Hiwot, spotted him outside her salon last week and could tell something was up. “He couldn’t wipe the smile off his face and I knew he had won something,” she said. Kinfe was the $5-million jackpot winner in the Jan. 4 Lotto 6/49 draw. He had bought his ticket before work that day and checked the numbers right away the following day. As more and more zeros appeared on the store clerk’s computer monitor, Kinfe let out a small scream. “People began crowding around and congratulating me,” he said. He took the day off work to let the win sink in and

We are pleased to welcome

Richard Johnstone to Hugh & McKinnon’s Residential Sales Group. Richard attended Crescent Park elementary and graduated from Semiahmoo High. His roots in our community run deep giving him an exceptional local knowledge. Over the past 30 years Richard has watched the South Surrey-White Rock area under go many changes. His goal is to ensure his clients have complete insight to the ever evolving market conditions.

Contributed photo

Dereje Kinfe and his wife, Hiwot, celebrate. surprise his wife. As well as paying off their mortgage, the couple is packed and ready to fly to their birthplace of Ethiopia to share their news with family and friends. – Sheila Reynolds

Richard Johnstone

FREE GIFTT VICE WITH SERVICE 1640

$

VALUE

Hugh & McKinnon has been providing clients with professional personalized real estate service for decades. Based in South Surrey we are an organization of professional Realtors and Property Managers and Administrators who utilize leading edge technology and traditional values to achieve results for our clients.

FREE

JOICO K-PAK COLOR THERAPY SHAMPOO 300ML

TTERS CHATTERS EXCLUSIVE USIVE LO

H WITH

richard@hughmckinnon.com www.richard-johnstone.com

E

C

O

UR SERV

IC

ONE PER PERSON. N. S WHILE SUPPLIES LAST.

Louise McKnight 604.531.4000 www.bchomequest.com

#80 16041 24 Ave. Grandview Corners 778-294-4410

Bay Realty Ltd.

Book your appointment with Allyson-Marie

Office: 604-531-1909 Mobile: 604 250-7103

14007-16th Avenue, South Surrey www.hughmckinnon.com

Is Your Memory Foam Mattress Safe? ++

+plus... 2013 Floor Model Discounts +++

(since 1904)

LUXURIOUS EUROTOP Was $2199 Then $1199

$

Clearance ce e

888

Double tempered pocket coils Dust mite resistant Natural latex Hypoallergenic wool

New Year Specials!

75 $ Queen Mattress 177 $ 77 Queen Eurotop Mattress 3 Twin Mattress

$

See video demo: www.wrmattress.com

Turns from this... into this (in less than 60 seconds)

with Mattress

FLOOR MODELS from

1499

Limited Quantity

Mattress Gallery www.wrmattress.com

A

good mattress is a very important tool to receive a needed, restful sleep. We spend a third of our lives in bed. Would you like to spend a third of your life on a toxic mattress? Off-gassing is a large component in a memory foam mattresses emitting a total of 61 Volatile Organic Compounds (V.O.C.) Chemicals Here are just a few of the 61 V.O.C. chemicals in a memory foam mattress and their association with your health. 1. Benzene – one of the chemicals in a memory foam mattress and has been linked to cancer. 2. Benezene 123 trimethyl is a colourless liquid. It’s flammable with a strong odour. It occurs in coal tar and petroleum and it is a gasoline additive. 3. Chlorobenzene is an aromatic organic compound used to make pesticides. 4. Naphthalene is a product used in mothballs. It gives a strong odour. Inhalation of naphthalene is associated with liver damage and possible neurological damage in infants.

A Healthier Alternative

Space Saver Ca-BED Ca-BED-Net -Net $

Sleep is one of the most important needs in life.

Celliant and Celitex latex are revolutionary new technologies that harness the body’s natural energy, as well as infrared light, sunlight, and other lights through the use of optically responsive minerals and fibres. My Recovery Matress has been clinically proven to increase blood flow and in turn bring needed oxygen to the body. Increased oxygen levels in the body helps naturally boost recovery and creates the optimal environment to help you feel better, balance body temperature and reduce pain.

www.recoverymattress.com

Clinical studies performed by 8 North American University Medical Centres • Improved sleep quality • Increased sleep efficiency • Reduction in pain • Reduction in soreness • Reduction wake after sleep onset (WASO)

2390 - 152nd St., South Surrey (in the old 7-Eleven Building)

604-385-0112

Also available for adjustable beds and multiple positions and massage

• Stimultion of healing process • Benefits even through several layers of fabric • Increased blood flow • Increased oxygen circulation • Reduces body temperature

OPEN 7 DAYS A WEEK SAVE! SAVE! SAVE! We will beat any competitors price or yours free* See in-store for details.


14 www.peacearchnews.com 14 www.peacearchnews.com

Thursday QLife after Stroke workshop Thursdays from 9 a.m. to noon at the Centre for Active Living, 5-1475 Anderson St. Info: Judith, 604-671-7761 or Gayl, 604536-4673.

Marine Dr. Cost: $25. Raising funds for several nonprofit organizations.

Saturday

QLet there be light oneday writing workshop Jan. 18, 10 a.m. to 3 p.m. Email Marilyn KroekerFriday Hahn, metamorph. QHot lunch & Abbotsford datebook@peacearchnews.com oh.sis@ gmail.com Male Chorus or call 604-996-2960 for performs for those 55+ details. Jan. 17, noon at White Rock Baptist Church, 1657 QTrigeminal Neuralgia Group meeting Jan. 18, 140 St. Cost: $8. RSVP to 2-3:30 p.m. Info: www. 604-531-2344 by Jan. 15. catna.ca QChinese New Year at QRobbie Burns 20th White Rock Elks, 1469 Annual Dinner & Dance George St., Jan. 31. DinJan. 25, 5:30 p.m. at Star ner at 6:30 p.m. Cost: $10. of the Sea Hall, 15262 Karaoke 7:30-11 p.m. Pacific Ave. Hosted by QFriends on the PenTam o’Shanter Dancers. insula Valentine’s fundInfo: 604-535-8949 or 604raiser Feb. 14, 6-9 p.m. 288-2458. Cost: $55. at Sandpiper Pub, 15585

date

Thursday, January 16, 2014 Peace Peace Arch Arch News News

lifestyles at White Rock Elks, 1469 George St. Cost: $15.

QRobbie Burns Celebration with DJ Johnny Twocoats at the White Rock Elks, 1469 George St., Jan. 25, 5-11 p.m. Cost: $10. QSt. Valentine’s Day Dance Feb. 15, 7-11 p.m.

QRobbie Burns Dinner & Dance fundraiser Jan. 25, 6 p.m. to midnight at the Royal Canadian Legion – Crescent Branch 240, 2643 128 St. Cost: $35. Benefiting Crescent Beach Pipe Band.

Cost: $25. QWhite Rock & Surrey Naturalists meet at Serpentine Fenn, 44 Avenue and King George Blvd. Feb. 9 and March 9, 9-11 a.m. Info: Liz Walker, 604591-7899.

Sunday QEncore Peninsula Concerts Feb. 2, 3-4 p.m. at First United Church, 15385 Semiahmoo Ave.

Monday QCommunity meeting Jan. 20 at 6:30 p.m. at White Rock Christian Academy gym. 2265 152 St. Discussion on proposed Semiahmoo Towers and arts centre.

book

Thinking of Remodeling? Doug McRae CEA, CSBA

• Kitchen and Bath Renovations • Plumbing/Heating Repairs • Sustainable Building Consulting • Air Leakage Testing

General Mills Cereals

99)XVLRQ Beverages

or V8 Vegetable Cocktail Selected Varieties, 1.06 L - 1.89 L

Selected Varieties 330 g - 505 g

6

WIN BIG!

for

for

$

Knorr Sidekicks Selected Varieties 111 g - 155 g

or Arriba Tortilla Chips Selected Varieties 200 g & 260 g

McCain Thin &UXVW3L]]DV

10 3$8

for

Selected Varieties 624 g - 920 g

Baileys Coffee Creamers or International Delight Non-Dairy Creamers 400 ml & 473 ml

Healthy Way Bread

2OG'

XWFK

Boost My Protein Say No to Fat & Sugar 500 g

for

10

$

Folgers Coffee

*Plus Dep. & Rec. Fees Where Applic

ea

'XWFK&UXQFK Potato Chips

Selected Varieties 465 g 515 g Frozen

$

10$ for

7

$

5

WIN BIG!

Kraft Shredded Cheese

Tropicana 2UDQJH-XLFH

Selected Varieties or Crumbled Feta Cheese 300 g & 340 g

Selected Varieties Chilled 2.63 L

6

$

ea

3

r’s

You Could WIN One Prize Of

Astro <RJXUW

FREE GROCERIES FOR A YEAR

5 $6 5$10 ea

Selected Varieties 142 g

Selected Varieties 235 g

5

pste

ea

Selected Varieties 650 g & 750 g

$

Or A $50 Grocery Gift Card, Daily!

for

*Plus Dep. & Rec. Fees Where Applic

$

Dem

$

6

5XIIOHV Potato Chips

for

for

$

Ocean Spray Craisins

ea

5

$

Sele Variected ties

Pringles Potato Chips

PLUS EVERY TICKET WINS

Selected Varieties 150 g 168 g

for

Instant Grocery & Discount Prizes

for

7II3J½GMEP6YPIWMRWXSVIJSVGSQTPIXIHIXEMPW

Call 778-888-4435

WHITE ROCK ELKS #431

1469 George St. 604-538-4016

While DVW OLHV/ 6XSS

Serving the Community for 54 years!

1

$ Chicken &RUGRQ%OXH Milford Valley Individually Frozen 5 oz.

1

$

D LLAR

DEALS

ea

17.64/kg

Ripple Creek, Shank or Butt Portion, 2.21/kg D LLAR

COMING EVENTS

Beef Prime 5LE6WHDNV

Smoked Spiral Ham

lb

Cut from Canada A Or Better Grades of Beef

Fresh Chicken Breasts Boneless, Skinless 11.02/kg

5

$

D LLAR

DEALS

lb

NEW MEMBERS WELCOME!

5XE\5HG *UDSHIUXLW Grown in Texas

ROBBIE BURNS CELEBRATION Sat. Jan. 25th 5-11pm Tix $10 Dinner/Dance DJ Johnny Twocoats Haggis:Piper:Drummer:Highland Dancers CHINESE NEW YEAR Fri. Jan. 31st. 6:30pm Dinner $10 KARAOKE with MARLENE 7:30-11pm

THE WALKERS Traditional & Classical Folk Music by Chuck, Dave & John Wed. Jan. 22nd 4-6pm N/C NORTH BLUFF Enjoy your Favourites with Ray, Mary & Ron Wed. Jan. 29th 4:30-7pm N/C ST. VALENTINEâ&#x20AC;&#x2122;S DAY DANCE Sat. Feb. 15th 7-11pm Tix $15 MIGHTY BIG FRASER BAND Music of the Big Bands of the 40â&#x20AC;&#x2122;s For further info check out our website www.whiterockelks.ca â&#x20AC;˘ Find us on Facebook

D LLAR

5$ for

Organic D LLAR %DE\6DODGV Earthbound Farm Product of USA 5 oz. Clamshell

5

$  for

DEALS

DEALS



ea

Fresh Express Spinach Product of USA 9 oz. Cello Bag

$

D LLAR

DEALS



8

$

D LLAR

DEALS

lb ea

DEALS

lb

Fresh Pork Loin Roast

Boneless, Centre Cut 6.61/kg

3

$

D LLAR

DEALS

lb

)XML Apples

Grown in BC Extra Fancy, 2.20/kg

1

$

D LLAR

DEALS

lb

Roma Tomatoes Grown in Mexico 3.31/kg

D LLAR

3

$ lbs

DEALS

ea

3ULFHV(IIHFWLYH6XQ-DQXDU\WKWR6DW-DQXDU\WK

Hillcrest Mall - 1405 Johnston Road, White Rock

VISA

Mastercard

+28560RQGD\)ULGD\DPSPÂ&#x2021;6DWXUGD\DPSPÂ&#x2021;6XQGD\ +ROLGD\VDPSP

:HVWHUQ&DQDGLDQ2ZQHG 2SHUDWHG

We reserve the right to limit quantities. Limited quantity specials require a $10 min. family purchase excluding limited quantity specials & tobacco products. Some items are subject to GST and plus deposit/eco fees where applicable.


Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 15 15 www.peacearchnews.com

lifestyles

NO TAX!

Ongoing

book

Buying or Selling a Home? I can help with all your legal documents, Power of Attorney, Wills

Jennine Fitterer, NOTARY PUBLIC #103 - 15149 No. 10 Hwy. Tel. 604-579-0205 Fax. 604-579-0212 jfitterer@shaw.ca Handicap Access

Free parking

BOTTLES COOL SAVINGS

#80 16041 24 Ave. Grandview Corners 778-294-4410 | www.chatters.ca

weddings / birthdays / anniversaries / retirement / holidays

Create your next special occasion at Deluxe Restaurant

10x10 Solid Wood Kitchen Cabinets

1,799

$

COUNTERTOPS

BEST PRICE BEST QUALITY BEST SERVICE

We specialize in large group events. Ocean view dining.

STARTING AT

90

$

LIN. FT.

date

Until Feb. 15, 2014.

STARTING AT

QFraud Smart 2 comQHistory Club meets munity policing workshop Jan. 27, 7 p.m. at White Rock Library. Presentation offered at the White Rock Community Centre Galby artist Bob Michener. lery Feb. 4 and March 13. Open to all with small Free. Contact donation. White Rock QDivorcecLeisure are non-profit Services to recovery register, 604group meets 541-2199. Monday evenings at datebook@peacearchnews.com QOneness Gogos White Peace Portal Rock/South Surrey group Alliance Church. Info: works to help African Donna, 604-538-6167. grandmothers raising Tuesday children orphaned by HIV/ AIDS. Meets monthly on QPride of Erin perform the fourth Monday, 1-3 Celtic music Feb. 4, 3:30-6 p.m. upstairs at the White p.m. at White Rock Elks, Rock Library, 15342 Buena 1469 George St. Vista Ave. Newcomers Wednesday welcome. For more information, email onenessgoQFolk music by The gos@gmail.com Walkers Feb. 19 and 22, 4-6 p.m. at the White Rock QWhite Rock & Surrey Naturalists photo preElks Hall, 1469 George St. QCountry music by North sentations every second Thursday of the month at Bluff Jan. 29, 4-6 p.m. at 7:30 p.m., Sunnyside ComWhite Rock Elks, 1469 munity Hall, 1845 154 St. George St.

FROM START TO FINISH We have Experienced Plumber’s Electrians & Tilers Avaliable RESERVATIONS & GIFT CARDS @ DELUXERESTAURANT.CA OPEN DAILY @ 12:00 - LATE

COWRY KITCHEN CABINETS & COUNTERTOPS Visit our showroom or call today!

604 542 5042

15475 MARINE DRIVE, WHITE ROCK, BC

PLEASE READ THE FINE PRINT: Offers valid until January 31, 2014. See toyota.ca for complete details on all cash back offers. In the event of any discrepancy or inconsistency between Toyota prices, rates and/or other information contained on toyotabc.ca and that contained on toyota.ca, the latter shall prevail. Errors and omissions excepted. 2014 Corolla CE 6M Manual BURCEM-A MSRP is $17,540 and includes $1,545 freight and pre-delivery inspection, tire levy, battery levy and air conditioning federal excise tax. *Lease example: 2014 Corolla CE 6M with a vehicle price of $16,440 (includes $1,100 Toyota Canada Lease Assist, which is deducted from the negotiated selling price after taxes, and $1,545 freight/PDI) leased at 2.9% over 60 months with $0 down payment equals 120 semi-monthly payments of $89 with a total lease obligation of $10,680. Lease 60 mos. based on 100,000 km, excess km charge is $.07. $0 security deposit and first semi-monthly payment due at lease inception. Price and total obligation exclude license, insurance, registration, fees and taxes. Dealer order / trade may be necessary. **Finance example: 1.9% finance for 60 months, upon credit approval, available on 2014 Corolla CE. Applicable taxes are extra. 2014 RAV4 Base FWD LE Automatic ZFREVT-A MSRP is $25,685 and includes $1,815 freight and pre-delivery inspection, tire levy, battery levy and air conditioning federal excise tax. †Lease example: 4.9% Lease APR for 60 months on approved credit. Semi-Monthly payment is $139 with $2,300 down payment. Total Lease obligation is $18,980. Lease 60 mos. based on 100,000 km, excess km charge is $.10. Applicable taxes are extra. Down payment, first semi-monthly payment and security deposit plus GST and PST on first payment and full down payment are due at lease inception. A security deposit is not required on approval of credit. ††Finance example: 0.9% finance for 60 months, upon credit approval, available on 2014 RAV4. Applicable taxes are extra. 2014 Tacoma Double Cab V6 4x4 Automatic MU4FNA-A MSRP is $32,965 and includes $1,815 freight and pre-delivery inspection, tire levy, battery levy and air conditioning federal excise tax. ‡Lease example: 4.9% Lease APR for 60 months on approved credit. Semi-Monthly payment is $165 with $3,980 down payment. Total Lease obligation is $23,720. Lease 60 mos. based on 100,000 km, excess km charge is $.10. Applicable taxes are extra. Down payment, first semi-monthly payment and security deposit plus GST and PST on first payment and full down payment are due at lease inception. A security deposit is not required on approval of credit. ‡‡Finance example: 0.9% finance for 36 months, upon credit approval, available on 2014 Tacoma. Applicable taxes are extra. ‡‡‡Semi-monthly lease offer available through Toyota Financial Services on approved credit to qualified retail customers on most 48 and 60 month leases (including Stretch leases) of new and demonstrator Toyota vehicles. First semi-monthly payment due at lease inception and next monthly payment due approximately 15 days later and semi-monthly thereafter throughout the term. Toyota Financial Services will waive the final payment. Semi-monthly lease offer can be combined with most other offers excluding the First Payment Free and Encore offers. First Payment Free offer is valid for eligible TFS Lease Renewal customers only. Not open to employees of Toyota Canada, Toyota Financial Services or TMMC/TMMC Vehicle Purchase Plan. Some conditions apply. See your Toyota dealer for complete details. Visit your Toyota BC Dealer or www.toyotabc.ca for more details. Some conditions apply; offers are time limited and may change without notice. Dealer may lease/sell for less.

Monday

#103 15585 24th Ave, South Surrey (In Pacific Business Park) • 604-542-5577

LEASE FROM ‡

FINANCE FROM ‡‡

165 0.9

$

%

OR

semi-monthly/60 mos.

per month/36 mos.

COMA

2014

4x4 Double Cab V6 $32,965 MSRP includes F+PDI

LEASE FROM †

FINANCE FROM ††

139 2.9

$

semi-monthly/60 mos.

‡‡‡

%

OR

2014 014

per month/60 mos.

RAV

FWD LE $25,685 85 MSRP in includes F+PD +PDII

FREE FIRST OR LAST PAYMENT

. No Security Deposit . Monthly or semi-monthly semi-mon payme yment ntt op option opt ion on ns . Standa Standard or Low w Kilo Kilo ome metre met re Lea Lease se

Corolla S - Sp port model shown

0

$

ALL NEW 2014

FINANCE FROM **

LEASE FROM *

89

$

OR

1.9

%

CORO

CE 6M MODEL $17,540 MSRP includes ludes F+PDI

per month/60 mos.

semi-monthly/60 mos.

*

down payment Follow us at:

To y o t a B C . c a

JIM PATTISON TOYOTA DOWNTOWN 1290 Burrard Street (604) 682-8881

JIM PATTISON TOYOTA NORTH SHORE 849 Auto Mall Drive (604) 985-0591

LANGLEY TOYOTATOWN LANGLEY 20622 Langley Bypass (604) 530-3156

OPENROAD TOYOTA RICHMOND Richmond Auto Mall (604) 273-3766

DESTINATION TOYOTA BURNABY 4278 Lougheed Highway (604) 571-4350

SUNRISE TOYOTA ABBOTSFORD Fraser Valley Auto Mall (604) 857-2657

WEST COAST TOYOTA PITT MEADOWS 19950 Lougheed Highway (866) 910-9543

SQUAMISH TOYOTA SQUAMISH 39150 Queens Way (604) 567-8888

30692

18732

9497

7825

9374

5736

7662

31003

GRANVILLE TOYOTA VANCOUVER 8265 Fraser Street (604) 263-2711

JIM PATTISON TOYOTA SURREY 15389 Guildford Drive (604) 495-4100

OPENROAD TOYOTA PORT MOODY 3166 St. John’s Street (604) 461-3656

PEACE ARCH TOYOTA SOUTH SURREY 3174 King George Highway (604) 531-2916

REGENCY TOYOTA VANCOUVER 401 Kingsway (604) 879-8411

VALLEY TOYOTA CHILLIWACK 8750 Young Road (604) 792-1167

WESTMINSTER TOYOTA NEW WESTMINSTER 210 - 12th Street (604) 520-3333

6978

6701

7826

30377

8507

8176

8531


16 www.peacearchnews.com

Thursday, January 16, 2014 Peace Arch News

DAY

3

®

SALE

SATURDAY

FRIDAY

18

17

JANUARY

N. U S . T A FRI.-S

$

New York Strip Loin Steaks Boneless. Cut from 100% Canadian beef. Sold in a twin package of 4 for only $20.00 each.

JANUARY

5

each steak

NLY! 3 DAYS O

SUNDAY

19

JANUARY

McCain Thin or Rising Crust Frozen Pizza 465 to 900 g. Or Pizza Pockets 8’s. Assorted varieties. HOUSEHOLD LIMIT FOUR - Combined varieties.

99

3

ea. E EXTREM PRICE

NLY! 3 DAPYRSICEO CLUB

! From the Deli

49

7

Signature CAFE BBQ Chicken

ea.

ONLY! 3 DAPYRSICE

Ready to enjoy! Available hot or cold.

Coast to Coast Italian Style Bread Or Whole Wheat. 675 g.

Fresh Whole Frying Chicken 1.5 kg.

CLUB

$ 2for

4

NLY! 3 DAPYRSICEO CLUB

Bakery Counter Dinner Rolls Or Crusty Rolls. White or Whole Wheat. Package of 12.

$r 2fo

3

NLY! 3 DAPYRSICEO CLUB

$

ea.

ONLY! 3 DAYS

T

E BUY 1 G

Tampax or Always Tampons, Pads or Liners. Select varieties. 14 to 64’s. LIMIT SIX FREE - Combined varieties.

Prices effective at all British Columbia Safeway stores Friday, January 17 through Sunday, January 19, 2014 only. We reserve the right to limit sales to retail quantities. Some items may not be available at all stores. All items while stocks last. Actual items may vary slightly from illustrations. Some illustrations are serving suggestions only. Advertised prices do not include GST. ®™ Trademarks of AIR MILES International Trading B.V. Used under license by LoyaltyOne, Co. and Safeway. Extreme Specials are prices that are so low they are limited to a one time purchase to Safeway Club Card Members within a household. Each household can purchase the limited items one time during the effective dates. A household is defined by all Safeway Club Cards that are linked by the same address and phone number. Each household can purchase the EXTREME SPECIALS during the specified advertisement dates. For purchases over the household limits, regular pricing applies to overlimit purchases. On BUY ONE GET ONE FREE items, both items must be purchased. Lowest priced item is then free. Online and in-store prices, discounts, and offers may differ.

9

1FREE EQUAL O

R VALUE R L E S SE

NLY! 3 DAPYRSICEO CLUB

JANUARY 17 18 19 FRI

SAT SUN

Prices in this ad good until January 19th.


arts & entertainment

Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 17 17 www.peacearchnews.com

…on the Semiahmoo Peninsula

Local talent takes to stage in Langley Players production

Old play, modern story Brenda Anderson

owner of the road-side Kansas eatery, feisty “grass widow” hat happens when Grace Hoyland. a diverse group of Also among the group of very strangers is stranded different people struggling in a small town diner — with no to connect in the midst of a iPods, cellphones or tablets to snow storm in Bus Stop are help them avoid interacting? young cowboy Bo Decker Let’s just say things are bound (Darcy Knopp), his older, wiser to get a little awkward as the colleague, Virgil Blessing (Joe Langley Players step back Tenta), school girl/waitress Elma in time with the Duckworth (Dayna ❝The theme of character-driven Thomas), alcoholic tale, Bus Stop, by people wanting to philosophy professor William Inge. connect with others Dr. Gerald Lyman Plum roles in the (David Bodor), – the need to be comedy-drama – Sheriff Will Masters loved...these things Jan. 23 to Feb. 22 at (Mike Parker) and are universal.❞ Langley Playhouse, bus driver Carl 4307 200 St. – go to (Peter Godard). Helen Embury two actresses well They may seem director known to Peninsula an incongruous audiences from recent White gathering – but each is faced Rock Players Club seasons. with some serious life decisions South Surrey’s Sarah Green as they wait out the worst of the (Drinking Alone) tackles key weather. character Cherie, an aspiring Bus Stop was first staged in lounge singer escaping a 1955 – a year perched between difficult ‘hill folk’ background, the perceived age of innocence while Langley resident Sheila and the new world of the 1960s Greentree (A CTC award winner which was about to unfold. for last year’s Fools) plays the But what appeared at first

W Black Press

to Langley Players’ Helen Embury, as a bit of a dated story, gradually grew on her with its “honest charm.” “It became clear this piece was still fresh, the characters are still real and interesting and their stories are still relevant today,” said the director. “I am constantly looking for quality material that will fit on our intimate stage and entertain our audiences.” And with its character-driven focus, Bus Stop is ideal for the Langley Players’ small space, she added. The only other issue Embury had with the script was that it was divided into three acts. Once she devised a way to adapt Bus Stop into a two-act play, any objections she’d had vanished. Because the Langley Players’ production is set in a small Midwestern American town during the 1950s, the dialogue includes colloquialisms and language that is specific to the time and place, said Embury. But it was important to her to › see page 19

Contributed photo

Cherie (South Surrey’s Sarah Green) is courted by Bo (Darcy Knopp) while father figure Virgil (Joe Tenta) looks on, in Bus Stop, running Jan. 23 to Feb. 22.


