Issuu on Google+

Bali Advertiser

e-paper

now on-line

www.baliadvertiser.biz

ADVERTISING FOR THE EXPATRIATE COMMUNITY

14 Nov - 28 Nov 2012

Business Hours Monday to Friday from 8:30 - 4:00 Jl. Majapahit No. 46, Kuta Tel : [0361] 755 392 [Hunting] - Fax : [0361] 764 191 E-mail: info@BaliAdvertiser.biz Website: www.BaliAdvertiser.biz

Photo Copyright Ida Bagus Ngurah Primarta <ibnprimarta@yahoo.co.id>

C/Ns/G-14 Nov. 12


Bali Advertiser

14 November - 28 November, 2012

2

For Sale; Boys BMX bike Rp. 250.000, goes well. Call 0813 3701 4332. Kuta. [044]

IN THIS ISSUE 5 72 - 75 69 86 77 71 75 75 71 69 71 29 58 * 40 * 6 35 36 * 8, 70 & 76 15 33 44 * 60 46 * * 50 26 68 30 81 14 * 69 42 21 17 27 78 79 20 80 10 62 32 31 48 38 59 18 28 14 22 16 66 34 31 -

58 47 65 21 30 15 27 17 71 37 33

ADVERTS

Cars, Motorcycles, Water Craft, etc. Employment Hello Ads Looking For Real Estate Pet Parade

For Sale; Sony Ericson Xperia Mini Android phone very good condition, boxed bought for Rp. 2.2 juta, sell for Rp. 1.1 juta nego. Contact 0831 1428 7888. Denpasar. [037]

ANNOUNCEMENTS

Bali Rainbow Community BIWA Christmas Charity Bazaar Canggu Club Christmas Gift Fair 2012 Intocht Sinterklaas 2012

For Sale; Teak shelves L=120cm, W=45cm, H=150cm, Rp. 3 million. Teak shelves L=110cm, W=45cm, H=130cm, Rp. 2 million. Teak shelves L=140cm, W=45cm, H=142cm, Rp. 2.2 million. 0878 6152 2859 / <indiego_ dk@yahoo.com>. Seminyak. [034]

www.the-o-party.com

CASA 8, Jl. Wayan Gentuh Br. Kwanji - Dalung 0361 - 780 1238 08123 941986 cbudiharsa@yahoo.com

KID'S PARTY (Games, Decoration, Jumping Castle, Magician, Art/Craft, etc) EFFECTS (Snow/bubble machine, Exploding Balloon, Balloon drop) CUTLERIES RENTAL (Tables, Chairs, Napkins, Marquee, etc)

INFORMATION

C/Ns/I-11 Jan 12

Art & Artists Bali Advertiser Calendar Bali Red Cross Community Groups

Bali Advertiser

FEATURES

All About Kids ... (every other issue) Anti Aging News ArtWords ... (returns later) BA Crossword Bali Eats Restaurant Bali Eats Update Bali Explorer ... (every other issue) BA Feature Article Bali PC Advisor Business Spotlight DVD Diary Eco Buzz ... (returns later) Fixed Abode Food Glorious Food From the Sea ... (every other issue) Gadgets Galore ... (every other issue) Garden Doctor Global Goings On Greenspeak Hector’s Diary Horoscope Kulture Kid Money Matters ... (every other issue) Nom de plume Paradise ... In Sickness & In Health Pathways Retail Therapy Say What? Schedule That Siapa...? The Business Builders Series The Frugal Balinist This Sporting Life Toko Buku Ubud News Ubud Writers & Readers Festival

Published by : PT. CITRA BALI ADVERTISER Licence : SIUPP No. 1593/SK/MENPEN/SIUPP/1999 General Manager Office Manager Marketing Graphic Design

iPhone 2G,3G,3GS,4/4S, iPad1,2,3 iPod Touch 2G,3G,4G

Unlock Permanently: iPhone: 4, 4S, 5

Call Now!! +6281237590000 (Eric) +6281999007171 NC/Ns/A-17 Oct 12

Official English language media for the Direktorat Jenderal Pajak (Bali Tax Office)

E AT T S

E 96 AL 2 -

RE

SERVICE & SPAREPARTS:

Address : Jl. Majapahit No. 46 Kuta, Badung, Bali Phone : 755 392 [Hunting] Fax : 764 191 E-mail : <info@BaliAdvertiser.biz> Printed By : PT. Temprina Media Grafika Jl. Imam Bonjol 129 Tegal Besar, Jember Phone : +62 331-320 300 Email : online@temprinajember.com

SECTIONS

Bali House & Home Body & Spirit Building & Maintenance Business & Travel Cargo & Export Computer & Internet Education & Family Fashion Local News Restaurant & Nightlife Ubud Area

: Made Wardiyasa : Ratih Utari : Ketut Brata Ketut Ferry Kuswara Indhy Tobing : Gede Merta Karya Gede Muliawan

SPECIALIST

iPhone, iPad & iPod Touch Sale Brand New: iPhone 5 (16gb,32gb,64gb)

8

www.BaliAdvertiser.biz

Nothing in Bali Advertiser can be reproduced in whole or in part, either in print based media or in internet based media, without the written permission of the publisher. Bali Advertiser is not responsible for the content of any advertisement. Opinions expressed in any article are that of the writer and not the opinions of Bali Advertiser.

Copyright © 2012 - all rights reserved C/R/G-14 Nov. 12

C/Ns/G-31 Oct. 12

JL. BY PASS NGURAH RAI - 1 km from Statue Dewa Ruci Just Before Mitra 10

C/Ns/G-2 Nov 11

C/Ns/G-11 Jan. 12


C/Ns/I-14 Nov 12


14 November - 28 November, 2012

4

Every Sunday 8am - 6pm at Plaza Amata, GWK, Jimbaran  FRESH PRODUCE & FLOWERS FOOD & BEVERAGES  FASHION & ACCESSORIES  Games & Play Area  Face Painting  Fun Competitions  Art & Craft

FREE ENTRY

Bring your bikes & skateboards and let’s have fun...

For Sale; Vinyl records (LP) in perfect condition. 60’s, 70’s, 80’s, rock, pop, soul music. Pink Floyd, Beatles, Tina Turner, James Brown, Deep Purple, Isaac Hayes, etc. From Rp. 100.000 each. Call 0819 9974 5109. Sanur. [046] Looking for; Donators to give away good second hand furnitures for school in Gianyar. We are building kids doctor room for students. Need single bed with mattrass, small table, chairs, etc. Contact : <saskara_dilla@yahoo. com>. [040] Daring ideas are like chessman moved forward; they may be beaten, but they may start a winning game.

Bazaar booth & more info: Vonny 746047, Susan 8780599 Mega 7430826 C/Ns/I-14 Nov 12

Looking for; Decent projector can trade good Canon EOS 550D or pay cash. Contact: <avid.vid@gmail.com>. Seminyak. [053] For Sale; Double single air tech spring bed (up and bottom with slide). Brand new, still covered with plastic. Bought Rp. 2.7 million. Sell Rp. 2 million. Call 0878 8039 7958. Denpasar. [054]

Bali Advertiser Piano for Sale and Rent Maintenance with Tune Master YAMAHA Grand Piano Upright Piano 2nd

excellent condition! PRICE FROM Rp. 17 Juta~

BALI Piano Consulting service

Showroom: Jl. Tibugsari No.7 Kwanji Dalung Kuta Bali Indonesia Tel: 0361-439474, 439475, 083 11 405 4543, 081 138 0398 Web: http://piano.jimdo.com Email: info@sarihati.ocnk.net C/Ns/G-31 Oct. 12

For Sale; PsVita 3G+wifi, only 2 months used. Condition like new. Complete with box charger etc, bonus 2 games (Gravity Rush and Unit 13). Sell for Rp. 3.1 million. SMS 081 734 2727. Denpasar. [055] For Sale; iPad 1 32Gb wifi+ 3G. Mint condition. No scratch, battery still excellent, home button and all is still like new. Complete with screen guard, original case and box, charger etc. Contact 081 734 2727. Denpasar. [056] For Sale; Kettler multi gym: kit form (photo by email). Well kept and with terri towel covers for protection of wear parts. Rp. 1.5 million. Buyer must collect from Kerobokan storage by appointment. Contact Dave 0857 9231 1196. [057] Notice: Bali Advertiser confirms all free Private Classified ads. When you send an ad, we will contact you. If we are unable to contact you then your ad is not printed.

C/Ns/I-03 Oct 12

C/Ns/G-25 Jan. 12

C/Ns/I-14 Nov 12


Bali Advertiser

5

14 November - 28 November, 2012

NC/Ns/I-14 Nov 12

For Sale; Dell Pentium III, 500mhz, memory 512mb, CPU, keyboard and mouse included, no monitor. Rp. 350.000 final price. Excellent condition. SMS 0815 4742 6222. <indiego_dk@yahoo. com>. Seminyak. [030]

For Sale; Little black dress, new, Rp. 300.000. Dress full length, lace, off-white, suitable for brides maid or party, new, Rp. 350.000. For viewing contact Iris 081 2464 6071 or <iriskyeteo@ gmail.com>. Denpasar. [049]

For Sale; Palm Pre 2 smart phone. Still in box. Rp. 3.5 million. For more info sms 0815 4742 6222 or e-mail <indiego_dk@yahoo.com>. Seminyak. [031]

For Sale; Great condition 18MP DSLR camera. Canon 550D, with 2 kit lenses+lens protectors, comes with battery and charger, cable too. Photo and video maker. Rp. 6 juta. 0821 4483 3668. Denpasar. [050]

For Sale: 15m antenna mast / pole used for internet connection. Contact me if you’re interested. For info SMS 0815 4742 6222 or e-mail <indiego_dk@yahoo. com>. Seminyak. [032] NC/Ns/I-14 Nov 12

Cars - Motorcycles - Watercraft - etc For Sale Line ads Rp 7.000 per word. Photo Ads Rp. 435.000. All ads must be paid for before printing.

Car

Car

Motorcycle

For rent; weekly/ monthly KIA Carens 2002 matic. Call 0819 9994 2211. [001]

Economic Car: Silver Kijang

Kawasaki Ninja 250 10/10 For Sale. Very fast engine. Many modification. Great condition. IDR 48 million. 0812 4651 6539. [016]

Krista Manual Diesel 2001 Rp 126 Mio ONO. 0813 3771 3039 Sanur. [009]

Rent Cars, Motorcycle. 085 73977 3134 / 081 93311 4401. [002] 2008 Chevrolet Captiva, Grey, excellent condition, only 35,000 kms, 210 Juta Phone : 0812 3767 8906. [003] For Sale; This fantastic 2010 Suzuki SX4 White, Automatic, 5 door hatchback, Excellent Condition. Priced to sell. IDR 180 million. Ph: 0812 3615 4700. [004]

Sale; Ford Escape 2.3, 2005, Good Condition, IDR 160 juta Nego. 0813 3932 8078. [010] 2004 Suzuki Karimun, tan, 117,000 km, 90 Juta; phone: 0821 4657 1958. [011] For Sale; Hot Masarati Cambiacorsa, 2004, Super Condition. Price Nego. Phone 0813 3872 2844. [012] Ford Ranger For Sale; Double cabin. 2004. Dark blue. Totally revised and

Mercedes A140 4door immaculate condition 2nd lady owner, long time expat leaving Indonesia. Phone 0877 6154 5414. [005] For Sale; Smart Car Passion Cabriolet. Colour Light Blue Muda, 2010. KM 7,000 Price Rp. 270juta. Call. 081 2383 6006. [006] 2012 White Mazda 8 only 8500 kms like new ! Leather interior, 7 inch LCD GPS command center, 2 x 7 inch led DVD passenger screens, sunroof, new car warranty, 485jt save millions on new ! Call 0838 9763 6192. [007]

new engine. 130 million or b e s t o ff e r. P l e a s e c a l l

Motorbike Megelli Sachs 250cc Super Moto, New model 2012, New engine, 27 PS, water cooling, engine + gear box made in Germany, Design GB, 8 months old, 5.000km, 3 years warranty or 30.000km, surf racks, price: 27 Mio Rp or 19 mio Rp Deposit + 1.226.000 Rp/ Month 28x. Phone 0831 1966 3816. [018]

ONE STOP ENTERTAINMENT IN BALI

MC, DANCER, LIVE BAND & DJ, MAGICIAN, TAROT READER & CLOWN

DZ STUDIO

RENTAL SOUND SYSTEM, LIGHTING, RIGGING, MULTIMEDIA, PYROTECHNIC, COFETTI, BUBLE, FIRE WORKS, KARAOKE MACHINE & TIFFANY CHAIR

PH. +62(0361) 9173973, 08123848903, 08113805835 (ENGLISH) fb: Dzsound Bali Wikaentertainment@yahoo.com | bbm. 21E77DB1 | w. dzsound.blogspot.com MC: Dewi Chartikasari C/Ns/G-14 Nov. 12

For Sale; Computer table 48cm wide by 110cm long, 73cm high. Rp. 200.000. For more info SMS 0815 4742 6222 or e-mail : <indiego_ dk@yahoo.com>. Seminyak. [033] For Sale; USB external hard drive (Acer brand), 300Gb, free USB anti virus. Absolutely perfect condition. Rp. 450.000 (fixed price). Call 0819 9974 5109. Sanur. [047] The secret to a rich life is to have more beginnings than endings. C/Ns/G-18 April 12

ALARM - CCTV

PERIMETER DEFENCE - ACCESS CONTROL - ENTRY SYSTEMS

Jl. Umalas II No. 102, Umalas Kauh - Kerobokan, Kuta - Bali 80361. www.fortress1st.com | 0361 737994 C/Ns/I-25 July 12

Isabelle 081.337 291 866. Sanur.

[013]

Grand Cherokee 3.6 Limited & 5.7 Overland; Wrangler Sport 2 & 4 doors; Wrangler

Brand new motorbike Honda CBR 250R silver, for sale 38 mill. Mileage 1000km. Phone 0819 3467 4699, <auf.zibelle@gmail. com>. [019].

Sahara 2 & 4 doors; Wrangler Rubicon 2 & 4 doors; Jeep Patriot; Compass; Dodge Journey; Visit Nadia Auto Graha Chrysler Bali Authorized Dealer, Jl. Teuku Umar 70, Denpasar. Ph. (0361) 237 008. [014]

Watercraft Passanger Iron Ship 30x65 Detroit 2x400Hp. IDR 3.8 Billion. 0821 4031 9696. [020] Boat for sell <www.g-land. com/kapal>. Phone 081 7939 9777. [021]

Porsche Cayenne Hybrid 2012; Mercy SLK 350 AMG ‘12;

Toyota FJ Cruiser;

Toyota Prado; Toyota Vellfire Jeep CJ7 4.2lt turbo diesel great car that’s a real head turner. Sad sale after 15yrs owning but leaving Bali. Rp 110mil. Ph David 0877 6154 5414. [008]

KTM XC250 ‘06, ReBuilt Nov ‘09, Very Fast, Excellent Condition. Rp.55 juta negotiable. Mark 081 855 5990/ <mark@ baliconstructionservices. com>. [017]

WIKABALI.COM

ZG Audioless & Alphard SC; Toyota FT-86; BMW X5 ‘10. Visit Nadia Auto Graha, (sales, service & spareparts) Jl. Teuku Umar 70, Denpasar. Ph. (0361) 237 008. [015]

Contact

Inflatables in Stock - Brand New ! 1 pc. 4.3 Meter Thunder Cat Inflatable, 3.6 and 3.8 meter Inflatables with Aluminum Floor boards. Never Used. Great Prices. Call 081 238 10585 or (0361) 753120. Wave Hunter Bali - Jalan Sunset 18X. [022]

Bali Advertiser

Telp. : (0361) 755 392 [Hunting] Fax. : (0361) 764 191 E-mail : info@BaliAdvertiser.biz Make your ad online at www.baliadvertiser.biz NC/Ns/I-14 Nov 12


Bali Advertiser

14 November - 28 November, 2012

6

Trade; MacBook 3,1 Intel Core 2 Duo, 2.2 GHz - for a PC laptop with good specs, video output, firewire. Contact: <avid.vid@gmail. com>. Seminyak. [052] Be agreeable. It raises the self-esteem of others and makes you feel good about yourself.

For Sale; 2 chairs and 1 table from mahony wood, price Rp. 2 million. Call Irma 0817 0339 0769. [213]

only Pak Tut √ makes the best croissants & danish at

Looking for; 2nd hand sewing machine, if possible to get portable type. Please contact <massabi@gmail. com> or 0818 0568 1953. Sanur. [214]

Try our Yummy Breakfast / Brunch “ Croissants Florenine “ Visit us at: “ Bedugul Lake View “ shophouse, Candi Kuning,Tabanan, Bali. Ph: (0368) 21838 or 081 23812843 Jl. Udayana Barat 2, Singaraja Tel. (0362) 7001400 C/Ns/I-11 July 12

ECR & Mini Printer

Electronic Cash Register

POS TOUCH SCREEN ECR POWERFUL AND VERY SECURE SOFTWARE FOR FULL RESTAURANT SYSTEM EASY TO USE - NO HANG - NO VIRUS - NO CHEATING

C/Ns/I-14 Dec 11

KARTU CANTIK

Call 0852 1918 1818

Kartu As: Indosat IM3: 0823 7434 3434 = 425.000 0857 5418 1818 = 475.000 0823 7692 9292 = 425.000 XL: 0823 2582 2222 = 475.000 0819 1991 1992 = 350.000 0823 7768 7768 = 400.000 0819 1991 1987 = 225.000 0823 7374 7374 = 550.000 0819 1991 1993 = 225.000 0823 7713 9999 = 375.000 0819 1991 1994 = 225.000 0823 7692 9999 = 375.000 0819 1991 1997 = 225.000 0823 7577 7888 = 850.000 0819 1991 1998 = 225.000 0823 7577 7999 = 850.000 Simpati : 085 754 181818 = 750.000 C/Ns/I-25 Jan 12

NC/Ns/P-14 Nov. 12

VERY LOW POWER CONSUMPTION SAVE YOUR ELECTRIC BILL MORE THAN Rp. 1 MILL/YEAR Authorized Distributor - PT. PRAKARSA UTAMA MANGGALA

JL. Suli No. 119 B2, Denpasar Tel: (0361) 225796, 7800965 Fax: 225796 Email: pumindo@cbn.net.id Website: http://pos-kasir.com

Jakarta: 021-3841789, Surabaya: 031-70927541, Yogyakarta: 0274-419590, Bandung: 022-70720142, Medan: 061-77861699 C/Ns/I-14 Nov 12

Bali Advertiser Crossword

C/Ns/G-11 July 12

See answers elsewhere in this issue C/Ns/G-7 March 12


C/Ns/G-31 Oct. 12


BA Feature

Article

GALLOPING ACROSS BALI By Shari

It’s early in the morning or possibly before sunset on the beach in Bali, and you see some horses galloping through the waves. If you’re like me I gaze at these beautiful creatures with awe and a tremendous desire to be mounted on one of them. Your dream of riding one of these gorgeous animals is easily attainable. There’s a horse for every level of rider, no matter if you’ve never been on a horse or have been hacking for years. Over the years more and more horse stables have opened in Bali enabling anyone the opportunity for an adventuresome ride on the beach or riding lessons in a corral. Horse riding is an excellent form of exercise to get fit. It stimulates blood circulation, muscle conditioning, strength building, increases balance, confidence, stress release and its fun! It’s also a great way to lose weight and tone muscles. An hour of trotting or galloping burns calories equal to an hour of jogging. It’s also wonderful for increased flexibility of the joints in the knees and pelvis. Plus it’s more pleasurable to tone the abdomen without doing a million sit-ups. You have the chance of getting out into fresh air and nature and seeing parts of Bali you’ve never been to. Focusing your attention on controlling a horse will keep your mind off any problems that have been causing you stress. You’ll return to the stable with a smile on your face feeling relaxed. Many young girls go through a phase of loving horses; however mine became a lifetime love. I was lucky my grandparents owned a farm with a couple of riding horses, so my mum put me up on a large horse when I was able to walk and thus began my love for horses. Every birthday and Christmas I begged for my own horse but my parents always told me that they didn’t have enough room for one. Years later when my beloved proposed marriage and presented me with a diamond ring, I told him that I wasn’t interested in a ring but if he wanted to marry me he should buy me a horse. After we married he kept his promise! Most people can still remember the first time that they rode a horse. It’s an unforgettable experience. Learning to ride as a child may be the best time to begin as it offers many valuable lessons in growing up. Kids learn to lead, take control, to make quick decisions, trust instincts, balance, increased hand – eye coordination, confidence to control a horse and responsibility. Kids learn that it’s more important to know what they can do rather than how they look. Parents may be wiser to send their kids for riding lessons rather than to the shopping mall to hang out looking cool and shopping. Riding lessons for kids includes learning to groom a horse, taking care of the bridle and saddle, walking a horse and riding. A young tot may start off being led until they’re old enough to hold the reins themselves and take control of their steed. Parents shouldn’t be deceived believing that a small pony is safer for their child than a big horse. It may be closer to the ground but often a pony has a worse temperament, especially Shetland ponies. Large horses are known as gentle giants. Every horse has its own unique personality. You need to learn to respect this large creature that weighs ten times or more than you. Some are gentle and affectionate and always steady, some may bite or kick, some are nervous and spook easily or others are pranksters enjoying taking their rider under a tree or up against a fence knocking their rider off. Horses are highly intelligent and intuitive, knowing immediately if a rider is afraid or confident. If you express fear the horse may venture to play tricks with you to see what they can get away with, while the same horse will be a perfect gentleman with an experienced rider. Of course beginners are always mounted on gentle trust-worthy ponies and horses and led by a guide. A more spirited horse is reserved for experienced riders. Generally a younger horse is more unpredictable in their behaviour but even an elderly horse in their late teens can still have a lot of spunk. A stallion is the most spirited horse in a stable, so in a riding stable, male horses are often gelded (neutered) to make them gentler. Most mares are pretty easy going. Many horses are cautious of something new in their environment and can easily be spooked by some new object, especially on the beach. Be careful on the beach if people

are flying large kites, as an unexpected movement may frighten your horse. Dogs running loose on the beach are another potential hazard. Some of them are foolish enough to chase a galloping horse, which may annoy the horse. The staff at the stable knows the personalities of their horses well and will give a reliable and gentle horse to an inexperienced rider. It’s best to be cautious with a horse until they get to know you and a bond is formed. If you’re a regular rider it’s usually a good idea to stick with one horse as a friendship will develop and eventually turn to love. Then you and your horse become a team as you sail over jumps or gallop along the beach. Watching a horse and rider team is magical. The horse flows effortlessly through their paces without a discernable movement from the rider. A light touch of the rein or leg pressure will signal the horse to perform every movement. It’s best to wear long pants and closed shoes to make your ride more comfortable. Some stables provide chaps to wrap around your lower legs to prevent the stirrup leathers from pinching your legs and the stables provide a helmet to protect your head too. The horse has every desire to please their rider and will never judge you, always make you smile, never give up on you, always try their best for you, never break your heart and never stop loving you. How does it get any better than that? WHERE TO GO RIDING Mesari Stables located at the end of Jalan Dynapura in Seminyak is the oldest riding stable in Bali. It opened in 1987 owned by the king of Denpasar, Cokordagrah Gede Pemecutan who had a great love for horses. His son Turah Made is the current owner who carries on the tradition. It’s the smallest stable in Bali with only five horses and two ponies for hire but also stables five privately owned horses. The horses are all well looked after and suitable for all levels of riders. You can go for a one or two hour ride along Legian beach either early in the morning or late afternoon. Mornings are preferable as there are often many people on the beach in the late afternoon making it a bit of an obstacle course. Call 0361-733319 to make a booking. Horse Adventure Bali also called Stable Kuda Bahagia, located in Pererenan has been in business for four years and is home to 35 horses, 10 of which are privately owned. Owners Arief and his wife Carmen bought several horses from the recently closed Umalas Stables and took on many of the staff as well. Bahagia has a stallion, which has been used to sire 11 foals in the past four years to replace the retired equines. The young colts are a delight to watch play in the field. Kuda Bahagia not only offers horse rides through the rice fields and beach for an hour or two but also has packages with a dokar (horse cart), trekking or cycling included. Special events include: children horse camp, birthday parties and weddings. They boast having the only white mare in Bali which is a must for an Indian wedding making them popular with wedding planners. The stable transports horses and a wedding carriage to any location in Bali for the event. Group or private riding lessons for children and adults are popular with not only tourists but residents also. Lessons are available for beginners to intermediate levels and jumping and dressage. They also have a trained instructor for children with learning disabilities. Transportation available. Bookings: 0361-3655597 or email: stablebahagia@gmail.com www.balihorseadventure.com

Island Horse Riding located north of Tanah Lot at Yeh Gangga is a wonderful place to ride on the beach because there aren’t many people to disturb your ride. There’s a long expansive black sandy beach, making it a genuine pleasure to gallop splashing through the waves. I had my most enjoyable ride on a lovely mare named Suzanne, who was smooth as silk to ride. This stable opened in 1994 and now is owned by John and Natalie and home to 22 beautiful horses suitable for all levels of riders from absolute beginner to advanced. They only offer trail rides for two hours

along the beach and village and can handle up to 18 persons at a time. Includes transportation in morning or afternoon and insurance. For bookings: 0361-731407 or 8718060 or email: ride@baliislandhorse.com www.baliislandhorse.com Kuda P Stables, Australian owned and operated is located in Pererenan and owned by Fran and her husband opened in 2004. It has 15 lovely horses for rental plus one privately owned. Fran has over forty years of horse training and is considered an expert in Bali, who teaches children and adults to ride from beginners to advanced. Kuda P is the only stable that offers horse therapy for the physically disabled or with learning disabilities on Tuesday afternoons, taught by a certified trainer. This is a wonderful therapy to consider for anyone who has physical or learning disabilities, which include autism, ADD, hyperactivity or dyslexia. The benefits for the physically disabled such as c e r e b r a l p a l s y, D o w n syndrome, multiple sclerosis, spinal injuries or stroke include: improvement in balance, coordination, muscle strength and selfconfidence. In fifteen minutes a walking horse takes 1000 steps. Each step requires the rider to use their muscles and mind to maintain balance and control the horse. For those with learning disabilities the benefits include: balance, increased body awareness, self-confidence and a sense of independence. Amazing transformations in oral and physical capabilities have occurred with disabled riders, who have formed a bond with their horse. They have quiet horses for beginners to advanced riders for one or two hour trail rides for a morning or afternoon ride. Includes pick-up. Bookings: 0361-7472716 or email: kudapbali@y7mail. com Tarukan Equestrian Centre in Canggu opened in 2002 and has 15 horses, however only 7 nice horses and 3 ponies are used for rental. They have a stallion and 4 young horses that aren’t ready for rental use yet. Enjoy a relaxing ride through the rice fields to the beach and a refreshing splash through the waves. They have horses for all levels with guides to lead the horse for children or inexperienced riders. Transportation service for morning or afternoon rides. Bookings: 0361-7470644 or email: info@ balihorseriding.com

The only horse stable on east Bali, located at Saba Beach is Bali Horse Riding part of the True Balinese Experience. It opened in 2002 and is locally owned with 28 horses. However, ten of those are too young to ride. I enjoyed a scenic ride through the village and along the long stretch of black sandy beach that is virtually empty for one and half hours in the morning or afternoon. This stable has delightful and friendly guides to accompany you. Lunch or dinner is also included with the transportation. Bookings: 361239440 or email: info@atruebalineseexperience.com Copyright Shari 2012 Spa.inspirations@gmail.com Copyright © 2012 Bali Advertiser You can read all past articles of BA Feature Article at www.BaliAdvertiser.biz


Bali Advertiser

14 November - 28 November, 2012

C/Ns/G-31 Oct. 12

9

C/Ns/G-14 Nov. 12

C/Ns/I-14 Nov 12


14 November - 28 November, 2012

10

For Sale; Solid teakwood carved entertainment cabinet 4 drawers (for CDs/ DVDs), 2 shelves with doors (for media players) and space for up to 30” TV with 2 doors that slide back. Size approx. 120x40x200cm. Color/ finishing is natural teakwood. Good for villa. Rp. 3.5 million. Call 0857 9256 8658 or<thingsadvertised@gmail. com> for photo. Sanur. [024]

Bali Advertiser Are You Organizing a Dinner and/or Party?

DUTCH DJ + SOUNDSYSTEM (w/ kitas)

Contact: bart.speelman@gmail.com 0821 - 45231135 C/Ns/G-5 Sept. 12

For Sale; Pool table combination air hockey table, complete with all equipment. Good condition. Great family fun! Rp. 4 million. Call/SMS Colin 0821 9040 5222. E-mail: <colin.biff@gmail.com>. Kerobokan. [025] C/Ns/G-04 April 12

C/Ns/I-19 Sept 12

By The Coach

This Sporting Life

RUGBY UNION NEWS

Bali Rugby Club supplied four players, two stand by reserves and the team manager to Indonesian National 7’s team, the “Harimau” to HSBC Asian WC Qualifiers for the 2013 World Cup 7’s in Moscow. Players included Andrew White,Didikus Ria (Markus), Dan Sivess and Ollie Olsen together with BRC President Nick Mesritz as team manager. The Harimau unfortunately went without a win finishing 12th in the ARFU tournament which was won by Asian powerhouse Japan, ahead of evergreen Hong Kong and the surprising Philippines.

Beverage at the AYANA Resort and Spa, Bali finished a very credible 6th (out of 94 finishers) in the “The Most Beautiful Thing” (TMBT) 100km Ultra Trail Marathon held in the Crocker mountain range of Sabah. Traversing gravel roads, the race included 4500 mt vertical. Jerome completed the race in 16hr, 3 minutes and 57 seconds at an astounding average of 6.25 km uphill and downhill, 3 hours behind the winnerJimmy Tee of Malaysia. This great result means Jerome has also qualified for the Ultra Trail du Mont Blanc 2013, a 166 km ultra marathon up Mont Blanc. Europe’s highest mountain, with over 2300 runners. SOCCER NEWS

BODY BUILDING NEWS West Australian Sam Attrill came 1st in medium class, 1st in the Masters and also won the female overall of the 2012 INBA Indonesia Natural Bodybuilding Championships in Bali - The event Pesta Raga organized by Bali’s own Ade Rai at the Bali Safari Park was held over the 21/22 October weekend and attracted 100’s of competitors. Sam is also president of West Australia branch of INBA (International Natural Body Building Association). ULTRA MARATHON NEWS Jerome Colson, Executive Assistant Manager for Food &

The 4th Coaltran Bali International Charity Soccer Sixes will be held on Saturday June 1st in Sanur. As in previous editions there will be an open division and a veterans (35+) division. For more information see www.balisoccersixes.com All proceeds go to fund Bali Sports Foundation’s “Road to Singapore” where BSF takes a young Balinese soccer side to the prestigous SCC Soccer 6’s in Singapore. SPORTS CHARITY QUIZ Bali Sports Foundation will be holding a charity sports quiz night on November 28 at Stiff Chilli in Sanur to raise monies for BSF’s sports programs for the disabled youth of Bali. Test your sporting knowledge against the best. Teams of 4 with many prizes. Quiz starts at 7.30 pm.

