__MAIN_TEXT__
feature-image

Page 1

BC TECH

2019 | ADVANCING TECHNOLOGY

PRINTING MUSCLE

TAMER MOHAMED: BREAKTHROUGH IN DUPLICATING HUMAN TISSUE

INTO THE FUTURE: MACHINE LEARNING WILL TRANSFORM SOCIETY

WOMEN AND ANGELS NUKING CANCER

00_BC Tech 2019_64p_2.indd 1

FEAR, HOPE & AI

ROBOTS AND JOBS

GAMERS BATTLE

2019-06-10 2:34 PM


00_BC Tech 2019_64p_2.indd 2

2019-06-10 2:34 PM


— TEACH THE FUTURE OF HIGH-TECH. COMPUTING FOR A COMPLEX WORLD. BCIT Computing is looking for computing and IT instructors to teach in our full-time programs and part-time courses. Bring your experience and passion for technology to the classroom and inspire students to launch careers in this exciting industry. Learn more at bcit.ca/teachcomputing

—— BRITISH COLUMBIA INSTITUTE OF TECHNOLOGY

00_BC Tech 2019_64p_2.indd 3

—— Computing instructor Bill Klug brings his expertise in cloud computing to the classroom.

2019-06-10 2:34 PM


CONTENTS

FEATURES

BC TECH

2019 | ADVANCING TECHNOLOGY

8 WOMEN & ANGELS Female investment group reaches for halos in a male-dominated sector

PRINTING MUSCLE

TAMER MOHAMED: BREAKTHROUGH IN DUPLICATING HUMAN TISSUE

12 SHOW ME THE MONEY Annual HR Tech Group survey reveals rising wages, generous benefits, yet tech still starved for talent with specific skills 14 ‘DIRECTED MISSILE’ NUKES CANCER Breakthrough comes as Ottawa invests nearly $300 million in Vancouver lab 18 PRINTING MUSCLE Aspect Biosystems set to commercialize its human tissue printing technology

8

22 AI: FEAR & TRANSFORMATION $15.7 trillion disrupter will touch and change every aspect of modern society 26 ROBOTS WORK CHEAP But that may lead humans to find the employment they really love 28 GENOMICS Predictive technology could revolutionize B.C. health care 30 GAME ON Vancouver indie game studios get creative to battle giant alien invaders

COLUMN

26

Tipping—6 COLUMN

Griffiths—28

INTO THE FUTURE: MACHINE LEARNING WILL TRANSFORM SOCIETY

WOMEN AND ANGELS NUKING CANCER

FEAR, HOPE & AI

ROBOTS AND JOBS

GAMERS BATTLE

PRESIDENT: Alvin Brouwer EDITOR-IN-CHIEF, BUSINESS IN VANCOUVER; VICE-PRESIDENT, GLACIER MEDIA: Kirk LaPointe EDITOR: Frank O’Brien DESIGN: Randy Pearsall PRODUCTION: Rob Benac CONTRIBUTORS: Dr. Ellie Griffith, Rolando Hinojosa, Stephanie Hollingshead, Tyler Nyquvest, Frank O’Brien, Tyler Orton, Jill Tipping PROOFREADER: Meg Yamamoto DIRECTOR, SALES AND MARKETING : Pia Huynh SALES MANAGER: Laura Torrance ADVERTISING SALES: Benita Bajwa, Blair Johnston, Corinne Tkachuk, Chris Wilson ADMINISTRATOR: Katherine Butler RESEARCH: Anna Liczmanska, Carrie Schmidt BC Tech 2019 is published by BIV Magazines, a division of BIV Media Group, 303 Fifth Avenue West, Vancouver, B.C. V5Y 1J6, 604-688-2398, fax 604-688-1963, biv.com. Copyright 2019 Business in Vancouver Magazines. All rights reserved. No part of this book may be reproduced in any form or incorporated into any information retrieval system without permission of BIV Magazines. The publishers are not responsible in whole or in part for any errors or omissions in this publication. ISSN 1205-5662 Publications Mail Agreement No.: 40069240. Registration No.: 8876. Return undeliverable Canadian addresses to Circulation Department: 303 Fifth Avenue West, Vancouver, B.C. V5Y 1J6 Email: subscribe@biv.com COVER PHOTO: Tamer Mohamed, founder and CEO of Aspect Biosystems Photo by Chung Chow

30

00_BC Tech 2019_64p_2.indd 4

2019-06-11 11:21 AM


| 5

MESSAGE FROM THE EDITOR

FUNDING CUTS REPRESENT ARTIFICIAL INTELLIGENCE British Columbia’s technology sector is one of the fastest g row i ng i n Canada, but its future is threatened by a lack of government and private venture support. “The strength of the industry is reflected in the $19.2 billion in gross domestic product and $31.3 billion in revenue generated by the tech industry in 2017 – the highest levels ever recorded,” according to a statement that BC Tech received from the B.C. Ministry of Jobs, Trade and Technology. The multi-dimensional tech industry in B.C. employs about 14,000 people. That is more than double the number of jobs in B.C.’s mining, forestry, fishing and oil and gas sectors combined. But, unlike the traditional resource industries that have sustained B.C. for

generations, the tech industry is young, rapidly evolving and subject to brutal competition on a national and global scale. It needs financial and logistics support to nurture startups to commercial success, and keep them in B.C. Yet in May, the Cube, a Vancouver incubator for 20 startup companies specializing in virtual reality and other computer-generated environments, was forced to close after the B.C. government declined to match federal funding. At the same time, Ottawa pledged more than $52 million to back a similar incubator program in Ontario. B.C. has extended the Interactive Digital Media Tax Credit to 2023, but this incentive, at 17.5 per cent, is the lowest of all provinces. B.C. also supports the industry through its four-year-old $100 million BC Tech Fu nd, but the cu rrent govern ment

appears to have a limited appetite to replenish a fund that is being quickly depleted. Government support is needed now more than ever because of waning private support for B.C. tech. A recent KPMG report noted that B.C. private venture capital (VC) financing is in sharp decline. In 2017, the latest numbers available, VC funding was $343 million in B.C., down more than 50 per cent from the $787 million seen in 2014. Powerful as it appears, B.C.’s technology sector is a fragile and skittish young beast. Great ideas are born here, but without foundational and financial support to help startups flourish, they will mature in other provinces or countries. Frank O’Brien, editor, BC Tech

Solutions S So lutiions ffor or all sealin sealing i g applic applications i ations at

Need help sealing your latest innovation? O’Rings - Seals - Gaskets - Plastic Shapes  Advanced Materials  Technical Support  Premium Service

(604) 278-6808 ‡fluidseal@sealsonline.com 13680 Bridgeport Road #5 ‡Richmond ‡ British Columbia ‡V6V 1V3

www.sealsonline.com

00_BC Tech 2019_64p_2.indd 5

2019-06-10 2:34 PM


6 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

SCALING TO A

$25 BILLION OPPORTUNITY An environment that could better support scale is holding us back from even stronger performance

JILL TIPPING

B Jill Tipping is president and CEO, BC Tech Association, headquartered in Vancouver •SUBMITTED

ritish Columbia now has more than 10,000 tech companies employing more than 114,000 people, and another 50,000 tech workers in non-tech companies. It is no surprise that B.C.’s fast-growing tech sector is a leading economic driver of growth in the province: technology is a tool empowering businesses, people and governments to tackle important problems and improve lives. Yet we know that a shortage of talent and an environment that could better support scale is holding us back from even stronger performance.

BC Tech’s vision for a province that overcomes these limiting factors is one of inclusive prosperity and far-reaching innovation. That’s why this year, we have focused the Technology Impact Awards (TIAs) on what matters most to build a thriving technology economy, including success on the world stage, growing the number of B.C.based scale and anchor companies, adopting technology across the economy, and showing grit and leadership in the face of challenges. (See a full report on the TIA winners beginning on page 32). In a small, open economy, B.C. firms’ ability to export

00_BC Tech 2019_64p_2.indd 6

is key to scaling up. Exporting empowers companies to learn from global customers, compete with world leaders and access rewarding new markets. Our Excellence in Global Export award showcases B.C. companies that have achieved export success. Our Company of the Year award is re-structured to highlight excellence at every stage of the scaling journey from startup to growth to scale-up to anchor. Each stage is crucial, but B.C.’s biggest opportunity is to increase the number of homegrown scale and anchor companies, the foundation of a thriving, sustainable ecosystem.

2019-06-10 2:34 PM


| 7

S PANIE S

M CO

TECH ADOP

TE

R

TA L E N T

AC C E

C A P I TA L

On the scaling journey B.C.’s tech leaders will undoubtedly face challenges: the road to success is rarely a straight line. The 2019 Spirit of BC Tech True Grit award celebrates the stories of people and teams who dug in and kept going when times got tough. Their peers will be inspired (and relieved) by the knowledge that they are not alone in encountering obstacles that need dogged determination as well as passion and ingenuity to overcome. A highlight this year was the strength of applications for the TIA recognizing Excellence in Technology Adoption, given to an organization showing standout progress in adopting technology to deliver better business outcomes. The range of finalists from tires to gold mining to government truly proves that, today, every company is a tech company. SMALLER CENTRES SHARE

The TIAs are ultimately about bringing the community together to build connections and celebrate our successes. Technology isn’t just generating opportunity in urban centres like Vancouver, Surrey, Victoria and Kelowna. Improving connectivity enables remote work and remote offices: witness Traction on Demand’s new hub in Nelson, for example, or Metal Tech Alley in Trail or the thriving gaming community in Nanaimo. Technology jobs both within and beyond the tech sector are opening up new career paths and driving economic diversification across the province. Statistics Canada reported earlier this year that Canada’s

00_BC Tech 2019_64p_2.indd 7

WE HAVE FOCUSED THE 2019 TECHNOLOGY IMPACT AWARDS ON WHAT MATTERS MOST TO BUILD A THRIVING TECHNOLOGY ECONOMY

R L E R AT O

S

digital economy is growing much faster than the rest of the economy and is already bigger than traditional industries such as mining, forestry and oil and gas. It is good to acknowledge the scale of today’s digital economy, but its importance is not to compete with traditional industries but to transform them to become more efficient and safer and to reduce their environmental impact. Technology can help protect and grow employment across every sector of the economy. Forward-looking economic policy doesn’t pick winners or pit one industry against another, but it builds the foundations of a sustainable prosperous economy of the future to make winners of us all on the global stage. The McKinsey Global Institute estimates that the GDP growth impact of accelerating technology adoption is up to 1.5 per cent. Modelling the potential impact on the B.C. economy, we could be enjoying perhaps as much as $25 billion of additional annual economic output by 2030. By working in partnership across our ecosystem – leveraging the strengths of industry, researchers, educators, investors, non-profits and government – I am confident British Columbia can overcome what holds us back and surge ahead. B.C.’s $25 billion opportunity is to double not only the tech industry but technology adoption and innovation in every B.C. industry. Success in this mission will power our province to become a world leader in the emerging economy and ensure inclusive prosperity for generations of British Columbians to come. É

2019-06-10 2:34 PM


8 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

WOMEN &

ANGELS

Female-powered investment group reaches for halos in a male-dominated sector

TYLER ORTON

WOMEN HAVE TRADITIONALLY BEEN VERY UNDERREPRESENTED IN ANGEL INVESTING j Stephanie Andrew Vice-president, finance, Timia Capital Corp., and co-founder, Women’s Equity Lab

00_BC Tech 2019_64p_2.indd 8

S

tephanie Andrew couldn’t help but notice a quintessential commonality among the speakers and attendees at angel investment events she began organizing in Victoria in 2014. “Everyone attending was pretty much mostly men,” recalled the vice-president of finance at Timia Capital Corp.

The scarcity of women at those events wasn’t a fluke. Only 22 per cent of all angel investors in the U.S. are women, according to a 2017 report from Angel Capital Association. Meanwhile, the 2017 Halo Report from the Angel Resource Institute and Florida Atlantic University’s Tech Runway found that only 25.7 per cent of angel investments involved deals that went to a company with a female founder. Comparable data isn’t available for Canada, but a 2017 report from the National Angel Capital Organization estimated there are between 20,000 and 50,000 angels in Canada, leaving a significant demographic untapped for investing in early-stage companies. “Women have traditionally been very under-represented in angel investing,” says Andrew, who in 2017 co-founded the Women’s Equity Lab, an angel investment

group that brought together 20 female accredited investors to pool capital and expertise. “Potential angels that were not involved in angel investing are getting involved in learning by doing with a small amount of capital so that they can write bigger cheques down the road,” Andrew says, adding $120,000 was pooled during the first round. The first round closed with investments made in four B.C.-based tech companies specializing in everything from driverless car technology to generating algorithms for self-publishing. The second round will feature 23 women, and organizations from other parts of Canada have been speaking to the Women’s Equity Lab about expanding its model throughout the country. It comes as the provincial government makes changes

2019-06-10 2:34 PM


| 9

Twenty female accredited

Venture financing declining

$900

together as angel investors

800

Millions of dollars

investors pooled money

700 600 500 400 300 200 100 2014

2015

2016

Venture capital investments Angel investments

00_BC Tech 2019_64p_2.indd 9

2017

Women in B.C. technology are competing for a slice of a smaller pie of angel and venture capital financing, according to KPMG’s British Columbia Technology Report Card 2018. The report found that angel investing in B.C.’s tech sector declined from $118 million in 2015 to $45 million in 2017, and venture capital funding dropped to $343 million in 2017, down from $630 million a year earlier. “The presence of [investment] funding is essential to ensuring companies are able to continuously grow their business in the B.C. market,” says Jameel Ahamed, partner, consulting, and B.C. lead, digital transformation and innovation, at KPMG and co-author of the report.

during the Women’s Equity Lab’s first round of investing • SUBMITTED

2019-06-10 2:34 PM


10 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

WOMEN & ANGELS

to its own angel investor tax credit to spur declining investments in early-stage companies. After being introduced in the latest provincial budget in February, the amount an individual can claim in one year under the angel tax credit program doubled from $60,000 to $120,000. Meanwhile, the maximum amount an eligible business can raise through the tax credit program also doubled, to $10 million from $5 million. “It has been pretty popular but it has not been revised or updated for about 12 or 13 years,” says B.C. Jobs, Trade and Technology Minister Bruce Ralston. “The degree to which angel investors are more willing to invest is the degree to which more capital will be available [to early-stage companies],” Ralston says. “It’s only one mechanism but it needed a refresh and some changes to make it more effective.”

BC Tech Association CEO Jill Tipping says the angel tax credit is an important program but the previous limit proved to be too low in most cases. “It essentially meant that you were probably getting an exemption for one investment,” says Tipping, whose industry group supports and advocates on behalf of the province’s technology sector. “A perennial issue for us is that the amounts of angel money available aren’t as big as would be useful [to the startup community].” Andrew, meanwhile, says angels like herself welcome the changes, but she sees other avenues the government could take to boost growth. “One idea is to provide a bigger tax credit to new investors, for example 40 per cent for a new angel’s first $50,000,” she says. “This would encourage the participation of new investors.” É

BRIEF Startup hits stride with gig job app A Vancouver startup that launched with “family and friends” funding has apparently hit its stride this year with an app that helps temporary “gig” workers find jobs and employers find short-term staff. The key to the popularity of the Grizzly Force app is likely that workers are paid automatically at the end of the shift every day. The mobile app is designed on the format of Uber, the popular ride-hailing software, explains Grizzly Force founder and CEO Sandro Ferrari, 35, who started Grizzly Force in 2016. He feels the company really launched in 2018 when it hit 10,000 users, including 150 employers. From 70 to 200 temporary workers are hired through the app every working day, Ferrari says.

Like Uber, the Grizzly Force app includes a map showing the location of temporary jobs and, like the ride-hailing service, it provides near-instant payment. Ferrari reached an agreement with Interac, the Canadian interbank network, that allows the transfer of funds via computer. Gig workers using the Grizzly Force app have their paycheque land in their bank account shortly after their shift ends. Grizzly Force takes care of deductions and payroll for employers and pays the balance directly to the worker. The employer then reimburses Grizzly Force within 30 days. Most of the employers using the Grizzly Force app are in the distribution and transport business, often needing warehouse workers for deliveries for Amazon and

Sandro Ferrari, founder of Grizzly Force • SUBMITTED

Apple, Ferrari says, but he adds that Grizzly has provided workers for many industries, including technology. “The workers can be someone looking for a short-term job or contract work, someone new to Vancouver seeking work or even a college student who needs beer money for the weekend,” he says.

The company started with $250,000 in seed money from a number of sources. “I begged and borrowed,” Ferrari recalls. “The money came mostly from family and friends.” Grizzly Force works out of offices on Alexander Street in East Vancouver and has grown from a staff of three to 14 people.

Delivering Integrated Communications Solutions Innovation | Design | Build | Integration | Service | Communications | Security | Audio Visual | Health Care | Electrical 604-941-4440 info@fouru.com www.4thutility.com

00_BC Tech 2019_64p_2.indd 10

2019-06-10 2:34 PM


| 11

BRIEF

Industry must take training role: Google Canada director Sabrina Geremia, Google’s country director for Canada, told a Vancouver audience this spring that tech training is too important to leave just in the hands of college professors. During her April address to the Canadian Club, Geremia urged businesses to prioritize retraining their workers as technology continues to transform the nature of work. She says Canada can’t rely solely on colleges and universities to train the workforce. She points to one of Google’s own initiatives that sent some of her team to Surrey to train businesses on digital tools. The company is also launching what it calls its IT Cert program, in which Google employees train people with minimal experience, allowing them to become

job-ready professionals in eight to 12 months. The team has already been assisting with training at Surrey Public Library. “We know that digital transformation is happening, we know that that’s the way to global prosperity and we know that that’s happening across businesses in Canada,” Geremia says. “We need to train Canadians to always be learning and to use the tools. It’s really just about supporting skills and training for the next generation of the workforce that’s going to be based in Vancouver.” Geremia hints that Google, which does not have an office in Vancouver, is looking this way. “I can tell you my folks are out here every single week – nothing to announce right now, unfortunately.”

Sabrina Geremia •

GOOGLE CANADA

abcellera.com/careers

00_BC Tech 2019_64p_2.indd 11

2019-06-10 2:34 PM


12 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

SHOW ME

THE MONEY Annual HR Tech Group survey reveals rising wages, and generous benefits, yet tech companies are still starved for talent with specific skills

B.C. TECH COMPANIES NEED TO PAY ATTENTION TO SALARIES TO REMAIN COMPETITIVE IN THIS TALENT MARKET j Stephanie Hollingshead CEO, HR Tech Group

00_BC Tech 2019_64p_2.indd 12

WHITEMOCCA/SHUTTERSTOCK

M

STEPHANIE HOLLINGSHEAD

edian salaries in B.C.’s tech industry have increased 3.4 per cent from a year ago, with many jobs increasing by much more than that. Web software developer salaries increased 10 per cent to $77,000. Intermediate software developer salaries increased eight per cent to $85,000, according to the annual BC Tech Salary Survey.

2019-06-10 2:34 PM


| 13

HIGHEST ANNUAL WAGE INCREASES

Average salary

Average salary year-over-year increase SALARY (THOUSANDS OF DOLLARS) INCREASE 40%

$173.9 $156.4 $151.7 $152.6 $153.9 29%

24% 20% $90.8 $93.2 15%

15% $92.5

$64.1

14%

$52.8 $53.3

ct

En

gi n d ee o r i re c r i n g , in t fo o r Te r ch se mat Di ni cu io n ca re ct l rit or GC ar t y ,p d s ro u p i re c du e r to ct vis r/ m or an ag em en VF Fa t X cil su it y pe pr r vis od or uc tio na ru s nn sis En er t a t - fi nt / te r y lm ch lev In sid ni el ca e es l d ffe ale i re c t sr ct s ep or In re te se rm nt ed at iat i ve et e c En As hn tr sis ol yog ta lev nt is t el pr co od m uc po er sit - fi or lm pr od uc Ap tio pl ica n tio ns ec ur it y

$35.9

re

Stephanie Hollingshead is CEO, HR Tech Group, an association of human resources professionals employed in B.C. tech companies. The group produces the leading BC Tech Salary Survey and provides complete data that keeps members up to speed on local business practices in tech. HR Tech Group serves over 150 mid-to-large member companies in all tech sectors including ICT, film/VFX, digital media, clean tech and life sciences.

HIGHEST-PAYING NON-EXECUTIVE POSITIONS

Di

The 2018 BC Tech Salary Survey, conducted for HR Tech Group in partnership with Mercer, has been the definitive resource for the high-tech sector in B.C. for more than 20 years. The latest edition includes data on 16,651 individual salaries, coming from 121 companies located in the province. There are 191 positions represented. Even with increasing salaries, 96 per cent of organizations that participated in the survey reported having difficulties filling some positions. The most difficult skills to find are software development and programming, cited by 59 per cent of companies as being the most difficult positions to fill. Employee benefits are also enhanced. The survey revealed that 44 per cent of participating companies provide registered retirement savings plan matching payments and 28 per cent provide maternity leave salary top-up benefits. If B.C.’s tech companies want to increase the number of female employees, I would urge them to include retirement benefits and maternity leave top-up payments to their total compensation packages. B.C. tech companies are struggling to hire the talent they need. Salaries are on the rise and there is no sign of a reversal in this trend, especially as major tech firms continue to set up shop in town. There has never been a better time to pursue a career in tech. Now more than ever, B.C. tech companies need to pay attention to salaries to remain competitive in this talent market. For more details and specific salary figures, a full version of the BC Tech Salary Survey is available for purchase online at hrtechgroup.com. É

SOURCE: HR TECH GROUP 2018 BC TECH SALARY SURVEY

/ Energy Management (M.S.) / Finance (M.B.A.) / Management (M.B.A.) / Information, Network, and Computer Security (M.S.) / Instructional Technology, Educators (M.S.)

nyit.edu/vancouver | vancouverinfo@nyit.edu | 604.639.0942

00_BC Tech 2019_64p_2.indd 13

Do. Make. Innovate. Reinvent the Future. 2019-06-10 2:34 PM


14 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

MEDICAL TECHNOLOGY

THE DRUG CARRIES A RADIOACTIVE PARTICLE THAT PRECISELY TARGETS CANCER CELLS WITH MINIMAL IMPACT ON HEALTHY TISSUE

00_BC Tech 2019_64p_2.indd 14

2019-06-10 2:34 PM


| 15

‘DIRECTED MISSILE’

NUKES CANCER Breakthrough comes as Ottawa invests nearly $300 million in Vancouver-based physics lab

TYLER ORTON

C

hemotherapy takes a shotgun-like approach to treating cancer, blasting tumorous and healthy cells without discrimination. But a new made-in-B.C. treatment has the potential to function like a “directed missile” targeting cancer cells while minimizing collateral damage to healthy surrounding tissues, according to Centre for Drug Research and Development (CDRD) venture partner Lana Janes at the University of British Columbia.

Lana Janes, venture partner at Centre for Drug Research and Development: partnership with Triumf led to development • SUBMITTED

00_BC Tech 2019_64p_2.indd 15

Her organization has partnered with national particle physics lab Triumf, just down the road from the CDRD on the University Endowment Lands, to develop the treatment requiring hard-to-come-by isotopes. “Given their world-class expertise in radiochemistry and isotope production, and our deep experience in developing therapeutic agents and working with clinicians, it made perfect sense for us to work together in this burgeoning field right now,” says Janes. Known as targeted alpha therapy, the treatment

involves the development of a drug that carries with it a radioactive particle, a nuclear-tipped warhead if you will, that delivers bursts of energy to attack cancer cells with minimal impact on healthy tissue. Even more novel breakthroughs appear to be afoot after Ottawa revealed in the 2018 federal budget it was earmarking $293 million to Triumf over the next five years, clearing the path for B.C. to be a global leader in nuclear medicine. Nuclear medicine involves the use of small amounts

2019-06-10 2:34 PM


16 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

MEDICAL TECHNOLOGY—’DIRECTED MISSLE’ NUKES CANCER

Triumf Innovations CEO Kathryn Hayashi: “there’s a real excitement growing around the area of nuclear medicine that we haven’t seen in a long time” • ROB KRUYT

of radioactive substances to research and treat diseases. Medical isotopes are notoriously scarce, and Triumf is one of the few centres in the world with expertise in their production, owing to its possession of the world’s largest cyclotron – a type of particle accelerator. And with nearly $300 million now in hand, one of the hallmark projects ahead for Triumf will be the creation of the Institute for Advanced Medical Isotopes (IAMI). IAMI, which broke ground at the end of April, will provide space for Triumf’s research partners and facilitate more industry collaborations. Triumf’s new, five-year strategic plan goes into effect next year, with designs on ramping up commercialization and research coming out of its labs. “There’s a real excitement growing around the area of nuclear medicine that we haven’t seen in a long time,” says Triumf Innovations CEO Kathryn Hayashi, who runs the national lab’s commercialization arm. “You’ve got these incredible investments in worldclass science infrastructure that is being put to the use of developing new therapies to benefit our health, to cure incurable diseases. It’s a wonderful story.” About 18 per cent of Triumf’s annual revenue stems from dozens of private-sector partners requiring access to the lab’s capabilities, Hayashi adds. É

The Health and Technology District is designed and built to bring together the brightest minds, academics, entrepreneurs, startups and multinational companies in health, life sciences and technology - working together to create solutions that impact lives and transform the way health care is delivered.

www.healthandtechnologydistrict.com

Where It’s All Happening - Join Us

00_BC Tech 2019_64p_2.indd 16

2019-06-10 2:34 PM


SPONSORED CONTENT

INDUSTRIAL DESIGN – OFTEN FORGOTTEN BUT INCREASINGLY VALUABLE PROTECTING THE LOOK OF YOUR PRODUCT CAN CREATE A COMPETITIVE ADVANTAGE Written by Roni M. Jones

C

onsumers have more options than ever when deciding what to buy. This has empowered consumers to make purchasing decisions based on the aesthetic qualities of a product, not just the functionality. For example, there are numerous models of smartwatches on the market, some designed by big tech companies, others by more traditional watchmakers. While most offer a similar array of useful functions, such as the ability to call or text, only a few smartwatches also make a fashion statement. Aesthetics play an even greater role in driving consumer loyalty to specific brands. As the visual design of products becomes more valuable, securing protection becomes increasingly important. An industrial design registration (referred to as a “design patent” in the United States) can protect these aesthetic features and provide a competitive advantage. Generally, all physical products with outwardly visible original aesthetic features may be eligible for industrial design protection. Industrial design registrations have traditionally been used to protect aesthetic features of products such as automobiles, consumer electronics, footwear, packaging, etc. Today, these registrations are increasingly directed to software-based graphical user interfaces

(GUIs) including features such as dividers, widgets, icons, text, graphics, animations and the placement, sizing and orientation thereof. An industrial design can be registered in Canada by filing an application with the Canadian Intellectual Property Office. Among other requirements, the design will be registered if: (1) the applicant has not publicly disclosed the design more than one year before the filing date (this is often referred to as the “one year grace period”); and (2) the design is novel. For a design to be novel, it cannot be the same as, and must differ substantially from, previous designs of the same or analogously similar products that were publicly available at the time of filing the application. Notably, industrial design protection may be available even when patent protection is not. As of November 5, 2018, Canadians can also file international design applications via the Hague Agreement. This can streamline the foreign application process and may result in lower overall costs when building a global design portfolio. Once an industrial design is registered in Canada, the owner can exclude others from manufacturing or selling any product with a substantially similar

design for up to 15 years. This right may provide a competitive advantage and may represent a considerable asset to your business. Applying for an industrial design registration does not preclude you from protecting your product with other forms of intellectual property. Industrial designs can, for example, complement patent and trademark portfolios and/or provide a stepping stone to trade dress protection. When compared to patents, industrial design registrations and design patents are relatively inexpensive, straightforward, and quick to obtain. Any business that designs products— including software and mobile applications—should consider seeking this form of intellectual property protection. Our lawyers would be pleased to discuss how your company can protect the valuable aesthetic features of your products in Canada and around the world. Our lawyers can also advise on the registrability and validity of industrial design registrations and handle matters involving infringement of registered industrial designs and ownership disputes.

OUR CLIENTS’ ideas are changing the WORLD

00_BC Tech 2019_64p_2.indd 17

2019-06-10 2:34 PM


18 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

MEDICAL TECHNOLOGY

PRINTING MUSCLE Vancouver’s Aspect Biosystems set to commercialize its advances in the technology of human tissue printing

I

TYLER NYQUVEST

STARTUP MADE WAVES WITH ITS ABILITY TO USE LIVE HUMAN CELLS TO CREATE AND BUILD LIVING HUMAN TISSUE

n the competition to reach commercialization, many of B.C.’s budding biotech companies are running in a tight race. Yet due to the size of the industry, there is still enough room in the province’s biotech ecosystem for each player to be recognized, even in its biggest city. “I actually think it is an advantage to be in Vancouver as opposed to somewhere like the Bay Area because [in the latter] there is a lot of noise and a lack of loyalty to the company you are working at,” says Tamer Mohamed, CEO and co-founder of Aspect Biosystems.

“Everybody is looking to join the next big thing whereas in Vancouver, people have joined and they have stayed and they have grown with the company.” Aspect Biosystems is the University of British Columbia

00_BC Tech 2019_64p_2.indd 18

(UBC) spinoff startup that made waves by announcing its ability to use live human cells to create and build living human tissue. Aspect is now one of the pioneering microfluidic 3D bioprinting companies in the world.

2019-06-10 2:34 PM


| 19

Among other achievements, the company’s 3D RX1 bioprinter is being used to create respiratory tissue for pharmaceutical trials – something that could cut reliance on the practice of animal testing. In addition, the company is crafting a portfolio of 3D bioprinted human tissues that will, one day, be available on demand for various clinical uses. In 2017, the company partnered with Johnson & Johnson to produce meniscus tissue – the rubbery disc in the knee that can cause serious long-term disability and pain if injured – from biocompatible materials. Last year, Aspect received $1 million in repayable funding from Genome BC’s Industry Innovation Program, which assists B.C. companies in the early stages of commercialization. LifeSciences BC has named Aspect the 2019 Growth Stage Company of the Year. “We’ve been spending a lot of time innovating on the business model and we work very closely with academic researchers,” Mohamed says. “We give them access to our platform, and then we share in the success of those results. “We are tapping into a large network of domain

00_BC Tech 2019_64p_2.indd 19

Tamer Mohamed (right), CEO and co-founder of Vancouver-based Aspect Biosystems, with cofounder and chief technical officer Simon Beyer. Their vision is to build an ecosystem and a pipeline of human tissue products • SUBMITTED

expertise instead of trying to do everything alone.” The company has continued to grow. Initially launching with 10 employees, it now has 40 and has moved to a new Vancouver office space on West 75th Avenue. The 8,000-square-foot space dedicated to Aspect is home to all integrated operations, a research and development lab and manufacturing. Aspect has welcomed new employees from all over the world. “We have been able to overcome the typical challenge that startups face in recruitment by having a bold vision and facing a global challenge that attracts very smart people to come to Vancouver.” On the track to commercialization, Aspect is pursuing all available paths to find the right formula. “We are both kind of putting our platform out there to the research base to fuel long-term application development but we are also focusing on real commercial tissue products internally at Aspect and working with our go-to-market partners,” Mohamed says. Currently, Aspect is developing muscle tissue as well as liver tissue and pancreatic tissue for Type 1 diabetes.

2019-06-10 2:34 PM


20 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

MEDICAL TECHNOLOGY—PRINTING MUSCLE

3D printing holds the potential of reproducing human organs from biocompatible materials • SUBMITTED

The potential of bioprinting is enormous and farreaching, notes Vikramaditya Yadav, a UBC chemical and biological engineering professor who is also with the Regenerative Medicine Cluster Initiative in B.C. “Bioprinted tissues or organs could allow scientists to predict beforehand how a drug will interact within the body. For every life-saving therapeutic drug that makes its way into our medicine cabinets, Health Canada blocks the entry of nine drugs because they are proven unsafe or ineffective. Eliminating poor-quality drug candidates to reduce development costs – and therefore the cost to consumers – has never been more urgent,” Yadav says. In Canada, he adds, nearly 4,500 people are waiting to be matched with organ donors. “If and when bioprinters evolve to the point where they can manufacture implantable organs, the concept of an organ transplant waiting list would cease to exist. And bioprinted tissues and organs from a patient’s own healthy cells could potentially reduce the risk of transplant rejection and related challenges,” the professor explains. É

BRIEF

TechWomen aids new immigrants When Anitha Amarnath left India for Canada in 2017, she thought she had a solid shot at scoring a job in a region strapped for technology experts. Amarnath graduated with a master’s degree in information technology in her home country, where she had hoped to one day become a lecturer. But aspirations of landing a position after arriving in B.C. quickly withered. “It’s really, really tough to get a job,” Amarnath says, noting her lack of work experience in Canada likely hurt her on the job hunt. But last fall Amarnath landed in a free pre-employment program geared towards immigrant women looking to get into the tech industry. The TechWomen program is being led by the Immigrant Services Society of BC (ISS) and the Emily Carr University of Art + Design

00_BC Tech 2019_64p_2.indd 20

(ECU) with funding for five years being provided by the Canadian Women’s Foundation and the Startland initiative. Startland launched more than three years ago, raising more than $500,000 as it trained Syrian refugees how to code. Founder Kate Armstrong says the TechWomen initiative was a natural evolution for Startland following the work with refugees. “We were able to bring together different kinds of partners than were typically in conversation before,” she says, adding this meant collaborations with startups, charities, the Ministry of Jobs, Trade and Technology and even tech giants like Microsoft Corp. “Those people hadn’t necessarily been in direct conversation before about how to partner.” Armstrong, who is also the director of ECU’s Shumka Centre for Creative Entrepreneurship,

Kate Armstrong, founder of TechWomen • SUBMITTED

has been tapping the university’s resources and offering classes to TechWomen participants if and when additional seats open up in relevant courses. In addition to technology training, participants receive help

with English-language skills, cultural education and job interview exercises. “They got a big confidence boost from going through this,” says Sarah Rolling, ISS’s program facilitator for TechWomen.

2019-06-10 2:35 PM


—— BRITISH COLUMBIA INSTITUTE OF TECHNOLOGY

— GET ACTIONABLE SOLUTIONS FOR YOUR BUSINESS. STUDENT CONSULTANTS FOR A COMPLEX WORLD. Leverage the BCIT Business pool of talented students for a fresh perspective on your project. BCIT Business has many years of experience placing students in industry through business consulting projects so they can apply their education before they graduate. Learn more at bcit.ca/bcp

—— BCIT Business student consultants work at Alpha Technologies Ltd.

00_BC Tech 2019_64p_2.indd 21

2019-06-10 2:35 PM


22 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

ARTIFICIAL INTELLIGENCE

ARTIFICIAL INTELLIGENCE: FEAR & TRANSFORMATION AI is expected to have the largest technological impact on society over the next generation – and many fear the disruption

ROLANDO HINOJOSA

S

hadowing the hope that artificial intelligence (AI) will dramatically increase efficiency and knowledge is a cloud of fear about the disruption that the technology may unleash.

“I think there’s a small understanding, but there’s a huge amount of fear,” said David McKay, CEO and president at the Royal Bank of Canada (RBC), May 29 during a panel discussion hosted by Borealis AI as part of the official launch of its newest research lab, located in downtown Vancouver. “And I think the word AI is associated at the government level with job loss and job disruption.” Established by RBC in 2016, Borealis AI is a research institute conducting AI research within a network of labs in Vancouver, Toronto, Miontreal, Edmonton and Waterloo. “It’s been a difficult year for artificial intelligence,

00_BC Tech 2019_64p_2.indd 22

from a [public relations] perspective,” says Foteini Agrafioti, head of Borealis AI and RBC’s chief science officer. “A lot of things happened with mismanagement, misuse of data. And unfortunately a lot of that is attributed back to artificial intelligence.” Agrafioti, who who was also recently named co-chair of the Canadian government’s advisory council on artificial intelligence, adds, “Unfortunately, the good stories around artificial intelligence, the great advances that come from that, are getting lost in the noise.” The applications of Borealis AI’s research go beyond financial services, with the institute supporting open

2019-06-10 2:35 PM


| 23

collaboration with academic researchers to help communities tackle diverse problems through tools such as reinforcement learning, natural language processing and deep learning. Agrafioti highlighted how Borealis AI’s placement at the edge of RBC has given the institute “a little bit of space and freedom to think a little differently,” which extends to the publication of its research.

00_BC Tech 2019_64p_2.indd 23

During the launch of its downtown Vancouver lab, Borealis AI hosted a panel discussion on the state of the Canadian artificial intelligence industry. Left to right John Stackhouse, SVP, office of the CEO, RBC; David McKay, president and CEO, RBC; Foteini Agrafioti, chief science officer, RBC, and head, Borealis AI; and Greg Mori, research director, Borealis AI • ROLANDO HINOJOSA

2019-06-10 2:35 PM


24 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

ARTIFICIAL INTELLIGENCE—MEASURED IN TRILLIONS “We’re not just using science, we’re contributing to [it] and putting that out in the public domain,” she explains. “I think what’s special these days, and in Vancouver particularly we’re really lucky to have two world-class computer science departments, at [the University of British Columbia] and [Simon Fraser University], in the same city – it’s a very rare thing,” says Greg Mori, who heads Borealis AI’s Vancouver lab and is also a professor of computing science at Simon Fraser University.