18 www.peacearchnews.com 18 www.peacearchnews.com

Thursday, January 16, 2014 Peace Peace Arch Arch News News

arts & entertainment

Hollywood-inspired artwork sought The Arts Council of Surrey is seeking original 2D art inspired by movies from the 1930s and 1940s. Artists are invited to participate in the Silver Screen Classics competition and Exhibition, which begins in February. Categories include Paintings on paper, drawing, mixed media and printmaking, photography and digital art. Prizes are $200, $150, $100 and $50. The entry fee is

T, FASE-FREE L S HAS

$10 per piece, with a maximum of three per artist. Works must be unframed, and precisely 18x24 inches. The deadline for entries is Jan. 31. More information and entry forms are available at 604594-2700, info@ artscouncilofsurrey. ca or http://bit. ly/1m3kWyq An opening reception takes place Feb. 18 from 7-9 p.m. at the Newton Cultural Centre, 13530 72 Ave.

ues Cheq f o s e l Typ  Al olds l oH  N tant Approva s In



Faith White Rock South Surrey Jewish Community Centre

2265 - 152 St., Surrey (604) 531-8301 Mike & Ev Schroeder - Pastors

10:30 A.M. SUNDAYS www.lifechurchwr.com

Serving the Jewish Community since 1994

Everyone needs a pastor and a church to call home

www.wrssjcc.org

2:00 P.M. Mandarin Worship

SEAVIEW PENTECOSTAL ASSEMBLY Sunday AM - Church With Life - 10:30AM

Fast, Hassle-Free

CHEQUE CASHING No Holds... Instant CASH!

WHITE ROCK MONEY MART 1812 152nd Street (across from the Semiahmoo Library)

604-536-2222 Open 7 Days A Week

O ON THE

SEMIAHMOO PENINSULA

Senior Pastor - Joey Booth 14633 16th Ave. South Surrey - 604-536-7011 www.seaviewassembly.org

12268 Beecher St. Crescent Beach • 604-209-5570 www.allsaintswhiterock.com

SEMIAHMOO BAPTIST CHURCH 2141 Cranley Drive 604-576-6504

Sunday Services 11 am & 6 pm

Rev. Dr. Richard Topping LUNCH HUT Fridays 11-1 pm

Independent, Fundamental Non-charismatic

White Rock Lutheran Church Sunday Worship Services English 10:30am Pastor Norm Miller 604-576-1394

Chinese 10:30am

$% ( Pastor David Leung 778-878-6699 Traditional & Christ Centered ALL ARE WELCOME

St. John’s Church 1480 George St., White Rock, B.C.

ALL WELCOME!

MOUNT OLIVE LUTHERAN CHURCH

UNITED CHURCH OF CANADA

2350 - 148 St., Surrey, B.C. Phone: 604-536-8527

FIRST UNITED

SUNDAY, JAN. 19th (604) 535-8841

January 19 Sunday Worship 10:30 am No Afrikaans Service during January 2014 9:50am Sunday School

Pastor Peter Hanson All are Welcome!

Rev. Craig Tanksley, Rector Rev. Denise Doerksen, Asst. Priest

1480 George St., White Rock B.C. Church Office: 604-536-9322 www.saint-johns.ca

We sing the Traditional Hymns and use the King James version in all services.

Worship & Sunday School 10:15 am

8:00 a.m. Holy Communion 10:00 a.m. Eucharist Service

This Sunday 10.30 am Everyone welcome e!

All Saints Community Church

Looking for Sound Biblical Teaching? You’ll Find It at St. Mark’s! 12953 - 20th Ave. Surrey www.stmarkbc.org

“Studies in the book of Acts”

Pastor Peter Klenner

Sunday PM - Acts 29, The Next Chapter - 6:00PM (Please Note - no PM Service on Long Weekends)

The Story of Christian Beginnings

Centre St. & Buena Vista Ave.

604-531-4850 Rev. Joan McMurtry

Service at 10:30 am on January 19th, 2014 with Rev. Joan McMurtry Godly Play begins at 10:30 am. A progressive, inclusive Christian community – all welcome, come as you are!

CRESCENT UNITED Corner 28th Ave. and 127th Street • 604 535-1166 Ministry Staff: Scott Swanson and Gabrielle McLarty Music Director: David Proznick

Anglican Church of the Holy Trinity 15115 Roper Avenue at Foster Street Phone: 604-531-0884 www.holytrinitywhiterock.org

Sunday Services The Reverend Neil Gray, Rector

8:00 a.m. Eucharist 10:00 a.m. Sung Eucharist Children's Program & Nursery Thursdays - 10:30 a.m. Eucharist

The Anglican Church welcomes you!

ROMAN CATHOLIC CHURCHES ON THE PENINSULA “A warm welcome to everyone”

MASS SCHEDULE Good Shepherd Church 2250 - 150 St., S. Surrey • Daily: 8:00 am • Saturday: 5:00 pm • Sunday: 9:00 am, 11:00 am & 7:00 pm Star of the Sea Church 1153 Fir St., White Rock • Daily: 9:00 am • Saturday: 4:00 pm • Sunday: 10:30 am Holy Cross Church 12268 Beecher Ave., Crescent Beach • Sunday: 8:30 am

For further information for all t hese churches Please call 604-531-5739 or go to: www.starofthesea.ca. STAR OF THE SEA CATHOLIC SCHOOL (K-Gr. 7) 15024 - 24th Avenue, South Surrey

Worship & Sunday School - 10 am

“The Star’s 3Rs” Reverence, Respect, Responsibility”

Everyone Welcome www.crescentunitedchurch.com

Please call 604-531-6316 or go to: www.starofthesea.ca


Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 19 19 www.peacearchnews.com

arts & entertainment

Vacation & Cruise Wear

Actors from all backgrounds featured › from page 17 bond together to tell a universal lighting and sound design as story all can relate to,” Embury well as props and wardrobe,” she respect those details within the said. said. larger context of the story. The director is also quick to Shows start at 8 p.m. each “The theme of people wanting point out that beyond the actors Thursday through Saturday; to connect with others – the need to be loved and appreciated the audience sees on stage, there Sunday matinees start at 2 p.m. Audience members are – these things are universal,” she is a veritable army of people involved behind the scenes of advised to arrive a half hour said. each production. before show time. Admission is “And Inge certainly was a “There has been a large design $15, payment by cash or cheque writer who knew and admired team working for the past two only. women. His female characters months to create the world of For more information are among his best. When 1955 and Grace’s Diner – from about the production visit Cherie lists the qualities she set design and decoration to langleyplayers.com is looking for in a husband, I am sure every woman in the audience will be thinking, ‘You are so right,’” said Embury. “And I’m sure the COSMETIC & FAMILY DENTISTRY men in the audience will be sympathetic welcomes… to Bo (Langley native and current Chilliwack resident Knopp) when he says it’s difficult to One Appointment Crowns Sedation Dentistry understand women Digital X-Ray Teeth Whitening ‘because they are Caring Staff Extractions different from men.’” When it came time to • WHEELCHAIR ACCESSIBLE cast the show, Embury – • NEW PATIENTS WELCOME as she does – had a fairly clear picture in her mind of how her characters 1115 Stayte Road, White Rock would appear. 778-294-6982 • www.staytedental.com “I always begin the audition process with a visual idea of what the characters will look like – and I always change my mind during auditions,” she said. “It is most important N OT I C E O F I NT E NT the actors be able to play the characters fully and COMMUNITY CHARTER S.B.C. 2003 CHAPTER 26 honestly. That takes skill NOTICE OF INTENTION TO SELL CITY LANDS and commitment – and we have plenty of both in Pursuant to Sections 26 and 94 of the Community Charter S.B.C. 2003, Chapter 26, our cast,” she added. as amended, the City of Surrey hereby gives notice of the intention to dispose of the Among the eight following City lands: performers Embury Legal Description: Parcel 1 and Parcel 2 both of Section 8 Township 2 cast is a combination New Westminster District Plan EPP34157 of experienced and new actors. Some are Civic Address: 539.2m² portions of road adjacent to professionals, others 6321 King George Boulevard. have honed their craft in Property Description: The properties are portions of redundant road. They are community theatre. designated Urban in the Official Community Plan and Retail “The magic of theatre Commercial in the Newton Local Area Plan. They are zoned is watching actors CHI (Highway Commercial Industrial). The City is selling the of different ages and 539.2m² portions of road for consolidation and rezoning with the adjacent private property located at 6321 King George different backgrounds

STAYTE DENTAL

IS BACK IN THE STORE. HURRY IN FOR BEST SELECTION! Chinese New Year items and decor arriving soon

Customer Appreciation Day Today! January 16 10% off your total purchase DONATIONS ACCEPTED TUESDAY TO SATURDAY 11 AM TO 3 PM

Thrift Store

Dr. Anthony Bellusci

www.whiterockhospice.org

15562 - 24 Ave. behind Black Bond Books 604-538-7600

We want you to ‘like’ us. Join Peace Arch News on Facebook and receive local news updates online. Visit peacearchnews.com and click on the Facebook link. And don't forget to follow us on Twitter, too, for regular tweets. www.twitter.com/whiterocknews

MASTER OF COUNSELLING With your Master of Counselling from CityU, you’ll be prepared to help others when they need it most. If you have a bachelor’s degree and want a career as a Clinical Counsellor, CityU’s Master of Counselling program could be a great fit.

Boulevard.

Purchasers:

SHOWTIMES

McLELLAN MEWS HOLDINGS LTD.

Nature of Disposition: Fee Simple

Friday, Jan. 17 - Thursday, Jan. 23

Selling Price:

Two Hundred Fifteen Thousand Dollars. ($215,000.00)

2381 King George Blvd., Sry 604-531-7456

AMERICAN HUSTLE (14A) Nightly 7:45 Mat Sat-Sun 2:10 FROZEN (G) Nightly 7:00, Mat Sat-Sun 2:30 SECRET LIFE OF WALTER MITTY (G) Nightly 9:15 RIDE ALONG (PG) Nightly 7:15 & 9:20 Mat Sat-Sun 2:20 THE HOBBIT: DESOLATION OF SMAUG (PG) Nightly 7:30 Mat Sat-Sun 2:00

Learn more at a Thursday info session:

January 23, 2014, 5:00pm

SHOWTIMES

City University of Seattle in Vancouver, BC 789 West Pender Street, Suite 310, Vancouver

Friday, Jan. 17 - Thursday, Jan. 23

Further information can be obtained from the City of Surrey, Realty Services Division, Engineering Department, 14245 - 56 Avenue, Surrey, BC V3X 3A2. Phone (604) 598-5718.

AUGUST: OSAGE COUNTY (14A) Nightly 7:10 & 9:25 Mat Sat-Sun 2:10 HER (14A) Nightly 7:00 & 9:20 Mat Sat-Sun 2:00

RSVP to 1.800.663.7466

THIS ADVERTISEMENT IS FOR THE PURPOSE OF PUBLIC DISCLOSURE ONLY, NOT SOLICITATION OF AN OFFER

www.surrey.ca

www.CityU.edu/Canada SP3713

1734 152nd St.,White Rock 604-541-9527

The term “university” is used under the written consent of the Minister of Advanced Education effective April 11, 2007, having undergone a quality assessment process and been found to meet the criteria established by the minister. City University of Seattle is a not-for-profit and an Equal Opportunity institution accredited by the Northwest Commission on Colleges and Universities.


20 www.peacearchnews.com

Thursday, January 16, 2014 Peace Arch News


Peace Arch News Thursday, January 16, 2014

www.peacearchnews.com 21

total health

MIND & BODY

Q just for the health of it! Q looking to learn something new – register now! Q january is alzheimer awareness month.Q boost your immune system.

January is

ALZHEIMER AWARENESS MONTH Keep those brain cells working! During the month of January, which is Alzheimer Awareness Month, we should all become more aware of the fact that this illness is affecting younger and younger people. In Canada, more than 71,000 people affected by Alzheimer’s or a related dementia, are less than 65 years old, a figure which represents about 15% of all the victims of this disease. This information allows us to see another side of Alzheimer’s: that of the actual and future impact of this neurodegenerative disease on society as a whole. Our health care system will be affected as well as all types of businesses and industries. Indeed the generation most affected by this disease are the baby-boomers, many of whom are our leaders and mentors.

Canadians are invited to do everything they can, and must do, to lessen the impact of Alzheimer’s disease and related dementias. The greatest known risk factor is increasing age so it is important to keep our brains working in order to give it the exercise it needs. Just as physical activity improves the functioning of the body, cerebral activity can help reduce the risks of contracting Alzheimer’s disease: play games,which exercise the brain (chess, letter and number games, jigsaw puzzles, crosswords…) explore new interests such as learning how to play a musical instrument or take classes; modify your routine, read and participate in cultural activities; continue hobbies or discover new ones, etc. By never forgetting to play, to learn, to communicate, to think, we contribute directly to the well-being of our brains.

DO YOU HAVE A NEW YEARS RESOLUTION TO

Feet are for a lifetime. Will yours go the distance?

FEEL BETTER?

If you are suffering from: • foot pains • plantar fasciitis • tired aching feet • bunions • knee pain • lower back pain • heel spurs Have been diagnosed with: • diabetes • arthritis • osteoporosis

In-Joy Life Laser Care presents a FREE 45 minute InformaƟon Session:

Unleash Your Pain with Low Level Laser Therapy ARE ANY OF THE FOLLOWING KEEPING YOU SIDELINED:

OsteoarthriƟs Knee or Hip Pain Plantar FasciƟis Shoulder Pain

Laser Therapy…

TendoniƟs Spinal Pain Foot Pain Elbow Pain

WHERE:

In-Joy Life Laser Care #301-2099-152 Street,, South Surrey

93

* Limited seaƟng available * Please RSVP by January 23rd by calling…

DOOR PRIZE FOR WELLNESS BASKET!

604ͳ535ͳ7373

SPONSORED BY:

Medi-SƟck • Chiro-Flow • Douglas Labs

VALUED AT $290

Response to Laser Therapy is interdependent

3D Gait Analysis & Electronic Casting Technology for the 21st Century To book your FREE electronic foot analysis call: Scott Robb Clinical Technician

Full contact into the arch. Can your old orthotic do that? Conventional orthotics do not support the arch, but use a wedge shape under the heel to affect foot position.

SHOES

Save $100



WHEN:

Tuesday, January 28 @ 5:00 pm

est. 19

• Helps to eliminate pain • Accelerates recovery • Promotes healing • Restores normal range of moƟon • Restores physical funcƟon • Reduces the need for medicaƟons

Discover the power of our medical grade orthotics. Our philosophy is very simple. Your whole body is relying on your feet. If your feet hurt, you’ve got a problem. If we can help you, then you’ve got a solution....We make pain go away, every day. It’s that simple.

on your nextt sett off custom t made d orthotics th ti Expires Jan. 31/14

29 YEA Servin

RS

g the Penins ul

a

SHOES

#105A - 1711 152nd Street SEMIAHMOO SHOPPING CENTRE

604-531-4633


22 www.peacearchnews.com

Thursday, January 16, 2014 Peace Arch News

Health, mind & body PTIMIZING HEALTH, FUNCTION & PERFORMANCE

Non-Surgical Drug Free Pain Relief

Dr. Vanessa Lapointe, R. Psych.

Services include:

Clinic Founder & Neufeld Institute Professional Associate

• Flexion-distraction for back, neck and leg pain

Anxiety and Children

• Spinal decompression for disc issues

About 42 000 children in BC are currently diagnosable with an anxiety disorder. Why?

• Sports injury treatment and rehabilitation • Active Release Technique

Like us on Facebook

WIN A WEEKEND FOR TWO AT WHISTLER See webpage blog for details. www.motionchiro.com

Dr. Nathan Dean www.motionchiro.com Office@MotionChiro.com 604-385-2799 2970 King George Blvd, Unit5 Surrey (by the shops at High Street) *ICBC Patients accepted

Contemporary neuroscience has revealed that our brains grow from the foundation up. This foundation governs our emotions, and it is optimally formed by immersing children in worlds that are “relationally rich.” Our children today are growing up relatively isolated, without the benefit of traditions that keep them marinating in the companionship of nuclear and extended family, villages, and communities. This void has occurred at the same time that the pressures on children have increased - they have to be “ready to learn” at younger

and younger ages; they are in multiple extracurricular activities; they are required to sit for long hours at desks in classrooms and “perform.” In order to fend off anxiety, we (parents, teachers, etc.) are left to backfill this relational void by finding ways to have the children in our care resolutely believe in the enduring comfort of the relational connection we share with them. It ultimately comes down to the most simple, readily available, affordable answer – relationship. In the literal and figurative arms of those who care for them, the anxious child can indeed find rest.

778-294-8732

129-3388 Rosemary Heights Crescent, Surrey, BC V3S 0K7 For more details, please visit our website: www.lapointepsychology.com

JANUARY CLEARANCE SALE ON NOW! HEAR US SATURDAY, JANUARY 18 AT 11:00 AM on with Stirling Faux on Boomer Life! Twin Mattress $69 • Any Size Boxes $89 Queen Mattress $199 HURRY IN FOR THE BEST DEALS!

RELIEVE PAIN!

For Back Pain

MAGNET BED ®

BIOFLEX Concentric Circle Medical Magnets The magnetic field causes the blood vessels to dilate, increasing circulation, thus accelerating the natural healing process. Reduces swelling, which is a major source of musculoskeletal pain.

ISS = A Healthier Sleep

For Back Pain

For Back Pain

For Relaxation

For Headaches

For Neck Pain

Deluxe Lumbar

Active Back

Flex Pad

Sleep (Eye) Mask

Headband

For Elbow Pain

For Wrist Pain

Carpal Tunnel Syndrome

For Thumb & Wrist Pain

For Hand Pain

For Thigh Pain

Arthritis Mitt

Thigh Support

Elbow Support

Wrist Support

Wrist Splint

Thumb & Wrist Support

For Shin Pain

For Ankle Pain

For Foot Pain

For Foot Pain

Shin Support

Ankle Support

Flat Magnetic Insoles

Magnetic Orthotics

For Elbow Pain

Neck Collar

Tennis Elbow For Knee Pain

Knee Stabilizer

Pain Relief for Any Part of Your Body Relief Wherever You Sit

20 Year Warranty!

Innovative Sleep Solutions

Universal Kit

Mini Circle Pad

Universal Magnetic Therapy Seat Cushion

We won’t be under sold!

#10-3033 KING GEORGE BLVD. 604-536-9380 www.innovativesleep.ca


Peace Arch News Thursday, January 16, 2014

www.peacearchnews.com 23

Just for the health of it! Say goodbye to those extra pounds!

Change is Possible

The beginning of each New Year brings a desire for change and, often enough, a real need to get our act together concerning the loss of those extra pounds which weigh heavily on our self-esteem and our health in general.

Compassionate & specialized counselling services for all family members • Individual Counselling • Child Counselling and Play Therapy • Family Therapy • Adolescent Therapy • Parent Child Relationship Therapy • Couples Therapy

But where do we start? Most nutritionists usually advocate the same formula: permanent weight loss can only be achieved through changes in our diet combined with a more active lifestyle.

2 locations to serve you

Surrey and South Surrey locations alisonbellcounselling.com • 604-536-4475

As far as physical activity is concerned, it’s important to start gradually and consult a doctor if necessary. The objective is to build up to 30 minutes of moderate physical activity, every day if possible.

Do you suffer with skin disease? Chinese medicine, as practiced in hospital settings around the world, can be a very effective and safe treatment for many skin ailments,

And what about your eating habits? Crash diets are not recommended as the lost pounds will soon reappear. The best method is, once again, to start gradually. For example, you could set yourself the objective of adopting a new, healthier eating habit each week such as replacing the evening’s rich dessert with a yogurt or a fruit salad. Depending on personality and the number of pounds which need to be lost, some people may want to attend weekly group meetings to keep their motivation levels high. Others will rely on low-fat prepared meals or even meal substitutes to simplify their lives and make their objectives easier to attain. Once those objectives are met, it will be much easier to maintain a healthy weight. The important thing to remember is to make use of all available resources to attain your goal.

STOP THE PAIN with

Acne Psoriasis Eczema & other skin issues

Rosacea

Exclusively focused on your skin.

Chinese Medicine Dermatology

778.886.1180 • www.drerikson.com

New Beauty Institute Get back the neck you knew!

Ultherapy is an innovative, non-surgical way to help reinvigorate skin that is starting to feel less firm, saggy, or too relaxed. This treatment stimulates the growth of new collagen which reduces the rate of your skin’s aging.

Laser Therapy

The Ultherapy results build over the course of two to three months; it is a great way to achieve gradual,natural-looking results.

a non-invasive lift “Ultherapy, that tightens loose skin on the face and neck ”

CONDITIONS THAT RESPOND WELL TO LOW INTENSITY LASER THERAPY* • Osteoarthritis • Rheumatoid Arthritis • Hip Pain • Rotator Cuff Injuries • Bursitis • Osteoporosis Pain • Tennis/Golfer’s Elbow • Neck/Back Pain • Tendonitis • Plantar Fasciitis

Before treatment

After one treatment

For both women and men!

Before treatment

*The effectiveness of Laser Therapy varies from patient to patient

Chiropractic Corp.

Pain and Soft Tissue Rehabilitation Today’s Alternative to Medication and Surgery

Suite 204 - 15230 #10 Hwy., Surrey Tel: (604) 575-1331 www.laserhealthsolutions.com May be covered by employee health care insurance benefits.

After one treatment

If you find that your skin is feeling less firm these days and you want to find a safe and effective way to improve its appearance, please make an appointment to come in and find out more about Ultherapy. All is possible with just one treatment.

112-1656 Martin Drive, White Rock 604.541.8750 www.new-beauty.ca Evenings & Weekend Appointments Available


24 www.peacearchnews.com

Thursday, January 16, 2014 Peace Arch News

Looking to learn something new? Register now!

New Year’s Resolution?

GET FIT! FIRST MONTH

FOR AGES 5 & UP!

ONLY $30

INCLUDES FREE UNIFORM

Unit 105 - 1461 Johnston Rd., White Rock (behind the Whale Wall)

604-541-1345

www.tongmoodo.com whiterock@tongmoodo.com Follow us at www.tongmoodo.com/blog

Open House SATURDAY, JANUARY 18th 18th 1:00-4:00 pm Q

Q REFRESHMENTS DOOR PRIZES Q DRAWS

Tour our facility! OUR SERVICES:

Acupuncture, Japanese Facial Japanese Body Massage

Make an appointment on the 18th and receive a 50% DISCOUNT on a Japanese Massage or Facial

Kenkoudou Health Centre

UNIT 2 ͳ 2119 ͳ 152ND STREET, SURREY • 604.259.3368

Over the course of winter… It’s time to register for winter activities; whether it is a class in dancing, swimming, painting, history or languages; taken at the neighbourhood community center, the local high school, college, or university; as a recreational activity for adults or an extracurricular activity for children. All reasons are good to sign up for a course this January. These activities are an important part of our daily lives. Taking a course allows us to perfect ourselves, to acquire new knowledge, and to create meaningful bonds. Taking a course in skating, ballet, guitar, or some other activity, often provides elementary and secondary grade students an opportunity to blossom and to shine. After experiencing some success in an area other than academics, students are better prepared to overcome some of their scholastic difficulties. Since we are spending less time outdoors, January is a good time for adults to act on their intentions to master computers, accounting, administration, etc. Do you plan on visiting a foreign country next summer? Italy, France, Spain? Taking a language class now will make your trip much easier and much more enjoyable. Do you want to get in shape for summer? You have a multitude of courses to choose from: pilates, yoga, aqua fitness, belly dancing and many more. Over the course of winter… we take courses! Let’s take advantage of this time to update our skills or acquire new ones. It’s the perfect time to make new friends and discover new talents!