C/Ns/G-14 Nov. 12

Sporting Calendar

Copyright ©2012 If you wish to add any sporting related information to the calendar, please email info@baliadvertiser.biz. You can read all past articles of This Sporting Life at www.BaliAdvertiser.biz C/Ns/I-31 Oct 12


Bali Advertiser

11

14 November - 28 November, 2012

For Sale; 2 fixie style bicycles, 1 white colour, 1 pink, very good condition rp. 1.1 million each. Call 0831 1428 7888. Denpasar. [175] For Sale; Polygon mens double suspension bicycle, good condition, Rp. 1.35 million nego. Call/SMS 0819 3626 4301. Denpasar. [171] NC/Ns/G - 27 July 11

Change of house, we have many things to sell, table, antique typemachine, seats of German cinema, good German books, clothes (also for cold season), belly dance equipment, jewelry. Please call 762 029 or SMS 0821 4680 8894 or write : <barbaraseibt@ yahoo.de>. [164]

PUSAT PERBELANJAAN DAN REKREASI

Cheap Shopping Centre & Family Recreation NEGARA - SERIRIT - GIANYAR - PANJER SINGARAJA - SANUR - BATUBULAN - AMLAPURA TABANAN - NUSA DUA PLAZA - SINGARAJA PLAZA C/Ns/G-24 March 10

C/Ns/I-19 Sept 12

C/Ns/I-14 Nov 12


Bali Advertiser

14 November - 28 November, 2012

12

All natural Bali muesli available in 500 gr bags Available at many local food stores For direct orders please call Ketut 0361 8605228 or email: originalbalimuesli@gmail.com

For Sale; 2nd JVC camcorder mini DV, GR DF470AA, can use MMC/SD memory and MiniDV cassette, light, 3D sound, low light plus, 700x zoom, complete with charger, 2 bateries, bag. Still working good, for only Rp. 999.000. Call (0361) 786 9350, no SMS. Denpasar. [187]

C/Ns/U-02 May 12

C/Ns/G-21 March 12

For Sale; Kendo equipment bogu and shinai 90%, Rp. 5 million. Call 0857 1929 9897. Seminyak. [203] For Sale; Used surfboard, 5â&#x20AC;&#x2122;9 x 191/2 x 23/6 Don Jhonston shape. Good condition. Can be viewed in Kuta. Rp. 1.5 million O.N.O. Call 0812 3754 6628. [181]

24hrs: +62-81337-99-33-22 www.geckoinvestigations.com

C/Ns/I-25 Jan 12

C/Ns/I-14 Nov 12

NC/Ns/I-14 Nov 12


C/Ns/G-14 Nov. 12


Computer & Internet For Sale; Running shoes new balance size 11 (EU 45), never used, wrong size, new Rp. 800.000, sell for Rp. 450.000. Call/SMS 0812 5134 3025. Sanur. [178]

C/CI/G-08 August 12

For Sale; Fins Mares Avanti Superchannel open heel size S brand new, new Rp. 1.200.000, sell for Rp. 850.000. Call/SMS 0812 5134 3025. Sanur. [179] Moving Sale; Folding table 60x180cm / 70x50cm, goddess statue H 160cm, magnetic white board 90x180cm / 90x60cm, mattress 90x180cm, wall fan, sofa 6 seater, chairs for office, folding chairs, etc. All 50-70% off. Call 0819 1916 7777. [180]

For Sale; Allied Telesyn 16 port fast Ethernet switch, Linksys wireless-G broadband router, staffold. SMS 0815 4742 6222. <indiego_dk@yahoo.com>. Seminyak. [165] For Sale; (7 units) Pentium Dual-Core 2.70ghz, 1GB RAM, HD 250GB, 17” Benq LCD, Aztec computer table, Logitec webcam, Keenion headset Rp. 2.400.000. Call 0815 4742 6222. E-mail: <indiego_dk@yahoo.com>. Seminyak. [166] For Sale; Car wheel rims (veg), size 15, silver colour, brand new, never been used. Sell for Rp. 2.5 million (fixed). Contact Elly 0818 0530 0379. Denpasar. [167]

ICA

UPS & Stabilizers

Uninterruptible Power Supply

The Best Solution For Power System

MINAMOTO

SERVO MOTOR CONTROL AC AUTOMATIC VOLTAGE REGULATOR

Sales & Service Centre

SINAR KENCANA

Jl. Tukad Pule No. 23 Sesetan - Denpasar Telp. (0361) 232158, 227798, 234377 Fax. (0361) 232158 Email: icaups@indo.net.id C/CI/G-21 March 12

Starting package Rp. 1.850.000/static web incl. annual web hosting & domain name (space up to 250Mb)

www.thenbagus.com NC/CI/P-30 May 12

C/CI/G - 25 Jan. 12

C/CI/I-14 Oct 12

C/CI/G-19 Sept. 12

from the

A Blurb from the Kulture Kid! By Vaughan Hatch

Why does Bali seem so lawless? Those people who arrive in Bali ‘fresh off the boat’ from an orderly society like Australia or Canada, for example, must think that the laws in Indonesia are based on some sort of random chaos, or simply made up on the spot at one’s convenience. Witnessing the apparent lack of traffic rules, waste disposal, anti-smoking or pollution laws on this island, it would seem that indeed there are no laws. I often get comments from visitors to Bali who can’t believe the numbers of motorbike riders who don’t wear helmets, or those parents who quite happily balance a couple of kids on their shoulders as they zoom down the bypass on their mopeds swerving in and out of large, smoke belching trucks. Whilst it may appear that they have emerged in the Wild West, it may comfort one a little to discover that there are actually laws here - they are just very, very poorly enforced. Like the rest of Indonesia, Balinese are extremely laid back in their attitude to life. Compared with the analytical, perfectionist standards of the West, people here seemed to be content with most things remaining in a constant state of chaos. The same goes for the police, who may not even be aware that a rule is bring broken as it is probably ‘ok’ in their world view. Second, firmness or rigidity is something that is seen as undesirable or uncomfortable for most Indonesians. People try their best to avoid conflict at all costs. I can see this at my son’s school. He is constantly late in the mornings, and rather than being told off by his teachers, they often say ‘oh, it’s ok – don’t worry’. The same answer incidentally is given if you ask someone why they burn their rubbish or chuck it in a stream. Third: the culture of corruption. While there have been improvements is some government departments, most laws can be bent with a ‘salam sepuluh ribu’ (ten thousand rupiah handshake), only emphasizing the apparent lack of laws or rules. Any hope for improvement or change. Perhaps… find out in the next issue of Kulture Kid.

Copyright © Kulture Kid 2012 You can read all past articles of Kulture Kid at www.BaliAdvertiser.biz C/Ci/I-16 May 12


Bali Advertiser

Computer & Internet

14 November - 28 November, 2012

Looking for; Promotors/ donators for local kids gong class in Gianyar. Already performed many times and are talented kids. Need funds for operational cost and costume. Ready to perform under your management. Please contact : <saskara_dilla@ yahoo.com>. [039]

Bali PC Advisor

For Sale; Sharp freezer still in good condition 200litre, Rp. 1.7 million (nego). Call 0877 7788 8227 / <szonestudio@hotmail. com>. Seminyak. [042] For Sale; Sewing machine, manequins and tall cabinet 2.5mtr. Call 0821 4479 8255. [043]

15

NEED INTERNET ACCESS ???

For lease !! Internet with hotspot / Wi-Fi Cheap!! Guarantee money back! These machines ready to use & very simple, no need grid antenna, tower, phone cable, etc. Suitable for small office / home office, NetCafe, restaurant, villa, hotel, trading online, ticketing online, etc

Call: 0361 742 5799 / 081 337 400 999

C/Ci/I-7 March 12

C/CI/I-28 Dec 11

by Pak Bruce

Internet Browser Cookies, should we be afraid?

Today, let’s play myth busters and help our dear Internet cookies rid themselves of a number of accusations. Let’s investigate six such misconceptions one by one.

C/CI/I-13 June 12

Misconception #1: Internet cookies are a form of virus or worm that can cause damage to your computer. Internet cookies cannot cause damage, unlike a computer virus or worm. In fact, cookies do not really have anything to do with your computer system, as it is only composed of text understandable by both your browser and the web server that sent it. In short, Internet cookies are composed of only data, not programmed or programmable code. Misconception #2: Internet cookies are spywares that give away your private information to the entirety of the web. Internet cookies contain information like browser type, IP addresses, and some private information, like usernames, that you provided (out of your own free will, of course), and that fact makes you afraid of Internet cookies being spywares themselves. But fear not, for the reason why Internet cookies took such information about you is because they only want to customize your surfing activities to your own liking. For example, most websites that require registration for you to visit them have an option of whether to remember you or not. This means that the web server of one of those websites can use Internet cookies to identify you among their database of users. The Internet cookie for that website will then customize your surfing activity by remembering your login information for you, so you don’t have to type them again. However, as mentioned in number one, Internet cookies are non-programmable and non-configurable, so there’s really no need to worry about them being spywares. On a personal note, I must warn you not to fully trust such “auto-remember” features of a website especially when you are using public or office computers. Misconception #3: Internet cookies produce pop-ups or allow their entrance to your browser. This is definitely a “no-can-do” for Internet cookies. Simply put, pop-ups comprise an online advertising scheme that increase Internet traffic, as they are contained in a separate browser window once its link is clicked. I find it rather doubtful that an Internet cookie could be triggered, not to mention open a web browser and burden the fast-paced Internet traffic that has always been loaded with server requests and replies.

• Sales • Service • Parts • On Call Site Service

Location: http://goo.gl/maps/zB1Vh S 8° 44’ 40” E 115° 10’ 46”

+62 8311 819 816 • +62 818 548 095 +62 361 743 7138 info@nyamabali.com

www.NyamaBali.com C/CI/I-17 Oct 12

Misconception #4: Internet cookies give way to spamming. Spamming, according to Wikipedia, is the abuse of electronic messaging systems to indiscriminately send unsolicited messages. In relation to Internet cookies, this, certainly, is not one of the functions of an Internet cookie, especially since an Internet cookie is just a group of data, not a programmed or programmable code (this seems to be the best explanation for all the misconceptions people have against Internet cookies). Also, they can only serve as informative tools browsers use for the computer user and nothing more. Misconception #5: Internet cookies are for advertising purposes only, causing alarm on the consumer’s part. Internet cookies serve a lot of purpose other than advertising. While it is true that advertisers somehow make use of the cookies’ ability to store browsing behaviors of users who click on their advertisements in a web page, Internet cookies are more than what we thought. Actually, Internet cookies care a lot about the consumers in this virtual market. Like any form of media there is today, the Internet also runs on advertisements to make browsing websites free for consumers. It would be too hard for you, a consumer, if you need to pay a website before browsing it every single time, right? It would also be too hard for online publishers if they should generate revenues of their own, similar with advertisers if they cannot reach their audience. Internet cookies make this seemingly triangular problem by allowing advertisers to promote on different publishers’ websites for consumers. Through watching a consumer’s surfing behavior, the cookies ensure that, while keeping enough ads for advertisers to catch an audience and for publishers to generate income, consumers will not be bombarded by too much promotion. Misconception #6: The best way to avoid any damage caused by Internet cookies is to disable and delete them. You don’t want to do this, believe me. Internet cookies make our virtual lives easier by giving us an option to remember all our seemingly repetitive details we keep on typing on websites’ textboxes. Imagine your Internet life without cookies to aid you. You have to type every single detail about you whenever you have to log on some website.

C/CI/I-03 Oct 12

And finally, on June of 2005, BURST Media published a report about cookies entitled “Don’t Understand Them, Can Be Good, But, Should Be Deleted” and I would like to wrap this article up the same way they did. Here’s the last paragraph, a quote, from their report: “Privacy and security issues taint online users overall perception of Internet cookies. Nevertheless, only one-out-of-four say they want Internet cookies ‘eliminated’,” says Chuck Moran, BURST! Media’s Market Research Manager. “There is significant opportunity for the Interactive industry – including content publishers, agencies and clients as well as third parties to build user understanding of and trust in Internet cookies.” For more information: http://www.dailybits.com/internet-cookies-evil-myths/ ============================================================================================ Have a question or problem? Write me at BaliPCAdvisor@Gmail.com. I’ll try and answer as soon as I can.

Rajawali System Solution

Bali PC Advisor and other Bali Advertiser article Archives now ONLINE: http://www.baliadvertiser.biz/

Jl. Pura Mertasari No. 9 Sunset Road Simpang Siur, Kuta Tel: (0361) 740 4990, 8477 456 Email: info@myobindo.com

If you are tired of trying to type the links you see in the printed articles you go to the Archive and cut-paste them PakBruce, your Bali PC Advisor!

✔ MYOB Authorised Reseller

©2004 - 2012 BaliPCAdvisor@GMail.com. All rights reserved. This material may not be published, broadcast, rewritten, or redistributed without permission of the author or The Bali Advertiser

✔ MYOB Training Centre ✔ MYOB Implementation

✔ Tax Services ✔ Accounting Services ✔ Human Resources C/CI/I-03 Oct 12


Fashion For Sale; Canon EOS 550d camera and Canon EF10.22 lens with Hoya filter, also included Canon 18. 135 and 50mm Canon lens. Hardly used and stored in dry box. Have upgraded and don’t need. Rp. 10 million. 0819 9940 1896. Kuta. [015]

Great Kids Styles

For Sale; Microwave Rp. 500.000, small bar fridge Rp. 500.000, toaster oven Rp. 300.000, desk Rp. 200.000, LG portable DVD player Rp. 1 million. All excellent condition. Call Niki 0812 3745 0797. Denpasar. [016]

Pertokoan Udayana - Kav. A33 Jl. Letda Made Putra Denpasar Ph. +62-361 - 254357 Email: balicenik@gmail.com C/G/G-25 July 12

Lucy’s Batik unique -stylish - timeless

WHOLESALE & RETAIL

• wine bottle cases • coasters • paintings • pillow cases • carpets • scarfs • shawls • clothes • handbags • many more

For Sale; Fishing rod: Fenwick-IGFA-50 6”10” 50 lb. 200USD. FenwickGFA-30 6”9” 30 lb. 150USD, D. A. M Hypron XS 500FS 50USD. Roll: Shimano Tiagra 16, 180USD, Shimano Tiagra 30W 450USD, Shimano Tiagra 50W, 550USD. 0813 5325 7552. Canggu. [018]

For Sale; Digital photo frame 7” LCD, play audio and video, support mostly file format. SD, MMC, MS, CF and USB input. Remote control and automatic transition. Sell for Rp. 500. 000 negotiable. 081 2392 5264 Adi. Denpasar. [098]

NC/G/I-14 Nov 12

For Sale; Wedding dress used once, mint condition and modern simple glamour design. Sell Rp. 2.900.000 ONO. Contact Adi 081 2392 5264. Denpasar. [099] For Sale; 20 pcs JVD hand dryer, made in France. Call Nirba 081 5574 9162. [100] For Sale; Teak, 4 post wooden bed. Queen size (160x200), carved post and headboard with flowers. Perfect condition. Rp. 2.5 Juta. Call 0812 3150 1655 or 0856 4821 9224. Denpasar.

C/G/G-31 Oct. 12

[101]

For Sale; Canon EOS 40D digital camera (need experience), optical Sigma DC 18-200mm, 450Euro. Phone 0813 5325 7552. Canggu. [019]

Jl. Raya Basangkasa No. 88 Seminyak, Kuta, Bali Tel. +62(361) 7951275 / 736098 Fax. +62(361) 736098 Jl. Dewi Sri No. 88 Kuta-Bali Tel. +62(361) 7418548 e-mail: lucysbatik@yahoo.com

For Sale; iPad 1st generation 64gb+3G. Excellent condition. No scratches, barely used. Includes case and charger. Rp. 4 million. More info: <raulmcas@ gmail.com> / 0878 6016 0924. Kerobokan. [017]

For Sale; 10” Smartfren netbook, Macbook like, build in CDMA EVDO modem. Excellent condition complete with box and original accessories. Bought Rp. 3.999.000, sell for Rp. 2.200.000 ONO. Contact Adi 081 2392 5264. Denpasar. [097]

C/G/I-22 August 12

For Sale; Samsung fridge RS22, side by side, 90cm wide, ice and water dispensor, 4 month old, Rp. 11 million. Phone 0813 5325 7552. Canggu. [020] For Sale; Professional espresso machine-Italian classic-Brasilia Century brand. Makes best coffee ever. Great condition parts and service available in Bali. Only Rp. 19.500.000 (ONO). Less than half of import price. Call (0361) 782 7006 (after 11am). Ubud. [021]

For Sale; 2 unit draft beer machine 1/2HP 220 Volt. 1 unit fotocopy machine Canon type NP6030, good condition. Interesting please call (0361) 288 294, e-mail <purchasing@siddharthabali.com>. Sanur. [102] For Sale; Blackberry 9900, white, very good condition, softcase Rp 4.500.000. Call 0878 6037 6800. Denpasar. [103] For Sale; New and original European plugs for your Macbook / iPad charger. Replaces the bulky / ugly standard Singaporean plug. Rp 100.000 for 2 pieces. <balicota@gmail.com>. Seminyak. [104]

C/G/I-31 Oct 12

• BVLGARI RESORT • THE BANYAN TREE • THE FOUR SEASONS RESORT • SWISS BELHOTEL • SUN ISLAND RESORT • TIRTHA ULUWATU

Jl. TEUKU UMAR 65 D (Simpang 6) DENPASAR Tel: (0361) 221663 Email : naiajewelry@yahoo.com C/G/I-14 Nov. 12

C/G/I-30 May 12

C/G/I-17 Oct 12


Fashion For Sale; Canon EOS 550d camera and Canon EF10.22 lens with Hoya filter, also included Canon 18. 135 and 50mm Canon lens. Hardly used and stored in dry box. Have upgraded and don’t need. Rp. 10 million. 0819 9940 1896. Kuta. [015]

Great Kids Styles

For Sale; Microwave Rp. 500.000, small bar fridge Rp. 500.000, toaster oven Rp. 300.000, desk Rp. 200.000, LG portable DVD player Rp. 1 million. All excellent condition. Call Niki 0812 3745 0797. Denpasar. [016]

Pertokoan Udayana - Kav. A33 Jl. Letda Made Putra Denpasar Ph. +62-361 - 254357 Email: balicenik@gmail.com C/G/G-25 July 12

Lucy’s Batik unique -stylish - timeless

WHOLESALE & RETAIL

• wine bottle cases • coasters • paintings • pillow cases • carpets • scarfs • shawls • clothes • handbags • many more

For Sale; Fishing rod: Fenwick-IGFA-50 6”10” 50 lb. 200USD. FenwickGFA-30 6”9” 30 lb. 150USD, D. A. M Hypron XS 500FS 50USD. Roll: Shimano Tiagra 16, 180USD, Shimano Tiagra 30W 450USD, Shimano Tiagra 50W, 550USD. 0813 5325 7552. Canggu. [018]

For Sale; Digital photo frame 7” LCD, play audio and video, support mostly file format. SD, MMC, MS, CF and USB input. Remote control and automatic transition. Sell for Rp. 500. 000 negotiable. 081 2392 5264 Adi. Denpasar. [098]

NC/G/I-14 Nov 12

For Sale; Wedding dress used once, mint condition and modern simple glamour design. Sell Rp. 2.900.000 ONO. Contact Adi 081 2392 5264. Denpasar. [099] For Sale; 20 pcs JVD hand dryer, made in France. Call Nirba 081 5574 9162. [100] For Sale; Teak, 4 post wooden bed. Queen size (160x200), carved post and headboard with flowers. Perfect condition. Rp. 2.5 Juta. Call 0812 3150 1655 or 0856 4821 9224. Denpasar.

C/G/G-31 Oct. 12

[101]

For Sale; Canon EOS 40D digital camera (need experience), optical Sigma DC 18-200mm, 450Euro. Phone 0813 5325 7552. Canggu. [019]

Jl. Raya Basangkasa No. 88 Seminyak, Kuta, Bali Tel. +62(361) 7951275 / 736098 Fax. +62(361) 736098 Jl. Dewi Sri No. 88 Kuta-Bali Tel. +62(361) 7418548 e-mail: lucysbatik@yahoo.com

For Sale; iPad 1st generation 64gb+3G. Excellent condition. No scratches, barely used. Includes case and charger. Rp. 4 million. More info: <raulmcas@ gmail.com> / 0878 6016 0924. Kerobokan. [017]

For Sale; 10” Smartfren netbook, Macbook like, build in CDMA EVDO modem. Excellent condition complete with box and original accessories. Bought Rp. 3.999.000, sell for Rp. 2.200.000 ONO. Contact Adi 081 2392 5264. Denpasar. [097]

C/G/I-22 August 12

For Sale; Samsung fridge RS22, side by side, 90cm wide, ice and water dispensor, 4 month old, Rp. 11 million. Phone 0813 5325 7552. Canggu. [020] For Sale; Professional espresso machine-Italian classic-Brasilia Century brand. Makes best coffee ever. Great condition parts and service available in Bali. Only Rp. 19.500.000 (ONO). Less than half of import price. Call (0361) 782 7006 (after 11am). Ubud. [021]

For Sale; 2 unit draft beer machine 1/2HP 220 Volt. 1 unit fotocopy machine Canon type NP6030, good condition. Interesting please call (0361) 288 294, e-mail <purchasing@siddharthabali.com>. Sanur. [102] For Sale; Blackberry 9900, white, very good condition, softcase Rp 4.500.000. Call 0878 6037 6800. Denpasar. [103] For Sale; New and original European plugs for your Macbook / iPad charger. Replaces the bulky / ugly standard Singaporean plug. Rp 100.000 for 2 pieces. <balicota@gmail.com>. Seminyak. [104]

C/G/I-31 Oct 12

• BVLGARI RESORT • THE BANYAN TREE • THE FOUR SEASONS RESORT • SWISS BELHOTEL • SUN ISLAND RESORT • TIRTHA ULUWATU

Jl. TEUKU UMAR 65 D (Simpang 6) DENPASAR Tel: (0361) 221663 Email : naiajewelry@yahoo.com C/G/I-14 Nov. 12

C/G/I-30 May 12

C/G/I-17 Oct 12


Bali Advertiser

Fashion

14 November - 28 November, 2012

For Sale; Wooden bar high chairs 5pcs and 2 high tables. Rp. 3 million OBO. Call 0877 7788 8227 / <szonestudio@hotmail. com>. Seminyak. [041]

Aum Rudraksha Designs The “Original Malas” created and designed by Soma temple, a resident of Bali for more than 20 years, mixing sacred Rudraksha’s have been used for centuries by ancient sages and

For sale; Antique shelf unit Chinese style with carving made from teak wood 2.3m long 2m high 50cm wide. Rp. 4 juta. Call/SMS 0878 6207 9604. Denpasar. [010]

C/G/G-14 Nov. 12

For Sale; Beautiful coffee table made from old railway sleepers, solid recycled hard wood. Width: 105cm, length: 200cm, height: 51cm thickness: 11cm. Rp. 8 million. Email for pictures <gabesinjava@yahoo. com>. Sanur. [008]

modern mystics to quiet the mind, cool the body, and enhance awarness. Full of Shakti to protect you. Lovingly, ethically handmade & blessed in Bingin Bali. www.aumrudraksha.com info@aumrudraksha.com, Ph.(0361) 7420937 C/G/I-27 June 12

RETAIL THERAPY M with

Fashion ✬ Accessories ✬ Beauty ✬ Furniture

Interiors

Artisans ✬ Food

x

Can you really believe that Christmas is only 6 weeks away, every year we say “where has this year gone?!” all we do know is we are another year older, working harder and squeezing a lot more into our days. Whatever, enjoy the day & don’t wish your life away! Following is one new foodie Artisan that is an absolute find, perfect to know about with the Holiday season fast approaching and forever entertaining - don’t worry about making dessert or cake, once you taste these treats instore you will be ‘hooked on sugar’ for more!

Pastries & Cakes: Monsieur Spoon

is the name of this little gem on Umalas 11, No 43, Umalas. T : 0878 60506330 E : order@monsieurspoon.com W : www.monsieurspoon.com

Once you taste their fresh croissants, a bite of chocolatine, perhaps a raisin roll you will understand what I mean. Not only assorted pastries but exquisite cakes too – like the well known opera, millefeuille, macaroons, a slice of lemon tart meringue & eclairs +++(take a look at their website & send in your order). Rafi is the Patissier Createur of this sweet gourmet treasure, hails from Lebanon & spent many years working in Paris. He certainly knows his business & feel sure you will fall in love with him & of course his heavenly delights! Take a visit & if they are not too busy you are sure to be offered a taste, tell them Retail Therapy sent you!

Flowers: are always a welcome gift and there are any number of small ‘hole in the wall’ places where you can pick up a bunch of florals. However, at this time of year the more delicate florals fade quickly so best to keep with the tropical stems in this hot weather, they will definitely last longer. Heliconia, Jl Raya Basangkasa, Seminyak (near Jari Manari for terrific massage) is one favorite store to visit, even just for a look-see, the guys are some of the most brilliant floral display artists around. Heliconia is well known for their amazing selection of tropical flowers & leaves, succulents, orchids along with stunning floral arrangements to be seen which grace many a hotel lobby & villa. Product & work is excellent! The other floral wonder is Bloomz situated on Jl Raya Kerobokan (next door to Bali Shells) set back off the road it’s a large space with an alang alang roof & parking at front. Once inside pop into the air-con space, it’s like a mini Garden of Eden where fragrance fills the air with the most gorgeous blooms placed at every turn in urns and vases all around. It’s also a veritable fossickers delight as there is always something new & wonderful to see in this creative space. Bloomz are well known for creating very special floral themed events with a distinctive touch.

Bedlinens +: Time and time again Disini Jl Raya

Seminyak, (near Lilla Lane for statement sandals & Vivaqua for sassy basket ware) show strength in their offer of unique duvet cover sets. Set on an all white background, the embroidery work is fantastic not only in their designs but in their mix of colors. It’s a credit to the many skilled artisans who work in this area of creativity. The duvet cover (available in a number of sizes) comes with

two pillowcases as a set, reasonably priced for exceptional work, art for your bed! You’ll find some distinctive taupe linen bath & hand towels with dramatic black embroidery, tablecloths, place mats & napkins and as always a colorful mix of cushion covers in plain, patterned & florals, along with rather nice rustic pieces of teak furniture.

Fashion: A newly opened store Basangkasa 47 (on Jl Raya Basangkasa) is actually the 50% store of the popular store Biasa (situated further down on Jl Raya Seminyk, opposite Paul Ropp). So what you find here is some fabulous stock at greatly reduced prices. There are fresh linens and cottons, sarongs, scarves, panama hats, funky fashion jewelry & sandals. The perfect opportunity to check out some easy-chic summer stock for men & women for the coming holiday season.

Bali Moor Clay Soap: I am sure many of you have heard of Moor Clay and the wonderful qualities for face and body. If not, then here is a basic explanation. It’s a rare form of mud / rich peat found deep within the earth from centuries old, in Austria. Within this peat are compressed herbs, plants and flower matter which in turn produces natural acids and nutrients, combined, Moor Clay provides extraordinary healing properties to the skin. This Moor Clay is the basis of the Soap along with other ingredients such as Virgin Olive Oil, Frankincense and Patchouli Essential Oils. Needless to say once you commence using this soap on a regular basis your skin (face and body) will exfoliate in the short term and very soon your skin will begin to glow beautifully once more. Bali Moor Clay Soap undergoes a cold mixed process, no heating involved, so you are getting complete purity from the essential oils used in the soap. Moor Clay has been clinically tested and found to be naturally hypo-allergenic and compatible with any skin type, eliminating the need for the many different types of creams that seem to clutter ones bathroom.

retailtherapym@yahoo.com.au

Beneficial for aged skin as well as acne, it’s a cleanser, will detox the skin of impurities & an anti-inflammatory. Regular use will certainly stimulate collagen growth and tighten the skin overall. For any skin type (however careful with overly sensitive skin) and for more detailed information of this particular soap, other natural skin/body products along with specialised treatments, call Jane on 0811 387 989. You can purchase a round of Bali Moor Clay Soap from Good Earth Cafe on Laksmana, Bali Buddha, Canggu and BIKU on Petitenget.

BABY CHIC: JUST OPENED!!! A new store on Jl Mertanardi No 74, Kerobokan, T : 0361-735 902 A bright big space for baby furniture and then the rest. The best aspect is, that if you need furniture for baby’s room now then this is where you come as they have ready stock available!