Borealis AI’s Vancouver facility is focusing mainly on computer vision, a subfield of machine learning that trains computers to see, process and understand the visual world. While RBC is most interested in capitalizing on the applications of computer vision for modelling financial data, the technology can also be applied to environmental science, agricultural management, and humanitarian initiatives. É

AI IS A POTENTIAL $15.7 TRILLION DISRUPTER It is hard to underestimate the potential economic impact of artificial intelligence, according to PricewaterhouseCooper (PwC). In its 2019 analysis Sizing the Prize, PwC forecast that by 2030 AI will add $15.7 trillion to the global economy, the equivalent of raising the world’s gross domestic product by 14 per cent. The economics of AI will be driven by: ■ Productivity gains from businesses automating processes (including use of robots and autonomous vehicles). ■ Productivity gains from businesses augmenting their existing labour force with AI technologies (assisted and augmented intelligence). ■. Increased consumer demand resulting from the availability of personalised and/or higher-quality AI-enhanced products and services. Gerard Verweij, global data and analytics leader, PwC, suggests resistance is futile: “No sector or business is in any way immune from the impact of AI. The impact on productivity alone could be competitively transformational and even disruptive. Businesses that fail to apply AI, could quickly find themselves being undercut on turnaround times as well as costs and experience, and may lose a significant amount of their market share as a result,” Verweij says.

00_BC Tech 2019_64p_2.indd 24

2019-06-10 2:35 PM


00_BC Tech 2019_64p_2.indd 25

2019-06-10 2:35 PM


26 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

ARTIFICIAL INTELLIGENCE

WILL AI EAT YOUR JOB? Machine learning could indeed make some work obsolete but could also open avenues to more rewarding employment

TYLER ORTON

A GREATER POTENTIAL ... FOR PEOPLE TO REALLY FIND THE WORK THEY LOVE DOING j Karen Bakker, Professor, University of British Columbia and director of strategy, Riipen

00_BC Tech 2019_64p_2.indd 26

W

hen Google sought to uncover the common characteristics shared by its best-performing teams, the tech giant found it wasn’t specific personality types or technical skills that dictated A-level results.

“What they found was that the major determinant of team success was essentially social and emotional intelligence,” says Karen Bakker, professor and director of the program on water governance at the University of British Columbia, referring to a 2012 study as detailed by the New York Times. “It was sharing airtime equally. It was the ability to be sensitive to the other people’s social and emotional cues – even unspoken. “I look forward to a world of work in 2050 where the engineers that are being trained at that point are as good at the social and emotional success skills as they are at the technical skills.” Bakker, who also serves as director of strategy for the educational collaboration platform Riipen, was addressing concerns over the future of the global workforce at an expert panel facilitated by the B.C. Tech Summit. The summit itself, held March 11–13, drew about 7,000 delegates ranging from entrepreneurs to investors to multinational corporation executives. Among the made-in-B.C. artificial intelligence (AI) technologies being showcased were robotic devices

from Advanced Intelligent Systems Inc. and Eleos Robotics that could take over manual labour traditionally performed by humans, such as agricultural work. And while many speakers at the conference delved into the economic potential behind AI – that is, the ability to cut costs and improve productivity compared with human workers – the panel featuring Bakker and other experts dug into how advances in technology will fundamentally change the workforce in the next quarter-century. “In an economy where more and more people are self-employed, we’re going to see a very different sort of relationship-building process where automation has taken away, let’s say, not menial but repetitive tasks out of the equation. It’s a very different, more conversational, relational approach to talent finding their match,” she said. “I look at that really optimistically in the sense of a greater potential at least for authentic engagement for people to really find the work that they love doing.” A 2017 report from Intuit Canada estimated 45 per cent of the workforce would be composed of

2019-06-10 2:35 PM


| 27

Simon Fraser University professor Jie Liang, president of AltumView Systems, demonstrates a camera system and facial recognition software that caregivers can use to track seniors in assisted-living facilities • CHUNG CHOW

independent contractors, freelancers and on-demand workers by 2020. Peter Nunoda, president and CEO of Vancouver Community College says he’s advising students to prepare for transformation. “We know what the impact of machine learning, of artificial intelligence, is going to be on making some occupations obsolete, but when we talk about this in a post-secondary aspect what we’re looking at is how we can enhance those transferable skills,” he explains. FOUR B.C. AI COMPANIES TO WATCH

Advanced Intelligent Systems Inc.: Should we fear the robots? This Burnaby-based company is developing robotic devices that can replace many of the repetitive tasks performed by human labourers. On display at the B.C. Tech Summit was the company’s Big Top model,

which functions as a robotic gardener at greenhouses. Ecoation: Is it possible to use your iPhone to know what a plant is feeling? This North Vancouver-based company predicts crop stress using plant signals and sends that information to growers via smartphones. Eleos Robotics: Why use herbicides when this Coquitlam company has created the RoboWeeder? The autonomous robot controls weeds in agricultural land by directing precision microwaves at unwanted plants. “This,” says CEO Yahoel Van Essen, “is going to change the value chain for growers and allow the scaling down of farms.” Epic Semiconductors Inc.: As artificial intelligence becomes more intertwined in our daily lives, this Vancouver firm is banking on its ubiquity by creating a “dust-sized” AI chip that can sense human action, physical forces, chemical reactions and vital signs. É

Deloitte ranks Vanrx Pharmasystems No. 1 Vanrx Pharmasystems, a pharmaceutical supply company in Burnaby, took the No. 1 spot in the Deloitte 2018 Technology Fast 50 winners list, boasting three-year growth revenue of 19,342 per cent. The annual Technology Fast 50 program celebrates the worldclass achievements of Canadian

technology companies, highlighting their commitment to innovation, leadership and rapid revenue growth over the previous four years. Mojio, based in Vancouver, follows in second place with an average three-year growth rate of 11,950 per cent, while

Quebec-based COLO-D takes third, with an average three-year growth rate of 10,942 per cent. Aside from taking the No. 1 and No. 2 spots in the 2018 awards, 12 B.C. tech companies were ranked among the Fast 50 winners.

Here is the ranking of B.C. firms in Deloitte’s Technology Fast 50, with their three-year growth revenue in brackets: 1 Vanrx Pharmasystems, Burnaby (19,342%) 2 Mojio, Vancouver (11,950%) 7 Bench Accounting, Vancouver (4,373%) 16 Left, Maple Ridge (1,242%) 20 Foodee, Vancouver (1,145%) 22 Strawhouse Inc., Kelowna (1,125%)

00_BC Tech 2019_64p_2.indd 27

23 Refresh Financial, Kelowna (934%) 33 Visier, Vancouver (679%) 34 Eastside Games Inc., Vancouver (663%) 43 Canada Drives, Vancouver (500%) 48 BuyATab Online Inc., Vancouver (433%) 49 Unbounce, Vancouver (409%)

2019-06-10 2:35 PM


28 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

MEDICAL TECHNOLOGY

A HEALTHIER FUTURE Using genomics to improve and protect B.C.’s health – we can’t afford not to

DR. ELLIE GRIFFITH

Genome British Columbia believes that every patient and individual in the province should benefit from genomic technologies. Over the past 19 years, Genome BC has invested in almost 400 genomics research projects as well as science and technology platforms. Scientific discovery, job creation and economic advantage have been important outputs, but our greatest impact is helping B.C. move toward a healthier future – in human health, forestry, agri-food, fisheries and aquaculture, energy, mining and the environment. Remarkable advancements have been made across multiple sectors, but human health is where we’ve seen the biggest evolution. In the past 20 years, the cost of sequencing a human genome has dropped from $300 million to $1,000 per genome, and a genome can be sequenced in a matter of days. This boom in affordability and accessibility is accelerating the pace of innovation. As the science evolves, so does patient readiness to use genomics in health care. The “one-size-fits-all” traditional approach to health care is nearing an end, ushering in the era of precision where we can use genomics through the entire health-care continuum. There are four main areas where genomics could have an immediate impact in health care: prevention, diagnosis, treatment and population genomics. Prevention: a more complete patient profile: By integrating genomics into the health-care system, we are seeing earlier and more personalized risk assessments of diseases such as cancer, diabetes, heart disease and asthma. Programs like the Genome BC supported Centre for Clinical Genomics (CCG) are already realizing the potential of capturing a more complete picture of a patient, including hereditary and novel genomic risk factors. The CCG’s 17-gene Hereditary Cancer Panel1, coupled with genetic counselling services, is helping patients with a family history of cancer receive personalized screening recommendations for monitoring and preventive care, a service the B.C. government is now reimbursing.’ Personalized diagnosis: Genomic sequencing helps us better understand the patient, but it also provides unique details in diseases like cancer. Single or multi “omics” profiling technologies, usually from a blood sample, are beginning to replace invasive tests like biopsies. In cancer, this provides critical information about the unique molecular profile of a tumour that goes beyond identifying the tissue affected (e.g., prostate,

breast) and into a precise molecular diagnosis of each specific tumour. Treatment with precision: Genomics can help us prescribe the right drug at the right dose to the right patient at the right time, leading to an increase of drug efficacy and decrease of adverse drug reaction (ADR). Genome BC funded pharmacogenomics projects have led to the development of drug metabolism profiles that can predict the effectiveness of medications, inform dosage and reduce ADRs for everything from blood thinners2 to cancer medications3. Several providers offer pharmacogenomics-related applications to B.C. residents. For example, pharmacists can now test a patient’s saliva for genes that will predict ADRs to commonly prescribed drugs while family doctors can select treatment options to identify personalized medication options for multiple common conditions. Population genomics: The more people who undertake personal genome sequencing and allow their information to be (anonymously) pooled into a larger data set, the more clarity we will have about certain conditions. Similarly, population genomics can play a significant role in managing infectious disease. Recent pandemics and infectious diseases put pioneering Genome BC researchers on the international stage where sequencing SARS and H1N1 lead to the development of vaccines, right here in Vancouver. Genome BC identifies funding for emerging issues, knowing that mobilizing quickly is key to mitigating outbreaks, epidemics and pandemics. Next steps: It is time to adopt genomics as a standard of care. In co-operation with B.C.’s Ministry of Health, Genome BC has developed an initiative to understand the factors that influence more widespread implementation of clinical pharmacogenomics, with a focus on improving outcomes and addressing cost-effectiveness in the health-care system. The barriers preventing the integration of genomic advances into the health system fall into one of four thematic areas: education, big data, capacity and access. We believe it’s worth our collective efforts to overcome these limitations. We cannot afford to stand still – the potential for improving health-care delivery is enormous but, more importantly, beneficial to all British Columbians. É Dr. Ellie Griffith, sector director, health, Genome BC, leads Genome BC’s team of sector managers in health to leverage the application of “omics” in ways that improve the health and wellness of British Columbians.

References: 1  Hereditary Cancer Panel, Centre for Clinical Genomics. www.ccgenomics.ca/hcp-panel.html. 2018. Accessed 1/9/2019. 2  Li J, Wang S, Barone J, Malone B. Warfarin pharmacogenomics. P T. 2009;34(8):422-7. 3  Godken M, Ariza A, Arnaoutakis K. Molecular Markers in the Diagnosis and Treatment of Cancer. Biomedical Research International 2015;2015:105217.

00_BC Tech 2019_64p_2.indd 28

2019-06-10 2:35 PM


00_BC Tech 2019_64p_2.indd 29

2019-06-10 2:35 PM


30 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

GAME ON

Vancouver indie game studios get creative to battle influx of alien invaders

FRANK O’BRIEN

BUCHOLTZ BELIEVES PLACING AN EMPHASIS ON STAFF HAPPINESS HELPS SMALLER GAME COMPANIES COMPETE FOR TALENT AS BIGGER STUDIOS MOVE IN OR EXPAND IN VANCOUVER

00_BC Tech 2019_64p_2.indd 30

K

abam, one of the largest video game developers in B.C., has taken seven floors in a new 33-storey office tower in downtown Vancouver after relocating back from California. Vancouver’s Hothead Games, which started in 2006, now has 140 workers and hot mobile games such as Kill Shot and Hero Hunters and has launched a new publishing division. East Side Games, an indie studio known for its Trailer Park Boys game, made the Deloitte Technology Fast 50 list this year after posting an average annual three-year revenue growth of 663 per cent. Giant Microsoft has its game subsidiary Coalition in a Vancouver studio. Electronic Arts, meanwhile, is the B.C. behemoth with more than 1,500 employees at its Burnaby facilities. Headquartered in California,it is the second-largest gaming company in North America and Europe, with annual revenues estimated at more than $5 billion. Yet there is still room for startup game studios that play to the strength of creating a community, and Vancouver’s continual search for work-life balance, according to the co-founder of one the hottest new contenders in the gaming arena.

CEO Solon Bucholtz started LBC Studios Inc. four years ago with partner Dennis Molloy. The indie mobile game maker now has 30 full-time staff at its Beatty Street offices on the fringe of Gastown. More important, LBC’s signature and first game, Hempire, is ranked among the top 100 highest-grossing mobile games in the world with 10 million installs across 63 countries. “Forty per cent of our players are in the U.S. but one of every 1,000 Canadians [who play mobile games] have played Hempire,” Bucholtz says. “On any given day, we get 10,000 to 20,000 new players.” While Hempire is a free dowload, LBC has earned $20 million over the past two years due to in-app purchases and monetization. Like the LBC offices, where workers are encouraged to

2019-06-10 2:35 PM


| 31

blend work and leisure, Hempire is quintessentially West Coast: the game revolves around cannabis production, sales and distribution. It has developed a sustained, even fanatical following: an entire wall at LBC’s studio features cards, photos, messages and drawings of Hempire characters sent in by players. “It’s rather overwhelming,” Bucholtz says. LBC has also focused on building a sustainable workforce. The company has had near-zero staff turnover, Bucholtz says, largely because of the culture it has created. “This is a place for work as well as for fun,” he says. Staffers are encouraged to work one day a week from home, or at least out of the office. The company’s studio features a kitchen, a games room, big-screen TV, a climbing wall and monthly staff parties – and nobody is punching a clock. Bucholtz believes placing an emphasis on staff happiness helps smaller game companies compete for talent as bigger companies move in or expand in Vancouver.

00_BC Tech 2019_64p_2.indd 31

CEO Solon Bucholtz, right, and community manager Jaymee Mak at LBC Studios on Beatty Street in Vancouver. Four-year-old mobile game startup has grown from five staff to 30 in the past two years with annual revenues of around $10 million • CHUNG CHOW

“Some people simply don’t want to work in the corporate culture crush,” he says. That crush was underlined this year when Alibaba Group founder Jack Ma extolled the virtue of “996”: working from 9 a.m. to 6 p.m., six days a week. “Not here,” Bucholtz says. “At LBC we don’t just talk about a great work environment; we live it.” LBC is launching its second game, also cannabis-themed but as yet unnamed, near the end of this year. The company is also looking at expanding its studio space, but has run into the problem of high office rents and low supply that challenges all Vancouver office tenants. “We are looking at Burnaby,” Bucholtz says. “It turns out half of our staff already lives there.” Bucholtz said he is not overly concerned with the large gaming companies setting up in Vancouver. He believes it helps make the city a destination for talented tech workers, and that many of them would rather work in a studio that places a greater emphasis on life balance and creativity than on, say, a six-day workweek. É

2019-06-10 2:35 PM


The TIAs celebrate the very best of BC Tech—those who are transforming our industry and building up the fabric of BC’s vibrant tech ecosystem. In recognizing the contributions of the companies, entrepreneurs, and people who make up our community, we highlight their success across a range of awards, from startups to anchors, from innovation to culture, from export on the world stage to tech adoption, and more.

OUR PARTNERS PLATINUM

GOLD

SILVER

AWARDS

RED CARPET

AFTER PARTY

DINNER

KENSINGTON MEDIA & PR

00_BC Tech 2019_64p_2.indd 32

2019-06-10 2:35 PM


Celebrating innovation, technology, and entrepreneurship

#2019TIAs | wearebctech.com

COMPANY OF THE YEAR Startup Success In partnership with Microsoft

WINNER | PrecisionOS ∙ precisionostech.com Precision OS is a Vancouver, BC based software company founded by an Orthopedic Surgeon and two veteran game developers. The company is innovating and disrupting how surgeons train and provide care for patients. It is based on the unique intersection of medicine and game development with their co-founders. PrecisionOS’ virtual reality software is for surgical trainees and surgeons who want to perform all the steps of surgery without patient risk. With the realism, they are also able to provide real time feedback to objectify performance and achieve competency. Their long-term goal is to standardize surgeon skills for all, decreasing costs and improving health outcomes for patients.

Finalist | CoPilot Advisor ∙ copilotai.co/webinarsignup CoPilot Advisor is a fast-growing SaaS/MarTech company based in Vancouver. They are on a 10-year mission to fundamentally change the way people connect with businesses. 3 billion people now live on social media, yet many businesses and their sales teams still rely on outdated and static means RIFRPPXQLFDWLRQQDPHO\HPDLODQG&50&R3LORWȇV$ΖSODWIRUPRÎ?HUVEXVLQHVVHVDVLQJOHSRUWDOWRLQWHUDFWZLWKSURVSHFWVDQGFXVWRPHUVQRPDWWHU which social media platform they’re on.

Finalist | SmartShare Solutions ∙ smartshareparking.com SmartShare Solutions is a cloud-based data platform that automatically aggregates parking data in real-time and crunches those numbers to display rich PHWULFVVXFKDVXVDJHHÉ?FLHQF\DQDO\WLFVDQGPLVXVHLQDFWLRQDEOHIRUPDWVWRPXQLFLSDOLWLHVWRKHOSWKHPEHFRPH6PDUW&LWLHV6PDUW6KDUHSURYLGHVFLWLHV with the dataset, tools, and technologies that they need to make smarter decisions, positively enhancing the quality of life of city residents in BC and beyond.

COMPANY OF THE YEAR Growth Success In partnership with Osler

WINNER | FreshWorks Studio ∙ freshworks.io FreshWorks Studio is an organization building powerful and highly functional apps for web, iOS, and Android using technologies like AI and blockchain. 7KH\KDYHVROXWLRQVDUFKLWHFWVSURGXFWRZQHUVEXVLQHVVDQDO\VWV8Ζ8;GHVLJQHUVGHYHORSHUVDQGVXSSRUWVWDÎ?WKDWZLOOWDNHDQLGHDDQGPDNHLWD reality by delivering a custom software solution on time and on budget. FreshWorks’ mission is to help organizations solve problems and create value for their customers, team members, and other stakeholders through remarkable digital experiences.

Finalist | Beanworks ∙ beanworks.com &RQFHLYHGE\DQDFFRXQWDQWZKRNQHZČ´UVWKDQGWKHSDLQVRIDFFRXQWVSD\DEOH%HDQZRUNVZDVFUHDWHGWRVROYHWKHSDLQVRIPDQXDOLQHÉ?FLHQWDQGHUURUSURQHWDVNV%HDQZRUNVDXWRPDWHVDFFRXQWLQJZRUNČľRZWRHPSRZHUWHDPVWRVXFFHHG)URPSXUFKDVHWRSD\PHQW%HDQZRUNVLQWHJUDWHVZLWK\RXU software to make accounts payable (AP) simple and delightful. Thousands of users manage AP at a fraction of traditional processing costs while remaining IRFXVHGRQČ´QDQFLDOPDQDJHPHQWDQGUHSRUWLQJ

Finalist | Nanotech Security ∙ nanosecurity.ca Nanotech Security produces nano-optic structures and colour-shifting materials used in authentication and brand enhancement applications across a wide range of markets including banknotes, tax stamps, secure government documents, and commercial branding. The company’s technology employs DUUD\VRIELOOLRQVRIQDQRLQGHQWDWLRQVWKDWFDQEHGHSOR\HGRQWRDZLGHUDQJHRIPDWHULDOVLQKLJKGHČ´QLWLRQ1DQRWHFKȇVLQQRYDWLRQHQVXUHVWKDWFXUUHQcies and brands are kept safe and sound.

COMPANY OF THE YEAR Scale Success In partnership with SAP

WINNER | AbCellera ∙ abcellera.com AbCellera is a biotechnology company focused on the discovery and development of next-generation monoclonal antibody therapeutics. The company VWDUWHGRXWLQZLWKRQO\VL[HPSOR\HHV'U&DUO+DQVHQWKHIRXQGLQJ&(2DQGČ´YHPHPEHUVIURPKLVUHVHDUFKJURXS8VLQJDPLFURČľXLGLFWHFKQRORJ\ developed at UBC, advanced immunology, protein chemistry, performance computing, and machine learning, the team developed a platform that can mine natural immune responses at greater depths than any other technology. The result? Faster therapy and vaccine discovery and brand-new treatments to help patients get healthy.

00_BC Tech 2019_64p_2.indd 33

2019-06-10 2:35 PM


Celebrating innovation, technology, and entrepreneurship

#2019TIAs | wearebctech.com

Finalist | Allocadia ∙ allocadia.com $OORFDGLDȇVSODWIRUPJLYHVPDUNHWHUVWKHFRQČ´GHQFHWRNQRZZKHUHWRLQYHVWWKHLUQH[WGROODU$OORFDGLDHQDEOHVPDUNHWHUVWRSODQVWUDWHJLFDOO\LQYHVW with purpose ,and measure with impact so teams are able to optimize the impact of their programs. This gives marketers the ability to drive better performance, increase ROI and improve alignment with corporate goals. Companies like Microsoft, GE Healthcare, Box and Charles Schwab manage more than $25 billion marketing dollars within Allocadia, giving their marketers the ability to drive more impact for their organization.

Finalist | Article ∙ article.com Article is part of the next generation of leading high-growth Vancouver technology companies. In the six years since launch, the company has managed to establish themselves at the forefront of an industry transition. Article is a furniture brand engineering remarkably better furniture experiences. The company’s founders started Article with the conviction that furnishing a home could be radically simpler and more enjoyable than it had been traditionally. Article’s direct-to-consumer approach gives customers access to stylish, quality furniture at fair prices, typically arriving at their doorstep in two weeks or less. Since launching in 2013, Article has delivered more than 300,000 orders to customers across the U.S. and Canada.

Finalist | Bench ∙ bench.co Bench is North America’s largest bookkeeping service. Bench aims to eliminate a universal pain point for entrepreneurs by making bookkeeping simple, HDV\DQGDÎ?RUGDEOH%\SDLULQJLQWXLWLYHVRIWZDUHZLWKDWHDPRIGHGLFDWHGERRNNHHSHUV%HQFKJLYHVVPDOOEXVLQHVVHVDÎ?RUGDEOHDFFHVVWRTXDOLW\Č´QDQFLDOLQVLJKWV%HQFKLVDWHDPRIPRUHWKDQSHRSOHKHOSLQJWKRXVDQGVRIVPDOOEXVLQHVVHVDFURVV1RUWK$PHULFDJDLQQHZSRZHURYHUWKHLUČ´QDQFHV from our Vancouver headquarters. As one of the fastest growing companies in Canada, Bench has become a pillar of the BC tech community.

COMPANY OF THE YEAR Anchor Success In partnership with EY

WINNER | Clio ∙ clio.com )RXQGHGLQ&OLRHPSRZHUVODZČ´UPVWREHFOLHQWFHQWHUHGDQGČ´UPIRFXVHG2Î?HULQJOHJDOSUDFWLFHPDQDJHPHQWVRIWZDUHFOLHQWLQWDNHDQGOHJDO CRM software, and the largest app ecosystem on the market, Clio’s product suite is trusted by 150,000 legal professionals and approved by over 65 bar associations and law societies, globally. Clio has been recognized as one of Canada’s Best Managed Companies, and a Deloitte Fast 50 and Fast 500 comSDQ\:LWK%&HPSOR\HHV&OLRLVD%&DQFKRUUHGHČ´QLQJKRZODZ\HUVUXQWKHLUSUDFWLFHVIRUWKHEHWWHU

Finalist | Fortinet ∙ fortinet.com )RUWLQHWLVDJOREDOSURYLGHURIQHWZRUNVHFXULW\DSSOLDQFHVDQGWKHPDUNHWOHDGHULQXQLČ´HGWKUHDWPDQDJHPHQW)RUWLQHWȇVWHFKQRORJ\VHFXUHVVRPHRI the largest enterprise, service provider, and government organizations around the world. Fortinet empowers its customers with intelligent, seamless protection across their business and the power to take on ever-increasing performance requirements of the borderless network— today and into the future. With over 800 employees in BC and 5900+ employees worldwide, Fortinet has come a long way since its founding in 2000 and contributes greatly to BC’s tech ecosystem.

Finalist | Sierra Systems ∙ sierrasystems.com Sierra Systems, an NTT DATA Company, is headquartered in Vancouver and was founded in 1966. It is a leading IT services and management consulting Č´UPRÎ?HULQJDIXOOUDQJHRIDGYLVRU\V\VWHPVLQWHJUDWLRQDQGPDQDJHGDSSOLFDWLRQVHUYLFHVSOXVDUHFRUGRIGHOLYHULQJVROXWLRQVWKDWVWUHQJWKHQRUJDnizations’ operational performance. Sierra systems is proud to enter their 53rd year of being headquartered in BC. Their contribution to the BC economy includes decades of support and advisory services for major BC-based companies as they pursue a global reach, including a major supplier of automotive parts to global mining industry.

EXCELLENCE IN GLOBAL EXPORT In partnership with Canada’s Digital Technology Supercluster

WINNER | Galvanize ∙ wegalvanize.com Galvanize (formerly known as ACL) is a tech company specializing in analytics and enterprise governance, risk and compliance management software. Galvanize delivers technology solutions that are transforming the audit and risk management process to give organizations unprecedented control over their business. Galvanize exports integrated governance software to over 118 countries, supports 32 international partners, and employs talent in the US, UK, France, Germany, India, Singapore, and Japan. Proudly based in Vancouver, their global reach is truly sharing the best of BC tech with the rest of the world.

00_BC Tech 2019_64p_2.indd 34

2019-06-10 2:35 PM


Celebrating innovation, technology, and entrepreneurship

#2019TIAs | wearebctech.com

Finalist | Motion Metrics ∙ motionmetrics.com 0RWLRQ0HWULFVZDVIRXQGHGWRHQVXUHWKDWPLQLQJLVVDIHDQGHQHUJ\HÉ?FLHQWZKHUHYHULWLVFDUULHGRXW7KH\EHOLHYHWKDWDUWLČ´FLDOLQWHOOLJHQFHDQGVHQVRUEDVHGWHFKQRORJLHVDUHWKHNH\WRRSWLPL]LQJPLQHRSHUDWLRQVDQGWKDWWKHVHVROXWLRQVDUHEHVWLPSOHPHQWHGZKHQWKH\Č´WH[LVWLQJZRUNČľRZVDQG DUHHDV\WRXVHIRUORFDOWHDPV7KHLUWHFKQRORJ\OHYHUDJHVWKHWHDPȇVH[SHUWLVHDQGLQVLJKWWRLPSURYHPLQHVDIHW\SURGXFWLYLW\DQGHÉ?FLHQF\DURXQGWKH world. Succeeding on the world stage has propelled them into a phase of rapid growth that wouldn’t otherwise be possible.

Finalist | PressReader ∙ pressreader.com PressReader is on a mission to change the way people discover stories that matter. The company is dedicated to taking the best content in the world and JHWWLQJLQWRSHRSOHȇVKDQGVQRPDWWHUZKHUHWKH\DUH7KURXJKDSSVIRUHYHU\GHYLFH3UHVV5HDGHUSURYLGHVXQOLPLWHGDFFHVVIRURQHČľDWIHHWRPRUHWKDQ 7,000 newspapers and magazines. From the Globe & Mail to the Washington Post, Newsweek to Vogue, there’s something for everyone. PressReader also ZRUNVZLWKEXVLQHVVSDUWQHUVDURXQGWKHZRUOGWRSURYLGHDFFHVVWRWKHLUFXVWRPHUV7KHVHSDUWQHUVLQFOXGH$LU&DQDGD&DWKD\3DFLČ´F)DLUPRQW+RWHOV Seabourn Cruises, the New York Public Library, and thousands more.

Finalist | Semios ∙ semios.com 6HPLRV RÎ?HUV D SUHFLVLRQ IDUPLQJ SODWIRUP WKDW SURYLGHV UHDOWLPH FURS PDQDJHPHQW WRROV IRU WUHH IUXLW DQG QXW JURZHUV /HYHUDJLQJ D SURSULHWDU\ in-orchard IoT wireless network, machine learning, and big data analytics, Semios helps growers manage insect pests, disease, frost, and irrigation. The Semios analytics engine draws on multiple sources of data and information including a robust, wireless network of in-canopy sensors on every acre of their customer farms measuring climate, soil moisture, insect and disease activity every ten minutes. In 2018, Semios more than doubled its acres under management and is now gathering over 160 million data points daily, from over 500,000 sensors, across more than 80,000 acres.

SPIRIT OF BC TECH True Grit In partnership with Safe Software

WINNER | LightIntegra ∙ lightintegra.com LightIntegra Technology is a medical diagnostics company launched from the Canadian Blood Services R&D labs by research scientist Dr. Elisabeth Maurer. Failed platelet transfusions are a major issue in healthcare, critically impacting the care of blood cancer patients. LightIntegra knows how painful failed WUDQVIXVLRQVDUHIRUSK\VLFLDQVWKHEORRGEDQNDQGPRVWLPSRUWDQWO\WKHSDWLHQWV7KLVVWUXJJOHLVZKDWJDYHELUWKWR7KURPER/8;WKHČ´UVWDQDO\]HUWR SURYLGHDURXWLQHWHVWIRUSODWHOHWDFWLYDWLRQVWDWXV7KURPER/8;LVDQRQLQYDVLYHČ´YHPLQXWHHDV\WRXVHRSWLFDOWHVWWKDWLPSURYHVSDWLHQWRXWFRPHV

Finalist | Appreciation Engine ∙ get.theappreciationengine.com Appreciation Engine makes it easier for musicians and companies like Universal and Sony to understand their customers better and build a relationship based on trust and co-operation. They go beyond static information to look at what customers are doing in real-time across streaming services, social networks, e-commerce & other online channels. Businesses who use AE create loyal customers, save marketing dollars, and drive revenue with actionable data.

Finalist | UrbanLogiq ∙ urbanlogiq.com 8UEDQ/RJLTKHOSVJRYHUQPHQWVEXLOGEHWWHUFRPPXQLWLHVZLWKGDWD6LQFHLWVIRXQGLQJLQ8UEDQ/RJLTKDVJURZQIURPWRVWDÎ?PHPEHUV7KHLU platform has now proven itself to service economic development, land management, public safety and education. UrbanLogiq’s cloud-based platform FRQVROLGDWHVGDWDWKDWLVFXUUHQWO\IUDJPHQWHGLQVLORVWRFUHDWHDXQLČ´HGYLHZRIDFRPPXQLW\8UEDQ/RJLTWKHQSURYLGHVDUWLČ´FLDOLQWHOOLJHQFHWRGHULYH insights and streamline processes using this data, providing a revolutionary way to help governments make faster, cheaper, and more accurate decisions.

TECH CULTURE OF THE YEAR In partnership with Harbour Air

WINNER | SAP Vancouver ∙ sap.com/canada At SAP Vancouver, culture is fundamental to business success, and SAP works constantly to set themselves apart in BC’s competitive technology sector. SAP is the market leader in enterprise application software, helping companies of all sizes and in all industries run at their best: 77% of the world’s transaction revenue touches an SAP system. Their machine learning, Internet of Things (IoT), and advanced analytics technologies help turn customers’ businesses into intelligent enterprises. By providing opportunities for employees to be lifelong learners, pursue passion projects, donate time and talent to the community and by valuing all kinds of diversity, SAP Vancouver is a sought-after destination to grow your career.

00_BC Tech 2019_64p_2.indd 35

2019-06-10 2:35 PM


Celebrating innovation, technology, and entrepreneurship

#2019TIAs | wearebctech.com

Finalist | Ayogo Health ∙ ayogo.com $\RJRLVDKHDOWKWHFKQRORJ\FRPSDQ\WKDWHPSOR\VYDOLGDWHGPHDVXUHVRISHUFHLYHGVHOIHÉ?FDF\DQGRWKHUSV\FKRVRFLDOIDFWRUVWREHWWHUXQGHUVWDQG what is important to people in the context of their real lives – not just their health. This enables timely, personalized and relevant interventions aimed at enhancing self-management and improving health outcomes. Because of the nature of the work they do— supporting patients living with chronic and degenerative illnesses— Ayogo naturally attracts a team that shares a profound common interest: doing good and meaningful work in the service of others. Ayogo’s culture is truly visible in their product and company success.

Finalist | East Side Games ∙ eastsidegames.com (DVW6LGH*DPHVKDVVSHQWWKHODVWHLJKW\HDUVUHČ´QLQJDQGQRZGHČ´QLQJZKDWJUHDWFRPSDQ\FXOWXUHORRNVOLNHDQGPDNLQJ(6*WKHQDPHWREHDWLQ WKLVVSDFH&XOWXUHFDQEHGHČ´QHGDVEHLQJDPLOOLRQOLWWOHWKLQJVWKDWDGGXSWRRQHLQFUHGLEOHWKLQJEXWWKH\EUHDNWKLVGRZQLQWRWZRPDLQFDWHJRULHVD FRPPLWPHQWWRWKHLUSHRSOHDQGWKHLUSRVLWLYHLQČľXHQFHLQWKHFRPPXQLW\(DVW6LGH*DPHVȇXQLTXHFXOWXUHKDVEHHQFUXFLDOWRWKHLUVXFFHVVDQGLQWHJUDO WRWKHVXFFHVVDQGJURZWKRIWKHLQGHSHQGHQWJDPLQJLQGXVWU\LQ%&ΖWLVDSDVVLRQDWHWHDPRIVHOIGULYHQGHGLFDWHGVWDÎ?ZKRRSHUDWHZLWKWKHVWDUWXS mentality of empowerment and hustle.

Finalist | Thoughtexchange ∙ thoughtexchange.com Thoughtexchange is reimagining engagement through their innovative community intelligence platform. They enable organizations to build dynamic, inclusive and empowered employee communities, while leaders are able to access the brightest ideas of their own people to drive innovation and change. 7KRXJKWH[FKDQJHLVSURXGWREHDJURZLQJFRPSDQ\RIPRUHWKDQHPSOR\HHVLQWKH%&WHFKVHFWRUZLWKWKHLUKHDGRÉ?FHLQ5RVVODQG%&DQGWKH majority of their employees working remotely from all over beautiful BC.

EXCELLENCE IN TECHNOLOGY ADOPTION In partnership with Accenture

WINNER | Newmont Goldcorp ∙ newmont.com Newmont Goldcorp’s recognition of the power of technological change, as well as its strong commitment to the adoption of disruptive technologies across the business make it a solid winner of the Excellence in Technology Adoption Award. Newmont Goldcorp’s recent partnership with IBM to develop the “Exploration with Watson� platform enables Newmont Goldcorp Geologists to quickly query decades of previously disjointed geological data and obtain new predictions of where gold mineralization might occur. This insight empowers geologists to newly determine where they should conduct exploratory drilling for gold, driving increased output with a smaller footprint.

Finalist | the BC Government ∙ gov.bc.ca 7KH2É?FHRIWKH&Ζ2LVLQWKH0LQLVWU\RI&LWL]HQVȇ6HUYLFHVDQGLVWKHFHQWUDODJHQF\DXWKRULW\IRUGLJLWDOJRYHUQPHQWLQIRUPDWLRQWHFKQRORJ\DQGLQIRUmation management within the Government of British Columbia. Through their work and much more, the government is proving it can work with the VRIWZDUHLQGXVWU\WRHÎ?HFWEUHDNWKURXJKLQQRYDWLRQDQGVHUYLFHLPSURYHPHQWIRUWKHSXEOLFΖWȇVKHOSLQJ%&WHFKČ´UPVJURZDQGFKDQJLQJWKHSHUFHSWLRQ of government when it comes to digital by adopting proven methods used by BC’s tech sector. In the last two years, agile digital teams from government DQG%&WHFKČ´UPVKDYHGHYHORSHGDQGVKLSSHGDSRUWIROLRRIRYHUQHZGLJLWDOVHUYLFHV

Finalist | Kal Tire ∙ kaltire.com With 250 retail and commercial stores across Canada, Kal Tire is the country’s largest independent tire dealer. Kal Tire’s technology adoption story has transformed their business. When the company saw a clear opportunity to improve their digital shopping experience, they took innovative action. Dozens of systems now work together to get customer tires to the store once an order is made, as well as ensure stores can install those tires in less than an hour. Today, a tire company is a tech company.

EXCELLENCE IN TECHNOLOGY INNOVATION In partnership with MDA

WINNER | Novarc Technologies ∙ novarctech.com 1RYDUF7HFKQRORJLHVLVDURERWLFVFRPSDQ\VSHFLDOL]LQJLQFROODERUDWLYHURERWVIRULQGXVWULDODSSOLFDWLRQV1RYDUFȇV6SRRO:HOGLQJ5RERWLVWKHZRUOGȇVČ´UVW of its kind in pipe welding application. Current demand for experienced welders is exceeding the supply, a trend which will continue. Novarc invented the 6SRRO:HOGLQJ5RERWDVWKHZRUOGȇVČ´UVWZHOGLQJURERW1RYDUFȇV6:5LVQRWGHVLJQHGWRUHSODFHZRUNHUVEXWUDWKHUWRKDYHDMXQLRURSHUDWRUZRUNZLWK the robot, where they can supervise the robot as it tackles and perfects the manual welding process. Novarc’s innovation keeps workers safe, productive, and equipped for the future.

00_BC Tech 2019_64p_2.indd 36

2019-06-10 2:35 PM


Celebrating innovation, technology, and entrepreneurship

#2019TIAs | wearebctech.com

Finalist | MediaValet ∙ mediavalet.com MediaValet provides enterprise-grade digital asset management for teams looking to produce, manage and distribute their marketing, video and creative UHVRXUFHVPRUHHÎ?HFWLYHO\0HGLD9DOHWSLRQHHUHGWKHLQWURGXFWLRQRI0LFURVRIW&RJQLWLYH6HUYLFHVLQWRWKH'$0PDUNHWOHYHUDJLQJWKUHH0DFKLQH/HDUQing-as-a-Service customization levels to enable AI-generated custom-tagging for enterprise clients. With their innovation, MediaValet makes digital and video collections instantly discoverable and expands assets’ reach, fueling business growth and team collaboration.

