Page 1

THE WEDNESDAY

APRIL 4, 2012

CANADIAN COMMUNITY NEWSPAPER AWARD 2012

TRI-CITY NEWS Despair and relief

Well, Hello Dolly

SEE LIFE, PAGE 14

SEE ARTS, PAGE 19

www.tricitynews.com

INSIDE

Tom Fletcher/10 Letters/11 A Good Read/15 Community Calendar/18

Man arrested for shooting By Sarah Payne THE TRI-CITY NEWS

A Sur rey man is facing charges in connection with a brazen daytime shooting last September at Mr. Lube in Coquitlam. On Sept. 28, 2011, the suspect allegedly targeted the victim, shooting him multiple times outside the Mr. Lube on Barnet Highway. Nobody else was hurt but the victim suffered serious, potentially lifethreatening injuries; the alleged shooter fled the scene. The Coquitlam RCMP Major Crime Section’s investigation recently involved executing a number of search warrants, the latest at a home in Surrey. Sukhdeep Singh Poony, a 27-year-old Surrey man, faces six charges, including: attempted murder using

TRI-CITY NEWS FILE PHOTO

The Coquitlam RCMP investigation into a shooting last September led to the arrest of a Surrey man. a firearm; possession of a loaded firearm; pointing a firearm; extortion; uttering threats; and assault with a weapon. Poony was scheduled to appear in B.C. Provincial Court in Port Coquitlam Tuesday for a bail hearing. On the day of the shooting, a witness told The Tri-City News the shooter walked right

past his car while he was waiting for an oil change. The suspect did not cover his face and was holding a handgun, he added. RC M P S g t . Pe t e r Thiessen said at the time the victim wellknown to a variety of police agencies throughout the Lower Mainland and added it was likely a targeted shooting.

A tattoo for Beverley B

BOAZ JOSEPH/BLACK PRESS

everley Klein was many things in her 73 years. A doted-on little sister to two brothers. A devoted mother to four boys. A wife, three times over. A sweet little girl who adored her Air Force father, and never dreamed of disobeying him. That is, until recently. Klein was dying of cancer and spending her last days at Crossroads Hospice. It was hospice volunteers who hatched a plan to fulfill a lifelong dream of Klein’s — a bit of giddy rebellion for a woman who has always played by the rules. Klein got a tattoo.

Amreet Dhaliwal of Surrey Football Club Pegasus jumps in front of PoCo United’s Abby Weisgerber during a U-14 girls’ Coastal Cup Youth Soccer game at Surrey’s Hjorth Road Park on Sunday. More sports, see pages 22 and 23.

see WE FINALLY,, page 3

SUBMITTED PHOTO

Beverley Klein with the tattoo artists who made a lifelong dream come true at Crossroads Hospice in Port Moody. A note from reporter Sarah Payne: I was fortunate to meet Beverley Klein for an interview on March 26. It was one of her last wishes to see this story in the newspaper and, despite being gravely ill, Klein was enthusiastic and upbeat throughout the hour-long interview. Much of this story had been written when Klein passed away early Monday, April 2.


A2 Wednesday, April 4, 2012, Tri-City News

www.tricitynews.com

live from port moody

ing • Over 200 Exhibit Companies! s • Fabulous Kitchen • Big Ideas • Lots of Inspiration on • Tons of Informati eas • Energy Saving Id eas • Outdoor Living Id • Show Discounts to S! SAVE YOU THOUSAND

ADMISSION Show Hours:

Friday 5:00 pm - 9:00 pm Saturday 9:30 am - 5:30 pm Sunday 10:00 am - 4:00 pm

HOME

2012

FREE

10th annual spring

EXPO

Tri-City’s Building, Renovation and Decor Show!

April 13, 14, 15, 2012

Port Moodyy Recreation Centre • 300 Ioco Rd, Port M Moody, oodyy, BC

Create your dream home ... our exhibitors will make it easy! Design Seminar Theatre featuring: HGTV’s series The Stagers Bridget Savereux

Interior design g • Renovation Construction Management

Ronnie Vanstone

ssponsored by produced by

www.homeshowtime.com

Show in nfo orm matio on: 1.800.471.1112 DECORATION • DOORS • FLOORING • GARDENING • HEATING • HOT TUBS • LANDSCAPING • RENOVATIONS • SWIMMING POOLS • WINDOWS


www.tricitynews.com

Tri-City News Wednesday, April 4, 2012, A3

‘We finally compromised’ continued from front page It came nearly 60 years after she first asked her father for permission to get one, and was promptly refused.

‘BEAUTIFUL ENOUGH’

The Second World War was looming when Klein was born on Jan. 25, 1939 in Portage La Prairie, Man. Her mother worked as a farm hand while her father, a flight lieutenant who worked in the control tower, was away for long stretches of time. “They were the most awesome, awesome parents you could imagine,” Klein recalled. Neither was overly strict but the house rules were well known and she and her brothers lived by them, plain and simple. Growing up, Klein was fascinated by Canadian First Nations and native American stories, studying the histories of various tribes, and she was particularly drawn to the hummingbird as a personal totem animal because of its protective nature. When she was about 15 years old, she asked her father if she could get a hummingbird tattoo. Her two older brothers had already been refused their requests but Klein, who has always seen tattoos as a “beautiful piece of exotic jewelry,” figured she’d give it a shot. Her dad said no. “He said I was beautiful enough already,” she smiled. She didn’t even consider going against her father’s wishes. “Not because I was afraid of him, but out of sheer respect and love.”

THE HUMMINGBIRD

A few years later, Klein got married and soon added four sons to the family, which eventually settled in Coquitlam. She could have gone to the tattoo parlour then; her father wouldn’t even have to know. But money was tight. “There was always an extra pair of shoes to buy, or a jacket, or someone else to help out,” she said, noting a tattoo was an extravagance the family could not afford. Once the kids were older, she and her husband, Don Klein, spent weekends camping or hitting the road on their motorcycles, so there wasn’t the time to sit in an artist’s chair for a bit of ink.

TRI-CITY NEWS FILE PHOTO

Jerome Bouvier of PoCoMo Youth Services Society in front of Project Reach Out bus. SUBMITTED PHOTO

The final product — a hummingbird tattoo — was inked on Beverley Klein’s arm using felt markers, not needles. “A tattoo was the last thing we needed, so I just kept bumping myself back further and further,” she said. About 30 years ago, Klein told her son’s friend, a member of the Cheam First Nation in Chilliwack, that she’d always considered the hummingbird her personal symbol. He later presented her with an elaborately carved hummingbird cane, and honoured her by making the bird her family’s totem. “I found out it’s one of the highest honours they can give you,” Klein said. It wasn’t the tattoo she was still dreaming of but Klein was deeply touched by the hummingbird gifts and considered her family’s totem a great source of pride. She was always a petite woman but, like the hummingbird, Klein was fiercely protective of her family — and even on the job. She spent more than 15 years as a security guard at the ScotiaBank tower in downtown Vancouver. There were several times when she had to “talk someone out of the building,” but with a calm, steady nature, Klein was never frightened by the work. Don Klein said it’s because she’s always had a sixth sense about people and an uncanny intuition about how things were about to unfold. “I had a feeling about ovarian cancer, too,” Klein said quietly as her husband chatted on the phone in her bright hospice room. She’d had a premonition years ago about the disease but when she fell ill on their annual summer trip to visit friends in Osoyoos last year, Klein thought she had food poisoning. She was wrong. By

the end of the year, after having several surgeries, Klein was in palliative care, and was later moved to Crossroads Hospice.

A SON’S GIFT

About a month ago, Klein’s son, Andy Leepart, was visiting his mom at Crossroads and mentioned an upcoming tattoo appointment. “She got to telling me she had always wanted to get a tattoo but she’d never got it done, and she wished she had,” said Leepart, a Maple Ridge resident. He asked her what she would have done if she’d been able to get the tattoo of her dreams, and Klein told him about the hummingbird. He went home and called his tattoo artist; not knowing how much time his mother had left, he asked to move up his appointment by a couple of weeks. On March 9, instead getting himself inked with the images of skulls and flames that characterize most of his other tattoos, Leepart chose a picture of a bright green hummingbird to go on his right shoulder. It hovers over four pink peonies, representing each of Klein’s sons. He had the drawing framed and presented it to his mother the following day before drawing back his shirt to show her the new tattoo. “I was proud to have it... and she loved it,” Leepart said. “There were tears in her eyes.” Klein was stunned, and humbled. “I would never expect someone to put something I wanted on their body... but I’m so proud.”

FINALLY

Klein wasn’t the only

one who was touched. Hospice volunteers got in on the action and started making calls to see if Klein could get the tattoo she’d always wanted. Elly Hageman and another volunteer eventually found Port Coquitlam’s Ink and Honey. Owner Steve Maidana didn’t hesitate when asked to do a tattoo on a hospice patient. “How can you say no if you have a chance to do something like that?” Maidana asked, and deflected the attention to hospice volunteers. “I did one thing one time, and that’s fine, but those people work there every day, and they need the praise and attention.” So one afternoon, Maidana and tattoo artist Janaya Singer arrived at Klein’s room, and found her giddy with excitement. They got to work and in an hour Klein had a colourful drawing — done with markers, not needles — of a hummingbird and two pink flowers. Ever practical, Klein was happy not have the real thing. “I’m going much sooner than I planned,” she said, “so it’s sort of a waste of money.” Besides, she added, “I never got my tattoo because it was meant to be this way, with the story of my son getting this tattoo. This is more important than having my own.” And what must her father be thinking? Klein figured that, up in heaven, he was probably laughing. “I know my dad loves me, whether this was inked on or not,” she said, glancing at her right forearm. “I feel we finally compromised.” spayne@tricitynews.com

Provincial honour for Coquitlam man Bouvier works with local youth Jerome Bouvier of Coquitlam is one of 35 people named to receive a B.C. Community Achievement Award, it was announced last Friday. Bouvier is executive director of the PoCoMo Youth Services Society

and the innovator of a unique program that reaches out to at-risk youth in the Tri-Cities. Based on establishing relationships with youth, the Project Reach Out Bus travels to areas where youth gather, provides support and services and, as a result, positively affects the lives of young people.

Bouvier also heads up the annual PoCoMo Wheelchair Tennis Classic tournament. Bouvier and the other award recipients will be recognized in a formal presentation April 25 at Government House in Victoria. Each will receive a certificate and medallion designed by B.C. artist Robert Davidson.

Wait, don’t trash those pennies yet, says ERH Auxiliary Every penny counts and the Eagle Ridge Hospital Auxiliary wants your pennies to count for a lot. This fall, the copper coins will fall out of circulation because they cost too much to produce but the auxiliary can put them to good use. (The penny will retain its value indefinitely and can continue to be used.) “Please help us turn pennies and other spare change into hospital equipment for Eagle Ridge Hospital,” Vivian Fraser, a 20-year member of the hospital auxiliary, said in a press release. Fraser said with the

THINKSTOCK

penny going out of circulation, it’s an ideal time for everyone in the Tri-Cities to participate in the Hospital Cent$ program; 100% of Hospital Cent$ revenue is used to buy hospital equipment and patient comforts for Eagle Ridge Hospital, she said.

Since 1976, ERH Auxiliary members have been volunteering and raising more than $800,000 for the purchase of equipment and other items at the hospital. The Hospital Cent$ program was introduced in 2004. Hospital Cent$ donations can be left in the auxiliary gift shop at Eagle Ridge Hospital. The gift shop is open from 10 a.m. to 3 p.m. and 4 to 7 p.m. weekdays, and from noon to 3 p.m. on weekends and holidays. New members are always welcome; call Vivian Fraser at 604544-1470 for more information.


A4 Wednesday, April 4, 2012, Tri-City News

Hunters speak up in Coq. By Janis Warren THE TRI-CITY NEWS

More hunters are lining up to take aim at a proposed city bylaw that would ban bow and arrow and firearm discharge in Coquitlam. This week, Burke Mountain resident Renato Spano spoke to council-in-committee to urge the city not to restrict hunting using guns, which is currently allowed around farmland near the eastern boundary of Coquitlam as well as Goose Island, the foreshore beside the Pitt-Addington Marsh Wildlife Area and the waters of the Pitt River. Later this month, council is expected to hear from Spano’s neighbour, Thaddeus Seidler, who uses a bow and arrow to hunt in Pinecone Burke Provincial Park, which is par tially located within the city limits. Both residents told The Tri-City News the draft bylaw, to which council has already granted three readings, would affect their livelihoods: Spano hunts mig ratory birds for sport — and sometimes with his family — while Seidler hunts blacktailed deer for food. At Monday’s meeting, Spano walked council through the regulations hunters in Coquitlam must adhere to, including obtaining a $1-million liability insurance policy. He described hunters as “conservationists� and “stewards of land� who haven’t caused any problems for the city or police. The incident that prompted the bylaw — bow hunters wounded a bear on a northeast Coquitlam blueberry farm last June and the injured creature wandered for 16 hours in a public park before it was destroyed by con-

PAYING TOO MUCH TAX?

Dale Barkman, FCA

Barkman & Tanaka

MORE PARKING AT CHURCH

A busy Coquitlam church that caters to families and immigrants — as well as its own congregation — will soon have more room for parking. On Monday, after more than 30 minutes of debate, city council granted a temporary-use permit to Hillside Community Church to allow overflow parking on the Austin Avenue property it owns next to its place of worship. The permit is good for three years and will result in a combined 84 parking spots for the church. Much of the discussion about the temporary permit centred around tree cutting, with half of council arguing for a deferral to see the church’s arborist’s report. According to city staff papers, seven trees will get the chop for 27 more spaces on a new gravel parkade. But with Coun. Mae Reid absent from the meeting, the vote resulted in a tie and meant the deferral was defeated; council then unanimously granted the permit. Other Coquitlam council news: Plans to build six detached homes close to a historic Maillardville square are getting mixed reviews from neighbours. On Monday, council awarded first reading to rezone and change the official community plan for 1319 Cartier Ave., where Morningstar Homes wants to build six strata units with a common driveway at the back. Morningstar intends to build in a heritage style similar to the homes built in the 1900s around Laval Square, according to a city staff report. But while some letters from neighbours say they like the design, others expressed concern about potential noise, traffic and parking problems as well as tree loss — a topic that has emerged frequently as the city revitalizes the traditionally FrenchCanadian enclave. The bid is being supported by the Maillardville Residents’ Association. A public hearing on Morningstar’s plans is expected be held this or next month.

servation officers — was “a senseless and stupid act� that gave hunters a

bad name, Spano said. “Let me make one thing perfectly clear:

Those individuals are not hunters. They’re poachers. They’re criminals. And they should be dealt with as such by proper authorities,� he said. Coun. Terry O’Neill said council was “surprised and overwhelmed� to learn hunting was still allowed in Coquitlam, after it introduced its ban, and he argued firearm hunting should be permitted in Coquitlam. Last month, council shot down a motion for a complete firearms discharge prohibition, arguing the city would be acting on emotions and not reason; however, advocates counter Burke Mountain is growing and the shoreline is being used more frequently by nature lovers who would feel uncomfortable with guns firing in the area. In January, the comm i t t e e h e a rd f ro m a Coquitlam hunter who warned the local Canada goose population at city parks would swell if a firearms ban was imposed. I f a p p r ove d , t h e bylaw would not apply to the city’s two gun clubs. Fourth and final reading of the bylaw is expected next month.

604-421-2591



Speak up

Lube Express

The city of Port Coquitlam wants to know how it can get the word out better to its residents. City staff are gauging feedback on city hall’s communication methods via an online survey, which can be accessed at www.portcoquitlam. ca/survey. The survey takes five to 10 minutes to complete and respondents can win one of 10 $20 gift cards for parks and recreation programs; the deadline to enter is April 30. Results of the survey are confidential and will form part of the city’s first strategic communications plan. In 2010 and last year, PoCo was honoured by the Union of BC Municipalities for its outreach efforts with social media. “The city is committed to providing residents and the business community with infor mation they need – whether it’s day-to-day information about services, or how to have their say about city activities,� Mayor Greg Moore said in a news release.

DRIVE-THRU OIL CHANGE - No Appointment Necessary ry

Radiator Flush Service Lube, Oil & Filter

59 34

Recommended every 48,000 kms.

GTX all oil grades, most cars & pickups. s. With FREE top up of all fluids

REG. from 69 00

REG. 3898

00 $

$

98

DRIVE HARD

Plus taxes and Enviro fees. Expires April 10/12. 2724A Barnet Hwy., Coquitlam (Opposite Milestones)

T

604-942-8088 Mon.-Sat. 8-6, Sun. 9-5 PLEASE PRESENT COUPON

N`cjfe :\eki\ ;\ekXc :c`e`Z

+$)(/,N`cjfe8m\%#Gfik:fhl`kcXd#9%:% 8Zifjj]ifdk_\Gf:fI\Z%:\eki\ 8Zifjj]ifdk_\ Gf:fI\Z%:\eki\k_\K\iip=foC`YiXip k_\K\iip=foC`YiXip

;i%<[dfe[C` =Xd`cp;\ek`jkip

<m\e`e^Xe[JXkli[XpXggf`ekd\ekjXmX`cXYc\

E\ngXk`\ekjXi\n\cZfd\ G_1-'+$0+)$.)(-Â&#x203A;=Xo1-'+$0+)$.)+-

jwarren@tricitynews.com

Waste Collection Notes

Port Moodyâ&#x20AC;&#x2122;s Cityy Wide City-Wide Garage Sale Saturday, April 21 Turn trash into treasure at Port Moodyâ&#x20AC;&#x2122;s 5th annual City-Wide Garage Sale! Register your house at www.portmoody.ca or sign up at City Hall by April 11, 2012. Weâ&#x20AC;&#x2122;ll then advertise your sale in the paper and online at no cost. If you have gently used goods youâ&#x20AC;&#x2122;d like to give away, this is also your chance. Weâ&#x20AC;&#x2122;re adding a re-usable component to our garage sale for the first time this year - itâ&#x20AC;&#x2122;s a great way to kick-start spring cleaning! Bargain hunters, look for participating houses online after April 13, 2012.

1. No waste collection on Easter Monday Please note that there is no waste collection in Port Moody on Easter Monday (April 9). Hereâ&#x20AC;&#x2122;s a revised schedule for April 9 to 13, 2012.

Mon Easter Monday

Tues 9 If youâ&#x20AC;&#x2122;re

No waste collection

City Hall/Library/Theatre P.O. Box 36, 100 Newport Drive, Port Moody

t www.portmoody.ca

Wed

Thurs

Fri

10 If youâ&#x20AC;&#x2122;re in 11 If youâ&#x20AC;&#x2122;re in 12 If youâ&#x20AC;&#x2122;re in 13

in Mondayâ&#x20AC;&#x2122;s zone, your recycling and green waste is collected today.

Tuesdayâ&#x20AC;&#x2122;s zone, your recycling and green waste is collected today.

Wednesdayâ&#x20AC;&#x2122;s zone, your recycling and green waste is collected today.

Thursdayâ&#x20AC;&#x2122;s zone, your recycling and green waste is collected today.

2. Hop to it this holiday! We all love Easter eggs, but theyâ&#x20AC;&#x2122;re one of the most over-packaged products on the market. A huge cardboard box, plastic molding to hold everything in place, shiny foil wrapping â&#x20AC;&#x201C; all to hold one little hollow egg! Consider buying chocolate eggs with minimal packaging â&#x20AC;&#x201C; choose ones that are only wrapped in foil or buy in bulk. Instead of buying Easter grass for your baskets try shredded newsprint, brown paper bags or magazines. Itâ&#x20AC;&#x2122;s a great way to re-use materials that can be tossed in your green cart later, or repurposed as packing material.

Chartered Accountants

Adjacent to the Lougheed Mall #225 - 9600 Cameron Street Burnaby, B.C.

www.tricitynews.com

City Hall/Library/Theatre P.O. Box 36, 100 Newport Drive, Port Moody

t www.portmoody.ca


www.tricitynews.com

Teen arrested following lockdown at Best school A 16-year-old boy has been arrested in relation to the lockdown last week at Dr. Charles Best secondary school. Coquitlam RCMP Cpl. Jamie Chung said the teen was arrested in the early morning hours of March 29, the day after the lockdown occurred at the Coquitlam school. He is now facing two criminal charges for failing to comply with conditions of an undertaking from a prior charge, which include abiding by a curfew and not having a cell phone. “The lockdown was necessary because the information we received was very serious and the safety of everyone at or around the school was paramount to us,” Chung said in a release. At about 2 p.m. March 28, Best principal Mary O’Neill recognized the young man, believed to

BACK BY POPULAR DEMAND

Prime Rib Weekends AT ROCKWELL’S

TRI-CITY NEWS FILE PHOTO

A 16-year-old boy was arrested the day after Dr. Charles Best secondary school in Coquitlam was locked down last week. be a former student, and escorted him off school grounds. There was also an unconfirmed report that he had a gun. School protocol is to initiate a lockdown and have students stay in their classrooms until police confirm it can be lifted. Parents were being asked to pick up their kids at the nearby Coquitlam Alliance Church until the lock-

down was lifted shortly before 4 p.m. “ T h i s i n d iv i d u a l caused havoc to everyone who works or studies at Charles Best secondary and to the community around the school,” Chung said. “In addition, his actions had many parents worried about the safety of their kids.” There was no weapon found at the scene or during the arrest.

The teen, who cannot be named due to provisions in the Youth Criminal Justice Act, is scheduled to appear in B.C. Provincial Court in Port Coquitlam today (Wednesday). Chung said it’s possible that as the Crown reviews the file, there may be additional charges stemming directly from the lockdown. spayne@tricitynews.com

Beware door-to-door scam A Tri-City resident is warning people about a door-to-door scam. In an email, the man, who did not say what area he lives in, wrote that a man and woman came to his door and said they had locked their keys in the car with it running. The pair said they had called Mundy Towing but were short $15, adding Mundy must receive payment before they retrieve the keys out of the car. “They are very desperate sounding and the woman offers to stay

Tri-City News Wednesday, April 4, 2012, A5

until the man returns from a bank machine,” the man wrote. “They are very persuasive... It may be human nature to want to help people in a jam and they take full advantage” He gave them $20 but did not see them again for repayment. Coquitlam RCMP Cpl. Jamie Chung said police receive occasional reports of a scam similar to this one, not necessarily because they are rare but because not everyone reports the incident. Other news: The B.C. Securities

Commission’s (BCSC) criminal investigations team has arrested a Coquitlam man for fraud and theft. According to the BCSC, a woman gave the suspect approximately $345,000 to invest between October 2004 and May 2008. “The Crown is alleging he used that money for purposes other than what he promised the woman he would do with it,” said Richard Gilhooley, spokesperson for the BCSC. Following a lengthy i nv e s t i g a t i o n , t h e

BCSC, with the help of Coquitlam RCMP, arrested Amir Beiklik at his home on March 6. He has been charged with two counts of fraud over $5,000 and theft over $5,000. Gilhooley said if Beiklik is convicted, the BSCS can impose administrative penalties such as a market ban or prohibitions on trading, but those sanctions aren’t necessarily automatic. Beiklik’s next court appearance is on April 10 at B.C. Provincial Court in Vancouver. spayne@tricitynews.com

CONGRATULATIONS!

SALESMAN OF THE MONTH JANUARY 2012 / FEBRUARY 2012 Kerry & Denzil

Kerry Renaud

NORTH VANCOUVER

wish to thank their customers for helping them gain this award. They invite all their past clients, friends & family to Carter GM, North Shore AutoMall and view the new & exciting lineup!

Succulent slow roasted prime rib served with Yukon Gold Mashed Potatoes and seasonal vegetables

$

95

16 6

Available every Friday, Saturday and Sunday A at the Rockwell’s location in the Coquitlam Best Western.

Enjoy our famous Sunday Brunch Buffet from 10 AM to 2 PM. Reservations recommended.

Make Your Easter Day Brunch Reservations Now!

April 2012

April Long Weekend Holiday Hours Facility Hours for the April Long Weekend

Coquitlam City Hall April 6, 7, 8 and 9 . . . . . . . . . Closed Coquitlam Animal Shelter April 6, 7, 8 and 9 . . . . . . . . . 10:00 a.m. to 4:00 p.m. Pinetree Community Centre April 6 . . . . . . . . . . . . . April 7 . . . . . . . . . . . . April 8 . . . . . . . . . . . . . April 9 . . . . . . . . . . . . .

. . . .

. . . .

. . . .

Closed 8:30 a.m. to 10:00 p.m. 8:30 a.m. to 10:00 p.m. Closed

Dogwood Pavilion April 6, 7, 8 and 9 . . . . . . . . . Closed Glen Pine April 6, 7, 8 and 9 . . . . . . . . . Closed Centennial Activity Centre April 6, 7, 8 and 9 . . . . . . . . . Closed Poirier Community Centre April 6, 7, 8 and 9 . . . . . . . . . Closed

Denzil Owen

CARTER’S

604-987-5231 • 800 AutoMall Drive North Shore Auto Mall • North Vancouver • We carry a full line of GM products!