Simple, clean, stylish lines in - cots, wardrobes, chest of drawers, all crafted in quality wood & superior finishings, fresh white for baby and prices are most affordable! Within the store are a host of baby walkers, high chairs, baby car seats, prams and strollers and much more. Some very attractive baby clothing, accessories, (love the cute lights for baby’s room) plenty of toys, even ‘jewelry’ for baby (like those little string bracelets!) There’s a complete range of body care for baby too, and wait for this one, I was informed they are soon bringing in ‘Washable Pampas’ product, now this is a new one.....!!

www.retailtherapybali.com

17


Business & Travel For Sale; Canon IXY 400F camera. Japanese model. Comes with 4GB SD card, 2 batteries, charger, Logic case and screen protector. Excellent condition, like new. Rp. 2 million. SMS +62 857 3825 0920. Kuta. [093]

C/BT/I-21 March 12

www.indo-ned.com

Indo - Ned your personal business to Indonesia Indo-Ned will help you in running your business in Indonesia. Assistance for foreigners who have, or intend to have, property in Indonesia. Indo-Ned will also be your partner for business and administrative affairs including business reports, and monthly and annual tax. OUR SERVICE INCLUDE: Company Registration: - PMA (BKPM, Act of Notary, Domicile License, Tax Register, SK-Kehakiman, TDP) - PT Local - Representative Office in Indonesia Other Licenses: Stay and Working Visa, Import License, SRP & NPIK Legal Documents Tax Reports and Administration Assistance

Our Offices: - Jl. Raya Kuta No. 68 Istana Kuta Galeria, Kuta Central Park, Bali T: (+62) 361 769 102, M: (+62)821-4795-7755, F: (+62)361-769-102 - CIKâ&#x20AC;&#x2122;s Building 2nd Floor Suite 215, Jl. Cikini Raya No. 84-86, Jakarta Pusat T: (+62) 21-314 5614 M: (+62)813-1593-5911 F: (+62) 21-314 5614 - Koperslager 2,6641 GS Beuningen (Gelderland) - The Nederlands M(+31)630-368-263 T(+31)024-677-0324 F: (+31) 024-675-0862 Email: asimbolon@indo-ned.com/info@indo-ned.com

For Sale; iPad 3 / 16Gb Wifi model, white with a lot of software. Including box, USB and charger (with Euro / Indonesian plug), all original. Runs latest IOS6.0. 1. <balicota@gmail. com>. Seminyak. [105]

For Sale; Light box 6x1,5 m white, 20 bulbs, 800 watts. Used 6 months. Possible to put any cut sticker, printed banner. New Rp. 9.5 million, sell for Rp 6.5 million. Contact 0819 9911 5831. Canggu. [094]

For Sale; New and original 5 Watt iPhone 4/4S chargers. European model, works without adaptor on Indonesian power grid. Rp 100.000 per piece. <balicota@gmail.com>. Seminyak. [106]

Looking for; Manual sewing machine, Butterfly / Singer brand, good condition and good price. Contact 0818 0551 2469. I am interested to buy. Denpasar. [095]

For Sale; New and original 30pins Apple iPhone / iPad / iPod USB charging cables. Rp 100.000 for 2 pieces. <balicota@gmail.com>. Seminyak. [107]

SPECIALIZE VISA ASSISTANCE ABROAD Many years of experience, helping the local & expatriate community in Indonesia, many visa applicants denied their visa by the Embassy due to lack of their document, we can come to help all their document from A-Z until they have a successful outcome. Our services: - Visa to Australia, visa to UK, visa to China, visa to Russia,visa to India, visa to Europe, visa to America, visa to Mexico, etc - Travel Insurance, Hotel voucher in overseas etc. Contact us: BALI CONNECTION SERVICE Jl. Pratu Made Rambug, Perum Bumisanti no.31 Batubulan Telp: +62-361-7801372,7431418, Mobile phone: 081 2366 6187 / 0812 3989 9666 website : www.baliconnectionservice.com C/BT/U-5 Sept. 12

SPA BUSINESS FOR SALE Spa furniture and equipment for sale (bed massage, sofa massage, TV, etc) Good business and all staff included in Jalan Legian-Kuta. Spa system/management are provided. The reason owner is retired/pension. Contact owner/SMS 0858 5744 2238 E-mail: baliasiaspa@gmail.com NC/BT/M-14 Nov. 12

C/BT/G-11 July 12

C/BT/G-30 May 12

C/BT/G-31 Oct. 12

C/BT/G-5 Sept. 12


C/BT/G-14 Nov. 12


20

Business & Travel

Bali Advertiser

14 November - 28 November, 2012

The Business Builder Series

CV. KREATIF BALI Immigration & Business Consultant

VISA • Foreign Investment Company • Local Company

Graeme Stevens

Jl. Mertanadi No. 92, Kerobokan - Kuta Telp./Fax : 0361 - 8475663, Flexi : 0361 - 7837576 Email : kreatif_bali@yahoo.com | kreatifbali@yahoo.com

The BizWiz Simplify business chaos… create value and release hidden profit

C/BT/I - 27 June 12

You need a skeleton in your closet How to avoid your business falling into a crumpled heap. John Grisham once revealed in a Newsweek interview that the big difference between his first novel and his second was stumbling upon a set of rules for writing suspense novels. He went from literally giving away his first book to earning $10 million for his second. Same guy, same ideas, same knowledge base, same skill with words. Every year since he has published a novel using the same set of rules; his annual income is now around $18 million and his net worth estimated at $600 million. And he loves what he is doing! Grisham’s business is writing novels and he found a framework to help him achieve consistent success. This was his secret skeleton in the closet. Can you too take a set of rules and change your great passion into a wildly successful revenue stream? The extent of small business failure If you don’t have a set of rules to follow, a framework or skeleton to build your business on, then you’re most likely to be part of the 45% of small businesses that fail in the first two years, growing to 55% after 4 years. It gets worse. Canadian statistics show that 80% of all non franchised businesses fail (franchised businesses by definition must have a framework.) And US research indicates 90% of small businesses fail in the first 10 years of existence. Is it likely to be any different here? How many people in Bali do you know who have started and then left a business?

vast range of businesses, from tiny seeds to saplings to kings and queens of the forest. I’ve worked with one business owner who started manufacturing in his garage and retired early on 70 million dollars from the sale of his business. I’ve known other business owners at the other extreme who thought just setting up the business and putting people there to run it without any further effort was all they needed to do - and then were amazed when it all fell apart.

C/BT/G-6 April 11

From all of this come very clear and simple guidelines that I want to share with you. I don’t say implementing them is simple or always easy, but they are things that must be done. Do them, and it will change your business and likely change your life and give you a better opportunity to enjoy this beautiful island. But how does your business base measure up right now? There’s a simple, free checklist to help you check out your current situation to see if you are heading for trouble. Email me for it, address below. How does your business measure up right now? Business Success Drivers In any small business, there are three key drivers of success: • Vision – your dream, where you want to be in 5-10 years. • Resources – cash, people, tools. • Organization – how effectively and efficiently you use your resources to create capabilities that help you achieve your vision.

And what these statistics don’t report are the number of surviving businesses where the owners are not having fun, but working longer and longer hours as the business grows, seeing more and more mistakes in product and service delivery; basically slaves to their crumbling dream.

Your vision The first “must have” is a vision for your business, where you want to go with it. This is you as the leader. You have a plan and you have to sell it to the stakeholders in your business – your customers, your staff, your suppliers and your bank. Your vision and how well you and your people understand it and are committed Causes of business failure Dun and Bradstreet research cites the main causes of to it should be the key driver of how you use your resources. businesses failure as: • 82% Poor cash flow management skills Resources • 79% Starting out with too little money Cash, people, business tools, networks: these are the • 78% Lack of a well-developed business plan, tools you need to accomplish your vision. Hopefully including insufficient research on the business the resources you have invested in are focused on before starting it. meeting your vision’s goals. • 77% Not costing and pricing properly - failure to include all necessary items when setting prices. Organisation • 73% Being overly optimistic about achievable sales, money required and about what needs to be Organization is about how well you use the resources you have. Any organization consists of stocks and done to be successful. flows. You have stocks of money, people and their • 70% Not recognizing, or ignoring, what they don’t various skills, products, information. Then you have do well and not seeking help from those who can. flows of money, information, products. A well-organized • 64% Minimizing the importance of promoting the business has these flows coordinated. business properly. • 63% Insufficient relevant and applicable business How is your cash flow organized? Are you making the experience. • 58% Inability to delegate properly - micro-managing best possible use of your funds? How are your people organized? Are their individual and team efforts work given to others or over delegating and abdicating focused on delivering value? How are your processes important management responsibilities. • 56% Hiring the wrong people - clones of themselves organized. Are they standardized, measured, effective? and not people with complementary skills, or hiring Capabilities friends and relatives. • 55% Not understanding who your competition is or Resources plus organization combined provide your business with a set of capabilities. Great combinations ignoring competition. • 47% Too much focus and reliance on one customer/ provide competitive advantage. Poor combinations waste resources, eat your profits and lose your client. customers. The business framework gives you a structure and a path to follow, to best mobilize your Putting these top 3 causes together are: capabilities to achieve your vision and build your business. • Incompetence – 46% • Unbalanced management experience – 30% Are you brilliantly inspired but seeking know-how? Will • Lack of technical experience – 11% all your hard efforts result in Grisham’s first novel, or his second? In comparison, when companies do use a framework you get results like this: • 88% report improvements in operating performance • 66% also achieve increase in profits. Let me know if there is any aspect of developing a So yes, it’s critical to look for a framework. It’s like successful business you would like me to write about. having a skeleton for the body of your business, to Email: graeme@balibizwiz.com stop it falling into a heap. I’ve spent a lot of time with Copyright © 2012 Graeme Stevens small business in Bali and see how incredibly hard some people have worked to build their dream. And over a business life time of 40 plus years I’ve had the opportunity to watch, work in, help and/or mentor a

C/BT/I-25 July 12

Bali Main Office: Vayatour Jl. Bypass Ngurah Rai 143, Sanur 80228, Bali T: (0361) 28 55 55 (Hunting) F: (0361) 28 11 44

Denpasar: Vayatour Travel Shop Jl. Gatot Subroto Tengah No. 279 Blok A/6 Denpasar 80231, Bali T: (0361) 418 324 (Hunting) F: (0361) 422 206 C/BT/G-7 March 12

Copyright © 2012 Bali Advertiser You can read all past articles of The Business Builder Series at www.BaliAdvertiser.biz C/BT/G-11 Jan. 12


Bali Advertiser

14 November - 28 November, 2012

Wanted; Nespresso capsules, Ristretto or Roma. Call 0819 9974 5109. Sanur. [048]

SULAWESI, CARAKA TRAVELINDO Many tailor made tours throughout Sulawesi, only one hours flight from Bali. For prompt and efficient service contact : info@sulawesi-indonesia.com Call (0411) 3618 877 or www.sulawesi-indonesia.com

For Sale; 1 unit veterinary monitors. Very good for veterinary clinic. Old stock but never been used. Rp. 6.5 million. Contact 0878 6431 8333. Jimbaran. [005]

C/BT/P-31 Oct. 12

Retirement Visa

Office :

55 Years & Above, 5 Years Stay

Travel Document Visa, Passport, Work Permit, Stay Permit

Airline Ticketing Domestic & International

Company License Foreign Capital Investment (PMA) Comanditer Veneescope (CV) Private Limited (PT)

Bali : Jl. Gunung Salak #233 Kerobokan Kuta Phone : 0361 - 732600 0361 - 7433400 Fax : 0361 - 735325 0361 - 733990 Jl. Raya Nyuh Kuning Next to BCC Hotel HP. 081 139 7852, 081 238 72666 Jakarta : Jl. Cikoko Timur No. 36 Pengadegan Jakarta Phone : 021 79187190 Fax : 021 - 7983542 C/BT/G-14 Nov. 12

Moving Sale; Canon HG10 HD camcorder. Included WD-H43-wide-converter. power adapter. 2 battery packs. Wireless controller. Component cable. Stereo video cable. USB cable. Software. Recording system AVCHD. 40GB HD drive. LCD screen: 2.7in. MiniSDcard. 3.5 Mio Rp (fix). Sanur. For pics and info please call Michael 081 2395 1444. [143] For Sale; Complete collection of David Baldacci’s books (about 20 volumes, including the latest The Innocent). Per book only Rp 80.000. Sell only the whole bunch for this price. Sanur. Please call Michael 081 2395 1444. [144]

Business & Travel

21

PMA Company Incorporation From Indonesia’s most experienced PMA company establishment firm.

Also, Accountancy & Taxation Services, Personal and Corporate. See our website for full details, including costs www.okusiassociates.com bali@okusi.net Istana Kuta Galeria Block Techno No. 2 Jl. Patih Jelantik, Kuta - Badung Bali 80361 Tel. (0361) 769 144

Jakarta – Bali – Batam C/BT/G-22 Feb. 12

Moving Sale; Large clothes dryer, 2 bedside tables, 1 bedside light, 1 standing fan, clothes cupboard with hanging space and shelves. Small oven, mosq net, laundry bin, iron board and carpet. All for Rp. 1 million. Call 0813 3944 0881. Ubud. [163]

Pathways to Healing the Body, Mind & Spirit By Michele Cempaka

Tools for a Magical Life Have you ever wondered why some people seem to have a truly magical life where everything seems to fall into the place and they always have a knack for creating whatever they wanted to actualize in their life? Have you ever said to yourself, “I want to have a life that is magical like theirs.” But then immediately in your next breath said, “That’s just not possible for me. I’m not as lucky as they are.” Or, “I just don’t deserve to have good things in my life. I’m not good enough for magic.” Did you realize that in that moment, you actually destroyed your possibilities of creating magic? What if it were possible for you to create magic in your life every day? What if you have already been doing it but you just didn’t know you were? Everyone deserves to have magic and everyone can have magic it in their lives if they just start asking for it to show up and be willing to accept it when it does. I want everyone to have the tools that I have learned and use regularly in my own life, because I know that once you start creating a magical life, that you’ll also want to share this with everyone else in your life so that they can have magic too. That’s when real change can occur on our planet, so let’s get started! Tool #1 Pulling Energy for Actualization Okay so you’ve been doing lots of affirmation work but it’s not working. Well this tool will do the trick. Let’s say you really want a job; it’s the dream job you’ve been waiting for your whole life, so you don’t want to blow the interview. Just by asking, you can begin pulling energy from the person or people who will interview you before you get there. You do this until you feel your heart open up and then when you walk into the office, equalize the flow. At the end of the interview you let a little energy trickle back to the interviewee until you feel your heart open even more. The effect will be that the person won’t be able to stop thinking about you and you’ll most likely get the job! Before doing this though, be sure this is the job that you really want. This tool will also work well with someone you’re attracted to. You can use this tool any time you want to create a connection. It’s important to remember that pulling energy is soft and doesn’t require a lot of effort. Tool #2 Actualizing More Money The Universe can provide us with what we ask for, but we need to be aware of how we ask for things. For example, it’s more effective to say: “I would like to actualize (bring into existence) more money.” Rather than saying: “I would like to manifest more money.” The word ‘manifest’ means how things show up in our lives, so if we say: “I’d like to manifest more money,” we’re actually saying: “I’d like to how it will show up more money,” which doesn’t really make sense. When we begin to become

C/U/I-16 May 12

more aware of how we use our words, this will make a significant difference in how we can successfully create and generate magic in our lives. For example, the word ‘want’ = lack, so by using this word to actualize something in your life, you’re actually telling the Universe that “I want (lack) more money,” thus, blocking the energy for the money to come to you. Additionally, it’s also important to set up a 10% account just for you. Always remember to pay yourself first and let the money grow. Don’t use it for anything else. By allowing the money to grow it will energetically open the doors for more money to flow into your life. Your business will start booming as a result and the money flows will keep on flowing. There’s a huge amount of magic in that 10%! Tool #3 Destroy & Uncreate Your Life Every Night Are you willing to destroy your life as it currently exists? What if a whole lot more could show up if you did? Every night when you go to bed say: “Everything I believed I was and everything I created today, I destroy and uncreate it all. Who I was today, I destroy and uncreate.” When you do this, a whole new you shows up that’s far greater than anything you ever thought was possible. In the morning when you wake up ask: “Who am I today and what grand and glorious adventure am I going to have?” This question alone will set the tone for your day and everything will generally go smoothly for you.

C/U/I-16 May 12

I hope that you will begin using these tools in your life and create a magical life beyond your imagination. As infinite beings, we are truly potent. There are so many possibilities available to us all we need to do is ask. What would it take for you to recognize how phenomenal you truly are? All of these tools and much more are in the book: Magic. You are IT. Be IT! By Gary Douglas and Dr. Dain Heer. If you’d like more information about this book or have any comments about this article, please email: mcempaka@gmail.com

Michele is a healer, transformational coach, teacher & writer who specializes in transforming people’s lives using a variety of tools. She has lived on Bali for 10 years & incorporates the indigenous spiritual qualities within her unique healing & coaching practice, providing a transformation healing experience for her clients and students. www.spiritweaverjourneys.com For questions or comments about this column, please email: mcempaka@gmail.com Copyright 2012 © Michele Cempaka C/BT/I-19 Sept 12


Education & Family A successful tutor will make you speak At your home or office 9 years experience, taught more than 100 foreigners

C/E/M-2 May. 12

Balinese Dance Lessons at Mekar Bhuana

Reg

ee DVD tutorial* ister now and get a fr Phone: 464 201

 Private or group for all ages  Professional English-speaking instructors with overseas experience  Comfortable studio with A/C and full-length mirrors  Easy-to-understand method  Flexible schedule Gamelan music lessons also available E: info@balimusicanddance.com www.balimusicanddance.com (conservatory) www.mekarbhuana.com (online store) By studying at Mekar Bhuana, you are supporting our documentation and reconstruction projects *For first 10 students enrolled. NC/E/I-18 April 12

For Sale; 2nd Pigeon manual breast pump and steam sterilizer (up to 6 bottles), used 1 or 2 times only, condition 95%, complete with box, never used baby walker. Call 0812 4674 4398. Denpasar. [074] For Sale; Blackberry Curve 9300 3G, black, condition 95%, charger, headset, manual book, USB data cable, box. Working well. Picture request by email. For more information call/ SMS 0813 3872 2998. Denpasar. [075]

For Sale; Wall kitchen cabinet 195x40x50cm, color dark brown. Rp. 1.500.000. Contact <pat2com@gmail. com>, SMS 0819 3433 8214. Denpasar. [114] For Sale; Unwanted gift. Transonic Pro Bird-X electronic pest repeller. Never use. Still in the box. New Rp. 698.000, sell for Rp. 450.000. Contact <pat2com@gmail.com> or call/SMS 0819 3433 8214. Denpasar. [115]

For Sale; Various 2nd hand SUP, Stand Up Paddle Board, Jimmy Lewis. Some of the best boards in the market, good conditions and prices. Can test in the water, Jankie 0813 3823 5082. Sanur. [076]

For Sale; 2 black metal garden chairs, glass top table, pillows. Elegant design, just few months old. Price was Rp. 800.000 at Ace Hardware, sell for Rp. 600.000. SMS your e-mail for pictures. Chris, 0857 9214 5997. Kerobokan. [116]

For Sale; Samsung Galaxy S2 with accessories, also spare battery with USB charger, 16Gb card, updated firmware (ICS) no contract, unlocked, Australian expat owner. Rp. 3.2 Juta. 0813 3739 9577. [077]

For Sale; Simbadda wooden 2x speaker, 1x subwoofer system CST 7100N. 3 months old. 2x40W, 62dB, 4kg. Great for PC or Music. Price was Rp. 399.000. Sell for Rp. 300.000. Chris, 0857 9214 5997. Kerobokan. [117]

NC/E/A-14 Nov12

NC/E/G-14 Nov. 12

C/E/I-08 August 12

C/E/G-14 Nov. 12


Bali Advertiser

Education & Family

14 November - 28 November, 2012

23

N O W O P E N F O R R E G I S T R AT I O N

Explore the Green school School Difference green Green School integrates a unique academic learning program with environmentally sustainable practices. As you consider school choices for your children, please consider the unique attributes we offer, including: š

š š š

š

An integrated, student-centered curriculum that combines academic content with environmental, experiential and entrepreneurial learning as it nurtures all of a child’s intelligences: intellectual, emotional, spiritual, and kinesthetic. A very high teacher-student ratio, with a diverse group of creative, talented, and caring educators from all over the planet. One of the most vibrant creative arts programs on the island: music, drama, dance, yoga, and the visual arts. An award-winning, interactive campus that features organic gardens, renewable energy projects, a breeding center for endangered birds, and innovative bamboo architecture that inspires students with its beauty and connection to the natural world. A warm, welcoming, and engaged community of students, teachers, parents, and friends representing 40 countries on six continents.

Now enrolling students for January 2013 intake, Pre-K through Grade 12 Please contact our admissions team at 0361 469 875 or email admissions@greenschool.org set up an appointment. Daily tours Mon - Fri at 3:30 for the public. Please visit our website for more information.

call

8888 551 Toddler (8 mo - 2 years) Pre Nursery (2 - 3 years) Nursery (3 - 4 years) K1 (4 - 5 years) K2 (5 - 6 years) Primary 1 (6 - 12 years)

RegentS school

www.greenschool.org Jalan De wi Madri 88. Renon

C/E/G-14 Nov. 12

C/E/I-21 March 12

C/E/G-14 Nov. 12


24

Education & Family

Bali Advertiser

14 November - 28 November, 2012

For Sale; Brand new external hard drive 500GB with 1000 albums Lounge & Chillout music plus all Putumayo albums in perfect quality. Perfect for bar and restaurant. Sell for Rp. 1.7 million. Call 0813 3798 4369. Kuta. [126]

Indonesian & English Courses Tutor :

For free trial class, please contact:

Ph: 0878 616 37 555 E-mail: nika.wirawan@gmail.com

Unwanted present: USB stick 32GB (original Kingston) filled up with the Rolling Stones magazine best 500 albums of all time collection in perfect quality. Price in the shop Rp. 1.2 million. Sell for Rp. 800.000. Call 0813 3798 4369. Kuta. [127] For Sale; Brand new Seagate external hard drive 1000GB (1TB) with over 1200 movies of the last decade (until 2012). Just plug into your TV and watch without DVD player! Sell for only Rp. 2 million. Call 0813 3798 4369. Kuta. [128]

C/E/U-11 July 12

C/E/I-02 May 12

( S E C ) Seminyak English Course Accessible location : www.learnindonesianinbali.com Jl. Seminyak No. 7. Tel: (0361) 733 342 Opposite Bintang Supermarket

For Sale; 4 x wooden dining chairs almost new Rp. 1.4 million. Leather woven chair Rp. 500.000. Wooden desk Rp. 1 million. And more! All must go before January 1st. Photo available. <Royaladdicts@gmail. com>. Kerobokan. [129] For Sale; LG direct drive washing machine, front loader. Type: WD-M1070TD 2 years old, very good machine! Rp. 3.75 million nego. <royaladdicts@gmail. com>. Kerobokan. [130]

Nika Wirawan, S.S., a university Lecturer with 7 years experiences in teaching Indonesian & English for private & companies.

o n l y 5 minutes from YOU

75% Conversation  

Legian Kuta

NEW OPEN

5 min. from

5 min. from

Jl. Raya Seminyak Jl. Raya Canggu near BRI Bank 26 NOVEMBER 2012 NEW CLASS C/E/I-14 Nov 12

C/E/G-14 Nov. 12

THE MAD CENTRE

the M.A.D centre

Jalan Nakula Timur 19C between Sunset Road and Iman Bonjol same road as Bale Udang, Seminyak Kuta Ph. 0361 894 7394

!

Ta m a n M a h a t m a G a n d h i F o u n d a t i o n

Taman Rama National Plus School

Quality Education - Moral Values The Taman Rama School is a private National Plus school serving the educational needs of the local and expatriate families that make up the community of Bali. Our school provides high quality education from kindergarten to Year 12.

www.madcentre.wordpress.com

PERFORMANCE ART CENTER - MUSIC, ACTING & DANCE - THE M.A.D. CENTRE

Kindergarten Programme

ENROLMENTS OPEN NOW FOR THE MAD CENTRE SEMESTER EXTRA-CURRICULAR LEARNING

Toddler: Age 2 - 3 years Nursery: Age 3 - 4 years

Music - Drums, Bass, Guitar, Piano and Vocals all to Diploma and Teaching Levels

K 1: Age 4 - 5 years K 2: Age 5 - 6 years

Acting - Musical Theatre, Drama, Speech and Communication all to Diploma and Teaching Levels Dance - Ballet (RAD) Street Jazz, Modern Lyrical, Hip Hop, Breakin, Salsa, Yoga and more.... Performance art packages from 990,000Rp per month Ages 3 + - check www.themadcentre.wordpress.com for all timetables

Cambridge Programme

National Plus Programme

Cambridge Primary Cambridge Secondary IGCSE AS / A Levels

Primary (SD) Junior High (SMP) Senior High (SMA)

www.ourbalischools.com

BOOK NOW If music be the food of love, play on.

Shakespeare

Cambridge International Fellowship Centre

Taman Rama School Denpasar: Jln. Cokroaminoto No. 382 - Ubung Kaja - Tel: +62. 361 414849 / 431693 Fax: +62. 361 414859. Email: info@ourbalischools.com C/E/G-25 July 12

C/E/I-30 May 12


Bali Advertiser

14 November - 28 November, 2012

For Sale; iPhone 4, mint conditions. 32Gbs, price Rp. 3.100.000. 16Gb, Rp. 2.800.000. Both are still locked! So you need to unlock it by yourself. Too lazy to do it. Call 0821 4483 3668. Kerobokan. [072] For Sale; Digital camera Olympus FE-170, 6.0MP 3x optical zoom 2.5 LCD, doesnâ&#x20AC;&#x2122;t work. Rp. 50.000. Contact 0818 0566 2911. Legian. [134] Notice: Bali Advertiser confirms all free Private Classified ads. When you send an ad, we will contact you. If we are unable to contact you then your ad is not printed.

Education & Family

25

For Sale; Kawasaki Moto X helmet. Grey KLX/dirt tracker 150. Brand new. Still in box, never used. Size large. Rp. 400. 000 or offers. Terry 0813 3813 6110. Sanur. [089] Looking for; Small sailing catamaran. Similar to Hobie cat or Caper cat. Any cond considered. E-mail to: <bradwoodger@aol.com> 0813 3745 6265. [090] Looking for; Trampoline in good cond with or without safety net, spoke wheels for Honda Tiger and Yamaha GP760 jetski eng. E-mail: <bradwoodger@aol.com> 0813 3745 6265. [091] C/E/I-17 Oct 12

C/E/U-22 Aug. 12

C/E/G-25 Jan. 12

C/E/G-14 Nov. 12

C/E/I-14 Nov. 12

C/E/I-14 Nov 12


26

Education & Family

Bali Advertiser

14 November - 28 November, 2012

Global Goings On........ World AIDS Day December 1, 2012 It is estimated that more than 33 million people worldwide are infected with the HIV virus and more than 30 million people have died from complications arising out of the escalated form of AIDS, since the early 1980’s. These are shocking statistics for a terminal disease that is highly preventable and it is therefore one of the key aims of the annual World AIDS Day to educate people about reducing the risk of contracting or passing on this terrible illness. Acquired immune deficiency syndrome (AIDS) is the final stage of the preceding human immunodefiency virus (HIV), a disease that attacks the immune system, preventing it from fighting off any illness and healing itself. HIV is exclusive to humans and is transmitted via bodily fluids excluding tears, sweat and saliva. Unprotected sex, blood transfusions, needles, pregnancy, childbirth and breastfeeding involving an infected person or their fluids, can likely result in contraction of the disease. Cases in humans are recorded as far back as late in the 19th century in Western Africa, where research has identified the original source to a breed of chimpanzee carrying a very similar virus (SIV). The likelihood is that infected animals were hunted and eaten by people, hence contracting the virus, which consequently mutated into the altered state (HIV) that may only be housed by a human body. Consequently, sub-Saharan Africa still accounts for almost 70% of all persons currently living HIV and AIDS. In any event, HIV was only formally acknowledged by the Centre for Disease Control and Prevention in 1981, after it had migrated to several other parts of the world where cases of infected persons were being reported. Sadly, what followed in developed countries were media and awareness campaigns, touting ill-conceived ideas and cherry picked facts that conjured up sentiments of the disease belonging exclusively to the sexually irresponsible and promiscuous or druggies sharing needles, so those affected were often stereotyped and treated as lepers. Unwiring the common fallacious mindset has been a key struggle for champions of the cause in garnering support for a ravaging disease that is now considered to be pandemic. World AIDS day seeks to enlighten minds about the facts, the risks, preventative measures and to empathise with those affected. It also raises funds to research possible cures, treatments and vaccines to reduce the suffering of existing carriers and the stem the spreading for the future. Statistical trends show that poorer regions are more susceptible and this is believed to come down to access to knowledge and education regarding the practice of safe sex and needle sharing which can account for several health risks not limited to HIV. Devastatingly, because of these shortfalls, children account for a significant percentage of the worlds affected persons as well as becoming orphaned due to the passing of infected parents. Over the years, several medical breakthroughs have been made in treating and prolonging symptoms including the successful use of Haart (highly active antiretroviral therapy) being implemented since the mid 1990’s. This treatment slows the onset of the virus and many of those living with HIV are experiencing average life expectancy with very reasonable health. Likewise, the likelihood of passing on the disease to a child through pregnancy, childbirth or breastfeeding has been greatly reduced through the same treatment. So the dedicated work is being rewarded as improvements in the stats are recording an overall reduction in new cases and deaths over the last 3 years, however, this trend is an average across the globe and some regions continue to show rises in the dissemination of HIV and AIDS. Indonesia is considered a critical region in terms of management of further spreading according to UNAIDS and Bali is far from exempt, reported cases rising by at least double in the last 5 years. This is particularly due to the sex industry and the lack of safe practices within it, the social stigma attached to the illness and inadequate access to medical attention for identification and/or treatment. We here in Bali revel in an environment that doesn’t restrict us or enforce too many rules so let’s self regulate to show that we can manage ourselves sensibly within it! HIV and AIDS are preventable with just a little care so please, take the precautions because the consequence could be a life sentence or worse. For more information www.unaids.org

St Nicholas Day December 6, 2012

Oil Painting Classes starting on 17 November Classes:

Saturday Morning ( Starters) 1 place left Thursday (Advanced) 2 place left Small groups, reasonable rate. For more information: www. noellaroos.com http://www.noellaroos.com/workshops/workshops.htm contact: noellaroos@hotmail.com NC/E/G-14 Nov. 12

C/E/G-18 April 12

On this day… JFK assassination - November 22, 1963 On this day… while riding alongside his wife Jacqueline in a convertible as part of a motorcade through Dallas Texas, American president John Fitzgerald Kennedy was shot through the head. Lee Harvey Oswald was arrested for the crime but would never be tried because he too was shot dead while in police custody. Jack Ruby who claimed to be overcome by grief for the presidents death was convicted of this murder which ultimately prevented closure on the world famous assassination. Cover-up conspiracy theories abound surrounding the death of the popular president JFK, but perhaps we can never know for sure… Guitar legend Jimi Hendrix is born November 27, 1942 On this day… the legendary left handed guitar ‘genius’ James Allen Hendrix was born. He became an undeniable rock superstar following the infamous guitar burning on stage and his unconventional performance of the ‘Star Spangled Banner’ at Woodstock. A complicated man with many a vice, he died of a drug overdose in 1970 at the age of 27. ‘Humane’ execution method introduced December 7, 1982 On this day… in Texas USA , the firs execution by lethal injection was carried out on Charles Brooks Jnr, whose crime was murder. This method was introduced as a more humane practice than the preceding gas, electrocution or hanging although the death penalty remains a rigorously debated issue in the discourse of the American public. 43 people were put to death via capital punishment in America in 2011.