Michael Gottner, MD Ophthalmologist

Two locations to better serve you! WHITE ROCK 15157 Roper Avenue LANGLEY #105-20644 Eastleigh Cresc.

Appointments by referral PHONE

604.530.2323 FAX

604.534.0399

Treating patients with Glaucoma, Diabetic Retinopathy, Macular Degeneration and other eye diseases.


Peace Arch News Thursday, January 16, 2014

www.peacearchnews.com 25

Stay Healthy this Flu Season Health officials urge all ages to get flu shot

health Q healing Q well-being Q balance Experience the beneƤts of Acupuncture

It’s the time of year that many on the Semiahmoo Peninsula are taking a good look at their health and wellness. Unfortunately for many, it’s also time for fighting off nasty cold and flu viruses. According to provincial health officials, this year’s flu strain is especially severe, with dozens of patients requiring hospitalization as a result of the illness. Unusual this flu season, however, is the fact that the strain seems to be targeting otherwise healthy people in their 20s, 30s and 40s. Most years, doctors note that elderly and very young patients are most at risk for complications; this year seems to be a different story. “We’re surprised at how many (patients) have come in such a short period of time with such severe diseases,” Dr. Paul Van Buynder, chief medical officer of Fraser Health told Black Press. Health officials are recommending people get a flu vaccine in light of the the viruses surge in the past few weeks. The vaccine is of particular importance to pregnant women, according to a study released earlier this monthly Dalhousie University in Halifax. According to the study – which followed more than 12,000 expectant mothers in the two years following the 2009 H1N1 outbreak – women who are vaccinated against the flu are less likely to deliver premature or low-birth-weight babies. Despite reports of a shortage across the province, the vaccination is still widely available at pharmacies, health clinics and doctors offices. To find a flu clinic near you, visit www.immunizebc.ca or call HealthLink BC at 811. “We are urging those who have not already had their flu shot to get one. It is not too late,” Van Buynder said.

Treatments for: • Acne, Rosacea, Eczema, Psoriasis • Allergies, Cough, Sinus Problems, Asthma, Bronchitis • Cosmetic Acupuncture (Facial Rejuvenation) • Digestive/Urinary Problems (including IBS and Impotence)

• Weight Loss, Smoking and Other Addictions

ACUPUNCTURE & NATURAL HEALING

Reg Price $ 159900

15231 16th Avenue White Rock 604-541-7550 L O C A L LY

ENJOY WALKING AGAIN! Don’t sacrifice your daily walks any longer…

Choose one of the solid, lightweight and > Transforms fat to muscle stable walkers from > Increases blood circulation, Save On Scooters. lowers blood pressure Offering maximum > Reduces cellulite and inflammation mobility, exercise through daily walks > Increases oxygenation, promoting healthy tissue regeneration can be acheived > Strengthens joints, with amazing results. reduces swelling Stay active & independent! NO TAX > Relieves chronic pain FREE LOCAL DELIVERY

AVAILABLE AT:

Save On Scooters

O W N E D

FENG LI M.D. (China) B.C. Registered Acupuncturist & Herbal Practicioner

1481 Johnston Rd., White Rock 604-538-9367

> Increases muscle mass and bone density by stimulating cellular movement

99900

• Stroke Recovery

Feng Li

include:

$

• Pain/Soft Tissue Injuries • Stress, Anxiety, Depression, Chronic Fatigue, Insomnia

BENEFITS:

OUR PRICE

• Infertility, Menstrual Problems and Pre-Menopausal Symptoms

Nurture your body’s natural ability to heal itself and thrive through the power of herbal medicine and complementary therapies

AND MEDICAL EQUIPMENT

&

O P E R A T E D

N E W

&

U S E D

Hours: Mon.–Fri. 9–5 p.m. Saturday 10–4 p.m. www.saveonscooters.ca S A L E S

&

R E N T A L S


26 www.peacearchnews.com

Thursday, January 16, 2014 Peace Arch News

White Rock South Surrey BASEBALL ASSOCIATION

2014 Registration South Surrey/White Rock Minor Softball

Be a Player! Girls & Boys ages 5 and up NEW PLAYERS WELCOME

Register in person at

WALMART Grandview Corners, 2355 160th Street, Surrey

Saturday, January 18th & Sunday, January 19th 9am to 5 pm

Register ONLINE www.sswrmsa.com

Be a Umpire!

REGISTRATION TRAINING FACILITY 14600 20th Avenue Saturday, Jan. 25, 2014 11 am - 2 pm • Late fee of $25 after Jan.31, 2014 • Cancellation fee of $25 after March 15 • $25 NSF Cheque Charge

• PHOTOCOPY OF BIRTH CERTIFICATE required for new players 2014 WRSSBA Fee Schedule 5 yr old................................ $70 6-7 yr old .......................... $130 8 yr old.............................. $150 9-10 .................................. $170 11-12 Minor...................... $180

Earn Cash $$$, make friends. Best seat for every game, school credits, clinics available, (ages 12 and up - Adults Welcome! Encouraged!), Sign up at the above location or call 604-536-5532

atypical townhome.

ONLINE REGISTRATION available at

www.wrssba.com

64 AVE

Eton Sales Centre #3 – 14888 62nd Ave, Panorama, Surrey

62 AVE

60 AVE

152 ST

148 ST

Move-in today!

146 ST

604.953.0833 { info@etonliving.com } etonliving.com

Programs available to players 5-18 years of age

144 ST

Nestled within a lush 3.3 acre greenspace 2 & 3 Bedroom townhomes from $334,900 Panorama neighbourhood

11-12 Major...................... $180 PeeWee (13U) .................. $190 Bantam (15U).................... $210 Midget (18U) .................... $230 Challenger Division .......... Free

HW Y 10

FAIRBORNE.COM Eton is developed by Fairborne Panorama Homes Ltd. Pricing is subject to change without notice. E.&O.E.


sports

Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 27 27 www.peacearchnews.com

…on the Semiahmoo Peninsula

Bayside players selected for international Sevens tourney

RCMP finals set for Saturday

Sharks set for Vegas

Three advance Nick Greenizan Sports Reporter

Nick Greenizan Sports Reporter

A handful of South Surrey rugby players will be among 36 from across the province heading to Las Vegas for the USA Sevens High School Invitational later this month. The prestigious event – the first of the year for the provincial program – is set to hit the pitch in Sin City on Jan. 23. Team BC will enter multiple teams into the tournament – two under-18 sides in the Elite division, plus an under-17 team in the Open category. The provincial U18 team’s roster includes a handful of Bayside Rugby Club members, including Joseph Carter – who attends Lord Tweedsmuir Secondary – Nick Collett (Southridge), Nico Docolas (Elgin Park), Matt Gallagher (Semiahmoo), Cali Martinez Cali Martinez (Earl Marriott) and Andrew Team BC O’Connor (Elgin Park). Of that group, Martinez, Collett and Docolas are returnees, having advanced to the finals of the 2013 tournament. At the U17 level, the Team BC roster will include one local – Keenan Houde (Earl Marriott), while Team BC’s U18 girls team will also include one local name – Clayton Heights Secondary’s Chantal McLean. “Chantal has shown a work ethic that drives the players around her,” said U18 women’s coach Brad Skene in a news release. Though the U18 boys advance to the finals last year – and were undefeated at the 2012 tournament – B.C. head coach Shane Thompson knows winning it all this year will be a challenge, considering their competition includes top provincial teams from across Canada, as well as state champions from across the United States. “We certainly have our work cut out for us,” he said. “Teams in the tournament are more organized and are getting better every year. We can’t think about what we’ve achieved in the past. (We) have lots of work to do if we hope to make it to the final again.”

Jump ball

Boaz Joseph photo

Earl Marriot Mariners Simon Chen (left) sweeps past Justin Chang of the Fraser Heights Firehawks on the opening day of the 23rd-annual Surrey RCMP Classic high school boys basketball tournament at Lord Tweedsmuir Secondary Sunday.

The Surrey RCMP Basketball Classic is off to a good start for a trio of south-end senior boys basketball teams. On Tuesday afternoon, the Southridge Storm, Tamanawis Wildcats and Lord Tweedsmuir Panthers all won their firstround contests, advancing to the second round of play Wednesday. The Storm advanced to the second round of the 23-team tournament after a 68-52 win over the Johnston Heights Eagles Tuesday at Fleetwood Park Secondary, while the Tweedsmuir Panthers punched their ticket to the next round of the bracket after narrowly defeating the Pacific Academy Breakers, 71-68. Meanwhile, at Tamanawis, the Wildcats – who were the runners up at last year’s tournament and among the favourites to win it all this year – defeated Princess Margaret handily, 97-44. At the other end of the spectrum, Semiahmoo lost its opening-round tilt 68-50 to Kwantlen Park. During the qualifying round Sunday, two other south-end teams were bounced to the B pool after losses. Clayton Heights lost 73-53 to L.A. Matheson, while Elgin Park was felled 66-58 by Princess Margaret. Wednesday’s games were all played after Peace Arch News’ press deadline. The semifinals are set for Friday night at 5:45 and 7:45 p.m. at Enver Creek Secondary, with the championship game Saturday at 7:45 p.m. A 20-team junior boys bracket is also currently underway. Junior semifinals are set for Friday, with the final at noon Saturday at Enver Creek.

FRIDAY, JAN. 17, 7 PM START F VS. TRAIL SMOKE EATERS SUNDAY, JAN. 19, 4 PM START S VS. LANGLEY RIVERMEN

Join the Eagles on the ice after the Sunday game!

2012/2013 Western Canadian Champions

TICKETS AVAILABLE ONLINE NOW.

South Surrey Arena 2199 - 148 St. Surrey

HEAD TO SURREYEAGLES.CA FOR MORE INFORMATON

2012/2013 BCHL Champions

YOUR CITY, YOUR T TEAM, EAGLES HOCKEY

604.531.GOAL (4625)


28 www.peacearchnews.com

Thursday, January 16, 2014 Peace Arch News

CO SO M I N ON G

East Coast Style. West Coast Living. Boston’s Ivy League style has arrived in the desirable South Surrey / White Rock neighbourhood. Inspired by the iconic brownstones of North America’s most respected academic institutions, Polygon introduces Kingston House, the premier apartment collection at Harvard Gardens.

Two Bedrooms Priced From $ 259,900. Register Now! Call: 604.541.8092 Email: kingstonhouse@polyhomes.com This is currently not an offering for sale. Any such offering may only be made with a disclosure statement. E.& O.E.

POLYGON KINGSTON HOUSE LTD. POLYGON HARVARD GARDENS LTD.


Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 29 29 www.peacearchnews.com

sports

Valley West drops both games of weekend doubleheader

Losses cut into Hawks’ lead Rick Kupchuk Black Press

What was once a six-point deficit for teams chasing the Valley West Hawks for third place has been cut in half. The Hawks dropped both ends of a BC Hockey Major Midget League doubleheader with the Vancouver Canadians last weekend, and now have just a three-point lead on the Vancouver Chiefs in the standings, with the Canadians just four points back. Valley West had won 17 of 26 games prior to the holiday break, but resumed league play with a

2-1 loss in Richmond Saturday and an 8-2 setback Sunday at the Langley Events Centre. The weekend started well for the Hawks, who took a 1-0 lead into the third period of Saturday’s game, only to give up a pair of goals in the final 15 minutes. Jesse Lansdell netted the Valley West goal with Justin Wilde earning an assist. The Canadians twice scored two goals in less than a minute in the opening period of Sunday’s contest, and led by three goals after 20 minutes. Goals 52 seconds apart lifted them to a 2-0 lead before Lansdell got

ROTARIANS

one back for Valley West, on an assist by Matt Bradley of Surrey. Another pair of Canadians tallies 57 seconds apart upped the count to 4-1. They led 8-1 before the Hawks netted their second goal, scored by Bradley. The Hawks will play twice again next week, hosting the lastplace Kootenay Ice at the Langley Events Centre. Also this week, Bradley was named the BCMML’s player of the month for December. Bradley tallied 11 goals and eight assists in seven games, moving into second place in league scoring

MAKE A

TIRED OF WORKING FOR SOMEONE ELSE & HAVING LIMITED INCOME?

DIFFERENCE

JANUARY 25, 2014 10AM – NOON

PARKS, RECREATION, AND CULTURE CAREERS

The City of Surrey is a place of innovative transformation and accelerated growth—where the future is limitless and possibilities are endless. If you are excited about helping to build the city of tomorrow— and you share our values of integrity, service, teamwork, innovation and community—join us, today.

Parks, Recreation & Culture - Summer 2014 The City of Surrey Parks Recreation and Culture department has started its summer hiring! Our Parks, Recreation & Culture department has a wide variety of summer positions available to assist in providing high quality facilities, programs, and services that benemt Surrey residents.

Successful candidates will help support programs and services in the areas of:

• Community Recreation • Healthy Communities • Park Play • Surrey Archives

• Early Childhood Education • Heritage Services • Park Planning & Design • Park Labourers

Join Us For – The Real World of Real Estate

101 15385 #10 Highway, Surrey Seating is limited – please call or email to reserve your space!

SIGN UP WITH A HOMELIFE OFFICE & RECEIVE… Twelve weeks of Peak Producer Training from certified mentors! Real World Tips helping you generate leads and close more transactions!

Homelife Benchmark Realty

You, as a qualimed candidate, are enthusiastic, versatile and up to the challenge of working with a dynamic team to serve our growing city. You also share the City’s values of community, innovation, integrity, service, and teamwork. Check out each posting at www.surrey.ca/careers for more specimc qualimcations and application deadlines. If you’re interested in an opportunity to make a difference in your community and gain valuable skills, please apply online at www.surrey.ca/careers.

The City of Surrey wishes to thank all applicants for their interest and advises that only those to be interviewed will be contacted.

White Rock, Langley, Walnut Grove & Cloverdale and Surrey

Why not become a member? www.semiahmoorotary.org

RSVP: Natalie (604) 764-0161 email: ngauvreau@homelifebc.com

TRAINING CENTRE: 101 15385 #10 Highway, Surrey

*CONDITIONS MAY APPLY. SEE DEALER FOR DETAILS.

2013 CTS 3.6L AWD ‘PERFORMANCE’ PACKAGE

Silver Coast Metallic/Jet Black, Executive Demo 9879 km’s, Sunroof, 18” Polished Alloys, Navigation, Bose Sound, Heated/Leather seating, Driver Awareness Package, CUE, Remote Start Stk# 3009110. 1 ONLY

MSRP $52,465

SALE PRICE $41,900

$10,565

PLUS TAXES & FEES.

CASH INCENTIVES

Black Raven/Ebony, Executive Demo 9924 kms Remote Start, 19” Alloys, Bluetooth, XM Radio, Heated/Leather Seating, Sunroof, Navigation. Stk# 3001910. 1 ONLY

MSRP $63,240

SALE PRICE

44,980

$

PLUS TAXES & FEES.

$18,260 CASH INCENTIVES

2013 XTS AWD ‘PREMIUM’ COLLECTION Sapphire Blue Metallic/Jet Black, Executive Demo 11285 km’s, Sunroof, Heated/Leather Seating, Heated Steering Wheel, Driver Assist Package. Stk# 3005410. 1 ONLY

MSRP $65,205

SALE PRICE

52,900

$

PLUS TAXES & FEES.

ON LOCATION

$12,305 CASH INCENTIVES

Hwy

1

#10 Highway

FINGERPRINT STATION

X

200th Street and #10 Hwy, Langley 604.534.4154 prestongm.com SALES HOURS Mon to Thurs: 8:30am - 9pm • Fri & Sat: 9am - 6pm • Sun & Holidays 11am - 5pm •

DL30568

200 St.

2013 ATS 2.L TURBO ‘PREMIUM’ PACKAGE


30 www.peacearchnews.com 30 www.peacearchnews.com

Thursday, January 16, 2014 Peace Peace Arch Arch News News

sports

KITCHENS & BATH

RENOVATIONS Complete Carpentry, Electrical, Plumbing, Tiling, Custom Shower Ensuites.

Call Peter or Brian.

Professional Real Estate Services 2013 Emerald Master

34 Years in Business

WALTON KITCHENS

604-535-4122

BE A BASEBALL UMPIRE!

Check, please Central City Breakers Piranhas’ Jd Collison (in white) goes down to block a kick from Andrea Kish of Coastal FC United during a women’s soccer game at Newton Athletic Park on Jan. 12. Boaz Joseph photo

Morgan CreekDental CALL TODAY FOR AN APPOINTMENT!

604-536-4222

Clinic New Patients Welcome

Providing quality dental care in a fun and friendly atmosphere! Now offering Invisalign & Botox AERIAL TRANSIT SYSTEMS FOR THE GVRD - WHY NOT? OTTOBE.COM

Dr. Tao Zeng

#209 - 15252 32nd Ave. South Surrey

Member Buying or Selling? Medallion F.V.R.E.B. Call me at... Bay Realty Ltd. • 604-531-4000

WOULD YOU LIKE TO: • develop the ability to assume responsibility • develop the ability to be objective, fair and decisive in your judgement • develop an awareness of your own talents • develop a greater sense of self-confidence • develop the skills to deal effectively with others in the work or play environment • develop a greater appreciation for the rules of the game of baseball

Umpire Registration Fees: Level 1 • $25 for ages 13 and under (of current membership year)

Level 2 • $50

WE WILL:

for ages 14 and up

• train you to do the job • provide equipment • pay you once you have passed the course • provide you with BCBUA 2-man system manual

Uniform Deposit • $25 (separate cheque made out for July 1st, 2014)

Make cheques payable to “WRSSBA”, dated Jan. 25th

Jeff Mager mager@telus.net

FEMALE UMPIRES WELCOME REGISTRATION FOR UMPIRES: SATURDAY JANUARY 25th 2014 11 - 2 p.m. (Parents must accompany youths under 14 yrs.)

WRSSBA Training Centre 14600 20th Ave. The training course is sponsored by the White Rock/South Surrey Baseball Assoc. and is a mandatory requirement for a position as umpire within the league.

SURREY’S FASTEST SELLING TOWNHOME COMMUNITY

TO MOVE IN HERE, YOU’LL HAVE TO MOVE FAST. Fleetwood Neighbourhood 3 & 4 Bedroom Townhomes 1325 – 1780 sq.ft. Priced from only $339,900

604.953.0288 · SILVERWOODLIVING.COM

88 AVE

MOVE-IN TODAY! SILVERWOOD SALES CENTRE #15— 8355 164th Street Open 12-5pm daily (except Fridays)

84 AVE

164 ST

• • • •

84 AVE

FR

AS

ER

HW

Y

80 AVE

FAIRBORNE.COM Silverwood is developed by Fairborne Fleetwood Homes Ltd. Pricing is subject to change without notice. E.&O.E.


Peace Arch News Thursday, January 16, 2014

www.peacearchnews.com 31

! e r t a e h t e h t t a u o y See Y S I A D S S I M IVING

TRE N E C S T R A Y E R SUR

Opening Week!

DR

S H IP LI K E LY F R IE N D N U N A F O Y D A COME ures of a g and moving advent in m ar ch e th s w llo inning play fo d reveals the This Pulitzer Prize-w 25-year friendship, an r ei th er ov ur ffe au and her ch new possibilities. Southern matriarch es and open itself to ic ud ej pr e m co er ov heart to power of the human

oncerts

s. sts and perform Sarah Hagen ho . am :30 10 at ert nc Acclaimed pianist and a 75 minute co m, 0a 9:3 m n, fro se nts las Refreshme byn Driedger-K bruary is soprano Ro Joining Sarah in Fe rrillo. Ca o Ot r ye nch horn pla and in March it’s Fre 5 13 | each concert $2 February 13; March

Ken Lavigne

Rae Spoon (L) and

Classical Coffee C

Gender Failure

e sician and author Ra Ivan Coyote, and mu , nts me ele eo vid Writer and storyteller d rd, animated an wo en ok sp al ay ine rtr mb po Spoon co artbreaking this hilarious and he and original music in o do not conform to wh us of se like for tho of what the world is gender binary fails ultimately, how the d an , es typ reo ste gender d for ages 15 and up us all. Recommende m | $30 and $35 February 7 and 8 | 8p

to Carnegie Hall ad Ro e Th e: gn vi La n Ke d joined d modern style, an

or sound an journey of pure With his classical ten n will take you on a Ke , nd ba e iec r-p by a fou ch as Danny Boy, O ing beloved songs su nd s ble t, en nm tai ter en and hilarious storie lujah with charming . ps Po rk Yo w Sole Mio, and Halle Ne aign to sing with the of his personal camp $29 - $35 February 15 | 8pm |

Arts From the Firehall

Centre production

of

per to by David Coo Chelsea Hotel. Pho

Sarah Hagen

Ivan Coyote

By Alred Uhry mpany | On Tour Arts Club Theatre Co m & 4pm | $29 - $43 January 16 to 25 | 8p

ngs of Leonard Cohen So e Th : el ot H a se el Ch y , six performers pla

new arrangements to the remarkable With extraordinary this concert, a tribute in nts me tru ins en sevente tel – a place full of w York’s infamous ho Ne o int k ec Ch r. ite wr ion. ent, desire and pass music and enchantm r ted by Tracey Powe Conceived and Direc Steve Charles by n Musical Directio n of the Company presentatio An Arts Club Theatre production Firehall Arts Centre $43 1 | 8pm & 4pm | $29 February 20 to March

e Laff! I Am Woman! Hear M female stand-up comics will

thering of all This ‘herlarious’ ga men ‘got it’ when it medians, proving wo co all get for r ba the raise , bring the men, and Bring the girlfriends ter gh lau th wi ing comes to big laughs. wl have everyone ho ll wi t tha dy me co a shot of ordinary. t makes women extra as they revel in all tha appropriate for all uations – may not be Adult material and sit audiences. - $35 March 7 | 8pm | $29

ve The Empire! Holmes & Watson Sa show features jaunty,

and funny, this Family-friendly, fast Music Hall tradition iniscent of the great rem sic mu ing pp -ta toe and plenty of laughs. colourful costumes, of the Victorian Era, - $35 March 8 | 8pm | $29

ca ps://tickets.surrey. tt h | 66 55 150 4Tickets 60 Avenue We’re at 13750 - 88 rrey.ca/theatre .su tre season at www View the entire thea ticket r ries and save $5 pe Create Your Own Se

Like us on


32 www.peacearchnews.com 32 www.peacearchnews.com

drivewayBC.ca |

Thursday, January 16, 2014 Peace Peace Arch Arch News News

Welcome to the driver’s seat

This h new Q50 llooks k great, has a wonderful interior, power to spare and solid handling dynamics. Zack Spencer

Visit the Q50 photo gallery at DrivewayBC.ca

2014 Infiniti Q50 challenges the old order Infiniti has had a bit of an identity crisis over the past year with a wholesale change in the way it names its products. Gone is the JX crossover, it’s called the QX60 now and the G 37 sedan has been replaced with the Q50 sedan. Q signifies for cars and QX for crossovers or SUVs. The outgoing G37 was already a very worthy on-road performer but a bit too simplistic in the inside. Now, Infiniti has taken things up a notch with the Q50, adding a dynamic look, sumptuous interior and class leading technology. Looks It could be argued that the current BMW 3 Series and Mercedes C-Class are a bit conservative, while this Q50 and the major competitor, Lexus IS, are much edgier. This is especially true with the front grille. The rest of the Q50 is nicely sculpted, with flowing lines and an almost elegant rear end. Sold as a base model, sport trim, all wheel drive (AWD), premium, and even a hybrid, there is a broad market for this sedan. Starting at $37,500 and ramping up to the AWD sport model at $49,950, there is a substantial discount with the Q50 when you compare it to a similarly equipped BMW. The base model comes with 17-inch wheels but most of the higher trim levels are equipped with 19-inch wheels. The car seen here is the AWD premium model starting at $43,400. Inside The Q50 centre console is very attractive with two screens placed for radio functions and the second for the

navigation ($1,400 option) opt for the AWD model, and backup camera. The which is a good choice way the lower screen is due to the higher level incorporated is first rate; of interior amenities. it looks like a high quality In addition, the Q50 is iPad that sits flush with the first car to have a the dash, while the higher steer-by-wire system screen is recessed for easier that is customizable and use in bright light. this system is optional Direct Adaptive The only problem with on the AWD models and Steering has its this system is the time it standard on the sport takes to boot-up when critics but for me, the versions of the Q50. you start the car over 30 Direct Adaptive Steering Q50 feels like it is seconds to access the radio has its critics but for an extension of the and other features. Most me, the Q50 feels like driver. people will buy the sport it is an extension of the model ($47,495) or the driver, moving through Zack Spencer premium trim ($43,400) to corners with ease and get heated leather seats, comfort with just the Bose stereo, backup camera with slightest movement of the steering around view cameras, and power tilt wheel. Handling is enhanced thanks to and telescopic steering to name a few a stiffer chassis and the rear suspenadditional features. The base model is sion has been adjusted. a price leader but expect to buy the The downside to equipping the Q50 premium model or above to get the with a V6 is the amount of fuel it car well equipped. In comparison, the burns in comparison to the turbo $53,800, 300hp BMW 335iS AWD is 4-cylinder offerings from the German much more expensive than many of the competition. Rated at 11.1L/100km in top Q50 trim levels. the city and 7.3L on the highway for the AWD equipped model. There is a Drive hybrid version available that drops the The latest trend is to include a turboconsumption down to 7.0L/100km in charged 4-cylinder engine as the base the city and 5.0L on the highway but power plant in most German compact it is a premium offering with a starting luxury sedans. This Q50 is bucking the price of $47,000. trend and sticking with the 3.7L V6

‘‘

’’

they had in the previous G37 with a powerful and smooth 328hp. The transmission is a 7-speed automatic that puts the power to either the rear wheels, or all wheels, depending on the trim selected. Most Canadians will

Verdict The benchmark in the premium compact sedan market has been the BMW 3 Series but the gap is narrowing. This new Q50 looks great, has a wonderful interior, power to spare and solid

Question

handling dynamics. On price, the BMW 328i AWD is the closest and starts at $46,200 but is equipped with a 241hp 4-cylinder. The direct competitor on power is the much more expensive 335is AWD. The Lexus IS350 AWD is another premium offering from Japan, and it starts at a very competitive $44,000. As much as the Japanese automakers like to challenge the German makers, they really end up competing with each other. Yes, this is a worthy car but the one thing you cannot factor into the buying decision is the badge appeal that storied brands like Mercedes, BMW and Audi provide.