Poirier Sport & Leisure Complex April 6 . . . . . . . . . . . . . . . . April 7 . . . . . . . . . . . . . . . . April 8 . . . . . . . . . . . . . . . . April 9 . . . . . . . . . . . . . . . .

8:00 a.m. to 9:00 p.m 6:00 a.m. to 10:00 p.m. 6:00 a.m. to 10:00 p.m. 8:00 a.m. to 8:00 p.m.

City Centre Aquatic Complex - No lessons on April 6 & 9 April 6 . . . . . . . . . . . . . . . . 10:30 a.m. to 10:30 p.m. April 7 . . . . . . . . . . . . . . . . 5:30 a.m. to 10:30 p.m. April 8 . . . . . . . . . . . . . . . . 7:00 a.m. to 10:30 p.m. April 9 . . . . . . . . . . . . . . . . 10:30 a.m. to 10:30 p.m.

www.coquitlam.ca


A6 Wednesday, April 4, 2012, Tri-City News

Ready to vote in the April 19 byelection? Advance polls among options for Port MoodyCoquitlam voters T h e Po r t M o o dy Coquitlam byelection will be a three-way race after candidates were confirmed by the filing deadline Monday. C h r i s t i n e C l a rke is running for the BC Conservative Par ty, Dennis Marsden is running for the BC Liberal Party and Joe Trasolini is the candidate for the NDP. As the race heats up, Elections BC is ramping up its public relations campaign to get people out to vote, announcing where and when people can cast their ballots on April 19. “B.C. voters have tremendous access to voting opportunities that reflects the diverse needs of today’s voter from student to senior,” stated Keith Archer, chief electoral officer, in a press release. “If voters aren’t sure of where to vote I encourage them to contact us.” During the byelections, voters may vote: • at their assigned voting place on April 19 from 8 a.m. to 8 p.m.; • at advance voting locations in their electoral district from 8 a.m. to 8 p.m.; • at any other general or advance voting place under absentee rules; • or if they can’t make it to a voting place, they may vote at the district electoral office or vote by mail until general voting day.

CLARK

MARSDEN

TRASOLINI

BYELECTION12

PORT MOODY-COQUITLAM APRIL 19

DEBATES

On Monday, the Port Moody-Coquitlam candidates dusted off the gloves in a one-hour debate on CKNW’s Simi Sara Show. Fielding questions from Sara as well as callers, Marsden, Clarke and Trasolini clashed on issues such as post-secondary education funding, the economy, gas prices, TransLink funding and candidate and party trustworthiness. Locally, the candidates will face-off in two all-candidates meetings on the following dates: • The Tri-Cities Chamber of Commerce will hold an all-candidates meeting on Wednesday, April 11 from 7 to 9 p.m. at Inlet Theatre in Port Moody city hall. • Burquitlam Community Association is inviting the candidates and members of the public to attend its meeting, which will take place in the gym at Sir Frederick Banting middle school (820 Banting St., Coquitlam). The meeting will run from 7 and 9 p.m. on Thursday, April 12. Both meetings are open to the public. For more information and a complete list of advance and general voting day voting loca-

tions, visit the Elections BC website at www.elections.bc.ca. dstrandberg@tricitynews.com

www.tricitynews.com

Dahlby, of PoCo, runs for Hope L e w i s D a h l b y, a 58-year-old Port Coquitlam resident, is running under the Libertarian banner in the ChilliwackHope byelection. Nominations for the April 19 byelection in Chilliwack a n d i n t h e Po r t Moody-Coquitlam byelection closed at 1 p.m. Monday. It’s not clear why Dahlby is running in the Chilliwack-Hope riding when he lives in Port Coquitlam. The candidate said he had trouble getting nomination booklets out for signatures while working and looking after family at the same time. “Unlike the other parties, we don’t have a whole team and a whole crew working for us,” he said. “For people who love freedom, I’m providing that choice for them.” D a h l by i s t h e four th candidate in the ChilliwackH o p e bye l e c t i o n contest; the others are NDP candidate Gwen O’Mahony, BC Conservative candidate John Martin and BC Liberal candidate Laurie Throness.

+ +

+

+

+ +

+

+

+ +

Notice of Public Input Opportunity Business Bylaw Amendment No. 3796 Tuesday, April 10, 2012 at 7:00 pm

Amazing PoCo Trivia Fact #97

Did You Know? Robert Hope was Port Coquitlam’s 9th mayor, serving in ofÀce from 1960 to 1966.

Council Chambers, Third Floor, Port Coquitlam City Hall 2580 Shaughnessy Street, Port Coquitlam, BC PLEASE TAKE NOTICE THAT pursuant to Section 59 of the Community Charter, the City of Port Coquitlam may, by bylaw, establish regulations for businesses. The proposed Business Amendment Bylaw includes a de¿nition change for the word “Business” and reduces the current ATM fee from $500 to $170. A copy of proposed Bylaw, cited as the “Business Amendment Bylaw, 2012, No. 3796” may be inspected until 4:00 pm on Tuesday, April 10, 2012, in the Corporate Of¿ce, City of Port Coquitlam, 2580 Shaughnessy Street, Port Coquitlam, BC, V3C 2A8, between the hours of 8:30 am to 4:30 pm, Monday to Friday, except any statutory holidays or at www.portcoquitlam. ca/getinvolved. If you wish to comment on the Bylaw, you may write to me prior to the meeting, or attend the Council meeting of Tuesday, April 10, 2012, at which time you will be given an opportunity to be heard, or to present a written submission. On April 10, 2012, Bylaw No. 3796 will be considered for ¿nal reading. Susan Rauh, CMC Corporate Of¿cer 604-927-5421 corporateof¿ce@portcoquitlam.ca

Sponsored by

TRI-CITY NEWS

www.portcoquitlam.ca/getinvolved

www.portcoquitlam.ca/volunteer

+

+ +


www.tricitynews.com

Earth Hour effort lacks juice Save energy all year

THE TRI-CITY NEWS

The Tri-Citiesâ&#x20AC;&#x2122; efforts for Earth Hour were dim, with all five municipalities ranking near the bottom for B.C. cities taking part in last Saturdayâ&#x20AC;&#x2122;s global initiative. Despite its heavy promotion of the annual climate-change event, Port Coquitlam dropped a mere 2% in electrical consumption between 8:30 and 9:30 p.m. on March 31. Still, the reduction was the best in the region, with BC Hydro registering a 1.85% decline each in Coquitlam and Port Moody, and a 1.82% power savings in Anmore and Belcarra. That compares with Revelstoke, which recorded the highest decrease in the province with a drop of 12.1%, followed by Pemberton at 6.8% and Ladysmith at 5.8%; Houston captured the worst score with a 0.1% decrease in power consumption. Pardee p Purewal, PoCoâ&#x20AC;&#x2122;s communications manager, said in the two weeks leading up to Earth Hour, the city encouraged residents and businesses â&#x20AC;&#x201D; as well as its own employees, the Business Improvement

THINKSTOCK

Despite many people turning out the lights, the Tri-Citiesâ&#x20AC;&#x2122; power consumption didnâ&#x20AC;&#x2122;t drop much during Earth Hour. Association and School District 43 â&#x20AC;&#x201D; to join the campaign by finding daily energy savings such as tur ning off non-essential lights and power sources. City council also recognized and proclaimed Earth Hour at its March 19 council meeting and staff offered tips on its website. As for Coquitlam, where council last week adopted a Community Greenhouse Gas Reduction Strategy targeting emissions for land use, transportation, buildings, energy supply and solid waste, the cityâ&#x20AC;&#x2122;s energy manager, Trevor Billy, pointed out that Coquitlamâ&#x20AC;&#x2122;s score was better than the provincial average of 1.67%. â&#x20AC;&#x153;We are happy that the city experienced a decline in energy consumption but it is im-

portant to note that the city and residents should continue to be aware of energy use throughout the year as well,â&#x20AC;? Billy said. â&#x20AC;&#x153;We have a number of operational and behavioural initiatives going on in the city to reduce corporate energy emissions all year. And we always encourage residents to find out ways to reduce their own power use throughout the year.â&#x20AC;? Earth Hour is an hour-long lights-out event created by World Wildlife Fund designed to show people how they can take part in a climate solution. Major landmarks around the world went dark during the allotted time period And 91 communities across B.C. registered their participation in Earth Hour.

Ten tips to reduce energy use year-round, from portcoquitlam.ca: â&#x20AC;˘ Use LED lights to replace existing light bulbs. â&#x20AC;˘ Unplug appliances (coffee makers, toasters) when not in use. â&#x20AC;˘ Lower the thermostat by four to five degrees when sleeping and when no one is home. â&#x20AC;˘ Turn off computer monitor or computer when not in use. â&#x20AC;˘ Unplug chargers for phones, iPads, etc. â&#x20AC;˘ Wash laundry in cold water. â&#x20AC;˘ Hang laundry to dry or select a lower drying setting. â&#x20AC;˘ Clean or replace furnace filters periodically. â&#x20AC;˘ Wash a full load in the dishwasher and airdry dishes on the energy-saver setting. â&#x20AC;˘ Turn off lights when leaving a room.

Experience the beneďŹ ts of Low Intensity Laser Light Therapy

THIS WEEKâ&#x20AC;&#x2122;S SPECIAL

A/C, PW, PL, PM, cruise Stk#M60040AA GS Ltd., CD, FM, PW, PL Stk#P1354

â&#x20AC;&#x153;Thanks to laser treatments (6 treatments) and a course of vitamins, a very bad skin disorder over my legs and left hand cleared up. I had this problem for over 6 months. Thanks again.â&#x20AC;?

HST

- Dan Scott (67)

EXEMP

T

COVER MOST EX ED BY HEALTHTENDED -CA PLANS RE

Foot Pain due to fracture â&#x20AC;&#x153;...my mobility has returned and the pain has gone!â&#x20AC;?

CD, radio, keyless entry, Stk#C97481A

2002 Cadillac Escalade

A/C, PW, PL, roof, PM Stk#C73979A

2004 Toyota Corolla

$11,880

PW, CD, radio, PL Stk#M36173A

$8,880

2009 Dodge Caliber

$12,880

AC, PW, keyless, roofrack Stk#P1347A

$10,880

2008 Mazda 3 Sport GT

$7,880

Keyless, sunroof, CD Stk#P1402

$16,880

2010 Mitsubishi Outlander

$17,880

Auto, one owner, P/W, P/L, A/C Stk#P1406

$17,880

Dealer aler 30875

Experience the OpenRoad Difference

THIS WEEKâ&#x20AC;&#x2122;S SPECIAL

2008 Volkswagen Rabbit Trendline 2007 Lexus LS 460 SWB

$16,980 $15,222

2010 Lexus RX 350 Pr. 2 Pkg. AWD

2011 Ford Flex Ltd AWD, 6-speed auto, A/C, PW, PL, premium audio. Stk#B0328

6spd auto, A/C, PW, PL, sun/moon roof,

$43,980

2007 Toyota Camry LE

$32,980

5spd auto, A/C, PL, keyless entry, cruise, AM/FM-CD-aux. Stk#B0324

5spd manual, A/C, PW, PL, sun/moon roof, AM/FM-CD-cass. Stk#IK6348A

$8,999

2010 Toyota Corolla CE Local, no ICBC claims, auto, A/C, CD, power locks & windows, keyless entry. Stk#B0319

604-461-7623

$15,680

Financing & Lease starts at 3.8% oac

$15,980

www.openroadlexus.ca

Experience the OpenRoad Difference

$21,980

2002 Honda Accord Coupe SE

2010 Toyota Corolla CE 4spd auto, A/C, PW, PL, heated mirrors, AM/FM-CD-aux. Stk#B0317

8spd auto, A/C, PW, PL, sun/moon roof, AM/FM-CDchanger-aux. Stk#B0326

Dealer 30266 THE PURSUIT OF PERFECTION.

Scion tC

Fully Loaded From $ +3 É&#x2019;+3/ /HQJLQH S Scion cion cio ion nt tC C $ É&#x2019;3DQRUDPLFPRRQURRI FullyL Fully lly Loaded Loaded oadedF oa o From rom    É&#x2019;3RZHUZLQG GRZVPLUURUV ORFNV É&#x2019;+3 É&#x2019;+3 +3 +3/H 3 /HQJLQH 3/HQ /HQJLQH QJLQH JLQH JLQ

É&#x2019;3DQR É&#x2019;3DQRUDP É&#x2019;VSHHGPD S DQXDOWUDQVPLVVLRQ RUDPLFPR LFPRRQUR LFPRRQUR RQURRI RI É&#x2019;3RZHUZ É&#x2019;3RZHU 3R HUUZLQGRZV LQGRZVP PLUURUV LUURUV OR ORFNV FNV LEASE FROM É&#x2019;VSHHG É&#x2019;VSHH É&#x2019;V HGPDQXD H PDQXDOWU OWUDQVP DQVPLVVLR QVPLVVLRQ Q

$

LE LEASE EA ASE FROM

Frt and PDI, levy and HST extra Payment Pay yme ent includes a Customer ustomer t d down wn payment p y of Payment y inclludes$1,5 rCdown payment of $1,500, $1,500, $ ,5 500, 00, p plus a matching matchi contributio t ibutio bution n from fro f m Scion FORplus 2011 SCION Sci S cion i of $1,500g, for a total $1,500, pALLa REMAINING matchin cion down payment ayment nt of $3,000. $ $3,000 3S ,000 0 0.*.* MODELS FINANCE FROM OAC. of $1 $ ,500 $1, 500 , PLUS for r a tot total al dow down n paym y ent0% of $ $3 ,000. ,00 0.

$

2 234 34 3 4

$M

1,500 OFF MTH

)258 )25 83720 72 0 07 7+)258372 6258 )258 ) )2 2 837207 72 07+6 07+6

604-461-3656 Dealer D7826

www.openroadscion.ca

M Experi Experience Expe rien ence ce the the OpenRoad Ope penR enR nRoa oad oa d Diff D Di Difference iff ffer eren er ence en c TM ce Why Wh hy buy buy a Sci Scion ion, wh whe hen yo hen you ca can n ow own n an Ope Ope p nRoa nRoa nR oad ad Scio Scio Sc ion? n? ?

OpenRoad

316 6 St. Johns St ., Por t Moody

Golden Spike Ln Ln.

St. Johns St.

Moray ay St St.

one block east of Coquitlam Centre

Find us online at: www.tricitynews.com

Buller er St. S

www.laserlighttherapyinc.com

Expires April 21, 2012. Please allow 2 days preparation.

ORDER YOUR FRESH TURKEY AND DOUBLE SMOKED HAM FOR EASTER!

604-461-9111

Dr. P. Bennett

Unit 215 - 3030 Lincoln Ave.

149

$

www.openroadmazda.ca

Laser Light Therapy

Lincoln Centre, Coquitlam

4 BACON WRALOIN BEEF TENDER STEAKS

2008 Mazda CX-7

$14,880

- Douglas Browne (55)

778.28.LASER 778.285.2737

* *BONUSPP ED

2005 Kia Sedona EX

- William (52)

Wound

WEEK

8 - 8 oz. New York Steaks 8 - 8 oz. Rib Eye Steaks 3 lbs. Lean Ground Beef 3 lbs. Baby Back Spareribs 2 lbs. Lean Bacon 6 Centre Cut Pork Chops 4 Salmon Burgers 3 lbs. Boneless Chicken Breasts

2008 Mazda M3 Sport

â&#x20AC;&#x153;...after just 7 sessions, I feel much better. I can now walk and go up and down stairs without pain at the end of the day.â&#x20AC;?

â&#x20AC;&#x153;...on the fourth day I had my 3rd and ďŹ nal 30-minute treatment. The outbreak was ďŹ nished and my lip felt and looked as good as new.

A

SPRING BUNDLE

2004 Mazda RX8

Local, showroom condition. Auto, A/C, premium sound system. Stk#B0336

Cold Sore

D AY S

Âł 153 point safety inspection and reconditioning Âł Professional detail Âł ICBC history Âł Lien free guarantee Âł Exchange guarantee Âł Invitation to Ownerâ&#x20AC;&#x2122;s Night Âł Warranty Available

Knee Pain

- Gail Locke (48)

7

SELECT PRE-OWNED

â&#x20AC;&#x153;...after 2 sessions of laser treatment, the pain and numbness disappeared! ...months later, the pain and numbness has never returned!â&#x20AC;?

- Stephen M (46)

OPEN

OpenRoadAutoGroup AutoGroup

CD, PW, PL Stk#P1255B

Neck Pain

MEATS

ÂŽ

DIRECT

PAYMENT AMERICAN EXPRESS

Locations in ONE

jwarren@tricitynews.com

Say Goodbye to Pain

BURQUITLAM PLAZA 604-936-5221

â&#x17E;¤

By Janis Warren

Tri-City News Wednesday, April 4, 2012, A7

N


A8 Wednesday, April 4, 2012, Tri-City News

Stewart’s legacy will help those in need Scholarships will be given out in name of late Coquitlam man The first round of scholarships named after a late Coquitlam resident who left behind a small fortune for SFU students and medical patients will be doled out next month. D a l e C l a rke, e x ecutive director of the Coquitlam Foundation, said the philanthropic organization will be awarding the James Gordon Stewart scholarships at its annual gala on May 29 at the Everg reen Cultural Centre in Coquitlam. Before he died in December 2009 at the age of 83, Stewart directed in his will that the foundation distribute $355,588 to help people with Alzheimer’s and kidney disease as well as Tri-City students attending Simon Fraser University. Clarke said the scholarships will be handed out according to applicants’ marks, community involvement and financial need while the charitable money

SUBMITTED PHOTO

James Gordon Stewart left more than $355,000 to the Coquitlam Foundation for philanthropic works. will be disbursed on a request basis. It is not known why Stewart chose to benefit research and patients with Alzheimer’s but Terry O’Neill, the foundation’s publicist (and a

Coquitlam city councillor), said Stewart left a legacy for people with kidney problems as his daughter, Marilyn Louise Stewart, died from the disease in 2008. In a press release,

Lorraine Gerard, executive director of the B.C. branch of the Kidney Foundation of Canada, said her group is “honoured and grateful to be named as one of the charities that Mr. Stewart’s foundationdirected fund will help support.” S t e w a r t l ive d i n Coquitlam for more t h a n 5 0 ye a r s a n d worked in sales, the fuelsupply business and wine marketing. O’Neill said Stewart “displayed a knack for investing” in his retirement years. The newly created fund comes as the Coquitlam Foundation marks its 20th year. It now manages about $2.2 million in foundationdirected and donor-advised funds. To donate, send cheques to PO Box 2, 1207 Pinetree Way, Coquitlam, V3B 7Y3 or visit www.coquitlamfoundation.com.

www.tricitynews.com

? ACUPUNCTURE

Are you in PAI N

TRY

BC MEDICAL COVERAGE AVAILABLE

Jane can help with such problems as:

• Arthritis • Shingles • Deftness • Allergies • Infections • Backaches • Rheumatism • Over-weight • Sciatica • Knee/Neck/Shoulder Pain • Migraines • Headaches • Hemorrhoids, Stroke, Facelift • Insomnia • Coughs & Quitting Smoking

1st Treatment

2 Treatment FREE Jane’s Acupuncture Clinic Jane Wang g 604-942-9239 36 years experience e

2 LOCATIONS TO CHOOSE FROM:

Lincoln Centre #240 – 3020 Lincoln Ave., Coquitlam

3068 – 8700 McKin Way, Richmond

jwarren@tricitynews.com

City of Coquitlam

Road & Utility Improvements Please use alternate routes to avoid delays. ™ North Road/Clarke Road – Ebert Ave. to Morrison Ave. Construction of new watermain replacement by Pedre

Speak up! You can comment on any story you read at www.tricitynews.com

Make sure your leftover food scraps go in your Green Can for recycling this Easter.

New to town? Getting married? Having a baby?

Remember not to add any food wrappings or plastic to your Green Can!

...if so, a warm welcome awaits you from your hostess and the local merchants

Contractors Ltd. 604-881-2411. Phase 1 (South of Foster Ave. to Smith Ave.) boulevard restoration underway. Phase 2 (Smith Ave. to South of Como Lake Ave.) water connections in progress. Phase 3 (Clarke Rd. / Como Lake Ave. intersection area under construction involving night work (Mon. to Fri. 7 p.m. Fri p m to 6 a.m.) a m ) Phase 4 (Clarke Rd. Rd / Como Lake Ave. Ave intersection to Morrison St.) construction involving some night work has commenced. Traffic pattern changes and lane closure will be in place. Expect delays. (see ad elsewhere for more details).

™ Brookmere Neighbourhood Waterworks and Paving Rehabilitation – Storm and sanitary inspection chambers March 5 to June 1 installation by Ace Excavating in area bounded by Whiting Way, Ebert Ave, Denton St, and Perth Ave starting with Ebert Ave. Denton Street will include water line replacement. Traffic control will be in place. Ace Excavating Ltd. 604 421-5778.

™ Huron Drive and Oneida Drive – watermain replacement and relocation – Construction of new watermain replacement and relocation starting April 2, 2012. Traffic control will be in place. Work to take place Monday to Thursday 7:00 a.m. to 6:00 p.m. by City construction crew, 604-927-6247.

™ Port Mann/Highway 1 Improvement Project For details and updates, visit www.pmh1project.com

™ Spuraway Avenue / Beach Court Watermain Relocation – Relocation of water services on 2600 Spuraway Ave. Block and Beach Crt nearing completion by contractor Ace Excavating Ltd. 604 421-5778. Traffic control will be in place.

Green Can Program, call us at 604-927-3500 or visit us online at www.coquitlam.ca.

1-866-627-6074 www.welcomewagon.ca www.coquitlam.ca

Visit www.coquitlam.ca/Road-UtilityProjects for details Engineering and Public Works Customer Service Line: 604-927-3500. Open 24 Hours/7 Days a week.

www.coquitlam.ca


www.tricitynews.com

Gas taxes jump 2 cents Metro Vancouver prices not far from all-time highs

Tri-City News Wednesday, April 4, 2012, A9

SAVE MONEY! BUY DIRECT

FROM THE PROCESSOR WHOLESALER!

By Jeff Nagel

There ere is Still Time to Get Your our E Easter teer H Ham m

BLACK PRESS

(C ((Closed Clo C Closed loosed sed Good se G Friday) Frrid F dayy)) Part Skin Bone-In Fully Cooked

BLACK PRESS

Motorists are now shelling out two cents a litre in gas taxes to cover the costs of building the Evergreen Line, but prices are set to rise higher, experts say.

HAMS $ 99 $ 39 1. 4. /lb

European Sausage usaagee & M Meeaatts, s alll maadde on sitte. e. Specialty Meats, Poultry, Cheeses, European Specialty Foods, RedBro Chickens. Natural products available.

“YOU’LL BE GLAD YOU CAME”

1606 Kebet Way, Port Coquitlam Just East of the Mary Hill Bypass @ Broadway

604.472.9995

139

Dr. D. Ma PRACTICE LIMITED TO

Periodontics (Gum Treatment)

MARY HILL BYPASS Tri-City News

KEBET WAY

Pitt River Bridge

Splashes

also: Easter Egg Hunt Egg Decorating Workshop Face Painting Wiggle Cars Inflatable Play Zone and more!

CERTIFIED SPECIALIST IN ORTHODONTICS

Dr. P. Rostamian

Mon - Fri • 9 am - 5 pm | Sat • 10 am - 4 pm

Saturday April 7, 12 - 3pm

F Free C Consultation... lt ti Limited Time Offer CALL FOR DETAILS

Extractions & IV Sedation

Homemade Soups & Salads

Easter Eggstravaganza

$

Dr. T. Lee

LUNCHES DAILY Full of flavour!

at the

ZOOM Whiteningg

Dr. B. Yu

1 LB. SANDWICHES

Meet the EASTER BUNNY

Smile! Cosmetic Dentistry

/kg

*W WHO WH HO H HOLE OLE LE PIECES PIIECES P CES CE ONL ONLY N Y

WY.