C/E/I-22 August 12

St Nicholas, the original Santa Claus died on December 6, 343 AD and on this anniversary each year, his life and death are celebrated by many European nations. Nicholas was born as a Greek in the city of Patara, (a region on the Mediterranean coast which now belongs to Turkey) to parents who raised him to be deeply religious and left much wealth to him upon their passing. Following the mantra of Jesus to ‘give to the poor’, he dedicated his life and inheritance to just that. He became a young Bishop of Myra in Lycia (also now a part of modern day Turkey), and his deeply generous reputation grew to precede him. He became known as a friend without bias, of anyone suffering misfortune and his empathy even extended to criminals on occasion. Stories evolved over time and eventually he became legendary in his abilities to restore good where adversity reigned. For example, it is told that three children were lured into the home of a wicked butcher where they were killed and pickled for sale as meat. Fortunately, the house was on the same trail that the bishop was traveling at that time and through his ethereal senses, he detected the crime and resurrected the children through prayer to be restored to their families. The butcher became his minion and Saint Nicholas became known as the protector of children. Another story tells of him gifting bags of gold to a poor father and his three daughters who lacked the required dowry to secure husbands and were hence doomed to be sold into slavery. It is believed that the golden gifts were anonymously tossed in through an open window and landed in socks that were hanging on the mantel to dry. St Nicholas is revered across many regions in Europe, as he is the patron saint of countless groups of people including children, merchants, students, sailors and even murderers! He is also considered the patron saint of many cities and towns across the continent… In Italy, he is the patron saint of the city of Bari where his remains are believed to rest and earnest commemorations take place while gifts to upcoming brides may be doled out to support their marriages. In Palestine, St Nicholas is the patron saint of Beit Jala right beside Bethlehem and here they celebrate with deeply religious rituals, prayer and parades. In Belgium and the Netherlands one practice is to leave a shoe or boot in front of the chimney with hay or carrots in them as gifts for St Nic’s horse and in return they may find a small gift the following morning. In some areas, it is thought that if St Nicholas ascertains that the child was not ‘good’ leading up, they may simply find a branch in their boot! In western regions such as America, Canada, Australia and the UK, St Nicholas Day is not formally observed but by the Diaspora of those countries that do. Instead, we can see how the legends surrounding him contribute the metamorphosis of St Nicholas into the modern day, ‘secular friendly’… Santa Claus or Father Christmas as he is also known. But he is celebrated later in the year and that is for another article…

Comments to info@baliadvertiser.biz

Copyright © 2012 Global Goings on You can read all past articles of Global Goings on at www.BaliAdvertiser.biz C/E/G-14 Nov. 12


Bali Advertiser For Sale; Mobile USB modem Huawei, price Rp. 300.000. Call 0857 1929 9897. Seminyak. [204] For Sale; AC 11/2pk Panasonic Eolia, good condition ex. boutique for only Rp. 750.000, bought Rp. 3.8 million. 2 canopies from iron never use. Good for shop Rp. 300.000. Call Chandra 0821 4656 7721. Need cash. Denpasar. [185] For Sale; 2nd Apple iPad 1, wifi only complete with box, screen protected since first day, flipcase, perfect condition like new, no waranty, only Rp 3.800.000. Contact (0361) 786 9350 no SMS. Denpasar. [186]

14 November - 28 November, 2012

For Sale; 1 bed and mattress, 2 sofa and coffee table, TV cabinet, 4 bedside table and 4 chairs, flexible table and TV Sharp Aquos 32”. Please call 0819 3607 4041. Dalung. [205] For Sale; Under counter chiller master 2 doors, display cooler 3 doors 1500lt, tables and chairs ex Ace photo available <info@alfredfood.org> / (0361) 878 4379 office time. Sanur. [206] For Sale; Spiral mixer bowl volume 200lt, 75kg adonan, 380V, 2 speed, photo available <info@alfredfood. org> / (0361) 878 4379 office time. Sanur. [207]

For Sale; Macbook Pro 15 inch HD 500Gb, RAM 4 Gb, webcam, good condition asked Rp. 10.500.000 nego. Call (0361) 745 5886. Denpasar. [192] For Sale; Laptop Acer 14 inch, HD 320Gb, RAM 2Gb, bluetooth, wifi, DVD-RW, good condition complete with the bag only Rp. 5.2 million nego. Call (0361) 745 5886. Denpasar. [193] For Sale; Fishing reel. Made in U.S.A. Penn Long Beach 68. Complete with new fishing line. Perfect for jigging, trolling, and bottom fishing. Mahi-mahi, Tuna, GT, Tengirri, Kerapu, dll. Call/Text 081 2298 1228. Kuta. [194]

For Sale; Fishing rod. Shimano model Talavera. Length : 6ft. Aftco roller guide and roller tip. Line weight 60 100 lbs. Fast action. Phone/SMS 081 2298 1228. Kuta. [200] For Sale; Fishing rod. Sabre made in California, U.S.A. Length : 6 1/2 feet. Line 10-40 lbs. Great general purpose rod. Casting, trolling, and bottom fishing. Phone/SMS 081 2298 1228. Kuta. [201]

Education & Family

27

SWIM SCHOOL & AQUATIC EDUCATION CENTER All Ages – All Abilities

at Canggu & Kuta RING 0361-7443102 or email to : bali_renang@yahoo.com, ptswimtec@yahoo.com Booking for Programs a must C/E/G-5 Sept. 12

For Sale; Assorted fishing lures. Hard baits, soft baits, and heavy duty skirts, Made in U.S.A. Rigged and unrigged. Phone : 081 2298 1228. Kuta. [202] C/E/U-25 Jan. 12

Say What? Question: I am a woman in my mid thirties with no kids. Since arriving in Bali about 3 months ago, I have been dating an Indonesian man whom I met at the guest house where I stay. Although he is responsible by local standards, I have more money than he. I am not wealthy, but I do OK for myself. He says it’s old-fashioned for a man to pay for the woman on a date, especially since Western women have more money than Indonesian men. He is upset that I expect him to pay when we go out. In my opinion, the man pays, and that it is just the way it is done. When you get married, it’s another story. What he says makes sense, but doesn’t feel right to me. What do you think? Dr. ZZ: There are many intricacies to consider in a cross-cultural relationship, money being one that affects most interpersonal involvements anywhere in the world. That you mention marriage in your one-paragraph about a man you have known for only 3 months is a red flag signal. You need to be careful that you are not dealing with a self-appointed “tour guide” who attaches himself to Western women and woos them with promises of a happy future together as he shows them around all the latest hotspots. If his idea of your paying for dates does not sit well with you, then you need to honor that information. When he asks an Indonesia woman out on a date, chances are he picks up the tab. If all he can afford is to treat you to bakso soup, then that’s the way it is. Just because you are a Westerner with more money than he doesn’t mean you are a walking wallet. On the other hand, if the two of you are “hanging out together” rather than dating, and you go places that involve transportation, accommodations and more than a quick meal, it may be reasonable for you to share expenses 50/50. The other option is that you hire a taxi on your own and go places solo. Offering to foot the bill to certain events when you are with him needs to be your decision, not his. There is a lot about Bali which he can show you that doesn’t involve big money. Bemos, local buses and jalan kaki go a long way on a shoestring. Any larger ticket expenditures when the two of you are together need to be negotiated in advance. If something doesn’t sit right with your gut, you need to be firm and say no. Freedom is the art of discovering who YOU are; it has nothing to do with compromising yourself for the sake of seeing how long you can stay in a particular relationship. Don’t fall for this fellow’s lines and behavior too quickly. Take your time before investing your emotions, and proceed with caution.

Question: My feet hurt (bone spurs), and I am about 18 kilos overweight. Looking back to when all this started, I would put it at about 20 years ago. My dad died unexpectedly, and my mother took it upon herself to disown me. She actually disowned all the children (we are all now in our 50s), but my two brothers don’t care. They just leave her alone, but I am different. She is my mother, and I will never forgive myself if I do not at least make the effort to communicate with her. I, however, live in Bali and she does not. So I write her letters, and they come back to me unopened. On Mother’s Day, she took her phone off the hook. Any time I call her to say “I love you,” she hangs up. This has been going on for years. It has grown worse lately, but it all started shortly after my father died.

C/E/G-14 Nov. 12

A psychic recently told me that, when she dies, I will be the only one to be left out of the will. I cry to think of it. Why would she do this? Because I am the only one who loved her? It makes no sense. What should I do? Dr. ZZ: Psychic aside, the outcome of your mother’s either including you in her will or excluding you need not be the focus of your interaction with her. There is wisdom to the adage that says, “Imagine all your worst fears as true, then go about living your life in spite of it.” Indeed, living life to the fullest is the only viable choice. You might as well act as if you already imagine she will write you out of the will; then make the most of your relationship with her in spite of such an outcome. If she comes through and bequeaths to you, you can celebrate the unexpected surprise. If she fails to bequeath, you are handling it. Troubled though she may be, she is nevertheless your mother. So send all the letters you care to; call and leave messages. Tell her in as many ways as you care to, “Mother, I just love you.” The only other option is to ignore her as your brothers have chosen to do. Any attempts at communication are as much for your own benefit as they are for hers. After she has passed, you will no longer have the opportunity to give of yourself in this way and to show your willingness to love and share. “In the end, all that matters is how well we lived, how well we loved, and how well we learned to let go.” Freedom comes from the authenticity of our own self-expression, not from being able to control the outcome.

C/E/G-14 Nov. 12

Copyright © 2012 Say What? You can read all past articles of Say What at www.BaliAdvertiser.biz

Dr. ZZ has a Ph.D. in Counseling and a doctorate in Natural Healing. Drawing on a background of over thirty years as a professional therapist, she offers self-help in the areas health, relationship and personal growth. All queries are answered by email and, if they appear in print, are subject to editing. Please email your questions to: <ba.saywhat@ yahoo.co.id> All identifying information is kept strictly confidential. C/E/I-31 Oct 12


Cargo & Export Bali

Over 5 years

Hawaii

Cargo Consolidators

Representatives in Bali & Hawaii Buying Agent for Indonesian Furniture & Handicrafts

Specializing in small shipments - LCL at low rates with no hidden charges.

Julie Watitjandi +62 811386204

Garry L. Corwin 808 256 - 6955

C/CE/G - 04 April 12

For Sale; Apple PowerBook G4, 1.5GHz, 75GB HD, 1GB RAM. Excellent condition, like new. Comes with extra battery and original install discs. Rp. 4 million (nego). SMS +62 857 3825 0920. Kuta. [092] For Sale; 1TB external hard drive filled with more than 1.500 pieces of USA/UK + Dutch/Belgian/Flemish television series (2011-12). A lot of stuff as recent as today. Also about 60 fairly recent NL/BE movies. Rp 1.500.000. <balicota@ gmail.com>. Seminyak. [035] For Sale; Ultra infrared foot, calf, body massager with different selectible speeds+ remote control. Infrared + reflexology provides therapy to your feet + body. Massaging nodes stimulate all pressure points on the feet-body. As new. Shop price is more than Rp. 3 million. Sell for Rp. 600.000. Call 0821 4755 8570. Gianyar. [080]

C/CE/G-30 May 12

PO Box 500, Northbridge WA 6865 Wayne Bayliss: +61.892.277.511 Skype: Wayne.Bayliss Mobile & Aâ&#x20AC;&#x2122;hours - Colin - +61.427.068.621 Email: admin@jetfastlogistics.com ABN: 54.124.633.450

We must ask where we are and whither we are tending. C/CE/G-5 Sept. 12

C/CE/G-25 July 12

C/CE/G-25 July 12


Bali Advertiser

Cargo & Export

14 November - 28 November, 2012

Anybody with experience on installing a grid-tie solar panel system for their villa to reduce electricity costs? Am looking for suppliers / installers / reports on customer satisfaction, etc. Send info to <marcelinbali@ gmail.com>. [061]

29

Trust our experience to manage your goods

For Sale; 2 Sanyo 200lt 1 year old freezer, good condition. One Rp. 1.2 million, both Rp. 2 million. Contact 0857 3726 9905. Kuta. [062]

C/CE/G-17 Oct. 12

For Sale; Kawasaki 150 KXL / dirt tracker original exhaust system. Brand new never used. Rp. 275.000 or offers. Terry 0813 3813 6110. Sanur. [088]

- Dedicated and specialized warehouses for Air freight, Sea freight, Consolidation and LCL cargo. - A strong network of agents worldwide. - An unmatched warehousing capacity in Bali (+5000m2). - A large fleet of trucks. - Professional service and experience at your disposal.

We ship to the five continents. If you need to know about specific regulations when importing into your own country...: Aqis standard, fumigation, E.T.O treatment, Lacey act requirements. ISF form, phytosanitary inspection, BSC, DPI - COTECNA, BIC, kadin, etc, please come and see us or send your requests to: info@limajaricargo.com.

LIMAJARI CARGO Jl. Raya Kerobokan No. 100 X, Denpasar - Bali Phone : (0361) 730 024 (hunting) Fax. : (0361) 730 382 Email : info@limajaricargo.com Website : www.limajaricargo.com

C/CE/G-16 May 12

C/CE/G-13 June 12

The Rotary Clubs of Bali and the Bali Red Cross Blood Bank are working together to increase the awareness about the severe shortage of Rh Negative Blood types here in Bali. These are much less prevalent in Asian populations (0.3%) vs. European populations (10%). If you have Rh Negative Blood and would be prepared to help save a life, please contact the Bali Red Cross Blood Bank office today at 0361-227 224 and one of their mobile units will visit you at your home/ office/hotel for your generous donation.

* Please note - the staff is professionally trained to International Standards and always uses new disposable needles. In addition, the Blood Bank is currently expanding its present list of Rh Negative Blood donors. If you are living in Bali and would be willing to have your name placed on a â&#x20AC;&#x2DC;confidential listâ&#x20AC;&#x2122; for emergency cases, please call Ibu Metta - 081 855 2299 (English speaking).

Help SAVE a life TODAY by sharing this information with your friends, colleagues and customers. Space for this ad donated by Bali Advertiser C/CE/G-14 Nov. 12


30

Cargo & Export

Bali Advertiser

14 November - 28 November, 2012

HECTOR’S Jl. By Pass Ngurah Rai No. 80X Sanur - Bali Mobile Phn : 081 238 333 25 081 238 333 29 info@balismartcargo.com E-mail : bsccargo@indosat.net.id www.balismartcargo.com C/CE/G-28 Dec 11

Water of Half-Life It has not yet been raining on the Bukit this official wet season, in any appreciable way at least, up to deadline time for this edition. It has been hot and humid instead. We southern hill-dwellers have seen the clouds over places apparently more favoured by whichever committee of gods it is that controls precipitation. That this is more scientifically seen as a seasonal phenomenon – a variable one as all of them are – has been dismissed in the minds of some who prefer to believe that a laser being operated on the new Kuta-Nusa Dua highway construction is to blame. The theory goes that the contractors are using the laser to deter rain since getting wet would upset their work schedule. It’s a lovely story. It might even be worth believing, since all manner of people here seem to believe in all sorts of things. There’s an acute water shortage on the Bukit too. That is also a perennial issue. It might be solved – one day – if anyone here believed in practical things, like planning, or building efficient infrastructure. Or maybe they should look at laser-enhanced public water pipes? That might help get the stuff pumped up the tiny rusted and corroded pipes and if effective would certainly advance science, since it would prove the Indonesian theory that water runs uphill. On the other hand, there may now be a glimmer of hope that the authorities will notice there is a problem. The village chief of Pecatu, I Made Sumarta, has got into the act, complaining that local people are also being forced into buying expensive tanker water. When it’s only “rich Bules” (hah!) and five-star hotels that quibble, well, frankly, no one gives a Rhett Butler.

DIY Clean-Up Neighbouring Ungasan, where the village authorities have a proud record of ignoring essentials, presents a problem for people who really would like to live without rat, snake, dog and mosquito-attracting rubbish. They’re into you for general levy fees – which we have avoided here at The Cage, preferring instead to pay the local Banjar, since it does useful social welfare work – but outside Ungasan village itself, little activity has ever been detected. So it’s interesting to learn that in another part of Tundun Penyu Dipal – the top ridge, from where there are fine views of the litter-strewn Balangan road – the local staff from 27 villas have got together and formed an association to provide mutual self-help and security. They meet monthly (refreshments provided), have a New Year’s party planned, and are benefiting from having friends around them. Many domestic workers do not have the local family support base available to Balinese who work in their home areas.

idea that is already practised elsewhere and should be copied in many other places. It’s self-help at its local best. Pity it puts the village authorities to shame, but there you go.

Five-Oh Jennifer Bee, who among other things markets Grand Komodo Tours & Diving and believes – so she tells us on her Facebook – that a glass is neither half empty for pessimists nor half full for optimists, but simply has room for vodka in it, alerts us to another astonishment. This year December has five Saturdays, five Sundays and five Mondays. Apparently this happens only once every 824 years and the Chinese have a term for it (well, they would). It’s the Money Bag. Bee, a Jakarta native who would look very fetching in a big red hat if only one were still in her possession (she gave it away), is also an aficionada of art. She might possibly be seen distant from her Sanur domain on Nov. 16, at the opening of the Bali Sumba Timor Photography Exhibition, featuring the work of Ari Saaski. The exhibition, which runs through to January, is at Cafe des Artistes in Jl Bisma, Ubud. The photos on show include landscape, nature and portraiture and probably should not be missed by The Diary, either.

Pumpkin Heads

LEGA Cargo Domestic Courier Cargo & Service

• Moving:

Java and Sumatra House, office, etc. Denpasar|Surabaya|Malang • Package Delive ry, Solo|Yogyakarta|Bandung |Semarang • Box Carter PPick Up & acking Servic Jakarta|Lampung|Palembang e! Open 7 days a week 08.00 - 19.00

Jl. Robbie William No.8(Mahendradata Selatan) Denpasar Telp.: (0361) 8466138, 8466128, 7810099, 08123806372 http.://www.legapaket.com

Email: DPS01@legapaket.com

C/CE/I - 02 May 12

PT. INTAN BALI INTERNATIONAL

EXPRESS CARGO SERVICE SPECIALIZING IN

PACKING AND SHIPPING - AIR AND SEA FREIGHTING - PACK AND PICK UP - DOCUMENTATION - CUSTOMS CLEARANCE - WAREHOUSING - BUYING AGENT - CARGO INSURANCE ARRANGEMENT OUR SERVICE IS OUR SPEED AND ACCURACY

It was Halloween on Oct. 31, as no one should need reminding since it occurs on that date every year. It’s the eve of All Saints’ Day, a Christian festival, and is traditionally a night when the spirits are abroad; rather like the night before Nyepi, really. But it’s chiefly an American thing, dating from when the fun-loving Pilgrim Fathers landed at the Kennedy Compound in Massachusetts and wondered what they could do with all those pumpkins, since it was plain they could do absolutely nothing with the Kennedys. Ever since, whimsy has been the American way. And we’re indebted to American Prospect’s daily news brief (of Nov. 1) for giving us a break from election year politics – that’s all over now too – and instead informing us that according to a leading polling outfit, PPP, 62 percent of US voters polled said chocolate was their Halloween poison of choice, and that if forced to turn into a monster, 22 percent would prefer being a vampire against 12 percent who’d like to be a werewolf. It seems that the Democrats are the Party Party. Thirty-three percent of registered Democratic respondents told the pollsters they would be dressing up for Halloween, against only 23 percent of Republicans.

OFFICE AND WAREHOUSE: JLN. PULAU MOYO NO. 100X, DENPASAR - BALI WEBSITE : www.intanbalicargo.com FOR MORE INFO PLEASE CONTACT PHONE : +62 361 725162, +62 361 8474236 FAX : +62 361 725162 MOBILE : +62 81 138 8884 E-MAIL : intanbalicargo@dps.centrin.net.id info@intanbalicargo.com

C/CE/G-25 Jan. 12

Peaced Off Perhaps Nick Way, of the Bali Peace Park Association, will have more time to devote to matters of importance now that he’s left Network Ten in Perth. We learned of his departure from the broadcaster, which is having a bit of a commercial struggle these days, through The Australian newspaper’s Strewth diary column.

Backed by one foreign resident, owner of one of the villas in the project, the association is now also conducting monthly clean-ups in the area. At the first, on Nov. 5, 22 of the available 27 people turned out. A contractor has been appointed to take the rubbish to the refuse disposal centre at Suwung, whose operators will hopefully dispose of it properly. Since Ungasan village provides no rubbish collection in the area and there is as yet no appreciable decline in the cultural practice of just tossing your garbage over the fence – or dropping it on the road as you meander along on your motorbike – this is a significant measure to reduce the litter overburden. It’s an

It reported that at this year’s West Australian Media Ball, held recently and like all such events an annual bash renowned for feats of alcoholic misadventure, job security was the talk of the tables among the lads and the frockedup lassies. This was apparently given extra piquancy by the departure of veteran sound-recordist Way and The West Australian’s so-called super sleuth Sean Cowan from the benefits of paid employment. Way should now be able to Google bananas (hint: they’re a plant, not a tree) to avoid further horticultural and arboreal embarrassment at the former Sari club site, as well as look for practical ways to progress his association’s long-running sequel to Mission Impossible. Hector can be contacted at reachme61@yahoo.com He blogs at wotthehec.blogspot.com and is on Facebook: Hector McSquawky Copyright © 2012 Bali Advertiser You can read all past articles of Hector’s Diary at www.BaliAdvertiser.biz NC/CE/I-31 Oct 12


Ubud Area For Sale; Apple Macbook Pro 13” thunderbolt, 8Gb, incl. Mountain Lion, MS Office, lots of graphic-design software, etc. Runs both Mac OS, WinXP, original box, perfect condition, less than 1 year. Can give Mac introduction course. <balicota@gmail.com>. Seminyak. [109]

Moving Sale; Baby car seat Rp. 500.000. AC model DGP-09CE TR 2pk, good condition. Call 081 2367 1491. Kuta. [063] For Sale; 2008 MacBook Pro. 2.26 GHz Intel Core 2 Duo, 4GB RAM. Rp. 7 million. Text 081 856 6288. Jimbaran. [066]

Bumi Bali

Balinese Restaurant & Cooking School Serving only specialty Balinese food despite complex blending of spices and fragrant roots that give Balinese food its intriguingly different flavor. Monkey Forest Road, Ubud Bali Phone (0361) 976 698 E : info@bumifood.com www.bumifood.com

C/U/I-17 Oct 12

&

UBUD WRITERS READERS FESTIVAL

Inez Baranay: A Peripatetic Author Interview by Uma Anyar The ninth Ubud Writers and Readers Festival has ended but Inez Baranay, author of “The Edge of Bali” and ten other books has stayed on in Ubud, reconnecting with the village she first discovered in the 70’s. Inez leads a peripatetic creative life. Like all writers she sits alone in a room to write books, but her writing rooms have been situated in diverse countries. She is a global citizen and place plays an important role in her novels. Inez was born in Naples, Italy of Hungarian parents. The family immigrated to Australia where Inez grew up. When Inez was in her teens her family moved to Malaya. The gypsy in her soul spurred her onto her own travel destinations when she entered her twenties and embarked on her first trip to Bali. She has lived in Papua Guinea and India among other places. She currently resides in Istanbul where she is writing her twelfth book and traveling to teach workshops and promote her books. During the festival I took Inez’s workshop, Practice and Persistence and found her to be a knowledgeable and helpful teacher who understands a great deal about the process of writing and has the ability to convey her knowledge in a succinct and interesting way. Inez also practices Iyengar yoga; her book, “Sun Square Moon: writings on yoga and writing” was first published in India and she now is giving it away as a free e-book that can be downloaded at Smashwords.com. I went to a literary event at Bar Luna Café in order to hear Inez read from her books and talk about her writing practice. In 2004 when I was a newly arrived expat I read “The Edge of Bali”. The Balinese wife in the story wrenched my heart. The book stayed with me. Recently, I wondered if the characters would behave in the same way if Inez were writing the book today. I got the chance to find out when she agreed to this interview. “The Edge of Bali” has just been reissued. Why has your Publisher decided to do this now? Is there a renewed interest in stories set in Bali? And if you were starting to write a novel about Bali ‘post bombing’, would it be very different from your original novel? My publisher found the novel (first published in 1992) was still relevant and would appeal to new readers, and he thinks, as you suggest, that there is a renewed interest in stories set in Bali. I’m happy to see it back in print. A novel inspired by today’s Bali would have to be different. The 2002 bombing would have to be a reference point. And, as I say in the Introduction to the new edition, “Mobile phones and going

C/U/I-05 Sept 12

online have altered the ways people find things out or fail to, keep in touch or go missing, have access to information or get confused. Once you factor in ubiquitous Internet and cell phone use, you are in a different universe”. In “ The Edge of Bali” you have a sentence that has intrigued readers: “She had hardly known she was seeking yet she had found.” There is a seeking impulse in this novel, as well as in “With the Tiger”, set in India, which deliberately follows the structure and theme of Somerset Maugham’s renowned novel “The Razor’s Edge”, which was one of the first important novels about a character’s spiritual quest and took Larry, the main protagonist, to India. What about seeking pulls you toward exploring this subject? And why did you write a novel based on Maugham’s story? Writing is a form of constant seeking: for knowledge, selfexpression, and the best way to use a semi-colon. With The Tiger came after my novel Neem Dreams, which is set in India, exploring the clash between tradition and globalization. It took many years and a great deal of research, and when it was published in India, I had not finished with India, or it had not finished with me. I turned to examine the craze for “spiritual” India, and found it began with Maugham’s The Razor’s Edge - before the Beats, the counter-culture or the New Age. The idea came to write a 60–years–later version. It’s partly a social history of that time, and explores, among other things, a Westerner’s changing relationship with India over 20 years and the effect of his seeking on the people in his life. Which of your novels would you like to see made into a movie and would you want to write the screenplay? At Binger Film Lab in Amsterdam I wrote a film adaptation of my novel Neem Dreams. My vampire novel Always Hungry was first written as an original feature film. Most if not all of my novels would make good films, and many have attracted film interest, and some extent of development, though so far none have gone into production. Not all novelists can or want to write for film, but it’s a form I love, and I would want to write the screenplay of any adaptation.

SUPER MARKET

DELTA DEWATA U

B

U

D

Open : 08.00 am - 10.00 pm

The Most Complete Supermarket in Ubud Jl. Raya Andong #14. Tel.973049, Fax. 978071 Ubud C/U/G-17 Dec. 08

At our shop in Ubud, our friendly staff will guide you to all things of a Spiritual/ New Age nature, including: Books, Music CDs, DVDs, Crystals, Incense, Jewelry, Inspirational Cards, Candles, Yoga Mats, Meditation Cushions, Engraved Stones, Tibetan Bowls, Clothing and more… Jalan Hanoman #64 – Ubud, Bali. Tel: 0361 796 9178 C/U/G-31 Oct. 12

You have taught creative writing in schools, festivals and non-traditional workshop settings. What about teaching and helping other writers turns you on? Teaching is learning, as any teacher knows. Also, at a point in one’s life it’s time to give others the benefit of your experience. Also, it is a break from the solitude and inwardness of writing. It’s fun to talk about writing with people who care. And probably I like to encourage things I value, like curiosity, courage, and clarity. Please tell us about the next one-day writing workshop you will be offering here in Bali? It’s an all-day workshop on 17 November, for writers of prose fiction and non-fiction, to be held at the Honeymoon Guest house, which supplies lunch as an added attraction. There’ll be a mix of discussion, exercises and Q+A. Writers putting aside the time to focus on their writing issues should find themselves freshly inspired, or at least feel that they’ve spent a day well. Applications to reservations@casalunabali.com or phone + 62 361 973282. More at on my website http://www.inezbaranay.com or on the Honeymoon website http://www.casalunabali.com/ honeymoon-guesthouses/ This sounds like a good opportunity for writers living in Bali. Thank you for your time. C/U/G-14 Nov. 12


32

Ubud Area

UBUD BALISPIRIT-ED TOURISM MINISTRY EVENT

S W E N BY

WAYAN JEN

ANOMALI COFFEE

The Indonesian Ministry of Creative Economy, Bali Spirit Festival and the Yoga Barn partner in a weekend mini-Festival in early December, featuring dance, yoga, meditation, sound healing and live music. “Indonesia Spirit” intends to attract social and environmentally conscious travelers in cities a plane flight from Bali, promoting our sustainable tourism, charity initiatives and cross-cultural riches. The government’s cooperation with BaliSpirit Festival validates the festival’s commitment to “conscious tourism”, of which it is a pioneer in this region. Indonesia’s Vice Minister of Tourism and Creative Economy, Sapta Nirwandar, said the festival “attracts visitors who put awareness and respect for culture first…. the kinds of guests Indonesia wants to welcome to Bali”. A percentage of ticket sales will support charity programs. December 7 to 9 at The Yoga Barn. E: pr@balispirit.com.

Tweaked to suit a slightly different market but following a successful J a k a r t a operation, Anomali Coffee opened recently at the corner of Jl Hanoman on Jl Raya Ubud. These people are passionate about delicious coffee. Using only Arabica or “mountain” coffee, Anomali sources its beans from all over Indonesia. The plants can only grow above a certain height, shaded and surrounded by other crops, so each island produces a different flavour, depending whether the coffee is surrounded by orange groves, nut plantations or herb gardens. Non-coffee drinks available, good food menu (try the creamy broccoli soup) and a huge open space upstairs, where they hope to have bands in the future.

REVIEW.IT!

YOGA PRANALA RETREATS

If you’ve been in Ubud for more than a minute, you know a person, place or p r o d u c t t h a t ’s special, not earning enough to feed a family and could do with more publicity. A website launching locally this month offers a simple solution. Co-founder Helvi Lystiani says review.it’s goal is “to link passionate customers, amazing local businesses and inspiring local causes”. It’s a simple, smart way to do business, and though the site has a marketing budget, no dollars are spent on billboards and flyers. Instead, money goes straight to local causes, with a dollar donated to a local charity for every review. Instead of focusing on big attractions, review. it is seeking our reviews of the little warungs, best trades people, come-to-your-home dance instructors – some of whom don’t even have access to the net. A team of Ubud-based Indonesians has worked on the start-up; the new site launches in Bali, with the intention to spread internationally by the same positive process. www.review.it.

CO-MUNITY-WORK SPACE Are you an Ubudbased designer, w r i t e r, a r t i s t , e n t r e p r e n e u r, scientist or other independent business person, interested in a place to talk seriously sometimes, shut up and work sometimes, and have proper office facilities on hand? If so, contact the founders of Hubud, the “community coworking space” due to open soon in Ubud because they’re looking for members! They say co working spaces are about community building, collaboration, and sustainability – because people are happier and more productive together. You can also meet the Hubud team at their monthly speaking event, called Ubud 20x20, which is hosted by Betel Nut on Jl Raya Ubud. E: team@hubud.org, or W: https://www.facebook.com/hubudbali.

HIGHLAND SPORT CLUB With snazzy renovations almost complete at Ubud Fitness in Kutuh, there’s competition opening on the other side of town. Above Bintang, a new local gym is luring members and annoying close neighbours - with loud music both early morning and at sunset. Further north, at Jl Sanginggan 21, Highland’s Sport Club has more to offer with an extensive range of hydraulic and aerobic equipment in a crisp, clean, white setting. It looks more like a five star hotel gym than a new Ubud outlet, but is already attracting customers to both equipment and its neat little ground floor class room, for yoga, modern dance and other classes. Open everyday, 6am-10pm. P. 081337380110.

Bali Advertiser

14 November - 28 November, 2012

In December, April and October, revered yoga teacher Linda Madani will lead three Yoga Pranala retreats in Ubud, offering participants the opportunity to “recover, rethink and rebuild” their lives. Inspired by her Balinese healer/teacher of 18 years, Linda has designed these retreats to help begin a new life. Each one focuses on a more flexible body, deep intuitive spiritual support, therapeutic massage, learning healing techniques and Pranala yogic skills that will stay for life. Linda says the students come from all over the world to deepen physical and spiritual awareness, renew their energy levels, restore health balance, release emotional baggage and reconnect with self! December 2-7, 2012 at OneWorld Retreats. W: www.intuitiveflow.com/retreats.