OF THE WEEK:

What is your favourite brand of car and what model specifically do you like? Please explain why you have made that decision.

?

QUESTION OF THE WEEK!

Go to drivewayBC.ca to submit your answer.

Safety Tip: When extreme winter road conditions hit, it’s a good idea to think about whether you even need to get behind the wheel. If you have the option, consider public transit or carpool with some who has a vehicle prepared for the conditions. Also consider leaving for work just a little later to allow crews to clear the roads.

Find more online at The Lowdown Power: 3.7L V6 with 328hp Fill-up: 11.1L/7.3L/100km (city/highway) Sticker price: $37,500-$47,950

drivewayBC.ca

zack.spencer@drivewaybc.ca

CIVIC IS THE BEST-SELLING CAR IN CANADA AN NA A A ADA See ee ou ourr FOR 16 YEARS IN A ROW. ad on And the best just got better. bchonda.com

page p age 37 7 2466 King George Blvd. Surrey 604-536-2111 www.whiterockhonda.com


Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 33 33 www.peacearchnews.com

drivewayBC.ca

Five fun coupes on the market that are perfect for singles

$

The 2014 VERSA NOTE

The 2014 SENTRA

• BETTER COMBINED FUEL EFFICIENCY THAN YARIS AND FIT* • BEST-IN-CLASS TOTAL INTERIOR VOLUME†

• BETTER COMBINED FUEL EFFICIENCY THAN CIVIC AND ELANTRA* • HEADLIGHT LED ACCENTS AND LED TAILLIGHTS

LEASE FROM

69 0.9% $ 0 AT

SEMI-MONTHLY

PER MONTH

APR

FOR

LEASE FROM

79 0% $ 0

$

39 MONTHS

AT

SEMI-MONTHLY

FREIGHT AND PDE INCLUDED

PER MONTH

APR

FOR

39 MONTHS

FREIGHT AND PDE INCLUDED

DOWN

DOWN

INTRODUCING

The Totally Redesigned 2014 NISSAN ROGUE • BETTER FUEL ECONOMY (HWY) THAN ESCAPE AND CR-V* • AVAILABLE INTUITIVE ALL WHEEL DRIVE • AVAILABLE 3RD ROW SEATING • DIVIDE-N-HIDE CARGO SYSTEM® • LED DAYTIME RUNNING LIGHTS SL AWD Premium model shownV

LEASE FROM

138 3.9%

$

AT

PER MONTH

SEMI-MONTHLY

APR

FOR

60 MONTHS

1,850 DOWN • FREIGHT AND PDE INCLUDED

$

OFFERS END JANUARY 31

ST

FIND YOURS AT CHOOSENISSAN.CA OR YOUR LOCAL RETAILER JONKER NISSAN 19505 Langley By-Pass Surrey, BC Tel: (604) 534-7957

KING GEORGE NISSAN 14948 32nd Avenue Diversion Surrey, BC Tel: (604) 536-3644

PAN PACIFIC NISSAN SURREY 15257 Fraser Hwy Surrey, BC Tel: (604) 589-8999

stackable trading dollars. Retailers are free to set individual prices. Offers valid between Jan. 3 – 31, 2014. †Global Automakers of Canada Entry Level Segmentation. MY14 Versa Note v. MY13/14 competitors. *All information compiled from third-party sources including manufacturer websites. Not responsible for errors

SL model shownV 1.6 SL Tech model shownV

for errors in data on third party websites. 12/17/2013. Offers subject to change, continuation or cancellation without notice. Offers have no cash alternative value. See your participating Nissan retailer for complete details. ©1998-2013 Nissan Canada Inc. and Nissan Financial Services Inc. a division of Nissan Canada Inc.

TM

2014 SUBCOMPACT CAR OF THE YEAR

applicable are included. License, registration, air-conditioning levy ($100) where applicable, insurance and applicable taxes are extra. Finance and lease offers are available on approved credit through Nissan Finance for a limited time, may change without notice and cannot be combined with any other offers except

WITH OUR ALL-NEW LINEUP:

available only on 2014 Versa Note 1.6 S (B5RG54 AA00), manual transmission/Sentra 1.8 S (C4LG54 AA00), manual transmission. This offer is only available on lease offers of an 39 month term only and cannot be combined with any other offer. Conditions apply. V Models shown $20,585/$24,765/$34,728 Selling

MY NISSAN

Price for a new 2014 Versa Note 1.6 S SL Tech (B5TG14 NA00), Xtronic CVT® transmission/Sentra 1.8 SL (C4TG14 AA00), CVT/Rogue SL AWD Premium model (Y6DG14 BK00), CVT transmission. ≠V Freight and PDE charges ($1,567/$1,567/$1,630), certain fees, manufacturer’s rebate and dealer participation where

and the seventh generation is coming soon. So if you want a killer deal on a 2013, now’s about as good of a time as any. alexandra.straub @drivewaybc.ca $5,380/$6,156/$18,289. $1,250/$950 NF Lease Cash included in advertised price, applicable only on 2014 Versa Note 1.6 S (B5RG54 AA00), manual transmission/Sentra 1.8 S (C4LG54 AA00), manual transmission through subvented lease through Nissan Finance. $200/$400 dealer participation included and

a tried and tested engine. What’s great about the GTI is that it works for all ages. You could be 16 and driving it, or 60, and you’d still look good. Granted, the current generation is on its way out

$29,375 The 3-door VW GTI is one of my favourite cars. The frontwheel, German engineered bundle of excitement has poise and pizzazz, along with a fabulous interior and

have many great standard amenities that come with the base model like 16-inch alloy wheels, fog lights, heated front seats, air conditioning and more. VW GTI: Base MSRP

Representative semi-monthly lease offer based on new 2014 Versa Note 1.6 S (B5RG54 AA00), manual transmission/2014 Sentra 1.8 S (C4LG54 AA00), manual transmission/2014 Rogue S FWD (Y6RG14 AA00), CVT transmission. 0.9%/0%/3.9% lease APR for a 39/39/60 month term equals 78/78/120 semi-monthly

MSRP $20,550 For just over $20K, the Kia Forte Koup is a solid value. And it’s not a bad looking car either. Inside, the interior is well finished and isn’t cheap. Furthermore, you

payments of $69/$79/$138 with $0/$0/$1,850 down payment, and $0 security deposit. First semi-monthly payment, down payment and $0 security deposit are due at lease inception. Prices include freight and fees. Lease based on a maximum of 20,000 km/year with excess charged at $0.10/km. Total lease obligation is

of the SRT’s 6.4L V8 HEMI to turn heads. Inside and out, this two-door has style and power. The base SXT trim comes equipped with a 3.6L V6 and 305 horsepower. Kia Forte Koup: Base

By Alexandra Straub So, you’re not married. That’s okay! You don’t have kids? No worries. You pretty much have the pick of the litter when it comes to buying a car. Why? Because you don’t necessarily have specific requirements that need to be met when selecting a vehicle. Meaning, you don’t need to consider having a large enough backseat to fit car seats, unless you want a big back seat for other reasons. Like, you have a dog that weighs as much as an adult. Unless your profession requires you to haul around equipment or gear, you don’t have to buy a crossover, minivan, sedan or SUV if you don’t want to. That said, many singles I know decide to get something a little less “practical” in the grand scheme of things. Less practicality is usually spelled with five letters: coupe. So, to those who are the alpha of their one-person wolf pack, here are a few coupes under $30K: Honda Accord Coupe: Base MSRP $26,400 I’m starting off with the Accord because it’s a cool car. The current generation has so much going for it and definitely has developed more personality in the redesign. You have the option of two engines: a more economical 2.4L 4-cylinder or a more powerful 3.5L V6. Either way, you can get them equipped with a 6-speed manual or a CVT transmission. Only the EX-L Navi trim with the V6 has the option of a 6-speed automatic transmission. No matter how you slice it, you’re getting a great car. Better yet, it has a decent cargo capacity of 379L so you could easily dump your hockey gear inside. MINI Coupe/ Roadster: Base MSRP $25,950/$28,900 With room for two, even the base model of MINI Coupe or Roadster is a hoot. Specs-wise, it has the least impressive engine of the lot (only putting out 121 horsepower,) but that can be overlooked because of via driving dynamics. It has one of the best manual gearboxes for a car of its size and has plenty of pep. They’re not cheap, though. So it has that working against it in some regards. Dodge Challenger: Base MSRP $26,995 If you’re driving a Dodge Challenger, you’re getting noticed. You don’t even need to have the grunt and roar


34 www.peacearchnews.com 34 www.peacearchnews.com

Thursday, January 16, 2014 Peace Peace Arch Arch News News

drivewayBC.ca

Off-road performance with on-road comforts The 2014 Nissan Pathfinder Hybrid is on a quest, to get your family where you need to go on as little fuel as possible.

Looks: One of the biggest changes last year was the switch from body-on-frame to a unibody construction. This reduced the overall weight, which makes a big difference on the fuel economy. The shape and design characteristics of this truck have changed, much smoother lines, and more aerodynamic. I remember the first Pathfinder introduced in 1986 and aimed at capturing some of the Toyota 4runner buyers. It looked promising but never completely took off. I think the focus was more on the off-road when it should have been more on-road with the ability to travel off-road. This version has done this, taking design cues and comfort from the Nissan Rogue and creating a larger crossover capable of transporting seven.

In The Cab: My tester was the Platinum edition. It came equipped with leather seats with 8 way power adjustability, It has the ability to 4 way power for the front drive down a gravel passenger, EZ flex seating system with 2nd row 60/40 road or up to the ski split fold-flat bench seat, hill, but Nissan has and 3rd row 50/50 split made sure it is also as fold flat reclining bench seat. The leather wrapped comfortable as a road steering wheel is heated car and as fuel-efficient and is a nice feature. There as it can be. is plenty of wood tone trim but it is not overdone, Ian Harwood giving it a rich feel. Bose audio system with 13 speakers, AM/FM/CD, SiriusXM, auxiliary audio input jack, USB connection, streaming audio via Bluetooth, steering wheel mounted audio controls and speed sensitive volume control and just some of the comforts you will find in the Pathfinder Platinum. The around view monitor uses four cameras to create a composite image from above and displays it on the touch screen monitor. This helps show the vehicle’s position relative to the lines around the parking space and guides you in easily.

Roadworthy: This vehicle does remind me of the Nissan Rogue. It is larger but feels very similar and that’s a good thing. I think Nissan is heading in the right direction with this vehicle. If studies show limited use off-road, then why spend money making this an off-road vehicle? It has the ability to drive down a gravel road or up to the ski hill but Nissan has made sure it is also as comfortable as a road car and as fuel-efficient as it can be.

Verdict: I think Nissan thought outside of the box on this one and was not afraid to start fresh and create something new. Price as tested $50,893 ian.harwood@drivewaybc.ca

The 2014 Nissan Pathfinder is comfortable, fuel-efficient and powerful.

TAKE ONE FOR A VICTORY LAP

‘‘

2014 AJAC Award Winner for Best New SUV (over $60,000). ALL-NEW 2014

328 1.9% $0

$

BI-WEEKLY PAYMENT

’’

Power: The engine is a 2.5-litre 4 cylinder with a 15kw, power regenerating electric motor, powered by lithium-ion cells and a dual clutch system that transfers power from the electric motor and the engine. This system generates 250 hp. The transmission is Xtronic CVT (continuously variable transmission) The All-mode 4x4 I-system allows select ability between 2WD, Auto, or 4WD lock. An independent front strut and multi-link rear gives the vehicle a comfortable ride.

36-MONTH LEASE

* DOWN

PAYMENT

2014

V6 $

278 2.9% $0 *

BI-WEEKLY PAYMENT

*

*

36-MONTH LEASE

OR

DOWN PAYMENT

2,500

$

CASH PURCHASE INCENTIVE

TH E ACUR A ACCELER ATED S A L E S E V EN T ON N OW AT

ACURA O F LA NGLEY

Safety first: Nissan’s advanced airbag system include, dual stage front airbags, driver and front passenger seat mounted side impact, and roof mounted curtain side impact airbags with rollover sensor. Traction control (TSC) and vehicle dynamic control (VDC) are standard on all models.

*

*

Selling price is $51,985 // $40,685 on a new 2014 Acura MDX (Model YD4H2EJN) // 2014 Acura RDX (Model TB4H3EJN). Selling price includes $1,995 freight and PDI and $0 // $2,500 cash purchase incentive. License, insurance, registration and taxes (including GST/PST) are extra. *Limited time lease offer based on a new 2014 Acura MDX (Model YD4H2EJN) // 2014 Acura RDX (Model TB4H3EJN) available through Acura Financial Services, on approved credit. Representative lease example: 1.9% // 2.9% lease rate for 36 // 36 months. Bi-weekly payment is $328 // $278 (includes $1,995 freight and PDI) with $0 // $0 down payment. 20,000 km allowance/year; charge of $0.15/km for excess kilometres. Total lease obligation is $25,584 // $21,684. Offer includes PPSA ($21.50). License, insurance, registration, options and applicable fees, duties and taxes are extra (includes GST/PST). †$2,500 cash purchase incentive available on all new 2014 Acura RDX models and will be deducted from the negotiated selling price of the vehicle before taxes. Cash purchase incentive cannot be combined with lease, finance or other offers. Some terms/conditions apply. Model shown for illustration purposes only. Offers end January 31, 2014, are subject to change or cancellation without notice and are only valid for BC residents at BC Acura retailers. Retailer may sell/lease for less. Dealer order/trade may be necessary. While quantities last. See Acura of Langley for full details.

AMAZING DEALS ON 2010 ACURA MDX

Pump frequency:

An amazing immaculate 1 owner MDX in showroom condition! The ultimate SUV.

7.8/7.1 L/100 km (city/highway) as tested.

$30,388

LuxuryVEHICLES 2011 BMW 328I X-DRIVE

2012 INFINITI G37X COUPE

Local car with no accidents! Only 32,100 KMS. Full BMW maintenance package & much more!

All wheel drive coupe with sport package. Black on black G37XS. Only 13,101 KMS. No accidents.

$30,288

1P0623

$42,388

1P0687

11666A

Drives-U-Crazy Curb lane crazies

1P0658A

JUST ARRIVED!

2011 MERCEDES-BENZ

$30,988

Call 604-539-2111

19447 Langley By-pass • www.acuraoflangley.ca

$47,388

IP0697

‹ Langley

L a n gl e

y By

pas

s

HAMPTON INN

192 Street

#1 0

Ask us about our Loyalty Program.

Excellent Shape, Navigation, Backup Camera, All Luxury Features, Fully Loaded.

wy

DEALER #30737

$22,388

2013 NISSAN ROGUE SL

AWD, navigation, leather interior. Only 19,000 kms.

er H

1P0615A

GREAT VALUE!

Fras

$19,388

2010 TOYOTA RAV4

One owner, all service records, no accidents! Low, low, low KMS. Just arrived, call now!

Surrey ›

keith.morgan@drivewaybc.ca

2006 HONDA ODYSSEY

The king of minivans! 1 owner, super clean touring package has every available option!

Hwy

Did somebody change the curb lane into the fast lane and not tell me? A day never passes when I don’t see drivers zipping down major drags in the curb lane, cutting in at the last second to avoid piling into a parked car. As soon as they’re past the obstacle they’re back in the gutter lane, spraying every poor pedestrian along the way. What drives-u-crazy?

1P0672


Peace Arch News Thursday, January 16, 2014

www.peacearchnews.com 35

START THIS NEW YEAR OFF IN YOUR NEW RVR!

SPECIAL PRICING ON NOW ONLY AT WOLFE MITSUBISHI! SPECI BISHI! FINANCE FROM

NO PAYMENTS UNTIL SPRING!

3.9% AUTO, HEATED AUTO SEATS, A/C, CD, POWER GROUP, KEYLESS, BLUETOOTH, LOW KMS.

2012 RVR SE 4X4 $18,995 5 CASH OR FINANCE FROM

THE LARGEST SELECTION OF RVRS IN B.C.

16 35 TO CHOOSE FROM

WOLFE MITSUBISHI 604-575-0275

19360 LANGLEY BYPASS SURREY/LANGLEY DL#30306

Lease payment is based on $3,750 down plus taxes & doc fees of $695, over a 48 month term @7.25% interest OAC. Kilometre allowance is 20,000 kms per year.

facebook.com/wolfemitsubishi

SHOP 24 HOURS A DAY! WWW.LANGLEYMITSUBISHI.COM

121913

$199

PER MONTH

LEASE FROM

WOLFE SUBARU OFFERS

NEW YEARS DEAL

2010 SUBARU WRX

2013 SUBARU IMPREZA #S2808

$25,995

2013 SUBARU OUTBACK

#S5501

NEW YEARS DEAL

$24,995

2014 SUBARU FORESTER

s

#S2797

NEW YEARS DEAL

$19,995

NEW YEARS DEAL

· CarProof Vehicle History Reports · 10-day/1,000 km Exchange Privilege (of equal or lesser value) · Subaru C.A.R.E. (CA Roadside Assistance)

$25,995 #1222

2013 SUBARU XV CROSSTREK

NEW YEARS DEAL

$18,995

NEW YEARS DEAL

$23,995

WOLFE SUBARU 19372 LANGLEY BYPASS SURREY/LANGLEY SHOP 24 HOURS A DAY! WWW.LANGLEYSUBARU.COM

604-534-2660

#1111

DLR#30305

200 ST.

➲❑ WOLFE SUBARU

Price does not include tax, license, insurance or doc fee of $395. Vehicles may not be exactly as illustrated. Offers valid while supplies last. Special APR rate of 2.9% is available on certified preowned vehicles only and is for a 24 month term OAC. See dealer for details on no payments for 90 days. Some restrictions apply.

121913

#S2800

· Exclusive selection of pre-owned Subaru vehicles (less than 5 model years old and driven less than 100,000 km) · 152-Point Inspection · Minimum 12 month/20,000 km Subaru Certified Limited Warranty

HW Y.

2013 SUBARU LEGACY CONVENIENCE PACKAGE

ALL SUBARU CERTIFIED PRE-OWNED VEHICLES INCLUDE:

FR AS ER

Peace-of-mind ownership is yours with SUBARU CERTIFIED PRE-OWNED VEHICLES


36 www.peacearchnews.com

Thursday, January 16, 2014 Peace Arch News

WOLFE MITSUBISHI ANNOUNCES NO PAYMENTS TRADE UP TO A MITSUBISHI AND FOR 90 DAYS SAVE UP TO $1,000 WITH THE PURCHASE OF ALL NEW VEHICLES^

0

$

DOWN PAYMENT

0

AVAILABLE % FINANCING ON ALL VEHICLES!

AVAILABLE 2014 OUTLANDER FEATURES: √ FUEL EFFICIENT V6 POWER √ 3,500 LBS TOWING CAPACITY¶¶ √ HEATED FRONT SEATS √ SUPER ALL-WHEEL CONTROL Insurance Institute for Highway Safely

Available on Outlander GT¶

OUTLANDER ES FWD Outlander GT S-AWC Model shown

STARTING AT

2014

Insurance Institute for Highway Safely Excludes Lancer Evolution and Lancer Raillart

Insurance Institute for Highway Safely

STARTING AT

Available on Lancer SE AWC and GT AWC

60

MONTHS

2014

MIRAGE

$19,998

STARTING AT

$12,498

LEASING AVAILABLE ON RVR’S AND OUTLANDERS.... CALL FOR MORE INFORMATION!

WOLFE MITSUBISHI 604-575-0275 19360 LANGLEY BYPASS SURREY/LANGLEY DL#30306

PIRCHASE FINANCING FOR

RVR

$14,998 Available on Lancer SE AWC and GT AWC

0%

2014

LANCER

STARTING AT

$25,998

facebook.com/wolfemitsubishi

SHOP 24 HOURS A DAY! WWW.LANGLEYMITSUBISHI.COM

§ AWC standard on RVR SE AWC and GT available on Lancer SE and GT. S-AWC standard on Outlander GT.¶¶ 3,500 lbs lowing capacity when equipped with trailer brakes. No payments for 90 days is available on select new 2013 & 2014 models financed through Mitsubishi Motor Sales of canada or Scotiabank subvented financing programs on approved credit through participating delars to qualified retail customers until January 31, 2014. Leases are excluded from the no payments for 90 days offer. Offer only applicable to monthly, weekly or bi-weekly payments. On monthly payments, interest charges (if any) will not accrue during the first 60 days after purchaser signs contract for a participating vehicle. After the first 60 days, interest (if any) starts to accrue and the purchaser will repay principal and interest (if any) monthly over the term of the contract. See your dealer for details on bi-weekly and weekly payment options. Some amounts may be due upon signing. See participating retailers or visit mitsubishi-motors.ca for complete details. “$500/$1,000 trade-in rebate available from January 3, 2014 to January 31, 2014 on the purchase of any new Mitsubishi (Lancer, EVO. Sportback. Mirage, i-MIEV, RVR, Outlander) models when you own and trade in a currently licensed car/SUV of any automotive brand in reasonably good condition. Rebate amount will be deducted from the negotiated price after taxes and at time of purchase. Cannot be combined with Suzuki Conquest or Mitsubishi Loyalty Prgrams. Some conditions apply. See dealer for details. *Best backed claim does not cover Lancer Evolution, Lancer Ralliart or i-miEV. ® MITSUBISHI MOTORS, BEST BACKED CARS IN THE WORLD are trade-marks of Mitsubishi Motors North America, Inc. and are used under license. **Whichever comes first. Regular maintenance not included. See dealer or mitsubishi-motors.ca for warranty terms, restrictions and details. Not all customers will qualify.