We’ll give you that beautiful

going higher yet.” Prices in this region were also driven higher after a fire in February knocked a refinery out of service at Cherry Point, Wash. It’s expected to resume operations this month. Pump prices don’t have far to go to hit alltime record territory. Metro Vancouver drivers briefly paid $1.50 a litre in the summer of 2008 when crude oil prices spiked. jnagel@blackpress.ca

H HEED LOUG

either undergoing maintenance shutdowns or switching from winter to summer gas blends, he said, so there’s less supply now and more potential for prices to shoot higher yet due to market forces. On top of that, gas prices normally rise in spring as more drivers take to the road. “We’re heading into a high gas price season with high prices to start with,” Coupal said. “So it’s likely prices are

WAY KINGS

ers were paying an average of $1.25 per litre, reaching a recent high of $1.44 on March 28 before easing late last week to about $1.425. Gasbuddy co-founder Dustin Coupal said the tax increase appears to cement Vancouver’s status as having the highest gas prices in Canada, slightly above some east coast cities. And Coupal doesn’t expect any relief for motorists this spring. Many refineries are

BROADWAY ST.

Metro Vancouver motorists are now paying an extra two cents per litre to TransLink every time they fill up. The TransLink tax increase from 15 to 17 cents a litre took effect April 1 and prices immediately ticked up. The hike will generate $40 million a year and is dedicated to covering TransLink’s $400-million capital contribution to the $1.4-billion Evergreen Line to Port Moody and Coquitlam. According to the price-tracking website gasbuddy.com, Metro Vancouver prices were averaging $1.437 per litre by Monday, up more than a cent from Friday. But the price at the pump has moved much more due to other factors in recent weeks. G a s p r i c e s h ave climbed sharply since early February, when Metro Vancouver driv-

For all your dental needs New Patients & Emergencies

ALWAYS WELCOME Most dental plans accepted

Dr. F. Rezaie Root Canals GENERAL PRACTITIONERS

Dr. P. Chedraoui Dr. D. Behan Dr. L. Ng Dr. A. Lai Dr. M. Aletomeh

GREAT NEW LOCATION

Complete Care in Comfort SINCE 1985

Lower level near Sears, Coquitlam Centre

604-464-1511

HOURS: Mon., Tues. & Sat. 8 am – 6 pm, Wed., Thurs. & Fri. 8 am – 9 pm, Sunday 11 am – 6 pm

Easter Egg Hunt and Wiggle Cars limited to children 3 - 12 years old or under 4· (wiggle cars). Parents with proof of receipt(s) from any Henderson Place Mall store will receive one Easter Eggstravaganza activity passport for each accumulative total of $30.00 from March 15 - April 7, 2012. Easter Eggstravaganza activity passports can also be purchased for $5.00 each. An activity passport grants the child one (1) face paint, two (2) eggs, and access to other activities. All Easter Eggstravaganza activities are subject to availability.

Henderson Place Mall

|

1163 Pinetree Way

|

604.552.6130


A10 Wednesday, April 4, 2012, Tri-City News

TRI-CITYY OPINION

www.tricitynews.com

KEEP IN TOUCH

Newsroom: Delivery: Display Ads: Classified Ads: Website:

604-525-6397 Q newsroom@tricitynews.com 604-472-3040 Q circulation@tricitynews.com 604-525-6397 Q admanager@tricitynews.com 604-575-5555 Q ads@bcclassified.com www.tricitynews.com

PUBLISHED & PRINTED BY BLACK PRESS LTD. AT 1405 BROADWAY ST., PORT COQUITLAM, B.C. V3C 6L6

Shop healthy

PICTURE THIS Adrian Raeside

T

he Canadian Society for Exercise Physiology wants children to move more and sit less, essentially, so they won’t become fat. The group wants them to grow up healthy and this past month released what it says are the first guidelines for the “early years.” Not surprisingly, they call for less screen time in front of TVs, computers, iPods and smart phones. Kids today undoubtedly spend a lot of time staring at such screens — watching videos and playing games, browsing and texting. But many are also very active, walking to and from school, playing hockey, soccer, baseball, lacrosse or rugby, taking part in track and field, martial arts or dance. They ride bikes, inline skate and skateboard. They stroll the streets with friends. Still, many are overweight. The main reason isn’t so much screen time as it is what they put into their bodies: sugar and fat. And it’s not just pizza and pop, hamburgers and fries, chips, donuts or cookies. So-called sport drinks can contain as much sugar as a slushee. Speciality coffees and hot chocolate are also loaded with calories. We consume such products despite healthy eating programs devised and promoted by our provincial government, even though we know better. We do so out of convenience and because many items that aren’t healthy taste good. So have a little, not a lot and not often. Families are busy but still have time to shop. So don’t buy a big bag of chips or a flat of pop, Buy more fruits and vegetables, whole grains and lean meats. Grow lettuce and berries out of pots on your back deck. Turn off the TV, the video game console, take away the iPods and cellphones, cook and eat together as a family, even if only once or twice a week. It’s a good habit to get into, as is going for a walk or gardening or cleaning the house. People are busy but they can also be lazy. But parents can start by setting a good example for their kids, and hopefully they’ll develop the healthy habits they’ll need for a long life. – The Maple Ridge-Pitt Meadows News (Black Press)

Gentleman John Cummins? Well, not so much BC VIEWS Tom Fletcher VICTORIA n an interview with one of Black Press’ Vancouver Island papers before Christmas, BC Conservative leader John Cummins made a bold prediction that he would have party status before the general election in May 2013. That’s four seats, and it wasn’t based on an unlikely sweep of the Chilliwack-Hope and Port Moody-Coquitlam byelections, now set for April 19. He hinted he was getting calls from MLAs looking to join up after a November Angus Reid poll showed a sudden surge to 18% for his resurgent brand. We now know that one of those callers was Abbotsford South MLA John van Dongen. I asked Cummins on Friday if he is still confident about three more. “Hopeful, let’s put it that way,” he replied. Van Dongen’s explosive departure was

I

2012 CCNA

arranged, with Cummins’ help, for maximum damage to Premier Christy Clark. Van Dongen notified the BC Liberal caucus that he was quitting. Then, in a questionable use of legislature privileges, he launched a broadside on Clark’s integrity. He cited the $6-million legal payout in the BC Rail sale, a decision made before Clark’s time, and the recent collapse of a deal to sell naming rights to BC Place. He described the BC Liberals as “an organization headed for failure,” then announced he’s joined the Conservatives. Cummins then joined van Dongen at a hotel news conference across the street as the former Gordon Campbell cabinet minister disclosed he has hired his own lawyer to dig through the roomful of paper from the BC Rail case once again. Auditor General John Doyle is already in court seeking access to details of the $6 million in lawyer bills, which the attorney general’s ministry hasn’t provided because it doesn’t have them. These delicate matters were farmed out to yet more independent lawyers.

TRI-CITY NEWS [CCAB AUDITED CIRCULATION 53,469 (MARCH 2009)] 1405 Broadway St., Port Coquitlam, B.C. V3C 6L6 telephone: 604-525-6397 • fax: 604-944-0703

Independent special prosecutor Bill Berardino also spent seven years and many more millions on the BC Rail case, including the role of Clark’s lobbyist brother, Bruce. He didn’t find the smoking gun now sought by van Dongen. This effort seems designed more for political revenge in an election year than to clarify the sorry legacy of the BC Rail sale that has already been examined through two provincial elections. Van Dongen was at the top of everyone’s list of disgruntled BC Liberals. During last year’s leadership contest, he muttered darkly about not only BC Rail but, also, the integrity of fellow Abbotsford MLA Mike de Jong. Now Clark is van Dongen’s target, with Cummins standing beside him trying to look statesman-like. Of course, van Dongen drove himself out of cabinet long before Clark returned. Chronic speeding by a public safety minister is a tough sell. I asked Cummins about the reluctance of key cabinet ministers Kevin Falcon and

George Abbott to confirm they are running again. His aw-shucks friendly-grandpa modesty precludes speculation but he did allow it’s “maybe a comment on the state of affairs in the Liberal caucus.” Reporters started surveying government MLAs after Falcon and Abbott kept their options open for 2013. For the record, fellow ministers Terry Lake, Shirley Bond, Pat Bell, Mary Polak, Rich Coleman and Stephanie Cadieux all said they are firmly on Clark’s election team. Independent-minded backbenchers Bill Bennett and Kevin Krueger also saluted the BC Liberal banner. Randy Hawes allowed that he’s 65, so if he leaves, it will be for the golf course. As I was talking with Cummins, BC Conservative advisor Randy White was assuring The Abbotsford News that more defections are coming. Cummins has people for the dirty work. Tom Fletcher is legislative reporter and columnist for Black Press and bclocalnews.com. tfletcher@blackpress.ca

Nigel Lark publisher Richard Dal Monte Don Layfield editor advertising manager Diane Strandberg Mike Kingston assistant editor production manager Lisa Farquharson Kim Yorston regional classified manager circulation manager

Q LEGALITIES THE TRI-CITY NEWS is an independent community newspaper, qualified under Schedule 111, Part 111,

Q CONCERNS THE TRI-CITY NEWS is a member of the BC Press Council, a self-regulating body of the province’s news-

Paragraph 11 of the Excise Tax Act. It is published Wednesday and Friday by Black Press Ltd. Copyright and/or property rights subsist in all display advertising and other material appearing in this issue of The Tri-City News. Second class mailing registration No, 4830 The publisher shall not be liable for slight changes or typographical errors that do not lessen the value of an advertisement. The publisher’s liability for other errors or omissions in connection with any advertisement is strictly limited to publication of the advertisement in any subsequent issue or the refund of any monies paid for the advertisement.

paper industry. The council considers complaints from the public about the conduct of member newspapers. Directors oversee the mediation of complaints, with input from both the newspaper and the complainant. If talking with the editor or publisher of The Tri-City News does not resolve your complaint about coverage or story treatment, you may contact the BC Press Council. Your written concern, with documentation, should be sent within 45 days to B.C. Press Council, 201 Selby street, Nanaimo, B.C. V9R 2R2. For information, phone 1-888-687-2213 or go to www.bcpresscouncil.org.


www.tricitynews.com

Tri-City News Wednesday, April 4, 2012, A11

TRI-CITYY LETTERS

CONTACT Please send letters to: email: newsroom@tricitynews.com fax: 604-944-0703 • Phone: 604-525-6397

Glen dog park too Coalition showing strain Speak up! close to the school The Editor, As longtime residents of Coquitlam and parents to two young children, we are quite concerned with the city’s Glen Park project. We have one child attending Glen elementary school and another who will be attending kindergarten in September. Although I think it is wonderful that the city has plans to develop/ improve the green area behind the school, I wonder what it is thinking by placing an off-leash dog area directly behind the school fence. As parents to a child who is terrified of any dog, it scares us thinking about her playing on the playground with dogs of all breeds and sizes directly behind the fence. Because we live close to Lafarge Lake, we frequently use the park during the spring and

terrified of dogs that she runs the opposite way when she sees any dog. She is so terrified that if she saw dogs behind the fence, she wouldn’t even venture out onto the playground. School is meant to be a place of learning as well as a place of play. Shouldn’t every child have the opportunity to play on the playground and shouldn’t every parent know that they can send their child to school and they will be safe on school grounds? The city should go ahead and make its plans to improve the green area and make that area enjoyable for all residents of this city but please rethink the decision to place an offleash dog area directly behind the school fence. Please keep our children safe. Diego and Kathleen Epherre, Coquitlam

summer. Last weekend, as we enjoyed the beautiful weather and spring-like conditions in the park, we noticed a large number of offleash dogs. Although we don’t currently have a family dog, we do advocate having some sort of off-leash park in the city. We would much rather that the city has an off-leash park than see people allow their dogs to run off-leash in every public park in the city. But we do not advocate having such a park directly behind an elementary school, with hundreds of small children playing on the playground. There are too many dogs in this city that are deemed “vicious” breeds. What if one of those dogs jumped the fence and attacked a small child? Is that not an accident waiting to happen? Our daughter is so

The Editor, After more than a decade in government, the BC Liberal Party, a coalition of former Social Credit, Conservative and, well, Liberal supporters, is showing the strain. On a rising tide of public grievance that c o m e s f ro m b e i n g long in power, coupled with the under tow of a resurgent BC Conservative party, this coalition is looking fairly fragile. A breakdown here would fragment the non-NDP vote, with the for merly-strong BC “Liberals” splitting into se parate, weaker, Liberal and Conservative blocks. It seems inevitable. Like

a train wreck unfolding before our eyes, it’s hard to look away. While everyone flying their own true colours for a change would be a good thing, and having more voices in the arena a very good thing, it does create problems in our first-past-the-post elections, which don’t work well with more than two significant voting blocks. Such elections are often decided on the largest plurality rather than a majority, and that is not a democratic best-practice. We need to resurrect electoral reform. Yes, we’ve had two referenda on this and both failed — narrowly — although both did have

rriding prefsingle-majority superential port, as I ballot, such b You can comment on recall. But as instant a any story you read at both votes rrunoff votwww.tricitynews.com were on the iing (IRV). This is exact same an eassy change inquestion, STV: proportional representavolving o only how we tion, with a preferential mark the ballots and ballot. how we count them, I voted for this the and requires no change first time, despite the to electoral boundaries, proportional represen- yet it solves first-pasttation, because of the the-post issues and adpreferential ballot, and dresses many concerns I voted against it the of proportional represecond time, despite sentation proponents. the preferential ballot, It’s a win-win. because it was made all The current governthat much clearer how ment is in a position to proportional represen- make this happen — it might not be again. I tation would play. Let’s just skip the urge it to do so, in the proportional represen- best interests of all. tation with a simple, Ron McKinnon, single-member-per- Port Coquitlam

TD Canada Trust

Pay a little more towards your mortgage each month

Take time off when you want Take a Payment Vacation

Find out how to take advantage of new flexible mortgage features today. We know how important managing your mortgage is. We also know how important it is to live life to the fullest. That’s why a TD mortgage offers a range of flexible features that helps you balance both. Take our Payment Vacation. With it, you arrange to pre-pay a little more each month and work towards the opportunity to take time away from your mortgage payments when it benefits you the most.1 Staying at home with a new baby, finishing that degree, taking a sabbatical or something else entirely – the choice is yours. Get in touch with us today to discuss how our flexible mortgage features can help you get the most out of life.

www.tdcanadatrust.com/home

604-930-9750

Store Hours Mon.-Wed. & Sat. 9:30-5:30 Entry 1015 Columbia St. X inhidden corner I.G.A. Thur. & Fri. Columbia Square Plaza Royal Ave. 9:30 - 9 www.fabriclandwest.com Sun. 12 - 5 NEW LOCATION

NEW WEST 604-525-0074

10th Street

Store Hours Mon.-Wed. & Riverside Heights Sat. 9:30-5:30 14887 - 108th Ave. Thur. & Fri. 9:30 - 9:00 Sun. 11-5:00

Colu mb Columbia ia S t. Square Plaza

Banking can be this comfortable

£

SURREY

1-888-632-9469

Subject to approval. Conditions apply. ®/ The TD logo and other trade-marks are the property of The Toronto-Dominion Bank or a wholly-owned subsidiary, in Canada and/or other countries.

1


A12 Wednesday, April 4, 2012, Tri-City News

www.tricitynews.com

It’s All About Kids! Hi ‘N’ Bye

The Learning Experience p “Join Us For Some Educational Fun!” /-0-1-2

KINDERCARE 2-1-0-/ PRESCHOOL + + AFTERNOON PRESCHOOL + +

Preschool Program 4 Hour Programs

-OUT OF SCHOOL CARE-GROUP CARE CENTER-

+ Morning Preschool + Out of School + Group Care +

REGISTER NOW!

for

Offering Your Children 25 years of excellent servi Terry or Susan

2012 / 2013

CHOCOLATA EASTER

EGGSTRAVAGANZA Sat.,Apr. Apr. 37rdth Sat,

WE OFFER: FT/PT Childcare 12 months - 5 years

• Before / After school care (7am - 6pm)

LEARN through PLAY! Developing social, emotional, physical, and cognitive skills in a safe, fun-loving environment. • Fully Qualified Educators • Fully Licensed by Fraser Health • Preschool Curriculum

Register Now For 2012/2013 Come & visit us at

1438 Pinetree Way (Grizzly & Pinetree)

604-942-3688 Jennifer

9:30 11:00am am 9:30 to to 11:30

LICENSED DAYCARE

• Montessori Full Day Program (7am - 6pm)

• Choice of 5, 4, 3 Day Programs

Register for Fall 2012

We are located on the Rochester School Grounds • hinbyepreschool@gmail.com www.hinbyedaycare.com • 604.937.5437

(604) 942-5008

• Kindercare AM & PM

E D U C AT I O N C E N T R E

Now Accepting Registrations

Limited Preschool Available. (On IrvineSpaces School Grounds)

• Montessori Preschool AM or PM

WHITE SWAN MONTESSORI

Your family is invited to attend Coquitlam Christian Centre’s

Learning Centre Inc. Coquitlam

Infant / Toddler Care & Daycare

604-944-9990

101 - 511 Rochester Street, Coquitlam

to reserve for your family

Easter Worship Services 10:30 am Easter Sunday Celebration Service

www.alegriachildrencare.com

Near Eagle Ridge GM

ENROLL TODAY!

3433 Coast Meridian Rd. Port Coquitlam

www.ccc-church.ca

www.rainforestlearningcentre.ca

604.475.7727 alegriachildcare@gmail.com

Coquitlam Christian Centre canyon sp 1-8H_Smr2010

2665 Runnel Drive, Coquitlam

604-931-SWAN (7926)

• Full Day Montessori Program • Montessori Full Day Kindergarten (Min. of Independent School) • Montessori AM/PM Preschool

REGISTER NOW FOR JULY/SEPT 2012

Childcare Ages Birth - 5 years

PANCAKE BREAKFAST AND EASTER EGG HUNT Due to limited space please phone

PRESCHOOL & KINDERGARTEN 800 Edgemont Ave. (off Robinson, off Como Lake) at MILLER PARK COMMUNITY SCHOOL, Coquitlam QUALIFIED CARING STAFF WARM NURTURING ENVIRONMENT 2, 3, 5 Day Program, AM & PM All Day Montessori - 9:00 am - 3:30 pm Full Montessori Program includes Language - Math - Science French - Music - and Much More!

1

604.880.0397

Webb’s Holiday Acres Horseback Riding Children’s Camp

April 10th - 9:00am April 12th - 7:00pm May 1st– 9:00am May 10th– 7:00pm

Thank you to those who attended our Tea & Fashion Show Fundraiser. It was a HUGE success!

34th Anniversary

• Beginners to experienced • Heated swimming pool • Weekly sessions • Volleyball/Basketball • Trail rides & 1/2 mile track court

• Weekly sessions 6 -PM 14 4/20/10ages 3:11:25 • From $398 - $505 including taxes • 40 minutes from Vancouver

BCCA Accredited

604-857-1712 • www.webbsholidayacres.ca Friendship Baptist Church invites children age 10 and under to their

Community

A Tri-City Pre K-12 Christian Education Alternative Since 1992

“C” Our Story

2910 Walton Ave., Coquitlam canyonspringsmontessori.com 604-945-0566

Email: admin@canyonspringsmontessori.com

BC CHRISTIAN ACADEMY

A big thank you to our local sponsors who supported our recent “Ladies Tea & Fashion Show Fundraiser”: x Rona (Coast Meridian St) x White Spot (Ottawa St) x Creekside Fashions x Cobs Bread x Save on Foods (Ottawa St) x PoCo Produce x Millennium Meats x Accent on Hair Salon x Pharmasave (Coast Meridian) x Ocean Day Spa x Royal Bank (Coast Meridian) x Meridian Meats x Cora’s Restaurant (Coquitlam) x IHOP Restaurant (Coquitlam) x MTF Price Matters (Aldergrove) x Heidi Dowell x Coopers Foods x Safeway (Shaughnessy St) x Antiquity Spa

• Before/After School Care (serving Walton Elementary) • Specialty Programs include Music, Dance, Drama & French • Ages 2 1/2 - 6 years

B & D MONTESSORI LEARNING ACADEMY Montessori Full Day Program Montessori AM/PM Preschool Montessori Kindergarten Out of School Care Program We provide your child with: • Excellence and efficiency in students’ preparation for both Montessori and regular school system • Highly educated and experienced Montessori and E.C.E. licensed teachers • An attractive classroom designed with New Millennium approach • Language, Mathematics, Science, Music, Dance and French lessons.

1187 Eagleridge Drive., Coquitlam 604-464-6447 www.bdmontessori.ca

Easter Egg Hunt

Saturday, April 7, 2012 10:00 a.m. FREE

Drop-in for a fun time • Egg hunt and treats • Crafts • Games • Face painting • Bouncy castle for age 5 and under

indoors if raining 2950 Dewdney Trunk Road, Coquitlam (corner of Lougheed Hwy and Dewdney Trunk Road near the pedestrian overpass)

604.945.8500 www.friendship-bc.com

A new option for parents: Join the

Sasamite Nature Club!

This 5-day program is just for youngsters.

Ages 3-5 – 3hrs/day

Explo

.. tep. S h c Ea ring Nature Safely With

For more information, or to come “C” Our Story, please call us @

604-941-8426

Or visit our website:

www.bcchristianacademy.ca

www.sasamat.org


www.tricitynews.com

Tri-City News Wednesday, April 4, 2012, A13

Drop-in closes, name change for centre By Diane Strandberg THE TRI-CITY NEWS

Public drop-in hours at the Women’s Resource Centre in Port Coquitlam will be discontinued but Tri-City Transitions will continue to schedule appointments for women who need resources and support, says the group’s executive director. Carol Metz Murray said the house located at 2420 Mary Hill Rd. will continue to provide educational, specialized and targeted programs but will no long er staff drop-in hours for women. As well, the name of the Women’s Resource Centre will be changed, Metz Murray said, to reflect the fact that men, as well as women, are utilizing services to reduce violence and abuse

DIANE STRANDBERG/THE TRI-CITY NEWS

The drop-in at the Women’s Resource Centre in Port Coquitlam is closed for good but women can still schedule appointments, says Tri-City Transitions executive director Carol Metz Murray. against women. In future, the building, leased from the city of Port Coquitlam, will be called the Family Resource Centre. The staffing change will allow T ri-City Transitions to do more follow-up work with

CREATE YOUR STYLE

Get the cutting-edge looks you crave from our expert team of pro stylists

women who leave the Transition House to return to the community. Metz Murray said

former residents of the house operated by TriCity Transitions for women fleeing abuse could fall through the cracks without regular follow-up. “We will now be able to fill that gap,” said Metz Murray, “I am really excited about that.” The changes aren’t likely to please the women who used to use the facility, Metz Murray acknowledged, but women will still be able to call the resource centre at 604-941-6311 if they need support, resources or referral. “They will still get services but in a specialized way,” she said. In the future, if funding becomes available,

Peace of Mind Service

the house could be used as more of a centre for families and Tri-City Transitions will also look at ways to utilize the kitchen facilities and the community garden. “We’re just starting out [in this new direction], one step at a time,” she said. The future of the internet services for job searching is uncertain, however, because TriCity Transitions doesn’t want to duplicate services being offered by a new WorkBC employment services centre in Port Coquitlam. That office is open for drop-in and is located at 206/208 2540 Shaughnessy St. dstrandberg@tricitynews.com

All work and repair done on premise. Services:

*Chains soldered............$9 *Retipping(each) ............$9 *Watch batteries.............$9 *Rings sized down........$18 *Rings sized up.............$25 *Safety chains ...............$22 *Insurance replacement *Appraisals *Pearl Restringing........$50 *Diamond setting .........$25 *Clean and Polish.........$10 *Two Ring Solder .........$30 *Three Ring Solder ......$50

Ramin Kasiri

* Conditions apply

Master Goldsmith

Since 1997

GOLDSMITH

604.461.3426

124-221 Ioco Road, Port Moody, B.C.

www.askara.ca

(next to IGA)

HAPPY

From your friends at Hidden Hills Shops & Services

• Cut & Style • Color & Highlights • Blowouts & Updos • Hair Extensions • Feather & Accent Extensions • Men’s Cuts 2107 - 2850 Shaughnessy St., Port Coquitlam, Shaughnessy Station

VANITY HAIR

604.464.8813

11 STORES TO SERVE YOU Admax Laser Tech Apex Chiropractic Flamingo Carpets & Rugs Ltd. Imagine Laserworks Live Love Dancewear Maximum Performance Fitness Poh & Associates Physiotherapy Clinic Sem. East Academy Ltd Dr. Yang Education Centers Review Hair Sportmed 4 U Day Spa

604-789-3525 604-942-8838 604-345-3800 604-464-8847 778-285-3335 778-865-3648 604-941-8754 604-552-3093 604-468-8899 604-942-4938 604-468-5818

Hidden

s l l i H

Shops & Services 3200 Westwood Street,

Port Coquitlam

Just North of the railroad tracks


A14 Wednesday, April 4, 2012, Tri-City News

www.tricitynews.com

TRI-CITYY LIFE Dementia and de-stressing

CONTACT Send notices & releases to: email: newsroom@tricitynews.com phone: 604-525-6397 • fax: 604-944-0703

Business owner aims to crack dementia code

IN QUOTES

“If we can manage those behaviours, they may be able to stay home longer and families won’t be burnt out as quickly.”