For Sale; Electric stove Westinghouse, it has 4 hot plates, a grill and oven and is in excellent condition. Rp. 2 million. Call 081 2394 7490. Nusa Dua. [064] For Sale; Unwanted gift, pearl silver necklace. Great condition, come with price tag. Price Rp. 550.000 nego. Call 0852 3712 6484. Canggu. [065] For Sale; Gazebo 4x4mt. Made from coconut wood with tile roof and glass windows, knockdown construction, easy reassembly. Great condition. Call 0813 3853 7334 or email <balihomeexchange@ gmail.com. Seminyak. [073]

Balinese, Indian & Vegetarian Food Romantic Setting • Sumptuous Menu

Cooking Classes (No minimum) Jalan Suweta No. 1, Ubud, Bali (Opposite Puri Saren Palace) Phone / Fax: (0361) 974 217 E : bumbu_bali@yahoo.com www.bumbubaliresto.com C/U/I-05 Sept 12

Without Advertising a Terrible Thing Happens ...........

nothing

Ubud’s Only Fully-Equipped Gym New Owners and Management • Complete strength and cardio equipment • Treadmills, Ellipticals, Bicycles, Rowing Machine • Friendly and professional personal trainers • Aerobics, Squash, Boxing, Pilates • Ballet, Jazz-Modern, Salsa Dance classes for adults • Ballet classes for children • Fully Air Conditioned • Free Wi-Fi • Daily, Occasional, Weekly, Monthly & Yearly Memberships

Terrace café • Smoothies • Fresh juices Open Daily 6:30 a.m. – 8:30 p.m.

Jalan Jero Gadung, Kutuh Kelod, Ubud Tel:

(0361) 974804

www.ubudfitness.com info@ubudfitness.com

Follow us on Facebook C/U/I-22 Feb 12

DAYU MEETS 007? Effervescent Ubud masseuse “Dayu Darling” had everyone guessing on Facebook last week – and me b e g g i n g shamelessly for an introduction – when she said she was picking up Sean Connery from the airport. Despite a look-alike photo (of the owner of one of the dive cruise boats she works on) it was all a tease: “Not really Sir James, Ibu Jen, my boss is just an Austrian three star general or something”. The reason we believed her is that Dayu has had her share of celebrated clients. West African reggae star Rocky Dawuni books massages with Dayu for his whole family as soon as her lands at Ngurah Rai airport. And she gave Balinese treatments to US country legend Kenny Rogers on another recent luxury cruise. FB Dayu Darling for cruise or home massages.

NEWS FLASH – KIDS’ LIBRARY SEEKS NEW HOME! Changes to the Pondok Pekak library, behind the football field on Jl Monkey Forest, will mean that the wonderful little children’s library – for visitors and the only library for many local Balinese children – has to find new premises. Open your generous heart and help find a place for these kids to read or borrow books. I will never forget the time founder Laurie returned from talking to local children about the concept of a library. “You mean there are many books in one place – and we can touch them?” asked one wide-eyed child. Contact Suzan Kohlik: E sariapi@indo.net.id.

E-MAIL: BAUBUDNEWS@GMAIL.COM COPYRIGHT © 2012 WAYAN JEN YOU CAN READ ALL PAST ARTICLES OF UBUD NEWS AT WWW.BALIADVERTISER.BIZ C/U/G-30 May 12


Bali Advertiser

Ubud Area

14 November - 28 November, 2012

Ganesha Bookshop

Independent bookseller in Bali since 1986 Ganesha in Ubud - the Main Store Jalan Raya (near the Post Office), Ubud, Bali Tel: (62 361) 970320 Web: www.ganeshabooksbali.com Email: info@ganeshabooksbali.com

Extensive range of New, Used, Rare and Out of Print Books. Used Books returnable for 50% refund. Good books at good prices. Eat, Drink, Read and Lounge at: Ganesha in Biku Jalan Petitenget 888, Kerobokan

NEW Bookshop and Reading Room Ganesha in Sanur Jalan Danau Tamblingan 42, Sanur

Books for Bali Project (est. 2004) A special project to support literacy, learning and reading for pleasure in the local community. We donate books to local schools and libraries. Check in the store or on the website for more details. GANESHA COMES TO SANUR: Jl Danau Tamblingan 42, Sanur

Moving Sale; All dishes, kitchen stuffs, etc. Contact Patrick <pat2com@gmail. com>, call/SMS 0819 3433 8214. Denpasar. [112] For Sale; Table from 2 blocks of lychee wood 41x42x80cm as feet and polished edges plateau glass 1900x1800x 11mm Rp. 1.500.000, big parasol for table Rp. 250.000. SMS 0819 3433 8214. Denpasar. [113] For Sale; Many items ex boutique. Dispay case, 2AC sale cheap. Hangers table sets made of glass nice. Lots of stocks good price all must go. Contact Chandra Sat-Sun for app. 0821 4656 7721 / (0361) 872 1362. [036]

33

For Sale; 2 bicycles Akita, 7-speed. Type: Marguerite daisy. incl. baskets, locks and bell. 2 years old, great bikes but not used a lot. Rp. 1.2 million per bike. Photo available. <royaladdicts@gmail.com>. Kerobokan. [131] For Sale; iPad 2 black 32Gb with 2 covers in perfect condition only 3 months in use. Rp. 5.5 million. E-mail <jmgent@live.com>. Denpasar. [132] For Sale: LG 17” flatscreen and Benq 17” flatscreen computer monitors. Rp 550.000 each. Perfect condition. Contact 081 2386 6753. Canggu. [071]

C/U/G-22 August 12

C/U/G-7 March 12

Bali Advertiser Interview: Putra U Oka of Bio Save (Amanaid) One doesn’t need to be an activist to see that Bali is under strain, with a combination of Western progress and a localised lack of understanding about environmental care. Although changes are happening: one company is determined to make a difference and has made considerable ground in swinging the pendulum back towards nature. Bio Save’s environmentallyfriendly Sewage Treatment Systems are part of the collective push towards a better Bali, and Bali Advertiser caught up with Putra U Oka, Assistant Director of PT Amanaid, to see how his company is helping to clean up Bali and what problems still need to be addressed. B.A. Putra, how bad is the untreated sewerage problem in Bali? B.S. In my opinion, the problem is quite severe and there is a lot to be done to address this issue. As the population of Bali is increasing, as well as the high presence of visitors from other parts of the world, we need to address the problem of untreated sewage more seriously, particularly in areas along the sea shores and rivers. You only have to drive along any river to realise the extent of the problem. For too long now, wastewater – including our raw sewage – has simply been disposed into our gutters and waterways untreated. The last thing a tourist wants is the smell of sewage while they are having a swim or having dinner on the beach. B.A. Can you tell us how your treatment systems work to make a difference? B.S. The difference they make is avoiding having raw sewage discharged into our gutters and waterways and ultimately onto our beaches. Our systems are designed to treat raw sewage and produce an effluent quality accepted by local authorities for disposal to open drains or waterways. It is not just a septic tank; it’s a wastewater treatment system designed to treat and restore sewage and sullage to an effluent quality safe to recycle into our waterways without a negative environmental impact. B.A. Is it true that even with a compliant septic system, people still need to be educated by way of not pouring chemicals down the drain as this inhibits the environmental functionality of the tank? B.S. Yes, of course. People still need to be educated about the harmful effect of chemicals, not only to our Sewage Treatment Systems but also to our environment in general. Our Sewage Treatment Systems are biological treatment systems, meaning that they function without the use of chemicals. We use naturally occurring safe bacteria to treat the wastewater and these bacteria need to live in a chemical free environment in order to live, multiply and achieve the desired treatment process. These wonderful bacteria eat the sewage, leaving only water which is safe to discharge into the environment. Basically, any household product available from the supermarket shelves is okay to use with our system but care should be taken with any product containing anti-bacterial properties, such as bleach: as long as the product is used in accordance with the manufacturer’s recommendations. B.A. You not only address human waste. You have other environmental hazardous protection products also. Can you tell us about those? B.S. We have also developed products such as our Bio-Gas Digester Tank System, where the main source of this system is cow manure. We use the natural bi-product of cow manure – methane – for use as fuel for simple gas stoves. Our process reduces the contamination of methane-to-air, and also lowers consumption of Liquid Petroleum Gas (LPG). Another great product we have is the Grease Trap. The

function of this product is to limit the amount of Fat, Oil and Grease (FOG) which poses problems to the sewage pipes in buildings and municipal facilities. And we are also investing in a range of new products designed to convert Fat, Grease and Oil into neutral carbon and gas, and we look forward to be able to offer these new products to hotels and restaurants in the near future. B.A. Is Bali beginning to take sewerage treatment more serious? B.S. Denpasar Sewerage Development Project (DSDP) is one of Bali’s government action plans to tackle the sewage problem in Bali. This municipal sewage treatment plant is managed by Badan Layanan Umum Pengelolaan Air Limbah (BLUPAL), a government department tasked to manage Bali’s sewage. We support this government effort to manage sewage more seriously, of which protecting Bali’s underground watertable is also a part of their duties of care. I believe Bali has taken measures to make the island cleaner, more efficient and effective by introducing new rules and regulations regarding effluent-quality wastewater. Denpasar and Bandung regency departments are enforcing these new regulations regarding the quality of wastewater effluent. Our economical and effective Sewerage Treatment Systems assist these government initiatives. B.A. What do you feel is the biggest threat to Bali’s environmental wellbeing at present? B.S. The biggest threat to Bali’s environmental wellbeing is to do nothing about the ever increasing level of pollution in our rivers and oceans. Bali has for many years been perceived as a paradise on earth, but over the past few years it has slowly lost this reputation and if we do nothing soon… It is imperative that not only the government of Indonesia, but also the tourist industry bodies as a whole do more to maintain our pristine environment if Bali intends to maintain its worldwide reputation in the future. B.A. What is the key factor that Bio Save is making a difference to the environment in Bali?

B.S. There are several key factors why we make a difference to the Balinese environment. With our wastewater treatment systems we can reduce the usage of clean water from PDAM (Clean Water Supply from the government) and protect the watertable by not needing to bore wells because we can reuse the effluent from sewage treatment into watering gardens. With this simple system we can save our client’s clean water bill and at the same time be part of saving the environment by reducing the usage of clean water – more often taken from the fragile watertable. Since introducing our new generation of septic systems onto the market 13 years ago, we have witnessed an ever increasing desire on the part of the Balinese hospitality industry to do the right thing toward their customers and to our environment. We are starting to see more and more businesses promoting eco-tourism and clean living: they are practicing what they preach. Businesses and tourist resorts are now finding it makes good economic sense to treat their sewage and sullage on site – recycling their water. Keeping their surrounds and our beaches clean and sweet smelling gives them a marketing advantage, while also recouping their investment from reduced water costs. Resorts have typically reduced water costs by 50%. B.A. Do you feel your company is educating locals to environmental care through your presence in Bali? B.S. Definitely. We consider it is one of our responsibilities to educate locals to take care of their environment. We have given seminars to universities and government agencies regarding the importance of wastewater treatment and the benefits from it. It would also be great to see more government initiatives to assist us in achieving this very worthwhile objective. We employ 65 people and have completed over 400 commercial installations. Every installation is an example of what can now be achieved. And our systems really are costeffective… they save money. This is the key factor to their growing acceptance. B.A. And finally, Putra, are there further new initiatives you are embarking on with Bio Save? B.S. I will continue to make efficient, cost-effective, low operational sewage treatment plants that are easy to install, simple to maintain, with the best quality output as stated in our company’s vision: “ To create a better environment for the future generations living in Indonesia and beyond.”

Copyright © 2012 Bali Advertiser You can read all past articles of Business Spotlight at www.BaliAdvertiser.biz


For Sale; Blackberry 9360 Apollo incl. box, USB cable, charger, all original, original screen protector still on the phone, no visible damage. However it doesnâ&#x20AC;&#x2122;t start up, might be good for spare parts, Rp. 1 million. <balicota@gmail.com>. Seminyak. [108] C/R/G-3 Oct. 12

For Sale; XL Force fins (one yellow, one black), price USD115/each. Contact <Operations@AquaMarine Diving.com>. Jl Petitenget No 2A Kerobokan. Phone (0361) 473 8020. [156] For Sale; Nokia AC-5E original charger Rp. 50.000, Microsoft bluetooth notebook mouse Rp. 150.000. Call 0858 5702 4740. Denpasar. [157]

C/R/I-11 July 12

For Sale; Samsung DVD home theater 5.1 HTD453HK incredible sound. Used for only two months. Price new Rp. 2.8 million, sell for only Rp. 2.100.000. Call 0858 5702 4740. Denpasar. [158] C/R/G-31 Oct. 12

%UHDNIDVW/XQFK'LQQHU 6WDUW\RXUGD\ULJKWZLWKDFXSRIRXUVHULRXVO\JRRGFRIIHH PDGHIURPGDLO\IUHVKO\URDVWHGRUJDQLFEHDQV 1RZGHOLYHULQJ:RRG)LUHG*RXUPHW3L]]DV )ODPH*ULOOHG3HUL3HULFKLFNHQ 6HHRXUZHEVLWHIRUIXOOGHOLYHU\PHQX ZZZJURFHUDQGJULQGFRP

1RZJULQGLQJDW -LPEDUDQ&RUQHU-DODQ8OXZDWX-LPEDUDQ MXVWXSIURP7KH,QWHUFRQWLQHQWDO+RWHO  6HPLQ\DN-OND\XMDWL;6HPLQ\DN C/R/I-22 August 12

C/R/I-08 August 12


Bali Advertiser

Restaurant & Nightlife

14 November - 28 November, 2012

35

EAT IN & TA (0361) 8 KE AWAY 57 0880

LITTLE KITCHEN International and Asian Cuisine CAFÉ | LOUNGE

Coffee & Breakfast | Lunch & Dinner | Free Canapes 07.00 - 23. 00

Bali Budha

Little

Jl . R a

KITCHEN café | lounge ya Semer

Jl. Raya Canggu

N Café Moka

Hotel Hapel

Jl. Raya Kerobokan

Jalan Raya Semer - Banjar Anyar Kerobokan C/R/I-22 August 12

C/R/G-14 Nov. 12

C/R/I-22 Feb. 12

Restaurant Review By Gerry Williams E-mail: gerry@balieats.com

The Surfing Chef! England has her Galloping Gourmet, Singing Chef and a host of other such named TV chefs, Bali just has our Surfing Chef! Young Justin Masters came to Bali 7 years ago, chasing waves and kitchen experiences, both of which had begun in the Margaret River area of Western Australia as an apprentice chef. A stint with Paul at Loloan [in its early hey days] inspired him to experiment with Asian spices. Various surfing/cheffing stints around Indonesia were followed by a serious period in Europe displaying his newfound Asian skills. The dream was always ‘back to Bali’ where surfing and kitchen could be combined, but small capital meant a tight set up. I have seen so many restaurants open, and fail, over the past 10 years or so in Bali. The amount of available capital seems to have virtually no relevance here [a number if big money newbies are on the verge of going under right now, some even for the 2nd time!]. Ingenuity, passion and that key ingredient, skill [experience, ability, whatever?] are more important. Justin had very little capital so he chose an economical site [coincidently close to the surfing beaches along the west coast of Bali], on the road to Canggu beach. He had no money for an elaborate ‘flash’ building, nothing trendy here with concrete, glass and coloured lights! So he bought the dying coconut trees at the back, chopped them up and made himself a restaurant that was intimate, almost funky, and definitely one that ‘felt right”, an often overlooked but all important ingredient so often missed by expensive architects who know little about restaurant operations. Then came the food, and the menu comprises what he and his fellow serious surfers like to eat, varying between the very healthy and other dishes for the alternate tasty tempting escapes from same. A cuisine that is both local and International, sometimes even a blend of both. Betelnut Café opens early for breakfast as these real surfers are often catching waves at dawn, building up a monster appetite. Eggs of course, and they can be any which way, with a whole host of extras to order as you wish. The Scrambled Eggs can be with avocado and feta, wrapped in a tortilla or with spinach, mushroom and a relish of roasted tomato served on toast. Fruit Bowls can be just tropical fruits alone or combined with muesli, yoghurt and that special

honey from Sumbawa. The baby surfers are not forgotten, a popular starter for the young fry are the Soft Boiled Eggs with crunchy toasted soldiers for dipping [pictured]. Start with a healthy Mezze Plate [falafel balls and tempe crisps with hummus, roasted peppers, marinated feta, sun-dried tomato and pita bread], a Fish Sate [lilit style minced with coconut on lemongrass], a high fibre Lentil Burger, the thick patty is topped with a light curry sauce and combined with mixed greens, fresh tomato and hummus] or if you are a Japanese surfer, or just super healthy, then a plate of Edamame Beans [immature soy beans still in the pod] are for you.

QUICK REVIEW Restaurant

: Betelnut Cafe

Address

: Jln. Batu Bolong 60,Canggu.

Telephone

: 0821-4680-7233

Open

: 8.00 a.m. to 11.00 p.m. [closed Mondays],

Smoking area

: Yes, upstairs with the view.

Non-smoking area

: Yes, downstairs in air-con room.

Other Burgers include Chicken [with betutu spices], Fish [herbed] or Beef [with cheese and other optional extras]. The Wraps are mostly healthy; Roasted Vegetables, Falafel Balls, Tofu [with crunchy tempe] or Sauteed Mushrooms. If you are into Raw Food then there are Tempe Handrolls [spiced dried tempe sheets filled with an Asian slaw and sweet soy sambal], a Vietnamese Salad or the original Indonesian salad, Gado-Gado.

Parking

: Street only.

Price

: Rp. 200,000 for two [+ drinks].

Credit Cards

: No

Food

: Healthy and fresh.

Wine

: BYO

Service

: Friendly.

A popular main is their Nasi Gila [crazy rice], a Nasi Goreng but made with red rice, all vegetarian with Balinese spices. Mex is the way to go at Betelnut. You can have your Tacos veggie style [avocado, mixed greens, tomato salsa and cheese] or have mahi-mahi or chicken breast meat added. The Tostado is a crisp flour tortilla with spiced beans, the Burrito a soft tortilla with red rice and beans, both also with guacamole, tomato salsa and cheese. The excellent tortillas are made fresh by a ‘Mexican lady just down the road!’.

Atmosphere

: Funky!

Overall

: Fun, relaxed and tasty!

There are daily blackboard specials of Salad and Soup as well as the Friendly Fish dish [whatever was available fresh from the market that morning, simply grilled to keep all the juices inside] and a Wonky Wok dish that usually comprises a variety of noodles with chicken or seafood, vegetables, Asian spices and a local sambal. A big daily array of fresh fruit is always available to produce juices, coolers, mocktails or smoothies of your choice, or even a wild fruity Frappe. The list of teas reads like a cocktail list, sourced local and International. Copyright © 2012 Gerry Williams For dessert it is hard to go past the Strawberry, Lime and Basil Tart. Betelnut Café is one of those ‘drop in anytime’ places, whether it is just for a thirst quencher, snack or meal. The fact that the place is relaxing, friendly and incredibly cheap whilst maintaining a high quality from the kitchen makes it a very special place. It only takes money and connections to open a new restaurant with a queue of customers. The big test is if it is still packed 12 months later! Betelnut Café passes the 1 year test, with flying colours!

Reviews that appear in Bali Advertiser are based on actual visits to the establishments listed, without the knowledge of the restaurants, and are not paid for by the individual restaurants. Opinions expressed here are those of Gerry Williams and not necessarily those of Bali Advertiser. Gerry Williams attempts to write from a ‘typical’ diner’s perspective and, whilst quality of food is the most important criteria overall, value for money is the real measuring stick.


36

Restaurant & Nightlife

Bali Advertiser

14 November - 28 November, 2012

Update Beachwalk is Bali’s first international shopping complex that works! It is an enormous site with 200 retail outlets, having replaced the old Sahid Hotel on Jln. Pantai Kuta, linking up with Poppies II at the side [there is a new Sheraton Hotel about to open above the centre], with a large car park underneath for 1,000 cars. Fashion shops [all the leading brands], cinemas and restaurants are the focus. Under a huge rotunda on the top level is Eat & Eat, undoubtedly the most advanced food court in Bali offering regional specialties from all over Indonesia as well as Indonesian versions of International cuisine, albeit virtually at restaurant prices. Amongst the eating houses represented throughout the complex are a number of major players [Burger King, Dominos and Starbucks but surprisingly no Golden Arches] and many small outlets, most of which are, sadly, American franchises or copies thereof, with very little innovation or originality. Some are already busy, whilst there are many others that will stay quiet forever.

For Sale; Original PC games, original box, manual and media. Far Cry, Silent Hunter III, each 100K Rupiah, Silent Hunter IV Collectors Box with Maps, Stickers and Identification Manual, Rp. 250.000. All together Rp. 350.000. Chris 0857 9214 5997. Kerobokan. [118]

Romantic Right on the Beach Customer’s voice: Vicky “ Lovely food, best service from staff in a long time, whole family loved it, kid liked too. Would recommend to anyone coming. Amazing from the kids. ”

0812 8613 4471 (Next to Segara Village Hotel, Sanur) C/R/U-31 Oct. 12

Café Sardinia so different from the rest is operated by local professionals which is probably why it was one of the first to both open and be busy. Situated in a prime position facing Jln. Pantai Kuta, at the front entrance, the menu is a mix of simple Italian [pasta, risotto and pizzas] and International [beef from Harvey Bay, lamb chops from N.Z. and BBQ Pork Chops from the USA, Salmon from Tasmania and those wonderful Bugs [also known as shovel nose or flathead lobsters] from Queensland’s Moreton Bay], snacks [burgers, paninis and melts] and Tapas [crab cakes, salt & pepper calamari, tempura bug tails and Spanish meat balls] all budget priced. Comfort food at comfort prices! Open early for breakfast they offer Eggs Benedict [pictured] true to its name unlike so many bogus versions on offer elsewhere throughout Bali. English muffins are split and toasted, covered with ham [from the pig not a pretend ham] and some English spinach borrowed from the Florentine, topped with a pair of perfectly poached eggs [firm white, soft yolk] liberally covered with a thick tasty hollandaise sauce…almost the classic original! The price, just Rp. 49,000++!

Kitchenette features French crepes and galettes, but with an American touch. The

savoury galettes are made to order with buckwheat flour and combine meat with eggs and vegetables in many different combinations. The local franchise owner has added basic Indonesian dishes as well which detracts from the original nature of the place. The sweet crepes combine with fruits, ice cream and cream. Large western dishes [salads and mains] to share is a strange option more likely to work in Jakarta.

Johnny Rockets was the original re-born American diner, retro 1950’s food, music and all, famous for their mini juke box selectors on every table with a heady mix of good old rock and roll, embarrassingly added to in true gauche American style with the wait staff singing along with the old favourites, using old fashioned coke bottles as impromptu microphones! Hamburgers, any which way with single or double patties plus extras, Toasted Sandwiches, Milk Shakes and Floats [Coke or Fanta with ice cream added]. The estimated calorie content of every dish is shown on the menu, supposedly making you feel better as you over-indulge? Is the juke-box at every table? Every visit to Beachwalk sees this place full, and rocking!

C/R/G-14 Nov. 12

Fish & Co offers fish and chips, many with foreign country names attached, most of

which bear no meaning to the supposed national dish. Yet another ‘theme’ restaurant, they rarely work in Bali although this one may as it is the only pure seafood outlet amongst the many others that are all offering same-same. ‘African’ Fish and Chips is with Peri-Peri sauce [which is Portuguese] and both America and Denmark supposedly champion Lemon Butter? Chicken is also combined with fish or prawns and a variety of Seafood Platters are available at Rp. 259-459,000++, prices that seem more at home in Jakarta than Bali.

Nanny’s Pavillion is yet another American pancake house! Their major entrée is French Fries which are offered with many accompaniments, sauces and cheeses. Pancakes and waffles are with a variety of fruits or even cheese and chocolate sauce. Pasta, Baked Potato with whatever and Toasted Sandwiches are what seems to be standard fare for an ‘American’ café in Indonesia. Tony Roma’s are famous for their Ribs, Steaks and Carolina Honeys [glazed with honey and molasses] served with an Onion Loaf. The Baby Back Ribs are with a Texan BBQ sauce even though the operation began in Miami [subsequently taken over by the owner of the Texan Dallas Cowboys]. Even in Jakarta the ribs are pork so this franchise stays original. Not open yet, it will be the last of the major players to operate. The Coffee Bean is also beachfront and offers all day breakfasts that include the usual [eggs, bacon and sausage on panini] and unusual [Turkey Meat Salad with turkey breast, lettuce, corn bread and fried egg]. Also on offer are Singapore Spicy Puffs, Beef and Onion Quiche and New York Sausage Rolls.

Ki Ha Na is the complete Japanese restaurant, inside and close to the eventual hotel reception entrance. They offer the full range of Sushi, Temaki, Makimono, Yakimono, Donburi, Ramen and Udon Noodles and Nabemono [hot pots]. Obviously expecting many Japanese guests at The Sheraton? ----------------------Taksu does Thanksgiving A full Thanksgiving Dinner on Thursday November 22, turkey with all the trimmings, will be held at one of Ubud’s small hidden gems, Taksu. It is located at the bottom of Jln. Goutomo, accessed by a small gang off Jln. Hanoman. The restaurant is situated in between the Taksu healing rooms and their valley spa, on the 1st floor at the rear of the building. It is a small but relaxed room faced with large windows open to the tree, garden and valley view. The Thanksgiving Dinner offers a full buffet for Rp. 200,000++ per person, and a pre-booking is advisable [Tel: 971.490]. The turkeys are imported from the USA and have been organically raised. Some are sent to a special Ubud farm for preparation betutu style, smoked with spices and herbs, others are roasted in the traditional method. Hand-carved by the chefs you can choose from either style, white meat or dark, or a tasting of all. Just a Turkey Platter, without the buffet, is Rp. 85,000++ and a full Vegetarian Buffet Rp. 125,000++. The Four dessert sampler is only Rp 40,000++. They include pecan pie, pumpkin pie, apple cobbler and raw cocoa avocado pudding for which you can add ginger. Children [under 12] pay 50%. Taksu is totally tobacco free. Gerry Williams For more information see our website: www.balieats.com NC/R/I-14 Nov 12


Bali Advertiser

14 November - 28 November, 2012

Restaurant & Nightlife

37

For Sale; 1 set PC dual core 3Ghz. 2GB RAM DDR3, 19” LG LED widescreen, 250Gb harddisk, ATX casing, mouse and keyboard logitech, computer table. Sell for Rp. 3.450.000 for all. Contact Adi 081 2392 5264. Denpasar. [096] For Sale; Meuble de Bar en plateau + teck, dimension 240x110x65+35cm Rp. 6.000.000, 4 bar chairs Rp. 150.000/chair. Bonus 1 bar chair. Patrick <pat2com@ gmail.com>, 0819 3433 8214. Denpasar. [111] For Sale; Surfboard Rp. 1.000.000 for one. Small longbord, Mini Malibu, PU (orange) 7’4 “, 21.1/2”, 2.3/4” light weight guys, children or girls. Modern shapes, good in maneuvers. Big Shortbord, Fanbord, Epoxy 6’4”, 22”, 2.3/4” medium and heavy weight guys. Quick take-off and stable. Have fixed dings, not half-broken. Call 0878 6085 9800. Kerobokan. [022]

C/R/I-31 Oct 12

For Sale : Satellite receiver openbox X3 full HD PVR and Wifi receiver. Set like new Rp. 95.000. Also functions as media player. Contact 0857 9256 8658 or <thingsadvertised@gmail. com>. for photo. Sanur. [023]

C/R/G-14 Nov. 12

For Sale; 2 chair and table set solid teakwood chairs and small round table Rp. 1.5 juta. Call/SMS 0878 6207 9604. Denpasar. [009] C/R/U-14 Nov. 12

NC/R/G-14 Nov. 12


Body & Spirit HOLISTIC COACHING COUNSELING Inner - Voyage qualified holistic life coach. The only measure of success is happiness.... Let me help you discover where it lives. Holistic life coaching recognises the value of past experiences but is about letting go & moving forward. Sanur 0812 3605 7888 mrilett@inner-voyage.com

For Sale; Rarity. 70year old Bezar compass. Still in good condition. For collectors only. Please call Michael 081 2395 1444. Sanur. [141] For Sale; 2 webcameras (MS and HP) as new. For 400.000 Rp. Please contact Michael. 081 2395 1444. Denpasar. [142]

NC/He/U-14 Nov. 12

For Sale; Small teak table, 30x40 H=25cm, suitable beside the bed or for kids, Rp. 220.000. 2 small wooden stools, carved in the shape of sheep, 40x15 H=15cm, one white and one brown, ethnic style Rp. 220.000 both. For pictures contact 0818 0566 2911. Legian. [135]

Dr. Raha Didevar PhD, MFT, MA, BA

CLINICAL & DEPTH PSYCHOLOGIST +62 (0) 812 3714 5129 raha@rabinafric.org Area of Expertise: Individual, Marriage & Family, Adolescent & Childrenâ&#x20AC;&#x2122;s Therapy Employment History: Cedar Sinai Hospital, & Private Practice in Los Angeles, California C/He/A-25 July 12

C/He/G-3 Oct. 12

C/He/G-11 July 12

C/He/G-14 Nov. 12


Bali Advertiser

Body & Spirit

14 November - 28 November, 2012

For Sale; Full fairing for Yamaha Byson, black, cost Rp. 330.000. Never used. All fixings, Rp. 150.000, no offers. Call 083 1180 8165. Jimbaran. [146]

Shashi Tarot Card Reading Crystal Healing Reiki Therapy

www.tarotpredictionsguru.com JI Werkudara 520, Legian Kaja, Kuta Hp: 081 811 9634 email: onasis@indo.net.id C/He/I-11 Jan 12

For Sale; Beautiful dugout canoe half hull. Sumatran perahi half for wall decoration (varnished), 3.5 meters, Rp. 2.5 Juta. For photo: <warrenandrobbin@ hotmail.com>. Ubud. [147] For Sale; Gas grill BBQ O-grill 3000 from Ace Hardware, orange, used once only. New Rp. 2.2 million, sell for Rp. 1.5 million. Call 0821 4570 4169 / 0819 0515 5572. Bukit. [148]

Moving Sale; Tables, chairs, sofa, beds, mattress, children car for playing, cooking plate, electric drill from Europe and etc. Call 0853 3846 0077. Kuta. [124]

39

A traditional Balinese massage with deep tissue work for a relaxed body and soul ...intensive relaxing, acupressure, reflexology combination

Open 9:30am - 10pm please contact for booking..!!

Moving Sale; Antique bottle Crystal from Czech Republic. Is old one with hand cut lead over 24% PBO. Rp. 2.5 million (nego). Call 0813 3851 0176. Kerobokan. [125]

Address: Jl. Batu Belig Kerobokan - Kuta Badung Ph: (0361) 7446747, Mobile: 081- 647 - 07569 www.devirabalimassage.com email: info@devirabalimassage.com C/He/I-11 July 12

For Sale; Italian books, many different writers; vendo libri in lingua italiana, scrittori e generi vari. Contact 0818 0566 2911. Legian. [133] Donâ&#x20AC;&#x2122;t confuse motion and progress. A rocking horse keeps moving, but doesnâ&#x20AC;&#x2122;t make any progress.