Finalist | Safe Software ∙ safe.com Safe Software breaks down barriers between data silos and has innovated to take on data in all its forms. Today, Safe Software is recognized as a premier DQFKRUWHFKQRORJ\FRPSDQ\LQ%ULWLVK&ROXPELDZLWKVLJQLČ´FDQWJURZWK\HDURYHU\HDUDQGDJOREDOUHDFKRIFXVWRPHUVLQFRXQWULHV%\ LQFOXGLQJGDWDLQGHFLVLRQPDNLQJZKHWKHULWȇVWKHORFDWLRQRIDVWUHHWUHSDLUWKHORFDWLRQRIDUDJLQJIRUHVWČ´UHWKHORFDWLRQRIWKHJDWHLQDQDLUSRUWRUWKH precise location of a tumour that needs treatment, Safe Software ensures this critical data gets into the hands of the people who need it.

Finalist | Wiivv ∙ wiivv.com Wiivv is a bionics company that creates custom, 3D-printed gear using body-perfect capture technology, accessible by everyone with a smartphone. Founded in the summer of 2014 by two Forbes’ 30 Under 30 recipients, Wiivv is using the best in computer vision, design, manufacturing, and biomechanics to promote body alignment and enhance athletic performance starting with its Custom Fit 3D Printed Insoles and now Custom Fit Sandals. Wiiv’s XQLTXHLQQRYDWLRQLVUHYROXWLRQL]LQJIRRWZHDUE\SXWWLQJFXVWRPHUVČ´UVW.

PERSON OF THE YEAR In partnership with BDC

WINNER | Greg Malpass Three words that are used to describe Greg are visionary, innovative and humanistic. Traction on Demand started as DFRQVXOWLQJȴUPDIWHU*UHJVDZWKHSRWHQWLDORIDOLWWOHNQRZQFORXGVRIWZDUHFDOOHG6DOHVIRUFHWRFRPSOHWHO\RYHUhaul how businesses operate. Over the last 12 years, Greg has been able to anticipate key gaps in various industries and launch many successful products. Greg has proven himself to be a thoughtful leader, successful business person and dedicated philanthropist. He has grown the company from just over 300 people to close to 600 people in the past \HDUFRQWULEXWLQJWR%ULWLVK&ROXPELDȇVWKULYLQJWHFKFRPPXQLW\E\FUHDWLQJIXOȴOOLQJMREVDQGSURYLGLQJSHRSOHZLWK tangible skills to take into the future.

Finalist | Kim Kaplan Having recently left Plenty of Fish after ten years, Kim has spent her time giving back to the community: mentoring over a dozen startups, meeting with founders, as well as being one of the most active female angel investors in BC. Kim works tirelessly to help the startups she advises to rise up to the next level of growth and VFDOHDQGVKHSHUVRQLČ´HVWKHLGHDOVWDUWXSDGYLVRUSUHVHQWHQFRXUDJLQJFXULRXVGDWDGULYHQDQGVWUDWHJLFDQG results-focused. Kim is highly engaged and delivers impact and value quickly. She truly cares about the people and companies she advises, and helps teams to improve not only the product, but critical processes to propel each business forward to success.

Finalist | Thomas Ligocki In three words, Thomas is determined, genuine, and enthusiastic. Thomas’ company Clevest is succeeding along an ambitious path to empower large utilities to be their best. He has built an exceptional and diverse team of management, product, sales, and development professionals while guiding and inspiring them with his vision. Thomas is a major supporter of underrepresented groups in BC Tech, and has made great strides to hire and invest in women in technology. Clevest is consistently above average in hiring and promoting women and supporting a diverse team; surely a factor in their breakout success. From challenging beginnings, Thomas has grown into a BC Tech leader.

Finalist | Lisa Shields Lisa Shields can be described in three words: visionary, resilient, and innovative. She was the founder and CEO of Hyperwallet Systems Inc., which was acquired by PayPal for $400 million in 2018. Currently, she is working on her second company, FI.SPAN. Lisa has a clear vision for her companies that inspires her team to strive to change industry standards. Her understanding of the banking sector in collaboration with her prior experience as the founder of Hyperwallet has been a key proponent of FI.SPAN’s recent success. Lisa is known for her ability to create an environment fostering new ideas and perspectives thanks to her realistic optimism and sense of purpose. Through her grit DQGDELOLW\WRDGDSW/LVDLQVSLUHVFRQȴGHQFHZLWKLQKHUWHDPPHPEHUV

00_BC Tech 2019_64p_2.indd 37

2019-06-10 2:35 PM


38 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

BRIEFS

Six scholarship students honoured The BC Tech Association honours six BC Tech scholarship winners, who will be awarded during the annual Technology Impact Awards, June 27 at the Vancouver Convention Centre. The 2019 scholarship winners are: HIGH SCHOOL Ember Dickson

Kai Leong

Bill Tam “True Grit” Bursary Winner Bound for the faculty of engineering at the University of Victoria, Emily is determined to revolutionize prosthetics and increase affordable access to life-changing devices. Her goal is to become a biomedical engineer.

Kai is studying bioinformatics and computer science. He has developed a remarkable smartphone gait analysis app to accurately screen for neurodegenerative diseases and improve health outcomes for seniors.

Rosalee Gringras

Daphne is passionate about computer science and is an accomplished developer, working in AR/ VR and winning the first hackathon she entered. She is determined to create a tech sector that welcomes women.

Rosalee’s inspiration to become a biomedical engineer by studying at the University of Victoria stems from her personal dedication to help those living with disabilities with innovative technology like artificial hearts and vertebrae.

Jill Tipping, president and CEO of BC Tech Association, and City TV broadcaster Riaz Meghji host the 2018 Technology Impact Awards: six new scholarships have been awarded in 2019 • SUBMITTED

UNIVERSITY Daphne Liu

Beriwan Ravandi

Jobina Tamminga

Bill Tam “True Grit” Bursary Winner Beriwan is a computer science student creating web platforms to help teens tackle cyberbullying and online harassment. As a child of Kurdish refugees, Beriwan overcame many challenges to get where she is today.

Jobina is a fourth-year University of British Columbia student studying computer science and biology. She is deeply involved with the Canadian Indigenous Science and Engineering Society. Jobina is set on working in the biotech sector and is gaining experience with internships to set herself up for success.

While EV sales are soaring in B.C., the number of hydrogen fuel cell cars on the road in Vancouver is estimated to be in the single digits. According to the New Car Dealers Association of BC, more than 6,300 buyers applied for B.C.’s electric vehicle rebate in 2018, an

increase of 4,000 from the previous year. Neither the federal nor B.C. incentives apply to electric bikes, though B.C.’s Scrap-It program provides an $850 rebate for someone scrapping an older vehicle and buying an electric bike through a participating dealer.

EV rebate can total $10,000 Combining B.C. and federal incentives could mean a buyer of an electric vehicle (EV) could pocket $10,000 in government rebates this year. The March federal budget included $300 million for electric and hydrogen fuel cell vehicle subsidies over three years. On new electric cars with a retail price of $45,000 or less, buyers would be eligible for up to $5,000 in rebates. In B.C., the rebate is up to $5,000 for a battery electric and up to $6,000 for a fuel cell car. (The price point for eligibility is higher in B.C. – $77,000 – so the rebate in B.C. applies to hydrogen fuel cell cars.) The federal Ministry of Finance

00_BC Tech 2019_64p_2.indd 38

confirms that federal and provincial incentives could be accessed on a single EV purchase. “The federal purchase incentive for electric battery or hydrogen fuel cell vehicles with an MSRP (manufacturer’s suggested retail price) of less than $45,000 can be used in conjunction with other incentive programs offered by provinces and territories,” a ministry spokesperson states. “Details on program design will be available in the coming months.” If the full federal subsidy applies, that could bring the rebate for a battery electric car in B.C. up to $10,000. Hydrogen fuel cell cars likely won’t qualify for the federal rebate until their price comes down, however.

2019-06-10 2:35 PM


| 39

TOP 100 TECH COMPANIES IN B.C. RANKED BY | Total number of employees in B.C.  

      

         



&

%#"$!

#+197465 -68/1)#:& 8,B668%)5+6;<-8%  !    

8+197)42 ".';42293/)'8/4373)  68,6<)#:&%)5+6;<-8%  $ !  7.';)' 2'>43$'3)49:+6 -68/1)#:&%)5+6;<-8%  !      '2'>43)' +11'3'*'  %18:;)3&)?%)5+6;<-8%  ' !

 (+11)' !4-+6742293/)'8/437

15/9=)?#;1:-;85)*?%  &

!     64-+67)42 " '3'*'3) )153)5,#:%)5+6;<-8%  !  

 7'5)42 "8+2)+11#+).3414-/+73)  #:):165#:%)5+6;<-8% 

!     78+2)+11)42 468/3+83)

#:1338--28#;1:- ;85)*?%  

!    ,468/3+8)42 /)6474,8'3'*'3)$'3)49:+6*+:+1452+38)+386+  8)5<133-#:#;1:- %)5+6;<-8% ( !      2)+)2/)6474,8)' ").3+/*+61+)86/)'3'*' 13468-&)?;85)*?%   !     7).3+/*+6+1+)86/))'7+741'6)42  ;88)8,#:#;1:- %)5+6;<-8%  

!     2*')46546'8/43)42 .'3-++'18.)'6+2'-/3-%460?4;'6+"4198/437  )4*1-",#;1:- "1+0465,% '  !     ).'3-+.+'18.)'6+)42 44879/8+ :0<-%)5+6;<-8% $"

!   

 .44879/8+)42 6+'8/43#+).3414-/+7 8)9-8:658:;85)*?%   !    )6+'8/438+).)42 '11'6* 4;+6"=78+273) 3-53?65!2?;85)*?%   !    ('11'6*)42 '3'*'6/:+7 ;88)8,#:#;1:- %)5+6;<-8% ' ! 

 )'3'*'*6/:+7)' "/+66'%/6+1+773)  &18-3-99&)?"1+0465,% % 

!    7/+66';/6+1+77)42 14('1!+1'= )4*1-#:5,B668%)5+6;<-8%  !    

 -14('16+1'=)42 #6')8/4343+2'3*  !86,;+:165&)?#;1:- ;85)*?%  !      86')8/4343*+2'3*)42 64953)  6;/3)9#: :0B668%1+:681)%& !     )-/)42

' & #

"!"     

'66+3 38;/781+78-91,-5:)5,  49- 6+3).->-+;:1<-<1+- 644;51+):1659786,;+:9)5,9-8<1+-9 78-91,-5:)5,

%)5+6;<-8 

  

6'*1+= ".';  '= +.678-91,-5:

)3/)8? 

  

#-)::3-&)90 

   

+,, +>47 4)@65+645+

-),15/)5),1)5+655-+:1<1:?+647)5?=1:0+659;4-8=18-3-99*;915-99 5-:=6829-8<1+-9)5,*;915-9915.8)9:8;+:;8-,1<191659 5315-8-:)13-8

+46-+ 45+78-91,-5:)5, )5,-33)5),)

644;51+):1659786,;+:9)5,9-8<1+-9

65:8-)3 

  

47+5. '8'1+

$-3-+644;51+):1659)5,4-,1)+647)5?

$6865:6  

  



/678+3 "98843<1+-78-91,-5:)5,4)5)/15/,18-+:68#!)*9 )5),)/36*)30-),#!)45/15--815/

;915-994)5)/-4-5:96.:=)8--5:-87819-8-96;8+-4)5)/-4-5:963;:1659 &)33,68.-84)5?    )5)3?:1+946*13-+633)*68):16515:0-+36;,   

11+3 ':+778-91,-5:)5,

-339-7)8):165+;3:;8-4-,1)159:8;4-5:9)5:1*6,1-9+?:6215-994)33 463-+;3-9-,;+):165)5,+65:8)+:)99)?9-8<1+-9

%)5+6;<-8 

  

+3 &/+.6;5,-8*6)8,+0)18)5,  /).'+1 &/+.6;5,-8 78-91,-5:)5,+01-.:-+05636/?6.A+-8

&683,=1,-786<1,-86.5-:=6829-+;81:?)7731)5+-9)5,)4)82-:3-),-815 ;51A-,:08-):4)5)/-4-5:

#;55?<)3-)31. 

 

+:/3 ++70+678-91,-5:

-<-3674-5:)5,9)3-6.+647;:-896.:=)8-)5,/)4-9

199199);/) 

  

!

5-8/?)5,76=-84651:6815/9?9:-4976=-8)5,);:64):165963;:1659 -3-+:81+)3,19:81*;:1655-:=6824)5)/-4-5:

  

/0+ 6++31+=/86;778-91,-5:

#7)+-86*6:1+99):-331:-)5:-55)9)5,9;*9?9:-499;8<-133)5+-)5, 15:-331/-5+-9?9:-49,-.-5+-)5,4)81:14-9?9:-49)5,/-697):1)38),)8 14)/-8? -7)8:4-5:)3,1)/569:1+14)/15/963;:1659-5:-87819-=682B6=)5, 15.8)9:8;+:;8-963;:1659->:-5,-,+)8-)5,+0)5/-4)5)/-4-5:963;:1659

";-13)34)1965 8)5+

%)5+6;<-8  

!

 

#)58)5+19+6 )31.  #6+1)38-3):165901773):.6844)5)/-4-5:.86465-15:-/8):-,,)90*6)8,=1:0 %)5+6;<-8 468-:0)5 4133165;9-89 

 

7.1+= ',+178-91,-5:)5,

65:8)+:-3-+:8651+,-91/5)5,4)5;.)+:;815/9-8<1+-9786<1,-8

;85)*? 

  

!'3*'11 ');+378-91,-5:)5,

-<-3674-5:4)5;.)+:;8-9)3-)5,9-8<1+15/6.+3-)5-5-8/?0?,86/-5.;-3 +-339

;85)*?  





4*= 6++3.6;5,-8)5,+6  /0+ '15/3+6

15)5+1)3:-+05636/?+647)5?-5)*315/)5),1)59:6)++-99);:6A5)5+15/ )5,6:0-8+8-,1:786,;+:9:086;/0)565315-73):.684

%)5+6;<-8 





+38 #.+<84378-91,-5:)5,

)8,=)8-96.:=)8-)5,9-8<1+-9.68+655-+:-,,-<1+-9

"1+0465, 





".'3343 !4-+6778-91,-5:)5,/-5-8)3+6;59-3 %'66+3 !4= )5,.6;5,-8

36;,)8+01<15/)5,15.684):165/6<-85)5+-963;:1659.68:0-/36*)3A5)5+1)3 9-+:68)5,6:0-801/03?8-/;3):-,15,;9:81-9

%)5+6;<-8 

  

6+- '15'77.6;5,-8)5,  46/33+ 9'  /0+ 53+6 78-91,-5:

#)3-9.68+-73):.684+659;3:15/1473-4-5:):165)5,96.:=)8-,-<-3674-5: ;85)*? 9-8<1+-94)82-:15/);:64):165,):)4)5)/-4-5:)5,96.:=)8-)9)9-8<1+- 

:-+05636/? 5,:6-5,768:.63166.01/0-5,$)5,*;915-99+659;3:15/9-8<1+-9 65:8-)3 

!='3 412+7

".';3 +6(=9-5168<1+-78-91,-5:&-9:-85)5),)67-8):1659

#6;8+-95:-8<1-=9=1:0)*6<-+647)51-9)5,  8-9-)8+0 :0-8+647)51-94)?0)<-8)52-,*;:,1,56: 786<1,-)5;7,):-*?,-),315- !6:786<1,-,  A/;8-   -9:14):-  96.-+-4*-8 6. 78-<16;9?-)8  ;915-99;51:6.+-9965-,1+)34)/15/   A/;8-

00_BC Tech 2019_64p_2.indd 39

 #"!! $!

  

 

  

#!!!#$ 4)2-9-<-8?)::-47::67;*3190)++;8):-15.684):16515:0-19:*;: )++;8)+?+)556:*-/;)8)5:--,"-9-)8+0-,*?)881-#+041,: !"! $

2019-06-10 2:35 PM


40 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

TOP 100 TECH COMPANIES IN B.C. RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;Total number of employees in B.C.  

        

         



&

%#"$!

 #"!! $!

' & #

"!"     

$/8/+7  0,>>C$>$?4>0 ',8.9?@0<'  "

   ;/8/+7)42 1/4#.+2/8"41:9/4383) ,8,/,(,C$?4>0 ?<8,-C'  )

"  )1/4)42 33+=438:19/3-74:53)

?<<,</$>$?4>0 ',8.9?@0<') "    '33+=-74:5)42 !+'1947)42  $3066-<4/20(,C$?4>0 #4.3798/' ) ( "   )'7++787+'1947)42 4+/3-$'3)4:;+7 

 9770<.0"5C$?4>0 #4.3798/' '  "     (4+/3-;'3)4:;+7)42 (841:9+ 

?8=7?4<$>$?4>0 "!9B  ',8.9?@0<') "     '(841:9+)42 1/739+-7'9+*2'-/3-"41:9/4383)   #4@0<=4/0(,C#4.3798/' ( "     @/7)42 '1;'3/?+ 9A0$>$?4>0 ',8.9?@0<' + "    <+-'1;'3/?+)42 :'79+).  >3@0$?4>0 ',8.9?@0<'  %

"     6:'79+).)42 +19'43974183)   @0$?<<0C' $ "     *+19')4397418)42 $/8/437/9/)'1 <,8@4660$>',8.9?@0<' $ "    ;/8/43)7/9/)'1)42 "'-+  (4<060==(,C#4.3798/' '

"     8'-+)42)' "/+77'">89+28'3###425'3> ,=>482=$>($?4>0 ',8.9?@0<'  

"   8/+77'8>89+28)42 /;'4;''3'*'475

  9<>3<,=0<(,C?<8,-C'   "      1/;'34;')42 4<+79+).'(83)  @0$?<<0C' (# "    54<+79+).1'(8)42 39+757/8+"4,9<'7+  $3066-<4/20(,C6/2 #4.3798/' ) ( "     '(()42)' &4<+774:53)

  9 #/$?4>0 #4.3798/' # "     ?+)42 #+).3414-/+8  6086C98"5C?<8,-C'   "    12/ *)42 /)748+7;+ 9748498$>$?4>0 ?<8,-C'  

"     2/)748+7;+)' "45.483) ?8=7?4<$>$?4>0 ',8.9?@0<'* "      845.48)42

4.3 ").<'7?.919?8/0<,8/! !>'3 %43-.919?8/0<:<0=4/08> ,8/.3401>0.389692C91E.0< ';+ %+/8(+)0.3401=><,>02C91E.0<

69?/-,=0/:09:60,8,6C>4.=,8/A9<519<.0:6,88482=96?>498=

',8.9?@0< 

 

?<8,-C 

 

')0 +<943.919?8/0<,8/! !/'3 ':;7+':.919?8/0<,8/.3401 69?/-,=0/602,6>0.389692C :09:6091E.0< "9')+> +73/:0:<0=4/08>,8/!

 

1':8 "'1).3+7@4.0:<0=4/08>=91>A,<00824800<482 !>'3 7++3@4.0 #0,60=>,>0=,60=,8/7,<50>482=96?>498= :<0=4/08>:<9/?.>

#4.3798/ 

  

4( '39<+11:<0=4/08>

,>,=.408.0,8/=91>A,<0/0@069:708>=0<@4.0=19<90482=269-,6 .?=>970<=

#4.3798/ 

 

.7/89> %>'99!

7-0//0/:0<=4=>08>08/:948>=0.?<4>C,8/7,8,20708>=96?>498=19< .97:?>0<=6,:>9:=>,-60>=,8/=7,<>:3980=

',8.9?@0< 

  

"+7-+ 41*+3(+7-@4.0:<0=4/08>,8/2080<,67,8,20<48>02<,>0/ 47,2482=96?>498=

0=4280<,8/7,8?1,.>?<0<913423:0<19<7,8.0/424>,6.,70<,=19< 48/?=><4,66410=.408.0,8/><,1E.,::64.,>498=9110<482,.97:<0308=4@0 :9<>1964991&$ 424<0(4<0&$ ,8/,70<,485:<9/?.>= 69?/-,=0/,?/4>,8/<4=57,8,20708>=91>A,<0A4>3/,>,,8,6C=4=19< E8,8.029@0<8,8.0<4=5%,8/.97:64,8.0:<910==498,6=

(46=98@4660!<0     ',8.9?@0< 

  

60,/0<480@!:=,8/2460/0@069:708>>3,>9110<=,::64.,>498 /0@069:708>>0,7=,8/48/4@4/?,6=19<,::64.,>49879/0<84D,>498,8/ 7,8,20708>,8/>0.389692C=96?>498= 8>0664208>-?46/482,?>97,>498=C=>07=,8/.98><96='.98><96=,..0== .98><96=6423>482.98><96==C=>07=48>02<,>498A0--,=0/,8/.69?/-,=0/ =91>A,<0,=,=0<@4.0=96?>498= ?=>970<<06,>498=34:48>0664208.0=91>A,<0>3,>47:<9@0=.?=>970< <06,>498=34:=>92<9A.?=>970<6410>470@,6?0

',8.9?@0< 



$?<<0C 





',8.9?@0< 

  

':7/+ ").:19?:<0=4/08>,8/! /).'+1 '-'88+@4.0:<0=4/08>',8.9?@0< 4.3 /).4118:<0=4/08> ")499 /11+7! ':1 "97:9.+780B0.?>4@0@4.0:<0=4/08>,8/7,8,2482/4<0.>9<$,20 ,8,/, "

?=480==7,8,20708>=91>A,<0=96?>498=,8/=0<@4.0=19<=7,66,8/74/ =4D0/-?=480==0=

0A.,=>60?:98 %C80&  %=0<@4.0=,8/7,8,20708>.98=?6>482E<79110<482,1?66<,82091,/@4=9<C ',8.9?@0< =C=>07=/0@069:708>,8/48>02<,>498,8/,::64.,>4987,8,20/=0<@4.0= 





 

+33/,+7 739475/4<0.>9<919:0<,>498=

0/4.,60;?4:708>,8/=?::640=7,8?1,.>?<482

98/98& 

 

!'>243* /3-8:<0=4/08>,8/!

!80=>9:=39:,::<9,.319<-?=480==0=<0;?4<482>0.384.,60824800<482 0B:0<>4=0=>,8/,</=,8/.9/0>0=>482;?,64>C>0=>482,8/1,46?<0,8,6C=4= =0<@4.0= 8>0<:<4=0=91>A,<0,8/=0<@4.0=19<,==0>48>08=4@048/?=><40==?.3,= 080<2C748482:?-64.481<,=><?.>?<0,8/><,8=:9<>,>498

$?<<0C 

 

>6,8>,, 

  

#4.3798/ 

 

?<8,-C 

 

"5:* '99.+<8:<0=4/08>

819<7,>498>0.389692C=96?>498=,8/=0<@4.0==:0.4,64D48248.69?/7,8,20/ ?<8,-C %,8/%=>,1E82 

 

.7/8 7',9@4.0:<0=4/08>:<9/?.>7,8,20708>

8.<C:>49808/:948>=0.?<4>CA0-07,4679-460,8/80>A9<5=0.?<4>C =96?>498=-,.50/-C$9:39=,-=

 

';/* 7'8+7@4.0:<0=4/08>:<9/?.>7,8,20708>

&'0 1!'21>:<0=4/08>,8/! /2'3 1!'21>.3401=><,>02C91E.0< $91>A,<0/0@069:708>,8/.98=?6>482E<7>3,>:<9@4/0=:<9/?.>=,8/ =0<@4.0=19<080<2C.9779/4>40=48/?=><4,6,2<4.?6>?<0,8/E8,8.4,6 7,<50>= #+77> 7*+3! "<0.4=498 =.,88482,8/48=:0.>498=96?>498=

$9?<.0=8>0<@40A=A4>3,-9@0.97:,840=,8/  <0=0,<.3!>30<.97:,840=7,C3,@0<,850/-?>/4/89> :<9@4/0,8?:/,>0-C/0,/6480 " 9>:<9@4/0/  "<0@49?=6C8,70.3,820/,C     0=>47,>0  E2?<0

00_BC Tech 2019_64p_2.indd 40

#0.<?4>708>:0<7,808>=>,1E820B0.?>4@0=0,<.3,8/9?>=9?<.0/=96?>498= ',8.9?@0< 48%,8/9>30<6480=91-?=480===0<@482,6648/?=><40=,.<9==,8,/, 

-482/98& 

#!!!#$ 7,50=0@0<C,>>07:>>9:?-64=3,..?<,>04819<7,>49848>304=>-?> ,..?<,.C.,889>-02?,<,8>00/#0=0,<.30/-C,<<40$.374/> !"! $

2019-06-10 2:35 PM


| 41

TOP 100 TECH COMPANIES IN B.C. RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;Total number of employees in B.C.  

        

         



&

%#"$!

 #"!! $!

1+:7516-9-0-%7'@5?1 *-9/:@A1=*  %   51+:7516-+75 '-;<87:<=-4$A;<-5;6+  ?4A1+'@5?1 *-9/:@A1=*%

%  

?.;16++75 788-:4-).



*5=?@-7+-D'@5?1  *-9/:@A1=*"  %  

+788-:4-).+75 ;+7-:7;8)+-)6),)<,  &5A1=&017?-*  % 

);+7*$).-$7.<?):  '?'@5?1

'@==1D* ( " %   ;).-+75

#%

':2?B-=1>:7@?5:9>?4-?>;-9?41.=1-0?4:2?41859593/D/712=:831:7:35/-7 %1=?4@>?=-75-   1C;7:=-?5:9-900-?-8-9-31819??:=1>:@=/11>?58-?5:9859101>539  ;7-99593-90;=:0@/?5:9/:9?=:7 935911=593-0A-9/109-?@=-73->193591>-902@17>D>?18> *-9/:@A1=

  

$-76-;1/66+ @=.5031'?)95? :<@5?7-8* 

%    ;-76+75 >7+-<<-%-+06747/1-;6+ 

'5C?4'? 90H::=#1B+1>?859>?1=* ! 

%  

)>7+-<<-+75 &6*7=6+ 1:=35-'?+'@5?1

*-9/:@A1=* %   =6*7=6+-+75 (A5-?7:3;6+ ?4A1+'@5?1 *-9/:@A1=* * %   BA5-?7:3;+75 "1447674,16/;:7=87.7; 199593=@=9-.D*# %  

,7:1/7+75-61/5)+7:8+75 7/716)6+-%-+06747/A6+  1:=35-'?+'@5?1

*-9/:@A1=* %   57/7+) 58+7 )6=.)+<=:-:;6+ @=.5031'?'@5?1 :<@5?7-8* 

%   

)58+75./+75 $9=1::-4$A;<-5; -C?1=%7@=9-.D** %  

;9=1::-4;A;<-5;+75 76-A?-44 

=::6>.-96A1#:=?4*-9/:@A1=* ' %    076-A?-448:7+-;;+75 ):,1=56+  7197D:9%6D'@5?1 @=9-.D*  %   3):,1=5+75 !=)<)$-+=:1<A) );<-:+):,758)6A -9-0-%7'@5?1 *-9/:@A1=* ( % 

  6=,)<);-+=:1<A+75 %07=/0<-@+0)6/  :7@8.5-A1&:>>7-90*  ,

%     <07=/0<-@+0)6/-+75 ")AA"076-%-+06747/1-;6+ -857?:9'?'@5?1 *-9/:@A1=* '

%   8)A*A8076-+75 #-)4;<)<-'-*5);<-:;

:881=/5-7'?#-9-58:*& %  :-)4-;<)<-?-*5);<-:;+75 $)5;=6/#)6),)$)5;=6/4-+<:761+;)6),)<, =1-?#:=?41=9+-D'@5?1

*-9/:@A1=*(  %   ;)5;=6/+75

)>1, 706;76$ 15 )+)44=5-/?593$ =,1 -;;$ 7=,-?126 !-12-6;/45128-=61?593:2G/1= ->16 #=;;-44A5/1;=1>5019?-903191=-78-9-31= 76 =::)A/:2:@901=-90;=1>5019? )4- =<B/:2:@901=-90A5/1 ;=1>5019?01A17:;819? %75 144;=1>5019?

%=:A501>01/5>5:9-9-7D?5/>?:/:8;-951>8-9-3593/=5?5/-7592=->?=@/?@=15?> *-9/:@A1= >:2?B-=1>:7@?5:9>71A1=-31:;1=-?5:9-7-90G9-9/5-70-?-?:417;/7519?>

8-6159A1>?819?01/5>5:9> 5=/=-2?193591>-90;-=?> =@>>17> 1735@8  "-61=:2-;7-?2:=8/-77101-?@=1"-95;@7-?5:993591"?4-? '@==1D >?=1-87591>?41?=-9>7-?5:9:2>;-?5-70-?-.1?B11931:81?=5/-900535?-7  2:=8-?>?410-?-59?13=-?5:9?1/49:7:3D5>@>10.D8:=1?4-9



:=3-95E-?5:9>B:=70B501 "-9@2-/?@=1>8:.571>@=A1577-9/1-90=1-7?581H11?8-9-31819?>:7@?5:9> :<@5?7-8 01>539102:=?41?=-9>5?>/4::7.@>-90/:-/4590@>?=51> 

$+7<< #7;;$ 1<+0-44 !/)1$$

"-9-310>1=A5/1>;=:0@/?59?13=-?5:9/:9>@7?593-90(>?-2G93

#1+3 "-::-)=4<$-90/:2:@901= -41+1) 7+01++017/4512=1A19@1 :2G/1= 14-; !=:;-/4512;=:0@/?:2G/1= #7*-:< )+7=/)44$

"-=61?593-90/:9A1=>5:9;7-?2:=8?4-?-77:B>8-=61?1=>?:.@570;@.75>4 -90?1>?7-90593;-31>;:;@;>-90>?5/6D.-=>B5?4:@?-B1.01A17:;1=

41 %-0:)61;=1>5019?-90$

1A17:;819?:2.5:?41=-;1@?5/>2:=/-9/1=>-90-@?:588@91-90 59H-88-?:=D05>1->1>@>593-;=105/?5A1/:8;@?-?5:9-7;=:?1591935911=593 ;7-?2:=8 :9?=-/?171/?=:95/>8-9@2-/?@=593>1=A5/1;=:A501=>:=53:'D>?18>-90 9538-9?1=/:991/?>@;;:=?$";=:0@/?5:9=1<@5=1819?>2=:8.-=1 ;=59?10/5=/@5?.:-=02-.=5/-?5:9?:2@77?@=961D->>18.7D>1=A5/1> 17;>-9-05-9/:9>@81=>8-9-31?415=G9-9/1>B5?4>58;710535?-7 >:7@?5:9>59/7@05932=11/=105?>/:=18:95?:=5935019?5?D2=-@0;=:?1/?5:9 ;=1;-50A5>-/-=0>0535?-78:=?3-311C;1=519/1-908:=1 '/=119-900535?-77D;=59?103=-;45/>-907-.17>59?1=2-/105>;7-D>:7@?5:9> /@>?:8;-=?>-90/:8;:919?>

):3 "14476;=1>5019? )>1, -44-:2:@901=$-90/4-5= :-/7:A -44-:;=1>5019?-90$ )66 76316;=1>5019?-90$

"!"     

 

 

 

 

#1B +1>?859>?1=  *-9/:@A1=



 

*-9/:@A1=

 

@=9-.D 

 

*-9/:@A1=

 

:<@5?7-8 

 

);76 --;76;=1>5019?

%:59?:2>-71>:7@?5:9>2:=4:>;5?-75?D590@>?=D

@=9-.D 

):A =:5)05=1/?:=

0A-9/10>19>593/:9?=:7-90-/?@-?5:9?1/49:7:351>2:=590@>?=5-7 ;=:/1>>1>

4-=7:??1# 



7=/ 7-:<B-6$

1A17:;593?4137:.18-;;593-90-.7-?5:9>D>?18-959A1>?53-?5:9-7 8105/-701A5/1@>1059?4105-39:>5>-90?=1-?819?:2-?=5-7G.=577-?5:9

@=9-.D



%->>5A1.5:81?=5/>-90.14-A5:@=-7-9-7D?5/>417;>/:8;-951>5019?52D@>1=> .->10:9:9759159?1=-/?5:9>F.14-A5:@=?4-?/-9?.18585/610:==1;75/-?10 .D-?45=0;-=?D )>- )+-7,2:@901=-90$ 15 1:;<*:7732:@901=-90;=1>5019? :88@95?D59?1775319/1;7-?2:=8417;59371-01=>-/=:>>#:=?481=5/-8-61 /4-7719359301/5>5:9>-90?=-9>2:=8593?415=:=3-95E-?5:9-7/@7?@=1>

*-9/:@A1=





&:>>7-90



6,:-); :=*-:;=1>5019?-9037:.-7$ )//1- 4)A$ );76 7);</4512;=:0@/?:2G/1= )<0-:16- $+7<</4512713-7:2G/1= 0:1; 7::7?/4512?1/49:7:3D:2G/1= 7:/)6 ):-A$:B91=2:@901=

*-9/:@A1=

 

1+0-4 1);;76$

%75 =//)6>195:=05=1/?:='-8>@93&9>?5?@?1-9-0-

':@=/1>9?1=A51B>B5?4-.:A1/:8;-951>-90  =1>1-=/4$?41=/:8;-951>8-D4-A1=-9610.@?0509:? ;=:A501-9@;0-?1.D01-07591 #%#:?;=:A5010 

G3@=1  6-8;/:=-GC-9099:A-?5A1 '539-31 

G3@=1

00_BC Tech 2019_64p_2.indd 41

' & #

+4:77D:B910.D*:76>B-31959-9/5-7'1=A5/1>%-DD%4:91>@;;:=?> /->471>>;-=6593;-D819?>A5->8-=?;4:91-90B1.-;;>

90?:190?1/49:7:3D>:7@?5:9>59/7@0593/@>?:8B1.>5?1>8-=61?593-90 #-9-58: /:9>@7?5932:=?:;=1-71>?-?1;=:21>>5:9-7>





'@;;:=?>37:.-701>53901A17:;819?:;1=-?5:9-90?1/495/-7>@;;:=?2:=- '@B:9':@?4 9@8.1=:2'-8>@93>8:.571;=:0@/?>-90>1=A5/1> :=1 

#!!!#$ 8-61>1A1=D-??18;??:;@.75>4-//@=-?1592:=8-?5:959?41!5>?.@? -//@=-/D/-99:?.13@-=-9?110&1>1-=/410.D-==51'/4850? !"! $

2019-06-10 2:35 PM


42 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

TOP 100 TECH COMPANIES IN B.C. RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;Total number of employees in B.C.  

                   

&

%#"$!

 #"!! $!

' & #

22*6,*<!*2*;&'0*2*6,=2(

2<?46.&A*&B6A2 ).;0<BC2?)  # 

 .22*6,*<(31 "8&6.7-*).(&0 <92@86;2%1)60A<?6.)-  #      78&6?7-1*).(&0(31 :*28'&7*#*(-2303,=2(

 <:2?&A).;0<BC2?) , #   *:*28'&7*(31 . 1*86.<  <D2&A&B6A2 ).;0<BC2?) % #   .51*86.<(31 -38323286302(

 )2?1B;#9&B6A2

%605:<;1)) ) #  

 4-3832(328630(31 0*:*78

 ;A2?;.A6<;.9#9%605:<;1)) + #   (0*:*78(31 :*29*  %</@<;&A&B6A2 ).;0<BC2?)  #    &:*29*-5(31 63(96.+=  #2;12?&A*&B6A2 ).;0<BC2?)  #    463(96.+=(31 !*286*+3669,!*7*&6(-*:*0341*28 *2@/?<<8 .99 A5H<<?).;0<BC2?)' -

#  

 ()6)(& 0&6.973'.0**&08  69:<?2*.F&B6A2  B?;./F) + #  (0&6.97(31 .2&2(.&0364

  C2&B6A2  &B??2F) '+

#  ?2(&)(31 #&7/834

 2<?46.&A*&B6A2

).;0<BC2?) - # 8&7/834(31 367&828*62&8.32&02( )686;4*.F&B6A2

%605:<;1))  #    2367&8(31  2*82(

C2&B6A2 &B??2F) &  #

 + 2*8 !.7**340*

2<?46.&A* A5H<<?).;0<BC2?) #

# 

  6.7*4*340*(31 4423:&8.32#*(-2303,.*7

 92E.;12?&A&B6A2 ).;0<BC2?) & # 

&4423:&8.32(31 .8=%*78&'0*&2)#*0*4-32*364  ?1C2#?6;02%B=2?A) 

#    (.8=;*78(& -&68*6

:=.9.%1)60A<?6.) 

#   (-&68*6(& *08& #*(-2303,.*7364

*6996;41<;C2B?;./F) 

#   )*08&5(31 .3=8.(&0&'36&836.*72(

 <::2?02#8F&B6A2

%605:<;1)) + #   '.30=8.(&0(31

!.(-&6) 0&2(-*8@2;6<?C602=?2@612;A5F1?<.;1@=206.9=?<720A@

%2;2D./922;2?4F5F1?<D6;1.;1@<9.?

<;4B2B69$B2 

 !#

.;.1.@9.?42@A:2160.912C60212@64;.;112C29<=:2;A0<:=.;FD6A5&" )60A<?6.

02?A6G21>B.96AF:.;.42:2;A@F@A2:.;1(&<<1.;1?B4

 1:6;6@A?.A6<;?246@A2?21:.;B3.0AB?6;43.0696A62@6;)60A<?6..;1'<?<;A< *++ ".2(0&.6".;10<3<B;12? *2 %*780<3<B;12? 2,*0& </6922C2;A.==@3<?=?2:6B:/?.;1@ ).;0<BC2? "83,6*C602=?2@612;AG;.;02 $.2(*28 &9;*8C602=?2@612;A1296C2?F  <=2?.A6<;@ -6.7834-*6 6=;90&/3<B;12?.;1" %2A.69:.;.42:2;A.;16;A2?.0A6C2?2A.69@<9BA6<;@ ).;0<BC2?