By Diane Strandberg THE TRI-CITY NEWS

Karen Tyrell, dementia educator

K

aren Tyrell jokingly calls herself the “dementia whisperer” but the nickname may be apt as she has as many problem-solving techniques and solutions as there are challenging behaviours. You name it, Tyrell, has seen it in her years as a therapeutic support worker for people with dementia. The signs of dementia are as varied as the people who acquire the debilitating disease: repetitive actions that seem to make no sense; wandering; disruptive or inappropriate behaviours — all of it looking like crazy behaviour unless you are the caregiver who is dealing with it and watching your trusted loved go into decline. “They feel guilty. They feel a loss of hope,” Tyrell said of caregivers. “That’s the stage where families are struggling. They don’t know how to cope.” While putting someone in a care home is one option, and some anxiety-reducing drugs will calm some patients, Tyrell believes nonpharmacological interventions offer promise and can keep people at home longer, in familiar environments where they do best. With her newly established consulting business, Personalized Dementia Solutions (www.dementiasolutions.ca), Tyrell offers hope for families walking down this dark and rarely discussed path to a calmer, more peaceful future. “If we can man-

Seniors, explore food at Dogwood Pavilion

THE TRI-CITY NEWS/DIANE STRANDBERG

Karen Tyrell, a dementia educator, with a game called Qwirkle that is good for exercising the brain of people with dementia. Tyrell helps caregivers find innovative ways to deal with the challenging or unwanted behaviours exhibited by some people with dementia. In addition to providing in-home consultations and practical solutions, Tyrell also offers free workshops for caregivers and teaches the required training for certified dementia practitioners through her business. age those behaviours, they may be able to stay home longer and families won’t be burnt out as quickly,” she explained. Typically, caregivers call Tyrell as a last resort. A partner or grandparent is wandering and getting lost; or they are relieving themselves in the corner of the living room; or they pace endlessly or ask the same question over and over, and then they get angry or abusive when challenged. Many of these behav-

iours are simply reflections of the individual’s particular history or reality. Memory is like an onion, said Tyrell: When the most recent memories peel away, the raw emotions of an earlier time are left behind. With so much pain, suffering, worry or even boredom at the centre of these behaviours, Tyrell advises getting to the heart of the matter using a technique called therapeutic reasoning to talk the patient out of their agitated state. It involves

more or less agreeing with the dementia sufferer to create a calm feeling. You acknowledge the problem, said Tyrell, but offer a solution, such as “Your sister is looking after the children” or “The cows have already been milked, aren’t we lucky!” These may seem like evasive strategies, but they do work. “All behaviour has meaning,” explained Tyrell, saying the caregiver needs to get into the head of the dementia sufferer to under-

stand them. In her experience, the wandering person is trying to get to a place that features prominently in an earlier memory — a former home, perhaps — or they may be looking for their children or their mom and dad. Sometimes, a solution is to tire the person out or remove a memory trigger, such as a coat rack, so they don’t see their coat and think of leaving. Tyrell describes a condition experienced by some dementia suf-

If you’re 50 or older, you can expand your cooking skills and knowledge of food with instructor Monica Hanser on Mondays this month at Coquitlam’s Dogwood Pavilion. Themes are: • April 16: cooking on a budget; • April 23: gluten-free recipes; • April 30: diabetes-friendly recipes. Classes run from 1 to 3 p.m. and each one costs $20 plus tax for Dogwood members, $25 plus tax for others; pre-registration is required. Alternatively, people 19 years and older can join wine steward Laura Murray as she educates you about wine and basic tasting techniques. You can sample reds and whites, and practise evaluating wine. Class takes place April 19 from 6:30 to 8:30 p.m. and costs $15 plus tax for members, $20 plus tax for others; pre-registration is required. For more details about these and other programs or Dogwood membership, or to register, call 604-927-6098. Dogwood Pavilion, a city of Coquitlam rec centre for people 50 years and older, is located at 624 Poirier St., at the corner of Poirier and Winslow. newsroom@tricitynews.com ferers called “sundowning,” where they get restless, usually at a time of day where they would have been active in an earlier part of their life, such as getting home from work or making a meal. She advises hiring a support worker who can keep the patient busy with brain-stimulating activities, such as puzzles, sorting games or art therapy, even reminiscing, often followed by a walk, which reduces their anxiety and prepares them for a

restful evening. “A lot of families don’t know this, they aren’t taught this,” said Tyrell. “But there are simple things that you can do.” • The next free workshop on Cracking the Dementia Code for all care gi v ers is available Friday, May 25 at Dogwood Pavilion from 1 to 2:30 p.m. Karen Tyrell will also be available for free consultations at the Shoppers Drug Mart at Burquitlam Plaza on April 26. dstrandberg@tricitynews.com


Check out some classics A GOOD READ Lynda Watson

B

ooks that have stood the test of time and are still relevant and enjoyable to read are considered classics. Here are a few to consider: “If everyone fought for their own convictions there would be no war.” – Leo Tolstoy, War and Peace War and Peacee may not be a good choice for those with commitment issues — it is not a quick read - but, like any good relationship, it is well worth the effort. The cast of characters is vast but you will soon get to know the main ones such as Pierre, Natasha and Prince Andrei. Tolstoy’s philosophy of war and peace is fascinating, as is the description of the Russian struggle with Napoleon. “She had been forced into prudence in her youth, she learned romance as she grew older: the natural sequence of an unnatural beginning.” – Jane Austen, Persuasion Pride and Prejudice is the usual recommendation of Jane Austen’s work but I would like to propose Persuasion n as well. It is a thoughtful, romantic story with Austen’s usual humour — this is satire, after all. The only danger to reading Austen is that her use of language is so exquisite that she ruins you for other authors. “His designs were strictly honourable, as the phrase is; that is, to rob a lady of her fortune by way of marriage.” – Henry Fielding, Tom Jones The original title of the book is The History of Tom Jones, a Foundling. Tom Jones is another longish book but it is also worth the time put into it. When it was written, Tom Jones was one of the first books to be referred to by the new term “novel.”

The book was radical for its time because of its raciness but it is also full of humour. The character of Tom Jones is extremely likeable in spite of his faults because he has such a good heart and he learns from his mistakes. “There is no happiness in love, except at the end of an English novel.” – Anthony Trollope, Barchester Towers This book and the rest of the Barchester novels are essentially about the ambitions and schemes of various characters in an English cathedral town. There are misunderstandings, power struggles and plenty of plotting amongst the characters (Mr. Slope is particularly memorable), all of which contribute to the comic irony of the story. “Some folk want their luck buttered.” – Thomas Hardy, The Life and Death of the Mayor of Casterbridge: A Story of a Man of Character Known more simply as The Mayor of Casterbridge, this book tells the tragic story of a man who sells his wife and baby daughter to the highest bidder after he drinks too much rum at a country fair. He vows to give up alcohol for 20 years and works his way up to becoming the mayor of the town of Casterbridge. When his wife and daughter find him 18 years later, his life starts to unravel. The various decisions he makes and consequences of his actions make up the rest of the story.

“Music and woman I cannot but give way to, whatever my business is.” – Samuel Pepys, Diary The diary of Samuel Pepys is a record of several years of one busy man’s life in 17th century London, and is a fascinating glimpse into the past. Although Pepys is far from perfect, it’s hard not to be impressed by the energy and intelligence of the man. As well as his personal life, he writes of events he was a witness to, such as the Black Death and the

London fire of 1666. Lists of classics can be found online. One popular source of recommendations is Oprah; several of the books she recommends are classics, such as those by Charles Dickens, William Faulkner, John Steinbeck and Leo Tolstoy. As well, be sure to check with your local library staff for even more great classics. A Good Read is a column by Tri-City librarians that is published every Wednesday. Lynda Watson works at Terry Fox Library in Port Coquitlam.

STORES FLYERS DEALS COUPONS BROCHURES CATALOGUES CONTESTS PRODUCTS STORES FLYERS DEALS COUPONS BROCHURES CATALOGUES CONTESTS PRODUC PRO DUCTS TS STORES STO RES FLYERS FLY ERS DEALS DEALS COUPO COUPONS NS BROCHURES CATALOGUES CONTESTS PRODUCTS STORES FLYERS DEALS COUPONS BROCHURES CATALOGUES CONTESTS PRODUCTS STORES FLYERS DEALS COUPONS STORES FLYERS DEALS COUPONS BROCHURES CATALOGUES CONTESTS PRODUCTS STORES STO RES FLYERS FLY ERS DEALS DEALS COUPO COUPONS NS BROCHU BRO CHURES RES CATALO CAT ALOG OGUE GUES CO GUES CONT ONTEST ESTS S S PR PRO ODUCTS ODUC ODU S ST S STO TORE ORES FLYERS ORES S DEALS DEA LS COU COUPON PONS PON SB BROC ROCHUR ROC HURES HUR ES CAT CATALO ALOGU ALO GU

YOUR CHANCE TO WIN A

1000

$

Tri-City News Wednesday, April 4, 2012, A15

Easter fun TAX RETURNS

Children five years and older are invited to share some afterschool fun tomorrow (Thursday) at Coquitlam Public Library with puppet show and a craft. The Poirier branch event runs from 3:30 to 4:15 p.m. April 5. This free program is drop-in — no registration is required. Information: 604-927-3561, Ext. 4.

• Professionally Prepared • Electronically Filed • Income Tax Consulting Seniors Noallan Naicker, CGA

Certified General Accountant www.naickercga.ca

Phone: 604-469-9369 #206-3003 St. Johns St., Pt. Moody

Centre Maillardville Centrefrancophone francophone de de Maillardville

Why say

“Pardon my French” Register now for French classes, starting April 10th

Three levels are offered to better suit your learning needs:

Beginner I Beginner II Conversation 942-B Brunette Avenue, Coquitlam

For info or to register, please call (604) 515-7070 or visit www.maillardville.com

“Where Do I Service My KIA?” !

@

Bring in Your KIA vehicle & get

FROM BEYOND THE RACK

Visit our facebook page at http://www.facebook.com/flyerland.ca

20%off Your Next Service

Vasile

Master KIA Technician Save time, save money.

Visit our other Black Press sites

Discount

N. NAICKER & ASSOCIATES INC.

SHOPPING SPREE

No purchase necessary. Contest open to all residents of Canada, aged 18 years of age or older. Odds of winning i i depend d d on the h number b off eligible li ibl entries i received. i d O One ((1)) grand d prize i will ill b be awarded. d d A Approximate i retailil value l of the grand prize is $1000. Entrants must correctly answer, unaided, a mathematical skill-testing question to be declared a winner. Contest closes April 7th at 11:59pm EST. To enter and for complete contest rules visit www.facebook.com/flyerland.ca.

OPEN SATURDAYS

Rob

Service Manager

Vasile is a Master KIA Technician who brings with him over 20 years of experience diagnosing cars of all makes and models in the Tri-Cities area.

8100 - 2850 Shaughnessy St., Port Coquitlam OPEN 7 DAYS A WEEK

We are the best... Come see why!

604-464-3330 DL#30882

www.orcabaysuzuki.ca

A Simple Hearing Test Can Change Your Life. • Do you experience ringing or noises in your ears? • Do you find it difficult to follow a conversation in a crowded room? • Do you need to turn up the volume on the T.V.? If you answered Yes to one of these questions we can help. Book your FREE Hearing Test today. , , Sara Lloyd Robert Lloyd ri ea ng ch, Sears H ee M er th ea H


A16 Wednesday, April 4, 2012, Tri-City News

Biz help

Parent council offers ed. on digital learning and safety What makes your kids “click?” That’s the topic of a presentation later this month in Coquitlam about how children engage with the internet and what parents can do to stay involved and informed. The presenter for this seminar presented by the District 43 Parent Advisory Council is

Dave Sands, a former Castle Park elementary school principal and current SD43 energy manager, who has a masters degree in technology and curriculum from SFU. Sands will discuss how parents are on the outside looking in on the new digital world while children are the experts. Acknowledging that

parents are often frustrated, isolated and unsure of what this new culture is all about, Sands will help parents understand inter net safety and get some ideas for connecting with children in new and exciting ways. Other topics include how can parents can monitor a child’s use of technology and how to prevent cyber bullying.

www.tricitynews.com Property Management Inc.

Help young people lear n about business in the Tri-Cities by volunteering for Junior Achievement. Junior Achievement is a non-profit organization that delivers business education to students. Tri-City volunteers are needed to lead classroom programs while sharing their own career and life experiences. Visit www.iabc.org or contact info@jabc. org.

The free presentation, called Participating and Engaging in a Digital World, takes place from 7 to 9 p.m. April 30 in the Gallery Room at Winslow Centre, 1100 Winslow Ave., Coquitlam. Register before April 26 via email to dpac43@ telus.net or call Sandy at 604-939-3690 (provide your name and phone number).

Peak Property Management Inc. is pleased to welcome Heather Price as a dynamic new member of our growing professional Property Management team. Heather is licensed to provide both Strata Management services as well as Real Estate Trading Services throughout the lower mainland/metro Vancouver area and has all the educational knowledge, skills and qualifications to assist you in achieving your desired results. Heather is thrilled to have the opportunity to offer her services. If you have any questions or inquiries about Property Management or Real Estate Sales, don’t hesitate to contact Heather at: Peakhp@gmail.com Heather Price c/o Peak Property Management Inc 208-1046 Austin Ave, Coquitlam, BC V3K 3P3 Bus. 604-931-8666 ext. 224 Cell 604-209-3136

Celebrate Our Risen Lord with these local Port Coquitlam Christian Assembly Celebrating Jesus for those who don’t go to church regularly.

Good Friday “The Passion of the Christ” the movie April 6, 7pm FREE Refreshments Easter Sunday Service April 8: 10:30am

Hunting for more this Easter? Join us for times of reÀection & celebration Good Friday Communion Service 11 am

1932 Cameron Ave., Port Coquitlam

Easter Sunday Celebration 9:15 am & 11:15 am

office@pocoassembly.org www.pocoassembly.org

1393 Austin Avenue, Coquitlam www.myhillside.ca 604-936-2313

604-942-1622

OPEN HEARTS  OPEN MINDS

Hillside Community Church

EASTER Good Friday Service 10:00 am Easter Sunday Services 9:15 am & 11:00 am Kids Church 9:15 am Rev. Graeme Illman

948 Como Lake Ave., Coq.

604-939-6136

ST. LAURENCE ANGLICAN CHURCH 825 St. Laurence St. Coquitlam 604-936-5423  www.saintlaurence.ca



(off Como Lake Ave. between Linton & Poirier)

EASTER SERVICES Maundy Thursday

April 5th at 7:30 pm

Good Friday

April 6th at 10:30 am

Easter Vigil

April 7th at 9:00 pm

Easter Sunday

April 8th at 9:00 am & 10:30 am

COME TO CHURCH THIS EASTER OPEN TO THE DIVINE

Happy Easter

Holy Thursday

Easter Mass schedule for Roman Catholic Churches in the Tri Cities May the blessings of the Risen Christ be with you all!

ST. JOSEPH’S

OUR LADY OF ASSUMPTION

OUR LADY OF LOURDES

ST. CLARE OF ASSISI

OUR LADY OF FATIMA

ALL SAINTS

140 Moody St. 604-461-1369

3141 Shaughnessy St. 604-942-7808

828 Laval Square 604-936-1311

1320 Johnson St. 604-941-4800

315 Walker St. 604-936-2525

821 Fairfax St. 604-939-1741

7.00 pm Lord’s Supper

7:00 pm Lord's Supper

7.00 pm Lord’s Supper

7.30 pm Lord’s Supper

Good Friday 11.00 am Stations 12 noon and 3.00 pm 3.00 pm Passion of our Lord Passion of our Lord Holy Saturday 11.00 am Stations 12 noon Blessing of Easter Food 9.00 pm Easter Vigil Easter Sunday

8.30 am, 10.00 am and 12.00 noon

Pastor Fr. Joseph Nguyen Asst. Pastor

11.00 am Blessing of Easter Food 8.30 pm Easter Vigil 9.00 am, 11.00 am and 1.00 pm Fr. Ronald Thompson

10:30 am Stations 3:00 pm Passion of our Lord

11.00 am Stations 11.00 am Stations 3.00 pm Passion of our Lord 3.00 pm Passion of our Lord

9:00 pm Easter Vigil

11.00 am Blessing of Easter Food 9.00 pm Easter Vigil

9:00 am and 11:00 am (English/French) Fr. Mariano Barreto

7.30 pm Lord’s Supper

7.00 pm Lord’s Supper 10.00 am Stations 3.00 pm Passion of our Lord

9.00 pm Easter Vigil

9.00 pm Easter Vigil

8.00 am, 10.00 am and 12.30 pm

9.00 am French Mass 10.30 am & 12.30 pm

9.00 am, 10.45 am, 12.30 pm and 5.00 pm

Fr. Craig Scott

Fr. Patrick Chisholm Fr. Claude Makulu

Fr. Tien Tran Fr. Hector Del Rosario


www.tricitynews.com

Free clothing for kids PoCo rhyme time 5 to 18 years April 18 Leadership students and staff at GOAL are presenting a clothing giveaway from 10 to 11 a.m. April 18 in the gym at Winslow Centre in Coquitlam. Some clothing is donated, other items are unclaimed from School District 43 lost and found — and ev-

erything is washed and sorted. There is good quality, lightly used clothing for students from five to 18 years of age — shoes and boots, all sizes of pants, shorts, t-shirts and hoodies plus gym bags, umbrellas, lunch bags and more. As well, if anyone

invites you and your family to

has clean, lightly used clothing to donate, students are still taking items at 644 Poirier St. For more information, call GOAL at 604939-9241. Winslow Centre is located at 1100 Wi n s l o w Ave. i n Coquitlam.

Who Could Imagine a King?

Sat., Apr. Apr. 37 Sat, 9:30 to 11:00am am 9:30 to 11:30 rd th

April 5th, 7pm

Good Friday

April 6th, 12noon-3pm Vigil 4pm Family Service

Holy Saturday

2950 Dewdney Trunk Road, Coquitlam

EGGSTRAVAGANZA

Maundy Thursday

a drama presentation

Sunday, April 8, 2012 10:00 a.m.

CHOCOLATA EASTER

St. Catherine’s Anglican Church

Your family is invited to attend Coquitlam Christian Centre’s

PANCAKE BREAKFAST AND EASTER EGG HUNT Due to limited space please phone

April 7th, 8:30pm Easter Vigil

604-944-9990

Easter Sunday

Easter Worship Services

to reserve for your family

April 8th, 8:30am & 7pm Easter Communion

(corner of Lougheed Hwy. & Dewdney Trk. Rd. near the pedestrian overpass)

Prairie Ave. & Shaughnessy St., Port Coquitlam

604.945.8500 www.friendship-bc.com

www.stcatherineschurch.ca

604-942-9812

ROY SWARTZBERG

Barrister & Solicitor When you need a helping hand!

Write a poem to Port Coquitlam and you could win in the My City, My Words poetry contest. PoCo residents only can celebrate in poetry why their hometown is the best place to live, work and play. They could win a Kobo e-reader and other prizes. See Terry Fox Library staff for details. Contest winners and their poems will be presented at the May Day opening ceremony on May 4. Entry forms are available online at www.portcoquitlam.ca or www.fvrl.bc.ca. Poems must be original and imaginative, and showcase the unique qualities of Port Coquitlam. One entry is allowed per person and the competition is open only to residents of Port Coquitlam. All entries must be submitted to Terry Fox Library by 5 p.m. on Saturday, April 14. For more information, call 604-927-7999 or visit Terry Fox Library, 2470 Mary Hill Rd.

Places of Worship Friendship Baptist Church

Tri-City News Wednesday, April 4, 2012, A17

10:30 am Easter Sunday Celebration Service

Coquitlam Christian Centre

Family Law • Separation Agreements • Divorce • Custody • Mediation • Emergency Restraining Orders

I.C.B.C. Claims • Free Initial Consultation

Criminal Law

• Impaired Driving • Drug Offences

#204-2922 Glen Drive, Coquitlam Fax: 604-945-2063

Tel: 604-945-2043

Our Lady of the Assumption Church HOLY WEEK SCHEDULE

HOLY THURSDAY Thurs., April 5th - Mass of the Lord’s Supper 7:00pm - Adoration 8:30pm - Midnight

GOOD FRIDAY Fri., April 6th

- 12:00pm & 3:00pm Passion of Our Lord

HOLY SATURDAY Sat., April 7th

- 11:00am Blessing of Easter Food in gym 8:30pm Easter Vigil

EASTER SUNDAY MASSES Sun., April 8th - 9:00am, 11:00am, & 1:00pm in Church

HAVE A BLESSED EASTER • Father Ronald W. Thompson 3141 Shaughnessy St., Port Coquitlam (1 Block North of Lougheed Hwy.)

604-942-7808

Hyde Creek Community Church Invites you to join us for: Good Friday, April 6th 10 am Easter Sunday, April 8th “Resurrection Revelation” 10:00 am All services held at 2145 Nova Scotia Ave., Port Coquitlam Just off the Pitt River Rd.

Call 604-944-1567

www.hydecreekchurch.ca

2665 Runnel Drive, Coquitlam Near Eagle Ridge GM

www.ccc-church.ca

Holy Week . . . . A Sacred Journey The United Church of Canada - Easter Services

The Lutheran Churches of Coquitlam invite you

GOOD SHEPHERD

GOOD FRIDAY 11:00 am Worship Service EASTER SERVICES 7:30 am Sunrise Meditation 8:00 am Breakfast rvice 10:00 am Celebration Service

KING OF LIFE

GOOD FRIDAY 10:30 am Worship EASTER SERVICES 88:30 am & 10:30 am Services 9:30 am Easter Breakfast & Children’s Easter Egg Hunt

1504 Sprice Ave.

1198 Falcon Drive

(at Schoolhouse)

(corner of Falcon & Guildford)

604-936-2939

604-941-0552

Has it been a while since you visited a Church? Come visit at Easter and renew your faith. All are Welcome!

Como Lake United Church 535 Marmont St - Coquitlam (604) 931-8555 Web: comolakeunitedchurch.com Palm Sunday - 10 am April 1 Good Friday - 11 am April 6 Easter Sunday - 10 am April 8

St. Andrew’s United Church 2318 St. Johns St - Port Moody (604) 939-5513 Palm Sunday - 10 am April 1 Good Friday - 11 am April 6 at Como Lake Easter Sunday Sunrise Service April 8 - 7:30 am Rocky Point Pier - 8:15 am Easter Breakfast locaƟon TBA - 10 am Easter Service

Eagle Ridge United Church The Traditional Anglican Church of Canada

Parish of St. Bride

Meeting in Pitt Meadows Community Church 12109 Harris Road

EASTER SERVICES

April 5: April 6: April 7:

Maundy Thursday Liturgy with Eucharist Good Friday Liturgy Easter Vigil, First Eucharist of Easter

1:00pm 1:00pm 1:00pm

No Service Easter Day

A warm welcome awaits you! A Member of the

Anglican Catholic Church - Original Province Worshipping around the world with the Book of Common Prayer

Phone: 604-463-5300

2813 Glen Dr - Coquitlam (604) 945-9811 www.eruc.ca Good Friday - 11 am April 6 at Como Lake Easter Sunday - 10:00 am April 8

Ioco United Church 1790 Ioco Road - Port Moody (604) 202-3103 Palm Sunday - 9:45 am April 1 Good Friday - 11 am April 6 at Como Lake Easter Sunday Sunrise Service April 8 - 7:30 am Rocky Point Pier - 8:15 am Easter Breakfast locaƟon TBA - 9:45 am Easter Service

Trinity United Church 2211 Prairie Ave - Port Coquitlam (604) 942-0022 www.ucpoco.ca Palm Sunday - 10:30 am April 1 Maundy Thursday -7 pm April 5 Good Friday - 11 am April 6 at Como Lake Easter Sunday Sunrise Service April 8 - 7 am Lions Park - 8 am Pancake Breakfast Trinity Hall - 10:30 am Easter Service

Alive in Christ!!!


A18 Wednesday, April 4, 2012, Tri-City News

www.tricitynews.com

COMMUNITY CALENDAR THURSDAY, APRIL 5

â&#x20AC;˘ Tri-Cities Womenâ&#x20AC;&#x2122;s Friendship Club bowling night at The Zone in Coquitlam. Info: Charlene, 604-944-7086.

SATURDAY, APRIL 7

â&#x20AC;˘ College Park Community Association Easter egg hunt, 10:30 a.m., Westhill Park. Hunt kicks off with Easter Bunny arriving on an old-fashioned fire truck.