C/He/I-14 Dec 11

C/He/G-31 Oct. 12

C/He/G-31 Oct. 12

C/He/I-31 Oct 12

C/He/I-03 Oct 12

C/He/I-14 Nov 12

C/He/G-7 March 12


40

Body & Spirit

Bali Advertiser

14 November - 28 November, 2012

Anti Aging News

Advertorial

Stay Young and Healthy with The Latest Advances in Anti Aging Medicine

ASIALIFE INTERNATIONAL HEALTH PLANS

Stem Cells – The Fountain Of Youth It seems that there is more and more new research documenting the incredible healing capabilities of Stem Cells being released every day – this is a rapidly expanding and growing field of medicine and certainly one that holds a lot of promise at returning us to a more youthful state of being. There will be a day in the very near future in which adult stem cells will become a routine part of treating a wide range of diseases, from Cancer to Alzheimer’s. With technology moving so fast that day is now here now! The wonderful thing about stem cells is that they can grow to become anything, from bone to brain tissue. Doctors hope to take your own cells, like those in your fat, and use them to grow replacement organs or to repair damaged muscles or other tissue. Stem Cell Therapy Now Legal Regulations now allow this latest Stem Cell therapy procedure, which involves the extraction, isolation, activation and then re-injection of your own fat derived stem cells, to be performed legally and safely both in Australia and in the USA.

effective as it used to be, hence, old age, disease and even death may occur. Now with the latest technology we are able to extract millions of your own dormant Stem Cells and then isolate and activate them ready for use! When injected or infused back into your body they will immediately react to the signals your damaged organs and tissues are sending out and get to work to repair, heal and regenerate! Benefits of Fat Derived Stem Cells • • • • • •

• Adipose (fat) tissue is abundant in Mesenchymal Stem Cells (MSC), which have proven to be very useful in the field of Anti Aging & Rejuvenative Medicine.

Monthly, quarterly, or annual payment systems

SERVING BALI AND INDONESIA SINCE 1998

General Insurance Houses, Villas, Hotels Factories, Shops Cars, Liability PT. ASIALIFE INVEST A5, Simpang Siur Square, Kuta, Bali 80361 Contact NatalieTel: (0361) 764 488 Fax: (0361) 764 728 Email: info@asialife.net Website: www.asialife.net C/He/I-05 Sept. 12

Low Risk – only uses your own MSC taken from your own fat, so there is no chance of rejection Low Side Effects – simple and safe procedure after a mini liposuction is performed Simple 3 hour procedure – all done on the same day No Embryos, moral or ethical issues Very High Numbers of Stem Cells – millions of stem cells are stored in your fat in a dormant state Light Activation – special light wavelengths are used to quickly activate and “turn on” your own MSC making them ready for regeneration within your body Infused IV immediately – for rapid and instantaneous return to your body – not sent to any outside laboratory for processing The Types of Stem Cell Therapy Procedures:

Stem Cells are new cells that can be transformed into a wide range of new cells and tissues within your body, and have enormous healing and regenerative potential. This is the future of Anti Aging Medicine & Healing from ALL Disease- it will be common practice in the years to come to routinely have Stem Cell therapy in order to recover and heal from all types of health conditions. As we are now using Your Own Stem Cells (MSC) safely and simply extracted, there is no longer any barriers stopping the use of this exciting therapy for any and all health conditions, or for simply helping you to Stay Young, Healthy, and Energetic.

80 Million Stem Cells as a Child

1) Cosmetic Facial or Joint AASCT - stem cells are taken from a small amount of your own body fat for this procedure. After they are isolated, purified and then activated, they are then injected either directly into your joints for repair of damaged joint tissues, or into your face for regeneration of your skin and facial tissues. This procedure can be done one or two times per year.

C/He/G-31 Oct. 12

2) Anti Aging & Disease Reversal AASCT – a larger amount of fat is extracted under local anesthetic for this procedure (similar to a mini-liposuction). Millions of previously dormant Stem Cells are then extracted, purified, isolated and then activated. The millions of stem cells are then infused immediately intravenously so that they can be used anywhere within the body whilst they are fresh and active - This procedure can be used simply for Anti Aging & Regeneration performed yearly or bi-yearly, or it can be used to recover from any illness or disease. Stem cell therapy is the medicine of the future, and is now being used in some countries around the world with promising results for a wide range of previously untreatable health conditions such as: Diabetes type 2, Chronic Heart and Lung Disease, Alzheimer’s, Parkinson’s, Arthritis, Kidney Disease, Stroke & Other Neuro-muscular disorders, Chronic Hepatitis, ALS, Autism, Natural Breast Augmentation, Hair Restoration, Sexual Dysfunction and of course for Anti-Aging or Age Reversal.

35 Million Stem Cells in circulation by age 40.

I believe that this technology signals a major breakthrough in medicine and is likely to transform health and healing significantly in the years to come.

C/He/I-14 Dec 11

The Fountain of Youth Within You! Stem cell therapy using your own light activated MSC is now available in some countries in the world and also available here in Bali. To find out how you can benefit from the latest Stem Cell therapy you can email me at drtheodorebali@gmail.com

100’s of millions of stem cells are added to the circulation to turn back the Aging Clock!

Please note that the contents of this article are the opinions of the author and should in no way be taken as medical advice. If you have any specific medical concerns please consult your doctor for an assessment.

Stem Cells can improve any and all parts of your body – your damaged organs and tissues send out signals for repair which normally (when you are young and healthy and you have abundant stem cells) are responded to by the production of new healing Stem Cells which make their way to that organ and help it to repair and heal.

Dr. Theodore (BMBS) is an Australian MD based in Sydney, Australia. His Major Specialties are; Anti Aging Medicine, Stem Cell Therapy, Whole Body Detoxification, Natural Health and Healing, Male Enhancement, Whole Body Oxygen Therapy, Fat Loss and Body Re-Sculpting, Natural Hormone Replacement Therapy and Nutritional Counseling.

As we age however, this process malfunctions, and isn’t as

You can read all past articles of Anti Aging News at www.BaliAdvertiser.biz

Copyright © 2012 Dr. Theodore

C/He/G-17 Oct. 12


Bali Advertiser

14 November - 28 November, 2012

For Sale; iPod touch 4gen 8Gb. Good quality. All works well like new. Complete with box, earphones etc. Sell for Rp. 1.6 million. SMS 081 734 2727. Denpasar. [058]

For Sale; Telephone table/ chair with drawer, brown, perfect condition, sell for Rp. 975.000. Contact Elly on 0818 0530 0379. Denpasar. [169]

For Sale; Antique Chinese stone from RRC and another country min 50 years old. Original condition, negotiable price. Call 0878 5107 3568 / 0888 0326 3670. Denpasar. [059]

For Sale; Garden chairs (two) and matching glass coffee table. Price new in ACE Hardware Rp. 600.000 sell for Rp. 400.000. Will send pictures by email. Call 0858 5702 4740. Denpasar. [160]

Looking for; Tennis players to set-up a group for social tennis, 2 times a week. Court is located in East Denpasar/Sanur. Contact me to be added to the prospect list: <marcelinbali@ gmail.com>. [060] C/He/G-13 June 12

Body & Spirit

41

Get your free life lesson number (numerology). Please send full name (exactly as shown in your birth certificate) and birth date. I also do Tarot, I Ching. <dolphin@hour.com>. [140 C/He/G-14 Nov. 12

Jl. Legian Kelod, No. 396. (between Melasti and Padma streets) www.luxehairbali.com Email: luxehair-bali@hotmail.com

H A I R C/He/I-14 Nov 12

C/He/I-17 Oct 12

● Presence in 70 Countries Alarm Centers ● 32 International Clinics ● Worldwide network with Insurance companies ● Dedicated Air Ambulances ● 27

Worldwide reach Human touch International SOS Bali, Jalan By Pass Ngurah Rai 505 X Bali - Indonesia

24 hr Alarm Center & Clinic Appointment: +62 361 710 505 E-mail: sos.bali@internationalsos.com C/He/G-11 July 12

C/He/G-31 Oct. 12


42

Body & Spirit

Bali Advertiser

14 November - 28 November, 2012

PARADISE... IN SICKNESS & IN HEALTH By Kim A. Patra SRN/RM.

Laser Therapy

POLY-WHAT???? Polycystic Ovary Syndrome (PCOS) Polycystic ovary syndrome (or PCOS) is common, affecting as many as 1 out of 15 women and yet it is still poorly understood and frequently missed by medical practitioners. Many women often end up feeling frustrated and even depressed that their symptoms are not being taken seriously and that they cannot find answers to the problems that they are facing. Recently the Australian Medical Association devised specific guidelines to assist medical practitioners to identify and correctly manage PCOS. Hopefully this awareness measure will bring welcome relief to women that have been struggling with PCOS for long enough. Will you find someone to identify, diagnose and treat PCOS in Bali? Possibly, however you might wish to mention that you are concerned about this to your doctor and perhaps suggest that he/she prescribe the tests mentioned in this article.

Do a number of lab tests to check your blood sugar, insulin, and other hormone levels. Hormone tests can help rule out thyroid or other gland problems that could cause similar symptoms. You may also have a pelvic ultrasound to look for cysts on your ovaries. Your doctor may be able to tell you that you have PCOS without an ultrasound, but this test will help him or her rule out other problems. How is it treated? Regular exercise, healthy foods, and weight control are key treatments for PCOS. Medicines to balance hormones may also be used. Getting treatment can reduce unpleasant symptoms and help prevent long-term health problems.

How is PCOS diagnosed? To diagnose PCOS, the doctor will: Ask questions about your past health, symptoms, and menstrual cycles. Do a physical exam to look for signs of PCOS, such as extra body hair and high blood pressure. The doctor will also check your height and weight to see if you have a healthy body mass index (BMI).

TO MAKE YOUR APPOINTMENT FOR A SMOKE FREE FUTURE I smoked for 20 years and tried to quit almost as many times. I received the laser treatment almost 2 years ago and haven’t looked back since.

Please Call

0811-380-1225

Kim Miller Sanur, Bali C/He/I- 03 Oct 12

The first step in managing PCOS is to get regular exercise and eat heart-healthy foods. This can help lower blood pressure and cholesterol and reduce the risk of diabetes and heart disease. It can also help you lose weight if you need to.

What is polycystic ovary syndrome (PCOS)? Polycystic ovary syndrome is a problem in which a woman’s hormones are out of balance. It can cause problems with • Try to fit in moderate activity and/or vigorous activity on your periods and make it difficult to get pregnant. PCOS may a regular basis. Walking is a great exercise that most also cause unwanted changes in the way you look. If it is not people can do. treated, over time it can lead to serious health problems, • Eat a heart-healthy diet. In general, this diet has lots of such as diabetes and heart disease. vegetables, fruits, nuts, beans, and whole grains. It also Often the symptoms begin in the teen years. Treatment can limits foods that are high in saturated fat, such as meats, help control the symptoms and prevent long-term problems. cheeses, and fried foods. If you have blood sugar problems, try to eat about the same amount of What are hormones, and what happens in PCOS? carbohydrate at each meal. A registered dietitian can help Hormones are chemical messengers that trigger many you make a meal plan. different processes, including growth and energy • Most women who have PCOS can benefit from losing production. Often, the job of one hormone is to signal the weight. Even losing 10 lb (4.5 kg) may help get your release of another hormone. hormones in balance and regulate your menstrual cycle. For reasons that are not well understood, in PCOS the PCOS can make it hard to lose weight, so work with your hormones get out of balance. One hormone change triggers doctor to make a plan that can help you succeed. another, which changes another. For example: • If you smoke, consider quitting. Women who smoke have The sex hormones get out of balance. Normally, the ovaries higher androgen levels that may contribute to PCOS make a tiny amount of male sex hormones (androgens). In symptoms. Smoking also increases the risk for heart PCOS, they start making slightly more androgens. This may disease. cause you to stop ovulating, get acne, and grow extra facial and body hair. A doctor may also prescribe medicines, such as: The body may have a problem using insulin, called insulin resistance. When the body doesn’t use insulin well, blood • Birth control pills. They can help your periods be regular sugar levels go up. Over time, this increases your chance of and can reduce symptoms such as excess facial hair and getting diabetes. acne. • An androgen-lowering medicine, spironolactone, may be What are the symptoms? used with birth control pills to help reduce symptoms Symptoms tend to be mild at first. You may have only a few even more. These medicines are not used if you are symptoms or a lot of them. The most common symptoms trying to get pregnant. are: • A diabetes medicine called metformin. It can help restore • Acne. regular menstrual cycles and fertility. • Weight gain and trouble losing weight. • Fertility medicines, if you are trying to get pregnant. • Extra hair on the face and body. Often women get thicker and darker facial hair and more hair on the chest, It is important to see your doctor for follow-up to make sure belly, and back. treatment is working and to adjust it if needed. You may also • Thinning hair on the scalp. need regular tests to check for diabetes, high blood pressure, • Irregular periods. Often women with PCOS have fewer and other possible problems. than nine periods a year. Some women have no periods. Others have very heavy bleeding. It may take a while for treatments to help with symptoms such • Fertility problems. Many women who have PCOS have as facial hair or acne. In the meantime over-the-counter or trouble getting pregnant (infertility). prescription acne medicines may help with skin problems. • Depression. Waxing, tweezing, and shaving are easy ways to get rid of • Most women with PCOS grow many small cysts on their unwanted hair. Electrolysis or laser treatments can ovaries. That is why it is called polycystic ovary permanently remove the hair but are more expensive. Your syndrome. The cysts are not harmful but lead to doctor can also prescribe a skin cream that slows hair growth hormone imbalances. for as long as you use it regularly. What causes PCOS? The symptoms of PCOS are caused by changes in hormone levels. There may be one or more causes for the hormone level changes. PCOS seems to run in families, so your chance of having it is higher if other women in your family have PCOS, irregular periods, or diabetes. PCOS can be passed down from either your mother’s or father’s side.

Safe, Painless and Relaxing

It can be hard to deal with having PCOS. If you are feeling sad or depressed, it may help to talk to a counselor or to other women who have PCOS. Ask your doctor about local support groups, or look for an online group. It can make a big difference to know that you are not alone. Kim Patra is a qualified registered nurse and midwife who has been living and working in Bali for almost 20 years. She now runs her own private practice and medical referral service from her Kuta office. Kim is happy to discuss any health concerns with you and she may be contacted via e-mail at info@chcbali.com or Office number : 0361-2775666.

Copyright © 2012 Kim Patra You can read all past articles of Paradise...in Sickness & in Health at www.BaliAdvertiser.biz

C/He/I-14 Dec 11

• • • • •

Retail & Wholesale Spa Products Spa Accessories Special and Corporate Gifts Development of Private Label Hotel & Villa Amenities

We supply high quality professional Spa products, amenities and accessories. Our core business is the supply of bulk spa products. We have a chemist on board to assist custom blending or help create signature treatments to compliment your menu. Our specialty is “Private Label” where our creative team, work with clients to customize and develop exclusive merchandise, to suite your image. We create, design and manufacture exclusive Spa accessories, anything from foot ritual bowls, product presentations and testers, dispensers, trays, tea rituals to tissue boxes. We also make and package gifts for special events and corporate functions. At every stage of design and manufacture we work with our clients to understand their specific needs, to develop and create quality products that reflect the company’s identity. Please check our website for more details on what we do; www.spafactorybali.com Head office and manufacturing facility

Our Singapore showroom :

Spa Factory Bali Jl. Toya Ning No 4 Kedonganan 80361 Bali, Indonesia Tel +62 361 701439

33A Mosque Street, Singapore 059511 Tel. +65 62258476.

www.spafactorybali.com C/He/G-14 Nov. 12


Body & Spirit

14 November - 28 November, 2012

Inte Hair rn a

lW

g

Seek first to understand, then to be understood.

n

din ed

K,

ne ar

Mc

n

Ar ca

Ph .

de

#2 ,

le

For Sale; Apple iPhone 4S, 64Gb, unlocked for all operator GSM perfect condition, no scratch and full application. Sell for Rp. 6.5 million. Call/SMS 0831 1964 5264. [231]

tio

Available WiFi & Nespresso

ra ba im II J

C/He/I-05 Sept. 12

For Sale; Shortboard: 6’3”, 19 1⁄2”, 2 1⁄2”, Gorilla pad, fiberglass fins. Few repaired dings. Never snapped. Pics via email. Rp. 1.2 million. Call 0812 3636 9241. [145]

| Nails | Make ent Up m t d ra T i t ea i & o r na | Wa al |T

atu Jl. Uluw

For Sale; Brand new household furniture: pictures, feature mirrors, 6 velvet ornate chairs + black wood dining room table, Baroque style. 2 x kingsize beds + mattresses, chest of drawers, shelving. Make an offer. For pictures email <furniture@indahuk.com> or call 0813 3722 7627. Seminyak. [233]

For Sale; Polygon broadway 2.0 bycycle upgraded. E-mail for pics and spec, price Rp. 2.9 million nego. Call 0818 0544 4150. Denpasar. [170]

ng xi

Moving Sale; Tables, chairs, AC, fridge, bamboo bed, pillows, household, plates, closets, mattress, sofa, beds, electric, sinks, toilets. Contact 0857 1109 3547, 081 7979 9922. <ceaderphoenix@yahoo. com>. Seminyak. [232]

43

Donal d)

Bali Advertiser

irc

C 0361 8472103xt to Ne

Jimbara - Bali ( n

C/He/G-13 June 12

C/He/I-03 Oct 12

C/He/I-11 July 12

C/He/G-31 Oct. 12

C/He/I-14 Nov. 12


44

Body & Spirit

William Russell, Aetna, IMG, Pasific, BUPA, IPH etc

DVD

Bali Advertiser

14 November - 28 November, 2012

For Sale; Telephone landline and fax machine, Nusa Lembongan, area code 0366. Call 0813 3739 9577. [078] Wanted; Cross trainer exercise bike. You are welcome to contact me on e-mail: <xpat@inbox.com> or Bali mobile 0878 6206 6969. [079]

For Sale; Honda full face helmet, black brand new. never used. Rp. 255.000 or offers. Terry 0813 3813 6110. Sanur. [086] For Sale; Yamaha Byson full face helmet, black brand new, never used. Rp. 255.000 or offers. Terry 0813 3813 6110. Sanur. [087]

International Medical / Life Insurance Group and Individual Scheme More Choices with Many Providers Based in Jakarta and Bali Contact: +6221 7692595 bhfs@cbn.net.id

www.bhfinancialservices.com

C/He/M-17 Oct. 12

The Girl After his success with ‘Psycho’ in 1960, ‘The Master of Suspense’, Alfred Hitchcock, is determined to outdo himself with a new horror movie, about a flock of birds which inexplicably start to attack the citizens of a small Californian coastal town. Unfortunately, Hitchcock’s favorite leading lady, Grace Kelly, is now permanently off the scene, so, Hitchcock decides to create a new leading lady, which he can mould into his own idea of a movie star. He chooses the inexperienced former fashion model Tippi Hedren to be his latest blonde screen goddess. This terrific HBO movie delves into the professional and private relationships between Alfred Hitchcock and Tippi Hedren, and, it is a taut sexual and psychological melodrama, which is by far more interesting than anything Hitchcock ever made himself. The movie is brilliantly acted by Toby Jones and Sienna Miller, while director Julian Jarrold reveals the Dirt behind the Glamour and the Truth behind the Myth. Ruby Sparks A young and successful author has no-one special in his life. One night he has a dream about a woman, and, when he wakes up, he decides to make her the heroine of his next novel. However, after he has written a few pages, strange things start to happen around his house, then, as he continues to write, his fictional woman suddenly materializes in real life. This is a very charming comedy, directed by Jonathan Dayton, and starring Paul Dano and Zoe Kazan, along with Antonio Banderas and Annette Bening. Still, as the movie progresses, a dark subtext emerges that explores the need for men to control and manipulate women for their own emotional and sexual desires. Chernobyl Diaries Some young tourists are backpacking their way through Europe, and, when they arrive in Russia, they meet an ‘Extreme Adventure’ tour guide, who offers to take them to the abandoned city of Chernobyl, to see first hand the results of the nuclear disaster. Their quick little trip to Chernobyl turns out to be much more than they anticipated. This horror movie, directed by Brad Parker, is actually very good, as everything which happens to the tourists is quite feasible and credible. This just goes to make the movie all the scarier. The Amazing Spider-Man Frankly, I don’t see the point in making this movie. The first ‘Spider-Man’ was released as recently as 2002. This re-make covers pretty much the same ground as the original. Once again we learn how Peter Parker became Spider-Man, and the rationale behind his crusade against crime. What is new in this movie is the Super Villain he has to confront. Anyway, that being said, this ‘Spider-Man’ is a terrific piece of film-making, which will attract a whole new younger generation. Andrew Garfield makes an appealing Super Hero, and his aerial acrobatics are amazing, but, it’s hard to tell how much is performed by the actor, a stunt double, or, is computer-animation. To Rome With Love Woody Allen continues his European Sojourn. This time he pays homage to the Eternal City with a quartet of Fellini-like short stories. Woody can often be a bit hit or miss, and, so it is with these stories, however, on the whole, they are all kind of amusing. The problem with the movie is that Woody intercuts his stories, and, as they all take place in different time frames, this becomes confusing. The movie could have been more successful if Woody had of presented his stories in the traditional Italian style, that is, one after the other, instead of mixing them up. As we all know, Woody pays his cast next to nothing. It’s a privilege to appear in one of his movies. This time we get to see Alec Baldwin, Roberto Benigni, Penelope Cruz, Judy Davis, Ellen Page, Greta

C/He/M-30 May. 12

Upix Nail Extensions

Diary by Mr. Robet

Gerwig, and Jesse Eisenberg all perform for the great maestro.

Professional Nail Tech Acrylic and Gel

At your home, hotel or villa Phone: 0361-874 2556 +62 813 3879 1146 Email: upixnails@gmail.com www.upixnails.baliklik.com C/He/I-22 August 12

Hindenburg This German movie is very old-fashioned in style, and, it features some aging International movie stars along with some not so fresh new German faces. All of the actors perform as a group of travelers, and flight crew, journeying on the Hindenburg Zeppelin, as it takes a fateful voyage from Germany to America. There are lots of Swastika flags fluttering in the breeze, to establish the period, and, all on board, are heaps of Gestapo officers, decadent socialites, and fleeing German Jews. Also, there could quite possibly be a bomb hidden somewhere on the airship. Okay, this all sounds hackneyed and corny, but, surprisingly enough, the movie does hold your attention during its extremely long running-time of just over 3 hours. Killer Joe William Friedkin is an eminent American director, best known for his sensationalism and depiction of violence in movies such as ‘The French Connection’ (1971) and ‘The Exorcist’ (1973). With ‘Killer Joe’, Friedkin adapts a stage play by Tracy Letts, but, he doesn’t do much to expand it out for the screen. Nearly all of the action takes place in a prefabricated house dumped in a dilapidated trailer park. ‘Killer Joe’ is an assassin for hire, and he gets a little bit upset when he is not paid for a job he undertook for a Texan white trash family. The movie is very violent, and its depiction of a perverted sex act is probably the most graphic to hit the screen in some time. That’s My Boy Adam Sandler just pulls faces and whines throughout another awful comedy.

Mr. Robet’s Best Buys

PROBLEM WITH YOUR TEETH Repair and rehabilitate your teeth in less than a week.

?

 911 Dental : when you have very severe toothache-I need two hours-one visit to clear-just walk in to have the treatment.  For Less Price : Crown 350 AUD including root canal treatment if needed. Dental Implant 1,200 AUD (+ Crown) we have immediate loaded implants.  For a Quick Results : Teeth in a day. Porcelain Crown/Bridgework finished in one day. 14 units bridgework in one week (full mouth rehabilitation). One implant + Crown-One day. Ten implants whole mouth - one week with Ceramill Multi-X Machine.  For No Stress Procedure : Just sit down in one place and finished! No referring to other specialist because we are the specialist.  We do Cosmetic Dentistry : Laser Bleaching, Laminating For Discolored Teeth, Soft Tissue Grafting, Gum Plastic Surgery For Gummy Smile, Bone Grafting.  Now We Have CEREC Technique from Germany. We make Porcelain Crown, Inlay, Laminating, Bridgework without metal for front teeth and posterior teeth for 14 unit bridgework.  No Waiting List, just walk in and get the treatment done! D E N TA L C L I N I C INHOUSE DENTAL LAB,CEREC

BALI 911 IMPLANT CENTER GALILEOS 3D X-RAY (SIRONA)

BALI 911 DENTAL CLINIC IMPLANT CENTER Jl. Patimura No. 9-11 Denpasar, Bali-Indonesia Tel. (0361) 249749, 222445 Speak to the Dentist: (0361) 7440911, 0812 3800911 e-mail: iguizot@indosat.net.id Website: www.bali911dentalclinic.com

for your benefit

MALL BALI GALLERIA 2nd Floor No. 2C-58/59 Jl. Raya By Pass Ngurah Rai, Simpang Dewa Ruci - Kuta Ph : (0361) 766254-55 Speak to the Dentist: (0361) 7449911 Open on Sunday

5 YEARS WARANTY

DHARMAWANGSA SQUARE Ground Floor Unit 65, Jakarta Ph: (021) 727 88284 Hp. 081 113 7241 E-mail: mguzt@mac.com FOR PORCELAIN & DENTAL IMPLANT C/He/G-28 Dec. 11

The Girl A film director chooses an inexperienced actress to mould into a movie star. Abraham Lincoln, Vampire Hunter As a boy Abraham Lincoln witnesses his mother being killed by a vampire. Ruby Sparks The fictional heroine of an author’s novel suddenly materializes in real life. Prometheus Some astronauts go to a distant planet to investigate the possibilities of life. Peace, Love & Misunderstanding Differences of opinion have driven a hippie mother and her daughter apart. Chernobyl Diaries Young backpackers take a trip to the abandoned Russian city of Chernobyl. The Details A mild-mannered doctor realizes that his backyard is infested with raccoons. Butter A ruthless woman wants to win first place in butter sculpture at a State Fair. The Amazing Spider-Man In this superfluous re-make Spider-Man has to confront a new Super Villain. To Rome With Love Woody Allen pays homage to the Eternal City with a quartet of short stories. E-mail: dvddiary@yahoo.com Copyright © 2012 Mr. Robet You can read all past articles of DVD Diary at www.BaliAdvertiser.biz C/He/I-03 Oct 12


Bali Advertiser

14 November - 28 November, 2012

For Sale; UPS, monitor Samsung, DVD Sanken and fan Krisbow incl. Rp. 600.000 final price. Excellent condition. Call/SMS 0878 5107 3568 Agus. [003] For Sale; Wireless antenna ex. Chanel-11 Internet Provider with 15m steel. Works for any ISP like Global Extreme, Channel 11, Bali Media, Era Akses, CBN. Call 0878 6431 8333. Jimbaran. [004] For Sale; Dumbbell 5kg 11lbs ideal for weight lifting at home or gym. Only Rp. 50.000 each or Rp. 80.000 for the pair. Call 0858 5702 4740. Denpasar. [159]

NC/He/G-17 Oct. 12

Klinik PENTA Medica

24 Hours Medical Assistance

GP consultation & home visit/out call Professional emergency room service Air charter & commercial medical evacuation Dental clinic service Home care & nursing care First aid training Ambulance transfer & standby event service By joining PENTA Medicare Club (PMC), will get discounts at several medical providers in Denpasar Only IDR 135,000/year PMC Family Member IDR 486,000/year Klinik PENTA Medica

Jl. Teuku Umar Barat - Marlboro No 88, Denpasar - Bali Telp. 0361 490709 / 7446144, Fax 0361 - 490708 www.pentamedica.com, e-mail: clinic@pentamedica.com

Klinik Penta Medica Candidasa

Jl. Raya Manggis No 88, Desa Manggis, Karangasem Telp. +62363 - 41909, Fax +62363 - 41002 E-mail: inhouseclinic1@pentamedica.com C/He/G-7 March 12

For Sale; Apple iPhone 4, 32 Gb, unlocked black color, good condition, comes with USB and plug and hard cases. Sell only Rp. 4.5 million. Please call/SMS 0831 1964 5264. [221] For Sale; Amazon Kindle 3 ebook reader (non ads)+ original Amazon leather case with lamp+ thousand ebook. All complete set (box, charger etc). Perfect condition. <hub.istimewa@ yahoo.com>. Call/SMS 0858 8000 2500. [222] Free: Private Classified Ads in Bali Advertiser. Put your free ad in the next issue. The easiest way to place your ad is at www.BaliAdvertiser.biz  Place An Advertisement page  Private Classified. You may also bring in, fax, or directly e-mail your ad.

C/He/G-14 Nov. 12

Body & Spirit

45

For Sale; Professional video camera Sony DSR-PD100A. Including extra battery (NPF960) and water/air tight Pellican case. Excellent deal for only Rp. 11 million (paid Rp. 26 million). SMS 0815 4742 6222. E-mail: <indiego_dk@yahoo.com>. Seminyak. [029] For Sale; Complete wind surfer (mistral made in Switzerland). 6mtr, sail with trailer that can be pulled by motorbike or car. 0812 3608 8589. Jimbaran. [235] For Sale; Voucher (gift) for a 1 night stay in a “Spectacular Ocean glimpse retreat” at W Retreat in Seminyak. Price at Agoda US$396, sell for US$250. <jaggernaut@ hotmail.co.id>. [211]

C/He/I-11 Jan 12

C/He/I-08 Feb 12

For Sale; New and original home micro-dermabrasion system pack by Skindoctors, a hand-held device to remove dead skin and for exfoliation. Contact 0819 3620 7706. Kerobokan. [229] For Sale; New and used books of all kinds in English and German. Contact 0813 1436 6695. Kerobokan. [230] Notice: Bali Advertiser confirms all free Private Classified ads. When you send an ad, we will contact you. If we are unable to contact you then your ad is not printed. C/He/G-21 March 12

C/He/G-14 Nov. 12


46

Body & Spirit

Bali Advertiser

14 November - 28 November, 2012

Sport Massage Therapist

Contact : Dhorta (certified from London school of Sport Massage UK) Telp : 0821 2263 2287, Email : dhorta_simbolon@yahoo.com

He, who moves not forward, goes backward.