 "(388 -.00.47" 3-2 %&0170*=""

 

 

  

.,*0 92832"

"=A60.9@2;@<?A205;<9<4F:.;B3.0AB?2?3<?D.32?3./?60.A6<;2>B6=:2;A6; @2:60<;1B0A<?.;1<A52?@<961@A.A26;1B@A?62@

%605:<;1



 



#-31&7 .,3(/.=?2@612;A.;1"

;;<C.A6C2@<3AD.?23<?:</692D<?83<?02:.;.42:2;A2E09B@6C29F3<?BA696AF %605:<;1 G291<=2?.A6<;@

 

-6.7 #63*0786&"

B691@.;1:.6;A.6;@.;<;96;2=?2@2;023<??2.9A<?@

!#



</692.;109<B1/.@21=?<0B?2A<=.F=9.A3<?:

!#

  

1&2 &22" 36)32 (&90*==?2@612;A.;1" &96*28 *0.77.*6" 32 %6.,-8"

9</.99632@062;02@C2;AB?2=<D2?6;4A526;1B@A?F/F0?2.A6;4.;14?<D6;4 ).;0<BC2? 0<:=.;62@<3@0.92D5692A?.6;6;4A52@062;A6G0.;1/B@6;2@@A.92;A;22121A<  1?6C2A52:A</20<:292.16;449</.9.;05<?@52?26;.;.1. </692B9A?.@<B;1A205;<9<4F B?;./F 



 

!3'*68 &6/=?2@612;A.;1" ./* 633/7@2;6<?C602=?2@612;A.;1 6;.;06.912?6C.A6C2@C.9B.A6<;.;1?6@8:.;.42:2;A@<3AD.?2.;1@2?C602@ ""

&B??2F



 !#

./ *678*2".;10<3<B;12? **0&2 -3/7.=?2@612;A.;1"" ".132 3)=136*"

&<3AD.?21296C2?FC.9B2@A?2.:6;A24?.A6<;

).;0<BC2? 

 

1.** -&2=?2@612;A.;1" 68-96 -.2"

*6?292@@0<::B;60.A6<;@=?<1B0A@.;1@2?C602@3<??2:<A2.;105.992;46;4 ).;0<BC2? .==960.A6<;@



 

!=&2 ".,39.2"" #.1 &.28*6" #3)) &22&2E20BA6C2C602 =?2@612;A?6A6@5<9B:/6.

.;.4216;3<?:.A6<;A205;<9<4F@2?C602@

1:<;A<;



 



&.> ')900&"

996;<;2%@<3AD.?26;09B16;45B:.;?2@<B?02@6;3<?:.A6<;@F@A2: 4?<B=/2;2GA@.1:6;6@A?.A6<;.;1=.F?<99

).;0<BC2? !#

  

6230) *92," 0&6*2(* **"

9</.91646A.9@<9BA6<;@.;1:.;.421@2?C602@=?<C612?1296C2?6;4@A?.A24F .==960.A6<;12C29<=:2;A.;12;A2?=?6@26;A24?.A6<;<;92.16;4<=2; A205;<9<462@ ;A2?;2AA292=5<;2A292C6@6<;1.A.0<;;20A6C6AFA52?;2A@2?C602@5<@A21 #+.;1C<602@2?C602@0<9<0.A6<;@2?C602@

).;0<BC2? 

 



#?6;02%B=2?A



  

&90 -&2)0*63<B;12?.;1" *00= .(-*00=?2@612;A

'2920<::B;60.A6<;@=?<C612?<3A205;<9<4F@<9BA6<;@.;1@2?C602@3<? /B@6;2@@4<C2?;:2;A52.9A50.?2.;121B0.A6<;

)60A<?6.



 

*2 .*0).2,"

.AA2?F05.?42?@/.@21<;564523G062;0F=<D2?0<;C2?@6<;A205;<9<4FD6A5 B?;./F 1646A.9@<3AD.?20<;A?<93<?2920A?60C256092:.;B3.0AB?2?@



 

!3'*68 &(/.*05.6?:.; .:0**2 $*70*1*7"

!&'A52D<?91@3.@A2@A5B:.;6::B;<12G062;0FC6?B@)A2@A=?<C612@ %605:<;1 .00B?.A2?2@B9A@6;92@@A5.; @20<;1@.;16@@<916;0<B;A?62@49</.99F

 

-6.7 &6*88" 323:&2 .&7C602=?2@612;A@.92@.;1=?<720A :.;.42:2;A

&<B?02@;A2?C62D@D6A5./<C20<:=.;62@.;1  ?2@2.?05"A52?0<:=.;62@:.F5.C2?.;821/BA161;<A =?<C612.;B=1.A2/F12.196;2 !#!<A=?<C6121  G4B?2  #?2C6<B@9F2C29 '205;<9<462@ .0>B6?212C29 6;202:/2? 

00_BC Tech 2019_64p_2.indd 42

"!"     

#!!!#$ :.82@2C2?F.AA2:=AA<=B/96@5.00B?.A26;3<?:.A6<;6;A526@A/BA .00B?.0F0.;;<A/24B.?.;A221%2@2.?0521/F.??62&05:61A !"! $

2019-06-10 2:35 PM


| 43

TOP 100 TECH COMPANIES IN B.C. RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;Total number of employees in B.C.  

       



















#

    

! "

$ !

   

3:9728)68%-21)282'

 </@0%?4>0  (,8.9?@0< (&  #     23:9723;'% 59%8-'2*361%8-'72'

09<24,%>)%?4>0  (,8.9?@0< (

#        %59%8-'-2*361%8-'7'31 3928)6%8,  ?<<,</%>%?4>0  (,8.9?@0< (*

#  

  

 '3928)64%8,'31 #!)',2303+-)78(

,746>98%>%?4>0  (,8.9?@0< ( % #        *':-28)6%'8-:)'31 38-32)86-'728)62%8-32%0364 0,6>3%.408.0= ,66%?4>0  (,8.9?@0< (& +

#      138-321)86-'7'31 4))(-2) 3098-3272'

 >037,8$/ --9>=19</ ( &) #     74))(0-2)73098-327'31 %.36!31  0,>>C%> (,8.9?@0< ( 

#     !# 1%.36831'31 )8%73*8 <78)172'

 ),>0<%>%?4>0  (,8.9?@0< (  #  

   1)8%73*8'31 %1)7:%27773'-%8)78(   ,<53,7%>%?4>0  (4.>9<4, (+* #     

      .)%'% 286-27<'!)',2303+-)7364 ?8=7?4<%>%?4>0  (,8.9?@0< ( ! #        -286-27<''31 %'->'3%7831

088482<%?4>0  ?<8,-C (!

#        4'3%78'% )(&6-'/!)',2303+-)72'

 %>9<0%>%?4>0  (4.>9<4, () (

#     !# 6(&6'/'31 !,)27;)63

!06=98=<0=%?4>0  !0A)0=>748=>0< (   #        

 8,)%27;)6'3'31 #)'-1%)8;36/72'  (,8,67,8@0 (4.>9<4, (+  #          :)'-1%'31 )59-0-&6-91 3*8;%6)2' <,8@4660%>%?4>0

 (,8.9?@0< ( & #    !# %)59-0-&6-91'31 -2%6< 86)%1 3*8;%6) 9D066=@0%?4>0  ?<8,-C (  #     &-2%6<786)%1'31 "2-7)6:)31192-'%8-327364

&0<748,6@0%?4>0

 (,8.9?@0< ( 

#        92-7)6:)'31 3*80%2(-2+ 3098-3272' ,=>482=%>)%?4>0   (,8.9?@0< ( ! # 

  

  73*80%2(-2+'% %0-$-6)0)77%2%(%2'  9770<.0<> ?<8,-C ( ! #      (%0-;-6)0)77'31 32+7&)6+)738)',8(

0-0>),C #9<>9;?4>6,7 (   #       /32+7&)6+1)738)','31

322% 3&)68732.9:<0=4/08>,8/.3401602,691F.0< 39+ 301%2.9:<0=4/08>,8/"

$0=4/08>4,6-<9,/-,8/.,-60&(48>0<80>>060:3980

(,8.9?@0<



 

(;%6( 9-08<19?8/0<:<0=4/08>,8/"

"<2,84D0=>30A9<6/E=A,>0</,>,>97,50>30/,>,,..0==4-60,8/?=01?6 /,>,7,8,20708>=96?>498=19<>3008>4<0A,>0<.C.60>3<9?23>3<00 :<9/?.>-<,8/=;?,<4?=4859,8/),>0<&<,B 0=5>9:>,-60>,8/79-460@94.09@0<48>0<80>:<9>9.96(9#=91>A,<0 :<9/?.>=,8/=96?>498=48.6?/482%#-,=0/=91>:3980==0<@0< ,::64.,>498=,8/FB0/79-460.98@0<208.0=96?>498= ?66=0<@4.0/424>,6.98=?6>,8.C:<9@4/482.?=>970<.08><4.=><,>02C /0=428,8/>0.389692C=0<@4.0=>9:?-64.,8/:<4@,>0=0.>9<.6408>= ,.<9==!9<>370<4., '=482,<>4F.4,648>0664208.0>947:<9@07484820;?4:708>:<9/?.>4@4>C,8/ =,10>C

(,8.9?@0<

 

(,8.9?@0<

 

(,8.9?@0< 

 

(,8.9?@0<



 

3,2 ()$30():<0=4/08>,8/"

$0=>,?<,8>:948>91=,60=91>A,<0,8/=C=>07=

--9>=19</



 

<2 6<%2"

%:0.4,64D48248/424>,67,<50>482,/@0<>4=482,8/A0-/0=428,8/ /0@069:708>=0<@4.0=

(,8.9?@0<

 

!6):36 /-00)2:<0=4/08>,8/"

%91>A,<0,=,=0<@4.0-,=0/1?8/4824819<7,>498,8/.?=>970< <06,>498=34:7,8,20708>/,>,-,=019<>30898:<9F>=0.>9<A9<6/A4/0

(,8.9?@0<



 

#08=498,/7484=><,>498=96?>498=

(4.>9<4,



 

!6%'< ))7:<0=4/08>,8/" )36+) )=2-/",8/.9<:9<,>0 =0.<0>,<C

#<9@4/0=:<9/?.><0,64D,>498=0<@4.0=>9.?=>970<=-?46/48248>0664208> .9880.>0//0@4.0=

(,8.9?@0<



 

6)+ %7%9082080<,67,8,20< 31% -6/39:0<,>498=7,8,20< <%2 )83962)%9<0>,46=,60=7,8,20<

!#

?<8,-C





!3&<2 3;()2" %6'3 -1)28)0 "

&30-,.5-98091/4=<?:>4@0/424>,6.97:,840=1<97=91>A,<0>9/424>,6 :?-64=3482$0/-<4.5.98.04@0=,.;?4<0=-?46/=,8/=?::9<>=>30 0@96?>49891=><9824/0,= ?=480==7,8,20708>48@08>9<C7,8,20708>,8/-?=480==48>0664208.0 =91>A,<0=96?>498=,=A066,=7,8,20/=0<@4.0==?.3,=.98=?6>482 80>A9<57,8,20708>,8/1?>?<0:6,88482 &3<00=02708>=@4/09,8/-<9,/-,8/=96?>498=@4/09.98>08>/064@0<C ,8/=>9<,20,8/>0607,>4.=6982/4=>,8.0><,8=74==49891.97:?>0<4D0/ 4819<7,>498 !#

(4.>9<4,

 

!0A)0=>748=>0<



 

(4.>9<4,



 

!#

 !#

%:-( %6448>0<47",8/" 3,%22 8%6/):<0=4/08>,8/" ,%,6%1 !%*%=30-:<0=4/08>,8/"

,)6)) 3,2732""

,%;2 78,)-1)6:<0=4/08>,8/19?8/0< 91-8 91%6:<0=4/08>,8/" 3,2 %22%" (6-%2 3-7)" %/ ,%,%0:<0=4/08>,8/"

A,</A488482=96?>498:<9@4/0<9108>0<:<4=0<0=9?<.0:6,88482,//98 ?<8,-C :<9/?.>=19< 4.<9=91>C8,74.=#*!(,8/C8,74.= 



 

-',%)0 ',30=.3,4<7,8 %66)2 -',3007:<0=4/08>

8>0<80>/424>,6:39801,B>907,46/4,6?:A0-39=>482/97,48 <024=><,>4987,8,20/&=0<@4.0=.969.,>49839=>0/,::64.,>498=>9 -?=480==.?=>970<=<0=0660<=0<@4.0= ,8,20/4819<7,>498>0.389692C:<910==498,6,8/.69?/<06,>0/=0<@4.0= 19<74/=4D0/>96,<2008>0<:<4=0=

(,8.9?@0<

 

(,8.9?@0<

 

0&)68 ))" ,%;2 8%40)832.3401>0.389692C91F.0<

)4<060==481<,=><?.>?<04889@,>9<:<9@4/482,1<98>3,?680>A9<5>3,>4= <0,/C,8/.,8=?::9<>  ,8/ 80>A9<5==47?6>,809?=6C

0869#,<5,641 

 

0)& !',%-/3:7/-,<0,/4<0.>9<

,8,/4,8=?-=4/4,<C91982=-0<2 ,<4>470=?::640=,A9<6/A4/0 982=-0<2!" .?=>970<-,=0A4>3:<9/?.>=19<=0,<.3,8/<0.9@0<C7,<4800824800<482 

=0.?<4>C,8/=?<@0466,8.0,8/9>30<?8/0<A,>0<,::64.,>498=

,%92 3&)687:<0=4/08> 2(6); 3&-)7/-7,8,2482/4<0.>9< %,133( %**)6>0.384.,6/4<0.>9<

%9?<.0=8>0<@40A=A4>3,-9@0.97:,840=,8/  <0=0,<.3">30<.97:,840=7,C3,@0<,850/-?>/4/89> :<9@4/0,8?:/,>0-C/0,/6480 !#!9>:<9@4/0/

00_BC Tech 2019_64p_2.indd 43

 !#

!!" 7,50=0@0<C,>>07:>>9:?-64=3,..?<,>04819<7,>49848>304=>-?> ,..?<,.C.,889>-02?,<,8>00/$0=0,<.30/-C,<<40%.374/>  "

2019-06-10 2:35 PM


44 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

BIGGEST ALTERNATIVE-ENERGY COMPANIES IN B.C. RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;Total number of employees in B.C.

 

      

         



 '

 &$#%"

!"!"!

! $

 "# 

").3+/*+71+)97/)'3'*' 3679</'+C ?<8+,C &   !     ! 8).3+/*+7+1+)97/))'8+841'7)42 '11'7*4<+7">89+283) 6/86C98!5C ?<8+,C &   !         ('11'7*)42 +3,41*8!44?3-3)  +<>6/C@/ 9;?3>6+7 &  ( !   

   

5+3,41*8744?3-)42 %+895479:+1">89+283)   >2@/'#?3>/ &+8-9?@/< & !  !        <,8/3))42 %+11438'3'*'   @/ #?<</C &  ! !        <+11438)' 33+7-+=!+3+<'(1+3+7->3)  /9<13+#>'#?3>/ &+8-9?@/< &  

!        /33+7-+=)42 +19' #+).3414-/+8475 '366381.98@/ ?<8+,C &   !    

    

*+19'6)42 +3+7'1:8/433) 988/@366/!6#?3>/  ?<8+,C &  $ !     ! -+3+7'1,:8/43)42 3;+39>83)  6/86C98!5C%83>  ?<8+,C & 

!          /3;+39>8/3))42 7++31/-.9334;'9/43475 <312>98@/#?3>/   ?<8+,C &  

!          -7++31/-.9/334;'9/43)42 3'1>9/)">89+28%'7+ 9* "3@/<'+C /6>+ &  !  

   

 '3'1>9/)8>89+28)42 47;:83+7->3)   /60!6#?3>/ "3-2798. & & !        )47;:8+3+7->)42 +=9+77'">89+28475

/9<13+#>'#?3>/ &+8-9?@/< &   !          3+=9+77')' 1'33+7->"947'-+"  #2/<,<995/#> &+8-9?@/< & ( "

!     ! 5(+8)42 &!+3+<'(1+83)  =2#>%83> &+8-9?@/< & ! $ !     ! 2-=7+3+<'(1+8)42 3('1'4<+7+9<47083)  =>#>'#?3>/ 9<>2&+8-9?@/< & ! 

!    ! +3('1')42 9'1/23)

>2@/'#?3>/  &+8-9?@/< & ) !  

  ! +9'1/2)42 /789/-.9#+).3414-/+8  $/88C=98@/ &3->9<3+ &* ! !

  ! ?7891/-.99+).3414-/+8)42 '0'/3+7->"41:9/4383) ! 9B  ?7,/<6+8. &"# !    ! .'0'/+3+7->841:9/438)42 7++31'3+/4-'8479.2+7/)'9*  3679</'+C#?3>/ ?<8+,C &  ( !    ! -7++31'3+(/4-'8)42

!

#96+<+8.,+-5?::9A/<"&7+<38/+8.-977/<-3+6@/23-6/:<9.?->= :9A/<7983>9<381+8.7/+=?</7/8>/;?3:7/8>



  

!'3*'11 ')<+3:</=3./8>+8.

/=318./@/69:7/8>+8.7+8?0+->?</90D/<9/73==398:<9>98/B-2+81/   7/7,<+8/0?/6-/66=





+3 '>.+<:</=3./8> ".':3 '>.+<1<9?:=+6/= +8.7+<5/>3817+8+1/< #>1+7 4*-+81<9?: 9:/<+>398=+8.=+0/>C7+8+1/< ';/* 4.3843  /2 ')'11:2+->381

"99E8138-6?.381=96+<:+8/6=





!

8@/8>9<=/8138//<=7+8?0+->?</<=+8.=?::63/<=90+.@+8-/.-6/+8 ,?<83810?/6=C=>/7=+8.-97:98/8>=



 

'97/)0 #.473943:</=3./8>

#:/-3+63D/=38>2/./=3187+8?0+->?<381+8.>?<85/C38=>+66+>39890 ,397+==+8.1+=E</.>2/<7+6/8/<1C=C=>/7=



 

!/).'7* 1'3).+9=/839<@3-/:</=3./8>2C.<9+8. =:/-3+6:<94/->=

'38.0+<7=<?890<3@/<2C.<9=96+<0+<7=+8.1/9>2/<7+60+-363>3/=



 !

+3 /+1*/3-

+>>/<C-2+<1/<=09</6/-><3-@/23-6/=+8.38.?=><3+6/;?3:7/8>



 

/).+1 '(+7-+09?8./<+8.-23/0=-3/8>3=> 7:)+ 41</11  /).'+1 +1'-+$  .7/8945.+7 4<7> %'>3+ #.42843/B/-?>3@/-2+3<7+8 1':*+ +94:73+'::</=3./8>+8.

/@/69:7/8>90>2/A9<6.=E<=>0?=398:9A/<:6+8>





+<,98-+:>?</>/-289691C





#?::63/<90>/=>=C=>/7=+8.38.?=><3+6+?>97+>398/;?3:7/8>?=/.09< ./@/69:381+8.7+8?0+->?<3810?/6-/66=,+>>/<3/=+8.2C.<91/8 /6/-><96CD/<= /=318/.E<=>#A3>-279./@96>+1/-98@/<>/<38 +8.>9.+C ./=318=+8.,?36.=+-97:6/>/<+81/90:<9.?->=38-6?.381,+>>/<C -2+<1/<=@96>+1/-98@/<>/<=38@/<>/<=:9A/<=?::63/=+8.79</ 312:9A/<38.?=><3+663>23?7398,+>>/<3/=













'3 7440/3--2+3<7+8

/@/69:381+8.-977/<-3+63D381-6/+8/8/<1C,397+==1+=3E-+>398 =C=>/7=



 !

7+39 +77>

8/<1C=>9<+1/



 

!

"/8/A+,6/D38-+3<0?/6-/66





79.:7 $48:</=3./8>+8.

:/<+>/=+=7+<>1<3.:6+>09<7>2+>-</+>/=+8/>A9<5906+<1/?=/<=90 /6/-><3-3>C



 

!43 145,+7

6/+8:9A/<1/8/<+>398?=381>2/<79+-9?=>3-:2C=3-=



!

"+'3 4:76:/3  :89/3 #';+73'@3-/:</=3./8> ,?=38/==./@/69:7/8>+8.-99A8/<

#96+<6312>381



 

'843 ')0843

#96+</8/<1C38>/1<+>398-977/<-3+6+8.-977?83>C=-+6/=96+<.3/=/6 900=/>>38138</79>/-977?83>/=



 



 

#9?<-/=8>/<@3/A=A3>2+,9@/-97:+83/=+8.  </=/+<-2 >2/<-97:+83/=7+C2+@/<+85/.,?>.3.89> :<9@3./<+853813809<7+>398,C./+.638/!9>:<9@3./.   /=>37+>/  E1?</

00_BC Tech 2019_64p_2.indd 44

!488 '/1+>:</=3./8>+8. '2+8 '7-74;+ 3*7+< 47*+3

7+39 '01/3@3-/:</=3./8>,?=38/==./@/69:7/8>+8. /@/69:=+8.=?::63/=>/-289691C90?:1<+.381,391+=>9</8/A+,6/ >/-289691C 7'* 4:;/11+:</=3./8> 8+>?<+61+=09<?=/38:3:/638/=+8.@/23-6/0?/6

$"""$%! 7+5/=/@/<C+>>/7:>>9:?,63=2+--?<+>/3809<7+>39838>2/3=>,?> +--?<+-C-+889>,/1?+<+8>//."/=/+<-2/.,C88+3-D7+8=5+ "#" %

2019-06-10 2:35 PM


| 45

BIGGEST DIGITAL AND MEDIA AGENCIES IN B.C. RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;Total number of full-time employees in B.C.

  

                   

!" )

!"(&%'$

#'$

!* #!& 

&%  $%  

3#%5+1010'/#0&   75+:*9054%(>":09,  :74()> $         53#%5+1010&'/#0&%1/ 31#&$#0& 132  ,2;022,"9 $(4*5:;,7 $ 

  

  $$57%1/ .#%+'3+)+5#.   9/;,% $(4*5:;,7 $ &

      ).#%+'3/'&+#&+)+5#.%# #,131/ ,(99>"9 $(4*5:;,7 $       /#,1351/%1/ '5*+0-#0#&#

7(4;022,"9":09,  $(4*5:;,7 $ $           3'5*+0-%#0#&#%1/

3') #.2#44-5:4+,7(4+ 13+00' 6# +-' 20'367,80+,49

"(2,8-57*,62(9-573*548:2904.0362,3,49(9054(4+85-9<(7, +,;,2563,498,7;0*,83(71,904.(:953(9054+(9(3(4(.,3,49(4+ 85-9<(7,(8(8,7;0*,9,*/4525.> 0.09(2,49,79(043,49*536(4>9/07+2(7.,89;0+,56756,79>.25)(22> -5225<04.55.2,(4+(*,)551

:74()> 

 

$(4*5:;,7 

 

75;0+,8+0.09(2675+:*98(4+8,7;0*,88:*/(8675.7(33(90*8,(7*/ ,4.04,569030?(90548,(7*/,4.04,3(71,904.<,)809,):02+8(4+ 85*0(23,+0( "6,*0(20?04.04+0.09(23(71,904.(+;,790804.(4+<,)+,80.4(4+ +,;,2563,498,7;0*,8

$(4*5:;,7 



$(4*5:;,7 

 

1/ *'2#04-:-5:4+,7(4+4(9054(23(4(.04.6(794,7 (71,904.(+;,790804.+,80.454204,+0.09(26(>-576,7-573(4*, *3+4 5#2.'4-5:4+04.6(794,7(4+4(9054(2*7,(90;, (4+85*0(23,+0( +07,*957 #0 3#+4-5:4+04.6(794,7(4+4(9054(2*7,(90;, +07,*957 1*#00 5#3-'67,80+,49(4+ 49,.7(9,+(.,4*>9/(9*7,(9,865<,7-:2*:8953,7,=6,70,4*,8 9/75:./*(6()02090,804,49,76708,(4+*548:3,79,*/4525.>

$(4*5:;,7 

 

$(4*5:;,7 

'3'- *13-':8,4057;0*,67,80+,49(4+3(4(.04. 6(794,7

=6,7908,(*7588-:227(4.,5-+0.09(23(71,904.*7,(90;,(4+897(9,.> 35)02,85*0(2*549,49897(9,.>:8,7,=6,70,4*,(4+9,*/ +,;,2563,49 7(4++,80.4+,*080548*0,4*,(4+(4(2>90*8*549,493(71,904. 35)02,85*0(29,*/4525.>:8,7,=6,70,4*,6:)20*7,2(905488/566,7 3(71,904.(4+357, ,80.404.6,562,*,4970*8>89,38(4+*:29:7,8--,704.*:29:7(2:8,7 ,=6,70,4*,(4++0.09(2,=6,7908,9597(48-57357.(40?(90548(4+ :425*165880)0209> 0.09(2(.,4*>675;0+04.+(9(+70;,43(71,904.852:90548

$(4*5:;,7 



$(4*5:;,7  

$(4*5:;,7 

$(4*5:;,7 



54;,78054569030?(9054(4+,=6,703,49(90548,7;0*,8-572,(+04. .25)(2)7(4+8:8,7049,7-(*,+,80.4*5.4090;,8*0,4*,+(9(8*0,4*, (4++,;,2563,49,=6,798 >)70+35+,23(71,904.*7,(90;,+0.09(2(4+*549,49852:90548@73 *53)0404.897(9,.0*,=6,7908,<09/04+:897>86,*0(20?(9054

$(4*5:;,7 

 

":77,> 





0.09(2(.,4*>86,*0(20?04.04<,)+,80.4+,;,2563,49(4+, *533,7*,<,)809,8

$(4*5:;,7 





,+0(897(9,.>*548:2904.3,+0():>04.+(9(3(4(.,3,49(4+ (4(2>90*8

#575495 





$(4*5:;,7 



!0*/354+ 

 

$(4*5:;,7 





$(4*5:;,7 

 

0.09(2*7,(90;,(.,4*><09/5-@*,804$(4*5:;,7(4+#575495

$(4*5:;,7 





:228,7;0*,+0.09(2(.,4*>86,*0(20?04.04<,)+,80.4,*533,7*, (66+,;,2563,49*(36(0.4885*0(2897(9,.0,8

$(4*5:;,7 



 (302954"9":09,  $(4*5:;,7 $ "   

    

  (%7+05'3#%5+7'%1/ #/2#%+<%  53,7"9":09,  $(4*5:;,7 $ 

        %#/22#%+<%%1/ #0#&# 574)>"9":09,  $(4*5:;,7 $ '#    

   

 &&$%#0#&#%1/ 1/#+0

!(02<(>"9":09,  $(4*5:;,7 $ 

          &1/#+0 %1/ 1+4'+)+5#.0%  53,7"9":09, $(4*5:;,7 $ %      01+4'&+)+5#.%1/ !+&'3600'.#3-'5+0)0% ",>35:7"9":09,  $(4*5:;,7 $  

  

  8+&'3(600'.%1/ !#3-'5+0)#350'34

 "9":09,  ":77,> $ "        %3'8/2%1/ 3#2*+%#..:2'#-+0)'37+%'40%   ,4+,7"9%":09,  $(4*5:;,7 $             )3#2*+%#..:42'#-+0)%#  #0%167'3 574)>"9":09,  $(4*5:;,7 $ '#   



  1/&%1/ 18'34*+(5'3  9/;, $(4*5:;,7 $ #        218'34*+(5'3%1/ ..0%.64+7'#3-'5+0) 566,78309/ 2":09,  !0*/354+ $   

    #..+0%.64+7'/#3-'5+0)%1/ 0)+0'+)+5#.0% 9/;,% $(4*5:;,7 $ &        '0)+0'&+)+5#.%1/ " %(9,7"9":09, $(4*5:;,7 $        19&%1/ 160&3#+0 ,(99>"9":09, $(4*5:;,7 $            2160&#0&)3#+0%1/ &'#'$'.  %(9,7"9 $(4*5:;,7 $       +&'#3'$'.%1/

"5:7*,849,7;0,<8<09/()5;,*536(40,8(4+  7,8,(7*/9/,7@7383(>/(;,7(41,+):9+0+459675;0+, 04-573(9054)>+,(+204,  59675;0+,+   ,8903(9,  @.:7,  7,;05:82>6,4!5(+ 533:40*(905489+4(3,*/(4.,+6702 

00_BC Tech 2019_64p_2.indd 45

*#*3;#& #(#5+-5:4+,7(4+ .7+0 3168'367,80+,49 :0 3:#0

#55: 10'467,80+,49 *#80 '6/#00 :#0 #0#8#.567,80+,49 3'713 #33 16+4' +/-+0897(9,.>+07,*957 13# *'303(4(.04.+07,*957 *3+4 18#3&-5:4+,7(4+ 3#&'0 16).#4-5:4+04.6(794,7(4+6704*06(2 14* #+3046(794,7(4+7,.054(2+07,*957 #5' 16).#4 7,.054(2+07,*957 3#+) +/.+%-7,.054(2+07,*957 #33'.. #&&'0 #410 0+&'367,80+,49%,89

 1.'%-#(4+-5:4+,7 '0+4' 1.'%-#6(794,7(4+ 0.09(2675+:*988,7;0*,8(4+.75<9/(.,4*>9/(9*53)04,8+(9( +,80.49/04104.(4+2,(4+,;,2563,4995675+:*,+0.09(2,=6,70,4*,8 5-@*,3(4(.,7 :#0 %13/+%-6(794,7(4+;0*, 67,80+,4956,7(90548 #3#* 60&:-5:4+,7(4+ 0.09(26,7-573(4*,3(71,904.(.,4*>86,*0(20?04.04(-@20(9, 3(71,904.+0.09(2897(9,.>8,(7*/,4.04,569030?(905485*0(23,+0( 3(71,904.(4(2>90*8(4+(9970):9054 5'2*'0 '%--5:4+,7(4+ '.' #-#/63#-5:4+,7 0.09(2):804,88897(9,.>:8,7,=6,70,4*,+,80.4,*533,7*,<,) (4+# (4+35)02,675+:*9(4+62(9-5738*:8953,7,=6,70,4*,(4+8,7;0*, +,80.4,4.04,,704.+(9((4(2>90*8 #33'0 +$$10467,80+,49 13&10 144;0*,67,80+,49 4+95,4++,80.4(4+9,*/4525.>*548:2904.@73 #0&: .'+4%*'33(4(.04.6(794,7 3#*#/ %00'4 *7,(90;,+07,*957(4+6(794,7 #%-410 632*:*7,(90;, +07,*957(4+6(794,7 #3# 5'+0$'3)3(4(.04.6(794,7 #/+' #33#55 '+. #:'4

&$ $$  !&'# 3(1,8,;,7>(99,369956:)208/(**:7(9,04-573(9054049/,089):9 (**:7(*>*(4459),.:(7(49,,+!,8,(7*/,+)>44(0*?3(481( $%$ '!

2019-06-10 3:45 PM


46 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

BIGGEST B.C.-BASED TECH COMPANIES BY REVENUE RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;2018 revenue

! " #!* 

      

         



"*197465 1:=35-%?) =0G::= (-9/:@A1= ( # 

!# 8*197(42 !.*66&$.6*1*773(  )5=171>>)-D $5/48:90 (( 

#        7.*66&;.6*1*77(42 $*7854689*1!=78*273(   ?4A1)%@5?1   (-9/:@A1= (#

#        ;+7.3((42 !8*2(*11"*(-3414,.*73(  %?-?5:9%? (-9/:@A1= (  #     78*2(*11(42 4:*1.43"-*6&5*98.(7 1:=35-%?)%@5?1  (-9/:@A1= ( #      34:*1.43(42 .(647*6:*

:8595:9%?%@5?1  @=9-.D (   #        2.(647*6:*(& &11&6)4;*6!=78*273( 7197D:9#6D @=9-.D (   #       '&11&6)(42 '74198*  @9>8@5=%?%@5?1 #":C   (-9/:@A1= (*  #       &'74198*(42 &3&)&6.:*7 @==-=0%?%@5?1 (-9/:@A1= (*  #   !# (&3&)&)6.:*7(& #*(.2&*8;46073(  (-9-78-9A1 (5/?:=5- (,  #        :*(.2&(42 %=2*;46073(  ?4A1)%@5?1  (-9/:@A1= ( ( #      >=2*;4607(42 -&68*6 8;-7-$0 (5/?:=5- (  #   !# (-&68*6(& 4,4.3&3(*"*(-3414,=3(

 1:=35-%?)%@5?1  (-9/:@A1= (  #    !# 24,4(& 5534:&8.43"*(-3414,.*7 71C-901=%?%@5?1 (-9/:@A1= ( % #      &5534:&8.43(42 -48434386413( (1=0@9#7%@5?1  $5/48:90 (( (

#   !# 5-4843(438641(42 4;*68*(-&'73( A1 %@==1D ( )$ #  

    54;*68*(-1&'7(42 &62&3&-"*(-3414,.*7465

-D%? (5/?:=5- (  #      (&62&3&-(42 .114341).3,764954+47  199593= @=9-.D ( ! #          )46.,4(42*3.,2&(465(42 455*61*&+

 (5=?@-7)-D%@5?1  (-9/:@A1= ( 

#      (455*61*&+(42 386.37=("*(-3414,.*7465  @9>8@5=%?%@5?1  (-9/:@A1= ( ! #        .386.37=((42

"#)'&(%

$"'&

"+ $"'!

%&  

(!'  %

&66*3 38;.781*;=1>5019?-90" 49, &%*&!+%&' 6*3(-1C1/@?5A1A5/1;=1>5019?-90"

:88@95/-?5:9>;=:0@/?>-90>1=A5/1>

(-9/:@A1= 

 

     

*38 "-*<843;=1>5019?-90"

-=0B-=1>:2?B-=1-90>1=A5/1>2:=/:991/?1001A5/1>

$5/48:90 

 



   

&:.) 4-3743" .2 &(&1192-/?593 &%*)#& "

935911=593-0A-9/109-?@=-73->193591>-902@17>D>?18>

(-9/:@A1= 

  

     

11*3 &:*7;=1>5019?-90"

177>1;-=-?5:9/@7?@=18105-59>?=@819?>-9?5.:051> /D?:6591>>8-778:71/@71>10@/-?5:9-90/:9?=-/?->>-D >1=A5/1> 5:?1/49:7:3D/:8;-9D01A17:;>-90/:881=/5-75E1> 599:A-?5A1:/@7-=;=:0@/?>?4-?-00=1>>@981?8105/-79110>

(-9/:@A1= 

  

   

(-9/:@A1= 

!# !#

   

92:=8-?5:9?1/49:7:3D>:7@?5:9>-90>1=A5/1>>;1/5-75E59359 /7:@08-9-310&-90&>?-2F93

@=9-.D 



 

  

&%*!->0-<

1A17:;819?8-9@2-/?@=1>-71-90>1=A5/593:2/71-9191=3D @=9-.D 4D0=:3192@17/177> 



 

    

-6.78= $=&88"

&%*&

8.10010;1=>5>?19?190;:59?>1/@=5?D-908-9-31819? >:7@?5:9>2:=/:8;@?1=>7-;?:;>?-.71?>-90>8-=?;4:91>

(-9/:@A1= 





   

4)= 6**32:@901=-90/:" .0* &15.3/:"

#=5A-?17D4170

(-9/:@A1=

 







   

!92.8 92&6;=1>5019?-90" 4-3 &33&"

&%*(

(5/?:=5 

 

 

  

1. "*-6&3.;=1>5019?-90"

&%*!+%,+ 

(-9/:@A1=



 

      

&91 -&3)1*62:@901=-90" *11= .(-*11;=1>5019?

!#

59-9/5-7?1/49:7:3D/:8;-9D19-.7593-9-05-9>?:-//1>> -@?:F9-9/593-90:?41=/=105?;=:0@/?>?4=:@34-9:97591 ;7-?2:=8 &4=11>13819?>A501:-90.=:-0.-90>:7@?5:9>A501:/:9?19? 0175A1=D-90>?:=-31-90?1718-?5/>7:9305>?-9/1 ?=-9>85>>5:9:2/:8;@?1=5E10592:=8-?5:9 1A17:;819?:2.5:?41=-;1@?5/>2:=/-9/1=>-90-@?:588@91 -9059G-88-?:=D05>1->1>@>593-;=105/?5A1/:8;@?-?5:9-7 ;=:?1591935911=593;7-?2:=8 &171/:88@95/-?5:9>;=:A501=:2?1/49:7:3D>:7@?5:9>-90 >1=A5/1>2:=.@>591>>3:A1=9819?41-7?4/-=1-9010@/-?5:9

(5/?:=5 

 

   

&:.) *11*62:@901="-90/4-5= 6*,46= *11*6;=1>5019?-90"

&%*!->0-< ""

(-9/:@A1=





   

6341) *93," 1&6*3(* **"

#=5A-?17D4170

(-9/:@A1=







    

.,*1 93843"

&%*#"

17;>-9-05-9/:9>@81=>8-9-31?415=F9-9/1>B5?4>58;71 0535?-7>:7@?5:9>59/7@05932=11/=105?>/:=18:95?:=5935019?5?D 2=-@0;=:?1/?5:9;=1;-50A5>-/-=0>-908:=1 7:.-70535?-7>:7@?5:9>-908-9-310>1=A5/1>;=:A501= 0175A1=593>?=-?13D-;;75/-?5:901A17:;819?-9019?1=;=5>1 59?13=-?5:9:971-0593:;19?1/49:7:351> ";?5/-7>19>:=?1/49:7:3D8-9@2-/?@=1=2:=B-21=2-.=5/-?5:9 1<@5;819?59>185/:90@/?:=-90:?41=>:750>?-?1590@>?=51>

$5/48:90 







 

 

"91>?:;>4:;-;;=:-/42:=.@>591>>1>=1<@5=593?1/495/-7 1935911=5931C;1=?5>1>?-90-=0>-90/:01?1>?593<@-75?D ?1>?593-902-57@=1-9-7D>5>>1=A5/1> #=:0@/1>-;:=?2:75::2;=:0@/?>2:/@>10:9191=3D:;?585E10 -90>:7-=?1/49:7:351>

%@==1D 



    

(5/?:=5 

!# !#

     

:9?=-/?171/?=:95/>8-9@2-/?@=593>1=A5/1;=:A501=>>@;;:=? " ;=:0@/?5:9=1<@5=1819?>2=:8.-=1;=59?10/5=/@5?.:-=0 2-.=5/-?5:9?:2@77?@=961D->>18.7D>1=A5/1> #=:A501>01/5>5:9-9-7D?5/>?:/:8;-951>8-9-3593/=5?5/-7 592=->?=@/?@=15?>>:2?B-=1>:7@?5:9>71A1=-31:;1=-?5:9-7-90 F9-9/5-70-?-?:417;/7519?>8-6159A1>?819?01/5>5:9> #=:A501>;=:0@/?=1-75E-?5:9>1=A5/1>?:/@>?:81=>.@570593 59?1775319?/:991/?1001A5/1>

@=9-.D 



   

(-9/:@A1=



 

 





(-9/:@A1= 

 

     

&%*%)

#=5A-?17D4170

.(-&*1 6.(*1C1/@?5A1A5/1;=1>5019?-90 !->0-<!(! " *3 &67-'&6,*659?1=58"-90 3191=-7/:@9>17 !59) &88-*;7;=1>5019? #=5A-?17D4170 &3)&11 &(;*3;=1>5019?-90"

&=243) .3,7;=1>5019?-90"

#=5A-?17D4170

4-3 !.22437" :&3 64;3"-90 &%*  /:=;:=-?1>1/=1?-=D &60 .1143;=1>5019?