SUNDAY, APRIL 8

â&#x20AC;˘ Coquitlam Sharks Aquatic Club final registration and assessment day at City Centre Aquatic Complex in Coquitlam, noon-5 p.m. The club starts the summer season on May 1. Whether you are a beginner, experienced or emerging elite athlete, Coquitlam Sharks has a program. Bring along your swim suit and goggles for an assessment. Info: www.coquitlamsharks. org.

TUESDAY, APRIL 10

â&#x20AC;˘ Burke Mountain Naturalistsâ&#x20AC;&#x2122; April meeting, 7:30 p.m., in the hall of Como Lake United Church, Coquitlam. Speaker: retired UBC professor Ken Hall, who will give a slide presentation on the importance of water in the desert. Admission is free and meeting is open to all. Info: 604-936-4108 or 604461-3864, or www.bmn. bc.ca.

APRIL 5: CHOCOLATE SALE

â&#x20AC;˘ Eagle Ridge Hospital Auxiliary annual Easter chocolate sale, 9 a.m.-4 p.m., in the ERH lobby, featuring chocolates from Chocolate Works. Proceeds will be used for the purchase of equipment and patient comfort items for the hospital â&#x20AC;˘ Ladies Legion Auxiliary meets, 1 p.m., Legion Branch 133, PoCo. If you would like to meet new people, drop in or call 604-942-6028 for more information. â&#x20AC;˘ Eagle Ridge Hospital Auxiliary monthly meeting, 7 p.m., in ERHâ&#x20AC;&#x2122;s ParkLane Room. Guests are welcome. â&#x20AC;˘ Canadian Parents for French, Tri-Cities chapter AGM, 7 p.m., Glen elementary school (staff lunchroom), 3064 Glen Dr., Coquitlam; all executive positions need to be filled. CPF is a non-profit organization dedicated to the promotion of French language learning opportunities through educational, social, cultural and sporting activities for youth. Info: www.cpf. bc.ca.

WEDNESDAY, APRIL 11

â&#x20AC;˘ Fitness class fundraiser hosted by Friendly Forest Parent Co-operative Pre-school and YOUnique Fitness in the gym at Anmore elementary school; all proceeds going to support the pre-school;

the Groove Method, cost: $10; doors open at 6 p.m. for registration and payment, class runs 6:15-7 p.m. More classes on April 18 and 25. Info: info@ friendlyforestpreschool. com. â&#x20AC;˘ Tri-City Centennial Stamp Club presentation night (visitors welcome): stamp â&#x20AC;&#x153;swap and shopâ&#x20AC;? at 7 p.m., presentation by speakers after 8 p.m., community centre, 630 Poirier St., McGee Room, Coquitlam. Info: www. stampclub.ca or 604-9419306.

THURSDAY, APRIL 12

â&#x20AC;˘ Canadian Parents for French, Tri-Cities Chapter, family yoga night, 6-8 p.m., Dr. Charles Best secondary school, Coquitlam; three half-hour sessions available: 6:, 6:45 and 7:30 p.m. Info: tricitiescpf@ gmail.com. â&#x20AC;˘ Tri-City Christian Womenâ&#x20AC;&#x2122;s Clubâ&#x20AC;&#x2122;s Womenâ&#x20AC;&#x2122;s Connection luncheon, noon, Executive Inn, 405 North Rd., Coquitlam. Speaker: Adena Paget on â&#x20AC;&#x153;Whoâ&#x20AC;&#x2122;s in control here, anyway?â&#x20AC;? Reservations:

Marie, 604-420-2667 by April 9.

WEDNESDAY, APRIL 18

â&#x20AC;˘ Fitness class fundraiser hosted by Friendly Forest Parent Co-operative Pre-school and YOUnique Fitness in the gym at Anmore elementary school; all proceeds going to support the pre-school; Zumba, cost: $10; doors open at 6 p.m. for registration and payment, class runs 6:15-7 p.m. Another class on April 25. Info: info@friendlyforestpreschool.com. â&#x20AC;˘ Leadership students and staff at GOAL present clothing give-away, 10-11 a.m., in the gym at Winslow Centre, 1100 Winslow Ave., Coquitlam. Many SD43 schools have donated lost-and-found items for kids 5-18 and everything is washed and sorted. The clothing giveaway is open to all Tri-City families. Also, if anyone has clean lightly used clothing to donate, items are being accepted at 644 Poirier St., Coquitlam. Info: 604-939-9241.

CLUBS

â&#x20AC;˘ Fear speaking to a group? Get self-confidence and speaking skills as the Tri-Cities only noonhour Toastmasters club meets at Coquitlam city hall every Tuesday, noon-1 p.m. Guests and visitors welcome. Info: tottcoquitlam.toastmastersclubs.org or Brad, 604-418-2393.

Looking for work? We can help. Get the training and support you need to find and keep a job in B.C. Job search resources â&#x20AC;˘ Personal employment planning â&#x20AC;˘ Workshops and training â&#x20AC;˘ Specialized services

Coquitlam Animal Shelter

Help Locate Your Cat if it Goes Missing

New Program

Protect Your Cat with ID Registration 3GTOCPGPVECVKFGPVKÂĄECVKQPECPJGNRTGWPKVG[QW YKVJ[QWTRGVUJQWNFKVIQOKUUKPI,H[QWTECVJCUC VCVVQQQTCOKETQEJKRTGIKUVGTKVYKVJVJG&QSWKVNCO $PKOCN6JGNVGTCPFYGYKNNCFFKVVQQWTFCVCDCUG 6JQWNF[QWTECVIQOKUUKPICPFDGDTQWIJVVQVJG $PKOCN6JGNVGTYGYKNNDGCDNGVQOCVEJ[QWTRGV SWKEMN[CPFEQPVCEV[QW

EMPLOYMENT SERVICES CENTRES Locations across B.C. Visit one near you. WorkBCCentres.ca 604.660.2421 TDD: 604.775.0303

The Employment Program of British Columbia is funded by the Government of Canada and the Province of British Columbia.

)KNNQWVCECVTGIKUVTCVKQPHQTOKPRGTUQPQTQPNKPGCPF GOCKNHCZOCKNQTFTQRKVQHHCVVJG$PKOCN6JGNVGT

Coquitlam Animal Shelter 0CTKPGT:C[ &QSWKVNCO%&9.%

www.coquitlam.ca


www.tricitynews.com

Tri-City News Wednesday, April 4, 2012, A19

TRI-CITYY ARTS

CONTACT Sarah Payne email: spayne@tricitynews.com phone: 604-472-3032 • fax: 604-944-0703

Easter art for the kids Leigh Square Community Arts Village is hosting a children’s Easter arts celebration t h i s S a t u r d ay, April 7 from 12:30 to 2:30 p.m. The event offers Easter e gg decorating, an egg hunt, arts and crafts, storytelling, entertainment by Jennifer Pielak of Second Storey Theatre and more (including a chocolate goody bag to take home). Pre-register at www.experienceit. ca or by calling 604-927-7529. Cost is $10 per child.

ECC art classes

SUBMITTED PHOTO/DAVID COOPER

The Royal City Musical Theatre’s production of Hello Dolly features Tri-City cast members, including: (front row, left to right) Kallista Jones, Nathan Piasecki, Trevor Kobayashi, Julia McLean and (back row) Tricia Zuskind, Carly-June Friesen, Nathan Sartore, Bradley Barkman, Jennifer Long and Colleen Austin.

Locals put on their Sunday best for RCMT’s Hello Dolly By Sarah Payne THE TRI-CITY NEWS

N

athan Sartore may only be 15 years old, but already he’s racking up an impressive list of musical theatre credits. A Grade 10 student at Heritage Woods secondary, Sartore has performed in the Theatre Under the Stars production of Bye Bye Birdie, Perry Ehrlich’s ShowStoppers and several school drama shows. And starting this weekend, Sartore will be making his Royal City Musical Theatre debut in the ensemble cast of Hello Dolly, running at the Massey Theatre in New Westminster from April 14 to 28. “It’s such a great opportunity to work with the professional actors,” he said. “It’s been great working with them in that professional atmosphere.” Sartore started dancing at the age of six and trains at the Tri-City Dance

Centre; he also takes voice and acting lessons with Lonnie Delisle. Three years ago Sartore added some international experience to his resume, when he travelled with the Dance Centre for performances in Disneyland and on the Norwegian Cruise Line. And in 2010, Sartore performed as a dancer at the 2010 Vancouver Paralympic Games. Being in an RCMT production has been a tremendous learning experience, Sartore said. “In classes you’re just learning — you’re trying hard, but when you’re doing a show with professional actors... and when you’re working with a director like Valerie Easton, who’s so well known around the city, you’re always trying to make a good impression.” In addition to Sartore, the large Hello Dolly cast has another nine TriCity members. Among them is Carly-June Friesen, a 21-year-old Port Coquitlam resi-

dent who graduated from Capilano University’s musical theatre program last April. As a student she won the roles of Kili, a dwarf in The Hobbit, and the fairy godmother in Cinderella. She’s also part of the ensemble cast in Hello Dolly, her RCMT debut, citing Put on Your Sunday Clothes as her favourite number because it brings “pretty much everybody” on stage. “We’re singing and dancing in a lot of the numbers, and Valerie’s great to work with,” Friesen said of the Hello Dolly director, and fellow Tri-City resident, Valerie Easton. “It’s a fun show and there’s lots for the ensemble to do.” Easton said she went for Hello Dolly because it’s such a family friendly classic, full of familiar, singable tunes. “It’s a fabulous script, and everybody knows the song Hello Dolly,” she said. The show has been enjoying a resurgence lately, she added, since the

animated film Wall-E used two Hello Dolly songs — Put on Your Sunday Clothess and It Only Takes a Moment. Hello Dolly is also a musical that appeals to a broad audience. It tells the story of widowed matchmaker Dolly Levi, who schemes to convince her wealthy client, Horace Vandergelder, that she — not the pretty young upstart Irene Molloy — will be the best match for him. “It’s lots of fun, and it’s a bit of a farce,” Easton said. “They all end up at the same place, at the same time, not realizing the others are there, so it’s a lot of mayhem.” • Hello Dolly is at the Massey T h e a t r e ( 7 3 5 - 8 t h Av e. , N e w Westminster) April 14 to 28, with shows at 8 p.m. and weekend matinees at 2 p.m. Tickets are available at royalcitymusicaltheatre.com or by calling 604-521-5050. spayne@tricitynews.com

Ar tist Judith M. Atkinson is offering a new lineup of art classes for all a g es at t h e E ve r g r e e n Cultural Centre on Mondays from April 16 to June 11. Creative Kids!, for ages seven to 11, allows kids to create, paint and explore the art of storyboards and collage from 3:30 to 5 p.m. A similar prog ram, Creative Teens! is geared to youth aged 12 to 17 years old, from 5:30 to 7 p.m. The cost for both programs is $98, including materials. For adults, there’s Continuing to Paint from 7:30 to 9:30 p.m., a program designed for artists of all levels. Participants will learn contemporary painting practices in a variety of media, as well as colour theory, composition and skill building. Cost is $155. Atkinson is a professional artist and fine art instructor. Re gister at judithm_atkinson@shaw.ca or visit ECC at 1205 P i n e t r e e Wa y, Coquitlam on April 4 from 2 to 5 p.m.


Fibre art retro show at Leigh A20 Wednesday, April 4, 2012, Tri-City News

The Leigh Square Community Arts Village is showcasing the work of a multimedia artist this month. The retrospective exhibition of work by Donna Polos displays the development of her unique style over the past 20 years. Polos paints watercolours on cotton, paper and canvas, creating interesting surfaces that are textured and layered with paint, embroidery, yarn, beads and thread. Polos, a retired elementary school teacher and self-taught artist, describes the creative process as a harmonious and calming experience. She prepares her fabric by painting wet-on-wet and glazing up to six layers to achieve dark values, often using glue as a resist and, during the summer, Polos also uses heliographic paint (sun paint). Some of Polosâ&#x20AC;&#x2122; pieces incorporate chalk pastel and fabric paint, with hand embroidery and quilting adding texture. The retrospective show at Leigh Square will feature works on canvas, paper and cotton to reflect her process of working in all three mediums side by side. Polos has exhibited in solo and group shows throughout Metro Vancouver and the U.S.; she has also been an artist-in-residence with the Stanley Park Ecology Centre. â&#x20AC;˘ Flourishing Fibres: Donna Polos Retrospective is at the Leigh Square Community Arts Village (1100-2253

www.tricitynews.com

SUBMITTED PHOTOS

Fibre art pieces including 7 Billion at 2011 (above) and Reflections at Pender Harbour (right) by Donna Polos will be part of a retrospective of her work, showing at Leigh Square Community Arts Village April 5 to May 7. Leigh Square, Port Coquitlam) April 5 to May 7. An opening reception with the artist in attendance is on April 14 at 2 p.m. Polos will be a guest instructor for a series of workshops for students and adults May 1 to 3, and a Motherâ&#x20AC;&#x2122;s Day afternoon tea and fabric painting workshop is on May 13 from 1 to 3 p.m. Register for the workshops online at www.experienceit.ca or by calling 604927-8441. spayne@tricitynews.com

?[PRTSTb0acb fTX]b_XaTcWTPacXbcX]TeTah^]T ! ! ! 5PRd[ch2^]RTacBTaXTb

:HZDQWWRKHDU\RXUVWRU\

3UHVHQWHGE\

CXRZTcb)  " $7BC CX\T) &)"?<

B0CDA30H0?A8; #)070A?8BCzB9>DA=4H

Know someone who needs a bike? Need a bike yourself? 7KHFRPPXQLW\GURSSHGRIIXVHGELNHVZKLFKKDYHEHHQ UHIXUELVKHGE\&DS¡V:HVWZRRG&\FOH1RZWKHVHELNHV DUHUHDG\IRU\RXWRULGHDQG3HGDO,W)RUZDUG

5TPcdaX]VATQTRRP1[PXa5aXT]Sb Come and be transported by an enchanting program of music and song as Rebecca Blair and friends tell musical tales from many countries. This harp concert promises to be a delightful evening of virtual travel to far away lands.

7HOOXVWKLQJV  ,I\RXZHUHOXFN\HQRXJKWRUHFHLYHD3HGDO,W)RUZDUGELNH ZKDWZRXOG\RXGRZLWKLW"  :KDWGRHV(DJOH5LGJH+RVSLWDODQG\RXUFRPPXQLW\PHDQ WR\RX"  6KDUH\RXUFUHDWLYHIXQGUDLVLQJLGHDVDQGRUFDPSDLJQ 7HOOXV\RXUVWRU\LQSDUDJUDSKVRUOHVV 6XEPLVVLRQVDFFHSWHGDW ZKHHOWRKHDO#HUKIFDRUE\PDLORULQSHUVRQDW(DJOH5LGJH+RVSLWDO )RXQGDWLRQDW*XLOGIRUG:D\LQ3RUW0RRG\ 'HDGOLQHIRUHQWULHV LV7KXUVGD\$SULOWK

Call 604.664.1636 for tickets! !1ad]TccT0eT]dT2^`dXc[P\

%#%%# %"%kfff_[PRTSTbPacbRP

Please visit www.wheeltoheal.ca to download an application li i fform.


www.tricitynews.com y

Tri-City y News Wednesday, y April p 4, 2012, A21

P T F L a w nmo w e r & Small Engine Repair

Works by Ying-Yueh Chuang (left) and Eliza Au, both ceramic artists, are on display in an exhibit called Variations on Symmetry at the Evergreen Cultural Centre April 13 to May 19.

®

www.ptÅawnmower.ca

SUBMITTED PHOTO

Fun Fascinators with Ilona Marshall Saturday, April 7th at 1:00 pm

Make a fascinator head piece to wear for Easter or other festive events! Extraordinary hat-maker Ilona Marshall will be leading a fun-filled creative workshop on fascinators.

Artists find variations on ceramic symmtery Ceramic artists Eliza Au and Ying-Yueh Chuang are transforming the Evergreen Cultural Centre art gallery into a world where structure and symmetry, pattern and proportion define their art work while challenging the boundaries of their medium. Au explores how sacred space is transformed by the use of pattern and geometry; much of her work is influenced by Gothic and

Islamic architecture. She is also interested in how systems work and how they relate to symmetry, repetition and scale, with works like The Fragility of Belieff evoking the patterns of 13th-century Gothic windows. Her mentor, Chuang, has exhibited nationally and internationally. Her large-scale installations are organic in shape and

Price: By Donation. All supplies included Registration is limited. Please call 604-516-6151 to sign up. Bring your mothers for a full high tea experience in our cozy vintage parlour! Fragrant teas, savoury sandwiches, and scrumptious dainties will be served.

Mother’s Day Tea Saturday, May 12 2:00 pm

form, like “hybrid forms inspired by organic material and imagined objects,” she said. • Variations on Symmetry: Installation works by Eliza Au & Ying-Yueh Chuang is at the Evergreen Cultural Centre (1205 Pinetree Way, Coquitlam) April 13 to May 19. An opening reception is on April 15, from 4 to 6 p.m. Visit www.evergreenculturalcentre.ca for more information.

This one sells out quickly, so please call 604-516-6151 to register now!

Mackin House Museum Operated by the Coquitlam Heritage Society 1116 Brunette Ave., Coquitlam Ph:

604-516-6151

www.coquitlamheritage.ca info@coquitlamheritage.ca

ARMS PUB & LIQUOR STORE

April Specials MONDAY

TUESDAY

4-11 or until sold out

5-11 or until sold out

25

CHICKEN WINGS

99 BBQ SLIDERS

DRAFT BEER $1.75 glass

DRAFT BEER $1.75 glass

¢

ea. + HST

¢

ea. + HST

WEDNESDAY LUNCH SPECIAL 8 OZ. NEW YORK STEAKS

with veggies & potato

695

$

+ HST

BUDWEISER BOTTLE $395 5-11 or until sold out!

CHICKEN WINGS

LIQUOR STORE HOURS: OPEN 7 DAYS A WEEK 9:00am-11:00pm

25 ea. + HST ¢

FRIDAY, SATURDAY & SUNDAY 8 OZ.

NEW YORK STEAK with 12 Tiger Prawns, veggies and potato.

10

$

95 + HST

604-941-4711 3261 COAST MERIDIAN DR., PORT COQUITLAM


A22 Wednesday, April 4, 2012, Tri-City News

www.tricitynews.com

TRI-CITYY SPORTS

CONTACT Larry Pruner email: sports@tricitynews.com phone: 604-525-6397 • fax: 604-944-0703

Coquitlam’s Nyhaug fifth in season’s first BMX race Racer recovers from an early crash to take fifth overall Even a crash couldn’t keep Tory Nyhaug down. A BMX racer from

Coquitlam, Nyhaug started his season off right on the weekend, scoring back-toback top-five results in Chula Vista, California, at the opening UCI BMX Supercross contest of the 2012 season. In qualifying last Friday,

Nyhaug went posted the fourth fastest time — 34.814 —in the Super Time Trial Finals race and qualified for the BMX Supercross showdowns. The next day, Nyhaug made it all the way through

single-elimination rounds to get to the Supercross finals, where he crossed the finish line in fifth place. Nyhaug was involved in a crash early in the race but managed to get back up and finish — and finish well.

American rider Connor Fields won both the time trial and the Supercross races, with Australia’s Sam Willoughby taking second, American David Herman third and Marc Willers of New Zealand fourth.

The next BMX Supercross race will be held from April 13 to 15 in Randaberg, Norway. Complete results can be found at www.bmx-results. com. sports@tricitynews.com

TRI-CITY NEWS FILE PHOTO

Coquitlam BMX racer Tory Nyhaug, shown here in a file shot taken at Town Centre Park, kicked off the 2012 racing season right with a fifth-place finish — despite an early fall — on the weekend in California.

Cup wins for local women The PoCo Fury were no fools on April 1. That’s when the Div. 4 women’s soccer team won their first ever cup with a victory in the Metro women’s final at South Surrey Athletic Park. The Fury beat the Semiahmoo Sabotage 2-1 to win the cup final, boasting a balanced attack that had served them well all season. In fact, during the season, 11 of 18 Fury players got on the scoresheet and the PoCo squad posted the league’s best plus/minus in regular season play. PoCo Fury is comprised of the first ever U-21 team that was formed in 2008/’09 after the mostly former Terry Fox and Riverside secondary school students came together after “aging out” of the Port Coquitlam youth program after U-18. The majority of the women have been playing soccer since they were six years old and are lifelong residents of Port Coquitlam: Rachelle Beuk, Jamie Brovold, Emily Carver, Melissa Dawson, Nicole Dawson, Stephanie Finn, Ashley Lafrance, Stephanie Larson, Kim Maloney, Ashley Martin, Amy Nadasdi, Brooke Nadasdi, Chantelle Nadasdi, Chelsea Quinn, Taryn Richards, Kim Smith, Jill Sweetable and Jessie Visser.

NCUSC STORM

Also in Cup action, North Coquitlam United Soccer Club’s U21 Storm won its championship Sunday in a hard fought game versus Golden Ears United Soccer club. The Storm left it all on the field, getting outstanding performances throughout the lineup. It took to the end and beyond for the Storm to claim the victory, however, as they won the game 3-1 in penalty kicks with Natasha Morin backstopping the locals to victory.

Locals figure in Reynolds 12th at men’s figure ringette victory skating worlds Now, they’re headed to ringette nationals

Coquitlam skater helps Canada, too Coquitlam’s Kevin Reynolds accomplished a couple of things on figure skating’s world stage last week in Nice, France. First, he finished 12th in the men’s singles competition at the ISU World Figure Skating Championships. Second, that finish guaranteed Canada three spots in men’s singles at next year’s world championships, to be held in London, Ont. Fellow Canadian Patrick Chan, five-time national champion, won the world title for the second year in a row and the Canuck ice dancing duo of Tessa Virtue and Scott Moir — sweethearts of the Vancouver 2010 Olympics — grabbed their second world title earlier in the week. sports@tricitynews.com

Some Tri-City power pushed a Lower Mainland ringette team to the AA U16 provincial title last month. Featuring six local players — Bayley Bird, Angela Cichos, Sarah Knight, Teagan Rasche and Katie Stanoffsky of Port Coquitlam Ridge Meadows Ringette Association, and Lauren Watson of Port Moody — the Lower Mainland squad won a best-of-three playoff over the representative team from the Thompson Okanagan. The locals won in straight games, 8-1 and 7-5. They now become Team BC at the Canadian National Ringette Championships, to be held April 8 to 14 in Burnaby. This will be the largest National Ringette tournament ever held in Canada (U16, U19 and 18+) and will feature teams from each province. The U19 Lower Mainland team also claimed the Team BC Title and includes PoCo Ridge Meadows players Sam Kell and Alicia Cecchini, and Coquitlam Port Moody Ringette Association players Alex Harris and Chantal Laurie.

Send results to: sports@tricitynews.com


www.tricitynews.com

Tri-City News Wednesday, April 4, 2012, A23

Kids’ d race to be part of RUSH at Buntzen Hey, kids, looking for an adventure? The Suburban RUSH adventure race, set for Saturday, April 28, is a 30 km off-road adventure for recreational athletes competing solo or in teams of two in mountain biking, trekking and mystery challenges in the trail networks near Buntzen Lake. The eighth annual race is expecting to be sold out. But what makes this a family affair is the second installment of the kids’ race. Children age three to seven years will tackle an age-appropriate mini Suburban RUSH course complete with race bib, finish line certificate and refreshments. Cost for registration is $88 per person for the main race and $20 per person for the kids’ race. For more information or to register, visit www. suburbanrush.com.

WE WANT YOUR VEHICLE! WILL PAY TOP DOLLAR FOR YOUR TRADE OR JUST BUY YOUR VEHICLE FROM YOU! QUALITY PRE-OWNED

save $7,991

2011 Ford Explorer Limited Leather, sunroof, 4x4, Navigation only 3800 km’s Was $52,001

UT031839

SALE $45,000 ONLY $327

bi-weekly***

save $7,291

2008 Fusion SEL AWD Leather, sunroof 61,689 km. Was $21991 SUBMITTED PHOTO

SALE

A race for children will take place along with the Suburban RUSH adventure race scheduled for Saturday, April 28 at Buntzen Lake.

UC155114

14,700ONLY 142 bi-weekly*

$

$

save $8,391

2010 F-150 Crew Cab 4x4 XLT 70,152 km’s. Was $32,991

Ringette in gyms thanks to local team

SALE

UT012244

24,600

$

ONLY

180 bi-weekly***

$

save $4,991

2007 Dodge Charger SRT8 Loaded !!! Fast car!!! A must see!!! Lowest price in the city for only. was $29,991

UC844263

SALE $25,500 ONLY $249

bi-weekly*

save $8,691

2009 Ford Escape Ltd.

Leather, sunroof, 4x4, alloy wheels, reverse sensors, the list goes on. UT084576 was $26,991

SALE $18,300 ONLY $152

save $6,391

2009 Chevrolet Uplander

SOLD

vacc.bc.ca

Consider your bike for local trips.