Peace Arch Arch News News Thursday, January 16, 2014 Peace

www.peacearchnews.com 37 37 www.peacearchnews.com

drivewayBC.ca

Roadhogs cause Secrets of the original Volkswagen Beetle motoring mayhem on Texas autobahn distance between those Austin, Texas: Road hogs two major centres. And are a common sight at dusk thatâ&#x20AC;&#x2122;s especially so, when here on the so-called Texas the posted speed limit on autobahn. the regular toll-free state Iâ&#x20AC;&#x2122;m not talking about those highways was raised to 75 crazy drivers transported by mph (120 four-wheeled km/h) shortly vehicles but after the those of the turnpike was four-legged opened. The variety â&#x20AC;&#x201C; main section boars! is also well And just to the east like the of Austin so two-legged, In terms of scenic there was a lead-footed interest, it is as trek before variety, the cloven-hoofed disappointing as a mild I could wild pigs chilli pepper in a bowl unleash the horses under cause crashes of Tex-Mex. the hood. â&#x20AC;&#x201C; four bad It would smashes on Keith Morgan help to hike the first night the limit that the high another 10 mph (16 km/h): speed State Highway 130 Itâ&#x20AC;&#x2122;s a very well-engineered toll road opened back in road and I canâ&#x20AC;&#x2122;t see that October 2012. causing carnage. At the risk Last week, I wrote about a of attracting the interest drive on the no-speed limit of a Texan posse bent on a autobahn from Munich hanging, I might suggest to Berlin. The piece was that a reduction of the limit prompted by the recent in the same magnitude Insights West/Black Press on the regular highways poll about increasing speed might dramatically increase limits on highways in BC. custom along the way. I just had to try out the The only positive I can say North American equivalent is that I maintained the top of the autobahn with its 85 legal speed for the length of mph limit (approximately the trip, which, as I reported 137 km/h) and here are my last week, was impossible observations. on the congested no-speed After driving a sporty Audi limit autobahn between S6 on the toll highway from Munich and Berlin. Austin on a day trip to San The growing network of Antonio, I think there must toll roads in central Texas have been more boars than may have the highest cars on the route for long speed limits in the nation stretches. It was a lonely but unless they ultimately daytime drive in the S6 stretch to Houston and/or with very few cars passing Corpus Christi on the Gulf in either direction. In terms coast, itâ&#x20AC;&#x2122;s hard to imagine of scenic interest, it is as disappointing as a mild chilli the operators emerging from pepper in a bowl of Tex-Mex. the billion-dollar financial quagmire. Itâ&#x20AC;&#x2122;s not that the tolls are The Department of high on the 65-kilometre Transportation has ended stretch I travelled on the a rebate that had allowed 210-kilometre route â&#x20AC;&#x201C; less trucks to use the road for than $10, under $30 for the same price as cars since commercial trucks. Itâ&#x20AC;&#x2122;s last April. That disincentive is just that the 85 mph limit likely to increase the red ink. is just not fast enough to keith.morgan@drivewaybc. encourage people to use ca it for what is a fairly short

â&#x20AC;&#x2DC;â&#x20AC;&#x2DC;

â&#x20AC;&#x2122;â&#x20AC;&#x2122;

By Rob Sass The original air-cooled VW Beetle lasted an incredible 58 years in production, during which time it was fundamentally unchanged. Although nearly everyone of a certain age has at least one Beetle story or fond memory, there are a few things still not generally known about the beloved car. Here are five noteworthy facts: 1. The original classic Beetle didnâ&#x20AC;&#x2122;t leave production until 2003, although it was last sold in North America in 1979 (by which time the water-cooled Rabbit had replaced it), the original air-cooled Beetle was produced in Puebla, Mexico, until 2003. Itâ&#x20AC;&#x2122;s essentially identical to the cars produced in Germany for export to the U.S. in the 1970s. 2. The original Beetle was the brainchild of Adolf Hitler. Keen to put ordinary Germans on the newly constructed autobahn superhighways in their

1966 Volkswagen Beetle. own cars, a subsidized savings plan involving a coupon booklet was devised. When a family filled their booklet, they were supposed to get their car. WWII intervened and all pre-war Beetle deliveries were limited to Nazi party officials. 3. Germans donâ&#x20AC;&#x2122;t remember it as fondly as we do because of its connection with the dictator who brought ruin to their country. And it serves as a reminder of the lean times before the West

German economic miracle took hold meaning post-war Germans donâ&#x20AC;&#x2122;t have the same feelings about the Beetle that American ex-hippies do. 4. The Beetle may have been inexpensive, but it was never cheap. Gaps were tight and doors sealed well. Additionally, it was a unibody car with a very flat floor with few openings. All of this meant that the car would actually float for at least several minutes after hitting the water before turning into a small sub! 5. The Beetle was the subject of one of the most influential ad campaigns of the 20th century. It was among the first national campaigns to utilize irony and self-deprecating wit. A tiny photo of a Beetle in a sea of white space with the headline â&#x20AC;&#x153;Think Smallâ&#x20AC;? was the first of the ads introduced in 1959 by the agency Doyle Dane Bernbach. Rob Sass is the vice-president of content for Hagerty Insurance. Learn more at hagerty.ca

2013 CIVIC AND FIT MODELS ARE GOING, GOING, ALMOST GONE. GET A 2013 013 CIVIC OR FIT BEFORE THEYâ&#x20AC;&#x2122;RE GONE.

Thanks Canada! anada!

2013 CIVIC

1,500

$

PLUS

500

$

PLUS

CASH PURCHASE INCENTIVE* ON SELECT 2013 MODELS.

BONUS CASH #

Starting from $16,935** includes freight & PDI. Model shown: FB6E5DKV

2013 FIT

2,000

$

CASH PURCHASE INCENTIVE* ON SELECT 2013 MODELS.

PLUS

500

$

BONUS CASH #

Starting from $16,075** includes freight & PDI. Model shown: GE8H7DE

bchonda.com Road hogs are a problem on Texas highways.

2466 King George Blvd. Surrey 604-536-2111 www.whiterockhonda.com Dealer #6911

FDVKSXUFKDVHLQFHQWLYHLVDYDLODEOHRQVHOHFW&LYLF)LWPRGHOV+RQGDFDVKSXUFKDVHLQFHQWLYHFDQQRWEHFRPELQHGZLWKVSHFLDOOHDVHRUĂ&#x20AC;QDQFHRIIHUVERQXVFDVKDYDLODEOHRQDOO&LYLF)LWPRGHOV +RQGDFDVKSXUFKDVHLQFHQWLYHDQGERQXVZLOOEHGHGXFWHGIURPQHJRWLDWHGSULFHDIWHUWD[HV 0653LVLQFOXGLQJ IUHLJKWDQG3',RIEDVHGRQDQHZD&LYLF';PRGHO)%('(;)LW';PRGHO*(*'(;336$OLFHQVHLQVXUDQFHWD[HVDQGRWKHUGHDOHUFKDUJHVDUHH[WUDDQGPD\EHUHTXLUHGDWWKHWLPHRISXUFKDVH 2IIHUVYDOLGIURP-DQXDU\UGWKURXJK-DQXDU\VWDWSDUWLFLSDWLQJ+RQGDUHWDLOHUV'HDOHUPD\VHOOIRUOHVV'HDOHUWUDGHPD\EH QHFHVVDU\RQFHUWDLQYHKLFOHV2IIHUVYDOLGRQO\IRU%ULWLVK&ROXPELDUHVLGHQWVDW%&+RQGD'HDOHUVORFDWLRQV3ULFHVDQGRUSD\PHQWVVKRZQGRQRWLQFOXGHUHSUHVHQWDWLYH336$OLHQUHJLVWUDWLRQDQGOLHQUHJLVWHULQJDJHQW VIHHVZKLFKDUHGXHDWWLPHRIGHOLYHU\2IIHUVVXEMHFWWRFKDQJHRUFDQFHOODWLRQZLWKRXWQRWLFH7HUPVDQGFRQGLWLRQVDSSO\9LVLWZZZEFKRQGDFRP RUVHH\RXU+RQGDUHWDLOHUIRUIXOOGHWDLOV


Wise customers read the fine print: •, *, ‡, «, >, † The First Big Deal Sales Event offers are limited time offers which apply to retail deliveries of selected new and unused models purchased from participating dealers on or after January 7, 2014. Offers subject to change and may be extended without notice. All pricing includes freight ($1,695) and excludes licence, insurance, registration, any dealer administration fees, other dealer charges and other applicable fees and taxes. Dealer order/trade may be necessary. Dealer may sell for less. •$19,998 Purchase Price applies to 2014 Dodge Grand Caravan Canada Value Package (29E) only and includes $7,000 Consumer Cash Discount. $23,888 Purchase Price applies to the 2014 Jeep Cherokee Sport. $19,998 Purchase Price applies to the new 2014 Dodge Journey Canada Value Package (22F+CLE) only and includes $2,000 Consumer Cash Discount. *Consumer Cash Discounts are offered on select new 2014 vehicles and are deducted from the negotiated price before taxes. ‡4.29% purchase financing for up to 96 months available on the new 2014 Dodge Grand Caravan Canada Value Package/2014 Dodge Journey Canada Value Package model to qualified customers on approved credit through Royal Bank of Canada, Scotiabank and TD Auto Finance. Examples: 2014 Dodge Grand Caravan Canada Value Package/2014 Dodge Journey Canada Value Package with a Purchase Price of $19,998/$19,998 (including applicable Consumer Cash Discounts) financed at 4.29% over 96 months with $0 down payment equals 208 bi-weekly payments of $114/$114 with a cost of borrowing of $3,644/$3,644 and a total obligation of $23,642/$23,642. «3.49% purchase financing for up to 96 months available on the new 2014 Jeep Cherokee Sport FWD model to qualified customers on approved credit through Royal Bank of Canada, Scotiabank and TD Auto Finance. See your dealer for complete details. Example: 2014 Jeep Cherokee Sport FWD with a Purchase Price of $23,888 financed at 3.49% over 96 months with $0 down payment equals 208 bi-weekly payments of $132 with a cost of borrowing of $3,506 and a total obligation of $27,394. >3.99% purchase financing for up to 96 months available on the new 2013 Dodge Dart SE (25A) model to qualified customers on approved credit through Royal Bank of Canada, Scotiabank and TD Auto Finance. Example: 2013 Dodge Dart SE (25A) with a Purchase Price of $16,880 financed at 3.99% over 96 months with $0 down payment, equals 416 weekly payments of $47 with a cost of borrowing of $2,844 and a total obligation of $19,724. †0.0% purchase financing for 36 months available on the new 2013 Dodge Dart SE (25A) to qualified customers on approved credit through Royal Bank of Canada, Scotiabank and TD Auto Finance on 2012/2013 Jeep Compass, Patriot and 2013 Dodge Dart models. Example: 2013 Dodge Dart SE (25A) with a Purchase Price of $16,880, with a $0 down payment, financed at 0.0% for 36 months equals 78 bi-weekly payments of $217.69; cost of borrowing of $0 and a total obligation of $16,880. ♦Based on R. L. Polk Canada Inc. sales data. Calendar year to date retail vehicle registrations. ¤Based on 2014 EnerGuide Fuel Consumption Guide ratings published by Natural Resources Canada. Transport Canada test methods used. Your actual fuel consumption will vary based on powertrain, driving habits and other factors. 2014 Dodge Grand Caravan – Hwy: 7.9 L/100 km (36 MPG) and City: 12.2 L/100 km (23 MPG). 2014 Jeep Cherokee Sport - Hwy: 6.4 L/100 km (44 MPG) and City: 9.6 L/100 km (29 MPG). 2014 Dodge Journey SE 2.4 L 4-speed automatic – Hwy: 7.7 L/100 km (37 MPG) and City: 11.2 L/100 km (25 MPG). 2013 Dodge Dart AERO – Hwy: 4.8 L/100 km (59 MPG) and City: 7.3 L/100 km (39 MPG). 2013 Civic Touring 1.8 L 16-valve, SOHC, i-VTEC ® 4-cylinder Automatic – Hwy: 5.0 L/100 km (56 MPG) and City: 6.2 L/100 km (45 MPG). 2013 Elantra L 1.8 L Dual CVVT DOHC 16V Engine Automatic – Hwy: 5.2 L/100 km (54 MPG) and City: 7.2 L/100 km (39 MPG). 2013 Corolla 1.8 L 4-Cylinder DOHC 16V VVT-i DIS ETCS-I Engine Manual – Hwy: 5.6 L/100 km (50 MPG) and City: 7.4 L/100 km (38 MPG). 2013 Focus SE with optional Super Fuel Economy package and 2.0 L I4 Direct Injection engine with 6-speed automatic– Hwy: 4.8 L/100 km (59 MPG) and City: 7.2 L/100 km (39 MPG). ^Based on 2014 Ward’s Middle Cross Utility segmentation. **Based on 2014 Ward’s upper small sedan costing under $25,000. ❖Real Deals. Real Time. Use your mobile device to build and price any model. TMThe SiriusXM logo is a registered trademark of SiriusXM Satellite Radio Inc. ®Jeep is a registered trademark of Chrysler Group LLC.

38 www.peacearchnews.com

DBC_141000_LB_MULTI_DART_FBD.indd 1

Thursday, January 16, 2014 Peace Arch News

T HE ♦

BIG DEAL EVENT

GE 2014 DODGE GRAND CARAVAN CANADA VALUE PACKAGE

$

19,998

$

PURCHASE PRICE INCLUDES $2,000 CONSUMER CASH* AND FREIGHT.

2013 Dodge Dart GT shown. Price: $25,690.

CANADA’S #1-SELLING CROSSOVER^

19,998 FINANCE FOR

FINANCE FOR

$

BI-WEEKLY‡

PURCHASE PRICE INCLUDES $7,000 CONSUMER CASH* AND FREIGHT.

44 MP MPG

HIGHW HIGHWAY 6.4 L/100 KM HWY ¤

2014 Jeep Cherokee Limited shown. Price: $31,690.

2014 DODGE JOURNEY CANADA VALUE PACKAGE

$

114 @ 4.29

BI-WEEKLY‡

59 MPG

HIGHWAY 4.8 L/100 KM HWY

¤

FINANCE FOR

$

WEEKLY >

47

BASED ON PURCHASE PRICE OF $16,880.

@

BEING B.C.’S #1-SELLING AUTOMAKER IS A VERY, VERY BIG DEAL.

AS GOOD AS

36 MPG HIGHWAY 7.9 L/100 KM HWY ¤

CANADA’S BEST-SELLING MINIVAN FOR MORE THAN 30 YEARS

114 @ 4.29 %

FOR 96 MONTHS WITH $0 DOWN

2014 Dodge Grand Caravan Crew Plus shown. Price: $32,990.

AS GOOD AS

LEGENDARY JEEP CAPABILITY

2014 JEEP CHEROKEE SPORT

$

23,888 •

FINANCE FOR

$

132 @ 3.49 %

BI-WEEKLY<<

PURCHASE PRICE INCLUDES FREIGHT.

3.99 0

% OR

FOR 96 MONTHS WITH $0 DOWN

INCLUDES FREIGHT. FOR 96 MONTHS WITH $0 DOWN

2014 JEEP CHEROKEE CH BEST NEW SUV (UNDER $35 $35,000)

AS GOOD AS

37 MPG

HIGHWAY 7.7 L/100 KM HWY ¤

%

FOR 96 MONTHS WITH $0 DOWN 2014 Dodge Journey R/T AWD shown. Price: $32,390.

AS GOOD AS

THE MOST TECHNOLOGICALLY ADVANCED VEHICLE IN ITS CLASS**

2013 DODGE DART

%†

FOR 36 MONTHS

ALSO AVAILABLE

Just go to www.chrysleroffers.ca to easily find special offers, incentives and current inventory from your nearest dealer.❖

REAL DEALS. REAL TIME.

1/8/14 7:25 PM


Peace Arch News Thursday, January 16, 2014

www.peacearchnews.com 39

All in the details at Boffo Development’s Adagio By Kerry Vital

Boffo Developments is bringing hotel-style sophistication to South Surrey with its newest development, Adagio. With a variety of floorplans and amazing features, there are plenty of things that set the project apart, including an amazing community courtyard with trees, paths and garden plots. The one-, two- and three-bedroom homes are spacious and inviting, with nine-foot ceilings (15 feet on the top floor),

expansive windows and large terraces and patios. Boffo is known for high-quality work, but it’s one room in the home that really draws people in: the kitchen. The natural granite or quartz slab countertops are matched with a complementary backsplash. The under-cabinet and recessed lighting easily illuminates your tasks, and the stainless-steel appliances and 40-inch upper cabinets are perfectly situated. Large kitchen islands feature a wine chiller and tons of space for food preparation or casual dining.

NEW HOME DEVELOPMENT

The bathrooms are luxurious and soothing, with either an oversize shower with frameless glass enclosure or an oversize soaker tub/shower combination. The ensuite includes built-in shower niches and a radiant heated floor to make you feel like you’re entering an exclusive spa, a feeling only magnified by the custom suspended vanity and natural granite or quartz countertops, complemented by a matching backsplash. Residents at Adagio will find everything they can possibly imagine on their front doorstep. From dining at one of the delicious local restaurants to shopping at nearby Semiahmoo Shopping Centre, Morgan Crossing or Grandview Corners, nothing is out of reach. Leisure and recreation is also close by, with several parks, pools, arenas and clubs in the neighbourhood, as well as White Rock beach. On-site, homeowners at Adagio will find a residents lounge with chef ’s demonstration kitchen, double-sided fireplace, televisions, pool tables and a large garden and patio area. There is also a large fitness centre with a steam room. For more information, visit www.adagiobyboffo.ca or call 604-531-6659.

Submitted photos

Tate on Howe, a new 40-storey tower in downtown Vancouver, will be close to everything that the city has to offer, from the nightlife in Yaletown to the shopping and dining on Robson Street and entertainment on Granville Street.

Downtown living at Tate on Howe By Kerry Vital

Artistic downtown living has come to Vancouver with Tate on Howe, a new condominium development from Bonds Group of Companies that offers not only gorgeous one- and two-bedroom homes but also an amazing collection and amenities and a location that can’t be easily beat. “We’ve just begun offering homes to

the public and are very pleased with the response we’ve received,” says Tracy McRae, vice-president of development for Bonds Group of Companies. “Vancouver has a very competitive landscape and well-educated buyers; they know quality when they see it.” The exterior has been designed by Merrick Architecture, and will be a striking part of the Vancouver skyline. The 40-storey tower will maximize water and city views, with huge windows designed to let the light pour in. Inside, you’ll find high ceilings (8’6”, with 9’ on the 34th floor and above) and spacious floorplans designed for comfortable living. The kitchens are fit for any aspiring chef, with imported European cabinetry systems by Eggersmann, chic polished-edge quartz countertops and a dramatic iridescent mosaic tile backsplash. The stainless-steel appliances include a Miele gas cooktop and wall oven.

The bathrooms hold their own Eggersmann European cabinetry, complemented by quartz countertops and a deep full-size soaker tub. Select homes feature separate showers and his-and-hers sinks in the ensuite. “Each of our homes pair thoughtful design with artistic flair and will truly be an oasis in the city,” McRae says. Homeowners will have access to the Tate Clubhouse, an amenities space that holds a fireside lounge and library with over-height ceilings, social room with a chef ’s kitchen and formal dining area, fitness facilities, a billiards room, 12-seat surround sound theatre and business facilities such as a meeting room and conference room. There will also a terrace garden on the fifth floor with a water feature and sheltered courtyards. Residents will also be part of High Street of the Arts, a 10,000-square-foot art space

dedicated to the City of Vancouver. “Featuring four storeys and an open concept design, we are very excited to see how the City uses this space to improve the arts and culture opportunities in the city,” says McRae. “This dedication to the arts is a theme throughout Tate on Howe from the luxuriantly designed common areas to the smallest of details.” Tate on Howe is within walking distance to the night life in Yaletown, the shopping and dining on Robson Street, entertainment on Granville Street, and the beaches, marinas and seawall at Stanley Park. Homes start at $268,000. For more information, check out tateonhowe.com, call 604-568-8283 or visit the presentation centre at 100-1265 Howe Street, open daily except Fridays between noon and 5 p.m.


40 www.peacearchnews.com

Thursday, January 16, 2014 Peace Arch News

AMAZING INCENTIVE PACKAGES AVAILABLE! 1, 2 & 3 Bedroom Condos

Move in today! Choose from a variety of spacious floor plans, sizes and locations. PRICED FROM

222,500 *

$

6477 196th St, Surrey CALL 604.530.0054

SalixLiving.com

*NET OF INCENTIVES

2, 3 & 4 Bedroom Townhomes in Morgan Heights

Unmatched privacy in a park-like setting. PRICES STARTING FROM

369,900

$

OVER 70% SOLD!

3039 156th St, Surrey CALL 604.535.5511

LiveAtNiche.ca

WBHOMES.CA Sales Centres open: 12 - 5pm

(except Fridays)

Courtesy to Agents. This is not an offering for sale. Any such offering must be made with a disclosure statement. Renderings are an artist’s rendition only. All prices exclude taxes. Incentives and prices subject to change without notice. Please speak to the Woodbridge sales team for offer details. E.& O. E.


Peace Arch News Thursday, January 16, 2014

www.peacearchnews.com 41

WHITE ROCK’S MOST COVETED ADDRESS HOMES SOLD FROM $339,900 TO $1,400,000 Enjoy life to the fullest in the heart of the beautiful beachside village of White Rock. Royce is simply a collection of the finest condominium residences in White Rock. Ocean and Courtyard view homes available ranging in size from 717 sq.ft. to 1,461 sq.ft. Homes are well under construction. Ready for living in 12 months!

ROYCELIVING.COM PRESENTATION GALLERY OPEN NOON - 5PM DAILY APPOINTMENTS RECOMMENDED CALL 604.538.8028

Prices quoted are subject to change without notice and exclude applicable sales tax. E&OE. Sales and Marketing by Fifth Avenue Real Estate Marketing Ltd. www.fifthave.ca


42 www.peacearchnews.com

Thursday, January 16, 2014 Peace Arch News

OPEN HOUSES 15585 GOGGS AVENUE • WHITE ROCK • $709,000 Spacious 4 bdrm., craftsman-style home. Great room OPEN concept plan, beaut. fin. w/real hardwood and slate SUNDAY floors on main, spacious kitchen with breakfast bar, JAN. 19 easy access to fully fenced back yard and sundeck. 2:00-4:00 Nanny quarters or room for grandparents. Single car garage and parking for 3 cars on flat drive. Paula Burns P.M.

OPEN SUNDAY JAN. 19 1:00-3:00 P.M.

604-785-2890 Sutton Group West Coast Realty

OPEN SUNDAY JAN. 19 2:00-4:00 P.M.

#102 - 15165 MARINE DRIVE • $505,000 High on hump of Marine Drive, this updated condo offers fab. ocean and pier views from outdoor sundeck, living, dining and kitchen. Master is 16’3x14’10 and 2nd bdrm. features Murphy bed. Walk-in laundry room. Bldg. has major reno in 2011: new windows, roof, boiler, rainscreening. 19”, secure parking, pet ok, locker. Shelley Mare 604-803-1316 HomeLife Benchmark Realty

OPEN 15118 THRIFT AVE. • WHITE ROCK • FROM $555,000 SAT. & Camden Corner, 5 townhomes by Oviedo Homes. Fab. SUN. kitchen, built-in oven & cooktop. Hardwood throughout main. Convenient den at entrance level, built-in study JAN. area on upper bedroom level. Single car garage with 18 & 19 to allow for 2nd car. Price incl. GST. Catherine 1:00-4:00 driveway Elliott 604-787-9322 Sutton Group West Coast Realty P.M. OPEN SUNDAY JAN. 19 2:00-4:00 P.M.

16TH AVE. & 136TH STREET • BAYVIEW TERRACE • $739,000 Ocean Breaks newest townhome development. Each 3 level home boasts 3 bdrms., 3 full baths, 2 car garage and private elevator. Gourmet kitchen with top of the line appliances. All the latest finishings and fixtures. Join us for a tour. Geof and Carolyn Glazier 604-531-4000 Bay Realty Ltd.

#312 - 15991 THRIFT AVENUE • $243,000 The Acadian. A family-friendly building in the heart of White Rock. Move-in ready. Many recent upgrades. Family and pet friendly. Guest suite and rec room. A must see. Mary Sutherland 604-880-0148 Park Georgia Realty #316 - 1588 BEST STREET • $229,900

Sunny Monterey. Close to everything. Two bdrm. OPEN SUNDAY updated with new floors, paint and countertops. Large master. Balcony facing courtyard. Great complex, JAN. 19 updated windows and rainscreening in 2000. No age 2:00-4:00 restric., small pet ok. Immaculate. Move right in. Jennifer Trentadue 604-530-0231 P.M. Royal LePage Wolstencroft

#306 - 15164 PROSPECT AVENUE • $529,900 Waterford Place, OPEN concrete and steel bldg., no age restrictions. Granite in gourmet SAT. kitchen with pantry, wide plank h/w floors. Two bdrms. and den, JAN. 18 2 underground parking stalls. Walk to beach. Large patio with 2:00-4:00 some ocean view. Fireside lounge in bldg. 2-5-10 warranty. P.M. John Ryan 604-721-4712 Team 3000 Realty Ltd. OPEN SUNDAY JAN. 19 2:00-4:00 P.M.

#72 - 15233 - 34TH AVENUE • SUNDANCE Spacious three bedroom townhouse. South-east end unit in centre of complex. Very quiet. Family room opens onto private garden patio. Window in kitchen. Garage and carport. Fantastic price: $350,000. Patricia Pousette 604-531-1909 Hugh & McKinnon Realty Ltd.

UNBELIEVABLE VALUE IN ELGIN! ELGIN OAKS! OPEN $10,000 Cash Back on 1 Remaining Single Family Home and DAILY 1:00-4:00 Select Townhouses! ONLY 1 house LEFT at $699,900 (14731 32 P.M. Ave)! NET GST INCL! 7 6 Townhomes LEFT starting at $384,900 (CLOSED (#2 - 3266 147 St) NET GST INCL!! FRIDAYS) Lulu Sorbara 604-541-4888 RE/MAX Colonial Pacific Realty Ltd.

15958 PROSPECT CRESCENT • $635,000 OPEN Beautifully renovated family home with over 2000 sq. ft. on 5000 SUNDAY sq. ft. lot. Three bedrooms, 2½ baths, newer kitchen, single car JAN. 19 2:00-4:00 garage. Terrific neighbourhood, cul-de-sac location, Peace Arch Elementary and near the beaches of White Rock. P.M. Kathleen Thomas 604-531-4000 Bay Realty Ltd.