For Sale; Mid size trailer for motorbike or car. 0812 3608 8589. Jimbaran. [236] For Sale; Overhead cover for motorbike full weather protection, from sun + rain with safety glass wind screen + wiper system. Call 0812 3608 8589. Jimbaran. [237]

COSMOB oSALON & SPA d y T r e a t m e n t s

H a i r & y r it and t t Jus se ef or

Try our facial, mani/pedi, or 6 different massages with the best staff in Bali. Look for our Daily Specials!

elf urs yo

Solution for your : • Shoulder and neck muscle problem • Lower back pain • Pain relief caused by sport, work, trauma or general activity • Muscle injury treatment, prevention and rehabilitation

For Sale; Fujixerox laser printer m205f, Rp. 1.5 million. LCD TV 32” w/wall bracket, LG Scarlet Rp. 2.5 million, Sanyo Rp. 2 million, Plasma Panasonic 42” Rp. 4 million. All fixed price. Info : <dvarindra@yahoo.com> / (0361) 214 7234. Sanur. [028]

Featuring Clinique and OPI products www.cosmobali.com Jl. Danau Tamblingan # 154 Sanur 286330

NC/He/I-27 June 12

C/He/G-5 Sept. 12

C/He/I-18 April 12

C/He/G-14 Nov. 12

By Ayu Spicy

Delicious International Dishes (Indonesian Language Version available at www.baliadvertiser.biz)

C/He/I-22 August 12

Directions: Heat the oven to 375 F. If you are using fresh corn tortillas, cut each into six wedges. Heat the oil in a frying pan and fry the tortilla pieces until crisp. Drain on a few layers of paper towel, blotting gently to get as much extra oil off as possible. Sprinkle with salt to taste. If you are using Cornitos, skip the above and continue. Fill a pot with water and bring to a boil. Put the tomatillos or the green tomatoes in the water for 7-8 minutes until the skins split. When that happens quickly remove them from the boiling water and put in a blender. Keep the water in the pot. Whirl until pureed and set aside.

When I lived in California all those many years ago, I often made this dish having easy access to fresh corn tortillas and tomatillos -those small green sour tomato like fruits with a papery outer husk so popular in Mexican food. I had forgotten about Chilaqules until a local organic farmer began growing the tomatillos. Because they’re seasonal and not that accessible here in Bali, I’ve put substitutes into the recipe. This is a dish to have fun with by changing the sauce ingredients - be creative!

CHILAQUILES Ingredients:

Serves 6-8

- 10 corn tortillas or 180g bag of Cornitos corn chips - rice bran oil for frying - salt - 1/2 kg tomatillos, remove the papery husk and wash, or use green tomatoes and the juice of a lime - 750 g fresh tomatoes - 2 yellow onion, chopped - 1 1/2 Tbl. olive oil - 1/4 cup roasted red bell peppers, chopped - 2 - 3 green chilies, seeded and finely chopped - 3 Tbl. coriander leaf, chopped - 1/2 tsp. palm sugar - 1 1/4 tsp. salt - 1/2 kg firm cheese (such as Cheddar, gouda, goat or a mix), coarsely grated - 1/2 cup milk - 1/2 cup sour cream - 1/4 cup yogurt Garnishes: - 3 hard cooked eggs, chopped - 4 chives, chopped - 1 Tbl. coriander leaf, chopped - 1/4 cup sour cream

Bring the pot of water back to a simmer. Add the tomatoes and boil for 3 minutes. Remove the tomatoes and remove their skins. Add these to the blender with the tomatillos or green tomatoes (add 1 Tbl. fresh lime juice if using the green tomatoes). Heat the olive oil in a frying pan and add the chopped onion. Stir fry until the onion is soft and just starting to brown. Add the tomatillo mixture, roasted bell peppers, chilies. 1¼ tsp. salt, coriander leaf, and palm sugar. Cook the sauce for about 5 minutes and then take off the heat. Into a glass or ceramic baking dish about 16x 30 cm, evenly spread 1/3 of the tomatillo sauce. On top of that add 1/3 of the tortilla chips. On top of those add 1/3 of the grated cheese.

reshape, rebalance, reform at

SUNSET PILATES STUDIO Pilates can benefit individuals wishing to: • Lengthen and strengthen muscles • Improve posture and mobility • Tone and centre the body • Align and centre the body through core stability • Help prevent Osteoporosis and Tendonitis • Aid injury rehabilitation • Improve focus and breath control

Jl. Dewi Sri No.98 Legian Kelod (Off Sunset Road) Telephone 0361 - 7914127 Bali’s first fully equipped Pilates Studio C/He/G-02 May 12

For the next layer start again with 1/3 of the sauce, 1/3 tortilla chips, and 1/3 cheese and continue until all the ingredients are added ending with the cheese. Mix the milk, sour cream and yogurt with a fork until well incorporated. Pour this evenly over the chilaquiles in the baking dish. Using a knife carefully life the tortillas so the sour cream mixture can flow around the three layers of chips. Cover the dish with aluminum foil and bake in a 375 degree oven for 20-25 minutes. Remove the foil and bake another 10 minutes. While this is baking put each of the garnishes in small separate bowls and put on the table so each diner can garnish as they choose. This is best eaten hot. ¡Buen provecho! That’s Spanish for enjoy your meal All recipes are available on the Bali Advertiser website in both English and Indonesian versions. You can easily copy and paste and print. Paste as unformatted text. Copyright © 2012 Ayu Spicy You can read all past articles of Food Glorious Food at www.BaliAdvertiser.biz C/He/G-30 Nov. 11


Bali Advertiser

14 November - 28 November, 2012

For Sale; LG big refrigerator, 2 doors, grey, still in good condition and compressor warranty for 2 years. Price Rp. 4.500.000. SMS 0819 9943 5810. Denpasar. [110] For Sale; AC Sharp 1.5pk, bought Rp. 4 million, sell for Rp. 2 million. Cash register used only 3 days, bought Rp. 3.5 million, sell for Rp. 3 million. 2 big light box size 2.5mx1.5m and 1,5mx1m, sell both for Rp. 3 million. Call 0819 9903 2805. [067] Do you have Baht Thailand currency? I would love to buy in less price. Will have trip next year and try to press expenses. Contact/SMS 081 6474 2485. [068] C/He/G-5 Sept. 12

Body & Spirit

47

For Sale; Tables (2) antique, glass-topped table sizes : L50xW50, Rp. 800.000 x H50 and L140xW40xH79, Rp. 2.000.000. Contact <Operations@AquaMarine Diving.com>. Jl Petitenget 2A. Ph 473 8020. [149] For Sale; Picture frames with glass (101pcs diving and marine life photos) sizes from 31x25 to 68x144, price between Rp. 20.000 Rp. 300.000, discount for bulk purchase. Contact <Operations@AquaMarine Diving.com>. Jl Petitenget 2A. Phone : 473 8020. [150] For Sale; Thermoses (Anodized Polyurethane foam insulated to keep hot and cold) = D 20 cm H 28 cm (3 pcs), Rp.150.000. Contact < O p e r a t i o n s @ AquaMarineDiving.com>. Jl Petitenget 2A. Phone 473 8020. [151] For Sale; 2nd hand wetsuit price between USD2-15, discount for bulk purchase. Contact <Operations@ AquaMarineDiving.com>. Jl Petitenget 2A. Phone 473 8020. [152]

NC/He/G-14 Nov. 12

RECTAL INSUFFLATION (Colonic Irrigation + Ozone)

• Detox the colon and liver • Improve the colon and liver function • We use a brand new and state of the art colonic irrigation machine that uses a triple filtration UV system with Reverse Osmosis Water (RO water)

Ruko Sunset Indah I No.10. Sunset Road # 89, Kuta (80361) Bali Telp/Fax: (0361) 767619 Hp. 081236216537 (0361) 8577345 Email: drwellysbali@gmail.com www.drwelly.com C/He/I-17 Oct 12

C/He/I-31 Oct 12

C/He/G-30 May 12

C/He/I-14 Nov. 12

C/He/I-17 Oct 12


Bali House & Home WHOLESALE & RETAIL

PBA Putri Bali Agung

CUSHION TABLE

For Sale: Teak baby cot. Four poster, solid wood, white wash finish with waterproof mattress. Rp 1.1 juta. Contact 081 2386 6753. Canggu. [069]

For Sale; Food and study table and chair for kids below age 6. Rp. 450.000. Small size local brand mattress Rp. 100.000. Call 0815 5850 0129. Denpasar. [006]

For Sale: HP Laserjet 1010. Works perfectly. Asking Rp 1.1 juta. Contact 081 2386 6753. Canggu. [070]

For Sale; Nintendo DS,used 1year, good condition, black color, Rp. 900.000.Call 0815 5850 0129. Denpasar. [007]

BOLSTER

BEDDING

RUNNER

TABLE

MAT

CURTAIN B W AG &

ALLET

Jl. Legian Kelod No. 143C, Kuta-Bali Tel/Fax: (+62 361) 761431 Email: putribaliagung@yahoo.com www.pbabali.com

T BESICE PR

Supplies: Uniform, Towel, Sheet, Pillow, Duvet, Mattress, Bathrobe, Napkin, etc. Jl. Mahendradatta no. 86, Telp. 0361 - 5067311 / 5067312 / 082139463388, Denpasar E-mail : suksesejati_bali@yahoo.com C/Ho/G-8 August 12

C/G/G-21 March 12

C/Ho/I-11 July 12

C/Ho/G-22 Feb. 12

C/Ho/I-13 June 12

C/Ho/G-14 Nov. 12


C/Ho/G-14 Nov. 12


Bali House & Home

G

50

Bali Advertiser

14 November - 28 November, 2012

ARDEN DOCTOR

by The Garden Doctor

by Dr. Kris

Organic Solutions for Pest and Disease

Dear Dr Kris I am enjoying reading your columns....thank you. I am in need of your advice I have 8 are under cultivation in Ubud, amongst the sawah...beautiful yes! Problematic also! We are getting great abundant harvests of tomatoes, eggplant & leafy greens, even beetroot and as I am new at this. I am thrilled, however wish to be totally organic....as the farmers started to use the chemicals after planting rice crops we have been hit with caterpillars and the like and crops are failing due to the infestation. Our kailan before very healthy fell immediately to the problem zucchini also. Also someone told me I have fusarium wilt which affects tomatoes and eggplant especially. They start off beautifully and then almost overnight leaves wilt from the bottom and gradually the plant fails. I guess we lose between 20-30% this way. So, three vital questions if I may: 1. How do I improve soil to prevent/combat fusarium? 2. What organic pesticide other than neem oil can I use to combat the caterpillars? 3. What is the best, most efficient way of being organic in an otherwise non-organic environment? What strategies are available to me? Thank you so very much...look forward to your response warm regards, Marisa’ Fusarium wilt is a fungus that lives in the soil and invades the plant through its root system. The fungus can remain active in the soil for years, and can be spread by soil on shoes and tools or even wind, rain, insects, weeds, and infected seed. It commonly affects tomatoes, eggplants, potatoes, basil and chillies. It primarily attacks the water conducting tissue (xylem) inside the stem. The lower leaves become yellow and wilted, gradually spreading up the plant. This can often prove fatal, once water uptake is totally blocked, and the whole plant has wilted. The stem may look normal on the outside but if split open the damaged inner tissues are brown. Promptly remove and dispose of any infected plants in the rubbish, not the compost, otherwise you will just recycle the disease, also remember not to use seeds from infected plants. There are chemical soil treatments for the problem, though there are also various organic options that you could try. Many organic gardeners have found that when they limed their soil to increase the availability of calcium to their garden they have inadvertently eradicated fusarium wilt. The reason is thought to be due to the accompanying ph rise to 6.5 – 7. Fusarium spores prefer an acidic soil, pH under 6.5. Do a pH test on your soil, raise the pH if necessary. Fusarium thrives in warm moist temperatures, so make sure your soil dries out occasionally, if it is constantly wet you are creating conditions for the fungus to thrive in. If possible, take immediate steps to improve soil drainage and minimize compaction. Wet soils and poor drainage contribute to outbreaks, amend clay or compacted soil with organic matter to improve drainage. Performing crop rotation each growing season by selecting different plants to grow in the same soil can also help reduce the spread of the disease. Mix it up a bit. Crop rotation is an absolute requirement for good soil health, and also helps to keep pest numbers down. Don’t plant tomatoes or other crops in the same place two years running. Sometimes the only solution for heavily infested soil is to plant tomato varieties that are resistant and keep adding compost until you get on top of it, if liming doesn’t work. You can easily find hybridized ‘fusarium resistant’ varies of tomatoes that will be marked with code ‘F’ on the packet. In regard to caterpillars ,well they can be a devastating

force that can wreck your garden almost overnight. They attack entire plant steams,leaves and fruit. While there are chemical insecticides all around that will kill caterpillars, they may cause more damage than the pests they are designed to control through their effect on garden ecology, the environment and possibly the gardener. Useful pollinating and predatory insects are often killed when insecticides are sprayed, making it easier for aphids and scale to breed quickly. Besides not everyone is comfortable spraying poison around their garden, better that you adopt a number of organic strategies to combat them.

For Sale; Fitness inversion table. Very good condition Rp. 4 juta. Available at Kerobokan. SMS e-mail address for photo at 081 835 0058. [182] For Sale; Fitness bike Treo R108 with console. Rarely used, good condition, Rp. 3 million. Available at Kerobokan. Send e-mail address for photo 081 835 0058. [183] For Sale; Goat skin otoman 1mtr diameter ex. boutique still good for Rp. 1.5 million only buy for Rp. 3.5 million. Contact Chandra 0821 4656 7721 or e-mail for pic to : <mmadeyudi@yahoo. com>. Denpasar. [184]

For Sale; Fishing reel. Penn Senator 114-H and 113-H. Made in U.S.A. This reel is perfect for trolling, bottom fishing, and jigging. Large line capacity for the big fish. International standard. Phone/Text 081 2298 1228. Kuta. [195] For Sale; Fishing rods. Trolling rods, jigging rods, and other rods. Custom made rods. Made in U.S.A. Phone/Text 081 2298 1228. Kuta. [196] For Sale; Fishing reel. Made in U.S.A. Pen Senator 4/0 Special. Catch the big fish! Good for trolling, jigging, bottom fishing. Call/text : 081 2298 1228. Kuta. [197]

Firstly, if you notice damage to plants such as kailan which often gets attacked, then try to plant them away from the main crop so that you can isolate the problem. Physically handpicking any caterpillars that you see is very effective if you keep at it for a few minutes over a few days you can almost eradicate the entire population. Look for them underneath leaves and on stems 10 minutes after watering. If you can see their dark green droppings on the leaves then you know that they are close by, and this can often be the best clue to finding them. Every caterpillar removed is one less moth laying eggs in the weeks to come. If you can prevent them laying their eggs then you are way ahead. Collect them and feed them to the fish or chickens. You can also shut them out by designing a cover with the use of mosquito netting or fly screen material. Seaweed and fish emulsion liquids are also a useful deterrent for caterpillars. Some home gardeners and even farmers noticed that when they sprayed their plants with seaweed or fish emulsion fertilizers, the pests simply disappeared or left. In regard to this it is thought that butterflies and moths find host plants by their acute sense of smell, so they wouldn’t hang around breeding when the smell of the kalian is masked by seaweed or fish. Placing upturned eggshells (white when viewed from above) is also said to confuse cabbage moths into thinking that the area is already populated, thereby moving onto another area before landing.

C/Ho/G-11 July 12

You should also use crop rotation as this can prevent pests from getting too comfortable with a certain type of plant. Having wildlife in the garden can also help without any effort on your part. Encourage animals that will eat caterpillars into the garden, such as birds, frogs and lizards which are all important in controlling pests. Then the final part of the strategy is spraying with a home-made organic pesticide. Caterpillars cannot stand the combination of garlic and chilli, and you can make this at home. Chilli Spray 20 hot chillies 1 garlic bulb crushed, Puree the chillies and garlic in a blender. Then add one litre of water and blend again. Strain the mixture and mix in a tablespoon of dishwashing soap. Spray this mixture undiluted on to plants. If it’s not strong enough add more chillis! Apply every few days, especially after rain.

www.moessongallery.com

C/Ho/G-5 Sept. 12

Or if you’re into something a bit more extreme pick off all the caterpillars that you can find, and pulverize them in a blender with water. Spray this mix back onto the crops. You will not get any more eggs laid there. Of course remember to wash your vegetables well before use! The most efficient way of being organic in a non-organic environment is to simply just keep doing what you’re doing! Keep looking for alternative ideas and new strategies to tackle the garden problems without harmful chemicals, and most of all remain vigilant!

Dr. Kris Garden Doctor Contact: dr.kris@ymail.com Copyright © 2012 Dr. Kris You can read all past articles of Garden Doctor at www.BaliAdvertiser.biz C/Ho/G-14 Nov. 12


Bali Advertiser

Bali House & Home

14 November - 28 November, 2012

51

Expand your horizons...

High quality Aluminium Door & Window Systems Folding Doors • Slide & Turn Doors • Sliding Doors • Windows

SUNFLEX Asia, Jln Rumah Sakit Unud No. 5 Jimbaran - Bali Phone. +62 81 835 3103 www.sunflexasia.com, alnatura@indosat.net.id C/Ho/G-03 Oct. 12

C/Ho/U-17 Oct 12

C/Ho/I- 5 Sept. 12

Villa Private residences Hotels & resorts Corporate

British interior design consultant

Creative solutions & concepts

Spatial layout specialists

Design studio & showroom

Expert design team

Quality imported & local fabrics

Accessories & furnishing

Quality & price guaranteed

Jl. Bypass Ngurah Rai No. 296 Betngandang, Sanur 80228 Tel : +62 361 270030 Fax : +62 361 285 031 www.gwinteriors.com info@gwinteriors.com

Luxurious design with affordable flair C/Ho/G-25 July 12

C/Ho/G-21 March 12


52

Bali House & Home

14 November - 28 November, 2012

Bali Advertiser

LIMAJARI PUBLIC STORAGE OFFERS YOU: - Short term and long term storages - Small and large volumes - Pick and pack service at your house - Racks available for storage of archives - Temperature controlled room upon request - Discount on long term rentals - Safe and secure environment

PLEASE CALL: AAN or RATJANI at 0361-730024 C/Ho/G-17 Oct. 12

C/Ho/G-21 March 12

C/Ho/I-14 Nov 12

C/Ho/G-19 Sept. 12

C/Ho/G-11 July 12

C/Ns/G-31 Oct. 12


NC/Ho/G-14 Nov. 12


54

Bali House & Home

Bali Advertiser

14 November - 28 November, 2012

Moving Sale; Big size travel suitcase brand Polo. Dark blue color. Rp. 500.000. SMS only 081 2381 5292. Denpasar. [001] For Sale; PC monitor LG Flatron T530S 15”, price Rp. 300.000. Call (0361) 781 7447 or 081 2389 5551. Bukit. [002]

For Sale; Used surfboard for beginner cheap. Call/ text 081 7939 9777. Nusa Dua. [228] For Sale; Fishing reel. Penn Surfmaster. Made in U.S.A. Great conventional reel for casting, bottom fishing, trolling. Call/SMS 081 2298 1228. Kuta. [198]

For Sale; DVD player Niko 618, DVD, MP3, MPEG4, Karaoke, USB Player. Price was Rp. 399.000 at Carrefour, plus microphone CentroTech, price was Rp. 85.000, together for Rp. 330.000. SMS your e-mail address for pics. Chris, 0857 9214 5997. Kerobokan. [119] Looking for people on the path of Personal Growth to form a Support Group. Based and inspired by Napoleon Hill, Brian Tracy, Robert Kiyosaki, Stephen Covey, Dale Carnagie and many others. 081 138 6021 <balisupportgroup@hotmail. com>. [120]

C/Ho/I-22 Feb 12

Wanted; Tiger motorcycle, (or equivalent) good condition 4-5 years old, must have DK registration, STNK and BPKB. Will consider larger CC English motorcycle (Triumph, Norton) as well. 0812 4739 8698. Ubud. [121] For Sale; high quality red maroon carpet, doesn’t suck dust, easily cleaned, 3.6 x 1.8m, only used a few days, as new. Rp. 1 million negotiable. Call (0361) 960 1096. Denpasar. [122] Moving Sale; Antique old safe from Germany size 97x65x50, Rp. 4.5 million (nego). Old antique collection Garuda Chempaka wooden size 170x74x80, Rp. 85 million (nego). Call (0361) 858 0395 / 081 7979 8507. Kerobokan. [123]

For Sale; Smartfren wi-fi modem and router. 1 month old, complete documentation n boxes, 99% condition, bought new for Rp 900.000. Contact 0878 6002 2239. we’ll let it go for best offer. Denpasar. [081] For Sale; Canon EF-S 1785mm f/4-5.6 image stabilized USM with Hoya 67mm UV filter included. Was bought in 2008, selling due to an upgrade. Rp. 4.2 juta (nego). Send SMS 0878 6004 3655. Canggu. [082] For Sale; Australian pure wool quilted under blanket. 5 pcs still new, original packaging from cot to kingsize. + Rp. 750.000. Call 0813 5361 7811. Canggu. [083] For Sale; Kawasaki dirt tracker 150. Brand new 14 inch wheel rims and spokes. 100/80/14 front tyre. 120/80/80/14 rear tyre. Rp. 455.000 or offers. Terry 0813 3813 6110. Sanur. [084] For Sale; Motorcycle leather jacket, brand new never worn. My design, padded elbows and back protectors. size XXL. Cost Rp. 2.5 million, sell for Rp. 1.7 million or offers. Terry 0813 3813 6110. Sanur. [085] For Sale; Mattress, size 180x200, very good condition, spring bed, sell for Rp. 1.2 million. Contact Elly on 0818 0530 0379. Denpasar. [168]

C/Ho/I-14 Nov 12

C/Ho/I-14 Nov. 12


Bali Advertiser

Bali House & Home

14 November - 28 November, 2012

WINDOW FILM SOLUTIONS Upgrade Your Existing Windows & Doors ● Save Energy ● Protect People/Property ● Increase Comfort ● Create Privacy

Bali Solarist: Ruko Sunset Plaza No. 14 Sunset Road Kuta - Bali TEL: 0361 8476792 Contact person: Doni: 081 337 873 888 0361-784 3177

55

For Sale; Two decorative wooden backs of the bed, L 92cm H 100cm each, suitable for one king or queensize bed or for 2 single bed. Rp. 220.000 both. Contact 0818 0566 2911. Legian. [136]

For Sale; Killer insect lamp, regency, LPN 901 new, still in the box, a smart device that attracts insects with UV and a strong adhesive glue board that traps them. Size cm 27x13. Rp. 80.000. Contact 0818 0566 2911. Legian. [137]

For Sale; Kettler sauna suit, great for exercise to increase sweat and weight loss, new unused in box bought Rp. 175.000, sell Rp. 125.000. Call 0819 3618 4525. Denpasar. [176]

For Sale; 2 Samsung touch screen phones, good condition only Rp. 550.000 each or buy 2 for Rp. 1 million. Call 0818 0544 4150. Denpasar. [173]

For Sale; Sony Ericson Xperia mini android phone, good condition, still boxed, bought Rp. 2.2 million, sell for Rp. 1.1 million. Call 0878 6211 2696. Denpasar. [177]

For Sale; Motorcycle cover big size, fits most motorcycle, new and unused, bought Rp. 140.000 sell for Rp. 85.000. Can send picture by email. Call 0819 3626 4301. Denpasar. [174]

C/Ho/I-25 Jan 12

MANUELA FURNITURE

IMPO FABR RTED ICS & Sofa Designer ■ Customized Order ■ Project Hotel F OAM C B L M F I U F F A L O

E A T H E R

I C R O

F I R S T

Alumunium

I B E R

O T T O N

T A L I E

Q U A L I T Y

Synthetic Rattan

O U T D O O R

F U R N I T U R E

Outdoor Sofa

Stainless & batyline une entreprise du Groupe Ferrari

Jl. Tangkuban Perahu No. 8A, Kerobokan, Kuta Utara, Bali, Indonesia PO.Box. 80361 | Ph/Fax: (0361) 737242 | E-mail: manuela@manuelaproduction.com C/Ho/I-30 May 12

C/Ho/G-14 Nov. 12


56

Bali House & Home

Bali Advertiser

14 November - 28 November, 2012

For Sale; Mountain bike, 1 year old, 21 speed Shimano gear, front suspension, incl. air pump. Available after 29 November. Rp. 600.000. Call 0877 6114 0692. Ketewel. [011] For Sale; Baby box made from wood, knock down, size 60x120, complete with mosquito net & bumper. Rp. 1 juta nego. Bed knock down size 160x200 made from wood, Rp. 1 juta nego. Call/SMS 0852 3704 8168 (English / Indonesian). Kerobokan. [012] If you don’t quit, and don’t cheat, and don’t run home when trouble arrives, you can only win.

For Sale; Fuji 1GB XD type M picture card. Used for storing photos, video and all types of data files. 5yr warranty. Unopened. Rp. 150.000. Contact <Operations@AquaMarine Diving.com>. Jl Petitenget 2A. Phone 473 8020. [153] For Sale; Senso’s wooden fruit basket, green; decorative teakwood display for necklaces. Rp. 50.000. For pictures contact 0818 0566 2911. Legian. [138] For Sale; Samsung DVD player 171P complete with remote control, doesn’t work. Rp. 45.000. Call 0818 0566 2911. Legian. [139]

C/Ho/I-19 Sept 12

Flower Arrangements • Wedding Decoration • Cut Flowers • Bouquet • Gifts Villa Cemara Indah No. 13

Br. Semer, Kerobokan, Kuta - Bali 80361 Phone : (0361) 7422 654 http : //www.baliflorist.com E-mail: info@baliflorist.com C/Ho/I-18 April 12

C/Ho/G-31 Oct. 12

C/Ho/G-22 August 12

C/Ho/I-08 August 12

C/Ho/G-16 May 12


Bali Advertiser

14 November - 28 November, 2012

Bali House & Home

57

PT. LUMBUNG AYU Tropical Asian

Design

Sunset Road No. 01X, Kerobokan-Bali, Ph.: 0361-732 538 Website: www.lumbungayu.com Email: lumbungayu@dps.centrin.net.id C/Ho/G-8 Feb. 12

C/Ho/I-11 July 12

C/Ho/G-8 Feb. 12

C/Ho/G-19 Sept. 12

Import/Export of: - Marine Fish and Invertebrates - Koi and Arowana Aquarium and Pond Accessories Aquarium Design Setting Specialist Pond Specialist Aquarium and Pond Maintenance Agent for Hozelock: Filtering & Gardening products Showroom and Office: Jl. Hang Tuah 42 (50), Sanur 80227 (opposite KFC), Bali - Indonesia Phone: 62-361-281488, Fax: 62-361-288031 Email: balireef@yokistudio.com

Bali Advertiser

e-paper

now on-line

www.baliadvertiser.biz

ADVERTISING FOR THE EXPATRIATE COMMUNITY

14 Nov - 28 Nov 2012

Business Hours Monday to Friday from 8:30 - 4:00 Jl. Majapahit No. 46, Kuta Tel : [0361] 755 392 [Hunting] - Fax : [0361] 764 191 E-mail: info@BaliAdvertiser.biz Website: www.BaliAdvertiser.biz

C/Ho/I-14 Nov 12

Photo Copyright Ida Bagus Ngurah Primarta <ibnprimarta@yahoo.co.id>

C/Ns/G-14 Nov. 12

NC/Ns/G-14 Nov. 12

C/Ho/U-5 Sept.12


58

Bali House & Home

Bali Advertiser

14 November - 28 November, 2012

C/Ho/I-14 Nov 12

C/Ho/G-14 Nov. 12

C/Ho/I-03 Oct 12

Community Groups

Part 8 of 8 (See all Community Groups at www.BaliAdvertiser.biz)

Yakkum Bali Project Yakkum Bali Project is a non-government organisation concerned with the rehabilitation of children and young adults who are physically disabled, offering training courses to enable them to become independent, both physically and mentally. For enquiries and support, contact Latra on Hp. 0812 399 0701 or <yakkum_bali@yahoo.com>. Yayasan BAWA (Bali Animal Welfare Association) Not for profit organization assisting Bali street dogs, offer free sterilization, vaccination, treatments and advice on animal care. Education programs held at local schools. Emergency ambulance also available 24hrs. Further information or donations please contact Klinik Hewan Ubud 0361 981490, Janice +62 361 977217 or +62 361 8564760. Email <bawabali@aol.com>.

Amongst other projects YKIP has established a medical library at Udayana University and together with YKIDS runs a scholarship fund for the semi-orphans from the Bali Bomb. We are also working on a number of projects with local NGOs. For further information, see <www.ykip.org> or email <info@ ykip.org> or call us on 759 544. Yayasan Kemanusiaan Indonesia / The John Fawcett Foundation In Bali 25,000 people are cataract blind, but are too poor to pay for an operation. Indonesia-wide, this figure is more than 3 million. Hundreds of children from poor families have cleft lips and palates. Many, many desperately ill children suffer unnecessarily because their parents cannot afford medical treatment for them. Yayasan Kemanusiaan Indonesia helps people in the lower socio-economic group free of charge with sight-restoring cataract operations, cleft lip and palate operations and medical treatment. But we can’t do all this without your support. For information on how to donate, see our website: <www.balieye.org> or contact our office Jalan Pengembak 16, Blanjong, Sanur, Bali. Tel (0361) - 270 812, fax (0361) - 287 707, email: <yki@indo.net.id>.

Yayasan CIMD Supporting children with sponsorship to continue their education, opportunities for children with learning problems and organizing an extra program available for their friends and all the children from community. Medical programs based on actual needs; efficient and adequate. Reorientation and Yayasan Metropoli Indonesia rehabilitation for persons with special needs. CIMD works Non-Profi t Organisation working for art & cultural project for closely together with other social organizations. For more the children in the Karangasem Regency. Co-operation information, visit our website <www.yayasancimd.org> system with the village, banjar, or local NGO in the community. 8 branches so far. Free courses of artistic expressions: Yayasan GUS dance, gamelan, painting, Balinese language, traditional Established in 2002, Yayasan GUS is a non profit organization, weaving, etc. Monday-Sunday, around 14.00 to 18.00. Other dedicated to improving Bali’s environment. Vision: Improve projects: mobile library & cine-club. Open for book donation. the environment of Bali. Mission: Work together with Phone/fax 0363 22600, mobile 081 337 143 228, email stakeholders to reduce environment pollution. GUS Activites: <metropoli.indonesia@yahoo.co.id> Beach Clean Up, Education Project, Non Toxic Pest Control, Public Toilet, Rubbish Bins, Environment Movies, Environment Yayasan Peduli Kemanusiaan Bali (YPK Bali) Events, Free Consultations. Legian 138 Kuta Bali. Telp. Bali Humanity Care Foundation 62-361-759 323. Fax 62-361-767 654. <www.gus-bali.org>, YPK Bali is dedicated to supporting people with physical <info@gus-bali.org>. disabilities in Bali. They have provided physiotherapy, occupational therapy and education for people with disabilities YKIP (Yayasan Kemanusian Ibu Pertiwi) since 2001. Programs operate from their centre in Denpasar YKIP is a charity dedicated to improving the lives of all those as well in villages through a Mobile Therapy program. YPK who live on Bali but with a focus on health and education. Bali focusses on those who come from disadvantaged

backgrounds who have no access to appropriate health services. For more information about YPK Bali and how to support them visit: <www.ypkbali.org>, email at: <info@ ypkbali.org> or connect through Facebook: ypkbali. Yayasan Senyum Bali Yayasan Senyum Bali-health care for people with cranio-facial disabilities. Facilities operations for cleft lip and palate and other cranio-facial deformities, due to birth defects, accidents, or tumuors. We help poor people from Bali, Lombok and further east, we raise funds for operations whether in Bali or Adelaide at the Australian Cranio-Facial Unit. We also work to build local skills, technology, and capacity through training and development. Further information see : <www. senyumbali.org>. Or contact us <yayasansenyum@yahoo. co.id> or fax (0361) 233 758. Yayasan Senang Hati A centre for physically challenged Balinese where they can meet and make friends, learn or share skills like painting, woodcarving, sandal making and practise English and computer skills. A gallery displays and sells works produced by the members. The centre is organized by the members themselves with some help from foreign volunteers and is located at Jl. Sasi Brata, Br. Tengah in Tampaksiring (near to the market). Contact Putu Suriati, tel./ fax (0361) 974 872 or email: <yantin21@telkom.net>. Yayasan Sjaki-Tari-Us Yayasan Sjaki-Tari-Us has the purpose to support, counsel and accompany children with a mental disability in their development and participation to society. Located at the soccer field in Ubud, we have play-learning groups for young children and daily activities for young adults. We establish this by mobilising Dutch resources, knowledge and expertise and put it to the disposal of parents, teachers, counsellors and other interested people on Bali. Our mission is to transfer the resources in that way, that they can apply and transfer this themselves in the future. Contact: <sjakitarius.bali@ gmail.com>, Monkey Forest Road, Sebelah lapangan sepak bola. Ubud, Bali, +62 (0) 813 5718 1122.