#=5A-?17D4170

9). *77" 49)*;./3 *./*37/4512 8-=61?593:2F/1=

#=5A-?17D4170

"6&(= **7;=1>5019?-90" *46,* *>3.0"-90/:=;:=-?1>1/=1?-=D

&%*&

%:@=/1>9?1=A51B>B5?4-.:A1/:8;-951>-90  =1>1-=/4"?41=/:8;-951>8-D4-A1=-9610.@?0509:? =1>;:90?:592:=8-?5:9=1<@1>?>.D01-07591 !#!:?;=:A5010   F3@=1  :9A1=?102=:8'%   1>?58-?1

00_BC Tech 2019_64p_2.indd 46

&"%* "

'%!%%!!"'($ 8-61>1A1=D-??18;??:;@.75>4-//@=-?1592:=8-?5:959?415>?.@? -//@=-/D/-99:?.13@-=-9?110$1>1-=/410.D-==51%/4850? %&% (" 

2019-06-10 2:35 PM


| 47

BIGGEST DIGITAL ARTS COMPANIES IN B.C. RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;Total number of employees in B.C.

 

    

!)

 ! (%$&#

"&#!" & "$$#!" % "& !$

 * " %

0*(7532.(576

&.;12?@<;*.F B?;./F ) +

$       *&(31

&77 .0'*<2E20BA6C2C602=?2@612;A @A?.A24604?<DA5 &9.) 877*5@2;6<? C602=?2@612;A.;142;2?.9:.;.42? ).;0<BC2? &2)< &/*=?2@612;A .(-*00* 5&)< @2;6<?C602=?2@612;A=?<1B0A6<;

;A2?.0A6C22;A2?A.6;:2;A@<3AD.?2

%21D<<16AF.963 "$

 "$





).;0<BC2?



"$ "$

 

).;0<BC2?



"$ "$

 

"$ 

 

 

 

"$ "$

 

32<.(785*61&,*:35/6  ?.;C6992&A ).;0<BC2? ),  $    "$ .1&,*:35/6(31 731.(&5733262(

*2@AA5C2 ).;0<BC2? ),  $    "$ &731.((&573326(31 

 A5C2* ).;0<BC2? ),  $   "$ )2*,(31 &5)*027*57&.21*272(

  ?1C2* ).;0<BC2? )  $     '&5)*0(&



$*).&

 A5C2* ).;0<BC2? ),  $        )-;1*).&(31 2)8675.&0.,-7&,.("&2(389*5 *.A2?&A&B6A2  ).;0<BC2? ) 

$    "$ .01(31 !-*3&0.7.32 2.AAF&A&B6A2  ).;0<BC2? ) 

$      7-*(3&0.7.32678).3(31 .2*6.7* ?2.A"<?A52?;*.F&B6A2  ).;0<BC2? )'  $     "$ (.2*6.7*(31 !.71386*

 ?1C2* ).;0<BC2? ), ' $  "$ 7.71386*2*7 1&,*2,.2**6.,22(

A5C2* ).;0<BC2? ),  $     

.1&,**2,.2*(31 .,.7&031&.2

 A5C2* ).;0<BC2? ) ) $     ).,.7&0)31&.2(31



0&(/'.5)27*5&(7.9* ?2.A"<?A52?;*.F&B6A2  ).;0<BC2? )'  $    "$ '0&(/'.5).27*5&(7.9*(31



/<'3;&'6   <B45221DF&B6A2  B?;./F ) $ 

"$ 6/<'3;0&'6(31

   

      

.2,*533)  <B45221DF&B6A2  $<?A<>B6A9.: ) , $    "$ =2,*5+33)678).36(31 *;7*9*0&1*6 %</@<;&A ).;0<BC2? )

$   

   

2*;70*9*0,&1*6(31 &67 .)*&1*6  A5C2*&B6A2  ).;0<BC2? )- + $      *&676.)*,&1*6(31 86*$

.:69A<;&A&B6A2  ).;0<BC2? ) & $   "$ +86*+;(31 !-.2/.2,4*27*57&.21*277)

9/2?;6&A&B6A2  ).;0<BC2? )  $   "$ &7-.2/.2,&4*(31 5(-.&(7

2<?46.&A*&B6A2  ).;0<BC2? ) $

$"$ "$ &5(-.&(795(31 .(/67&5727*57&.21*27

%.69D.F&A&B6A2  ).;0<BC2? )  $    "$ /.(/67&57*27(31

0.12:FD.?1D6;;6;4C6@B.923320A@.;1.;6:.A6<;@AB16<8;<D;3<?=5<A<?2.9 96C2.0A6<;C6@B.923320A@1F;.:600?2.AB?2.;105.?.0A2?.;6:.A6<;.;13B99 .;6:.A6<; *22.+*5 !:.2*5(&5532=?2@612;A.;1 B99@2?C602.;6:.A6<;0<:=.;F=?<1B02@.;1I;.;02@<?646;.9=?<=2?A62@.;10< # =?<1B0A6<;.;1@2?C602

&22&- 33/42;2?.9:.;.42? 84*57 357*552.1<3=?<1B0A6<; 78&57 &50*< 52.1<3 .(/ .6(-*0# .(-&5) 5.*9*@2;6<? C602=?2@612;AI;.;02.;1/B@6;2@@ .33.6?@ !.2& -3:@2;6<?C602=?2@612;A =?<1B0A6<;.;112C29<=:2;A &5&- #&00C602=?2@612;A.;6:.A6<; =?<1B0A6<;

0.12:FD.?1D6;;6;4C6@B.923320A@.;6:.A6<;.;1@A2?2<0<;C2?@6<;0<:=.;F <;1<;( 3<?32.AB?2I9:.;1A292C6@6<;D6A5@AB16<@6; <;1<;).;0<BC2?!B:/.6 <@

 ;4292@52;;.6!<;A?2.95.;164.?5F12?./.1.;1<. &=206.96G6;46;.;6:.A6<;.;10?2.A6C2@2?C602@3<?32.AB?2I9:@A292C6@6<;.;1 ).;0<BC2? 6;A2?.0A6C2<;96;20<;A2;A

 92.16;405691?2;H@0<;A2;A.;1/?.;1@0<:=.;F

.963.E 

&2)&0 -35*2E20BA6C26;05.?42 ! ).;0<BC2?

&A.?*.?@=6@<12+9.116;C2;42?@;1.:2'52!.;1.9<?6.; (;12?4?<B;1'52?6@5:.;

&.;?.;06@0<.963 "$





 

3) *5,86632@AB16<52.1 ./* 5814 2.?@<3*.?3?.;056@2 16?20A<?<3<=2?.A6<;@

%21:<;1*.@5 "$

"$ "$



!&5& *1*642;2?.9:.;.42?

B??2;A9FA2.:21D6A5!2A?<<91DF;!.F2?3<?'5211.:@.:69F.;2D 32.AB?2.;6:.A6<;:<A6<;=60AB?2/.@21<;A520?22=F0<:6009.;

<;1<;(



 "$

 "$

*22.+*5 &<C602=?2@612;A.;152.1<3 =?<1B0A6<; *9.2 &1'0*C602=?2@612;A .;1@B=2?C6@6;4=?<1B02? -&:2 #&06-C6@B.923320A@2E20BA6C2 =?<1B02?.;142;2?.9:.;.42?

D.?1D6;;6;4.;6:.A6<;=?<1B0A6<;0<:=.;F8;<D;3<?'52)2;AB?2?<@ !2A.9<0.9F=@2&B=2?7.6964!<BA5"68<.;1A52&D<?1<3 645A 6AA9264 D2@<:2.;16A@I?@A32.AB?2I9:"2?19.;1 )6@B.923320A@.;1.;6:.A6<;

<@;4292@.963

 



"$



"$ "$





&0& &9,&9.&2C602=?2@612;A5B:.; ?2@<B?02@.;1?20?B6A6;4

)6@B.923320A@@AB16<D6A5?202;A=?<720A@6;09B16;4.=A.6;!.?C29C2;42?@ ;14.:2&5.G.:%2.1F$9.F2?#;2C2;42?@;I;6AF*.?&=612?!.; <:20<:6;42.BAF.;1A522.@A'5<?%.4;.?<8'6A.;60'52B?6<B@.@2<3 2;7.:6;BAA<; <:2D<?912@2?A@<35.?.8?292.@21 A5?22;2DC612<4.:2=?<720A@ 0B??2;A9F6;12C29<=:2;A

<@;4292@.963 "$

"$ "$



3' 822.2,-&1# *7*5 5**2:33)# %,,< .2,'# 5.( !35.2## &5&- (&.55B:.; ?2@<B?02@16?20A<? -<&2, 32,0<3<B;12? *5*/ &(*.0 &A29..9<;I;6A2!6;20?.3A.9<42<3:=6?2@42<3!FA5<9<4F 0<3<B;12?.;1:.;.46;4=.?A;2? 7*9* .09*67*50<3<B;12?.;1:.;.46;4 =.?A;2? <&2 *7*56320<3<B;12?.;1# B691@A205;60.9@<9BA6<;@3?<:A524?<B;1B= !5*27 -81&<0<3<B;12?.;1=?2@612;A

).;0<BC2? 

"$



 



B?;./F

"$



 

$<?A<>B6A9.: 

"$ "$



38,0&6 !5326,&5)#

)612<4.:212C29<=2?@D<?86;416?20A9F3<?"6;A2;1<

).;0<BC2?







36- .06320<3<B;12?.;1#

9D.F@&B;;F.;4<2@!</692'?.692?$.?8<F@?2.@F!<;2F

).;0<BC2?

 





32 3:0*<52.1<3=?<1B0A6<;@2;6<?)+ B99@2?C60249</.9C6@B.923320A@0<:=.;F@2?C6;432.AB?2@2=6@<160.;1 @B=2?C6@<? 867.2 0&))*2:.;.46;4 0<::2?06.9@ =?<1B02? *26-. 5&6&/.0<3<B;12?.;1# 6;41<:@<3208I?2$.?AF6;!F<?:6;41<:@.A*.?.@6;<+

<@;4292@.963 

 



).;0<BC2? 

 

 

5&2/ -*2# 857 86(-@AB16<52.1 ).;0<BC2?/.@21=?2:6B:C6?AB.9.;1.B4:2;A21?2.96AF@AB16<D6A5.&5.;45.6 <3I02?202;A4.:2@6;09B12C.@6<;.;16112;<?AB;2

).;0<BC2?

"$

 

*&7-*5 8773(/0<3<B;12?

).;0<BC2?



"$



 

&<B?02@;A2?C62D@D6A5I?:@A5.A?2@=<;121A<?2>B2@A@3<?6;3<?:.A6<;/F12.196;2.;1  ?2@2.?05 "$ "<A=?<C6121

00_BC Tech 2019_64p_2.indd 47

 "'#$  #$    

<?2@2?C602@6;09B1212C29<=:2;A96C2.0A6<;=?<1B0A6<;3<?I9:.;1A292C6@6<; .;6:.A6<;C6@B.923320A@0<I;.;06;4.;196A2?.?F=B/96@56;4

%### %&" :.82@2C2?F.AA2:=AA<=B/96@5.00B?.A26;3<?:.A6<;6;A52 6@A/BA .00B?.0F0.;;<A/24B.?.;A221%2@2.?0521/F.??62&05:61A #$# & 

2019-06-10 2:35 PM


48 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

BIGGEST SOFTWARE COMPANIES IN B.C. RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;Total number of employees in B.C.

  ' 

      

         



# '4'*'4) *264*6-#< %*6,7=>.: %  !  

     9'6)53 

=::*:-#<#=2<.  %*6,7=>.: %  

!          3*')58658':/54)53 .'4-++'2:.)'8+3'-/4-&581@5='8+#52;:/549  *5+2."-#=2<.  "2,1576- % '  !          ).'4-+.+'2:.)'8+)53 55:9;/:+ <1>. %*6,7=>.: % $"

!   

 ! .55:9;/:+)53 25('2"+2'> *5+2.#<6-D77: %*6,7=>.: %  !    

      -25('28+2'>)53 $8'):/5454+3'4*  !:7-=,<276&*A#=2<.  =:6*+A %  !      ! :8'):/5454*+3'4*)53 2/5$.+3/9#52;:/5494)

*6*-*&*A#=2<.  =:6*+A %  ' ! 

! )2/5)53 +4). "7+;76#<#=2<. %*6,7=>.: %  !! ! (+4).)5 "+'2:58)53  #1.44+:2-0.&*A#=2<.  "2,1576- % '& !

  ! )'8++898+'2:58)53 5+/4-%'4)5;<+8  755.:,.!3A#=2<. "2,1576- % % !          (5+/4-<'4)5;<+8)53 (952;:+  =6;5=2:#<#=2<. ! 7@  %*6,7=>.: % ' !          '(952;:+)53 '2<'4/?+ 7?.#<#=2<.  %*6,7=>.: % ) !  

    

 =+-'2<'4/?+)53 %/9/548/:/)'2 :*6>244.#< %*6,7=>.: % #

!  

   

 </9/54)8/:/)'2)53 #'-+  &2:.4.;;&*A "2,1576- % % !     ! 9'-+)53)' /-/:'2+*/'

 *::*44#<#=2<. %*6,7=>.: %   !       

64/3+*/')53 #56.594) =6;5=2:#<#=2<.  %*6,7=>.: % (

!    

 ! 956.59)53 566+82+', %2:<=*4&*A#=2<.  %*6,7=>.: % 

!          )566+82+',)53 <+4:('9+$+).4525->4) 75.:#< %*6,7=>.: % ( !    ! +<+4:('9+)53 2+<+9:  6<.:6*<276*4!4 "2,1576- % %' !     ! )2+<+9:)53 <+4;+! "7+;76#<#=2<. %*6,7=>.: % 

! ! '<+4;+.7)53

!$#

! $

   "# 

=;26.;;5*6*0.5.6<;7/<?*:..6<.:8:2;.:.;7=:,.5*6*0.5.6<;74=<276;*6*4A<2,;57+24. /89:+4 #;::54>2,.8:.;2-.6<*6-5*6*0260-2:.,<7:#!*+;*6*-* ,744*+7:*<27626<1.,47=047+*41.*-#!*56026..:260



   

#8*,.:7+7<2,;;*<.442<.*6<.66*;*6-;=+;A;<.5;;=:>.244*6,.*6-26<.4420.6,.;A;<.5; -./.6,.*6-5*:2<25.;A;<.5;*6-0.7;8*<2*4:*-*:25*0.:A

/1+ 8++42+>0:7=88:.;2-.6<

 

 

.8*:<5.6<*4-2*067;<2,25*0260;74=<276;.6<.:8:2;.?7:3D7?*6-26/:*;<:=,<=:.;74=<276; .@<.6-.-,*:.*6-,1*60.5*6*0.5.6<;74=<276;

!



 

#7,2*4:.4*<276;12884*</7:55*6*0.5.6</:7576.26<.0:*<.--*;1+7*:-?2<157:.<1*6

5244276=;.:;

">'4 523+9







47=-*:,12>260*6-26/7:5*<27607>.:6*6,.;74=<276;/7:<1.047+*4C6*6,2*4;.,<7:*6-7<1.: 12014A:.0=4*<.-26-=;<:2.;

#.'4454 "5-+898:.;2-.6<*6-0.6.:*4,7=6;.4 &'88+4 "5> *6/7=6-.:







#*4.;/7:,.84*</7:5,76;=4<2602584.5.6<*<276*6-;7/<?*:.-.>.4785.6<;.:>2,.;5*:3.<260 8+- '26'99/7=6-.:*6-  58/44+ ;'  /1+ 64+88:.;2-.6< *=<75*<276-*<*5*6*0.5.6<*6-;7/<?*:.*;*;.:>2,.<.,167470A



 

47=-+*;.-4.0*4<.,167470A

')1 +=:54,7/7=6-.:*6-  "/'4 ';<8+';,7/7=6-.:*6-,12./ 8.784.7/C,.:



 

26*6,2*4<.,167470A,758*6A<1*<*=<75*<.;*,,7=6<260<*;3;<77:0*62B.<1.C6*6,2*4;7/ ;5*44+=;26.;;.;

'4 859(>,7/7=6-.:*6-



 

".*4.;<*<.;*4.;*6-5*:3.<260;74=<276;

2';9 #'2).4+8>2,.8:.;2-.6<;7/<?*:..6026..:260 ">'4 8++4>2,. 8:.;2-.6<8:7-=,<







*<*;,2.6,.*6-;7/<?*:.-.>.4785.6<;.:>2,.;/7:7.260;047+*4,=;<75.:;

5( '4:=+228:.;2-.6<



 

5+.--.-8.:;2;<.6<.6-8726<;.,=:2<A*6-5*6*0.5.6<;74=<276;/7:,758=<.:;4*8<78; <*+4.<;*6-;5*:<8176.;

.8/9:> &>'::



 

47=-+*;.-*=-2<*6-:2;35*6*0.5.6<;7/<?*:.?2<1-*<**6*4A;2;/7:C6*6,.07>.:6*6,. :2;3$*6-,75842*6,.8:7/.;;276*4;

';8/+ #).;2:?8:.;2-.6<*6-



 

=;<75.::.4*<276;12826<.4420.6,.;7/<?*:.<1*<258:7>.;,=;<75.::.4*<276;128;<70:7? ,=;<75.:42/.<25.>*4=.

#)5:: /22+8



 

=;26.;;5*6*0.5.6<;7/<?*:.;74=<276;*6-;.:>2,.;/7:;5*44*6-52-;2B.-+=;26.;;.;

';2 #:8;:.+89.@.,=<2>.>2,.8:.;2-.6<*6-5*6*0260-2:.,<7:#*0. *6*-*





#7/<?*:.84*</7:5/7::.<*24.:;<1*<7//.:;76-.5*6-8.:;76*42B.-8:7-=,<;/7:;*4.76426. /:7526;<7:.327;3;*6-/:7557+24.-.>2,.;

#/354 '/8490.6.:*45*6*0.:





6,:A8<276.6-8726<;.,=:2<A?.+.5*2457+24.*6-6.<?7:3;.,=:2<A;74=<276;+*,3.-+A #7817;*+;

.8/9 8',:>2,.8:.;2-.6<8:7-=,<5*6*0.5.6<





!:7>2-.;-.,2;276*6*4A<2,;<7,758*62.;5*6*0260,:2<2,*426/:*;<:=,<=:.2<;;7/<?*:. ;74=<276;4.>.:*0.78.:*<276*4*6-C6*6,2*4-*<*<71.48,42.6<;5*3.26>.;<5.6<-.,2;276;

;*/ +99  5;*+=/04 +/0+49,12./5*:3.<2607/C,.:



  

7+24..>.6<*88;/7:8:.52=5+:*6-;

+,, #/4)2'/8 *6-,7/7=6-.: +4 &+9:,7/7=6-.: 4-+2' #:5-8+  >2,.8:.;2-.6<C6*6,. %/4)+4: ';=+:>2,.8:.;2-.6<-.42>.:A78.:*<276;



667>*<2>.;7/<?*:./7:57+24.?7:3/7:,.5*6*0.5.6<.@,4=;2>.4A/7:=<242<AC.4-78.:*<276;

$.53'9 /-5)1/8:.;2-.6<*6-





=24-;*6-5*26<*26;*676426.8:.;.6,./7::.*4<7:;

.8/9 $85+29:8'





#7=:,.;6<.:>2.?;?2<1*+7>.,758*62.;*6-  :.;.*:,1 <1.:;5*A1*>.:*63.-+=<-2-67<:.;876-<7 26/7:5*<276:.9=.;<;+A-.*-426.!7<8:7>2-.-  *6*-2*6+=;26.;;7/*@*:$.,1674702.;  =;26.;; =62<7/,.;;76.-2,*45*0260   .;<25*<.  !:.>27=;4A6*5.,1*60.-*A    C0=:.

00_BC Tech 2019_64p_2.indd 48

 &$#%"

$"""$%! 5*3.;.>.:A*<<.58<<78=+42;1*,,=:*<.26/7:5*<27626<1.2;<+=< *,,=:*,A,*667<+.0=*:*6<..-".;.*:,1.-+A66*2,B5*6;3* "#" %

2019-06-10 2:35 PM


| 49

BIGGEST COMMUNICATION TECHNOLOGY FIRMS IN B.C. RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;Total number of employees in B.C.

  

      

        

!" *

!"!)&%'$

#!&%$!#$#'$

!#%*!( #$

#!& 

!!  $%  

#+197465  3=@57/'B+ @2J==@*/<1=CD3@* " %  #% 8+197)42 ".';42293/)'8/4373) =@2=D/'B+*/<1=CD3@* ( % 

#% 7.';)' +11'3'*'

 *7@BC/:+/G*/<1=CD3@*", %

 #% (+11)' !4-+6742293/)'8/437   7<5AE/G'C7B3 

C@</0G*+ %         64-+67)42   'B'C7B3

'C@@3G* +  % 

#% '>-14('1)42 1+38+13)  =;;3@13@BC@</0G*# %  

   -1+38+1)42 '<< .43+#+).3414-/+73) /;7:B=<'B'C7B3 */<1=CD3@* '

%   #% 5'<(<5.43+)42

'66+3 38;/781+>@3A723<B/<2$ 49- 6+3). 3F31CB7D3D713>@3A723<B/<2$

=;;C<71/B7=<A>@=2C1BA/<2A3@D713A

(',(



 

6'*1+< ".';$ '< +.6>@3A723<B



 

+46-+ 45+>@3A723<B/<2$/<23::/</2/

!3/27<5/</27/<1=<<31B7D7BG1=;>/<GE7B61=<AC;3@ (',#-''& E7@3:3AA0CA7<3AA<3BE=@9A3@D713A/<20CA7<3AA7<4@/AB@C1BC@3 27D7A7=<A =;;C<71/B7=<A>@=2C1BA/<2A3@D713A (',#-'



 

47+5. '8'1+$

(3:31=;;C<71/B7=<A/<2;327/1=;>/<G



  

4+ 6+).>@3A723<B

<57<33@A>@=D7A7=<A0C7:2A/<2>@=D723A>@=2C1BA/<2A3@D713A #% 4=@1CAB=;3@A0@=/20/<2<3BE=@9A

#%

 #%

!':/ 440'1'>@3A723<B/<2$

(3:31=;;C<71/B7=<AA3@D713A/<2;=07:3A=:CB7=<A

3::/<2&=53@A



 

3*6+'7 69(+6>@3A723<B/<25:=0/:$ '--/+ 1'<$ '743 4'7816734>@=2C1B=4I13@ '8.+6/3+ ")48816734:35/:=4I13@ .6/7 4664;16734B316<=:=5G =4I13@ #42 9--'3A3<7=@27@31B=@'/;AC<5&<AB7BCB3 /</2/

+6=::G=E<320G*=:9AE/53<7</<17/:'3@D713A%/GG%6=<3 AC>>=@BA1/A6:3AA>/@97<5>/G;3<BAD7/A;/@B>6=<3/<2E30 />>A

#%

  

'C>>=@BA5:=0/:23A75<23D3:=>;3<B=>3@/B7=</<2B316<71/: AC>>=@B4=@/<C;03@=4'/;AC<5A;=07:3>@=2C1BA/<2 A3@D713A

#/A2/?''!#



 

2/++ .'3>@3A723<B/<2$ 68.96 ./3$

+7@3:3AA1=;;C<71/B7=<A>@=2C1BA/<2A3@D713A4=@@3;=B3/<2 (',##-'#'(  16/::3<57<5/>>:71/B7=<A

 

"'2793-!'3'*'"'2793-1+)8643/)7'3'*' 8* @3/B#=@B63@<+/G'C7B3

*/<1=CD3@*(  %   #% 7'2793-)42 467'838+63'8/43'13) 

*797<5+/G'C7B3 &716;=<2** ! %   

    3467'8)42 /8<&+78'(1+'3*#+1+5.43+465

 @2D3%@7<13&C>3@B* ! %   

#% )/8<;+78)' 4:97  @2D3*/<1=CD3@*(  %    34:9734;)' 4938+6 '8.  C@@/@2'B'C7B3

*/<1=CD3@*, " % 

  

  )4938+65'8.)42 %+)/2'+8;46073)  */</:;/<D3*71B=@7/*.  %          :+)/2')42 $3/7+6:+42293/)'8/437465 (3@;7</:D3'C7B3 */<1=CD3@* %   

    93/7+6:+)42 '1/&/6+1+77'3'*'3)  =;;3@13@BC@</0G*# % 

  

 *'1/;/6+1+77)42 42293/)'8/437  C@@/@2'B'C7B3 */<1=CD3@*. & %       '())42293/)'8/437)42 ':/-'8'42293/)'8/4378*

@/<D7::3'B'C7B3 */<1=CD3@* ' %  

#% 3':/-'8')' '3#+).#+1+)423)  #=@:/<2D3'C7B3 C@</0G*  %    

)'38+).8+1+)42)'

.6/7 '6+88$ 434:'3 /'7D713>@3A723<BA/:3A <B3@<3BB3:3>6=<3B3:3D7A7=<2/B/1=<<31B7D7BGB63@<3B /<2>@=831B;/</53;3<B A3@D713A6=AB32%,/<2D=713A3@D713A1=:=1/B7=<A3@D713A

7BG=4%@7<13&C>3@B 

 

433' !4(+687431=>@3A723<B/<216734:35/:=4I13@ 49- 412'31=>@3A723<B/<2$

&3A723<B7/:0@=/20/<21/0:3(*7<B3@<3BB3:3>6=<3

%@7D/B3:G63:2



 

':/* '657<B3@7;$/<2$

(',%( #/A2/?%

 

(',*"



 

(',*)''

 

%@7D/B3:G63:2





%@7D/B3:G63:2





;+3 /1(+68>@3A723<B

3A9B=>B/0:3B/<2;=07:3D=713=D3@7<B3@<3B>@=B=1=:*=% A=4BE/@3>@=2C1BA/<2A=:CB7=<A7<1:C27<5'%0/A32 A=4B>6=<3AA3@D3@/>>:71/B7=<A/<2IF32;=07:31=<D3@53<13 A=:CB7=<A (6@33A35;3<BAD723=/<20@=/20/<2A=:CB7=<AD723=1=<B3<B 23:7D3@G/<2AB=@/53/<2B3:3;/B71A:=<527AB/<13 B@/<A;7AA7=<=41=;>CB3@7H327<4=@;/B7=< <B3@<3B2757B/:>6=<34/FB=3;/7:27/:C>E306=AB7<5 2=;/7<@357AB@/B7=<;/</532(A3@D713A1=:=1/B7=<6=AB32 />>:71/B7=<AB=0CA7<3AA1CAB=;3@A@3A3::3@A3@D713A +7@3:3AA7<4@/AB@C1BC@37<<=D/B=@>@=D727<5/4@=<B6/C:<3BE=@9 B6/B7A@3/2G/<21/<AC>>=@B  /<2<3BE=@9A A7;C:B/<3=CA:G '>317/:7H3A7<0@=/20/<21=<<31B7D7BGB=@C@/:/<2@3;=B3/@3/A =4B6@=C567BA:/@53IF32E7@3:3AA<3BE=@9:A==443@A'! 1/0:3/<2I0@3=>B711=<<31B7=<AB6@=C56=CBC@0/< 3<D7@=<;3<BA7</<2:03@B/ *=713/<22/B/<3BE=@97<5

#%

#%

 

"8+:+ !'/3(48.>@3A723<B '< "86+1+',,3F31CB7D3 D713>@3A723<B

(3:31=;7<AB/::A>317/:7AB23A75<B316<71/:@7557<53:31B@71/: /<21/0:7<5

/<(316(3:31=; <1





"92/8 92'6>@3A723<B/<2$ 4.3 '33'$ /).'+1 ").41=16/7@;/< '66+3 /).4117>@3A723<B 1(+68 ++$ ".';3 "8'51+84316734B316<=:=5G =4I13@ 4( 11+3$ .6/7 11+3>@3A723<B

%C0:7A6327<  30@C/@G 

'=C@13A<B3@D73EAE7B6/0=D31=;>/<73A/<2  @3A3/@16$B63@I@;A ;/G6/D3@/<9320CB272<=B>@=D7237<4=@;/B7=<0G23/2:7<3 #%#=B>@=D7232 

I5C@3  A=4 313;03@ =4>@3D7=CAG3/@

00_BC Tech 2019_64p_2.indd 49

(',&& #-'&

&$ $$  !&'# ;/93A3D3@G/BB3;>BB=>C0:7A6/11C@/B37<4=@;/B7=<7<B63!7AB0CB /11C@/1G1/<<=B035C/@/<B332&3A3/@16320G/@@73'16;72B $%$ '!

2019-06-10 2:35 PM


50 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

BIGGEST LIFE SCIENCES COMPANIES IN B.C. RANKED BYâ&#x20AC;&#x201A;|â&#x20AC;&#x201A;Number of R&D employees in 2018

$! 

                  

%#&$.

%&"%"-*) +(

5'.%'--'%*/0-0)+'4/%  $>,>498$> ',8.9?@0< '  "      45'.%'--%0. ":.'803,4/%   >3@0($?4>0  ',8.9?@0< '  ' "         ;:.'803,4%0.

3$6564 +01*#3.#031 6086C98"5C$?4>0 ?<8,-C '   "          #3$6564$+0%0. #3&+6./%  6086C98"5C$?4>0

 ?<8,-C '  "          ,#3&+6.%0.

$'--'3# +0-0)+%4/%  *?598$> ',8.9?@0< ' * "  

  " #$%'--'3#%0. '/0/*#3.#%'65+%#-4/%

4679<0(,C$?4>0  ?<8,-C '  ( "    

       9'/0/1*#3.#%0.

.)'/ 3+5+4*0-6.$+#/% 8>0<:<4=0$> ?<8,-C ' ' "           #.)'/%#

 11-+'& +0-0)+%#-#5'3+#-4/%

'45482(,C&84> #4.3798/ ' ' 

"          #$.)00&%0.

--'/ #7'4:<0=4/08>,8/! "<9@4/0=.066.?6>?<070/4,.066=0:,<,>498>996=,8/,..0==9<C<0,208>= "<4@,>06C306/ 19<.066-49692C<0=0,<.348.6?/482=>07.066-49692C<02080<,>4@0 70/4.480477?89692C,8/.,8.0<<0=0,<.3

-+ '*3#/+:<0=4/08>,8/! 8>4-9/C,8/:<9>048>30<,:0?>4.=/0@069:708>A4>3,:<47,<C19.?=48 %$) *$+* 98.9692C

3530/ +0'4'#3%*/%

  9<>3<,=0<(,C ?<8,-C '   "           #3530/$+0%0. 633#3&*#3.#%'65+%#-4  ,=>482=$>($?4>0 ',8.9?@0< ' 

"      " $633#3&1*#3.#%0.

41'%5 +04:45'.45&  >3@0( ',8.9?@0< ' " " "      " #41'%5$+04:45'.4%0. '07#4%/% 

,C.<0=>(,C$?4>0   #4.3798/ ' '  "         /'07#4%%0. '/0.''#/#&#

'45482(,C&84> #4.3798/ ' '  "     " )'/0.'.'%# 6 +0-0)+%4/%  (,C-?<80<$?4>0   ?<8,-C '  ) "         

26$+0-0)+%4%0. '/ :4

 &84@0<=4>C6@/$?4>0  ',8.9?@0< ' %+

"      " )'/9:4%0.

-'%504*'3#1'65+%4  06=98(,C ?<8,-C '  

"          #-'%504%0. +0:5+%#-#$03#503+'4/% 

9770<.0"5C$?4>0 #4.3798/ ' ' ) "           $+0-:5+%#-%0. +0-69'4'#3%*5&  "9A066$>$?4>0  ',8.9?@0< '  "        

 035*016-4'%0. +/'964 +0+/(03.#5+%4031 

=3$>$?4>0 ',8.9?@0< ' " %

"          ,+/'964%# '-#3*#3.#%'65+%#-4/% <9,/A,C($?4>0  ',8.9?@0< ' +

"      " &'-.#31*#3.#%0.

#3, 633#::<0=4/08>,8/ ! #7+& #45+/)4! 06) 0'35;'/!

,$'( &

' %*$

%() "%"".  

%() %   ()  



   

 

 



  

   







"  

   

 



  

  

 

"<4@,>06C306/



 









" "





,=/,;&$ 4=.9@0<482/0@069:482,8/.9770<.4,64D482,.?<019<:,>408>= =?110<4821<97.3<984.30:,>4>4=4810.>498A4>3,:4:06480.98=4=>48291 7?6>4:60/<?2.,8/4/,>0=A4>3.97:60708>,<C70.3,84=7=91,.>498 ,</49@,=.?6,< "<4@,>06C306/

#3- #/4'/:<0=4/08>,8/! %30<,:0?>4.,8>4-9/C/4=.9@0<C +.0/ +.450/'!

08><,680<@9?==C=>070:460:=C:,48

,=/,;) 



 "

0*/ '-#/':/4<0.>9<91 <0=0,<.3

8>4-9/C>30<,:0?>4.=19<>30><0,>708>91.,8.0<48G,77,>498,8/ 4810.>49?=/4=0,=0=

,=/,;



 

'5'3 +! +4# !06/)! "<9/?.>==:,80@0<C>34821<97#$"#20800/4>482>996=,8/@4<,6 +7+#/ #0@4.0:<0=4/08> @0.>9<=@4<?=0=>9>30A9<6/E=6,<20=>.9660.>49891?84;?0.0666480=,8/ .9<:9<,>0/0@069:708> >3079=>,/@,8.0/:96C70<,=0.3,48<0,.>498,8/80B>2080<,>498 =0;?08.482>0.38969240=,8/=0<@4.0= +-)6/ '.+3@4.0:<0=4/08> 8>4208,8/,8>4-9/C7,8?1,.>?<0<

"<4@,>06C306/



  





 

"<4@,>06C306/



" "





 "

#:*#/ 0#:'3+!

<?2/0@069:708>7,8?1,.>?<482,8/19<7?6,>498

"<4@,>06C306/



 "



"

 "

#.'3 0*#.'&:<0=4/08> ,8/! +.0/ ':'3.3401 >0.389692C91F.0< 3'& 0-'/:<0=4/08>,8/!

0@069:=:<9:<40>,<C -49:<48>482,8/3?7,8.066.?6>?<0>0.389692C

"<4@,>06C306/



" "

 

 

0@069:=7,8?1,.>?<0=,8/7,<50>=4889@,>4@0@,=.?6,</0@4.0= %$) ' 9110<482:0<4.,</4,6>4==?0:<9.0==482@,=.?6,<:<9/?.>/0@069:708>,8/ ,=/,; ' /0=428,8/7,8?1,.>?<482=96?>498=>948/?=><C:,<>80<= 960.?6,<:,>39692C,8/7960.?6,</4,289=>4.= "<4@,>06C306/



 

" "





 

 

 

0*#..#& #$'4*! #- 6//!

%<0,>708>91.,8.0<,8/477?80<06,>0//4=0,=0==?.3,=<938= /4=0,=0,8/?6.0<,>4@0.964>4=

"<4@,>06C306/



 

 

 

#3- 3+/)-'! #35+/ #8'4.3401=.408>4F.91F.0< #3, '-('3.3,4< 3/'45 %#%*'3/:<0=4/08> ,8/!

97:<0308=4@0:<0.4=498:<0=.<4-482=91>A,<0>3,>47:<9@0=70/4.,>498 "<4@,>06C306/ =,10>C48.<0,=0=/<?201F.,.C,8/<0/?.0=30,6>3.,<0.9=>=



" 

 

 "

"<4@,>06C306/



" "

 

 

0$'35 #%,+'.3,4<7,8 +7-''/ '4-'.'4!

'>0=>54>

"<4@,>06C306/







 

'7+/ 53#/)':<0=4/08>,8/ !

0@069:=,8/7,<50>=6423>,..060<,>0/9<>39/98>4.=>0.389692C,8/ :<9/?.>=19<?=0489<>39/98>4.=47:6,8>9692C,8/9>30</08>4=><C 7,<50>= "<9>0974.=,8/-494819<7,>4.=:<9/?.>=,8/=0<@4.0=

"<4@,>06C306/



"

 



"<4@,>06C306/



" 





 

,=/,;"









5'7'/ '-'%*:<0=4/08>,8/ .3401=.408>4F.91F.0<

0?<9=.408.0

#++& "#33#$+#/:<0=4/08>,8/ ,8.0<>30<,:0?>4.= !