EDITION

UT114924

SALE $11,600 ONLY $113

bi-weekly*

save $5,091

SOLD

r t r ep a n nt. o t fo ion s me t o n ce ua s - t ant h re elo r p es ex v v nt de e s c ari n e re ar in o tv e of r tor e sers : T Sha c p l l a “T e a as ta bi b e v y h n to arr 50 an e s t es s o lun ne min es c o r cca vo et r rov ert o er lai tat v 2 0 m tha d p al s vt a oth o n .co cy an ci ce sen t h a te s or c t en nks er so n re ts in ws i d o g e e h t n he s o e a ba oth bee en am yn tac cot hurc Th food and has resid u t oorcit tri e al g oq d ,c sw it w. loc usin ays from rt C out Shar r all t e e r ww n ho ces s orts , Po y ab s. “ - oo d i o p d r i m v g re tla oo sse or-t s a ecM i ” o a n , r i qu rt nv t e Co d Po r ca olici o n re’s an -doo ot s o r m S a to es n o d ott d a n is do r fo r Sc e y e s ts fo ath il m v i c den le He F a S e r resi eop p p. e y ty a r n i t i-Ci ey to orste h u r o n S m T mo e d m ng h C o r ni give on t wa t to licit no o so h w

be t ’ n Do

All power options, air, 7 passenger, only 26,272 kms was $17,991

2006 Ford F-150

a

was $13,991 95,253 km’s

led o o f

SALE

8,900

$

UT021827

ONLY

113 bi-weekly*

$

save $9,191

2008 Honda Accord EX-L

s say rity oora h d ty c ot go oney -Ci Tri oes n for m ti d oor d to-

bi-weekly**

Loaded, Leather, Sunroof, Automatic, 66,429 km’s was $27,991

NOW

18,800

$

ONLY

UC802003

180bi-weekly*

$

2010 Ford Mustang Convertible

SOLD

save $12,991

Loaded with only 43,057 kms was $32,991

UC114440

SALE$20,000 ONLY $166bi-weekly**

save $6,191

2010 Ford Focus SE

SOLD

All power options automatic , air conditioning, alloy wheels, nice car year end blow out was $15,991 UC178643

SALE $10,000 ONLY $85

t co hois to sed ry u t n ga ow yell The

s g i B

bi-weekly**

save $11,197

2010 Dodge Grand Caravan SE Stow n go 7 pass, 32021 kms black

u bo t No ent a cid ac rep By

was $28,991

UT464579

SALE $17,800 ONLY $132

*** bi-weekly

save $7,191

2010 Toyota Camry LE

CHECK ECK OUT OUR NEW eEdition ion @ tricitynews.com FROM COQUITLAM QUITLAM TO CAPE TOWN KEEP IN TOUCH CH WITH YOUR COMMUNITY

4 cylinder automtic, 73,002 kms was $21,991

UC016096

SALE $14,800 ONLY $125

bi-weekly**

All prices plus $399 Dealer Administration fee, plus taxes. *60 months, **72 months, ***84 months. All payments plus taxes

FROM ANYWHERE, ANYTIME

WEST COAST

• check out our eEdition online • flip through, as you would with a newspaper • zoom in on the text for a more detailed view • the e-edition is fully searchable • see an ad you like? click on it to check out the advertiser’s website

FORD LINCOLN DL 6077 WE ACCEPT VISA, MASTERCARD & AMERICAN EXPRESS

MAPLE RIDGE

Sales Toll Free

DEWDNEY TRUNK

203 RD

Hundreds of Tri-City girls know ringette is cool. Now, some of the sport’s proponents are trying to make it a little less cold. Coquitlam Port Moody Ringette Association recently received a grant from the 2010 Legacies Now sport development program to create a gym ringette program for local schools. Gym ringette is a modified version of the sport played on ice and known for promoting teamwork. This program was spearheaded by long time local ringette coach and player Amy Byrne. “I was very excited when we received this grant as I saw it as an opportunity to expose our sport to students and teachers,” she said in a press release. “I have run similar programs in the past and have seen how much the students and teachers enjoyed it. “ We h ave n o w equipped various schools and teachers with the knowledge and equipment to make this program part of their regular PE. curriculum.” Players from the local Port Coquitlam Open “A” team came together to run this program; besides Byrne, instructors were Allyson Epp, Ryeigh Deno, Krista Kell, Britany West and Nicole Robb. T h e y w o rk e d a t Riverview and Porter elementary schools in Coquitlam and Aspenwood in Por t Moody, and are planning on attending Coquitlam River elementary this month. Anyone wishing to try the sport on the ice can go to www.cometryringette.ca for a list of free local events.

VEHICLES

1-888-251-7930

20370 Lougheed Hwy. www.westcoastautogroup.com

Parts & Service Toll Free 1-888-889-7826

STAPLES

BURGER KING

SAVE-ONFOODS

V N

LOUGHEED HWY.


A24 Wednesday, April 4, 2012, Tri-City News

www.tricitynews.com

Your community Your classifieds.

604.575.5555

bc classified.com

Circulation 604.472.3040 FAMILY ANNOUNCEMENTS

INDEX IN BRIEF FAMILY ANNOUNCEMENTS . . . . . . . . . 1-8 COMMUNITY ANNOUNCEMENTS . . . . 9-57 TRAVEL . . . . . . . . . . . . . . . . . . . . . . 61-76 CHILDREN . . . . . . . . . . . . . . . . . . . . 80-98 EMPLOYMENT . . . . . . . . . . . . . . . 102-198 BUSINESS SERVICES . . . . . . . . . . 203-387 PETS & LIVESTOCK . . . . . . . . . . . 453-483 MERCHANDISE FOR SALE . . . . . . 503-587 REAL ESTATE . . . . . . . . . . . . . . . . 603-696 RENTALS . . . . . . . . . . . . . . . . . . . 703-757 AUTOMOTIVE . . . . . . . . . . . . . . . . 804-862 MARINE . . . . . . . . . . . . . . . . . . . . 903-920

7

OBITUARIES

DISCRIMINATORY LEGISLATION Advertisers are reminded that Provincial legislation forbids the publication of any advertisement which discriminates against any person because of race, religion, sex, color, nationality, ancestry or place of origin, or age, unless the condition is justified by a bona fide requirement for the work involved.

COPYRIGHT Copyright and/or properties subsist in all advertisements and in all other material appearing in this edition of bcclassified.com. Permission to reproduce wholly or in part and in any form whatsoever, particularly by a photographic or offset process in a publication must be obtained in writing from the publisher. Any unauthorized reproduction will be subject to recourse in law.

Advertise across Advertise across the the Advertise across the Lower Mainland Mainland in Lower in lower mainland in the 18 best-read the 18 best-read thecommunity 17 best-read community community newspapers and newspapers and newspapers. dailies. 53 dailies. ON THE WEB: ON THE WEB:

33

INFORMATION

DENIED CANADA PENSION plan disability benefits? The Disability Claims Advocacy Clinic can help. Call Allison Schmidt at 1-877-7933222. www.dcac.ca HOST AN EVENT for BC Annual Arts and Culture Week! April 22-28, arts councils & schools across BC are hosting inspiring arts events. www.bcartsweek.org. WITNESS TO ACCIDENT on Tues, Feb 21st, btwn a dump truck & a pick-up truck on Lougheed Hwy at entrance to north Hwy #1, Coquitlam. Please call 604-765-8527.

It is agreed by any Display or Classified Advertiser requesting space that the liability of the paper in the event of failure to publish an advertisement shall be limited to the amount paid by the advertiser for that portion of the advertising space occupied by the incorrect item only, and that there shall be no liability in any event beyond the amount paid for such advertisement. The publisher shall not be liable for slight changes or typographical errors that do not lessen the value of an advertisement.

bcclassified.com reserves the right to revise, edit, classify or reject any advertisment and to retain any answers directed to the bcclassified.com Box Reply Service and to repay the customer the sum paid for the advertisment and box rental.

COMMUNITY ANNOUNCEMENTS

CRIMINAL RECORD? Don’t let it block employment, travel, education, professional, certification, adoption property rental opportunities. For peace of mind & a free consultation call 1-800-347-2540.

AGREEMENT

bcclassified.com cannot be responsible for errors after the first day of publication of any advertisement. Notice of errors on the first day should immediately be called to the attention of the Classified Department to be corrected for the following edition.

fax 604.575.2073 email ads@bcclassified.com

CHILDREN

FLOWERS Family Child Daycare lic’d & cert. Educational activities, healthy snacks & meals, lrg playground & backyard. F/T & P/T Birth-12 yrs. 6:30am - 6pm. Drop off & pick up $700 incl everything. Coast Meridian Branch 604-942-6579 Cell 604-771-8076 azammalaekeh@yahoo.com

RUSHTON, Gerta Caroline Feb, 12, 1922 - Mar. 13, 2012

Gerta was called home by her Lord on March 13, 2012. Originally born in Saskatchewan to Fred and Caroline Richter, Gerta’s parents and their family moved to a farm in Duncan, BC in 1938 and later moved to Victoria in 1941 during the war. During the late 40s, she worked at HMCS Royal Roads (Royal Canadian Naval College), where she met Ted Rushton. They were married in 1950 and had four children – Richard, Fay, Tom and Fern. Ted and Gerta were married for 42 years when Ted passed away in 1992. Gerta brought her children up with her light of faith shining in all of their lives, bright as a star. She attended Stephen Ministry classes at Hope Lutheran Church in Port Coquitlam, BC, and many church members of Hope were blessed by her light as well when she would go to the hospital or their homes with home baking and love – even into her 80s. Gerta is survived by her son Richard (Louise), daughter Fay (Robert), son Tom (Noy) and daughter Fern, grandsons – Dennis (Samantha) and Patrick Carss and Philip Rushton, and granddaughters – Mara (Darcy) Foran, Keara (Jeremy) Groner, and Nicolle Rushton, and great grandchildren Eric & Lucas Groner, Isabella Foran. Also left to cherish her memory are her two sisters (Esther & Edna) as well as many nieces and nephews who all thought the world of her. We will miss our shining star, but are comforted by knowing that Jesus was waiting to greet her with open arms. Memorial service will be held on Saturday, April 7th, 2012, at 1:00 pm at Hope Lutheran Church (3151 York Street, Port Coquitlam, 604942-5322). In lieu of flowers, you are invited to make donations to the Heart and Stroke Foundation of Canada, Canadian Cancer Society, or Hope Lutheran Church and School.

Parkland Players & Meadowbrook Players Reggio Emilla Approach

✫ Infant & Toddlers ✫ Preschool ✫ Group Daycare ✫ Day Camp ✫ Before & After School Care 604 - 936 - 7005

EMPLOYMENT/EDUCATION 108 BUSINESS OPPORTUNITIES $294+ DAILY Mailing Postcards! Easy! Guaranteed Legit Work! www.ThePostcardGuru.com $20-$60/Hr Using Your Computer! www.FreeJobPosition.com Overnight Cash To Your Doorstep! www.CashGiftingBucks.com More Amazing Opportunities Visit: www.LegitCashJobs.com

ADVERTISE YOUR BUSINESS bcclassified.com to Every Hunter in BC! Advertise in The BC Hunting Regulations Synopsis 2012-2014 publication. Increased circulation 250,000 copies! Tremendous Reach, Two Year Edition! Contact Annemarie at 1 800 661 6335 or hunt@blackpress.ca

HOME BASED BUSINESSWe need serious and motivated people for expanding health & wellness industry. High speed internet and phone essential. Free online training. www.project4wellness.com HOME BASED BUSINESS We need serious and motivated people for expanding health & wellness industry. High speed internet and phone essential. Free online training. www.project4wellness.com LIKE DECORATING, cooking or entertaining? Need extra money? Become a Consultant and turn your passion into extra earnings! Canadian company expanding in this area! Visit www.everydaystyle.com for free information. Saving time, money & steps Before you go anyplace else,take a walk through the Classifieds for the best bargains round.

1563 Regan Ave, Coquitlam 900 Sharp St, Coquitlam www.parklandplayers.com

School House Lic. Family D/C. F/T & P/T - 10m-5yrs. ECE, 1st Aid Cert. Includes pre-school program snacks, Spanish, sign language. + more. 25 yrs serving the Tri-Cities 604-939-5189

bcclassified.com Shopping made easy.

109 CAREER OPPORTUNITIES

WE’RE ON THE WEB www.bcclassified.com

98

PRE-SCHOOLS

SUNNY GATE MONTESSORI SCHOOL Preschool & Full Day Program ✶✶✶✶✶✶✶✶✶✶✶

Recipient of the Prime Minister’s Award for Excellence in Early Childhood Education.

✶✶✶✶✶✶✶✶✶✶✶ We Offer: • AM & PM Montessori Preschool • Extended Day Program from 7:30a.m. - 5:15p.m. • PM Junior Kindergarten with focus on math and language • Music, Drama & French

Now accepting registration for 2012/2013 School Year Inside LBD Lord Baden Powell School 450 Joyce St. Coquitlam (Across from the Vancouver Golf Course off Austin)

To register, please call us at 604-931-1549 or visit us at: www.sunnygatemontessori.com

EMPLOYMENT/EDUCATION 108 BUSINESS OPPORTUNITIES $294+ DAILY MAILING POSTCARDS! Easy! Guaranteed Legit Work! www.ThePostcardGuru.com $20-$60/Hr Using Your Computer! www.FreeJobPosition.com Overnight Cash To Your Doorstep! www.CashGiftingBucks.com More Amazing Opportunities Visit: www.LegitCashJobs.com EARN EXTRA CASH! - P/T, F/T Immediate Openings For Men & Women. Easy Computer Work, Others Positions Are Available. Can Be Done From Home. No Experience Needed. www.HWC-BC.com

SERVICE MANAGER Peterbilt Pacific Inc. Abbotsford is accepting resumes for a Service Manager. Requirements are: BCTQ, previous management or supervisory experience, excellent communication & customer skills, industry & job knowledge. Apply by resume only to: Peterbilt Pacific Inc. 1001 Coutts Way, Abbotsford B.C. V2S 7M2.

114

DRIVERS/COURIER/ TRUCKING

CLASS 1 DRIVERS WANTED! Sign bonus $2000 for Owner/op ph: 604-598-3498/fax: 604-598-3497

DRIVERS WANTED: Terrific career opportunity outstanding growth potential to learn how to locate rail defects. No Experience Needed!! Extensive paid travel, meal allowance, 4 wks. vacation & benefits pkg. Skills Needed - Ability to travel 3 months at a time Valid License with air brake endorsement. High School Diploma or GED. Apply at www.sperryrail.com under careers, keyword Driver DO NOT FILL IN CITY or STATE

EMPLOYMENT/EDUCATION 114

115

DRIVERS/COURIER/ TRUCKING

DRIVER WITH CLASS 1 + AIR WANTED To conduct deliveries for international lubricants co. in Vancouver area, Seattle-Tacoma, Prince George, Okanagan & Edmonton. Pay $20/hour, mileage, bonus, profit-sharing & full benefits. Apply with resume by emailing custservpacific@fuchs.com or faxing to 604-888-1145

115

EMPLOYMENT/EDUCATION EDUCATION

115

EDUCATION

124

FARM WORKERS

AIRLINES ARE HIRINGTrain for high paying Aviation Maintenance Career. FAA approved program. Financial aid if qualified- Housing available. CALL Aviation Institute of Maintenance 1(877)818-0783. APPLY NOW: Pennywise Scholarship For Women to attend Journalism certificate course at Langara College in Vancouver. Deadline May 30, 2012. More information: www.bccommunitynews.com

EDUCATION

Adventure + Agriculture = AGRIVENTURE! Live & work on European, United Kingdom, Australian, New Zealand or Japanese agricultural/horticultural operations. 18-30 year olds may depart in spring, summer or fall for 4-12 months or more. www.agriventure.com 1-888598-4415.

AUJLAS’ FARMS LTD FARM LABOURERS required 5 or 6 Days/Week 40 or 50 Hours/Week $10.25/Hour Horticultural work such as: Planting, pruning, spacing and harvesting the crop. Employment starts early July’12 Submit your application to: 604-465-8153 or by Fax:604-465-9340 or by mail:12554 Woolridge Rd., Pitt Meadows, B.C. V3Y 1Z1

AIRLINES ARE HIRING- Train for high paying Aviation Maintenance Career. FAA approved program. Financial aid if qualified- Housing available. CALL Aviation Institute of Maintenance (877)818-0783

109 CAREER OPPORTUNITIES

EMPLOYMENT/EDUCATION

109 CAREER OPPORTUNITIES

109 CAREER OPPORTUNITIES

The City of Coquitlam is a rapidly growing community of 120,000 people located in the heart of the Lower Mainland (Metro Vancouver, BC). As a recognized leader in municipal information and communications technology, we invite you to be a part of our award-winning team in the following role:

TRADES 2 MECHANIC

Apply your Journeyman-level skills in this temporary full-time role until November 30, 2013 Focusing on fleet maintenance/repair and exercising considerable independent judgement, you will perform skilled shop and field mechanical work, including maintenance, overhaul and repair on automotive and heavy duty equipment and vehicles. Along with a BC TQ (Heavy Duty / Commercial Transport Mechanic), you have: • at least 3 years’ related Journeyman experience • proficiency repairing/maintaining a variety of vehicles and equipment • the ability to work with minimal supervision while in a team environment • a Class 3 BC driver’s license with air endorsement. A CUPE hourly rate of $33.95 is offered, plus a competitive benefits package and compressed work week. Short listed candidates will be asked to supply a driver’s abstract. Please submit a cover letter and résumé citing reference #TCN-2012-100862, by 5:00 pm, April 16, 2012 to:

City of Coquitlam - Human Resources Division 3000 Guildford Way, Coquitlam, BC V3B 7N2 Phone: 604-927-3070 Fax: 604.927.3075 email: careers@coquitlam.ca; website: www.coquitlam.ca The City of Coquitlam is an Equal Opportunity Employer

We thank all applicants for their interests; however, only those selected for an interview will be contacted.


www.tricitynews.com

Tri-City News Wednesday, April 4, 2012, A25

EMPLOYMENT/EDUCATION 125

EMPLOYMENT/EDUCATION

FOSTER/SOCIAL CARE

130

HELP WANTED

EMPLOYMENT/EDUCATION 130

HELP WANTED

EMPLOYMENT/EDUCATION 134

HOTEL, RESTAURANT, FOOD SERVICES

EMPLOYMENT/EDUCATION 163

VOLUNTEERS

PERSONAL SERVICES 171

ALTERNATIVE HEALTH

HOME/BUSINESS SERVICES 206

APPLIANCE REPAIRS

Carriers Needed

The following routes are now available do deliver the NEWS in the Tri-City area: 6187 3-55 Hawthorn Dr

Some great kids aged 12 to 18 who need a stable, caring home for a few months. Are you looking for the opportunity to do meaningful, fulfilling work? PLEA Community Services is looking for qualified applicants who can provide care for youth in their home on a full-time basis or on weekends for respite. Training, support and remuneration are provided. Funding is available for modifications to better equip your home. A child at risk is waiting for an open door.

. Fitness Instructor

8461 787-802 Banting St 743-825 Como Lake Ave(odd) 740-760 Covina Crt 790-798 Dalip Crt 741-800 Egmont Ave 738-780 Ellice Ave 800-810 Fowler Crt 808-838 Raynor St (even) 804-926 Robinson St

.

$100-$400 CASH DAILY for Landscaping Work! Competitive, Energetic, Honesty a MUST!

8221 343-385 Blue Mountian St (odd) 901-975 Edgar Ave (odd) 900-970 Stewart Ave 907-964 Walls Ave

PropertyStarsJobs.Com

ADULT CARRIER

CITY OF YELLOWKNIFE. Lifeguard/Instructor. We are seeking an experienced individual to be a Lifeguard/Instructor. Refer to: www.yellowknife.ca for the required qualifications. Submit resumes by April 13, 2012, quoting competition 602106U to: Human Resources Division, City of Yellowknife, P.O. Box 580, YK, NT, X1A 2N4. Fax to: (867) 669-3471. Email: hr@yellowknife.ca

109 CAREER OPPORTUNITIES

Ability to work till late or work early (6am start) a great asset.

8611 3200-3228 Bosun Pl 1050-1091 Dolphin St 1060-1087 Hull Crt 3207-3223 Mariner Way (odd) 3201-3229 Pier Dr 3208-3225 Sail Pl

HELP WANTED

Call 604-472-3040

6078 631-800 Alderside Rd 646 Bentley Rd 642-740 Ioco Rd

6068 1-17 Parkdale Pl 1-18 Parkglen Pl 1-19 Parkwood Pl

RENTALS: These listings cover all types of rentals from apartments, condos, office space, houseboats and vacation homes. So if you’re in the market to rent, or looking for a roommate, start here. Call bcclassified.com 604.575.5555

With reliable car required to deliver The TriCity News door-to-door to households in the Tri-City area Wednesday & Friday.

Hiring for all FULL TIME Shifts for Prairie Ave & Home Depot locations in POCO.

9013 1140 Castle Cres

Make it yours. Call 604-708-2628 www.plea.bc.ca

130

8751 3226-3269 Karley Cres 1361 Shaughnessy St

Kisoya Sushi Ltd. is looking for a Japanese cook. Minimum 3 years experience in Japanese Cooking. Completion of secondary school. Cook Trade Certification. Full Time position, 40 hrs per week, $17/hr. 14 days paid vacation. Work location:#109B-1475 Prairie Ave., Port Coquitlam, BC V3B 1T3 If you are interested, Please send your resume to kisoyasushi@gmail.com

Shop from home! Check out our FOR SALE sections: class 500’s for Merchandise, 600’s for Real Estate, and for Automotive view our 800’s.

bcclassified.com

109 CAREER OPPORTUNITIES

8420 901-951 Austin Ave 506-534 Blue Mountain St (even) 922-948 Dennison Ave 500-600 Joyce St 501-530 Mentmore St 508-522 Roxham St 6013 3300-3364 Henry St 3301-3378 Viewmount Dr 3353-3373 Viewmount Pl 6055 1002-1015 Alpine Pl 1102-1119 Barberry Pl 3-17 Campion Crt 1302-1323 Campion Lane 1202-1224 Cypress Pl 1402-1414 Dogwood Pl 1502-1509 Fernwood Pl 1602-1622 Hemlock Pl 999-1124 Noons Creek Dr 8402 690-700 Blue Mountain St (even) 753-765 Cottonwood Ave (odd) 687-695 Easterbrook St (odd) 752-936 Runnymede Ave 752-764 Smith Ave (even) 6079 101 Parkside Dr 8118 333-359 Decaire St (odd) 356-376 Duncan St 1566-1778 Hammond Ave 378-399 Laurtian Cres 1551-1768 Thomas Ave 9262 1104-1189 Alderwood Ave 3910-3969 Ambleside Close 1103-1188 Lynwood Ave 4013-4098 Wedgwood St

Advertising Sales Consultant The Langley Times, a twice-weekly award-winning newspaper has an outstanding opportunity for a full-time sales person. The successful candidate will have a university or college education or two years of sales experience – preferably in the advertising or retail industry. The ability to build relationships with clients and offer superior customer service is a must. The winning candidate will be a team player and will also be called upon to grow the account list with an aggressive cold calling mandate. The ability to work in a an extremely fast paced environment with a positive attitude is a must. We offer a great working environment with a competitive base salary and commission plan coupled with a strong benefit package. Black Press has over 170 community newspapers across Canada and the United States and for the proven candidate the opportunities are endless. Please submit your resume with a cover letter by Friday, April 20, 2012 to: Dwayne Weidendorf The Langley Times, #102-20258 Fraser Highway, Langley, B.C. V3A 4R3 or email to publisher@langleytimes.com No phone calls please.

www.blackpress.ca

Division of Black Press

9709 1280-1320 Durant Dr 1200-1300 Hayward Lane (even) 1296-1320 Johnson St (even) 2800-2871 McLaughlin Ave 2628-2641 McLaughlin Crt 2627-2879 Walton Ave (odd) OTHER ROUTES NOT LISTED MAY BE AVAILABLE. PLEASE CALL TO ENQUIRE. If you live on or near one these routes and you are interested in delivering the papers please call Circulation

@ 604-472-3042 and quote the route number.

MOVIE EXTRAS ! WWW.CASTINGROOM.COM Families, Kids, Tots & Teens!! Register Now Busy Film Season

All Ages, All Ethnicities

CALL 604-558-2278

START NOW!!! 12 F/T CSR reps needed Up to $20/hr, weekly pay

Must be outgoing Call Erica

604.777.2195 131

HOME CARE/SUPPORT

L.P.N. NURSE or Care Aide who works evenings or midnight shifts to work 3 hrs a day on a 5 day shift in exchange for free room & board. Home Care for stroke patient! Call Harold 604-941-9021.