14072 - 32A AVENUE • $2,398,000 OPEN Stunning residence in Elgin. Like new. No GST. SUNDAY Over 8000 sq. ft. on 18,514 sq. ft. lot. Soaring ceilings, 8 bdrms., JAN. 19 8 baths. Stunning gourmet kitchen plus wok kitchen. 1:00-4:00 Many high-end features. Must be viewed! P.M. Lulu Sorbara 604-541-4888 RE/MAX Colonial Pacific Realty Ltd.

12670 - 28TH AVENUE • $848,000 Steps to Crescent Beach, OPEN Crescent Park & Elem. school, this unique character home has SUNDAY fabulous layout and tons of light. Fully fenced south-facing yard JAN. 19 2:00-4:00 accessible from living/dining and family room. Fin. bsmt. w/sep. entrance could be suited, or great for teenagers. Tons of updates. P.M. Pam Mitchell 604-541-4888 RE/MAX Colonial Pacific Realty

1456 STEVENS STREET • $559,900 Rare find! Beautifully updated 2-level duplex-style townhouse that feels like a house! Updates include beautiful hardwood flooring, stainless steel appliances, three spacious bedrooms, three renovated bathrooms and more! Lulu Sorbara 604-541-4888 RE/MAX Colonial Pacific Realty Ltd.

TO ADVERTISE ON THIS PAGE CALL SUZANNE 604-542-7417

OPEN SUNDAY JAN. 19 2:00-4:00 P.M.

#209 - 14855 THRIFT AVE. • WHITE ROCK • ROYCE • $447,300 OPEN Brand new 2 bdrm., 2 bath luxury condo. Overlooks courtyard, DAILY NOON- peek-a-boo ocean view. Close to shopping, dining, parks, beach. 5:00 P.M. High-end finishing, exceptional detailing, stainless appliances, OR BY quartz countertops, lavish use of marble. Adriana Cikojevic APP’T. 604-538-8028 Fifth Avenue Real Estate Marketing OPEN SAT. JAN. 18 2:00-4:00 P.M.

#1103 - 15152 RUSSELL AVE. • MIRAMAR VILLAGE! • $448,000 Gorgeous view, wonderful location. Well looked after 1 bdrm. & den. High-end appliances incl. stainless steel fullsize refrigerator, air cond., heated bathroom floors, loads of windows to take advantage of the view. Security in place. Sue Anderson 604-351-2353 Hugh & McKinnon Realty Ltd.

OPEN SUNDAY JAN. 19 2:00-4:00 P.M.

14717 - 34A AVENUE • $679,000 • ELGIN BROOKES ESTATES Beautiful 4 bdrm., 4 bath family home. Quality millwork, hardwood floors, great layout. Upstairs loft area is perfect for kids or quiet study area. Stainless steel appliances, slow-close cabinets, granite. Spacious back deck off family room. Sue Anderson 604-351-2353 Hugh & McKinnon Realty Ltd.

2606 BAYVIEW STREET • $669,000 Buy a lifestyle! Live in OPEN Crescent Beach. Completely renov. cottage tucked beind private SUNDAY hedge. View from upper deck, plus 16x20 deck, fully fenced, JAN. 19 back courtyard, new aluminum gazebo, privacy wood screen. 2:00-4:00 Hardwood floors, gas stove, gas f/p. Cozy with character. P.M. Janalee Barnes 604-649-4252 RE/MAX Colonial Pacific Realty

REALTORS To advertise on this page call Suzanne 604-542-7417 DEADLINE TO BOOK SPACE Monday at 11:30 a.m.

Check out these two White Rock condos #304 - 1480 Foster St. • White Rock Square One Solid Concrete • $204,900!

Spacious, private and quiet 1 bedroom and enclosed balcony, over 900 sq. ft. Insuite laundry, one secure underground parking, plus locker. Fabulous roof-top garden and rec center with panoramic ocean views. Lovely, well-run building, beautifully kept. Close to everything: shopping to the beach! Call today for your private viewing.

#302 - 1442 Foster St. • Just Listed Total Reno • $249,900!

924 sq. ft. one bedroom and enclosed balcony. Open kitchen, stone counters, stainless appliances, insuite laundry, hardwood flooring and tile throughout. S.E. facing corner unit with oceanviews over Bryant Park. Tower II, 55+, well run, friendly strata. Please call for your appointment to view.

Call today! Terrence Flahiff 778-229-1674 ®

RE/MAX Crest Realty (Westside)


Peace Arch News Thursday, January 16, 2014 The Sign you want.

JUST LISTED

www.peacearchnews.com 43

The Agent you need.

#101 15150 29A Avenue, Surrey Stunning south Surrey ground level unit, tucked away on 29A, walking distance to High Point Shopping Plaza, centrally located to “everything” you need. Huge partially covered patio 21x12 with alcove for BBQ and extra seating area. Peaceful serene setting, in well maintained complex. Lots of storage and great floor plan with bedrooms separated. Bright kitchen eating area. Amenities include bike room, library and workshop.

SOLD

Your Home Sold In 45 Days OR Less, Guaranteed!!! At a Price Acceptable To You, OR I Will Pay You $3,500 CASH!!!

$

Quick possession/ must sell!

259,000

Lynn Brice-Polegato WestCoast Realty

You’ve found a home 1176 Kent St. White Rock Sold in 5 Days

Sutton Seafair

9255 156A St

Realty

Surrey

1625 56th St.

Sold in 4 Days

Delta BC

#2 6518 121 St Surrey Sold in 26 Days

Bill Dunlop

10268 Sheaves Ct North Delta

604-943-3110 O 604-818-6370 C

Sold in 22 Days

Even in this slow market, there are Buyers ready to buy. My websites receive over 30 Buyer requests every day from Buyers looking for homes in your area. My GUARANTEED SALES PROGRAM will sell your home in less than 45 Days, or I will pay you $3,500 CASH!! Details at www. Guaranteed45Days. com

Surrey Sold in 45 Days #303-15875 Marine Dr White Rock Sold in 11 Days

56th. Street Tsawwassen Sold in 15 Days

Elegant custom home 5672 SF on 12060 SF lot next to peaceful park. 6 bdrm & 6 bath, 2 kitchen w/walkout bsmt. 20 ft soaring ceilng in the living and kitchen area. Open floor plan, premium millwork...

Ladner Sold in 1 Day

North Delta

Buyer Found!!

Sold in 6 Days

15800 Buena

#2 6518 121 St

#32 12165 75th St

8165 108 St.

#121 18701

Vista Ave

Surrey

Surrey

North Delta

66th.St.

Buyer Found!!

Sold in 26 Days

Sold in 45 Days

Sold in 14 Days

Buyer Found!!!

11136 Larson Rd

#29-5388

#205 1320

#54 2929 156th St

#608 1551

N. Delta

201A St Langley

55th. St

Surrey

Foster St

#106 1685 152A St Surrey Buyer Found!!!

Surrey

White Rock

White Rock

Tsawwassen

Buyer Found!!!

Sold in 8 Days

Sold in 13 Days

Buyer Found!!!

#400 15336

#105 15041

#72 10812

17A Ave

Prospect Ave,

152nd.St

Surrey

Surrey

Surrey

Buyer Found!!

Buyer Found!!

Buyer Found!!!

Foreclosures, Distress Sales White Rock Area Free list with pics. www. DistressWR.com

15827 Alder Pl

#104 15080

#111 15168

Surrey

Prospect Ave.

36th Ave

White Rock

Surrey

Buyer Found!!!

Buyer Found!!!

Buyer Found!!!

Lot Located Prestigous

4728 48B St

St. White Rock

Buyer Found!!!

! JUST SOLD

#403N- 1100

11689 75A Ave

For your home

lynnbrice.com

14586 17th Ave

#109-1533 Best

Reserved!!!!!

604-209-5545

What are you waiting for?? Call me now!!! 604-818-6370

For all your real estate needs

www.BillDunlopRealEstate.com Not intended to solicit properties currently listed for sale.

Hiring? We can help...

Call 1-855-678-7833 today for more details.

! D L O S T S U J


44 www.peacearchnews.com

Thursday, January 16, 2014, Peace Arch News

Your community Your classifieds.

COMMUNITY ANNOUNCEMENTS

COMMUNITY ANNOUNCEMENTS

COMMUNITY ANNOUNCEMENTS

COMMUNITY ANNOUNCEMENTS

7

7

7

7

OBITUARIES

OBITUARIES

fax 604.575.2073 email ads@bcclassified.com

COMMUNITY ANNOUNCEMENTS

COMMUNITY ANNOUNCEMENTS

6

7

IN MEMORIAM GIFTS

MOM (1953 - 2006) Missed everyday, Never forgotten You’re alive in our hearts and memories

6

IN MEMORIAM GIFTS

OBITUARIES

ANDERSON, Frank Ronald Frank passed away peacefully on January 11, 2014 surrounded by his family. He is lovingly remembered by his wife Barbara of 62 years; children Eric (Helen), Janice (Garry), Margie (Glen), Ross (Kathy), Karyn (Bill); 12 grandchildren and 2 great grandchildren. He will be greatly missed by all who knew him. A Memorial Service will be held Monday, January 20, 2014 at Crescent United Church, 2756 127 Street, Surrey. In lieu of flowers, donations to a charity of your choice would be appreciated. Victory Memorial Park Funeral Centre 604-536-6522

.Peace Arch Hospital Foundation www.pahfoundation.ca Tribute Gifts 604-535-4520

7

BC Cancer Foundation Legacies accepted 604.930.4078 or visit: bccancerfoundation.com

OBITUARIES

July 3, 1924 – January 11, 2014

LEACH, Billy Ewart June 10, 1922 - Dec 21, 2013 It is with great sadness that we announce the passing of our Dad, Grandpa, GreatGrandpa and husband. Bill passed away at Peace Arch Hospital in White Rock, BC on Saturday, December 21st, 2013 at the age of 91. He is lovingly remembered by his wife Irene of 65 years, his son John (Lucille), daughters Cindy, Debbie (Tony) and stepdaughter Donna (Arvid); sister Betty; grandchildren Ron (Jacque), Karen, Torin (Debbie), Erin, Maddison, Harley, Jenavieve, Emma; great-grandchildren Jacob, Ashley, Amanda, Nathan and Addison. Bill was predeceased by his son Kerry in 1990 and brothers Herb, Archie and sister Hazel. Bill was born in Edmonton on June 10, 1922. The Leach family moved to Smithers, BC in 1923 where he spent his school years along with playing his beloved hockey & baseball. Bill served overseas with the RCAF from 1941 - 1945, returned to Smithers where he and Irene were married in 1948. He spent most of his working years with his brothers Herb & Archie in the grocery and later hotel business. Bill took an early retirement in August 1977 due to a heart condition and from then on travel was limited due to health.However, Bill & Irene were able to spend 10 to 12 years wintering in Arizona where they enjoyed their golf & many new friends. By this time they were living in South Surrey, BC, where Irene is presently residing close to family. Bill will be deeply missed by his family and friends. At Bill’s request, no formal service is planned. His family will have a private party in his honour at a later date. In lieu of flowers, a donation to Canuck Place would be appreciated.

LACATE, Adelene Yu Kheng January 9, 2014 It is with great sadness that we announce the passing of Adelene (Addy) Lacate (nee Lee) on Thursday, January 9 after a prolonged battle with illness. Addy was born on July 4, 1966 in Kuala Lumpur, Malaysia. At the age of thirteen, she immigrated to Canada with her family, where she attended Burnaby Central High School. Addy’s varied career included stints in the food and hospitality industry at the Boathouse, in the business and investment community with Barretto Pacific Corp and Chai-Na-Ta Corp, and in the medical community with the Fraser Health Authority. Addy had lived in the South Surrey/ White Rock community since moving there as a newlywed in 1997, and she was so proud to call the area home. She was deeply involved in many of her children’s activities and relished being a “hockey mom”. Addy’s greatest achievement in life was her ability to make others feel loved. Addy was a devoted and loving mother and a cherished wife. Addy is predeceased by her parents, Lawrence and Mona Lee. Addy is survived by her husband Russ, sons Jacob and Spencer and mother-in-law Marilyn. She will be greatly missed by all of the wonderful cousins and aunts and uncles of the Lee family, and by her dear girlfriends who were by her side until the end. Special thanks to the doctors and nurses and care workers at the BC Cancer Clinic at Surrey Memorial Hospital and to the wonderful and caring medical staff at Peace Arch Hospice. A Visitation will be held Saturday, January 18, 2014 from 11:00 am to 1:00 pm at Victory Memorial Park Funeral Centre, 14831 28th Avenue, Surrey, BC, followed by a Celebration of Life Service at 1:00 pm. Condolences may be offered at www.victoryfuneralcentre.ca Victory Memorial Park Funeral Centre 604-536-6522

DANCEY, John Wayne 1933 - 2014 Jack passed away peacefully at Peace Arch Hospice on Sun, Jan 12, 2014. Jack was predeceased by his parents Eleanor and Clarence Dancey. Jack graduated from the University of Sask. and received his masters at Iowa State Univ. He worked in hospital pharmacies in Toronto, Vancouver and for over 20 years as Director of Pharmacy at Lions Gate Hospital in North Van and also lectured at UBC. We would like to express grateful appreciation to Dr. Zayonc, Dr. Joshi and the superb hospice care nurses at Peace Arch. A Service of Remembrance will be held Sunday, January 19th at 1:00pm at Victory Memorial Park Funeral Centre 14831 28th Ave., South Surrey. In lieu of flowers donations to the Peace Arch Hospital in White Rock would be appreciated. Jack is survived by his partner of 44 years, Elwood. Victory Memorial Park Funeral Centre 604-536-6522

OBITUARIES

Armstrong, Terry (Therese Roy)

604.575.5555

bcclassified.com

OBITUARIES

MILLER, WILLIAM (BILL) CHARLES

MARCH 5, 1939 – JANUARY 11, 2014 Bill passed away peacefully on Saturday January 11th, 2014 at Peace Arch Hospice surrounded by his loving family. Bill is survived by his wife of 51 years Hilda (nee Huber), son Cameron, daughter-in-law Meg, daughter Janet McDougall, son-in-law Craig and six grandchildren, Declan, Kyle, Michaela, Evan, Callum and Paige. Bill is predeceased by his parents Edward (Ted) and Isabelle and his sister Sally. He is also survived by brothers Robert (Bob) (Jean), John (Louise) and Carl (Diane) as well as many nieces and nephews. He will be missed by all his family and by the extended Huber family. Bill was born and grew up in Edmunston, New Brunswick. After graduating from Cormier High School, Bill attended Mount Allison University. However, after two years he followed his dream and joined the Royal Canadian Air Force and after training was posted to Winnipeg. He left the Air Force in 1960, stayed in Winnipeg and met the love of his life, Hilda. It was in Winnipeg where Bill started a successful career in the warehousing industry. He started as a warehouse clerk and retired in 1994 as a well-respected president of SeaWay MidWest. During his career Bill had many moves across the country, and with each move, another step up the ladder. These moves, from the east coast to the west coast and the many places in between, enabled the Miller family to make friends all across the country. Bill was well known for his ability to tell a joke or a story and make people laugh. His house was regularly full of people who enjoyed his prowess with the BBQ and his taste in fine wine. Like all Miller’s Bill loved cards and golf and was always ready to play either game. After retirement he indulged in his passion for family and travel. Over the years, he and Hilda travelled throughout the world, enjoying many different countries and places with good friends or just the two of them. While we will miss his love, friendship, humour and jokes, we will cherish the time we had together. Special thanks go to the staff at Peace Arch Hospital, particularly 6 North and Hospice, for their kind and excellent care. We also thank our many friends for their years of support and encouragement. Donations in Bill’s name can be made to the Peace Arch Hospital Foundation or the Alzheimer’s Society of BC. A celebration of Bill’s life will be held at Mount Olive Lutheran Church, 2350 - 148th Street, Surrey, BC on Friday January 17th at 1:00 PM.

Terry was born in Camp Lister, B.C. and lost both parents when she was very young. Her first language was English but she proved a quick study learning French fluently in public school in Falher, Alberta. She graduated from high school in Picture Butte and at age 17 moved to Calgary to support herself. She married Dr. William (Bill) Terrance Armstrong in 1949 and the young couple lived briefly in Vancouver, Kamloops and Vernon before settling in Revelstoke to raise their growing family. After 15 years in Revelstoke the family moved to Rossland, BC. Terry and Bill retired to Langley, BC in 1986. Terry is predeceased by husband Bill and brother Eugene Roy. She will be missed by children and their spouses, Gerry (Sandy Chalmers), Joanne (Randy Taylor), Rick (Donna Davis), Larry (Marsha Scott), Glen (Mary Tkachyk), Donna, Ken (Denise Lacombe), sister Marilyn Hain (Tony), 17 grandchildren, 10 great-grandchildren and friends. Terry raised her family in a home that never saw a storebought loaf of bread, cake or cookies and whose kitchen table was the envy of all. We will cherish and pass on to the grandchildren and great-grandchildren the many beautiful knitted and crocheted afghans, sweaters and other treasures she made for us all over the years. Mom’s memory will live on in our hearts, her many recipes in our kitchens and in kitchens everywhere and her hand-crafted treasures in our homes. The family would like to thank all those at Evergreen Heights, Peace Arch Hospital and the Irene Thomas Hospice for their kind care and support. A funeral mass followed by a tea will be held at the Star of the Sea Catholic church in White Rock on January 17, 2014.

PLAIN, GEORGE DUNCAN

George Duncan Plain, born July 3, 1926, son of Leroy and Rita Plain, left this earth peacefully on January 12, 2014 at the age of 87 years. George was born near Sheddon, Ontario. He was the first son in a family of five children, Mary, Don, Shirley and Bill. George's family was originally a farming family and he maintained his love of the land for his entire life. At a young age, his family moved from Ontario to the community of Pibroch, Alberta, which is near Westlock, Alberta. This is where George met the love of his life, Anna Bernice Campbell. George and Anna were married on November 15, 1947 and began their new life in Pibroch on their own farm. They mixed farmed to support their growing family. They had six children, Larry (Lori Whitcutt), Bradley (Joy Butwilofski), Connie (Peter Swaisland), Joyce (Simon Grant), Shaunet (Andrew Barton), and George Junior (Yvonne Faber). The first four of their children, Larry, Brad, Connie and Joyce, were born in Pibroch and then the family decided to move to the coastal town of White Rock to another farm where several of their brothers and sisters were already farming. This is where the last two children, Shaunet and George Junior, were born. George and Anna farmed for another 10 years in White Rock before moving to Kelowna. They owned and operated the Kenogan Motel for years, welcoming many tourists to all of the wonders of the valley. After 10 years of running this business, they sold the motel and George began working at the Kelowna Golf and Country Club as a greenskeeper until his retirement. He loved running the big machinery and always brought home golf balls and mystery mushrooms. At this time they moved to the their home of 30 years on Calmels Crescent near the golf course. George and Anna have enjoyed many years with their six children, spouses, and 14 grandchildren and spouses. There was always a home full of love, laughter, good meals,a lot of singing, puzzle making and harmonica playing. In addition to having a strong love for his family, George enjoyed fishing, hunting, curling, gardening, square dancing, and nature in all its glory. George and Anna recently moved to the Okanagan Chateau in Kelowna where they made many new friends. George will be dearly missed by his wife Anna, all of his children, grandchildren and the many people who he shared his life with. His memory will be held strongly in our hearts forever. We love you dearest husband, Dad, and Grandpa. Thank you for all of the memories, love and laughter. Please come and join us to celebrate George's life and to share your thoughts, feelings and memories. Memorial services will be held at First Memorial Funeral Home at 1211 Sutherland Avenue, Kelowna, BC on Tuesday, January 21, 2014. Service will be at 11:00 a.m. Internment will follow at 2:00 p.m. at Lakeview Memorial Gardens.


Peace Arch News Thursday, January 16, 2014 COMMUNITY ANNOUNCEMENTS 21

COMING EVENTS

TRAVEL 75

TRAVEL

www.peacearchnews.com 45 EMPLOYMENT/EDUCATION 102

21st Century Flea Market. Jan 19th 10am-3pm. Croatian Cultural Ctr. 3250 Commercial Dr. Adm $5.

ACCOUNTING/ BOOKKEEPING

Intermediate/Senior Accounting Technician

33

Public practice firm with three locations is seeking an intermediate/senior level accounting student for our office in White Rock. The position will require the preparation of working papers for Notice to Reader and Review files, as well as T1, T2 and T3 preparation.

INFORMATION ADVERTISE in the LARGEST OUTDOOR PUBLICATION IN BC The 2014-2016 BC Hunting Regulations Synopsis

The most effective way to reach an incredible number of BC Sportsmen & women. Two year edition- terrific presence for your business.

Please call Annemarie 1.800.661.6335 email: fish@blackpress.ca

42

LOST AND FOUND

FOUND: Boys Wallet at Future Shop in White Rock in December please come into the store to pickup and identify. FOUND - Ladies Green Jacket vic. of 152nd & 17th Ave. White Rock area approx 1 wk ago. Pls call to identify. (604)541-9200

. Unbelievable price $2999 19 Day Holland America cruise. Sandy 604-535-6277

76

VACATION SPOTS

PALM DESERT POOLSIDE CONDO

Beautiful newer 1,500sf. Fully equipped. 2 bdrm, 2 bath Condo. Granite counters, S/S appliances. Very Quiet & peaceful. Close to Golf Course. Outdoor pool & hot tub, amenities room and indoor gym. Avail. March 18 - 31, April & May - weekly or monthly.

604-833-0342

LOST - TOYOTA Car Key. Sat Dec 7th. Possibly in prkg lot on Russell. Please call: (604)535-5387

GETAWAYS

TRAVEL SOMEWHERE WARM... Unique Vacation Club Worldwide Resorts One-time fee No levies ~ No booking fee. Hotweeks: (7 nights) for less than $390

www.UniqueVacationClub.info

HELP WANTED

HAIRCARE PROFESSIONALS CHAIR RENTAL AVAILABLE at

TEEZERS HAIR STUDIO

206

98

PRE-SCHOOLS

Peace Arch Appliance Service to fridges, stoves, washers, dryers & dishwashers. Reasonable. Also Appliance Removal Call Mark (604)536-9092

Custodian (Spare Board) Service Operations Department

Bus Driver (temporary) Transportation Department For more information about these opportunities please go to: surreyschools.ca (Career opportunities - support staff) or makeafuture.ca/surrey.

160

TRADES, TECHNICAL

14633 - 16th Avenue

Fun Family Phonics 3, 4, 5 or 6 hrs a day classes 2 - 5 days per week available Junior Kindergarten, ESL

(Est. since 1995) BRENDA 604-531-2100

130

HELP WANTED

CLEANING SERVICES

CLEANING LADY ~ reliable, prof., will clean your home, office. 10 years exp. Reasonable rates. Excellent references. 778-960-9865

Change ugly popcorn ceiling to a Beautiful Clean White Flat Ceiling. Lovely to look at. Update your house and increase it’s value.

D Windows Out & In D Gutters cleaned In & Out D Pressure Washing D Serving W. Rock for over 30 yrs D Lic. & WCB insured. D Free Est. Seniors Discount

* No Scraping * No Sanding * No Mess

Eric 604-541-1743 RELIABLE HOME & YARD CARE Let us do it for you! • Flexible Services/ Affordable Prices • Housework/Yard work • Rental Suite Cleaning • Household Organization • Errands for Seniors

leader is seeking an energetic, aggressive self starter for a full time position. Req. immediately.

BENEFIT PACKAGE!

HELP WANTED

(604)-309-3707

Please contact Mike e-mail: mike@megacranes.com or fax 604.599.5250

Catch Basin Cleaning

A MAID TO CLEEN

NOW HIRING:

Sump and Catch Basin Cleaner/Operator

For all Your Cleaning Needs

Experience a must. Good driving record needed. Please forward resume and drivers abstract to: apply@catchbasinclean.com

CALL FRIENDLY BENJAMIN 604-230-7928

260

A Great Janitorial Franchise Opportunity

• Annual Starting Revenue of $12,000 - $120,000 • Guaranteed Cleaning Contracts • Professional Training Provided • Financing Available • Ongoing Support • Low Down Payment required A Respected Worldwide Leader in Franchised Office Cleaning. Coverall of BC 604.434.7744 info@coverallbc.com www.coverallbc.com

FLAGGERS NEEDED. No Certification? Get Certified, 604-575-3944

FLAG PERSONS & LANE TECH PERSONNEL NO EXPERIENCE REQUIRED

WE WILL TRAIN!