$9?<.0=8>0<@40A=A4>3<0:<0=08>,>4@0=91>30,-9@0F<7=,8/  <0=0,<.3!>30<F<7=7,C3,@0<,850/-?> /4/89><0=:98/>94819<7,>498<0;?0=>=-C/0,/6480 " 9>:<9@4/0/

00_BC Tech 2019_64p_2.indd 50

'(%'('

*( $(( $$%*+' 7,50=0@0<C,>>07:>>9:?-64=3,..?<,>04819<7,>49848>304=>-?> ,..?<,.C.,889>-02?,<,8>00/#0=0,<.30/-C88,4.D7,8=5, " ()(  +%#

2019-06-10 2:35 PM


| 51

INDUSTRY ASSOCIATIONS

Accelerate Okanagan Technology Association (AOTA)

460 Doyle Ave Suite 201 Kelowna, BC V1Y OC2 t: 250-870-9028 e: contact@accelerateokanagan.com accelerateokanagan.com

BC Tech Association

Innovate BC

LifeSciences British Columbia

887 Great Northern Way Suite 101 Vancouver, BC V5T 4T5 t: 604-683-6159 e: info@wearebctech.com wearebctech.com

1188 Georgia St W Suite 900 Vancouver, BC V6E 4A2 t: 604-683-2724 e: info@innovatebc.ca innovatebc.ca

Wendy Hurlburt, President 1285 Broadway W Suite 580 Vancouver, BC V6H 3X8 t: 604-669-9909 f: 604-669-9912 e: info@lifesciencesbc.ca lifesciencesbc.ca

BCNET

999 Canada Pl Suite 404 Vancouver, BC V6C 3E2 t: 604-652-3324 aiacpacific.ca

555 Seymour St Suite 750 Vancouver, BC V6B 3H6 t: 604-822-1348 f: 604-822-9887 e: info@bc.net bc.net

Applied Science Technologists & Technicians of BC (ASTTBC)

Canadian Hydrogen and Fuel Cell Association

10767 148 St Surrey , BC V3R 0S4 t: 604-585-2788 f: 604-585-2790 e: techinfo@asttbc.org asttbc.org

475 Georgia St W Suite 660 Vancouver, BC V6B 4M9 t: 604-283-1040 f: 604-683-6345 e: info@chfca.ca chfca.ca

BC Bioenergy Network

DigiBC -The Interactive & Digital Media Association of BC

Aerospace Industries Association of Canada - AIAC Pacific

666 Burrard St Suite 500 Vancouver, BC V6C 3P6 t: 604-889-4549 bcbioenergy.ca BC Environment Industry Association (BCEIA)

Kate MacDonald, Membership Administrator 1130 Pender St W Suite 305 Vancouver, BC V6E 4A4 t: 604-683-2751 f: 604-677-5960 e: info@bceia.com bceia.com

1311 Cypress St Vancouver, BC V6J 3L1 t: 604-602-5237 e: exec@digibc.org digibc.org Engineers and Geoscientists British Columbia

4010 Regent St Suite 200 Burnaby, BC V5C 6N2 t: 604-430-8035 f: 604-430-8085 e: info@egbc.ca egbc.ca

BC Sustainable Energy Association

HR Tech Group

1631 Oakland Ave Victoria, BC V8T 2L3 t: 604-332-0015 e: info@bcsea.org bcsea.org

Stephanie Hollingshead, Executive Director PO Box 38024 Vancouver, BC V5Z 4L9 t: 604-874-2653 f: 604-874-2654 hrtechgroup.com

Innovation Central Society

1299 3rd Ave Prince George, BC V2L 3E6 t: 236-423-0113 e: office@iinovationcentral.ca innovationcentral.ca Innovation Island Technology Association (IITA)

327 Prideaux St Suite 13 Nanaimo, BC V9R 2N4 t: 250-753-8324 e: info@innovationisland.ca innovationisland.ca Kamloops Innovation Centre Society

348 Tranquille Rd Kamloops, BC V2B 3G6 t: 250-434-0200 e: info@kamloopsinnovation.ca kamloopsinnovation.ca Kootenay Association for Science and Technology (KAST)

PO Box 124 Trail, BC V1R 4L3 t: 250-362-5052 e: info@kast.com kast.com Kootenay Rockies Innovation Council (KRIC)

Technical Safety BC

2889 12th Ave E Suite 600 Vancouver, BC V5M 4T5 t: 866-566-7233 e: contact@technicalsafetybc.ca technicalsafetybc.ca T-Net British Columbia

1207 Pacific Blvd Suite 300 Vancouver, BC V6Z 2R6 t: 604-899-4146 bctechnology.com Victoria Innovation, Advanced Technology & Entrepreneurship Council (VIATeC)

Dan Gunn, CEO 777 Fort St Victoria, BC V8W 1G0 t: 250-483-3214 e: info@viatec.ca viatec.ca VR/AR Association Vancouver Chapter

2758 8th Ave W Vancouver, BC V6K 3Z1 t: 604-880-8983 thevrara.com

PO Box 453 Stn Main Cranbrook, BC V1C 4H0 t: 250-426-6388 f: 250-489-1886 e: info@kric.ca kric.ca

WE’RE PROUD TO BE MADE IN BC -l;70‹mvb]_|v|o|_;ƑƏƐѶ bm|;1_ƑƔƏķ-Ѵbv|o=|_;‰ouѴ7Ľv|orCm|;1_ v|-u|†rvķuo]u;vv-bv-m-7-Ľv=-v|;v|]uo‰bm]Cm-m1b-Ѵ|;1_moѴo]‹Ѵ;m7;u=o1†v;7om changing the way pay cheque to pay cheque Canadians access and build credit.

progressa.io

00_BC Tech 2019_64p_2.indd 51

2019-06-10 2:35 PM


52 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

TECHNOLOGY DIRECTORY CATEGORY INDEX AEROSPACE 100 Maintenance ..........................................................52 150 Manufacturing.......................................................52 300 Special Processes (heat treating, coatings, etc) .........................................................52 350 Training.....................................................................52 310 Other .........................................................................52

BIOTECHNOLOGY – LIFE SCIENCES 1030 1040 1050 1060 1000

Bioproducts............................................................52 Medical Devices & Diagnostics ....................52 Pharmaceuticals ..................................................52 Research & Scientific Services.....................53 Other .........................................................................53

ENERGY TECHNOLOGIES 2005 2010 2020 2030 2040 2070

Alternative Energy ..............................................53 Alternative Engine Fuels..................................53 Biofuels, Biomass & Waste-to-Energy ....53 Fuel Cells .................................................................53 Nanotechnology ..................................................53 Power & Energy Efficiency Technologies ......................................................................................53 2000 Other .........................................................................53

INFORMATION & COMMUNICATIONS TECHNOLOGY 3010 Electronics ..............................................................54 3015 Engineering, Analytical & Design Services ......................................................................................54 3020 Hardware .................................................................54 3022 Internet Providers ...............................................54 3025 Internet Services .................................................54 3030 Software & Services ..........................................54 3040 Telecommunications .........................................56 3050 Video Conferencing/Webcasting ...............57 3000 Other .........................................................................57

NEW MEDIA 4010 4020 4030 4040 4050 4060

Animation/Digital Film .....................................57 E-learning ................................................................57 Interactive Design & Communications ....57 Interactive Entertainment/Games .............57 Software ..................................................................58 Web Development/Marketing/Commerce ......................................................................................58 4000 Other .........................................................................58

SERVICES 7010 7013 7015 7020 7030 7050 7075 7000

Accounting..............................................................58 Audiovisual..............................................................58 Consultants ............................................................59 Financial Services................................................59 Legal Services .......................................................59 Professional Services ....................................... 60 Recruiting ............................................................... 60 Other ........................................................................ 60

SUSTAINABLE TECHNOLOGIES 5010 Air Pollution Abatement Equipment, Noise/Vibration Equipment.......................... 60 5030 Environmental Monitoring & Instrumentation .................................................. 60 5040 Green Building & Sustainable Planning Services ................................................................... 60 5050 Hazardous/Solid Waste Management .... 60 5060 Information Systems for Sustainable Resource Management ................................... 60 5090 Site Remediation ................................................ 60 5100 Water & Waste-Water Treatment: Water Conservation Equipment ............................... 60 5000 Other ......................................................................... 61

WIRELESS 6010 6020 6030 6000

Components, Infrastructure & Devices ... 61 Enabling Software .............................................. 61 Wireless Applications........................................ 61 Other ......................................................................... 61

00_BC Tech 2019_64p_2.indd 52

A comprehensive listing of technology companies in British Columbia, organized by industry sector. How companies get listed in BC Tech BC Tech is the most complete and comprehensive guide to the province’s high-tech industries, and we at Business in Vancouver pride ourselves on providing the most up-to-date information available at press time. We gather company information by searching online resources and business publications, making initial contact by email and verifying specific company information by phone. In all, BIV makes a minimum of three attempts to verify each company’s information.

AEROSPACE MAINTENANCE

100

Testforce Systems Inc 34255 Larch St, Abbotsford V2S 2P7 Chris Sztuhar ... p: 604-557-0715 f: 403-202-2016 e: chris@testforce.com testforce.com Vibratec Management Inc 1750 Hartley Ave Suite 101, Coquitlam V3K 7A1 Jeff Boulter ..... p: 604-522-8126 f: 604-522-3283 e: info@vibratec.com vibratec.com MANUFACTURING

150

Metal Action Machining Ltd 12448 82 Ave Suite 207, Surrey V3W 3E9 James Hargrove .........................p: 604-543-7378 f: 604-592-7372 e: jimh@metalactionmachining.com metalactionmachining.com Stallion Manufacturing Inc 1125 15th St W, North Vancouver V7P 1M7 Noorez Devraj.............................p: 604-990-0988 e: sales@stallionmfg.com stallionmfg.com SPECIAL PROCESSES (HEAT TREATING, COATINGS, ETC)

300

Faradyne System Group Inc 4471 No 6 Rd Suite 150, Richmond V6V 1P8 Reggie Ho ........ p: 604-278-1887 f: 604-278-5313 e: inquiry@faradyne.com faradyne.com TRAINING

350

BCIT Aerospace Technology Campus 3800 Cessna Dr, Richmond V7B 0A1 ........p: 604-419-3777 bcit.ca/aerospace OTHER

310

BC Tech Association 887 Great Northern Way Suite 101, Vancouver V5T 4T5 ............ p: 604-683-6159 f: 604-683-3879 e: info@wearebctech.com wearebctech.com Pro Wings Aviation Ltd 8678 Sunburst Pl, Chilliwack V2R 3J1 R Grace Rouch ............................p: 604-795-1221 e: rouch@prowings.bc.ca prowings.bc.ca

BIOTECHNOLOGY – LIFE SCIENCES BIOPRODUCTS

1030

Catalyst Agri-Innovations Society 82 Gladwin Rd, Abbotsford V2T 5Y2 Christopher Bush ........................p: 604-999-2653 e: chris@aces-bc.ca aces-bc.ca

If we do not receive written or verbal confirmation that the data is correct, then we have no choice but to delete that company from the database. If your company is not listed in the directory, and the services that you provide fit into one of the categories listed in the category index, you can either call BIV at 604-688-2398 and ask for Anna Liczmanska or email the pertinent information to annamae@biv.com. To ensure your listing, please contact a BIV Magazines representative and pay the guarantee of $35.

good natured Products Inc 470 Granville St Suite 814, Vancouver V6C 1V5 Paul Antoniadis ..........................p: 604-566-8466 e: info@goodnatured.ca goodnatured.ca MEDICAL DEVICES & DIAGNOSTICS

1040

Artron BioResearch Inc 3938 North Fraser Way, Burnaby V5J 5H6 ........... p: 604-415-9757 f: 604-415-9795 e: info@artronbio.com artronbio.com Biolux Research Ltd 825 Powell St Suite 220, Vancouver V6A 1H7 ........... p: 604-669-0674 f: 604-608-5558 e: info@bioluxresearch.com orthopulse.com

StarFish Medical 455 Boleskine Rd, Victoria V8Z 1E7 ............ p: 250-388-3537 f: 250-483-1975 e: info@starfishmedical.com starfishmedical.com Vigil Health Solutions Inc 4464 Markham St Suite 2102, Victoria V8Z 7X8 Troy Griffiths .... p: 250-383-6900 f: 250-383-6999 e: information@vigil.com vigil.com PHARMACEUTICALS

1050

BioLytical Laboratories Inc 13351 Commerce Pky Suite 1108, Richmond V6V 2X7 ........... p: 604-204-6784 f: 604-244-8399 e: info@biolytical.com biolytical.com CTF MEG International Services LP 68 Schooner St Unit 7, Coquitlam V3K 7B1 Nicholas Adam Peatfield............p: 604-540-6044 f: 604-540-6099 e: sales@ctfmeg.com ctf.com Datrend Systems Inc 4020 Viking Way Suite 130, Richmond V6V 2L4 Jon Strong ....... p: 604-291-7747 f: 604-294-2355 e: sales@datrend.com datrend.com GenomeMe Canada 3691 Viking Way Unit 1, Richmond V6V 2J6.......................................p: 604-244-9962 e: info@genomeme.ca genomeme.ca Kardium Inc 8518 Glenlyon Pky Suite 155, Burnaby V5J 0B6............ p: 604-248-8891 f: 604-304-3478 e: doug.goertzen@kardium.com kardium.com LivaNova Canada Corp 5005 North Fraser Way, Burnaby V5J 5M1 .......... p: 604-412-5650 f: 604-412-5690 livanova.com Mindful Garden Digital Health Inc 191 Alexander St, Vancouver V6A 1B8 ......................................p: 604-669-2296 e: mross@mindfulgarden.com mindfulgarden.com

AbCellera 2215 Yukon St, Vancouver V5Y 0A1 ......................................p: 604-559-9005 e: info@abcellera.com abcellera.com Amgen British Columbia Inc 7990 Enterprise St, Burnaby V5A 1V7 ........... p: 604-415-1800 f: 604-676-8349 e: natashab@amgen.com amgen.ca Alectos Therapeutics 8999 Nelson Way, Burnaby V5A 4B5 ........... p: 604-628-7129 f: 604-628-0137 e: info@alectos.com alectos.com Arbutus Biopharma Corp 8900 Glenlyon Pky Suite 100, Burnaby V5J 5J8 ............ p: 604-419-3200 f: 604-419-3201 arbutusbio.com Burrard Pharmaceuticals 1021 Hastings St W Suite 900, Vancouver V6E 0C3.......................................p: 604-281-2762 e: info@burrardpharma.com burrardpharma.com DelMar Pharmaceuticals Inc 999 Broadway W Suite 720, Vancouver V5Z 1K5.......p: 604-629-5989 delmarpharma.com

Neovasc Inc 13562 Maycrest Way Suite 5138, Richmond V6V 2J7............ p: 604-270-4344 f: 604-270-4384 e: info@neovasc.com neovasc.com

Novelogics Biotechnology Inc 550 Burrard St Suite 2900, Vancouver V6C 0A3 ......................................p: 604-723-7774 e: info@novelogics.com novelogics.com

Peerforma 7434 Fraser Park Dr, Burnaby V5J 5B9 Hadi Mansoor.............................p: 888-875-3039 e: info@peerforma.com peerforma.com

Qu Biologics Inc 4475 Wayburne Dr Suite 305, Burnaby V5G 4X4 ........... p: 604-734-1450 f: 604-676-2235 e: info@qubiologics.com qubiologics.com

ReFlex Wireless Inc 1055 Hastings St W Suite 300, Vancouver V6E 2E9 Andy Tsai ....................................p: 778-800-0841 e: info@reflexwireless.com reflexwireless.com

RepliCel Life Sciences 570 Granville St Suite 900, Vancouver V6C 3P1.......................................p: 604-248-8730 e: info@replicel.com replicel.com

2019-06-10 2:35 PM


| 53

Biotechnology – life sciences

Energy technologies

WEX Pharmaceuticals Inc 1100 Melville St Suite 1150, Vancouver V6E 4A6 Walter Korz ..... p: 604-676-7893 f: 604-683-8868 e: walterk@wexpharma.com wexpharma.com

Chinook Power Corp 4388 Prospect Rd, North Vancouver V7N 3L7 Stephen Cheeseman ..................p: 604-924-4494 chinookpower.com

Xenon Pharmaceuticals Inc 3650 Gilmore Way Suite 200, Burnaby V5G 4W8.......... p: 604-484-3300 f: 604-484-3450 e: info@xenon-pharma.com xenon-pharma.com

Corvus Energy Inc 13155 Delf Pl Suite 220, Richmond V6V 2A2 ........... p: 604-227-0280 f: 604-227-0281 e: info@corvusenergy.com corvusenergy.com

Zymeworks Inc 1385 8th Ave W Suite 540, Vancouver V6H 3V9 ........... p: 604-678-1388 f: 604-737-7077 e: info@zymeworks.com zymeworks.com

Delta-Q Technologies Corp 3755 Willingdon Ave, Burnaby V5G 3H3 ........... p: 604-327-8244 f: 604-327-8246 e: info@delta-q.com delta-q.com

RESEARCH & SCIENTIFIC SERVICES

1060

ABM Applied Biological Materials Inc 3671 Viking Way Unit 1, Richmond V6V 2J5............ p: 604-247-2416 f: 604-247-2414 e: info@abmgood.com abmgood.com BRI Biopharmaceutical Research Inc 8898 Heather St Suite 101, Vancouver V6P 3S8 Clara Faan ....... p: 604-432-9237 f: 604-432-9239 e: info@bripharm.com bripharm.com Genome BC 575 8th Ave W Suite 400, Vancouver V5Z 0C4............ p: 604-738-8072 f: 604-738-8597 genomebc.ca Infogenetica Solutions Inc Box 64743 Sunwood Square PO, Coquitlam V3B 0H1 Alma Barranco-Mendoza ...........p: 604-288-7051 e: info@infogenetica.com infogenetica.com Kinexus Bioinformatics Corp 8755 Ash St Suite 1, Vancouver V6P 6T3 ............ p: 604-323-2547 f: 604-323-2548 e: info@kinexus.ca kinexus.ca LifeLabs Medical Laboratory Services 3680 Gilmore Way, Burnaby V5G 4V8 ......................................p: 604-431-5005 e: contactus-BC@lifelabs.com lifelabs.com Stemcell Technologies Inc 1618 Station St, Vancouver V6A 1B6 ........... p: 604-877-0713 f: 800-567-2899 e: info@stemcell.com stemcell.com OTHER

1000

Aspect Biosystems Ltd 1781 75th Ave W, Vancouver V6P 6P2 .......................................p: 604-263-0502 e: info@aspectbiosystems.com aspectbiosystems.com BCIT School of Health Sciences Burnaby Campus, 3700 Willingdon Ave, Burnaby V5G 3H2 .............. p: 604-434-5734 bcit.ca/health BC Tech Association 887 Great Northern Way Suite 101, Vancouver V5T 4T5 ............ p: 604-683-6159 f: 604-683-3879 e: info@wearebctech.com wearebctech.com Xenon Pharmaceuticals Inc 3650 Gilmore Way Suite 200, Burnaby V5G 4W8.......... p: 604-484-3300 f: 604-484-3450 e: info@xenon-pharma.com xenon-pharma.com

ENERGY TECHNOLOGIES ALTERNATIVE ENERGY

2005

Analytic Systems Ware (1993) Ltd 8128 River Way, Delta V4G IK5 ............ p: 604-946-9981 f: 604-946-9983 e: sales@analyticsystems.com analyticsystems.com

00_BC Tech 2019_64p_2.indd 53

Freethem Generation Inc 7131 Stride Ave Suite 305, Burnaby V3N 0E3 Claes Fredriksson .......................p: 866-882-0088 e: claes@freethem.com freethem.com General Fusion Inc 3680 Bonneville Pl Suite 106, Burnaby V3N 4T5 ......................................p: 604-439-3003 e: info@generalfusion.com generalfusion.com Greenlight Innovation Corp 3430 Brighton Ave Suite 104A , Burnaby V5A 3H4 ........... p: 604-676-4012 f: 604-676-4111 e: info@greenlightinnovation.com greenlightinnovation.com

BIOFUELS, BIOMASS & WASTE-TO-ENERGY

2020

Greenlane Biogas North America Ltd 3605 Gilmore Way Suite 110, Burnaby V5G 4X5 ......................................p: 604-259-0343 e: salesna@greenlanebiogas.com greenlanebiogas.com Nexterra Systems Corp 650 Georgia St W Suite 1218 PO Box 11582, Vancouver V6B 4N8 ........... p: 604-637-2501 f: 604-637-2506 e: sales@nexterra.ca nexterra.ca Quadrogen Power Systems Inc 8288 North Fraser Way Unit 110, Burnaby V3N 0E9 Alakh Prasad ... p: 604-221-7170 f: 604-221-3001 e: sales@quadrogen.com quadrogen.com Richway EnvirTech Ltd 12520 Horseshoe Way Suite 118, Richmond V7A 5K3 Leonard Li ........ p: 604-275-2201 f: 604-275-2203 e: marketing@richway.ca richway.ca FUEL CELLS

2030

Hakai Energy Solutions Inc PO Box 1236, Cumberland V0R 1S0 ......................................p: 888-604-3128 e: info@hakaienergysolutions.com hakaienergysolutions.com Innergex Renewable Energy Inc 1185 Georgia St W Suite 900, Vancouver V6E 4E6 ............ p: 604-633-9990 f: 604-633-9991 e: info@innergex.com innergex.com

power to change the world®

PowerPal Micro-Hydroelectric Generators 73 Gorge Rd W Suite 510, Victoria V9A 1L9 David Seymour p: 250-361-4348 f: 250-360-9012 e: info@powerpal.com powerpal.com

Loop Energy Inc 2880 Production Way, Burnaby V5A 4T6 Ben Nyland ...... p: 604-222-3400 f: 604-227-4365 e: info@loopenergy.com loopenergy.com

Schneider Electric Canada 3700 Gilmore Way, Burnaby V5G 4M1 .....................................p: 604-422-8595 e: canadian.pss@schneider-electric.com schneider-electric.ca/sesolar.com

MGX Renewables Inc 8765 Ash St Unit 1, Vancouver V6P 6T3 .......................................p: 604-558-1406 e: zes@zincnyx.com mgxrenewables.com

Wellons Canada 19087 96 Ave, Surrey V4N 3P2 ........... p: 604-881-3229 f: 604-888-2959 e: pat.thornton@wellons.ca wellons.ca ALTERNATIVE ENGINE FUELS

2010

ECO Fuel Systems Inc 20043 92A Ave Suite 2, Langley V1M 3A5 Bruce Styles .... p: 604-888-8384 f: 604-888-6607 e: info@ecofuel.com ecofuel.com Westport Fuel Systems Inc 1750 75th Ave W Suite 101, Vancouver V6P 6G2 ........... p: 604-718-2000 f: 604-718-2001 e: info@wfsinc.com wfsinc.com

Legend Power Systems Inc 1480 Frances St, Vancouver V5L 1Y9 Michael Davis . p: 866-772-8797 f: 604-420-1533 e: info@legendpower.com legendpower.com Plan B Energy Storage (PBES) 8286 Sherbrooke St, Vancouver V5X 4R6 ......................................p: 604-425-1053 e: info@pbes.com pbes.com Rainforest Automation Inc 4225 Kincaid St, Burnaby V5G 4P5 Bill Richardson ...........................p: 604-630-4287 e: bill.richardson@rainforestautomation.com rainforestautomation.com Tantalus Systems Corp 3555 Gilmore Way Suite 200, Burnaby V5G 0B3 Jacquie Hudson..........................p: 604-299-0458 f: 604-451-4111 e: tantalusInfo@tantalus.com tantalus.com OTHER

Ballard Power Systems Inc 9000 Glenlyon Pky, Burnaby V5J 5J8 ............ p: 604-454-0900 f: 604-412-4700 e: marketing@ballard.com ballard.com

VREC - Vancouver Renewable Energy 130 Broadway W, Vancouver V5Y 1P3 Rob Baxter ....... p: 778-869-8333 f: 604-909-1988 e: main@vrec.ca vrec.ca

Enbala Power Networks Inc 930 1st St W Suite 211, North Vancouver V7P 3N4 ......................................p: 604-929-6006 e: sales@enbala.com enbala.com

2000

BCIT School of Energy Burnaby Campus, 3700 Willingdon Ave, Burnaby V5G 3H2 ..............p: 604-434-5734 bcit.ca/energy

Inventys Inc 8528 Glenlyon Pky Unit 143, Burnaby V5J 0B6............ p: 604-456-0504 f: 604-435-7670 e: info@inventysinc.com inventysinc.com

Testforce Systems Inc 34255 Larch St, Abbotsford V2S 2P7 Chris Sztuhar ... p: 604-557-0715 f: 403-202-2016 e: chris@testforce.com testforce.com

Delta-Q Technologies Corp 3755 Willingdon Ave, Burnaby V5G 3H3 ........... p: 604-327-8244 f: 604-327-8246 e: info@delta-q.com delta-q.com

Palcan Energy Corp 4250 Wesbrook Mall Suite 1152, Vancouver V6T 1W5 .......... p: 604-288-7822 f: 604-288-7878 e: hannah.han@palcan.com.cn palcan.com NANOTECHNOLOGY

2040

Nanotech Security Corp 3292 Production Way Suite 505, Burnaby V5A 4R4 ........... p: 604-678-5775 f: 604-678-5780 e: info@nanosecurity.ca nanosecurity.ca POWER & ENERGY EFFICIENCY TECHNOLOGIES

2070

Analytic Systems Ware (1993) Ltd 8128 River Way, Delta V4G IK5 ............ p: 604-946-9981 f: 604-946-9983 e: sales@analyticsystems.com analyticsystems.com Coda Research Corp 195 21st St Suite 1201, West Vancouver V7V 4A4 Johan Dooyeweerd ....................p: 604-986-2004 e: sales@codaresearch.com codaresearch.com

BC Tech Association 887 Great Northern Way Suite 101, Vancouver V5T 4T5 ............ p: 604-683-6159 f: 604-683-3879 e: info@wearebctech.com wearebctech.com CBVL Robotics Inc 2130 Hartley Ave, Coquitlam V3K 6W5 Ed Tycholaz ...... p: 604-522-3761 f: 604-522-8167 e: info@cbvl.com cbvl.com

Clevest 13700 International Pl, Richmond V6V 2X8 Thomas Ligocki...........................p: 604-214-9700 e: info@clevest.com clevest.com Etalim Inc 62 8th Ave W Suite 400, Vancouver V5Y 1M7 .....................................p: 604-566-3487 e: info@etalim.com etalim.com Motion Metrics International Corp 2389 Health Sciences Mall Suite 101, Vancouver V6T 1Z3 Joseph Tsang... p: 604-822-5842 f: 604-677-5191 e: info@motionmetrics.com motionmetrics.com Samlex America 4268 Lozells Ave Suite 103, Burnaby V5A 0C6 Christine Ford .. p: 604-525-3836 f: 604-525-5221 e: christine.ford@samlexamerica.com samlexamerica.com

2019-06-10 2:35 PM


54 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

Information & communications technology

INFORMATION & COMMUNICATIONS TECHNOLOGY ELECTRONICS

3010

Ampco Manufacturers Inc 9 Burbidge St Suite 101, Coquitlam V3K 7B2 Dann Konkin .... p: 604-472-3800 f: 604-944-4068 e: sales@ampcomfg.com ampcomfg.com Cadex Electronics Inc 22000 Fraserwood Way, Richmond V6W 1J6 John Bradshaw p: 604-231-7777 f: 604-231-7750 e: info@cadex.com cadex.com CCI Canadian Circuits Inc 13140 88 Ave Suite 12, Surrey V3W 3K3 Praveen Arya ... p: 604-599-8600 f: 604-599-8181 e: pam@canadiancircuits.com canadiancircuits.com Dorigo Systems Ltd 3885 Henning Dr, Burnaby V5C 6N5 Beth Miller ...... p: 604-294-4600 f: 604-294-4609 e: bmiller@pillonholdings.com dorigo.com Enigma Interconnect 8070 Winston St, Burnaby V5A 2H5 Beth Miller ...... p: 604-420-3313 f: 604-420-7525 e: boards@enigmacorp.com enigmacorp.com

LMI Technologies 9200 Glenlyon Pky, Burnaby V5J 5J8 Rizwana Buksh p: 604-636-1011 f: 604-516-8368 e: info@lmi3d.com lmi3d.com Powertech Labs Inc 12388 88 Ave, Surrey V3W 7R7 Caitlyn Boyle ... p: 604-590-6644 f: 604-590-6656 e: caitlyn.boyle@powertechlabs.com powertechlabs.com Tangram Design Ltd 611 Alexander St Suite 402, Vancouver V6A 1E1 Robert Johnston .........................p: 604-398-2106 tangramdesign.com HARDWARE

3020

1stDataRecovery.com 2981 Simpson Rd Suite 210, Richmond V6X 2R2 Richard Liao................................p: 604-278-3776 e: info@1stdatarecovery.com 1stdatarecovery.com Pathway Design & Manufacturing Inc 2708 Wembley Dr, North Vancouver V7J 3B6 Colin Adamson ...........................p: 604-603-1053 e: info@pathwaydesign.com pathwaydesign.com

Flir Integrated Imaging Solutions Inc 12051 Riverside Way, Richmond V6W 1K7 Kelly Gies ........ p: 604-242-9937 f: 604-242-9938 e: kelly.gies@flir.com flir.com Pacific Insight Electronics Corp 4664 Lougheed Hwy Unit 188, Burnaby V5C 5T5.......................................p: 800-995-1155 e: sales@pacificinsight.com pacificinsight.com S-P International Inc 5118 North Fraser Way Suite 100, Burnaby V5J 0H1 Wilf Wassersleben ....................p: 604-324-4811 f: 604-324-3148 e: info@s-pintl.com s-pintl.com Testforce Systems Inc 34255 Larch St, Abbotsford V2S 2P7 Chris Sztuhar ... p: 604-557-0715 f: 403-202-2016 e: chris@testforce.com testforce.com ENGINEERING, ANALYTICAL & DESIGN SERVICES

Skyway West Sales...........................................p: 604-482-1225 e: sales@skywaywest.com skywaywest.com Business-class access since 1996. Connecting Canada! Fibre, ADSL, PureFibre, Cable, Failover and Bonding, Co-locate, VoIP and UC. Reliable access and excellent service. Stargate Connections Inc 6450 Roberts St Suite 347, Burnaby V5G 4E1 Joe Wong ........ p: 604-606-8999 f: 604-606-8998 e: info@stargate.ca stargate.ca

Advisor Websites 1930 Pandora St Suite 311, Kelowna V5L 1K5 Alex Wingert ..............................p: 866-638-0273 e: marketing@advisorwebsites.com advisorwebsites.com Aequilibrium Software Inc 409 Granville St Suite 1300, Vancouver V6C 1T2.......................................p: 604-227-9157 e: info@aequilibrium.com aequilibrium.com

3025

Alandale Training Corp 6580 Bouchard Crt, Richmond V7C 5H4 John Chandler ............................p: 604-839-8777 e: info@alandaletraining.com alandaletraining.com

ABC Communications 970 Burrard St Suite 147 PO Box 358, Vancouver V6Z 2R4............ p: 888-235-1174 f: 250-992-3930 e: info@abccomm.com abccommunications.com

Andornot Consulting Inc 808 Nelson St Suite 1700, Vancouver V6Z 2H2 Kathy Bryce ..... p: 604-269-2525 f: 604-269-2527 e: info@andornot.com andornot.com

CityXpress Ltd 5118 Joyce St Suite 300, Vancouver V5R 4H1 Ken Bradley ..... p: 604-638-3811 f: 604-638-3808 e: kbradley@cityxpress.com cityxpress.com

Annex Consulting Group Inc 555 Burrard St Suite 950, Vancouver V7X 1M9 Stacey Cerniuk ...........................p: 604-638-8878 e: scerniuk@annexgroup.com annexgroup.com

INTERNET SERVICES

The Answer Co 233 Nelson’s Cres Suite 502, New Westminster V3L 0E4 Shawn Ostheimer.......................p: 604-473-9166 f: 604-473-9115 e: info@theanswerco.com theanswerco.com

Russell Technologies 233 1st St W Suite 140, North Vancouver V7M 1B3 .......... p: 604-985-6047 f: 604-985-6039 e: hrussell@russelltechnologies.ca russelltechnologies.ca

Appazur Solutions Inc 2416 Main St Suite 398, Vancouver V5T 3E2 Trevor Cox...................................p: 888-277-5705 e: hello@appazur.com appazur.com

Synetic Inc 780 Kings Rd Suite 200, Victoria V8T 5A2 ......................................p: 250-475-3001 e: inquiry@synetic.ca synetic.ca Tri-M Technologies Inc 31510 Gill Ave Suite 208, Mission V4S 0A1 Ed Foster.....................................p: 604-814-5069 e: sales@tri-m.com tri-m.com INTERNET PROVIDERS

3022

Skyway West Sales...........................................p: 604-482-1225 e: sales@skywaywest.com skywaywest.com Business-class access since 1996. Connecting Canada! Fibre, ADSL, PureFibre, Cable, Failover and Bonding, Co-locate, VoIP and UC. Reliable access and excellent service. Webnames.ca Inc 333 Terminal Ave Suite 333, Vancouver V6A 4C1 ........... p: 604-633-1142 f: 604-633-3174 e: support@webnames.ca webnames.ca SOFTWARE & SERVICES

3030

3LOG Systems Inc 2633 Viking Way Suite 208, Richmond V6V 3B6 ......................................p: 604-249-2100 e: info@3log.com 3log.com

Aero Geometrics Ltd 837 Hastings St W Suite 209, Vancouver V6C 3N6 ........... p: 604-408-8740 f: 604-408-8747 e: manager@aerogeo.com aerogeo.com

00_BC Tech 2019_64p_2.indd 54

Advanced Computer Networking Systems Inc 7342 Winston St Suite 103, Burnaby V5A 2G9 Tom Carter ....... p: 604-473-9044 f: 604-473-9034 e: tcarter@adv-network.com adv-network.com

Phase 1 Systems Corp 410 Willingdon Ave, Burnaby V5C 5G4 Steve Neophytou........................p: 604-291-1558 f: 604-298-5126 e: info@phase-1.com phase-1.com

3015

AnalysisWorks 1234 6th Ave W, Vancouver V6H 1A5 Jason Goto ...... p: 604-739-7363 f: 604-739-7364 e: info@analysisworks.com analysisworks.com

AccSys Solutions Inc 20486 64th Ave Unit 108, Langley V2Y 2V5 Douglas Dickie p: 604-534-4344 f: 604-534-4385 e: sales@accsyssolutions.com accsyssolutions.com

Form3 Design Inc 365 Railway St Suite 201, Vancouver V6A 1A4 Alex Feldman..............................p: 604-709-3676 e: alexf@form3.com form3.com Contract industrial design and mechanical design services, including product graphics, interface, prototyping and transfer to manufacturing.