WE’RE ON THE WEB Browse Classified Listings On-line www.bcclassified.com

Benefits available, and competitive wage Email resume and hours available to: Subway_careers@shaw.ca

138

LABOURERS

DRIVER/LABORER for reg. pick-up + junk removal services. Must have class 5 with clean dr/ab + crim rec, be phys. fit + enthus with positive attitude. $16/hr. w/benefits. 24+ h/w apply @happystan1@hotmail.com

142 OFFICE SUPPORT/CLERKS

Be part of our exciting, worldclass softball tournament, which takes place from June 30 - July 9 in Surrey, BC. We are looking for volunteers in areas such as: scorekeeping, security & parking, transportation, batgirls, tickets & gates, and more! We ask that each volunteer work a minimum of 20 hours. In exchange for your time, each volunteer will receive:

Call our office or visit our website for more info. 604-536-9287 or www.canadianopen fastpitch.com or Attend our next Volunteer meeting for more details. Tuesday, May 1 7:00 pm at the Sandman Signature Hotel, 8828 201 Street, Langley

CONCRETE FINISHERS and Form Setters. Edmonton based company seeks experienced concrete finishers and form setters for work in Edmonton and northern Alberta. Subsistence and accommodations provided for out of town work; john@raidersconcrete.com. Cell 780-660-8130. Fax 780-444-7103.

236

CLEANING SERVICES

~~ A GIFT OF TIME ~~

Clean to Perfection Reliable / Honest ICBC & Veteran’s Claims Lic’d / Ins. ~ Windows Free Gift Certificates

175 CATERING/PARTY RENTALS

778-840-2421

Specializing in Private Events! We Come To You! Doing It All, From Set-Up - Clean-Up.

• Home Dinner Parties • Meetings • Funerals • Weddings • B-B-Ques • Birthdays • Anniversaries Unique Taste, Unique Menus... Gourmet, Customized Menus Tailored To Your Function...

Kristy 604.488.9161 threescocatering@shaw.ca

182 PERSONAL SERVICES 171

ALTERNATIVE HEALTH

101-1125 Nicola Avenue Port Coq. (behind COSTCO)

604-468-8889 candymassage.blogspot.com/

FINANCIAL SERVICES

DROWNING IN DEBTS? Helping Canadians 25 years. Lower payments by 30%, or cut debts 70% thru Settlements. AVOID BANKRUPTCY! Free consultation. www.mydebtsolution.com or Toll Free 1 877-556-3500 GET BACK ON TRACK! Bad credit? Bills? Unemployed? Need Money? We Lend! If you own your own home - you qualify. Pioneer Acceptance Corp. Member BBB. 1-877987-1420. www.pioneerwest.com If you own a home or real estate, ALPINE CREDITS can lend you money: It’s That Simple. Your Credit / Age / Income is NOT an issue. 1.800.587.2161. MONEYPROVIDER.COM. $500 Loan and +. No Credit Refused. Fast, Easy, 100% Secure. 1-877776-1660.

188

for the Kitimat Modernization Project. Approximate Journeyman Structural Steel Rate $36.27 This work will start 6/15/12. Please respond to this ad by 4/20/12. Please respond via email by placing Structural Steel Erector in the subject line to: patton@bakerconcrete.com

LEGAL SERVICES

CRIMINAL RECORD? Guaranteed Record Removal since 1989. Confidential, Fast, & Affordable. Our A+BBB Rating assures EMPLOYMENT & TRAVEL FREEDOM. Call for FREE INFO. BOOKLET

1-8-NOW-PARDON (1-866-972-7366) RemoveYourRecord.com

604-460-8058 #7 - 20306

HOME/BUSINESS SERVICES

203

Dewdney Trunk, M. Ridge Corner Max Gas Station

A + Spa

ACCOUNTING/TAX/ BOOKKEEPING

INCOME TAX. TAJ DAMJI 604-781-0315. Pickup delivery in Tri City Free. Singles $45 Couples $65. No limit on number of slips.

TAX RETURNS

604-942-8688

Current and overdue returns going back as far as 1998

- near Safeway Sunwood Square

Starting at $45.00 per return Couples discount at $80.00

242

CONCRETE & PLACING

DALL’ANTONIA CONCRETE Seniors disc. Friendly, family bus., 40+ yrs. 604-240-3408/604-299-7125

HERFORT CONCRETE NO JOB TOO SMALL Serving Lower Mainland 23 Years! *Prepare *Form *Place *Finish *Granite & Interlocking Block Walls *Stairs *Driveways *Exposed Aggregate *Stamped Concrete. *Interlocking Bricks *Sod Placement -Excellent Ref’s -WCB Insured

LEO: Mobile #657-2375, 462-8620

PLACING & Finishing * Forming * Site Prep, old concrete removal * Excavation & Reinforcing * Re-Re Specialists 32 Years Exp. Free Estimates.

Call: Rick (604) 202-5184

STAMPED CONCRETE FPatios FPool Decks FSidewalks FDriveways FForming FFinishing FRe & Re All Your Concrete Needs 30yrs exp. Quality workmanship Fully Insured

Danny 604 - 307 - 7722

UNIQUE CONCRETE DESIGN F All types of concrete work F F Re & Re F Forming F Site prep FDriveways FExposed FStamped F Bobcat Work F WCB Insured

778-231-9675, 778-231-9147 FREE ESTIMATES

257

DRYWALL

COMPLETE DRYWALL SERVICE, res/com. Ref’s. Reno’s. Reas. rates. 604-941-8261, cell 778-999-2754.

FRANKS Drywall *Boarding*Taping *Spraying no job too sm. Seniors rts Free ests. 604-939-7029, 809-1945 THREE STAR DRYWALL LTD Boarding, Taping, & texture. Small jobs welcome! Kam 604-551-8047

M A R K B R A G I E L, CFP Tri-City Business Centre 604-552-9399 ext. 329

260

Tax Returns

DC ELECTRIC (#37544). Bonded. 24 hr service. We specialize in jobs too small for the big guys! 30 yrs exp. Free est. 604-460-8867.

ELECTRICAL

• Personal • Self employed • Corporate

DL Baker Construction Canada is looking for Cement Mason/Finishers in Kitimat, BC, Canada. Red Seal preferred. Finishers must possess competency in finishing high tolerance floors. Knowledge & experience in using all finishing hand tools, walk behind, and riding trowels. Must have experience in floor hardeners, shake and the ability to establish grade. Project Terms is Project Based Wages are in accordance with Project Labour Agreement between Kitimat Modernization Employer Association and Coalition of

Disc. for seniors

604-468-2287

(Mon - Fri) 9 - 5:30 pm, Sat. Appt

accountableaccounting.ca TAX RETURNS Professionally Prepared by CGA Personal Tax Returns & Efile CorporateTaxes/Financial stmnts. Consultation & Bookkeeping Very Reasonable Rates

604-472-7776 #300-2232 McAllister Ave. POCO

206

British Columbia Building Trades

for the Kitimat Modernization Project. Approximate Journeyman Cement Mason $31.82 This work will start 6/1/12. Please respond to this ad by 4/20/12. Please respond via email by placing Cement Mason/Finisher in the subject line to patton@bakerconcrete.com

HEALTH PRODUCTS

HERBAL MAGIC - With Herbal Magic lose up to 20 pounds in just 8 weeks and keep it off. Results Guaranteed! Start today call 1-800854-5176.

WE’RE ON THE WEB www.bcclassified.com

British Columbia Building Trades

DL Baker Construction Canada is looking for Rodbusters in Kitimat, BC, Canada. Red Seal preferred. Rodbusters must be competent in rigging, shaking out & installing (tying) all types of reinforcement used in concrete. Must have basic knowledge of reading and understanding cut sheets and drawings for the reinforcing. Must be capable of signaling and rigging loads for cranes. Project Terms is Project Based Wages are in accordance with Project Labour Agreement between Kitimat Modernization Employer Association and the Coalition of British Columbia Building Trades for the Kitimat Modernization Project. Approximate Journeyman Rodbuster $36.27 This work will start 5/1/12. Please respond to this ad by 4/20/12 Please respond via email by placing Rodbuster in the subject line to patton@bakerconcrete.com

173E

• FREE ADMISSION to all playing venues • 1 complimentary item of event apparel • 1 complimentary meal per volunteer shift worked!

TRADES, TECHNICAL

DL Baker Construction Canada is looking for Structural Steel/Precast Erectors in Kitimat, BC, Canada. Red Seal preferred. Erectors must be capable of erecting, installing of temporary braces, splice plates and welding required for the erection of precast panels. Must have the ability to read shop drawing and provide basic layout of precast. Must have the ability to correctly rig and hoist material. Provide proper crane signals to fly material in place. Project Terms is Project Based Wages are in accordance with Project Labour Agreement between Kitimat Modernization Employer Association and Coalition of

JIM PUGH Owner/Technician 30 Yrs+ Experience 3755 Bracewell Court, Pt Coq. Pgr: 669-6500 #4909

AT THE SCOTIABANK CANADIAN OPEN FASTPITCH!

WE are seeking an Administrative /Accounting Assistant. Must be very organized, professional, friendly, polished and detail-oriented. Send applications to: grsstt@msn.com

160

MAJOR Appliance Repairs to All Makes

VOLUNTEER

APPLIANCE REPAIRS

POCO Appliance Mart 942-4999 Service to all Makes of Appliances & Refrigeration. Work Guaranteed

Radiance Day Spa Tel:604-936-6828 K-435 North Road Coquitlam

JOBS: Whether you’re looking to find or fill a position, this is where your search begins.

bcclassified.com

(#102055) Bonded

Specializing in Renos New Const, (Comm./Res.) Free Estimates 778.885.7074 Trent Reisinger

Sekora Electric Ltd. Specializing in residential renos and service panel upgrades. Free est. 604-657-9776 EC. Lic# 88601

Small Ads, BIG Deals!

www.bcclassified.com


A26 Wednesday, April 4, 2012, Tri-City News HOME/BUSINESS SERVICES 260

ELECTRICAL

www.tricitynews.com

HOME/BUSINESS SERVICES

HOME/BUSINESS SERVICES

283 GUTTERS & DOWNSPOUTS

300

LANDSCAPING

HOME/BUSINESS SERVICES

HOME/BUSINESS SERVICES

329 PAINTING & DECORATING

353 ROOFING & SKYLIGHTS

HOME/BUSINESS SERVICES 374

TREE SERVICES

✶ Electrical Contrator ✶ Residential / Commercial ✶ Advanced lighting control (iPhone, iPad integration)

Contact us for all your electrical and maintenance needs.

GUTTER Cleaning Service, Repairs Free Est, 20 yrs exp, Rain or shine. 7 days/week. Simon 604-230-0627

Call 604-802-6722

M.T. GUTTERS

Visit our website:

Professional Installation

www.stonebridgeom.com

5” Gutter, Down Pipe, Soffit

NO Wood byproducts used

28 YRS EXP. *FULLY INSURED

When QUALITY Matters

PEDRO’S GENERAL CONTRACTING & DRAINAGE. ✶ Pipelining, backfilling, landscaping, water lines & more. ✶ Hardworking, reliable & reasonable rates. 604-468-2919.

Tree removal done RIGHT!

“ ABOVE THE REST “ Int. & Ext., Unbeatable Prices, Professional Crew. Free Est. Written Guarantee. No Hassle, Quick Work, Insured, WCB. Call (778)997-9582

17607 Ford Road Pitt Meadows

HOME IMPROVEMENTS

PICK-UP ...... or .... DELIVERY

604-465-3189

A-1 CONTRACTING. Renos. Bsmt, kitchens, baths, custom cabinets, tiling, plumbing, sundecks, reroofing. Dhillon 604-782-1936.

A-TECH Services 604-230-3539 Running this ad for 8yrs

PAINT SPECIAL

ADDITIONS, Renovations & New Construction. Concrete Forming & Framing Specialist. 604.218.3064

3 rooms for $299, 2 coats any colour (Ceiling & Trim extra) Price incls Cloverdale Premium quality paint. NO PAYMENT until Job is completed. Ask us about our Laminate Flooring & Maid Services. www.paintspecial.com

Rick’s Bobcat Service. Leveling, Back filling, Trucking reas. rates.778-355-2978, 604-290-2978

269

FENCING Making Your Renovation Dreams Come True... Kitchens - Bathrooms New Additions - Flooring Painting - Decks Windows / Doors Stonework - Siding & More Free Estimates * BBB * WCB * Insured

ASHDOWN CONTRACTING Fences, Decks & Reno’s. Quality you can Afford. 604-970-4732

275

FLOOR REFINISHING/ INSTALLATIONS

POLMAR HARDWOOD FLOORS New floor inst. & finishing. Refin. Repairs, Staining. Free Est.. Mario 604-671-8501 or 604-468-4117.

HOOT & OWL Renovations & repairs Also rubbish removal available Email: hoot&owl@telus.net Gary 604-339-5430 MLG ENTERPRISES All Aspects Landscaping & Garden Solutions

317 OF Home (604)501-9290

604-728-5643

MISC SERVICES PRO ✶ ACC PAINTING LTD ✓ ✓ ✓ ✓

GrassSBranchesSLeavesSWeeds $59.00 Per Ton

Meadows Landscape Supply

CANE CORSO MASTIFF, shots, dewormed, tails cropped, vet ✓ $1,000. Call 604-826-7634.

EXTRA

CATS GALORE, TLC has for adoption spayed & neutered adult cats. 604-309-5388 / 604-856-4866

Fully Insured

All Work Guaranteed

Call John 604-464-8700 778-867-8785

MOVING & STORAGE

NO JOB TOO SMALL! Renovations/Repairs/Building Emergency services available! S Bathrooms S Basements S Suites S Decks / Sheds S Plumbing S Flooring / Tiles S Electrical S Interior Designing

Gary 604-690-7JNL (7565) “Family Owned & Operated in the Tri-Cities”

300

LANDSCAPING

Alpine Landscaping ◆ ◆ ◆ ◆

Retaining Walls New Lawns Plant Installation Complete landscape installation services.

604 - 961 - 8595 ANDY’S LANDSCAPE Majored, 20yr exp. www.andyslandscape.ca 778-895-6202

$36/HOUR. Local lic’d Plumber. Big & small jobs. Plumbing, heating, plugged drains, call (778)549-2234

Local & Long Distance

$45/Hr

From 1, 3, 5, 7,10 Ton Trucks Licenced ~ Reliable ~ 1 to 3 Men Free estimate/Seniors discount Residential~Commercial~Pianos

✔ ALL YOUR PLUMBING NEEDS Call Niko Plumbing Ltd. 24/7. Res/Com, plugged drains. h/w tanks. ★15 yrs exp. 604-837-6640 Bridgeview Plumbing & Heating : H/W tank, New construction, repairs, furnace. Licensed, insured and bonded.604-561-7756

604-537-4140

D Free estimates D Insured Licensed D References Residential D Pressure Washing

Serving Tri City 32 Yrs. Call 24 Hrs/7 Days paylesspainting.multiply.com

Scott 604-891-9967 INTERIOR / Exterior Repaints & New Construction Ceiling Painting/Drywall Repair

Call: (604)460-8776

DRNEWEARTH.COM Craig 604 - 240 - 7594

★ Disposal ★ Renovations Debris ★ Construction ★ Drywall Pickup ★ Demolition ★ 7 days/week ★ Free Estimates ★

359 SAND, GRAVEL & TOPSOIL Always! deliver Top soil, bark mulch, sand & gravel. 7days/wk. Simon 604-230-0627 will spread

.Enterprise Plumbing, Heaitng, Gasfitting

341

PRESSURE WASHING POWER WASHING GUTTER CLEANING

SAME DAY SERVICE AVAILABLE

Call Ian 604-724-6373 TOPLINE PRESSURE WASHING Siding, gutters, & tile roofs. We use SOAP. WCB insured 604.861.6060

353 ROOFING & SKYLIGHTS KIWI ROOFING. For all your residential re-roofing needs. Call Rob for free estimate. (604)537-7057

HOMES WANTED

SUNDECKS

LAB PUPPIES, chocolate & black healthy, family raised. Parents on site. $625. Vet ✔, 1st shots 604755-1364 shakhana@hotmail.com NEED A GOOD HOME for a good dog or a good dog for a good home? We adopt dogs! Call 604856-3647 or www.856-dogs.com NORWEGIAN ELKHOUND PUPS. Dewormed, 1st vaccination. Ready now! 604-823-2259 mitzvig@hotmail.ca PUGS, fawn, 2 male, 2 female. family raised, vet chk’d, shots. $500. (604)796-2727/799-2911 Rottweiler Pups- PUREBRED, tails, dewclaws, shots, vet checked Health guarantee. Ready April 6th $650. to $1,000, 604 460 0804. SHIH TZU PUPPIES, Male & Female. 1st shots. Tricolor $450. 604-465-4305

WE BUY UGLY HOUSES! Older House • Damaged House Moving • Estate Sale • Just Want Out • Behind on Payments Quick Cash! • Flexible Terms! CALL US FIRST! 604-657-9422

660 LANGLEY/ALDERGROVE HOMES FOR SALE-SUPER BUYS

www.dannyevans.ca

Homelife Benchmark Realty Corp. Langley

MERCHANDISE FOR SALE Aluminum patio cover, sunroom, gates, alum roof. 604-521-2688 www.PatioCoverVancouver.com

Woodland Decks WDesign & Renovations WCedar Decks WFences WWooden Retaining walls Home Renovations Call Patrick for a free est.

374

329 PAINTING & DECORATING

LOOK for our YARD SIGNS

Jack Russell pups, cute, short, stocky, smooth coat, tail doc, deworm, 1st shot. $600. 604-798-9233

604-351-6245

SPARTAN Moving Ltd. Fast & Reliable. Insured Competitive rates. Wknd Specials. Call Frank: (604) 435-8240

# 1 PAY-LESS Painting Ext./Int. SPRING Special

★ ★CALL NOW★ ★ LOW COST RUBBISH REMOVAL

PLUMBING

ABE MOVING - $35/Hr. Per Person *Reliable Careful Movers. *Rubbish Removal. *24 Hours. 604-999-6020

DRNEWEARTH.COM Call: (604)460-8776

338

10% OFF if you Mention this AD! *Plumbing *Heating *Reno’s *More Lic.gas fitter. Aman: 778-895-2005

AFFORDABLE MOVING

RENO & REPAIR

Cocker spaniel pups – purebred, no papers 1st shots, dewormed, ready to go now. $600. Call 604-888-0832

www.proaccpainting.com

1PRO MOVING & SHIPPING. Real Professionals, Reasonable. Rates. Different From the Rest. 604-721-4555.

627

CATS OF ALL DESCRIPTION in need of caring homes! All cats are Spayed, neutered, vaccinated and dewormed. Visit us at fraservalleyhumanesociety.com or call 1 (604)820-2977

(778)997-5757, (604)587-5991

372

HOUSES FOR SALE

PETS

Serving The Lower Mainland Since 1988

Ph: 604-942-4383

604-465-1311

320

- Est. 1989 F WCB, Insured, Licensed F Free Estimates F Many References F All Types of Painting

477

220.JUNK(5865)

Isaac 604-727-5232

SBroken Concrete RocksS $22.00 Per Metric Ton SMud Dirt Sod ClayS $22.00 Per metric Ton

Yard Maintenance Hedge Trimming~Tree Pruning Lawn Cuts ~ Weeding Wooden Retaining Wall

meadowslandscapesupply.com

Robert J. O’Brien

✶Dump Site Now Open✶

★ SPRING CLEANUP ★

(604)465-1311

“JUST A GREAT JOB!”

Improvements,

COQUITLAM LANDSCAPING

✶ Bark Mulch ✶ Lawn & Garden Soil ✶ Drain Grave Lava Rock ✶ River Rock ✶Pea Gravel

NO Headaches NO Surprises NO Excuses

626

PETS

BERNESE Mountain Dog Puppies. 2 females remaining Vet checked with first shots and ready for new homes. $950. 778-241-5504. Langley

RUBBISH REMOVAL Almost for free!

*Retaining Walls *Interlocking *Fencing *Drainage *Decking *New Lawns *Hedges 17 Years exp. - Work Guaranteed Cel:604-836-6519, 778-285-6510

Always! Pwr. raking, grass cutting, fertilizing, hedging, pruning, Rubbish rem. Free Est. 604-230-0627

Meadows Landscape Supply Ltd.

Free Estimates * Fully Insured

CHEAP

SPRING YARD MAINT.

604 - 961 - 8595

Seven Days a Week

On Time, As Promised, Service Guaranteed!

bradsjunkremoval.com

Landscaping

Alpine Landscaping

Prompt Delivery Available

Call Scott at 604-618-0333 Certifi ed Arborist

Northstar Painting Ltd.- The Residential Specialists. BIG jobs, Small jobs - We do it all! Interior and Exterior Projects. Master Painters at Students Rates. WCB Safe, Reliable, Efficient & Quality Paint. 778.245.9069

SAWMILLS from only $3997 MAKE MONEY & SAVE MONEY with your own bandmill - Cut lumber any dimension. In stock ready to ship. FREE Info & DVD: www.NorwoodSawmills.com/400OT 1-800-566-6899 Ext:400OT.

Your Tree Service For Honest Prices & Quality Work

www.recycleitcanada.ca

NICK’S

Dean 604-834-3076

www.treeworksonline.ca treeworkes@yahoo.ca 10% OFF with this AD

• Estate Services • Electronics • Appliances • Old Furniture • Construction • Yard Waste • Concrete • Drywall • Junk • Rubbish • Mattresses & More!

16897 Windsor Road Pitt Meadows

Kitchens, Bathrooms, Flooring, Drywall, Garages, Decks & more * 30 YEARS EXPERIENCE* INSURED ~ WCB

✶ 2012 Spring Special ✶

IVY GREEN YARD SERVICE Hedges, pruning, yd cleanup, maint 35 years exp. FREE Estimates. Guar. Work. Calvin 604-992-4633

JUNK REMOVAL Recycled Earth Friendly

But Dead Bodies!!

Home Renovations and New Construction

15% SENIORS DISCOUNT lawn cuts, aerating, power-raking, pruning, hedge trimming, trees, 23 yrs. exp. Free est. Brad 778-552-3900

S S S S

RECYCLE-IT!

Haul Anything...

604-465-9812 1-800-663-5847

604-787-5915, 604-291-7778

DIY STEEL BUILDING DEALS! Many sizes and models. Make an offer on clearance buildings today and save thousands of dollars. FREE BROCHURE - 1-800-6685111 ext. 170.

RUBBISH REMOVAL

#1 DUMP YOUR JUNK No job too small.On time every time 604-939-0808 D 604-649-4339

(Turn right 1st road East of Pitt River Bridge from Vancouver)

GARDENING

$95 includes: Aeration, Moss Control & Fertilization Now accepting NEW 10 day weekly lawn mowing customers. ✓Installation ✓ Maintenance ✓Renovations ✓Call a Profes.

356

604.

Hardwood Floor Specialist •Installation•Sanding•Refinishing Express your unique & individual style with a custom stain. Dust free sanding. 778-995-Wood (9663). View our picture gallery at www.visionexotik.com

281

Roofing Experts. 778-230-5717 Repairs/Re-Roof/New Roofs. All work Gtd. Free Est. Call Frank.

• Tree & Stump Removal • Certified Arborists • 20 yrs exp. • 60’ Bucket Truck • Crown Reduction • Spiral Pruning • Land Clearing • Selective Logging ~ Fully Insured • Best Rates ~

604.587.5865

Instant Grassifacation!

www.caliberwest contracting.com 604.764.9594

VISION EXOTIK FLOORING INC.

615 COMMERCIAL PROPERTY

Jas 778-896-4065 Bell 604-339-2765

COMPOSTED MUSHROOM MANURE $5/Yard + Delivery *****************

MERCHANDISE: CLASS 500’S From antiques & collectibles, to sporting goods and electronics, to parakeets and pet supplies, if it’s considered merchandise for sale, you can find it here.

287

25 year of experience. Call for your FREE estimate.

**SPRING SPECIAL**

263 EXCAVATING & DRAINAGE BAJ MINI EXCAVATING, Sewer, storm, drainage, oil tank removal, paving, old house drainage. 604779-7816, 604-540-9420

REAL ESTATE

all soils are tested for Optimum growing requirements

Cleaning & Repairing Call Tim 604-612-5388 YOUR ELECTRICIAN $29 Service Call Lic #89402 Same day guarn’td We love small jobs! 604-568-1899

NAHAL CONSTRUCTION New and Re-Roof Specialist Residential & Commercial. Shakes, Shingles and Duroid.