Please E-mail Resume: grasdald@telus.net

DRIVERS/COURIER/ TRUCKING ATLAS POWER SWEEP DRIVERS

Power sweeping,power scrubbing and pressure washing. Must be hard working with a good attitude. Burnaby based. Must be available to work nights and weekends. Good driving record & abstract required. Experience and Air Ticket beneficial. Email: jobs@atlasg.net or Fax: 604-294-5988

HIGHWAY OWNER OPERATORS & COMPANY DRIVERS Van Kam’s group of companies req. Highway linehaul owner operators & company drivers based in our Surrey terminal for runs throughout BC and Alberta. Applicants must have winter and mountain driving experience/training. We offer above average rates and an excellent employee benefits package. $3500 Signing BONUS for Owner Operators To join our team of professional drivers, email a detailed resume, current driver’s abstract and details of your truck to: careers@vankam.com or Call Bev, 604-968-5488 or Fax: 604-587-9889 Only those of interest will be contacted. Van Kam is committed to Employment Equity and Environmental Responsibility.

INTERNET MARKETING and Sales Person for Bothell, Washington based Minimally Invasive Surgery Center: Social Media -Strong skills in internet base marketing & sales -Experience in CRM a must, SalesForce preferred. Qualifications -BA/BS degree in related field required -Minimum 1-3 years of agency experience -Solid understanding of communications strategies and tactics -Strong attention to detail -Exceptional written and oral communications skills and editorial content development experience -Exceptional organizational and time-management skills -Highly-collaborative team player with positive attitude and ability to self-motivate -Solid computer skills with proficiency in PC-based systems, Microsoft Word, Outlook, PowerPoint and Excel. To apply please send your resume to: tracys@spineinstitutenw.com. -Location: To market the area of British Columbia -Compensation: DOE

132

HOME STAY FAMILIES

YOUR ELECTRICIAN $29 Service Call Lic #89402 Same day guarn’td We love small jobs! 604-568-1899 Lic. Electrician A+, BBB member Expert trouble shooter, All types of Electrical work 24/7 604-617-1774

ALL JOBS Big or Small. Panels, lighting, plugs, fans, hot tubs, etc. Guaranteed work. Ph 604-539-0708 Cell 604-537-1773 (Lic. 26110)

275

Residential & Commercial Services ~ Excellent Rates!! * Licensed * Bonded * Insured

778-883-4262

✶ Repairs & Staining ✶ Installation ✶ Free Estimates

FARM WORKERS

MOHINDER Ent Ltd. (Surrey), seeks FT Farm Workers. $10.35/hr, 50hrs/wk, Apr 1-Nov 15. outdoor work. Duties: weeding, pruning, harvest, planting. Fax 604-575-2584

Efficient, Reliable, Friendly, Bonded Excellent References with 18 yrs of experience. Call Ivet: 778-235-4070

239

FLOOR REFINISHING/ INSTALLATIONS

HARDWOOD FLOOR REFINISHING

Century Hardwood Floors 604-376-7224 www.centuryhardwood .com

COMPUTER SERVICES 281

GARDENING

*Yard Clean-up *Hedge Trimming ~ RUBBISH REMOVAL ~ Seniors Discount 778-549-0248

SUPREME HEDGES

PERSONAL SERVICES 175 CATERING/PARTY RENTALS

15% OFF FALL CLEAN-UP • TREE Pruning & Top • Hedge Trimming • Tree REMOVAL

.computer service

*Seniors Disc. *Insured *26 yrs.

Jay 604-513-8524 Specializing in Private Events! We Come To You! Doing It All, From Set-Up - Clean-Up.

• Home Dinner Parties • Meetings • Funerals • Weddings • B-B-Ques • Birthdays • Anniversaries Unique Taste, Unique Menus... Gourmet, Customized Menus Tailored To Your Function...

Kristy 604.488.9161

.

threescocatering@shaw.ca or Visit us at: www. threescompanycatering.ca

182

FINANCIAL SERVICES

GET BACK ON TRACK! Bad credit? Bills? Unemployed? Need Money? We Lend! If you own your own home - you qualify. Pioneer Acceptance Corp. Member BBB. 1-877-987-1420 www.pioneerwest.com

.Jim’s Mowing. 310-JIMS (5467).

283 GUTTERS & DOWNSPOUTS GUTTER CLEANING SAME DAY SERVICE AVAILABLE

Homestay Families S. Surrey / W.Rock

Call Ian 604-724-6373 Computer Problems? Call Blue Sky Tech 604.512.7082 John Jespersen

287

Japanese students Mar 21st -29th $40 per night - 1 per family Must be native English speaking.

HOME IMPROVEMENTS

287

HOME IMPROVEMENTS

Call Julie

604-809-9463

134

HOTEL, RESTAURANT, FOOD SERVICES

Food Service Worker required part-time

124

BECOME A VOLUNTEER LITERACY or MATH TUTOR and help a child who is struggling to learn! You must have excellent English and/or math skills, and enjoy working with children. Tutoring locations in both Surrey & Langley. Extensive training starts Jan 18th. For more information call: 604-591-5156 www.ldafs.org

COMPETITIVE RATES Must Have Valid TCP Certificate, Reliable Insured Vehicle And Provide A Clean Drivers Abstract!

VOLUNTEERS

ELECTRICAL

ELECTRICIAN - Dana Thompson Over 24yrs exp. Res/Comm. Free est. Bonded. #14758 604-353-1519

Weekly, Biweekly, Monthly Q-DECKERS WANTED Physically demanding, must be comfortable at heights. $15-20/hr depending on exp. Please call Roger, (604)830-1669

DRYWALL

PSB DRYWALL ★ All Boarding, Taping, Framing & Texture. Insured work. Dump Removal Service. 604-762-4657/604-764-6416

E & M MAINTENANCE WINDOW WASHING

Heavy Duty Diesel Truck Mechanic Mega Cranes Ltd. an industry

163

114

Route Number Boundaries Number of Papers 18102501 129 St, 129A St, 129B St, 21A Ave, 21B Ave, 22 Ave, 22A Ave, 22B Ave, 24 Ave 93 18102514 136 St, 137 St, 137A St, 138 St,138A St, 139 St, 16 Ave, 17 Ave, 17A Ave, 18 Ave 162 18103604 Bayview St, Beecher St, Crescent Rd, Gordon Ave, Maple St, McBride Ave, McKenzie Ave, O’Hara Ln 90 18103605 124 St, Cedar Dr, Crescent Dr, Dogwood Dr, Seacrest Dr82 18103612 130 St, 32 Ave, 35 Ave, 35A Ave, Crescent Rd 104 18103617 134 St, 136 St, 25 Ave, 26 Ave, 27 Ave, 28 Ave 49 18103618 128 St, 137A St, 139 St, 24 Ave, 25 Ave 61 18103624 132 St, 133 St, 134 St, 25Ave, 26 Ave, 28 Ave 44 18103625 136 St, 137A St, 138 St, 138A St, 139 St, 31 Ave, 32 Ave, 33 Ave 79 18103626 132 St, 135A St, 28 Ave, Balsam Cres, Vine Maple Dr, Woodcrest Dr & Pl 70 18103629 124 St, 124B St, 127A St, 128 St, 24 Ave, 25 Ave 92 18104709 141 St, 142 St, 24 Ave, 25 Ave, 25A Ave, 26A Ave, 27A Ave, 28 Ave 58 18104724 140A St, 141 St, 141A St, 32A Ave, 33 Ave, 33B Ave 61 18411327 145 St, 145A St, 145B St, 146 St, 60 Ave, 60A Ave 68 18511804 Boundary Drive W, Northpark Pl 66 18511816 134 St, 134A St, 135B St, 136 St, 61B Ave, 62 Ave, 62A Ave, 62B Ave, 63 Ave 120

ALL Concrete Brick, Block & Stonework. Good job - Good price. Call Enzio (604)594-1960

DETAILED EUROPEAN CLEANING.

KIDS AND ADULTS NEEDED FOR CARRIER ROUTES Papers are delivered right to your door. No need to insert flyers either! Deliver 2x a week, after school, Tuesday and Thursday. Call the Circulation Department at 604 538-8223 ext. 14 or email us at: zchecker1@peacearchnews.com

Call: Rick (604) 202-5184

257 236

ELECTRICIANS - with technical training, level 2 and higher including Journeyman to start immediately. Sites in Langley, Maple Ridge and Coquitlam, new residential construction. Send resumes to dnelectric@telus.net

Call Rose (604)340-8975

SANDCASTLES & Sunshine Preschool

CONCRETE & PLACING

Placing & Finishing * Forming * Site Prep, old concrete removal * Excavation & Reinforcing * Re-Re Specialists 34 Years Exp. Free Estimates. coastalconcrete.ca

Call (604)538-9600

1st month rent free

108 BUSINESS OPPORTUNITIES

242

Repairs to all major appliances

The Surrey School District has an opening for the following positions:

Includes back-bar products. 10% commission on retail $700/month

130

APPLIANCE REPAIRS

HOME/BUSINESS SERVICES

RANGERS OCEAN PARK APPLIANCE LTD

CHILDREN

EMPLOYMENT/EDUCATION 130

127

HOME/BUSINESS SERVICES

142 OFFICE SUPPORT/CLERKS

WA GARDEN, 17535 40 Ave., Sry req’s F/T vegetable workers. Weed, plant, package, harvest, good eyehand co-ordination, some heavy lifting & good health. 40 hrs/wk. Start early Apr. $10.25/hr. 604-313-1133

Candidates should have minimum of 2 years accounting experience, at least of which 1 year has been in a Canadian public practice environment. Strong written and oral English skills required. Preference will be given to local candidates with experience using Caseware, Caseview, Profile, Simply Accounting and QuickBooks. Strong bookkeeping, GST / PST skills a definite asset. Candidates must possess the ability to deal with clients in a professional manner. We are a well-established firm and offer a great working environment.

FARM WORKERS

EMPLOYMENT/EDUCATION

INTERNATIONAL HERBS (BC) Ltd growers of fresh herbs and vegetables located in Surrey, British Columbia is looking for SEASONAL FARM LABOUR. Duties will include (but are not limited to) the following: Seeding, Planting, Weeding, Harvesting, Processing & Packaging. Ability to operate farm machinery is an asset. No skills or prior exp. required. Hourly pay is $10.75. Work begins January 15th so apply now. Email: work@internationalherbs.net or drop by in person (only between 9am-4pm) at 4151 184th St. Surrey.

Thank you to all applicants. Only those being interviewed will be contacted

ITALY- beautiful countryside, friendly locals, village house for rent. Anita, 250-655-4030.

75

124

Please apply with resume by email to: vspindor@eprcga.com or fax to 604-467-1219 No phone calls please.

TRAVEL 66

EMPLOYMENT/EDUCATION

“White Rock & South Surrey’s Leading Renovator since 1989” Need CA$H Today? Own a vehicle? Borrow up to $25,000 Snapcarcash.com 604-777-5046

PROTECT YOUR LOVED ONES

Monday-Sunday for a Senior Retirement Community in South Surrey.

Life Insurance can keep your loved ones well positioned financially.

Please email resume to:

Contact Bill Ambrock for a free quote or consultation.

swright@pacificcarlton.com

Ph: 604-385-3704 or email:

~ no phone calls please ~

William@williamambrock.com

Designing and renovating new kitchens, bathrooms, basements, house make-overs and additions since 1989

Call for FREE in-home consultation In-house design team and cabinet shop Let MPB make your renovation dreams come true!

www.mpbconstruction.com Showroom: Unit 62 - 15515 24th Ave. (at King George Blvd.) Tel: 604-538-9622


46 www.peacearchnews.com HOME/BUSINESS SERVICES 283 GUTTERS & DOWNSPOUTS

HOME/BUSINESS SERVICES 320

GUTTER/Window Cleaning, Power Washing, 30 yrs exp., For Prompt Service Call Simon 604-230-0627

283A

MOVING & STORAGE

HOME/BUSINESS SERVICES 329 PAINTING & DECORATING

HOME/BUSINESS SERVICES 356

RUBBISH REMOVAL

LOCAL & LONG DISTANCE

HANDYPERSONS

V U

U

604-536-6620

506

332

 



www.affordablemoversbc.com

$45/Hr

From 1, 3, 5, 7 & 10 Ton Trucks Licensed ~ Reliable ~ 1 to 3 Men Free Estimate/Senior Discount Residential~Commercial~Pianos

HOME IMPROVEMENTS

PAVING/SEAL COATING

ASPHALT PAVING â&#x20AC;˘ Brick Driveways â&#x20AC;˘ Retaining Walls â&#x20AC;˘ Foundation Repairs â&#x20AC;˘ Sealcoating 604-618-2304

AFFORDABLE MOVING

APPLIANCES

338

bradsjunkremoval.com

Hauling Anything..

PLUMBING

MISC. FOR SALE

20 YARD BINS AVAILABLE We Load or You Load !

604.220.JUNK(5865) Serving Metro Vancouver Since 1988

604-537-4140

512

HOUSES FOR SALE

CUSTOM home at ANDERSON WALK. 4000+ sqft. 6 bed 4 bath. No expense spared! Mnt & River Views. $848k. 778-888-7720

627

HOMES WANTED We Buy Homes BC â&#x20AC;˘ All Prices â&#x20AC;˘ All Situations â&#x20AC;˘ â&#x20AC;˘ All Conditions â&#x20AC;˘ www.webuyhomesbc.com (604) 657-9422

BICYCLES

Gary Fisher Advance Mountain bike, suits person 5â&#x20AC;&#x2122;2â&#x20AC;&#x2122;â&#x20AC;&#x2122; - 5â&#x20AC;&#x2122;9â&#x20AC;&#x2122;â&#x20AC;&#x2122; Selling for $75 GIANT FCR 2 Sport Road Bike Size L - Suits 5â&#x20AC;&#x2122;9 - 6â&#x20AC;&#x2122;2â&#x20AC;&#x2122;â&#x20AC;&#x2122; Hardly used. $500.

1PRO MOVING & SHIPPING. Across the street - across the world Real Professionals, Reas. Rates. Best in every way! 604-721-4555.

North Delta 604-591-9740 Can email Pictures

â&#x20AC;˘ DIFFICULTY SELLING? â&#x20AC;˘

DifďŹ culty Making Payments? No Equity? Penalty? Expired Listing? We Buy Homes! No Fees! No Risk! www.GVCPS.ca / 604-786-4663

638

INTERIOR/EXTERIOR BROTHERS MOVING & DELIVERY

CONTRACT OR HOURLY FREE ESTIMATES 25 YEARS IN BUSINESS

551

OPEN HOUSE

www.brothersmoving.com

JUNK REMOVAL By RECYCLE-IT! 604.587.5865 www.recycleitcanada.ca

Per Molsen 604-575-1240

START TO FINISH CONTRACTING

329 PAINTING & DECORATING .604.536.2216 www.bhserviceplumbing.org

A Gas Fitter â&#x153;­ Plumber RENOS & REPAIRS Excellent price on Hot Water Tanks Furnace, Boilers, Plumbing Jobs & Furnace & duct cleaning

Blake and his Dad make a positive difference in your life by providing quality workmanship delivered with integrity. D interior & exterior renovation D rot repair & restoration D Decks D Fences & much more free estimates.

FREE! Scrap Metal Removal...FREE!!! *Appliances *BBQs *Exercise Equip *Cars/Trucks/Trailers *Hotwater Tanks *Furnaces * Restaurant Equipment All FREE pickup!

604-572-3733

â&#x153;­ 604-312-7674 â&#x153;­

www.tkhaulaway.com

#1 IN RATES & SERVICE. Licâ&#x20AC;&#x2122;d/Ins. LOCAL Plumber. Plugged drains, renos etc. Chad 1-877-861-2423

EXTRA

CRESCENT Plumbing & Heating Licensed Residential 24hr. Service

CHEAP

â&#x20AC;˘ Hot water tanks â&#x20AC;˘ Furnaces â&#x20AC;˘ Broilers â&#x20AC;˘ Plugged Drains 778-862-0560

10% OFF if you Mention this AD! *Plumbing *Heating *Renoâ&#x20AC;&#x2122;s *More Lic.gas fitter. Aman: 778-895-2005

MOON CONSTRUCTION BUILDING SERVICES

353 ROOFING & SKYLIGHTS

374

TREE SERVICES

â&#x20AC;˘ Additions â&#x20AC;˘ Renovations â&#x20AC;˘ New Construction Specializing in â&#x20AC;˘ Concrete â&#x20AC;˘ Forming â&#x20AC;˘ Framing â&#x20AC;˘ Siding

All your carpentry needs & handyman requirements.

~ PRO PAINTERS ~ INTERIOR / EXTERIOR Quality Work, Free Estimates

Renovation Specialist Quality workmanship since 1968 Commercial - Residential

EXP. CARPENTER / HANDYMAN All types of work! No job too small! Over 20 yrs exp! Ed 778-888-8603

Trees removal, Hedges Pruning, Topping Chipping. Insured. WCB Free wood & chips. David Fast 604-536-5426

1 room $69 - Includes baseboards

Repaint Specialist

AFFORDABLE RENOVATIONS All types of walls & floor finishing. Prof & Fast Service. Free Est. Call (604)626-7941

Homes & Condoâ&#x20AC;&#x2122;s Commercial Buildings Small Renoâ&#x20AC;&#x2122;s Drywall & Ceiling Repairs

Prestige Industries General Contractors

RENEâ&#x20AC;&#x2122;S SPRAY & BRUSH PAINTING

778-855-5361

* Demo - Small Jobs *Junk removal * Fences + Decks * Snow Plowing + salting â&#x20AC;&#x153;No Job Too Smallâ&#x20AC;?

MESA PAINTING INTERIOR and EXTERIOR Quality work at reas rates. Free Est. Michael (cell) 604-724-7458

Call Zach @ 778-789-5784 or Spencer @ 778-789-5785

PETS BEST BUSY BOYS ROOFING LTD.

D Conversion from Cedar to Asphalt, Shingles, Fiberglass D 30, 40, 50 years Warranty D WCB, BBB, Liability Ins. Free Estimates. Call Gary 604-599-5611 OR Visit

www.bestbusyboysroofing.com

356

RUBBISH REMOVAL

PATRICKâ&#x20AC;&#x2122;S RUBBISH REMOVAL *Landscape *Trimming *Yard Clean *Const. Clean. *ANYTHING!!! 1 Ton Truck. Call Patrick for Prompt Quality Service @ 604-808-1652. TONYâ&#x20AC;&#x2122;â&#x20AC;&#x2122;S PAINTING

www.paintspecial.com 604.339.1989 Lower Mainland 604.996.8128 Fraser Valley

WHITE ROCK RUBBISH REMOVAL

Running this ad for 8yrs

PAINT SPECIAL 3 rooms for $299, 2 coats any colour

OLD TIME CLEANING. Cleaning the Old Fashioned Way. Free Est. Seniors Discounts. 604-385-3704.

320

MOVING & STORAGE

MOUNTAIN MOVERS- Your trusted choice for residential moving services. (778)378-6683

(Ceiling & Trim extra) Price incls Cloverdale Premium quality paint. NO PAYMENT until Job is completed. Ask us about our Laminate Flooring & Maid Services.

Pursuant to Sections 26 and 94 of the Community Charter S.B.C. 2003, Chapter 26, as amended, the City of Surrey hereby gives notice of the intention to dispose of the following City lands: Legal Description:

That Part of Section 4 Township 7 New Westminster District Plan Shown as Parcel A on Plan EPP32502 That Part of Section 4 Township 7 New Westminster District Plan Shown as Parcel B on Plan EPP32502 That Part of Section 4 Township 7 New Westminster District Plan Shown as Parcel C on Plan EPP32502

Civic Address:

A 0.187 ha. and a 0.102 ha. portion of road located adjacent to 442 â&#x20AC;&#x201C; 188 Street; and a 0.134 ha portion of road located adjacent to 435 â&#x20AC;&#x201C; 192 Street

Property Description: The properties are portions of redundant road. They are currently zoned General Agriculture (A-1) and are designated Agricultural in the Official Community Plan. The properties are being sold to an adjoining owner for consolidation and development purposes. Purchasers:

CIMD PROPERTIES LTD.

Nature of Disposition: Fee Simple

Save-On Roofing - Specializing in New Roofs, Re-Roofs & Repairs. 778-892-1266

GL ROOFING. Cedar/Asphalt, Flat roofs, WCB Clean Gutters - $80. 604-240-5362. info@glroofing.ca

289 HOUSEHOLD SERVICES

Call Fiona 604-255-7061

NOTICE OF INTENTION TO SELL CITY LANDS

Semiahmoo Tree Experts

PATTAR ROOFING LTD. All types of Roofing. Over 35 years in business. 604.588.0833

Emersonâ&#x20AC;&#x2122;s Contracting 604-524-2451, 604-535-0566

OFFERS TAKEN AFTER 2PM

COMMUNITY CHARTER S.B.C. 2003 CHAPTER 26

604-787-5915/604-291-7778

www.treeworksonline.ca treeworkes@yahoo.ca

Vincent 543-7776

KITCHENS - BATHRMS CROWN MOULDING SUITES, DECKS, REPAIRS - BUILDING MAINT. REFS. WORK GUARANTEED

IMMED. POSS. OPEN TO OFFERS

N OT I C E O F I N T E N T

â&#x20AC;˘ Tree Trimming â&#x20AC;˘ Fully Insured â&#x20AC;˘ Best Rates

WCB INSURED

Lovely ground floor corner unit with walk out patio, 2 baths, large master bedroom, private setting with access to bakerview Park. Approx. 1330 s/f. Incl. 5 appliances.

OPEN HOUSE JAN. 18th 2-4pm & JAN. 19th, 10am -2pm

Dishes, furniture, decorator items, designer purses, clothing plus lots more.

removal done RIGHT!

Member of Better Business Bureau

BRIGHT, 1 bdrm suite near P.A. Hospital, f/s, w/d, full bathroom, private entry with covered patio; available now; $850/mo inc. utils; NS, NP; Refs, credit check required; Ph: Debbie 604-541-5245

2 Bdrm Condo - Stratford Garden #117 - 15350 19A Ave.

Moving/Estate Sale

TREE & STUMP

.Hayden Painting 778-229-0236 Family Owned & Operated Ryan 778.229.0236

604-218-3064

S SURREY

TILING

A-1 Ceramics, Marble, Glass blocks etc. Install/Repair. Res./Comm. Free Est. 20 years exp. Peterâ&#x20AC;&#x2122;s Tile (604)209-0173

Licensed, Insured, WCB

APARTMENT/CONDO

(778)997-5757, (604)587-5991

373B Call Blake or Brian (604)816-1653

706

RUBBISH REMOVAL Almost for free!

FIXIT PLUMBING & HEATING H/W Tanks, Renoâ&#x20AC;&#x2122;s, Boilers, Furnâ&#x20AC;&#x2122;s. Drain Cleaning. Ins. (604)596-2841

.Can-Pro Paint & Drywall. 3 rooms $250. Over 25 yrs of quality service. Insured/Free Est. 604-7717052

MOVING SALE- Brand new curtains, 3 Area Rugs brand new, brand new Play Station 3 - used once, with 2 games, Porcelain dolls etc. Call (604)542-4917

Sat. Jan 18 9am - 5pm. 14084 28 Ave.

RENTALS

ESTATE SALE

GARAGE SALES

Local & long distance Movers

Call 604-720-0931

RON Morin

639 REAL ESTATE SERVICES

Repairs & Renoâ&#x20AC;&#x2122;s, Sundecks & Additions, New Homes European Quality Workmanship

639 REAL ESTATE SERVICES

REAL ESTATE

But Dead Bodies!!

BRO MARV PLUMBING 24/7 Plumbing, heating, plugged drains BBB. (604)582-1598, bromarv.com

REAL ESTATE

HOT TUB (SPA) COVERS. Best price. Best quality. All shapes & colours available. 1-866-652-6837 www.thecoverguy.com/newspaper?

626

Service to fridges, stoves, washers, dryers & dishwashers. Reasonable. Also Appliance Removal Call Mark (604)536-9092

.Russells Rubbish Removal 604-787-7355 White Rock / South Surrey

LOCAL & LONG DISTANCE

A SEMI-RETIRED CONTRACTOR. Specializing in Renovationâ&#x20AC;&#x2122;s. Available for work. 604-532-1710

560

Peace Arch Appliance

Northstar Painting Ltd.- The Residential Specialists. BIG jobs, Small jobs - We do it all! Interior and Exterior Projects. Master Painters at Students Rates. WCB Safe, Reliable, Efficient & Quality Paint. 778.245.9069

www.BBmoving.ca

A PROFESSIONAL HANDYMAN / CARPENTER 20 yrs exp. Licensed & Insured. Call 604-802-8809. Renovations, Repairs, Decks, Baths, Kitchens, Mouldings, Flooring.

PETS

70

B & B MOBILE SERVICES

AT YOUR SERVICE. Carpentry, Concrete, Painting, Rubbish Removal. Call Dave (604)999-5056

477

MERCHANDISE FOR SALE

MERCHANDISE FOR SALE

' #!!' %# $ t4NBMM#JH.PWFTt*OUFSOBMT ' %$' &""$ t4JOHMF*UFNTt1BDLJOH4VQQMJFT

MAINTENANCE, REPAIR, RENOVATION www.proficientrenovation.com or call 604-323-4111 for more details.