Novus Entertainment Inc 112 3rd Ave E Suite 300, Vancouver V5T 1C8 Roddy Ouano ... p: 604-642-6688 f: 604-685-7832 e: roddy.ouano@novusnow.ca novusnow.ca

14 Oranges Software Inc 3820 Cessna Dr Suite 295, Richmond V7B 0A2 Sylvain Marcotte ........................p: 604-304-0020 e: sales@14oranges.com 14oranges.com Absolute 1055 Dunsmuir St Suite 1400 PO Box 49211, Vancouver V7X 1K8 ........... p: 604-730-9851 f: 604-730-2621 e: info@absolute.com absolute.com

Aprio Inc 1090 Georgia St W Suite 450, Vancouver V6E 3V7............ p: 604-684-9943 f: 604-689-7729 e: info@aprio.net aprio.net Aquilon Software Inc 8557 Government St Suite 102, Burnaby V3N 4S9 ...p: 877-810-8787 aquilonsoftware.com AvenueHQ 545 Robson St Suite 200, Vancouver V6B 1A6 ......................................p: 800-882-2857 e: hello@avenuehq.com avenuehq.com Bench 545 Robson St Suite 200, Vancouver V6B 2B7 ................................................................ e: media@bench.co bench.co Binary Stream Software 4238 Lozells Ave Suite 201, Burnaby V5A 0C4 Lak Chahal ....... p: 604-522-6300 f: 866-834-7622 e: info@binarystream.com binarystream.com Blue System Integration Ltd 5228 Somerville St, Vancouver V5W 3H4 Laurent Mingo ............................p: 604-726-1817 e: info@bluesystem.ca bluesystem.ca Boeing Vancouver 13575 Commerce Pky Suite 200, Richmond V6V 2L1 ............ p: 604-232-4200 f: 604-232-4201 e: rachel.kelly@aeroinfo.com boeingvancouver.com

2019-06-10 2:35 PM


| 55

Information & communications technology

Catalyst Healthcare 1631 Dickson Ave Suite 820, Kelowna V1Y 0B5 Kasumi Oda ................................p: 250-980-4713 e: info@catalystrmscom catalystrms.com

ECL Computing 7979 Granville St, Vancouver V6P 4Z3 Edward Lee...... p: 604-266-1124 f: 604-263-9535 eclcomputing.ca

C-DAT Systems Inc 3999 Henning Dr Suite 304, Burnaby V5C 6P8 Gerald Cole.................................p: 604-293-7754 e: info@cdat.com cdat.com

Equicare Health 2020 Yukon St Suite 201, Vancouver V5Y 3N8 ........... p: 604-708-9075 f: 604-687-6942 e: info@equicarehealth.com equicarehealth.com

Change Healthcare Imaging, Workflow & Care Solutions 10711 Cambie Rd Suite 130, Richmond V6X 3G5 ........... p: 604-279-5422 f: 604-279-0572 e: iwsmarketingcom@mckesson.com changehealthcare.com

Fatigue Science 409 Granville St Suite 1588, Vancouver V6C 1T2 David Trotter...............................p: 604-408-0085 e: info@fatiguescience.com fatiguescience.com FinancialCAD Corp (FINCAD) 13450 102 Ave Suite 1750 Central City, Surrey V3T 5X3 Wendy Kahlert p: 604-957-1200 f: 604-957-1201 e: info@fincad.com fincad.com Galvanize 980 Howe St Suite 1500, Vancouver V6Z 0C8............ p: 604-669-4225 f: 604-669-3557 e: info@acl.com acl.com

Clevest 13700 International Pl, Richmond V6V 2X8 Thomas Ligocki...........................p: 604-214-9700 e: info@clevest.com clevest.com Clio (Themis Solutions Inc) 4611 Canada Way Suite 300, Burnaby V5G 4X3 ......................................p: 888-858-2546 e: info@clio.com clio.com CommandWear Systems Inc 887 Great Northern Way Suite 101, Vancouver V5T 4T5 Mike Morrow .............................p: 604-761-3647 e: info@commandwear.com commandwear.com Copperleaf 2920 Virtual Way Suite 140, Vancouver V5M 0C4 .......... p: 604-639-9700 f: 604-639-9699 e: info13@copperleaf.com copperleaf.com

Gens Software Ltd 4050 38th Ave W, Vancouver V6N 2Y9 Radik Gens ...... p: 604-266-5767 f: 604-266-5769 e: radikg@genssoft.com genssoft.com GenXys 5950 University Blvd Suite 320, Vancouver V6T 1Z3 .......................................p: 604-827-4185 e: adriana.suarez@genxys.com genxys.com GeoTalent by GeoMetrix (the Evolution of TrainingPartner) 780 Kings Rd Suite 301, Victoria V8T 5A2 Karla Willems.. p: 800-616-5409 f: 250-361-9362 e: info@geotalent.com geotalent.com Global Relay 220 Cambie St 2nd floor, Vancouver V6B 2M9 .......... p: 604-484-6630 f: 604-608-2941 e: info@globalrelay.net globalrelay.com Globalme Localization Inc 1008 Homer St Suite 310, Vancouver V6B 2X1 Emre Akkas.................................p: 855-438-5106 e: info@globalme.net globalme.net Gravit-e Technologies Inc 525 Seymour St Suite 610, Vancouver V6B 3H7 Nick Oostveen . p: 604-637-6567 f: 604-608-5528 e: info@gravit-e.ca gravit-e.ca Grow Technologies 1285 Pender St W Suite 200, Vancouver V6E 4B1 Kevin Sandhu .............................p: 888-540-3951 e: info@poweredbygrow.com poweredbygrow.com

CounterPath 505 Burrard St Suite 300, Vancouver V7X 1M3 .......... p: 604-320-3344 f: 604-320-3399 e: corporate@counterpath.com counterpath.com Award-winning VoIP solutions that enable teams to connect and collaborate across any device, on any platform and on any network. DataRecoveryBC.com 1066 Hastings St W Suite 2000, Vancouver V6E 3X1 Ann An........................................p: 604-681-3770 e: help@datarecoverybc.com datarecoverybc.com Discerning Systems Inc 7887 Morley St, Burnaby V5E 3Y9............ p: 604-544-3748 f: 604-544-3648 e: info@discerningsystems.com discerningsystems.com

00_BC Tech 2019_64p_2.indd 55

Helm Operations 1208 Wharf St Suite 400, Victoria V8W 3B9 Ron deBruyne .. p: 250-360-1991 f: 250-360-1359 e: info@helmoperations.com helmoperations.com INETCO Systems Ltd 4664 Lougheed Hwy Suite 295, Burnaby V5C 5T5 Stacy Gorkoff... p: 604-451-1567 f: 604-451-1565 e: info@inetco.com inetco.com Innsource Solutions Inc 9790 Second St Suite 105, Sidney V8L 3Y8 Ben Larsen....... p: 250-656-9790 f: 250-656-9780 e: sales@innsourcesolutions.com innsourcesolutions.com Intense Technologies Inc 3731 Rees Rd, Richmond V6X 2S4 John Ens .....................................p: 604-270-2780 e: info@intense.ca intense.ca

i-worx Enterprises Inc 1520 Barrow St Unit 201, North Vancouver V7J 1B7 Andre Coetzee . p: 604-639-6300 f: 604-637-2019 e: info@i-worx.ca i-worx.ca James Evans & Associates Ltd 4464 Markham St Suite 1205, Victoria V8Z 7X8 Sheree Johnson .........................p: 250-380-3811 f: 250-380-0091 e: info@jea.ca jea.ca JDV Consulting 2870 Philip Ave, North Vancouver V7R 1B8 Jiri Dvorak ..................................p: 604-220-0529 e: jiri.dvorak@t4bi.com Jostle Corp 1090 Georgia St W Suite 1200, Vancouver V6E 3V7 Brad Palmer ................................p: 604-566-9520 e: info@jostle.me jostle.me Kashoo Systems Inc 343 Railway St Suite 201, Vancouver V6A 1A4 Jim Secord .................................p: 888-520-5274 e: jim.secord@kashoo.com kashoo.com Kobelt Development Inc 18525 53 Ave Suite 231, Surrey V3S 7A4 Tom Kobelt ...... p: 604-574-7225 f: 604-574-7256 e: info@kdi.ca kdi.ca MagicLogic Optimization Inc 150 Canterbury Cres, Nanaimo V9T 4S4 Tim Smith ...................................p: 250-585-4409 e: tim@magiclogic.com magiclogic.com

PDFTron Systems Inc 838 Hastings St W Level 5, Vancouver V6C 0A6 ........... p: 604-730-8989 f: 604-676-2477 e: sales@pdftron.com pdftron.com Leading global provider of electronic document technologies, including cross-platform, highperformance software components for PDF viewing/editing, document conversion and universal document web viewing. Progressa 1500 Georgia St W Suite 2000, Vancouver V6G 2Z6 ........... p: 855-723-5626 f: 855-477-1110 e: philipp.postrehovsky@progressa.com progressa.io Quartech 2889 12th Ave E Suite 650, Vancouver V5M 4T5 Michael Lagasse ........................p: 604-291-9686 f: 604-291-0243 e: communications@quartech.com quartech.com

Medinet Health Systems Inc 1755 Broadway W Suite 403, Vancouver V6J 4S5 Kate Culter ...... p: 604-737-1477 f: 604-742-8850 e: info@medinet.ca medi.net Microzip Data Solutions Inc 851 Old Lillooet Rd, North Vancouver V7J 2H6 Axel Krieger..... p: 604-683-3711 f: 855-845-8903 e: info@microzip.com microzip.com MRX Solutions Corp 470 Kingsway Ave Suite 103, Vancouver V5T 3J9 Sava Jurisic ..... p: 604-676-2362 f: 604-676-2362 e: info@mrxsolutions.com mrxsolutions.com Nero Global Tracking 2700 Production Way Suite 300, Burnaby V5A 2X1 Lindsay Ryerson .........................p: 778-355-9545 e: info@neroglobal.com neroglobal.com Oak Bay Softrends Inc 3230 31st Ave W, Vancouver V6L 2A7.......................................p: 604-739-9385 e: info@oakbaysoftrends.net oakbaysoftrends.net Pacific Tier Solutions Inc 2871 Jacklin Rd Suite 110, Victoria V9B 0P3 Bruce Toogood. p: 888-599-8282 f: 250-380-1172 e: sales@bookking.ca bookking.ca Paramount Computers Ltd 19505 68A Ave Suite 36, Surrey V4N 6K3 Gary Hee.....................................p: 604-510-0360 e: paramountcomputersltd@shaw.ca paramountcomputersltd.com

Realtor.com 10271 Shellbridge Way Suite 300, Richmond V6X 2W8 .....................................p: 800-444-8570 e: sales@topproducer.com careers.realtor.com Realtor.com, The Home of Home Search , is a leading online real estate destination. Offering the most MLS-listed for-sale properties in the U.S., and access to information, tools and professional expertise, realtor.com makes finding buying and selling your home easier and more rewarding. We pioneered the world of digital real estate more than 20 years ago, and today is the trusted resource for home buyers, sellers and dreamers. Realtor.com is operated by News Corp [Nasdaq: NWS, NWSA] [ASX: NWS, NWSLV] subsidiary Move Inc. under a perpetual license from the National Association of Realtors. For more information, visit realtor.com Recreation Sport Management Inc 101-1001 Broadway W Suite 112, Vancouver V6H 4E4 Harvey Smith ..............................p: 604-235-1987 e: harvey@esportsdesk.com esportsdesk.com Redbrick Technologies Inc 1630 Store St Suite 200, Victoria V8W 1V3 Olivia Scholes.............................p: 250-891-2870 e: olivia.scholes@rdbrck.com rdbrck.com Resonance Software Inc 335 Wesley St Suite 208, Nanaimo V9R 2T5 Ivan Eggers ...... p: 877-740-3800 f: 250-740-0169 e: sales@worksight.net worksight.net

2019-06-10 2:35 PM


56 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

Information & communications technology

Rise People 1055 Georgia St W, 10th floor, Vancouver V6E 3P3 Faiz Abdulla ................................p: 604-336-2900 e: info@risepeople.com risepeople.com

Switch United 1600 Hornby St Suite 703, Vancouver V6Z 2S4 Catherine Winckler ....................p: 604-309-7530 e: cwinckler@switchunited.com switchunited.com

Sage 13888 Wireless Way, Richmond V6V 0A3 ................ p: 604-207-9480 sage.com/ca

Synergy Computer Consulting Ltd 2755 Cooperative Way Unit 104, Vancouver V5M 4S4 Kathy Woolverton ......................p: 604-681-0516 f: 604-681-0916 e: info@synergycc.com synergycc.com

salonMonster 1917 4th Ave W Suite 106, Vancouver V6J 1M7 Stephen Parslow ........................p: 800-901-1001 e: info@salonmonster.com salonmonster.com SAP Canada Inc 910 Mainland St, Vancouver V6B 1A9 Kirsten Sutton . p: 604-647-8888 f: 604-681-2934 e: vancouver@sap.com sap.com SchedulePro by EDP Software 625 Howe St Suite 750, Vancouver V6C 2T6 Sachin Agrawal ..........................p: 877-501-7776 e: sachin.agrawal@edpsoftware.com scheduleprosoftware.com SilkStart Technology 838 Fort Street Suite 220, Victoria V8W 1H8 Ross Wamboldt ..........................p: 888-630-9469 e: sales@silkstart.com silkstart.com

Tecnet Canada Inc 3214 Beta Ave, Burnaby V5G 4K4 Matthew Van Heyst ...................p: 800-832-6381 f: 604-433-5552 e: matthew.vanheyst@tecnet.ca tecnet.ca Thoughtexchange 1990 E Columbia Ave PO Box 2260, Rossland V0G 1Y0 Alex Chapple ..............................p: 250-551-2492 e: alex.chapple@thoughtexchange.com thoughtexchange.com

Smart Hotel Software Inc 1975 Lonsdale Ave Suite 107, North Vancouver V7M 2K3 Douglas Ash ...............................p: 604-926-3215 e: sales@smarthotelsoftware.com smarthotelsoftware.com Softlanding Solutions Inc 555 Hastings St W Suite 1605, Vancouver V6B 4N6 Shaun Roberts . p: 604-633-1410 f: 604-633-1409 e: sroberts@softlanding.ca softlanding.ca Softree Technical Systems Inc 1075 1st St W Suite 204, North Vancouver V7P 3T4 Craig Speirs ..... p: 604-519-6222 f: 604-982-2554 e: cspeirs@softree.com softree.com Sophos Inc 777 Dunsmuir St Suite 1400, Vancouver V7Y 1K4 ......................................p: 604-484-6400 e: careers-canada@sophos.com sophos.com SpeedLine Solutions Inc 3899 Mt Lehman Rd, Abbotsford V2T 5W5 .......... p: 888-400-9185 f: 866-850-9688 e: info@speedlinesolutions.com speedlinesolutions.com Squirrel Systems 8585 Baxter Pl, Burnaby V5A 4V7 ........... p: 604-412-3300 f: 604-412-3399 e: info@squirrelsystems.com squirrelsystems.com StandardFusion 119 Pender St W Suite 203, Vancouver V6B 1S5 Mirek Pijanowski........................p: 604-755-3356 e: info@standardfusion.com standardfusion.com StarGarden Corp 3665 Kingsway, Vancouver V5R 5W2 .......... p: 800-809-2880 f: 604-451-0578 e: salma.sultana@stargarden.com stargarden.com SustaiNet Software International Inc 1681 Chestnut St Suite 400, Vancouver V6J 4M6 Howard Adam . p: 604-717-4327 f: 604-736-9531 e: howard@sustainet.com sustainet.com

00_BC Tech 2019_64p_2.indd 56

Vision Critical 200 Granville St, Vancouver V6C 1S4 ........... p: 604-647-1980 f: 604-647-1005 e: visioncritical@pluckpr.com visioncritical.com

Novus Entertainment Inc 112 3rd Ave E Suite 300, Vancouver V5T 1C8 Roddy Ouano ... p: 604-642-6688 f: 604-685-7832 e: roddy.ouano@novusnow.ca novusnow.ca Xodo Technologies Inc 838 Hastings St W Level 5, Vancouver V6C 0A6 ........... p: 604-730-8989 f: 604-676-2477 e: info@xodo.com xodo.com Xodo Technologies is a provider of innovative, cross-platform business and productivity applications. Our goal is to reimagine how the world works with documents, and to bring the best-in-class in PDF and document technology to users everywhere. Xodo is the ultimate PDF app for viewing, annotating and collaborating on PDF files across platforms and devices. TELECOMMUNICATIONS

Rogers Communications 4710 Kingsway Suite 1900, Burnaby V5H 4W4.......... p: 604-214-2161 f: 604-431-1414 e: customer.service@rci.rogers.com rogers.com Santel Communications 11880 Hammersmith Way Suite 197, Richmond V7A 5C8 Kevin Kondo .... p: 604-273-9063 f: 604-273-1983 e: kkondo@santel.ca santel.ca Shaw Communications Inc 1067 Cordova St W, Vancouver V6C 3T5.........................p: 888-472-2222 shaw.ca

3040

Algo Communication Products Ltd 4500 Beedie St, Burnaby V5J 5L2 Paul Zoehner ... p: 604-454-3790 f: 604-437-5726 e: sales@algosolutions.com algosolutions.com TLD Computers and CustomWorks - A Division of London Drugs Ltd 12251 Horseshoe Way Suite 100, Richmond V7A 4V4 ........... p: 888-933-9777 f: 604-272-6026 e: solutions@tld.com tld.com/customworks.ca We provide IT and AV solutions and services for western Canadian businesses. From your server room to your boardroom, we offer professional consultation, design, implementation and ongoing services. We have over 35 years of history and experience supporting B.C. businesses. Call us today!

Ansatel Communications Inc 940 Kingsway, Vancouver V5V 3C4 ........... p: 604-872-6500 f: 604-879-5377 e: sales@ansatel.com ansatel.com

Traction on Demand 2700 Production Way Suite 500, Burnaby V5A 0C2 Kevin Murray ..............................p: 604-620-6040 e: kmurray@tractionondemand.com tractionondemand.com

CounterPath 505 Burrard St Suite 300, Vancouver V7X 1M3 .......... p: 604-320-3344 f: 604-320-3399 e: corporate@counterpath.com counterpath.com

Trulioo 1055 Hastings St W Suite 1200, Vancouver V6E 2E9 Kim Hong ....................................p: 888-773-0179 e: kim@trulioo.com trulioo.com TwoTonic Labs Inc 308 5th Ave E, Vancouver V5T 1H4 Robert Zalaudek .........................p: 604-771-8768 e: info@twotonic.net twotonic.net Unilogik Systems Inc 999 Broadway W Suite 620, Vancouver V5Z 1K5............ p: 604-739-8488 f: 604-739-7337 e: info@unilogik.com unilogik.com Velora Systems Inc 7730 Manitoba St, Vancouver V5X 2Z8 Vladimir Zeldis p: 778-588-7054 f: 778-588-7078 e: info@velorasystems.com velorasystems.com Visier 858 Beatty St Suite 400, Vancouver V6B 1C1 Ryan Tessier .... p: 778-331-6950 f: 778-331-6951 e: ryan.tessier@visier.com visier.com

Bell Canada 2925 Virtual Way, Vancouver V5M 4X5 .....................................p: 800-667-0123 e: bcecomms@bell.ca bell.ca CityWest Cable and Telephone Corp 248 3rd Ave, Prince Rupert V8J 1L1 .......................................p: 250-624-7001 e: donovan.dias@cwct.ca citywest.ca

Glentel Inc 8501 Commerce Crt, Burnaby V5A 4N3........... p: 604-415-6500 f: 604-415-6565 glentel.com Intra Systems Ltd 17942 55 Ave Unit 1, Surrey V3S 6C8 Brian Sanheim ............................p: 604-576-7730 e: sales@intrabc.com intrabc.com Mil-Sted Data Products Ltd 3071 No 5 Rd Suite 6, Richmond V6X 2T4 Michael Gould . p: 604-273-2877 f: 604-270-8534 e: michaelg@mil-sted.com milsteddataproducts.com NATGisIT 1585 Cliveden Ave Unit 9, New Westminister V3M 6M1 Alan Muirhead p: 604-526-2129 f: 604-526-5972 e: info@natgisit.ca natgisit.ca Navigata Communications Ltd 200 Granville St Suite 1210, Vancouver V6C 1S4 ......................................p: 604-990-2000 e: info@navigata.ca navigata.ca

Skyway West Sales...........................................p: 604-482-1225 e: sales@skywaywest.com skywaywest.com Business-class access since 1996. Connecting Canada! Fibre, ADSL, PureFibre, Cable, Failover and Bonding, Co-locate, VoIP and UC. Reliable access and excellent service. Telus Corp 510 Georgia St W 23rd floor, Vancouver V6B 0M3 .....................................p: 604-697-8044 e: ir@telus.com telus.com TeraSpan Networks Inc 6870 Palm Ave, Burnaby V5J 4M3 .......... p: 604-684-8711 f: 877-373-5741 e: info@teraspan.com teraspan.com TMC IT and Telecom Consulting 1500 Georgia St W Suite 1300, Vancouver V6G 2Z6 Ellen Koskinen-Dodgson ............p: 604-683-1103 f: 604-685-1520 e: ellen@tmcconsulting.ca tmcconsulting.ca Uniserve Communications Corp 333 Terminal Ave Suite 330, Vancouver V6A 4C1 ........... p: 604-395-3900 f: 604-630-7194 uniserve.com Vandelta Communication Systems Ltd 4320 Tiffin Cres, Richmond V7C 4X8 Hugh M Rae .... p: 604-271-7797 f: 604-732-4727 e: hughrae@vandelta.com vandelta.com Vecima Networks Inc 771 Vanalman Ave, Victoria V8Z 3B8............ p: 250-881-1982 f: 250-881-1974 e: info@vecima.com vecima.com

2019-06-10 2:35 PM


| 57

Information & communications technology

West Mobile Mounts Inc 1751 Harvey Ave Suite 100, Kelowna V1Y 6G4 Randy Fehr....... p: 250-448-4148 f: 250-448-4149 e: sales@westmobilemounts.com westmobilemounts.com VIDEOCONFERENCING/ WEBCASTING

3050

4th Utility Inc 2526 Davies Ave, Port Coquitlam V3C 4T7 Jeff Lewis........ p: 604-941-4440 f: 604-941-4433 e: jlewis@fouru.com fouru.com CounterPath 505 Burrard St Suite 300, Vancouver V7X 1M3 .......... p: 604-320-3344 f: 604-320-3399 e: corporate@counterpath.com counterpath.com Message Impact Systems Inc 1124 Lonsdale Ave Suite 1107, North Vancouver V7M 2H1 Dave Roitner.... p: 604-243-4442 f: 866-306-3140 e: info@messageimpact.com messageimpact.com OTHER

3000

New Media

BSM Technologies 4299 Canada Way Suite 215, Burnaby V5G 1H3 ........... p: 604-434-7337 f: 604-434-5270 e: info@bsmtechnologies.com bsmtechnologies.com CuePath Innovation Inc 555 Hastings St W Suite 1200, Vancouver V6B 4N6 Victor Lesau................................p: 888-877-2848 e: info@cuepath.io cuepath.io eproval 343 Railway St Suite 304, Vancouver V6A 1A4 Karen Ng ....................................p: 604-568-6807 e: info@eproval.com eproval.com Fortinet Inc 4190 Still Creek Dr Suite 400, Burnaby V5C 6C6 ........... p: 604-430-1297 f: 604-293-8885 e: communications@fortinet.com fortinet.com intelliNet 21331 Gordon Way Suite 2155, Richmond V6W 1J9 .......... p: 604-273-5001 f: 604-273-5011 e: dwestrheim@intellinet-canada.com intellinet-canada.com Lendesk 1038 Homer St, Vancouver V6B 2W9 Alex Conconi ..............................p: 800-853-5979 e: sales@lendesk.com lendesk.com MDA 200 Burrard St Suite 1570, Vancouver V6C 3L6 ............ p: 604-974-5275 f: 604-974-5807 e: info@mdacorporation.com mdacorporation.com

4th Utility Inc 2526 Davies Ave, Port Coquitlam V3C 4T7 Jeff Lewis........ p: 604-941-4440 f: 604-941-4433 e: jlewis@fouru.com fouru.com Acumen Computing Services Ltd 15454 32 Ave Suite 27, Surrey V3Z 2J8 Dan Wilder .................................p: 604-532-8460 e: dwilder@telus.net Advance Connexions Inc 12180 86 Ave Suite E, Surrey V3W 3H7 Tom Mosbrucker.........................p: 604-594-8288 e: sales@advanceconnexions.com advanceconnexions.com

Pintacle Systems Inc 7730 Manitoba St, Vancouver V5X 2Z8 Vladimir Zeldis p: 778-588-7054 f: 778-588-7078 e: info@pintacle.com pintacle.com PlaceSpeak Inc 1005 Cypress St, Vancouver V6J 3K6 Colleen Hardwick .......................p: 604-336-6977 e: info@placespeak.com placespeak.com Sierra Systems, an NTT DATA Company 1177 Hastings St W Suite 2500, Vancouver V6E 2K3 Charles Robinson .......................p: 250-588-0180 f: 888-688-6482 e: charlie.robinson@nttdata.com sierrasystems.com Superion Inc 5830 176A St Suite 102, Surrey V3S 4H5 Mike Burton..... p: 888-318-5118 f: 888-318-5118 e: info@superion.ca superion.ca

Cinesite 565 Great Northern Way Suite 500, Vancouver V5T 0H8 ......................................p: 604-216-2615 e: featureanimation@cinesite.com cinesite.com

E-Cubed Media Synthesis Inc 2nd Floor 3807 William St, Burnaby V5C 3J1 Steven Widen.............................p: 604-294-1556 e: info@e-cubed.com e-cubed.com

Digital Domain 1618 8th Ave W, Vancouver V6J 1V4............ p: 778-783-6000 f: 778-783-6099 e: jlalani@d2.com digitaldomain.com

Emily Carr University of Art + Design 520 1st Ave E, Vancouver V5T 0H2 ........... p: 604-844-3800 f: 604-844-3801 e: communications@ecuad.ca ecuad.ca

DNEG 149 4th Ave W, Vancouver V5Y 4A6 ......................................p: 778-372-9000 e: info@dneg.com dneg.com

Go2 Productions Inc 343 Railway St Suite 420, Vancouver V6A 1A4 Gemma Scott..............................p: 604-408-5844 e: gemma@go2productions.com go2productions.com

FuseFX 1168 Hamilton St Suite 300, Vancouver V6B 2S2 ......................................p: 604-637-3010 e: bcinfo@fusefx.com fusefx.com Goldtooth Creative Agency Inc 329 Railway St Suite 102, Vancouver V6A 1A4 Justin Bullard .............................p: 604-568-9168 e: info@goldtooth.com goldtooth.com Image Engine Design Inc 15 5th Ave W, Vancouver V5Y 1H4 ........... p: 604-874-5634 f: 604-708-8433 e: vfx@image-engine.com image-engine.com Industrial Light & Magic Vancouver 21 Water St Suite 400, Vancouver V6B 1A1 ......................................p: 415-746-4700 e: contact-van@ilm.com ilm.com Sony Pictures Imageworks 725 Granville St, Vancouver V7Y 1K4 ......... p: 604-673-2500 imageworks.com E-LEARNING

4020

Ingenuity Works 325 Howe St Suite 407, Vancouver V6C 1Z7 Teresa Mew .... p: 604-484-8053 f: 888-786-6578 e: information@ingenuityworks.com ingenuityworks.com INTERACTIVE DESIGN & COMMUNICATIONS

4030

Agentic Communications Inc 207 Hastings St W Suite 414, Vancouver V6B 1H7 Phillip Djwa ................................p: 604-255-2131 e: agentic-info@agentic.ca agentic.ca Artist/Designer Kim Hunter/Indigo 990 Lagoon Dr, Vancouver V6G 2R9 Kim Hunter .................................p: 604-682-7533 e: info@kimhunter.ca kimhunter.ca

BC Tech Association 887 Great Northern Way Suite 101, Vancouver V5T 4T5 ............ p: 604-683-6159 f: 604-683-3879 e: info@wearebctech.com wearebctech.com

00_BC Tech 2019_64p_2.indd 57

ANIMATION/DIGITAL FILM

4010

Bardel Entertainment Inc 1523 3rd Ave W, Vancouver V6J 1J8 ............ p: 604-669-5589 f: 604-669-9079 e: info@bardel.ca bardel.ca

KIMBO Design Inc 409 Granville St Suite 1251, Vancouver V6C 1T2 Kim Pickett ...... p: 604-562-8242 f: 604-738-6468 e: kim@kimbodesign.ca kimbodesign.ca Line49 Design Group Inc 1275 6th Ave W Suite 300, Vancouver V6H 1A6 Dave Smith ...... p: 604-591-3283 f: 604-591-1383 e: info@line49.ca line49.ca Oaxaca Studio 1300 7th Ave W, Vancouver V6H 3W5 Alex Gonzalez .............................p: 604-874-6654 e: alex@oaxacastudio.com oaxacastudio.com Powershifter 38 5th Ave E, Vancouver V5T 1G8 JP Holecka..................................p: 604-484-0606 e: hello@powershifternew.biz powershifter.com 4040

Blackbird Interactive 565 Great Northern Way Suite 400, Vancouver V5T 0H8 ......................................p: 604-424-4355 e: pr@blackbirdinteractive.com blackbirdinteractive.com The Coalition 858 Beatty St Suite 600, Vancouver V6B 1C1 ........... p: 604-247-6000 f: 604-221-4400 thecoalitionstudio.com East Side Games 555 12th Ave W Suite 550, Vancouver V5Z 3X7............ p: 604-710-7721 f: 604-568-5051 e: info@eastsidegamestudio.com eastsidegames.com Electronic Arts 4330 Sanderson Way, Burnaby V5G 4X1 ........... p: 604-456-3600 f: 604-456-5000 e: info@ea.com ea.com

NEW MEDIA Atomic Cartoons Inc 123 West 7th Ave, Vancouver V5Y 1L8 .......................................p: 604-734-2866 e: info@atomiccartoons.com atomiccartoons.com

Ion Brand Design 948 7th Ave W, Vancouver V5Z 1C3 David Coates ..............................p: 604-682-6787 e: david@iondesign.ca placebranding.ca

INTERACTIVE ENTERTAINMENT/ GAMES

Vmax Systems Inc 13986 Cambie Rd Suite 218, Richmond V6V 2K3 ........... p: 604-214-3638 f: 604-821-0563 e: sales@vmaxcanada.com vmaxcanada.com

BCIT School of Computing and Academic Studies Burnaby Campus, 3700 Willingdon Ave, Burnaby V5G 3H2 ........................p: 604-434-5734 bcit/cas Industry-sponsored student projects: bcit.ca/ cas/issp

Intergalactic Agency Inc 1224 Hamilton St Suite 302, Vancouver V6B 2S8 Michael Farquhar .......................p: 604-738-3311 e: info@intergalactic.com intergalactic.com

Burst! Creative Group 211 Columbia St Suite 20, Vancouver V6A 2R5 Jeff Pinder ....... p: 604-662-8778 f: 604-662-8778 e: jeff@burstceativegroup.com burstcreativegroup.com Echelon Media Group Ltd 1274 Barclay St Suite 103, Vancouver V6E 1H3 Sergiy Melnik .............................p: 604-526-2222 e: info@mediaechelon.com mediaechelon.com

Next Level Games 208 Robson St, Vancouver V6B 6A1 ........... p: 604-484-6111 f: 604-464-6112 e: info@nextlevelgames.com nextlevelgames.com Patrick Turner Studios 1959 Marine Dr Unit 1963, North Vancouver V7P 3G1 Patrick Turner .............................p: 604-929-7158 e: pat@patrickturner.com patrickturner.com

2019-06-10 2:35 PM


58 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

New Media

Services

Skybox Labs 4190 Lougheed Hwy Suite 200, Burnaby V5C 6A8 ......................................p: 604-558-4330 e: info@skyboxlabs.com skyboxlabs.com

Domain7 339 Railway St Suite 250, Vancouver V6A 1A4 ........... p: 604-855-3772 f: 604-854-3349 e: hello@domain7.com domain7.com

Smoking Gun Interactive Inc 900 Hastings St W Suite 1000, Vancouver V6C 0C4 ........... p: 604-689-7486 f: 866-250-7950 e: info@smokingguninc.com smokingguninc.com

eBridge Marketing Solutions 4620 Teviot Pl, North Vancouver V7R 4M5 Hartland Ross .............................p: 604-731-5530 e: info@ebridgemarketingsolutions.com ebridgemarketingsolutions.com

A Thinking Ape Entertainment Ltd 1132 Alberni St Suite 200, Vancouver V6E 1A5 David Cronin ...............................p: 604-682-7773 e: press@athinkingape.com athinkingape.com SOFTWARE

4050

Finger Food 2755 Lougheed Hwy Suite 420, Port Coquitlam V3B 5Y9 Nick Malaperiman......................p: 604-475-0350 e: nickm@fingerfoodstudios.com fingerfoodstudios.com PNI Digital Media 425 Carrall St Suite 100, Vancouver V6B 6E3............ p: 604-893-8955 f: 604-893-8966 e: pr@pnimedia.com pnimedia.com Powershifter 38 5th Ave E, Vancouver V5T 1G8 JP Holecka..................................p: 604-484-0606 e: hello@powershifternew.biz powershifter.com WEB DEVELOPMENT/MARKETING/ COMMERCE 4060

All Inclusive Marketing 11180 Coppersmith Pl Suite 238, Richmond V7A 5G8 ......................................p: 866-215-1314 e: info@allinclusivemarketing.com allinclusivemarketing.com Article 1010 Raymur Ave, Vancouver V6A 3T2 ......................................p: 604-756-2053 e: reena.gacad@article.com article.com Bayleaf Software Inc 839 Cambie St Suite 200, Vancouver V6B 2P4 George Tomes . p: 604-683-1288 f: 604-683-1287 e: info@bayleaf.com bayleaf.com Briteweb 225 8th Ave W Suite 300, Vancouver V5Y 1N3 ......................................p: 604-620-6174 e: agency@briteweb.com briteweb.com

CREW Marketing Partners 5446 152 St Suite 301, Surrey V3S 5J9.......................................p: 604-557-1488 e: sunger@crewmp.com crewmp.com Cryptek Labs 999 Canada Pl, Vancouver V6C 3E2 Kyle Barker .................................p: 877-239-3153 e: info@crypteklabs.com crypteklabs.com

00_BC Tech 2019_64p_2.indd 58

Hootsuite 5 8th Ave E, Vancouver V5T 1R6.......................................p: 604-681-4668 e: media@hootsuite.com hootsuite.com

Noise Digital Inc 856 Homer St Suite 200, Vancouver V6B 2W5 .....................................p: 604-689-9574 e: vancouver@noisedigital.com noisedigital.com

Lee Gabel Design & Visual Effects 1497 Admirals Rd Suite 105 PO Box 717, Victoria V9A 2P8 Lee Gabel ...................................p: 778-746-7345 e: info@leegabel.com leegabel.com

E-Cubed Media Synthesis Inc 3807 William St Suite 200, Burnaby V5C 3J1 Steven Widen.............................p: 604-294-1556 e: info@e-cubed.com e-cubed.com

OXD 12 Water St Suite 210, Vancouver V6B 1A5 Darren Gibbons ..........................p: 604-694-0554 e: marketing@oxd.com oxd.com

Pro Exp Media Inc 23200 Gilley Rd Suite 200, Richmond V6V 2L6 Norm Lai .....................................p: 604-227-2739 e: info@proexp.net proexp.net

Engine Digital Inc 34 8th Ave W, Vancouver V5Y 1M7 .....................................p: 604-684-3330 e: vancouver@enginedigital.com enginedigital.com

PixelGems Software Box 1509 RPO Vedder Crossing, Chilliwack V2R 3N7 Karl Geng....................................p: 604-847-9080 e: info@pixelgems.com pixelgems.com

PromoKeychain.com Custom USB Flash Drives Vancouver Rob Wilson...............p: 702-997-3233 e: info@promokeychain.com promokeychain.com

FCV Technologies Ltd 1120 Hamilton St Suite 400, Vancouver V6B 2S2 Johann Starke . p: 604-662-8407 f: 604-662-8409 e: info@fcvinteractive.com fcvinteractive.com

Powershifter 38 5th Ave E, Vancouver V5T 1G8 JP Holecka..................................p: 604-484-0606 e: hello@powershifternew.biz powershifter.com

Free Spirit Media 100 Laval St Suite 178, Coquitlam V3K 6N2 Leanna Hoskins p: 604-341-0277 f: 604-687-5159 e: freespiritmedia@telus.net freespiritmedia.com

Real Estate Webmasters 223 Commercial St, Nanaimo V9R 5G8 ......................................p: 877-753-9893 e: marketing@realestatewebmasters.com realestatewebmasters.com

Glacier Digital 303 5th Ave W, Vancouver V5Y 1J6.......................................p: 604-630-3501 e: abrouwer@glaciermedia.ca glaciermediadigital.ca

Snaptech Marketing 4370 Dominion St Suite 406, Burnaby V5G 4L7 Flavio Marquez p: 604-677-0742 f: 604-677-5237 e: flavio@snaptech.com snaptech.com

Graphically Speaking Services Inc 1140 Pender St W Suite 840, Vancouver V6E 4G1 Darrell Hadden p: 604-682-5500 f: 604-682-1312 e: darrell@graphicallyspeaking.ca graphicallyspeaking.ca

StudioIMI 885 Berwick Rd S Unit 7, Qualicum Beach V9K 1N7 Craig Montgomery .....................p: 250-580-5250 e: projects@imotionmarketing.com studioimi.com

Idea Rebel 113 Water St, Vancouver V6B 1A7 ......................................p: 604-569-2155 e: info@idearebel.com idearebel.com

WiderFunnel Marketing Inc 333 Seymour St Suite 1480, Vancouver V6B 5A6 Chris Goward..............................p: 604-800-6450 e: hello@widerfunnel.com widerfunnel.com

Jelly Digital Marketing & PR 9607 Church St, Langley V1M 2R6 Darian Kovacs ............................p: 604-674-3559 e: darian@jellymarketing.com jellymarketing.com

World Exposure 5788 Birney Ave Suite 401, Vancouver V6S 0A2 Corinne Assayag ........................p: 604-221-1789 e: sales@worldexposure.com worldexposure.com

JenTekk Web Solutions Co 20976 56 Ave Suite 309, Langley V3A 7Z2 Jeannette V Duguay...................p: 604-510-2781 f: 604-510-2782 e: info@jentekk.com jentekk.com

Zapp Worx Design 318 Homer St Suite 205A, Vancouver V6B 2V2 Luie Zappacosta .........................p: 604-689-5531 f: 604-687-6272 e: info@zappworx.com zappworx.com

Lara Spence Web Design + Business Writing 5293 St Catherines St, Vancouver V5W 3G2 Lara Spence................................p: 604-324-4020 e: lara@laraspence.com laraspence.com

Burst! Creative Group 211 Columbia St Suite 20, Vancouver V6A 2R5 Jeff Pinder ....... p: 604-662-8778 f: 604-662-8778 e: jeff@burstceativegroup.com burstcreativegroup.com

Mountain Interactive Inc 343 Railway St Suite 304, Vancouver V6A 1A4 Rene Michaely p: 604-568-6807 f: 604-648-8038 e: info@mountaininteractive.ca mountaininteractive.ca

M2O Digital Agency 730 Union St Unit A, Vancouver V6A 2C2 Bradley Shende ..........................p: 604-626-1057 e: bshende@m2o.ca m2o.ca

OTHER

4000

Backlot Media 422 Richards St Suite 170, Vancouver V6B 2Z4 John Durrant ..............................p: 604-916-1749 e: john@backlot.ca backlot.ca BCIT School of Business Burnaby Campus, 3700 Willingdon Ave, Burnaby V5G 3H2 .......... p: 604-434-5734 bcit.ca/business

Major Tom 548 Beatty St, Vancouver V6B 2L3 .......................................p: 604-262-9083 e: van@majortom.com majortom.com

BC Tech Association 887 Great Northern Way Suite 101, Vancouver V5T 4T5 ............ p: 604-683-6159 f: 604-683-3879 e: info@wearebctech.com wearebctech.com

MeZine Inc 555 Hastings St W Suite 2200, Vancouver V6B 4N6 Emily/Sunny Hirai.......................p: 604-430-4588 f: 604-430-4566 e: customerservice@websitedynamics.com mezine.com

BroadbandTV Corp 1205 Melville St, Vancouver V6E 0A6 ......................................p: 604-647-2288 e: pr@bbtv.com bbtv.com

SendtoNews 56 Bastian Sq, Victoria V8W 1J2 Matthew Watson .......................p: 855-590-1991 f: 877-211-2946 e: info@sendtonews.com sendtonews.com

SERVICES ACCOUNTING

7010

BDO Canada LLP 925 Georgia St W Suite 600, Vancouver V6C 3L2 Mark Zastre ..... p: 604-688-5421 f: 604-688-5132 e: info@bdo.ca bdo.ca Ernst & Young LLP 700 Georgia St W Suite 1600 Box 10101, Vancouver V7Y 1C7 Richard Mockett .........................p: 604-891-8456 f: 604-643-5422 e: richard.mockett@ca.ey.com ey.com MNP LLP 1021 Hastings St W Suite 2200, Vancouver V6E 0C3............ p: 604-685-8408 f: 604-685-8594 e: vancouver.reception@mnp.ca mnp.ca North49 Business Solutions Inc 3185 Willingdon Green Suite 302, Burnaby V5G 4P3 Peter Grajczyk.. p: 604-282-6000 f: 604-282-6000 e: solutions@north49.com north49.com Smythe LLP 475 Howe St Suite 1700, Vancouver V6C 2B3 Camellia Ho ..... p: 604-687-1231 f: 604-688-4675 e: cho@smythecpa.com smythecpa.com AUDIOVISUAL

7013

4th Utility Inc 2526 Davies Ave, Port Coquitlam V3C 4T7 Jeff Lewis........ p: 604-941-4440 f: 604-941-4433 e: jlewis@fouru.com fouru.com Applied Electronics Ltd 8573 Commerce Crt, Burnaby V5A 4N5 Stephen Monteith ......................p: 604-439-7228 f: 604-439-7210 e: AEL.vancouver@appliedelectronics.com appliedelectronics.com AV Solutions BC Ltd 12448 82 Ave Suite 221, Surrey V3W 3E9 Mark Bachleitner........................p: 604-599-0333 f: 604-599-0107 e: mark@avsolutions.ca avsolutions.ca TLD Computers and CustomWorks - A Division of London Drugs Ltd 12251 Horseshoe Way Suite 100, Richmond V7A 4V4 ........... p: 888-933-9777 f: 604-272-6026 e: solutions@tld.com tld.com/customworks.ca

2019-06-10 2:35 PM


| 59

Services

CONSULTANTS

7015

Aquilon Software Inc 8557 Government St Suite 102, Burnaby V3N 4S9 ...p: 877-810-8787 aquilonsoftware.com Atmoswater Research 2116 Grand Blvd, North Vancouver V7L 3Y7 Roland Wahlgren .......................p: 604-985-3720 e: atmoswater@shaw.ca atmoswater.com Campbell & Company Public Relations 23195 96 Ave Box 770, Fort Langley V1M 2S2 Steve Campbell ..........................p: 604-888-5267 e: tech@ccom-pr.com ccom-pr.com

RSG Revenue Services Group 1151 8th Ave W, Vancouver V6H 1C5 Carla Elm ......... p: 604-800-4112 f: 604-733-7090 e: carla.elm@revenueservices.ca revenueservices.ca RSG Revenue Services Group is Western Canada’s premier SR&ED firm, offering full SR&ED claim development consulting and assessment of relevant government funding initiatives. Customers include some of B.C.’s best-known tech and manufacturing firms. Revenue Services Group advises most mid-tier accounting firms on SR&ED, interacts closely with the CRA and has associated resources nationwide and throughout North America.