D Garden Blend Soil D Lawn Blend Soil D Custom Blends avail. D Composted Mushroom Manure

566 MUSICAL INSTRUMENTS

PIANO; APT SIZE Lowrey upright piano $550/obo. Ph: 604-418-6274 or 604-531-1576.

AAA PRECISION PAINTING. Quality work. 778-881-6096.

Gutter Cleaning & Repairs. (Res. & Strata). Prompt Service. Window Cleaning & Pressure Washing. Grants Home Maint. 604-936-2808.

MERCHANDISE FOR SALE

TREE SERVICES A1-TRI-CRAFT Tree Serv. Dangerous tree removal, spiral pruning hedge trimming, stump grinding, topping. Insured, WCB Free Est Arborist Reports

Andrew 604-618-8585 $ Best Rates $

506

APPLIANCES

POCO Appliance Mart 942-4999 Rebuilt*Washer*Dryer*Fridge*Stove Up to 1 Yr Warranty. Trade-in Avail.

696

RURAL NOVA SCOTIA water front lots for sale. Country living at its best. Three bedroom apartments for rent. 45 miles to university town. www.sawmilllanding.com waterfront@bellaliant.net 1.902.522.2343

Searching for your dream home or selling it? This is the location. BCCLASSIFIED.COM listings include everything from acreage, farms/ranches to condos and waterfront homes.

548

FURNITURE

MATTRESSES staring at $99 • Twins • Fulls • Queens • Kings 100’s in stock! www.Direct Liquidation.ca (604)294-2331

559

MEDICAL SUPPLIES

FAST RELIEF the First Night!! Restless Leg Syndrome and Leg Cramps Gone. Sleep Soundly, Safe with Medication, Proven Results. www.allcalm.com 1-800-765-8660.

560

MISC. FOR SALE

CAN’T GET Up Your Stairs? Acorn Stairlifts can help. Call Acorn Stairlifts now! Mention this ad and get 10% off your new Stairlift! Call 1-866-9815991. Can’t Get Up Your Stairs? Acorn Stairlifts can help. Call Acorn Stairlifts now! Mention this ad and get 10% off your new Stairlift! Call 1866-981-5991 **HOME PHONE RECONNECT** Call 1-866-287-1348. Prepaid Long Distance Specials! Feature Package Specials! Referral Program! Don’t be without a home phone! Call to Connect! 1-866-287-1348.

OTHER AREAS

RENTALS 706

APARTMENT/CONDO #1 IN RENTALS (Since 1990)

Professional Property Management Services P.Meadows Brand New - Solaris Towers. 2 & 3 bdrms, 5 appli’s, nr WCE, shops,parks,schls. Now. NS/NP,refs. Rents Start@ $1200 Downtown POCO - 4 bdrms + den house. Cls to schools, WCE, all amens. Cat ok $1750/mo.

Call 604-464-7548

$1260, April 1, one bdrm & a large den, close to all amenities, gym, dishwasher, washer/dryer, parking, storage, guest room, party room. 778-995-4146 & 604-925-9236

COQUITLAM CENTRE - NEW 2 BEDROOM APARTMENT $1,525/month - Luxurious living in Metropolitan-One, 899 sq.ft, 6 highend appliances, workstation, secured parking/storage, available immediately, refs. required, no smoking, no pets. Call: 604-469-1054

COQUITLAM: Clean, quiet apt blk. Suites to rent. Sorry no pets. Family owned & operated for 39 yrs. (604)936-5755.


www.tricitynews.com

Tri-City News Wednesday, April 4, 2012, A27

RENTALS 706

APARTMENT/CONDO BURNABY & COQUITLAM

Spacious 2 & 3 Bdrm T/hses 2 Bdrm Apartments With accessible amenities, in safe family oriented communities of Coquitlam, North Burnaby. Pet friendly.

Subsidies available based on gross houseold income.

RENTALS 706

APARTMENT/CONDO

706

Coquitlam/Port Moody

St. John’s Apartments 2010 St. John’s St, Port Moody Cozy apts easy access to SFU. 1 & 2 bdrms from $720. Close to schools, transit, Barnet Beach & park. View suites of Burrard Inlet. U/g pkg, laundry room. For more info & viewing call

2 Bedroom Apartment between $22,800 & $31,800

Dragan 778-788-1845

2 Bedroom Townhouse between $30,000 & $37,200

Hyland Manor

3 Bedroom Townhouse between $34,800 & $43,200 If your income is lower than these ranges call BC Housing 604-433-2218

RENTALS

751 Clarke Rd, Coquitlam Beautiful, large, 1 & 2 bdrm stes from $750. Close to Lougheed Mall, transit, parks shopping. Nestled in a park like setting, a must see. Parking, laundry room. For more info & viewing call

For further info call 604-451-6075 to view

Dragan 778-788-1845

Metro Vancouver Housing Co-operation.

Professionally Managed by Gateway Property Management

APARTMENT/CONDO PORT COQUITLAM

1 Bdrm & den suite $875 2 Bdrm corner suite $925 S Incl heat/hot wtr, wndw cvrngs S Close to bus stop S Walk to shpng/medical/WCE S Across from park w/Mtn views S Gated parking and Elevator S Adult oriented building S References required CALL FOR APPOINTMENT

Call 604-944-2963 Derek Manor 2048 Manning Ave. Port Coq ~ 604-941-5452 or 604-944-7889 FREE PREMIUM CABLE $80 Value

515-525 Foster Avenue 2 Bedroom suite available immediately (heat and hot water included). Pet allowed.

S Impeccably clean S Heat S Hot Water S Parking

1 bdrm $790/mo - No pets

Avail April 1 - Ref’s req’d GLEN/PINETREE New Highrise, 2 bdrm, 2 baths, wrk stn, prk, strg, 8 appls. Immed. $1400/mth. NS/NP. 604-817-8381 between 8am to 8pm GREENBOROUGH APTS

“New Building” 1 bdrm - from $1025 /mth 2 bdrm, 2 bth - from $1395/mth

(604) 463-9522 Central Maple Ridge 2 BDRM. AVAIL. NOW

Great location for seniors!

Clean, quiet & affordable! Incl. heat, h/w, cable. Senior Move-In Allowance.

Avail. immed. Centrally located. N/S, No dogs. Close to all amens & transportation. Clubhouse facilities.

Phone (604)468-1698 LGE 2 bdrm, upper flr, sep. ent, newly painted, on bus routes, close to schools & park, no pets, ref, $750 plus util., 604-802-4039

Polo Club Apartments 19071 Ford Rd. Pitt Meadows

OFFICE/RETAIL

748 SHARED ACCOMMODATION PORT COQUITLAM bright furn’d room in large gr lvl ste, full bath, nr amens, $450 incl util/cbl/net. Avail now. NS/NP. Refs. 604-807-9612

SUITES, LOWER

1 BEDROOM & LARGE DEN GARDEN SUITE.

$9,995.00 604-463-9428

9½ft Vanguard camper, new fridge. $700. Call 604-888-6042.

Contact 604-944-6345 COQUITLAM, 2/bdrm ground floor, insuite laundry. $1000/mo. Incl util. April 15. NS, NP (604)561-6553 COQUITLAM - Ranch Park - Avail. Immediately. Semi-furnished bsmt studio suite $750 with separate entrance. Incl: wifi, utilities, cable, offstreet parking, shared laundry & patio. Close to transit & Coq Ctr. Good transit links to SFU, Douglas College. NS/NP. 778-968-6260. COQUITLAM WEST. 2/bdrm suite, newer house. Laundry. $1100/mo. incl util/cable. May 1. NP, NS. 604-937-6692 or 604-727-4549 COQUITLAM WW Plateau. Bright grnd. level 2 bdrm. Ldry incl. $900. N/S. N/P. Avail now. 604-808-2964. NORTH POCO. 2 bdrm, bright. laminate floors. Shrd laundry. Quiet loc. Nr river. N/S, No dogs. $875/mo. 604-617-3599.

Clean, Quiet Well Managed Bldg. 3 Blocks to W.C. Express W 1 & 2 Bdrm Suites W 3 Appliances W Secured Garage Parking W Adult Oriented W Ref’s Req’d & Absolutely No Pets

PORT COQUITLAM 1 bdrm. suite, grnd. lvl., large & bright. N/P N/S. Sep. entry. Avail now. $770 mo. incl. utils.,cable & int. 604-323-3580

604.465.7221 PORT COQUITLAM

RENOVATED 2 BDRM Available 2 bdrm, renovated suites - $850$925/mo. Some with D/W & W/D. Centrally located. Adult oriented. Refs req. Sorry no pets.

Call 604-941-9051

For more info. google us. PORT COQUITLAM: 2 Bdrm apts. $780 & $800/mo. Quiet family complex. No pets. Call 604-464-0034.

WE’RE ON THE WEB www.bcclassified.com

PORT COQUITLAM, 2/bdrm grnd level suite. Full bath. Sep entry. Cl to all amenities. $800/mo incl hydro, gas, cable, laundry. N/S, N/P. Avail May 1. (604)945-5911 PORT COQUITLAM, Northside. Clean quiet 2 bdrm suite, priv entry & prk, patio, newer paint, carpet & lino. Separate lndry. Near all aments, N/P, N/S. Ref’s. Avail. now. $850/mo incl hydro. 604-537-2131.

SCRAP CAR REMOVAL 2 hr. Service www.a1casper.com (604)209-2026

2008 JEEP PATRIOT - North Edition 5 spd, 40,000 kms. Warranty. $16,000/obo. (604)525-3508

851 AAA SCRAP CAR REMOVAL Minimum $150 cash for full size vehicles, any cond. 604-518-3673

Autos • Trucks • Equipment Removal

DreamCatcher Auto Loans “0” Down, Bankruptcy OK Cash Back ! 15 min Approvals

By virtue of a WAREHOUSEMAN’S LIEN for Coquitlam Towing & Storage Co. Ltd we will dispose of the following unit to recover the amount of indebtedness noted plus any additional cost of moving, storage, seizure and sale. 12-057A 2004 DODGE RAM Vin#: 1D7HA16D94J129361 Registered Owner: BURNS, HOWARD JAMES Indebtedness: $5,810.80

FREE TOWING 7 days/wk. We pay Up To $500 CA$H Rick Goodchild 604.551.9022

TRUCKS & VANS

2008 Silverado 2500HD

12-057B 2002 JEEP LIBERTY Vin#: 1J4GL48K82W146899 Registered Owner: BARRIENTOS, ASTUA LUIS CABRIER Indebtedness: $3,158.40 12-057C 2003 GMC ENVOY Vin#: 1GK0S13S332156948 Registered Owner: ROACH, ERIN Indebtedness: $4,402.62 Day of sale is Wednesday April 11, 2012 @ 12:00 NOON.

Crew cab, 4x4, power windows/locks, A/C, AM/FM/CD, color matched Leer canopy, tow package.$20,995(Stk# 30683AA) www.fraserway.com/ consignment 1-877-651-3267 DL#31087

Absolute Bailiffs Inc. 20119 113B Avenue, Maple Ridge, B.C., V2X 0Z1 Contact: Sheldon Stibbs 604-522-2773

BEFORE BUYING NEW OR USED... Check the classifieds.

2009 DODGE RAM 3500

1-800-910-6402

www.PreApproval.cc DL# 7557

GUARANTEED Auto Loans or

Here are just a few of the classifications offered in our

We Will Pay You $1000

All Makes, All Models. New & Used Inventory. 1-888-229-0744 or apply on line at: www.kiawest.com (click credit approval) Must be employed w/ $1800/mo. income w/ drivers license. DL #30526

#1 FREE SCRAP VEHICLE REMOVAL ASK ABOUT $500 CREDIT $$$ PAID FOR SOME 604.683.2200

Short box, reg. cab, pwr. windows/locks, AM/FM/CD, trailer tow pkg. $39,995(Stk# 27776)

www.fraserway.com/ consignment

Automotive Section: Class 818 - Domestic Cars Class 821 - Sports & Imports Class 851 - Trucks & Vans

1-877-651-3267 DL#31087

SHIFT AUTO FINANCE Get Approved Today! CREDIT DOESN’T MATTER.. For The Best Interest Rate Call: 1.877.941.4421 www.ShiftAutoFinance.com WANT A VEHICLE BUT STRESSED ABOUT YOUR CREDIT? Christmas in April, $500 cash back. We fund your future not your past. All credit situations accepted. www.creditdrivers.ca 1-888-5936095.

3UHVHQWHGE\

818

CARS - DOMESTIC

1993 BUICK Park Ave. Altera, fully loaded, G.T.S., aircared, $3,900. Call (778)565-4334 2003 CHEVY MALIBU 110,000 km, auto, AirCared, good tires, $3000 obo. Call: (604)531-3251 2008 PONTIAC WAVE, 4 dr sedan, auto, high kms. runs/looks good, white, $4300 firm. 604-538-9257.

821 CARS - SPORTS & IMPORTS 2001 HONDA ACCORD-4 dr. sedan, 4 cyl. auto, local, silver w/ grey cloth, 161k, pwr. options, A/C, very clean in/out. $5500 / 604.312.7415 2001 VOLKSWAGEN JETTA, 1.8T turbo, 4 dr sedan, std, all options, exc cond. $5500 obo 604-780-8404

5HJLVWHUQRZ#ZKHHOWRKHDOFD

 6$)(&2856(6

IRU\RXWRFKRRVHIURP .,'6

.

2002 TOYOTA CAMRY XLE 4 door. White 187,000 kms. $7700. Call 604-541-9129. 2005 TOYOTA COROLLA, 114 km, loaded, p/sun roof, all maint. done, exc. cond. $6,300. 604-836-5931. 2007 TOYOTA COROLLA, 4 dr, loaded, 82kms, local, exc. cond., $7,800 obo. Call 604-596-9970.

0DMRU6SRQVRU

2011 HONDA CRV 4 wd, Auto, silver. Loaded. Local car. $21,500: 9000k.778-895-7570/604-836-5931

830

MOTORCYCLES

2001 YAMAHA V STAR - 1100 cc, chocolate brown, flamed tank & fenders. Inc. helmet, Great shape. $3500/obo. (604)463-4185

838

751

2007 WILDERNESS trailer, 28’, 2 slides, Q bed, 2 drs, comp. w/hitch, exc. shape. $19,500. 604-856-3777

SUITES, UPPER

847 SPORT UTILITY VEHICLES 2004 JEEP GRAND Cherokee Ltd. 4x4, auto, green, 126K, $6800 firm. Call 604-538-4883

PORT MOODY 3 bdrm bsmt ste, inste W/D, S.S. appl, d/w. Cls to park May 1. $1395. (604)939-4346.

COQUITLAM Centre area. 4 Bdrm upper flr, 2 full baths, garage, 2 f/p, shared laundry, pet ok. Avail now. Ref’s & credit check req’d. $1500/mo. Call 604-340-9757.

SHOP from HOME!

WAREHOUSEMAN’S LIEN

Check out bcclassified.com

845

Upper Eagle Ridge near Newport Village. Private entrance, quiet neighbourhood. Close to amenities & bus routes. 5 Appliances. Heat, h/w, cable included. Non-smoker, no pets. Available now. $850/mo.

COQUITLAM - Lower Suite 3151 Cambridge St. Large 2 BR 1 Bath; 900 sf; laundry; $900 May 1 Peak Property Mgmt 604-931-8666

Port Coquitlam - Apartment 2550 Gordon Ave; Reno’d 1 BR 650 sf; 1 Bath; lndry; $675 NOW Peak Property Mgmt 604-931-8666

Refs & Credit check req. Sorry No Pets

Northwest Pkg, 22 ft, Sleeps 7, 1 bunk, Shower in & out. G.V.W. 3300. Lots of extras

HOMES FOR RENT

COQUITLAM OFFICE SPACE WESTWOOD CORP. CENTRE Various sizes of office space available CALL 604-944-2963

750

TOWNHOMES

GARIBALDI Court

2003 Salem Light:

Now,

Quiet, clean, well-maintained, updated, adult oriented one bdrm suites. Close to all amenities, and WC Express. Gated parking. Call for appointment to view. SORRY, NO PETS.

741

*IN-SUITE W/D *GARBURATOR *ONSITE MANAGER *BEHIND COQ. CTR. MALL

COQUITLAM. Westwood Plateau. “Silver Springs”. 2 bdrm., 2 bath. Ns/np. Inste ldry, pool, gym, Whistler inspired, beautiful & stylish. Ref’s. $1300. May 1 604-512-8725

Apply

It’s a New Year! Start it Right in The PERFECT LOCATION! On-site Manager

2 Bdrm apt. $1225

535 - 555 Shaw Avenue (google map) (yahoo map)

Loan.

PORT MOODY

COQUITLAM - bright spacious, 4 bdrm. 2 bath, 2 kitchen, W/D, fenced yard, alarm, W/D, cls. to amens. $2150/mo. 604-936-4827 or 604-936-4824 for more info.

Coquitlam Centre “Raphael Towers”

Please call Nova for viewing at 604-767-9832

Need A Vehicle! Guaranteed Auto 1.877.680.1231 www.UapplyUdrive.ca

PORT MOODY. Ideal Apartment. 1/bdrm. Avail May 1. Secure parking, storage. Res manager. No pets. 778-355-1808, 604-469-9100,

736

604-945-5864

Nice, well maintained studio, 1 and 2 bdrm. Fridge and stove. Balcony. Heat, hot water and 1 parking stall included. Nice location in Coquitlam just off Lougheed in quiet cul-de-sac.

AUTO FINANCING

COQUITLAM 663 Harrison Ave. 4 Bd avail now or May 1 $1350/mo. Newly reno’d, 5 appl, F/P, 1600 s.f. no pets, fncd bk/yrd. 604-454-4540

Email: sandy@terramanagement.ca or phone

COQUITLAM

810

SCRAP CAR REMOVAL

The Scrapper

PORT COQUITLAM, 2043 sq ft. Ground floor, dance/fitness area. Facing onto city park. 1 blk from Lougheed/Shaughnessy intersection. 604-464-3550.

2 & 3 bdrm apartments avail. $790 & $913/month No subsidy avail. Centrally located, close to transit & schools.

COQUITLAM, newer 2 bdrm, 2 bath apt. in highrise, D/W, W/D, cls. to all amenities. $1400/mth. Avail. now. NS/NP. Call Jeanie 778-996-8298.

TRANSPORTATION

709 COMMERCIAL/INDUSTRIAL

Coquitlam Centre Co-op

Contact: Costina 778-847-3153

845

SCRAP BATTERIES WANTED We buy scrap batteries from cars, trucks & heavy equip. $4.00 each. Free pickup anywhere in BC, Min. 10. Toll Free Call:1.877.334.2288

www.bcclassified.com

www.aptrentals.net

3 Bedroom townhouse available now (heat and hot water included) with laundry hook up. Pet allowed.

RECREATIONAL/SALE

WE’RE ON THE WEB

Call 604-421-1235

3 Bedroom townhouse available immediately (heat and hot water included) with laundry hook up. Pet allowed.

838

Call 604-724-6967

1 Bdrm Apts starting at $950 2 Bdrm Apts starting at $1200 Heat and hot water included. Dishwasher, fridge, stove, balcony, shared laundry. Avail Immed. Close to amen, schools and mall.

Medallion Court Apt / Townhomes

TOWNHOUSES

TRANSPORTATION

PITT MEADOWS: 2 - 3 bdrm co-op T/H $1030/mo - $1134/mo. Shares req’d. Close to WCE, schools & shopping. No subsidy available. 19225 119th Ave. For more info & to book an appt. call 604-465-1938

604-464-3550

MAPLE PLACE TOWERS

COQUITLAM

752

TRANSPORTATION

TOP CA$H PAID TODAY For SCRAP VEHICLES!

BURNABY

COQUITLAM CTR, 2 bdrm, 2 bath, cls. to amenities, schls & Douglas Coll. Walk to Lake/stadium. NS/NP, $1295. Avail. May 1. 604-941-3259

RENTALS

RECREATIONAL/SALE

2008 FREEDOM SPIRIT 20’ travel trailer, like new, hardly used, a/c, f/s, dble bed, dble sink, nook, couch 2 prop tanks/2 batteries, $11,500 obo. Please call: (604)581-5117

2IÀFLDO6SRQVRUV

.

.


A28 Wednesday, April 4, 2012, Tri-City News

www.tricitynews.com

1300 Dominion Ave. Port Coquitlam 604-942-7518 STORE HOURS: Monday - Sunday 9am - 6pm SALE ENDS: Tuesday, April 10th, 2012 8JNDP(SPVQPG$PNQBOJFTtXXXBSULOBQQTDB

7

ea.

1

ea.

Art Knapp Plantland & Florist

2

$ 97

EASTER LILIES The perfect Easter flower and fragrance. Come check out our selection of Easter items and pick up your Easter Lily today. SALE

EASTER BOUQUETS Choose from the freshest and fullest Easter bouquets to brighten your Easter. Affordably priced for this holiday weekend.

8

4

$ 97

HANSA SHRUB ROSE This disease free Rose is a continual bloomer with vibrant violet red flowers and a heavy spicy clove fragrance. Reg. $24.99 SALE

5

1297

$

ea.

8

$ 97

$ 97

ea.

$ 97

GRASS SEED Rapid start grass seed germinates quickly and produces a lush full lawn. Covers 375 sq. ft. Reg. $12.99 SALE

ASSORTED HOSTA A summer blooming shade loving perennial with large lush colourful leaves. 1 per pkg. Reg. $6.99 SALE

PURPLE POTATOES Unique and colourful potatoes add life to salads and the dinner plate. Reg. $7.99 SALE

PRUNERS Quality pruners to make your pruning projects easier. Reg. $12.99 SALE

9

$ 97

ea.

BLUE STAR JUNIPER A rich blue coloured juniper great for garden beds or low maintenance areas. Low growing evergreen. Reg. $12.99 SALE

1497

$

ea.

FABULAWN LIME A pelletized Dolomite lime for easy application through a spreader to help prevent moss problems. Reg. $19.99 SALE

TIMUN DENIM BLUE PANT

25% off

ALL LED HANDBAGS

Do you spend a long time searching your purse for your keys and cell phone? LED handbags have arrived - The purse uses micro-LEDs, which are attached to the inner fabric of the purse. You can switch the lights on and off as you wish. SALE

Weekends call for comfort and this pant more than achieves that goal! Drawstring with tie-string at the top in the waist gives the pants a custom fit feel. Reg. $45.00 SALE

2997

$

ea.

9

$ 87

ea.

WIPE OUT A non-selective weed and grass killer to kill weeds in and around plants and on cracks in sidewalks and patios. Reg. $14.99 SALE EXCLUSIVE AND NEW TO ART KNAPPSâ&#x20AC;Ś

FIXATION LEATHER JEWELRY HAND MADE IN MONTREAL

Fixation has come out with an exceptional leatherbased jewellery line that is both refined and elegant. This timeless natural skin has been merged with high quality metal parts to create a unique sophistication all its own.

ea.

PINK LEMONADE BLUEBERRY Back by popular demand - Combined flavour of Blueberry and Pink Lemonade makes a amazingly delicious taste combination. Reg. $19.99 SALE

ea.

ea.

ea.

COMBINATION APPLE TREES Grow 4 different apples on 1 tree right in your own back yard easily, organically and fresh. Reg. $69.99 SALE

1797

$

ea.

BUTTERFLY BUSH NEW! Flutterby Grande Vanilla Nectar bush. Large pale yellow blossoms with a deep yellow throat and a vanilla fragrance. Reg. $29.99 SALE

ea.

ROSEMARY One of our favourite culinary and aromatic herbs. Perfect for pots or the garden. Reg. $4.99. SALE

2297

$

$ 27 FUCHSIA PLANTS Upright or trailing fuchsia plants ready for planting in containers or hanging baskets. reg. $1.99 SALE

4997

$

$ 97

3

$ 97

ea.

/pkg

FERTILIZER SPIKES Feed your trees, shrubs, fruiting plants quickly and easily with fertilizer spikes. pack of 5 Reg. $6.99 SALE

3997

$

ea.

GROW BED No garden, no problem. This 38â&#x20AC;? X 38â&#x20AC;? polyethylene raised garden is ready to go. Just add soil. Reg. $49.99 SALE

RELAX ž LOOSE TRENCH Relax Trench is a super comfortable spring/ summer jacket with ž sleeves and thin lining which closes in front with a simple button and tie-string in the waist for a feminine cut. (Ombre Blue) Reg. $89.00 SALE

4997

$

ea.

FINE TEAS AND ACCESSORIES, COMING SOON!!!!

The Tri-City News, April 04, 2012  

April 04, 2012 edition of the The Tri-City News

Read more
Read more
Similar to
Popular now
Just for you