PETS

Pitt Bull x American Bulldog pups. Beautiful markings, vet checked. 1st Shot. Call 778-982-4068.

MOVING?

HANDYMAN. Very reliable. 20 yrs exp. Seniorâ&#x20AC;&#x2122;s discount. Make a list. CAN DO IT ALL! 604-866-4977

287

Thursday, January 16, 2014, Peace Arch News

.COM Seniors Discount RELIABLE, SERVICE 7 days a week

CALL ROGER 604-

968-0367 CHEAPER PRICES

477

PETS

Selling Price:

One Hundred Sixty-Seven Thousand Seven Hundred Dollars ($167,700.00)

Beautiful Pitt Bull Puppies $500, call Kimberlee 604.763.3125

CATS GALORE, TLC has for adoption spayed & neutered adult cats. 604-309-5388 / 604-856-4866 CATS OF ALL DESCRIPTION in need of caring homes! All cats are spayed, neutered, vaccinated and dewormed. Visit us at fraservalleyhumanesociety.com or call 1 (604)820-2977 GERMAN Shepherd pups blk & tan, shots, defleaed & dewormed. Parents to view. $550 (604)625-0082 GERMAN SHEPHERD Pups & young adults. Quality German & Czech bloodlines. 604-856-8161. NEED A GOOD HOME for a good dog or a good dog for a good home? We adopt dogs! Call 604856-3647 or www.856-dogs.com

Pitt Bull Puppies, $500. Born Nov.17, first shots, dewormed, vet checked, 604.763.3125

Further information can be obtained from the City of Surrey, Realty Services Division, Engineering Department, 14245 - 56 Avenue, Surrey, BC V3X 3A2. Phone (604) 5985700 THIS ADVERTISEMENT IS FOR THE PURPOSE OF PUBLIC DISCLOSURE ONLY, NOT SOLICITATION OF AN OFFER.

www.surrey.ca


Peace Arch News Thursday, January 16, 2014 RENTALS 706

RENTALS

APARTMENT/CONDO

706

APARTMENT/CONDO

WHITE ROCK

ACTIVE SENIOR 1 & 2 Bedrooms

$795-$805. 1 BDRM APT

Well maintained Concrete High Rise in White Rock close to shopping.

Great Location! Good Management!

~ THIS IS A MUST SEE ~ * Very desirable 1 bdrm apt, ideal for quiet tenants. * Across from ponds and park, close to beach, near shops and Peace Arch Hospital. The bus stops in front of the next apartment block. * Reasonable Rent Includes: 43 channels of cable vision, heat and hot water. * Security Deposit: Half Month of Rent. * Absolutely No Smoking, No Drugs, No pets.

Swimming Pool & All Amenities. UTILITIES INCLUDED. NS/NP

Call 604-538-5337 Beautiful & Affordable Kiwanis Park Place For Adults 55+ rental apartments in a modern complex, right next to beautiful Crescent Park! On site maintenance & office staff Mon. through Friday. 1 bdrm. units from $751 - $844 incls. heat, electricity and friendly reliable service.

Call 604-538-9669 for information or to visit. NEW TOWNHOME FOR RENT South Surrey near Grandview Corners. 2 Bdrm + Den, 2.5 Bath. In suite Laundry and Dishwasher. $1700/mo. No Smoking. Wont last long. Call Now! 604-765-9155

Call Manager at 604-538-5085. WHITE ROCK Oceanview lrg 2 bdrm recent reno, new paint $900. Deluxe 1 bdrm $725. N/S. Incl heat/hot water 604-589-7818

RENTALS 736

WHITE ROCK

Sunset & Partial Ocean Views! Close to all amenities & walking distance to beach. Spacious 2 Bdrm. on third floor of a well maintained 4 story walk up. $1050/mo. incls. • Heat • Hot Water • WiFi • Parking • Adult Oriented • Quiet • Smoke Free • Sorry No Pets!

White Rock Quiet community oriented living.

1 & 2 Bdrm Suites Hot Water & U/G Parking Incl

Call 604-536-8499 www.cycloneholdings.ca

Available Now! www.thelyons.ca 604-535-3585

SOMERSET GARDENS (S. Sry) Family housing 1851 Southmere Crescent E. 2 bdrm apartments starting from $899 - $981/mo. incl. heat. Pet friendly, near all amenities. Community garden.

WHITE ROCK SUNSET VILLA

1 Bdrm. w/ D/W & Gas F/P Large balcony. Concrete building.

$900 incls. HEAT & H/W. 1 block from Semiahmoo Mall. Available Immediately!

604-451-6676

Call for appt to view 604.541.6276

S.Surrey PACIFICA RETIREMENT RESORT, 1 bdrm corner ste, W/D, incl all amens. Sec prk Sm pet OK. N/S. $2000. Bryan 604-328-6461.

HOMES FOR RENT

WHITE ROCK: 4 Bdrm exec home (top 2 flrs), 2 sundecks with huge ocean view, 1/2 blk to beach. W/D, D/W, jacuzzi tub, 3 prkg & storage shed. Ref’s. $1850/mo. N/S, sm pet neg. Mar 1. Ph Debbie Dowden @ Hugh & McKinnon, 604-531-1909 or 604-771-4117 or 604-536-4117

741

OFFICE/RETAIL

Rosemary Centre 3388 Rosemary Hts Cres. Surrey, one ground floor office/retail unit 526 sq ft. in quiet Rosemary area.

~ Fir Apartments ~

Call 604-536-0379

2012 FORD ESCAPE XLT 2wd auto 4/cyl, blue, leather, 48K, $13,000/firm. Call (604)538-4883

827

South Surrey: 152nd / 34th Ave. “Sereno” - Gated community, 3 bdrms + den. 2.5 bths, walk to bus clse to Hwy # 99 NS/NP. $1800/mo + utils. Avail now (778)858-2800

ROOMS FOR RENT

OCEAN PARK lrg bdrm, up, furn., sink, lndry. $485. Now. ns/np. Sml portion hydro/gas. 604-535-5953

TRANSPORTATION

S. SURREY 1 Bdrm. Resort retirement living at the Pacifica (walk to Peninsula Village) 1 prkg, lrg patio, grnd level, pet ok. $1800/mo. Call: Milan 604-505-1326

810

2 Bdr. upstairs apt. in back of commercial building in White Rock. N/S, no pets, $900 plus utilities. 604531-6916. lbdm@shaw.ca

SURREY127/61, clean 1 bdrm Jan 15. NS/NP. $600 incl cbl/hydro. Suit quiet person. Refs. 604-596-5591

WHITE ROCK

WHITE ROCK - 1164 Elm Street. 1 Bdrm lower ste - suit sgle person. $750/mo incl heat, h/w and lndry. N/S. N/P. Call 604-538-1630.

Call (604) 541-8857

AAA SCRAP CAR REMOVAL Minimum $150 cash for full size vehicles, any cond. 604-518-3673

Need A Vehicle! Guaranteed Auto Loan. Apply Now, 1.877.680.1231 www.UapplyUdrive.ca

N OT I C E O F R OA D C LO S U R E SURREY CLOSE AND REMOVE THE DEDICATION OF HIGHWAY OF A PORTION OF ROAD ADJACENT TO 6415 and 6469 – 192 STREET AND 19141, 19153 AND 19169 FRASER HIGHWAY, BYLAW, 2014, NO. 18156

White Rock: Central loc. 2 - 1 Bdrm corner units, newly reno’d. Prking, heat, h.water inc. adult oriented. N/S, N/P. Refs. Avail now. Lease req. $825/mo & up. 604-808-6601

Alfred 604-889-6807

Call (604) 541-8857 WHITE ROCK. Feb 1. Corner grnd flr w/hg garden deck. Adult oriented. 1yr lease. Refs. Credit chk, ns/ np, u/g prkg. $725. 778-384-2410 WHITE ROCK, Haighton Manor 1 Bdrm, balc, heat/h/w, quiet bldg, central loc. NS/NP. 604-531-6714 haightonmanor@terracrestpm.com

WHITE ROCK Newly renod 1 Bdrm, $865/mo, 2 Bdrm, $1025/mo. Avail Now. Quiet, well kept building. Hot water incl. Nr shops, bus, & hospital.

Call 604-538-4599

autocredit 911

Auto Financing 1.800.910.6402

This closure is intended to remove the dedication of 1,000.9 square metres of surplus road allowance in order to facilitate the consolidation with the adjacent properties at 6415 and 6469 - 192 Street and 19141, 19153 and 19169 Fraser Highway. In accordance with the Community Charter, approval of the disposition of the road will be considered by City Council at a later date.

WHITE ROCK. 1 Bdrm. Newly reno’d w/beautiful finishes. 1/2 blk to beach. 6 appls. Utils incl. N/S. Avail immed. $1000. (604)788-5593

White Rock - East Beach:

PROPERTY OWNERS

Clean, quiet bldg. Reno’d 1 bdrm 3rd floor. Avail now. Incl heat, hotwater & prkg. Hrdwd floors. Close to mall, grocery, library & all amens. Safe & secure. NonSmoking, No Pets. Crime free multi-housing awards.

NOTICE IS HEREBY GIVEN of the intention of the City Council of the City of Surrey, pursuant to Section 40 and Section 94 of the Community Charter S.B.C. 2003, c.26, to adopt “Surrey Close and Remove the Dedication of Highway of a Portion of Road Adjacent to 6415 and 6469 – 192 Street and 19141, 19153 and 19169 Fraser Highway, Bylaw, 2014, No. 18156” at the Regular Council-Public Hearing meeting on the 3rd day of February, 2014.

WHITE ROCK - 15th & 160th St. 2 Bdrm bsmt suite, new home. Cls to school, bus, shopping. Avail now. NS/NP. $800. (604)590-6813

WHITE ROCK. Bachelor suite. $650/mo incl heat, hot water & basic cable. Sorry no pets. Avail Feb 1st. Call 604-538-8408.

WHITE ROCK

Megan Knight - Executrix

OCEAN VIEW

WHITE ROCK. 2 Bdrm 1 bth. Nr Mall. $1195 inc heat/h. water, w/d Senior oriented. N/S,N/P. Cls to bus. 604-536-9565 / 604-765-9565.

WHITE ROCK: Avail now. 1 Bdrm Heat, h/w, cble & prkg incl. NS/NP, ref’s, adult oriented. (604)385-0275

The Scrapper

OCEAN PARK 1 bdrm / office, quiet area. Suit single prof, N/S, N/P. W/D, utils incl. $850. (604)356-3418

S.SURREY Ocean Park. Newly reno’d grnd flr 2 bdrm ste. Walk to all amens/shops. Shared lndry. Jan 15 $950/mo incl utils. 604-541-9082.

OCEAN PARK. 2 Bdrm, 4 appls, H/W flrs, fenced yard, deck, carport & workshop. $1375/mo + utils. Suit couple or small family. N/S. Refs req’d. 604-536-4188

#1 FREE SCRAP VEHICLE REMOVAL ASK ABOUT $500 CREDIT $$$ PAID FOR SOME 604.683.2200

CREDITORS AND OTHERS having claims against The Estate of JOHN JULIEN COSTE, Formerly of: #106-45650 Patten Avenue, Chilliwack, BC are required to send full particulars of such claims duly verified to the undersigned Executrix at: #1031656 Martin Drive, Surrey, BC, V4A 6E7 on or before February 6th 2014 after which date the estate assets will be distributed having regard only to claims that have been received.

SUITES, LOWER

WHITE ROCK, 1/bdrm top floor. I/S laundry. 1561 Vidal. N/S, N/P. Avail Feb 1. $950/mo. 604-207-9029

..

SCRAP CAR REMOVAL

AUTO FINANCING

WHITE ROCK: 1 bdrm new paint & carpet incl heat, hot water & cable. $850/mo. Sorry n/p. (604)538-8408

3 Bdrm, 2 bath, reno’d, d/w, lrg closets, hrdwd flrs, Incl heat, hotwater & prkg. Quiet bldg close to mall, grocery, library & all amens. Safe & secure. Non- smoking, no pets. Crime free multi-housing awards. $1370/mo incl heat, h/wtr & prkg. Avail Dec 1st.

845

WANTED TO RENT

FEMALE SENIOR wanting to rent studio or small furnished apt in White Rock. Feb & March. Must be in quiet area. Call 604-740-8039.

747B SENIOR ASSISTED LIVING

750

Creditors and others having claims against the estate of BARRIE COHEN are hereby notified under section 38 of the Trustee Act that particulars of their claims should be sent to the Administratrix, RACHEL COHEN LUNNING, c/o Wilson Rasmussen LLP, at #300-15127 100th Avenue, Surrey, British Columbia, on or before February 23, 2014, after which date the Administratrix will distribute the estate among the parties entitled to it, having regard to the claims of which the Administratrix then has notice.

NOTICE TO CREDITORS .DJ AUTOMARKET 604-538-2422

757 746

VEHICLES WANTED

..

Call 536-5639 to view & for rates

S. SURREY; HUGE NEW, clean & bright 1 bdrm on bus route, insuite W/D, full kitchen & D/W, $1000 incl utils. Call 604-538-3781 to view.

Incl heat, h.water, sec u/g pkng & SWIMMING POOL

821 CARS - SPORTS & IMPORTS

Re: The estate of BARRIE COHEN, deceased, formerly of 1444 King George Boulevard, in the City of Surrey, in the Province of British Columbia V4A 4Z4.

CRESCENT BEACH lifestyle, cute & cozy 2 bdrm+sm den 2 lvl cottage 4appls, suits sngl/cple Incl gardener NS/NP $1375+util. 604-649-7115

Great Location Amid Sea & Shops 1/2 Month FREE Rent 1 Bdrm Suites - Avail Now

HOMES FOR RENT

TOWNHOUSES

White Rock 3 bdrm hse new kitchen paint & flrs, large yard, walk to Westbeach. $1200mo. Only serious inquiries please. 604-771-9084

CRESCENT BEACH. 3 bdrm, 2- 1/2 bathroom family home with den, office, 2 FP’s, family room & ample storage. Two storey with large upper deck and fenced yard on quiet street in Crescent Beach. $2,200.00. Min. one year lease. 604-290-5673

736

752

TRANSPORTATION

NOTICE TO CREDITORS AND OTHERS

WHITE ROCK avail March 1. 2 bdrm sunny, lower suite w/own driveway, level entry & walkout patio area. Ocean view, only 2 min to White Rock pier & 5 min to uptown shops & restaurants. Quiet, no-through traffic street. 1 bath, in-suite lndry & gas f/p. All utils & heat incl. $1300/mo NP/NS. Refs req please. Anytime after 6pm 604-535-5899.

SUNNY WHITE ROCK

RENTALS

SUMMERFIELD, 2400sq.ft. 3 bdrm, unfinished basement for storage. Short term ok. $2300, available now. Call 604-536-1397

WHITE ROCK quiet reno’d 1 bdrm 1 blk from mall overlooking park. $875 incls heat, hot water, storage, prkg. No smoking, no pets, ref. required. 778-858-3713.

Skyline Apts

WHITE ROCK. 1 & 2 bdrm suites $850m & $985m inc cble/heat/pkng, ns/np. Avail now. 604-535-0925

www.peacearchnews.com 47

Big or small properties, WE MANAGE IT ALL! Houses needed for qualified tenants for estimate call:

TENANTS Houses/Condos/Townhouses Rental units available now www.bcforrentinfo.ca Office: 604-534-7974 Ext: 205

SOUTH SURREY Short Term or Long term

Sold Your House? Downsizing? Renovating? Just bring Your Clothes. Fully Furnished & Equipped Like New Townhouse. Only 3 years old. Immaculate Deluxe, 2 bdrm. + Rec. Room/Office + 2 Full Bath T/House. Flr. to ceiling storage + storage rm. in garage. 6 s/s appli. d/w, w/d, Garburator. Crown Mouldings, 9ft. ceilings, H/W laminate flooring and slate tile. Gas F/P & Alarm. 1 car garage parking. Covered patio lower & outdoor patio upper. Amenities room incls. full gym, outdoor hot tub & pool. Walk to Morgan Heights shopping. NO Smoking inside & NO Pets! $2350/month. Available March 1.

604.488.9161 S. SURREY 22/174 St. 1 Acre, gated, 3 bdrms, 2 bath, hrdwd flrs & new paint. Pets/smoking ok. Avail now. $2200 + utils. (604)782-5106 WHITE Rock, walk to beach oceanview reno 3bdrm 2bath + loft 5 appl prkg $1700. Feb 1. 604-531-5784

1/bdrm + large den ground lvl ste; suitable for professional, quiet single/couple; 15502 Victoria Ave. W/D; Cat OK w/ deposit; No dogs; Non-Smokers Only; $1150/mo. (incl. utils); 1 year lease. Ref. req’d. AVAIL. Feb/March1st. Date flexible. Call: 604-816-5409.

818

CARS - DOMESTIC

WHITE ROCK, LARGE, BRIGHT, 1 Bdrm, quiet & private. Near the beach. Private prkg & utils incl $895 N/S, N/P. Call: 604-535-4084 WHITE ROCK new very lrg 2 bdrm covered patio, inste lndry, new appl $1300, immed. 604-626-5680 WHITE ROCK / S.Surrey. Spacious newly reno’d grnd lvl 1 bdrm + den suite with priv ent & patio, in quiet c/d/s, walk to East Beach. Insuite laundry, gas f/p, 5 appls & 1 car prkg. NP/NS. $1050 incl utils. Ref’s req’d. Avail Feb 15th. 604-535-8499

751

SUITES, UPPER

WHITE ROCK, Victoria Ave. Ocean view, upper duplex with own fenced yard, garden & large deck. Avail before Feb 1. $1050/mo. Refs req. 604-538-1576 W. R. 2 bdrm + den. Above shops Priv & gated entr. On bus line. w/d, f/s. $1250 inc. heat & h.water. Suit quiet tenants. 1 parking spot inc. Newly reno’d. N/S. (604)536-9886

752

TOWNHOUSES

SERENO 152nd/34th. Great location, near schools. 3 bdrm, 2 1/2 bath, w/Den. Granite throughout. Hardwood floors. Stainless Steel appliances, 9 ft ceilings, Crown Mouldings, Gas Fireplace, Exercise Room. $1850/mo. Avail Feb 1. Call 604-868-0267

2008 FORD TAURUS SEL 111,000/kms. Well maint’d. 1 Orig owner. $7000. 604-597-2774. 2009 CHEVROLET EQUINOX 38,000 kms. One owner. V6. $15,000: Call (604)786-8750

821 CARS - SPORTS & IMPORTS 2007 MERCEDES. A luxury car like no other. This fully loaded Mercedes S550 4-Matic S class. Premium and comfort package includes - navigation, voice command, heated and cooled seats, power rear shades and blinds, premium sound system, panoramic roofs both front and rear. Absolutely has it all. Very clean inside and out. No accidents. 150,000 km. Asking $26,900 obo. Contact me via email for further information at:

jsarowa@shaw.ca or 604-897-1546

Should you have any concerns or comments you wish to convey to Council, please submit them in writing, fax or email to the City Clerk, 14245 - 56 Avenue, Surrey, BC, Fax: (604) 591-8731, email: clerks@surrey.ca, no later than Monday, February 3, 2014 at 4:00 pm. There will also be an opportunity for persons wishing to do so, to make representations to Council at the February 3, 2014 Regular Council-Public Hearing meeting. Copies of the bylaw may be inspected at the City Hall and any inquiries relating to property issues should be made to the Realty Section (604-598-5700) or for inquiries relating to traffic issues contact the Transportation Planning Section (604-591-4146), Monday through Friday (except statutory holidays) between the hours of 8:30 am and 4:30 pm, commencing Thursday, January 16, 2014 up to and including February 3, 2014. City Clerk

www.surrey.ca


48 www.peacearchnews.com

Thursday, January 16, 2014 Peace Arch News

GLUTEN FREE 100% BC Owned and Operated Prices Effective January 16 to January 22, 2014. We reserve the right to limit quantities. We reserve the right to correct printing errors.

Grocery Department Gluten Freeda Instant Oatmeal

Meat Department assorted varieties

4.49

SAVE

SAVE

product of USA

Nuts to You Organic Peanut Butter

35%

from

product of Canada

Wedderspoon Manuka Raw Active Organic Honey 12+

32%

SAVE

500g

32%

14.99

23%

250g product of New Zealand

product of Canada

SAVE from

15 count product of USA

Liberte Classic Yogurt

23-113g • product of USA

25%

34%

bags only

20% off regular retail price 2 pack

Health Care Department

reg 7.99 each

assorted varieties

3.29

2.99

SAVE

product of USA

25%

product of Canada

3.99

assorted varieties

SAVE

25 pack product of Belgium

33%

19.99

Wholesome Country Sourdough Bread

Marinelli Pasta Sauce

5.49

Prairie Natural Hemp Force Protein Powder

Bakery Department

156g

from

750g

Ecover Zero Dish Tabs

SAVE

6.49

Bulk Department Choices Sorghum Flour (Stone Ground)

Zorbas Gluten Free Spanakopitas

! New

3/3.00

each

Amy's Gluten-Free Frozen Burritos assorted varieties

SAVE

5.49

3/3.99

30%

product of Canada

Fair Trade Organic Mexican Grown Avocados from Pragor Coop

500ml • reg 6.99

from

1.98lb/ 4.37kg

Happy Planet Canadian Inspired Soups

50g

assorted varieties

5.99

33%

Deli Department

3/2.97

assorted varieties

SAVE

product of Canada/USA

Enjoy Life Plentils Chips

Two Leaves Organic Tea

BC Grown Organic Red Bulk Beets

6.99lb/ 14.41kg

250g – 430ml

assorted varieties

SAVE

product of Canada

value pack

3/7.50

Hardbite Potato Chips

1.48lb/ 3.26kg

Boneless Skinless Chicken Breasts

assorted varieties

5.49

Organic Granny Smith Apples from Sundance Farm Cawston, BC

6.99lb/ 14.41kg

40g product of USA

Old Dutch Restaurante Chips and Salsa

smooth or crunchy

SAVE

3/4.98

28%

300g

31%

SAVE

Local Lean Ground Beef grass fed, grass forage finished

Kind Fruit & Nut Bars

assorted varieties

Produce Department

3.99

575g

Innovite Magnesium Citrate

All Muffins

740ml product of Canada

11.99

mini or regular

2.99-5.99 Glutino Gluten-Free Pretzels

San Zanone Organic Rice and Corn Pasta

assorted varieties

assorted varieties

6.99

2/4.98

400g product of Canada

product of Italy

Natur-A Almond Beverages

Glutino Gluten-Free Snack Crackers

assorted varieties

assorted varieties

3/5.97

2/4.98

946ml • product of Canada

Gluten Free

250ml

Cruicial to a well functioning cardiovascular system.

Vega One Nutritional Shake

Crazy for Coconut or Nuts and Honey Breakfast Bread

340g

400g

Hemp Protein delivers superior quality protein containing every one of the essential amino acids our body needs.

54.99

2.99-3.99 150g

120g • product of Canada

from 828g

Vega One Nutritional Shake is an all-inone, plant-based supplement, packed with 50% daily intake of vitamins and minerals, protein, fibre, Omega-3, plus antioxidants, probiotics and greens.

Gum it Down

with Red Seal Baker Lisa Wagner and Dietitian Nicole Fetterly January 25 & 26th, 11:00am – 11:45am at the Vancouver Gluten Free Expo Learn how to change your gluten-free baking for the better with Choices’ Own Lisa Wagner and Nicole Fetterly, RD. Find out how to use more nutrient-dense grains and other whole food-based ingredients like chia, coconut and rice bran in place of costly chemically derived gums and binders typically found in gluten-free baking. This is your chance to increase wholesomeness without sacrificing taste and texture. Visit www.glutenfree expo.ca for full details and ticket information.

2010 - 2013 Awards. Your loyalty has helped Choices achieve these awards. Thank you!

Find us on Facebook: facebook.com/ChoicesMarkets Best Organic Produce

Best Grocery Store

Follow us on Twitter: twitter.com/ChoicesMarkets

2010-2013

www.choicesmarkets.com Kitsilano 2627 W. 16th Ave. Vancouver 604.736.0009

Cambie 3493 Cambie St. Vancouver 604.875.0099

Kerrisdale 1888 W. 57th Ave. Vancouver 604.263.4600

Yaletown 1202 Richards St. Vancouver 604.633.2392

Rice Bakery 2595 W. 16th Ave. Vancouver 604.736.0301

South Surrey 3248 King George Blvd. South Surrey 604.541.3902

Burnaby Crest 8683 10th Ave. Burnaby 604.522.0936

Kelowna

Floral Shop

1937 Harvey Ave. Kelowna 250.862.4864

2615 W. 16th Vancouver 603-736-7522


Peace Arch News, January 16, 2014