DLA Piper (Canada) LLP 666 Burrard St Suite 2800, Vancouver V6C 2Z7 Chris Bennett... p: 604-687-9444 f: 604-687-1612 e: chris.bennett@dlapiper.com dlapiper.com Legal services for intellectual property, technology and outsourcing, video games and interactive entertainment, renewable energy and sustainable development.

Lawson Lundell LLP 925 Georgia St W Suite 1600, Vancouver V6C 3L2 Valerie Mann ... p: 604-408-5317 f: 604-641-2811 e: vcmann@lawsonlundell.com lawsonlundell.com Lawson Lundell’s Technology Group provides a wide range of legal services to technology companies at all stages.

Technology Incentives Inc 4639 3rd Ave W, Vancouver V6R 1N5 Richard Moore............................p: 604-331-4688 e: richard@techincentives.ca techincentives.ca Varshney Capital Corp 1055 Georgia St W Suite 2050 PO Box 11121, Vancouver V6E 3P3 Praveen Varshney .......................p: 604-684-2181 varshneycapital.com Devencore 555 Burrard St Suite 1155 PO Box 260, Vancouver V7X 1M8 Jon Bishop....... p: 604-681-3334 f: 604-681-5255 e: jbishop@devencore.com devencore.com

LEGAL SERVICES

7030

Dominion Sales & Marketing Services Inc 4170 Still Creek Dr Suite 200, Burnaby V5C 6C6 Tyler Dawson.........p: 778-783-0689 talkisbs.com

Alexander Holburn Beaudin + Lang LLP 700 Georgia St W Suite 2700, Vancouver V7Y 1B8 Christopher E Hirst .....................p: 604-484-1700 f: 604-484-9700 e: info@ahbl.ca ahbl.ca

Inside Information Inc 1279 Nicola St Suite 306, Vancouver V6G 2E8 Lois Sperling...............................p: 604-684-6434 e: admin@insideinformation.com insideinformation.com

Blake, Cassels & Graydon LLP 595 Burrard St Suite 2600 PO Box 49314, Vancouver V7X 1L3 Shayla Ryan................................p: 604-631-3369 e: shayla.ryan@blakes.com blakes.com

Jumpstart Sales & Marketing Inc 4170 Still Creek Dr Suite 200, Burnaby V5C 6C6 Tyler Dawson..............................p: 778-783-0689 jumpstartcorp.com

Borden Ladner Gervais LLP 200 Burrard St Suite 1200 PO Box 48600, Vancouver V7X 1T2 Geoffrey de Kleine .....................p: 604-687-5744 f: 604-687-1415 e: info@blg.com blg.com

Lead Generators International Sales & Marketing Group Inc 4170 Still Creek Dr Suite 200, Burnaby V5C 6C6 Tyler Dawson. p: 604-918-5078 clientfinders.com FINANCIAL SERVICES

7020

Discovery Parks Investments/Nimbus Synergies 610 Main St Suite 400, Vancouver V6A 2V3 Laura Cassin ...............................p: 604-734-7275 e: lauracassin@discoveryparks.com discoveryparks.com

00_BC Tech 2019_64p_2.indd 59

Clark Wilson LLP 885 Georgia St W Suite 900, Vancouver V6C 3H1 David Ford ....... p: 604-687-5700 f: 604-687-6314 e: dford@cwilson.com cwilson.com Neil Melliship.. p: 604-687-5700 f: 604-687-6314 e: nmelliship@cwilson.com cwilson.com Providing a full range of legal services to technology businesses: financing from early stage to U.S. and Canadian public markets, intellectual property protection, enforcement, and commercialization, company formation and governance, M&A transactions, employment, privacy, tax and cross-border immigration – IT, clean tech, e-commerce, digital media, new media and outsourcing.

MBM Intellectual Property Law 555 Hastings St W Suite 2610, Vancouver V6B 4N6 Stuart Bristowe p: 604-669-4350 f: 604-669-4351 e: sbristowe@mbm.com mbm.com

Fasken Martineau DuMoulin LLP 550 Burrard St Suite 2900, Vancouver V6C 0A3 William Westeringh ...................p: 604-631-3131 f: 604-631-3232 e: vancouver@fasken.com fasken.com Gowling WLG (Canada) LLP 550 Burrard St Suite 2300, Vancouver V6C 2B5 Jenny Grimes .............................p: 604-891-2787 e: jenny.grimes@gowlingwlg.com gowlingwlg.com McCarthy Tétrault LLP 745 Thurlow St Suite 2400, Vancouver V6E 0C5 Selena Brown .. p: 604-643-1000 f: 604-685-7832 e: info@mccarthy.ca mccarthy.ca McMillan LLP 1055 Georgia St W Suite 1500 PO Box 11117, Vancouver V6E 4N7 Karl Gustafson. p: 604-689-9111 f: 604-685-7084 e: info@mcmillan.ca mcmillan.ca Harper Grey LLP 650 Georgia St W Suite 3200, Vancouver V6B 4P7 Prentice Durbin p: 604-895-2903 f: 604-669-9385 e: pdurbin@harpergrey.com harpergrey.com We team with startups, emerging and mature companies to help them achieve their objectives. We provide counsel, guidance and creative and practical solutions.

Canada Drives 555 Burrard St Suite 600 Bentall Two, Vancouver V7X 1M8 ..........p: 888-865-6402 canadadrives.ca CCC Investment Banking 400 Burrard St Suite 450, Vancouver V6C 3A6 Hugh Notman .............................p: 604-689-2495 e: hnotman@cccinvestmentbanking.com cccinvestmentbanking.com

Farris LLP 700 Georgia St W Suite 2500 Box 10026 Pacific Centre, Vancouver V7Y 1B3 Chelsea Birnie . p: 604-684-9151 f: 604-661-9349 e: cbirnie@farris.com farris.com

Norton Rose Fulbright LLP 510 Georgia St W Suite 1800, Vancouver V6B 0M3 Janet Grove ..... p: 604-687-6575 f: 604-641-4949 e: janet.grove@nortonrosefulbright.com nortonrosefulbright.com/ca/en

Koffman Kalef LLP 885 Georgia St W Suite 1900, Vancouver V6C 3H4 Mark E Wong .. p: 604-891-3688 f: 604-891-3788 e: info@kkbl.com kkbl.com Oyen Wiggs Green & Mutala LLP 601 Cordova St W Suite 480, Vancouver V6B 1G1 ........... p: 604-669-3432 f: 604-681-4081 e: mail@patentable.com patentable.com

2019-06-10 2:35 PM


60 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

Services

Sustainable Technologies

Tekworks | Tek Services Group Inc 8207 Swenson Way Suite 8, Delta V4G 1J5 Gary Sawall ..... p: 604-543-7230 f: 604-543-0313 e: info@tekworks.ca tekworks.ca

GREEN BUILDING & SUSTAINABLE PLANNING SERVICES

VenturePlus Partners 3806 33rd Ave W, Vancouver V6N 2H6 Garth Edgar ................................p: 604-727-3610 e: gedgar@ventureplus.ca ventureplus.ca RECRUITING

Stikeman Elliott LLP 666 Burrard St Suite 1700, Vancouver V6C 2X8 Michael Urbani p: 604-631-1340 f: 604-681-1825 e: murbani@stikeman.com stikeman.com PROFESSIONAL SERVICES

7050

247 Networks Ltd 1515 Broadway St Suite 208, Port Coquitlam V3C 6M2 George Hsu.................................p: 604-592-2473 e: hello@247networks.ca 247networks.ca Aquilon Software Inc 8557 Government St Suite 102, Burnaby V3N 4S9 ...p: 877-810-8787 aquilonsoftware.com

7075

Affinity 2985 Virtual Way Suite 275, Vancouver V5M 4X7 Daniel Lamb ...............................p: 604-562-7584 e: info@affinity-group.ca affinity-group.ca Corporate Recruiters Ltd 151 Hastings St W Suite 313, Vancouver V6B 1H4 ......................................p: 604-639-9560 e: careers@corporate.bc.ca corporate.bc.ca Elevate Search Group Ltd 777 Hornby St Suite 600, Vancouver V6Z 2H7 Allan Welyk ................................p: 604-678-5627 e: allan@elevatesearchgroup.com elevatesearchgroup.com

Odgers Berndtson 1066 Hastings St W, Vancouver V6E 3X1 Elaine Grotefeld .........................p: 604-676-0400 e: elaine.grotefeld@odgersberndtson.com odgersberndtson.com Odgers Berndtson is a leading global executive search and leadership advisory firm with deep expertise in tech and cleantech. Swim Recruiting 601 Cordova St W Suite 330, Vancouver V6B 1G1 Simon Wood.... p: 604-689-7946 f: 604-689-7950 e: info@swimrecruiting.com swimrecruiting.com OTHER

7000

BC Tech Association 887 Great Northern Way Suite 101, Vancouver V5T 4T5 ............ p: 604-683-6159 f: 604-683-3879 e: info@wearebctech.com wearebctech.com

A-Z World Translation and Interpretation Inc 704 Maurelle Crt, North Vancouver V7R 2M1 Ana Maria Zuñiga ......................p: 604-351-3615 e: am@a-zworld.ca a-zworld.ca

Chemetics Inc 2930 Virtual Way Suite 200, Vancouver V5M 0A5 Andrew Barr .... p: 604-734-1200 f: 604-734-0340 e: chemetics.info@jacobs.com jacobs.com/chemetics

BenefitDeck Consulting Ltd 422 Richards St Suite 170, Vancouver V6B 2Z4 Alex Miljkovic.. p: 877-318-1812 f: 604-909-2641 e: info@benefitdeck.com benefitdeck.com CBRE Ltd 1021 Hastings St W Suite 2500, Vancouver V6E 0C3 Norm Taylor ..... p: 604-662-3000 f: 604-684-9368 e: norm.taylor@cbre.com cbre.ca

GO Recruitment 601 Broadway W Suite 400, Vancouver V5Z 4C2 Raymond To ................................p: 604-871-4166 e: raymond@gorecruitment.com gorecruitment.com

City of Coquitlam - Economic Development 3000 Guildford Way, Coquitlam V3B 7N2 David Munro...............................p: 604-927-3442 e: economicdevelopment@coquitlam.ca coquitlam.ca/economicdevelopment

CMC Engineering & Management Ltd 1160 Douglas Rd Suite 300, Burnaby V5C 4Z6 Lucio Sacchetti p: 604-294-6483 f: 604-294-0457 e: info@cmcengineering.com cmcengineering.com

IT/IQ Tech Recruiters 1111 Georgia St W Suite 680, Vancouver V6E 4M3 Feras Elkhalil ..............................p: 604-294-1200 e: info@it-iq.com it-iq.com

HR Tech Group PO Box 38024, Vancouver V5Z 4L9 Stephanie Hollingshead .............p: 604-874-2653 e: shollingshead@hrtechgroup.com hrtechgroup.com

Ernst & Young LLP 700 Georgia St W Suite 1600 Box 10101, Vancouver V7Y 1C7 Richard Mockett .........................p: 604-891-8456 f: 604-643-5422 e: richard.mockett@ca.ey.com ey.com

Miles Employment Group Ltd 55 Water St Suite 603, Vancouver V6B 1A1 Sandra Miles ..............................p: 604-694-2500 e: sandra@miles.ca miles.ca

SUSTAINABLE TECHNOLOGIES AIR POLLUTION ABATEMENT EQUIPMENT, NOISE/VIBRATION EQUIPMENT 5010

Envirotech Air Inc 17358 104A Ave Suite 8, Surrey V4N 5M3 George Daschko .........................p: 604-951-2330 f: 604-951-2335 e: enviropc@telus.net envirotechbc.com

HUB International Insurance Brokers 470 Granville St Suite 1001, Vancouver V6C 1V5 Derek May ....... p: 604-331-5464 f: 604-269-1001 e: derek.may@hubinternational.com hubtechnology.ca LingoStar Language Services 6491 12th Ave, Burnaby V3N 2J4 Lenka de Graafova .....................p: 604-629-8420 f: 866-714-3189 e: info@lingo-star.com lingo-star.com McNamara Communications 1527 Myrtle Ave, Victoria V8R 2Z7 Tom McNamara..........................p: 250-896-5936 e: info@mcnamaracommunications.com mcnamaracommunications.com PwC Canada 250 Howe St Suite 1400, Vancouver V6C 3S7 Cameron Burke/ Rob Coard........p: 604-806-7000 f: 604-806-7806 e: info@ca.pwc.com pwc.com/ca

00_BC Tech 2019_64p_2.indd 60

ENVIRONMENTAL MONITORING & INSTRUMENTATION

Modis Canada Inc 505 Burrard St Suite 1150, Vancouver V7X 1M4 Sascha Pogor..............................p: 604-689-8717 e: sascha.pogor@modis.com modis.com MountainCrest Personnel Inc 1384 Haversley Ave, Coquitlam V3J 1V3 Harvey Fishman ..........................p: 604-377-9055 e: harvey@peakpeople.ca mountaincrestpersonnel.com

5040

Avid Consulting Group Ltd 610 Granville St Suite 3113, Vancouver V6C 3T3 Jo Anne Gin................................p: 778-317-8814 e: joanne.gin@avidconsulting.ca avidconsulting.ca

5030

CD Nova Ltd 19353 22 Ave Suite 110, Surrey V3Z 3S6 Bruce Fleming.. p: 604-430-5612 f: 604-437-1036 e: bfleming@cdnova.com cdnova.com SMT Research Ltd 1089 East Kent Ave N Suite 103, Vancouver V5X 4V9 Jason Teetaert ...........................p: 778-373-2070 e: info@smtresearch.ca smtresearch.ca

GOGREEN Environmental Consulting Inc 3050 Gordon Ave Unit 3, Coquitlam V3C 4S7 Erling Kjerside ............................p: 604-944-1113 e: erling@gogreenwastewater.com gogreenwastewater.com Lockhart Industries Ltd PO Box 784, Duncan V9L 3Y1 Doug Lockhart . p: 250-748-1731 f: 250-743-4570 e: sales@lockhart.ca lockhart.ca Urban Systems Ltd 1090 Homer St Suite 550, Vancouver V6B 2W9 Ila Sutherland .............................p: 604-235-1701 e: vancouver@urbansystems.ca urbansystems.ca HAZARDOUS/SOLID WASTE MANAGEMENT

5050

Binpal Engineering Ltd 8232 120 St Suite 215, Surrey V3W 3N4 Jas Binpal........ p: 604-596-3815 f: 604-596-5194 e: info@binpaleng.com binpaleng.com INFORMATION SYSTEMS FOR SUSTAINABLE RESOURCE MANAGEMENT

5060

Computrol Systems Inc 8537 Commerce Crt, Burnaby V5A 4N4 Joshua Rottenberg .....................p: 604-421-1001 f: 604-421-1007 e: info@computrolsystems.com computrolsystems.com Envirochem Services Inc 267 Esplanade W Suite 206, North Vancouver V7M 1A5 .......... p: 604-986-0233 f: 604-986-8583 e: response@envirochem.com envirochem.com Hatch 1066 Hastings St W Suite 400, Vancouver V6E 3X2 Mellissa Winfield-Lesk ..............p: 604-689-5767 f: 604-689-3918 hatch.com Optigo Networks 555 Hastings St W Suite 1200, Vancouver V6B 4N6 Monica McMahen......................p: 778-373-0912 e: monica@optigo.net optigo.net SITE REMEDIATION

5090

NEXT Environmental Inc 2550 Boundary Rd Suite 215, Burnaby V5M 3Z3 Harm Gross...... p: 604-419-3800 f: 604-419-3801 e: hgross@nextenvironmental.com nextenvironmental.com WATER & WASTE-WATER TREATMENT: WATER CONSERVATION EQUIPMENT 5100

Acuva Technologies Inc 3771 North Fraser Way Unit 1, Burnaby V5J 5G5 Manoj Singh ...............................p: 800-980-8810 e: info@acuvatech.com acuvatech.com BQE Water 900 Howe St Suite 250, Vancouver V6Z 2M4 Patrick Littlejohn ........................p: 604-685-1243 f: 604-685-7778 e: info@bqewater.com bqewater.com

2019-06-10 2:35 PM


| 61

Sustainable Technologies

ECO-TEK Ecological Technologies Inc PO Box 309 Stn Fort Langley, Langley V1M 2R6 Kimron Rink ................................p: 778-298-6835 e: kimron@ecotek.ca ecotek.ca

Wireless

WIRELESS COMPONENTS, INFRASTRUCTURE & DEVICES 6010

McCue Engineering Contractors 8291 92 St Suite 203, Delta V4G 0A4 Chris McCue ...............................p: 604-940-2828 e: info@mccuecontracting.com mccuecontracting.com OTHER

Norsat International Inc 4020 Viking Way Suite 110, Richmond V6V 2L4 ............ p: 604-821-2800 f: 604-821-2801 e: marcom@norsat.com norsat.com

Pacific CoastCom 3855 Henning Dr Suite 109, Burnaby V5C 6N3 Greg Casault.... p: 604-299-8180 f: 604-299-8179 e: sales@pcoast.ca pcoast.ca

Samsung R&D Canada/Samsung Electronics Canada Ltd 565 Great Northern Way Suite 700, Vancouver V5T 0H8 ...............p: 604-484-1160 samsung.com

PayByPhone Technologies Inc 1168 Hamilton St Suite 403, Vancouver V6B 2S2 ......................................p: 778-953-2490 e: marketing@paybyphone.com paybyphone.com

Testforce Systems Inc 34255 Larch St, Abbotsford V2S 2P7 Chris Sztuhar ... p: 604-557-0715 f: 403-202-2016 e: chris@testforce.com testforce.com

5000

BCIT School of Construction and the Environment Burnaby Campus, 3700 Willingdon Ave, Burnaby V5G 3H2 .....p: 604-434-5734 bcit.ca/construction BC Tech Association 887 Great Northern Way Suite 101, Vancouver V5T 4T5 ............ p: 604-683-6159 f: 604-683-3879 e: info@wearebctech.com wearebctech.com

4th Utility Inc 2526 Davies Ave, Port Coquitlam V3C 4T7 Jeff Lewis........ p: 604-941-4440 f: 604-941-4433 e: jlewis@fouru.com fouru.com

First Light Technologies 3303B Tennyson Ave, Victoria V8Z 3P5 Scott Daly ...................................p: 844-279-8754 e: info@firstlighttechnologies.com firstlighttechnologies.com

AFL 7485 130 St Suite 200, Surrey V3W 1H8 ....................................p: 778-590-2000 e: ns-communications@aflglobal.com aflglobal.com Netcetera Consulting Inc 828 Harbourside Dr Suite 205, North Vancouver V7P 3R9 Steve Weeks ..............................p: 604-980-2700 e: steve@netcetera.ca netcetera.ca

Valhalla Systems Inc 160 Bannister Rd, Bowen Island V0N 1G1 John Turner ................................p: 604-947-2196 e: johnt@valhalla-systems.com valhalla-systems.com ENABLING SOFTWARE

6020

Eventbase Technology Inc 1280 Homer St, Vancouver V6B 2Y5 ......................................p: 604-568-2988 e: info@eventbase.com eventbase.com WIRELESS APPLICATIONS

OTHER

6000

BC Tech Association 887 Great Northern Way Suite 101, Vancouver V5T 4T5 ............ p: 604-683-6159 f: 604-683-3879 e: info@wearebctech.com wearebctech.com Star Solutions International Inc 4600 Jacombs Rd Suite 120, Richmond V6V 3B1 Myles Lu .....................................p: 604-276-0055 e: myles.lu@starsolutions.com starsolutions.com

6030

Mogo Finance Technology Inc 401 Georgia St W Suite 2100, Vancouver V6B 5A1 Christy Cameron .......... p: 604-659-4380 mogo.ca

PRINT | DIGITAL | VIDEO | PODCAST | EVENTS | MAGAZINES

Trusted content. Integrated solutions. Business in Vancouver is BC’s most significant voice of local business news and information. We write, broadcast and post across seven platforms—print, digital, video, podcasts, magazines and special events—as one of Canada’s leading integrated media companies. For three decades we’ve successfully connected organizations like yours with the business audience and community.

Get Connected | Call: 604-688-2398 or email: ads@biv.com

00_BC Tech 2019_64p_2.indd 61

2019-06-10 2:35 PM


62 |

BC TECH 2019 PUBLISHED BY BUSINESS IN VANCOUVER

INDEX

1stDataRecovery.com, 54 3LOG Systems Inc, 54 4th Utility Inc, 57, 58, 61 14 Oranges Software Inc, 54 247 Networks Ltd, 60 A ABC Communications, 54 AbCellera, 52 ABM Applied Biological Materials Inc, 53 Absolute, 54 AccSys Solutions Inc, 54 Acumen Computing Services Ltd, 57 Acuva Technologies Inc, 60 Advance Connexions Inc, 57 Advanced Computer Networking Systems Inc, 54 Advisor Websites, 54 Aequilibrium Software Inc, 54 Aero Geometrics Ltd, 54 Affinity, 60 AFL, 61 Agentic Communications Inc, 57 Alandale Training Corp, 54 Alectos Therapeutics, 52 Alexander Holburn Beaudin + Lang LLP, 59 Algo Communication Products Ltd, 56 All Inclusive Marketing, 58 Amgen British Columbia Inc, 52 Ampco Manufacturers Inc, 54 AnalysisWorks, 54 Analytic Systems Ware (1993) Ltd, 53 Andornot Consulting Inc, 54 Annex Consulting Group Inc, 54 Ansatel Communications Inc, 56 Answer Co, The, 54 Appazur Solutions Inc, 54 Applied Electronics Ltd, 58 Aprio Inc, 54 Aquilon Software Inc, 54, 59, 60 Arbutus Biopharma Corp, 52 Article, 58 Artist/Designer Kim Hunter/Indigo, 57 Artron BioResearch Inc, 52 Aspect Biosystems Ltd, 53 Atmoswater Research, 59 Atomic Cartoons Inc, 57 AvenueHQ, 54 Avid Consulting Group Ltd, 60 AV Solutions BC Ltd, 58 A-Z World Translation and Interpretation Inc, 60 B Backlot Media, 58 Ballard Power Systems Inc, 53 Bardel Entertainment Inc, 57 Bayleaf Software Inc, 58 BCIT Aerospace Technology Campus, 52 BCIT School of Business, 58 BCIT School of Computing and Academic Studies, 57 BCIT School of Construction and the Environment, 61 BCIT School of Energy, 53 BCIT School of Health Sciences, 53 BC Tech Association, 52, 53, 57, 58, 60, 61 BDO Canada LLP, 58 Bell Canada, 56 Bench, 54 BenefitDeck Consulting Ltd, 60 Binary Stream Software, 54 Binpal Engineering Ltd, 60 Biolux Research Ltd, 52 BioLytical Laboratories Inc, 52 Blackbird Interactive, 57 Blake, Cassels & Graydon LLP, 59 Blue System Integration Ltd, 54 Boeing Vancouver, 54 Borden Ladner Gervais LLP, 59 BQE Water, 60 BRI Biopharmaceutical Research Inc, 53 Briteweb, 58 BroadbandTV Corp, 58 BSM Technologies, 57 Burrard Pharmaceuticals, 52 Burst! Creative Group, 57, 58 C Cadex Electronics Inc, 54 Campbell & Company Public Relations, 59 Canada Drives, 59

00_BC Tech 2019_64p_2.indd 62

Catalyst Agri-Innovations Society, 52 Catalyst Healthcare, 55 CBRE Ltd, 60 CBVL Robotics Inc, 53 CCC Investment Banking, 59 CCI Canadian Circuits Inc, 54 C-DAT Systems Inc, 55 CD Nova Ltd, 60 Change Healthcare Imaging, Workflow & Care Solutions, 55 Chemetics Inc, 60 Chinook Power Corp, 53 Cinesite, 57 City of Coquitlam - Economic Development, 60 CityWest Cable and Telephone Corp, 56 CityXpress Ltd, 54 Clark Wilson LLP, 59 Clevest, 53, 55 Clio (Themis Solutions Inc), 55 CMC Engineering & Management Ltd, 60 Coalition, The, 57 Coda Research Corp, 53 CommandWear Systems Inc, 55 Computrol Systems Inc, 60 Copperleaf, 55 Corporate Recruiters Ltd, 60 Corvus Energy Inc, 53 CounterPath, 55, 56, 57 CREW Marketing Partners, 58 Cryptek Labs, 58 CTF MEG International Services LP, 52 CuePath Innovation Inc, 57 D Dali Wireless Canada Inc, DataRecoveryBC.com, 55 Datrend Systems Inc, 52 DelMar Pharmaceuticals Inc, 52 Delta-Q Technologies Corp, 53 Devencore, 59 Digital Domain, 57 Discerning Systems Inc, 55 Discovery Parks Investments/Nimbus Synergies, 59 DLA Piper (Canada) LLP, 59 DNEG, 57 Domain7, 58 Dominion Sales & Marketing Services Inc, 59 Dorigo Systems Ltd, 54 E East Side Games, 57 eBridge Marketing Solutions, 58 Echelon Media Group Ltd, 57 ECL Computing, 55 ECO Fuel Systems Inc, 53 ECO-TEK Ecological Technologies Inc, 61 E-Cubed Media Synthesis Inc, 57, 58 Electronic Arts, 57 Elevate Search Group Ltd, 60 Emily Carr University of Art + Design, 57 Enbala Power Networks Inc, 53 Engine Digital Inc, 58 Enigma Interconnect, 54 Envirochem Services Inc, 60 Envirotech Air Inc, 60 eproval, 57 Equicare Health, 55 Ernst & Young LLP, 58, 60 Etalim Inc, 53 Eventbase Technology Inc, 61 F Faradyne System Group Inc, 52 Farris LLP, 59 Fasken Martineau DuMoulin LLP, 59 Fatigue Science, 55 FCV Technologies Ltd, 58 FinancialCAD Corp (FINCAD), 55 Finger Food, 58 First Light Technologies, 61 Flir Integrated Imaging Solutions Inc, 54 Form3 Design Inc, 54 Fortinet Inc, 57 Free Spirit Media, 58 Freethem Generation Inc, 53 FuseFX, 57 G Galvanize, 55 General Fusion Inc, 53

Genome BC, 53 GenomeMe Canada, 52 Gens Software Ltd, 55 GenXys, 55 GeoTalent by GeoMetrix (the Evolution of TrainingPartner), 55 Glacier Digital, 58 Glentel Inc, 56 Globalme Localization Inc, 55 Global Relay, 55 Go2 Productions Inc, 57 GOGREEN Environmental Consulting Inc, 60 Goldtooth Creative Agency Inc, 57 good natured Products Inc, 52 GO Recruitment, 60 Gowling WLG (Canada) LLP, 59 Graphically Speaking Services Inc, 58 Gravit-e Technologies Inc, 55 Greenlane Biogas North America Ltd, 53 Greenlight Innovation Corp, 53 Grow Technologies, 55 H Hakai Energy Solutions Inc, 53 Harper Grey LLP, 59 Hatch, 60 Helm Operations, 55 Hootsuite, 58 HR Tech Group, 60 HUB International Insurance Brokers, 60 I Idea Rebel, 58 Image Engine Design Inc, 57 Industrial Light & Magic Vancouver, 57 INETCO Systems Ltd, 55 Infogenetica Solutions Inc, 53 Ingenuity Works, 57 Innergex Renewable Energy Inc, 53 Innsource Solutions Inc, 55 Inside Information Inc, 59 intelliNet, 57 Intense Technologies Inc, 55 Intergalactic Agency Inc, 57 Intra Systems Ltd, 56 Inventys Inc, 53 Ion Brand Design, 57 IT/IQ Tech Recruiters, 60 i-worx Enterprises Inc, 55 J James Evans & Associates Ltd, 55 JDV Consulting, 55 Jelly Digital Marketing & PR , 58 JenTekk Web Solutions Co, 58 Jostle Corp, 55 Jumpstart Sales & Marketing Inc, 59 K Kardium Inc, 52 Kashoo Systems Inc, 55 KIMBO Design Inc, 57 Kinexus Bioinformatics Corp, 53 Kobelt Development Inc, 55 Koffman Kalef LLP, 59 L Lara Spence Web Design + Business Writing, 58 Lawson Lundell LLP, 59 Lead Generators International Sales & Marketing Group Inc, 59 Lee Gabel Design & Visual Effects, 58 Legend Power Systems Inc, 53 Lendesk, 57 LifeLabs Medical Laboratory Services, 53 Line49 Design Group Inc, 57 LingoStar Language Services, 60 LivaNova Canada Corp, 52 LMI Technologies, 54 Lockhart Industries Ltd, 60 Loop Energy Inc, 53 M M2O Digital Agency, 58 MagicLogic Optimization Inc, 55 Major Tom, 58 MBM Intellectual Property Law, 59 McCarthy Tétrault LLP, 59 McCue Engineering Contractors, 61 McMillan LLP, 59 McNamara Communications, 60 MDA, 57 MediaStreams Communications,

Medinet Health Systems Inc, 55 Message Impact Systems Inc, 57 Metal Action Machining Ltd, 52 MeZine Inc, 58 MGX Renewables Inc, 53 Microzip Data Solutions Inc, 55 Miles Employment Group Ltd, 60 Mil-Sted Data Products Ltd, 56 Mindful Garden Digital Health Inc, 52 MNP LLP, 58 Modis Canada Inc, 60 Mogo Finance Technology Inc, 61 Motion Metrics International Corp, 53 MountainCrest Personnel Inc, 60 Mountain Interactive Inc, 58 MRX Solutions Corp, 55 N Nanotech Security Corp, 53 NATGisIT, 56 Navigata Communications Ltd, 56 Neovasc Inc, 52 Nero Global Tracking, 55 Netcetera Consulting Inc, 61 NEXT Environmental Inc, 60 Nexterra Systems Corp, 53 Next Level Games, 57 Noise Digital Inc, 58 Norsat International Inc, 61 North49 Business Solutions Inc, 58 Norton Rose Fulbright LLP, 59 Novelogics Biotechnology Inc, 52 Novus Entertainment Inc, 54, 56 O Oak Bay Softrends Inc, 55 Oaxaca Studio, 57 Odgers Berndtson, 60 Optigo Networks, 60 OXD, 58 Oyen Wiggs Green & Mutala LLP, 59 P Pacific CoastCom, 61 Pacific Insight Electronics Corp, 54 Pacific Tier Solutions Inc, 55 Palcan Energy Corp, 53 Paramount Computers Ltd, 55 Pathway Design & Manufacturing Inc, 54 Patrick Turner Studios, 57 PayByPhone Technologies Inc, 61 PDFTron Systems Inc, 55 Peerforma, 52 Phase 1 Systems Corp, 54 Pintacle Systems Inc, 57 PixelGems Software, 58 PlaceSpeak Inc, 57 Plan B Energy Storage (PBES), 53 PNI Digital Media, 58 PowerPal Micro-Hydroelectric Generators, 53 Powershifter, 57, 58 Powertech Labs Inc, 54 Pro Exp Media Inc, 58 Progressa, 55 PromoKeychain.com Custom USB Flash Drives, 58 Pro Wings Aviation Ltd, 52 PwC Canada, 60 Q Quadrogen Power Systems Inc, 53 Quartech, 55 Qu Biologics Inc, 52 R Rainforest Automation Inc, 53 Real Estate Webmasters, 58 Realtor.com, 55 Recreation Sport Management Inc, 55 Redbrick Technologies Inc, 55 ReFlex Wireless Inc, 52 RepliCel Life Sciences, 52 Resonance Software Inc, 55 Richway EnvirTech Ltd, 53 Rise People, 56 Rogers Communications, 56 RSG Revenue Services Group, 59 Russell Technologies, 54 S Sage, 56 salonMonster, 56 Samlex America, 53 Samsung R&D Canada/Samsung Elec-

tronics Canada Ltd, 61 Santel Communications, 56 SAP Canada Inc, 56 SchedulePro by EDP Software, 56 Schneider Electric Canada, 53 SendtoNews, 58 Shaw Communications Inc, 56 Sierra Systems, an NTT DATA Company, 57 SilkStart Technology, 56 Skybox Labs, 58 Skyway West, 54, 56 Smart Hotel Software Inc, 56 Smoking Gun Interactive Inc, 58 SMT Research Ltd, 60 Smythe LLP, 58 Snaptech Marketing, 58 Softlanding Solutions Inc, 56 Softree Technical Systems Inc, 56 Sony Pictures Imageworks, 57 Sophos Inc, 56 SpeedLine Solutions Inc, 56 S-P International Inc, 54 Squirrel Systems, 56 Stallion Manufacturing Inc, 52 StandardFusion, 56 StarFish Medical, 52 StarGarden Corp, 56 Stargate Connections Inc, 54 Star Solutions International Inc, 61 Stemcell Technologies Inc, 53 Stikeman Elliott LLP, 60 StudioIMI, 58 Superion Inc, 57 SustaiNet Software International Inc, 56 Swim Recruiting, 60 Switch United, 56 Synergy Computer Consulting Ltd, 56 Synetic Inc, 54 T Tangram Design Ltd, 54 Tantalus Systems Corp, 53 Technology Incentives Inc, 59 Tecnet Canada Inc, 56 Tekworks | Tek Services Group Inc, 60 Telus Corp, 56 TeraSpan Networks Inc, 56 Testforce Systems Inc, 52, 53, 54, 61 Thinking Ape Entertainment Ltd, A, 58 Thoughtexchange, 56 TLD Computers and CustomWorks - A Division of London Drugs Ltd, 56, 58 TMC IT and Telecom Consulting, 56 Traction on Demand, 56 Tri-M Technologies Inc, 54 Trulioo, 56 TwoTonic Labs Inc, 56 U Unilogik Systems Inc, 56 Uniserve Communications Corp, 56 Urban Systems Ltd, 60 V Valhalla Systems Inc, 61 Vandelta Communication Systems Ltd, 56 Varshney Capital Corp, 59 Vecima Networks Inc, 56 Velora Systems Inc, 56 VenturePlus Partners, 60 Vibratec Management Inc, 52 Vigil Health Solutions Inc, 52 Visier, 56 Vision Critical, 56 Vmax Systems Inc, 57 VREC - Vancouver Renewable Energy, 53 W Webnames.ca Inc, 54 Wellons Canada, 53 West Mobile Mounts Inc, 57 Westport Fuel Systems Inc, 53 WEX Pharmaceuticals Inc, 53 WiderFunnel Marketing Inc, 58 World Exposure, 58 X Xenon Pharmaceuticals Inc, 53 Xodo Technologies Inc, 56 Z Zapp Worx Design, 58 Zymeworks Inc, 53

2019-06-10 2:36 PM


00_BC Tech 2019_64p_2.indd 63

2019-06-10 2:36 PM


Scale, UHGHÄ&#x;QHG Helping tech companies unlock their next stage of value

pwc.com/ca/tech

Put us in your corner

Š 2019 PricewaterhouseCoopers LLP, an Ontario limited liability partnership. All rights reserved.

00_BC Tech 2019_64p_2.indd 64

2019-06-10 2:36 PM

Profile for Business in Vancouver Media Group

BC TECH 2019  

BC TECH 2019