COMMUNITY GROUPS is free for all non profit activities, groups, etc. For your group to be listed here contact: Bali Advertiser Tel. 755 392 / Fax. 764 191 or email : info@BaliAdvertiser.biz. Please notify our office for any corrections or changes. Let’s keep this up to date!


Building & Maintenance Certified European Project Manager with own MEP/ Architect/Supervisor staff, very experienced, excellent reference list in Bali and abroad, offers you • Site Supervision or full PM Services - as requested • MEP & Architectural Design • Construction Drawings • Pre Purchase Check-Up on existing Structures

YOUR TRUSTED CONSTRUCTION EXPERTS Phone: +62 8123 80 93 10 Mail: pm@ossbali.com

Wanted; Baby cot. Please SMS 0878 6172 9562. [172] For Sale; 2nd hand Protech PPS-600 paper shredder Rp. 200.000 and old video JVC P29 Rp. 100.000. Contact <Operations@ AquaMarineDiving.com>. Jl Petitenget No 2A. Phone (0361) 473 8020. [155]

For Sale; Desktop PC ideal for office or gaming. Price new Rp. 7.5 million, sell for only Rp. 4.500.000. Call for specs and pictures at 0858 5702 4740. Denpasar. [161] Moving Sale; Samsung washing machine, 7 months old, Rp. 1.3 million. Call 0813 3944 0881. Ubud. [162]

Swimming pool always green?

Call the experts, CV Tropical Pool and Spa 289104, 287673 or email: trevor@dps.centrin.net.id.

From as low as Rp 475.000 per month we will maintain your pool. C/BM/G-19 Sept. 12

Mega Water Filter provides solutions & consultation in water treatment system. With more than 10 years of experience, we’ve served clients from almost all industry sectors. Industrial Service Food & Beverage Pharmaceutical Laboratory Cosmetic & Chemical Photography Silver & Gold Plating Ice Maker System

Commercial Service Hotel & Spa Apartment Residential Office Restaurant Laundry & Car Wash Reverse Osmosis (sea, brackish, tap)

Hotline +6281 7557550 +62 361 8075757

Bring this ad, get 10% discount

Water Filter & Treatment Services

C/Bm/A-17 Oct 12

Jl. Raya Kuta 21 No. 5 Pertokoan Kuta Raya, Kuta - Bali Jl. Mayjen Sutoyo No. 37 Denpasar - Bali C/BM/G-30 Nov. 11

C/BM/I-28 Dec 11

BIO-Save Waste Water Treatment Tank

C/BM/G-3 Oct. 12

Recycle Black & Grey Water to Water Garden Sewage Supporting Products: Grease Trap IC Tank (Inspection Chamber Tank) Effluent Tank (Final Holding Tank), Manhole etc...

Itʼs not only a septic filter ... , Itʼs a proper sewage treatment Tank !!!

Easy Installations (BIO Save) Installations without retaining walls Almost Free Maintenance No Bacteria Additions Low Electrical Consumption : start at 47 Watts Meet Local and International Standard

PT. AMANAID

New Product BIO Gas For Generator For Stove For Hot Water

Specialize in Design and Build Sewerage Treatment Plant (STP) for Domestic and Commercial (House, Villas, Hotels, Restaurants, Hospitals, etc)

Grease Trap

Address: Jalan Nakula No: 63C, Kuta, Bali, Indonesia Phone: (0361) 499218, (0361) 7475698, 9244526, 9244527 Fax: (0361) 499188 Email: info@amanaid.com Website: www.amanaid.com

See the product and how it works at Toko Damai Sejahtera, Jl. Imam Bonjol 555 A 1/2, Denpasar C/BM/I-08 Feb 12

NC/BM/G-14 Nov. 12

C/BM/G-25 July 12


60

Building & Maintenance

Bali Advertiser

14 November - 28 November, 2012

Prima Jaya Stone

“Snake and Pigmy Pie” “ADAAAAAM.” “Yes my love.” “Adam I want something.” “Yes my love.” “I don’t know what it is yet but I’m working on it.” “Yes my love.” “I want a place to cook, you know like my own room. “Yes my love.” “I think..... I think I’ll call it a kitchen.” “Yes my love.” “ I want a place over here with a fire to cook on and a chimney to take the smoke away.” “Yes my love.” “A place here for storing dead things.” Yes my love.” “A place here for peeling the spuds and carrots.” “And a place here with a flat top so I can bludgeon things to death and disembowel them.” “Yes my love.” “It mustn’t be too high though I’m only 4 foot 9 and a half.” “Yes my love.” “Yes my love?” “I, er, I mean no my love.” “Ok I want it ready for next Saturday. You get on with that and I’ll make you a nice snake and pigmy pie with apple sauce for your supper.” “Yes my love.” You see right from the start someone thought about a kitchen as a utilitarian space that should be designed to suit the purpose of cooking. While the furnishings have changed a little since Adam was a lad, the basic concepts of kitchen design are still the same and have evolved over eons of time (an eon, that’s an excruciatingly long period of time you know). For people who spend much time in a kitchen the layout is very important and even small flaws can be a pain in the proverbial and this is why chefs are infamous for being grumpy old sods. People who work in kitchens tend to know how they should best be designed (funny that). It’s all to do with ergonomics. Years ago I was standing in a kitchen with an architect. It was a very spacious kitchen and I immediately thought that whoever would have to work in here would end up wearing joggers and carrying a GPS. “Who designed it?” I asked. “I did” replied the architect. “Do much cooking?” I ventured. “No my wife cooks in our house.” “Thought so.” In recent years we have been seeing larger and larger houses being built. The trend is towards minimalist design, higher ceilings and large spacious rooms. Kitchens tend to be following this trend and all too often I see kitchens that are better suited to repairing A380s. Compact is often good with everything within reach. Most kitchens will only have one person cooking at a time, a few will have two and only commercial kitchens need to be designed to have discreet working areas where teams of people will work. As many people know kitchens are designed around a “work triangle” with most movement being between the cooker, refrigerator and sink. Work benches are interspersed around these and located so that when that couchsportsman of a husband has finally been hounded into action and is determined to prove once and for all that he should not be allowed anywhere near a kitchen ever again there is somewhere handy for him to throw the flaming pan. Of course we do need to chop up dead things from time to time (perhaps even the odd recalcitrant husband) so we need some bench space for that. Bearing all this in mind let us look at some standard kitchen layouts which will determine, or if you are renovating probably be determined by, the shape of the room. 1. Along a Wall Kitchen This design is used when you build a kitchen against a wall. Usually with a fridge at one end, the sink in the middle, the cooker towards the other end and bench space in between. The work triangle in this case is in fact a line between the fridge the cooker and the sink and so movement wise it is not a very efficient layout. This design is often used in small flats or bedsits where space is at a premium and cats cannot be swung. If this layout is used in an open plan dining room / kitchen a view of the back of the person cooking is not very sociable although it does allow you to avoid eye contact with a grumpy spouse in the morning. It doesn’t look good with the kitchen being “on full display” to the room.

2. Corner Kitchen

Jalan Raya Pantai Padang Galak No. 17, Kesiman-Bali (80237) Telp. 0361-8525788 Fax. 0361-285598 Hp. 081-239 63357 Email: primapoolbali@yahoo.com www.primapoolbali.com C/BM/G-27 June 12

This design wraps around a corner of a room (surprise surprise) with the fridge at one end, the sink and cooker on two walls and bench spaces in between. This is better than the previous single wall kitchen in that the work triangle becomes a triangle making it more efficient as a workspace. Corner kitchens suit a layout with a kitchen table and chairs added although inevitably the table will become a secondary work area. This design allows more than one person to work at once. It does have a corner bench which can tend to become dead space with a difficult to access cupboard in the corner. 3. A Return or U Shaped Kitchen Here an extra wing or return is added to the corner kitchen. This increases working efficiency with the work triangle becoming compact and it allows for the separation of food preparation, cooking and cleanup functions. The extra wing may be used as a breakfast bar and can be good as a work area when socialising. It also looks much tidier screening the kitchen from the rest of the room. This kitchen design does, however, have two dead corner cupboard spaces. C/BM/U-16 May. 12

4. Galley or Parallel Kitchen So named because it is widely used on ships where the shortage of space means the kitchen is very often also used as a corridor. The kitchen is lined up on two parallel walls. Some people really like this style of kitchen and it is a design often found in the professional kitchens used in movies where the hero chases the baddy as he tries to exit stage left - through the kitchen - pulling crockery and pans off the shelves as he passes. The work triangle can be made to work well and work areas can be separated. There are no dead corners. Common in Britain, a galley kitchen can be a pain if it is a through route to a storeroom or, more commonly, to the back door.

SERIOUSLY DESIGNED ARCHITECTURE

I

INTERIOR

I

LIGHTING

5. Island Kitchen This is similar to the corner kitchen except that an “island” bench unit is placed away from the other benches where a kitchen table might otherwise be. Island kitchens have become very popular being easy to work in, with good access, separation of work areas and the work triangle working well. Also good if you have more than one person messing about in the kitchen at the same time, very good if you like having domestics (you can duck behind the island as the plates fly over) and is particularly useful if you present cooking programmes on the television. They can be expensive, require a lot of space and you must remember that there might be problems getting the plumbing and power to the island unit. Don’t build the house and then decide you’ll add an island unit later, you’ll give your local plumber (or yourself) a nervous breakdown as he hacks away at your beautiful parquet flooring.

S E R I O U S LY D E S I G N E D

ARCHITECTURE I INTERIOR I LIGHTING i n f o @ s e r i o u s l y d e s i g n e d . c o m w w w . s e r i o u s l y d e s i g n e d . c o m C/BM/G-11 July 12

Whatever the kitchen design you might choose it is important to get the dimensions correct so the distances between benches, the cooker, fridge and sink are short enough to be efficient but large enough to allow space to move especially if more than one person will work in the kitchen at once. As I said before a kitchen is a place where compact often works well. You’ll remember I said that when you are halfway through peeling the onions and, with tears streaming down your face, you realise you left the tap running in the kitchen sink and the fridge door open and, as you reach out your left foot to close it, you notice the frying pan is starting that telltale smoke that says it is about to burst into flames. As a final note in any kitchen it is very important to buy a fridge with a door that opens the right way. You don’t want a right handed door in a left handed kitchen. You will find that some fridges have reversible doors. If blather about kitchens leaves you cold you can totally ignore all of this and go find a warung or there’s always a passing kaki lima. Bakso carts, of course, use the age old postage stamp kitchen design made famous by Luigi Vinnebago who had a less than thriving business building motor homes out of Fiat 500s. Phil Wilson Opinions expressed are those of Phil Wilson. He can be contacted through the websites at www.wilsonbali.com or at www.mrfixitbali.com or through the office on 0361 288 789. Copyright © 2012 Phil Wilson You can read all past articles of Fixed Abode at www.BaliAdvertiser.biz C/BM/G-14 Nov. 12


C/BM/G-14 Nov. 12


62

Building & Maintenance

POOL IONISER ● ● ● ● ● ●

Bali Advertiser

14 November - 28 November, 2012

Always Clear and Clean Water ● No Salt Low Maintenance ● Guarantee 3 Years Friendly Environment ● Competitive Price 95% Less Chemical Use Low Power, Max 12 watt Pump working hours about 4-7 hours/day

Call: Dave 0818 0553 7120

For Sale; Mens bicycle good condition. Can send photos by email. SMS 0878 6211 2696. Denpasar. [038] For Sale; Surfboards 6ft 2” Al Merrick fair condition, Rp. 400.000, 6ft Come Sand veneer bottom, good codition, Rp. 800.000. Call 0813 3701 4332. Kuta. [045]

For Sale; HD handycam Sony XR260VE. 160GB memory, 8.9Mp, 29.8mm wide angle lens, 30x optical zoom and 55x extended zoom. New, perfect conditions, used only one week. Price Rp. 6 million. Sara 0812 3675 4518 / <sara.scappin@gmail. com>. Canggu. [051]

ADA CLEAN CLEANING SERVICES General cleaning I windows cleaning I Floor polishing I Benches Bathub & Wash basin polishing | Toilet bowl cleaning I Kitchen detailling I Natural stone floor cleaning & coating | Mattress, sofa, Carpet refreshing I Timber sanding & finishing and......... ADA much more. Ada Clean provides the right chemicals for ur property

Office 0361-8474139 / 08123940401

TOKO BUKU

C/BM/I-13 June 12

C/BM/U-22 Aug. 12

Reviews of English language books on Indonesia

East Bali & North Bali by Richard Mann Have you ever wondered why the main focus of tourism in Bali is largely in the south and the art center of Ubud when all the major historical, cultural and natural sites are for the most part in the east and north of the island?

Here are only a few of these books’ intriguing personalities whose innovative businesses garland the whole northern and eastern coasts of Bali:

Taken together, the two guides East Bali and North Bali cover Bali’s most historic and unspoiled areas - the districts of Buleleng and Karangasem - which share a common border and virtually wrap around the whole island from east to west. The two guidebooks are actually companion volumes that perfectly complement each other.

*What passion first drove Photographer Michael Lorenti to first sell coconuts from his bungalow for extra income, then with Balinese friends eventually found Sensatia Botanicals to market a 100% organic line of products as a profit-sharing cooperative?

These richly illustrated guides are among Richard Mann’s My Bali series that also include Ubud & Beyond, Kuta+, Seminyak and Lombok & Beyond. This implausibly prolific septuagenarian author has written a total of 87 books about Indonesia during his 26-year publishing career. Opening chapters include detailed maps, descriptions of the physical geography and historical significance of the two districts, while the remaining pages cover destinations and unusual businesses (with full contact details and detailed summaries of facilities) not usually found in other guidebooks. The travel information is serviceable, supplemented by hundreds of original and stock photo collages, including one vintage sepia tone showing Raja of Amlapura’s Puri Gede in the last century with his 20 wives! The author gives a lot of attention to dive sites (Amed and Tulamben in the East Bali; Menjangan and Secret Bay in North Bali) with maps of the better known and lesser-known sites that regularly attract divers. Both guides also give capsule descriptions of each dive site – a guide within a guide – including its location, dive season, level of experience needed, visibility, maximum depth, currents, drop offs, undersea life, tips for photographers and safety advice. Valuable travelers advice and cultural asides are sprinkled throughout the text, such as the Gelgel Palace’s remains, the secret beaches of Seraya and Lebih along the coast on the way up to Amed, trekking opportunities in the Munduk area, where to find pinisi schooners in faraway harbors and the life and work of novelist Agung Pandji Tisna who opened the first hotel on Lovina Beach in the 1950s. One of the most readable and enjoyable aspects of the guides is the short biographies of “refugee” expats whose personal histories are full of adventure and remarkable business genesis stories. The majority, who for some mysterious reason come from northern Europe – Dutch, German, British, Danish and Swedish – have collectively amassed hundreds of years experience living and working in Bali. Almost invariably, these diverse and idiosyncratic characters have escaped from the stress-filled environments of their home countries or from hectic south Bali to find peace and tranquility in some of the most remote hinterlands of the island. These old salts have built second homes, then set about seeking a livelihood by creating innovative businesses: hotels, restaurants, dive operations, adventure sports outfits, eco resorts, yoga retreats, art galleries, villa development projects, meditation and healing centers, village tourism projects, radical approaches to artificial reef construction and bird and wildlife sanctuaries offering rainforest and mountain trekking. Owners of professional dive outfits, such as Geko Dive and Pro Dive Bali, provide extensive diving surveys, reflecting the many years spent in the marine recreation business.

C/BM/I-30 Nov 11

*How did ex-world traveler Charles “Chuck” Esposito happen upon East Bali’s Jasi Beach, surf its waves, build a bamboo hut and eventually establish a business selling palm syrup, natural soap and dark chocolate?

*How did Marjan van Ravenzwaaji, a former advertising executive, get it into her head to start an organic farm that serves gourmet food in the mountains of Bedugul? *Why did Carl G. Meyer who set up the first and only animal circus in Bali featuring bears, otters, birds, reptiles and where guests can ride and touch dolphins? *What made ex-theatrical make-up artist Theo Zantman – the “Van Gogh of the Tropics” - find a recluse in North Bali where he paints tropical landscapes romanticizing the quintessential Bali? C/BM/I-5 Sept. 12

*What drew Karen Kingston, with two international bestselling books to her credit, to remote Amed where she established the Dancing Dragon Hotel according to strict Feng Shui principles? *What motivated environmentalist Chris Brown’s “reef gardeners” to maintain local reef health by collecting crownof-thorn starfish, parasitic snails and reef refuse to grow the world’s largest Biorock installation? *Randall Dodge’s creation of a remarkable underwater Balinese Garden replete with temple, statues and split gateway? *What can be more intriguing than a dive outfit called Sea Rovers run by a Captain Paul M. Turley on the edge of Bali Barat National Park? *What inspired the luxury boutique Zen Resort Bali, Bali’s first integrated holistic health and nature resort where a staff practices a school of Ayurvedic medicine from Kerela, India? These destination guides are in essence directories of strange and curious expat enterprises located in the far corners of Bali. Experts in their given fields, reading of how these idiosyncratic entrepreneurs first discovered Bali, how they sent down roots, and what inspired them gives readers insights into a thriving sector of the Balinese economy in regions long neglected by visitors. East Bali by Richard Mann, Gateway Books International (http://www.palacesofbali.com), ISBN 978-602-8630-03-0, paperback, 168 pages. Dimensions 15 cm X 20.5 cm. North Bali by Richard Mann, Gateway Books International (http://www.palacesofbali.com), ISBN 978-602-8630-04-7, paperback, 168 pages. Dimensions 15 cm X 20.5 cm. Both available for Rp150,000 at Ganesha bookstores. For any publishers interested in having one of their books considered for review in Toko Buku, please contact: dariskm@gmail.com

081 999 66 0007 Mr. David

Consulting Swimming Pool & Spa

+20 Years Experience In the World Speak French / English / Indonesian - Engineering / Expertise - All Solutions for your problems: Hotel, Resort & Villa - We Check your plan for you / We can follow your project

0361 - 864 7800 email: water-dream-bali@hotmail.com Address: Jl. Raya Padonan No. 25 Banjar Aseman Kawan / Canggu C/BM/G-14 Nov. 12

AUSTRALIAN LICENCED BUILDER Design & Construction Building Consultant Building Report Interior Refurbishment Contract Administration Project Management Quality Control New Construction & Renovation Remedial Builder

Copyright © 2012 You can read all past articles of Toko Buku at www.BaliAdvertiser.biz C/BM/I-17 Oct 12


NC/BM/I-14 Nov 12


Building & Maintenance

64

NC/BM/I-14 Nov 12

Trust your home improvement projects to the experienced Pros @ Super Handyman : Painting

Plumbing

Electrical

Flooring

Carpentry

Garden

Tiling On

Pool

going property maintenance

Roof

One call does it all with Super Handyman!! Phn : (0361) 784 6889 or (0361) 784 2429 Service you can trust!! C/BM/A-19 Sept 12

Petitenget

SHUTTER WINDOW

• Wooden Blinds 25mm, 50mm, 35mm • Bamboo Blinds • Roller Blinds • Vertical Blinds • Exterior Blinds • Curtain, Blackout, Vetrage • Sliding Doors - Shutter Window • Natural Carpets ( Sisal, Seagrass, Banana Fiber, Pandanus) • Sun Louvre - Canopy, Awning • Magnetic Insect Screen • Outdoor Umbrellas • Wooden House • Rattan Ceiling

Kuta

Denpasar

Jl. Raya Kerobokan

Jl. Umalas

WOODEN BLINDS

25mm, 35mm & 50mm

NORTH

Bali Advertiser

14 November - 28 November, 2012

Export Quality Wholesale & Retail

BALI BAGUS

Jl. Raya Kerobokan 2X Mobile: 081 2366 5447, Phone: 0361 7849691 Email: balibagus.indo@gmail.com Fax: 0361 731906

For Sale; Water Purification Drinking Straw. (5) no tablets, no aftertaste, just clean water! Reusable, filters 500 litres. 2.000 fewer bottles used! Rp. 275.000. <Operations@AquaMarine Diving.com>. Jl Petitenget No 2A Kerobokan. Call (0361) 473 8020. [154]

For Sale; Used tablet Archos 7.0 home tablet Android, internal 8Gb, wifi, Android, micro SD slot up to 8Gb, complete with box, charger, keyboard, slave, manual, great for movie player HD resolution, for Rp. 950.000. Call (0361) 786 9350. Denpasar. [188]

For Sale; iPhone 4S 22Gb. Unlocked. OS6. Mint condition-not 1 scratch. Case on since day 1. Comes with sync cord and power adapter. Pick up in Sanur. Rp. 7 jt. <mkmoglan@gmail. com> or SMS 0812 3793 9924. Sanur. [013]

For Sale; Second Netbook/ laptop Acer Aspire Happy N550, ultrathin, 10,1”, Wifi, 6cell battery 4-8 hours, 320GB harddisk, 1GB DDR3, very good condition like new, only unit, slave, original Charger, for Rp. 1.9 million. (0361) 786 9350 no SMS. Denpasar. [189]

For Sale; iPhone 5, 32Gb unlocked. Black. Rp. 12 jt firm. No lowball offers. Never used. Box and acc. included. Only opened to unlock. Original USA ATT phone. Email : <mkmoglan@gmail. com> or SMS 0812 3793 9924 for details. [014] For Sale; Banana boat, inflatable, for 3 people. Can be towed with jet ski or small motor boat. Includes cover and pump. Rp. 2 million. Call/ SMS Colin 0821 9040 5222 or e-mail: <colin.biff@gmail. com>. Kerobokan. [026] For Sale; Wakeboard, Hyperlite Evolve 144. Ideal for learner to intermediate level. Complete with bindings. Call/SMS 0821 9040 5222 or e-mail: <colin.biff@gmail. com>. Kerobokan. [027]

Burner

FOR WOOD, SPICES, FURNITURE, HANDICRAFT, ETC

CV. ASA Jl. Gunung Agung, Mertha Jaya I No. 2 Telp. (0361) 435778 - 422703 08123968797 C/BM/G-1 Dec. 10

For Sale; Original old coin 50 sen from Indonesia 1959, for Rp 500.000 for 10pcs. Call (0361) 786 9350 no SMS. Denpasar. [190]

C/BM/G-08 August 12

For Sale; Laptop Packard Bell dual core 15” HD 120gb, RAM 1 Gb, webcam, DVDRW, good condition except the battery drop. Only Rp. 2.8 million nego. Call (0361) 745 5886. Denpasar. [191] Leaving Bali: All house items, teak furniture, sofa, bed, tables, fridge, washing machine, bench, teak dining table/chairs for 8 and a lot more. Great quality stuff for great price. SMS for pictures and price: 081 2380 2728. Jimbaran. [208] If you don’t like what you’re doing, then don’t do it. C/BM/G-17 Oct. 12

C/BM/I-30 May 12

Show Rooms; Istana Kuta Galeria (central park) Block BW2 No.11 Jl. Patih Jelantik, Kuta-Bali Ph/Fax. 0361 769128, Esia 0361 9655285 Email: hegarsumberkreasi.bali@gmail.com

Istana Building Commodities Center (IBCC) Block A6 No. 6 & 12A, Jl. Ahmad Yani 286, Bandung Ph. 022 7238534 Fax. 022 7238543 Email: marketing@hegarsumberkreasi.com

www.moncol.com

• Swimming Pool Equipments • Ozone and UV Sterilizer • Water & Wastewater Treatment • Irrigation Sprinklers Bayern Filter & Pumps

Ozone Solutions : • Low chlorine swimming pool & spa • No more red eyes, dry/itchy skin • Cleaner and healthier water Ozone breaks down chloramines and kills viruses, bacteria and fungi.

Also Producing: - Railings (stairs, balcony) - Steel works - Motorized Gates - Sliding doors - Aluminium Composite Panel

Ozone Solutions

UV Sterilizer

PT. MONCOL GOLFUSA, Denpasar : Tel (0361) 281-082, Fax (0361) 288-805 Jakarta : Tel (021) 475-1127, Fax (021) 471-1972, Surabaya : Tel 081-331435390 Email : infodps@moncol.com, info@moncol.com, infojkt@moncol.com

C/BM/G-14 Nov. 12

C/BM/G-8 Feb. 12

C/BM/I-08 August 12

C/BM/G-11 July 12


Bali Advertiser

QUICK & SMART SERVICES WE DO ALL BUILDING SERVICES * Architect Design * Waterproof * Painting * Pool Maintance * Renovation

Building & Maintenance

14 November - 28 November, 2012

* Electrical * Plumbing * Carpentry * Roof and Floor

Phone : (0361) 9264536 you call and we quickly mobile : 087862732753 respond (free for inspection)

For Sale; Fishing reel. Penn Jig Master. Original made in U.S.A. Industrial strength for big fish. Jig it, troll it, drift it. Great reel. Call/SMS 081 2298 1228. Kuta. [199] Don’t bother just to be better than your contemporaries or predecessors. Try to be better than yourself.

C/BM/G-2 May 12

For Sale; 1 set back support seat for motorbike front and rear, professionally made in Germany. 0812 3608 8589. Jimbaran. [238] For Sale; 1 set encyclopedia (30 seri A-Z) American Edition 1978, price Rp. 6 million. Call Irma 0817 0339 0769. [212]

65

RESTORATION SPECIALIST If you have toys, bicycles, cars, jeeps, motorcycle, scooter, machines, tools, trailers, needing professional restoration work. Any & all restoration project considered and advise given. Engineering consulting available.

Call :

0812 3608 8589 NC/BM/U-14 Nov. 12

phone (+62 81 7979 9797) - fax (+62 361 750 392) - email (arch22492studio@gmail.com)

C/BM/M-8 Aug .12

C/BM/U-04 April. 12

C/BM/I-17 Oct 12

Slab Factory

• Simple to integrate in conventional construction process • Fast installation & easy pouring • Comes with its fully lower reinforcements • Continuous quality control by German engineering • Environmental contribution due to reduction up to 90% in plywood and construction/supporting wood/bamboo

GO EFFICIENT! Building a two story House/Villa Hotel/ Factory/Bridge or a retaining wall?

SAVE YOUR TIME & MONEY by use precast concrete slabs for floor/ceiling/roof Call: 0361-9159054 e-mail: slabfactory@yahoo.com ICB , Jln Suweta 7, Ubud C/BM/G-17 Oct. 12

NC/BM/G-31 Oct. 12

NC/BM/G-14 Nov. 12

C/BM/G-14 Nov. 12


Local News Lampung Clashes Targeting Ethnic Balinese Results in 14 Deaths Recent village clashes in South Lampung on Sunday (28/10) have led to the death of 3 people, with more people being killed during a second round of the conflict on Monday, according to police in the area. Lampung Police spokeswoman Adj. Sr. Comr.Sulistyaningsih said on Tuesday that after the initial confrontation on Sunday the violence escalated into a major conflict on Monday. The first attack reportedly took place after two girls from Agom village were injured after young men from Balinuraga teased them while the girls were riding on a motorcycle. The incident grew into an ethnic clash, as slurs were uttered between residents of Agom village, inhabited by native Lampung people, and Balinuraga, most of whose occupants are Balinese. Following this hundreds of residents of several villages in the sub-district of Kalianda attacked the village of Balinuraga in the neighboring sub-district of Waypanji. The death of three people on Sunday — identified as residents who lived outside the two villages — triggered a larger attack on Balinuraga on Monday, with about 10,000 people, including those from outside South Lampung, joining the people from Agom. The angry mob managed to break through a police blockade of Balinuraga, where 1,000 officers were on guard.

“A total of 14 people have died since Sunday. All of the victims [were] males,” Sulistyaningsih told the Indonesian news portal vivanews.com, adding that all the injured have been admitted to Abdul Moeloek Hospital in Bandar Lampung. She said that aside from the dead, several people were injured in the encounter, while dozens of houses were destroyed after being torched. Sulistyaningsih said that some 2,000 police officers were now guarding the area, including personnel from the Banten Police and the National Police headquarters in Jakarta. The coordinating minister for political, legal and security affairs, Djoko Suyanto, noted that some 500 Indonesian Military (TNI) soldiers have also been dispatched to Kalianda to assist security measures. Before he departed to London for a three-day working visit, President Susilo Bambang Yudhoyono said “all members of the public should take part in efforts to prevent such communal conflicts. Do not leave it only to police personnel or the local TNI territorial command. Everybody should care [of the situation]. Only with [a proactive attitude] can we prevent conflict in an optimal and effective way,” (October 30th 2012)

Lampung Truce Achieved, But at Expense of Justice for Dead The government has welcomed a peace deal between rival ethnic communities in Lampung, where long-simmering tensions boiled over into violent clashes last week that left at least 14 people dead and thousands displaced. Djoko Suyanto, the coordinating minister for political, legal and security affairs, said on Monday (5/10) that the 10-point truce was agreed on Sunday night between representatives from the native Lampung community and migrant Balinese community in South Lampung district. “Early in the meeting, no agreement was reached because tensions were still high,” he said, adding that it took urging from Lampung Governor Sjachroedin Z.P. to get them to see eye-to-eye. “Even though several agreements were finally made, the governor continued to push for them to hold follow-up meetings,” Djoko said. He added that Bali Governor Made Mangku Pastika would also visit Lampung to help follow up on the peace pact. “We are coordinating with the governor and the district administration to promote this agreement at the grassroots level,” the minister said. The violence was sparked by a trivial spat on Oct. 28, which, fueled by long-running tensions between the predominantly Hindu migrant Balinese community in Balinuraga village and surrounding villages with mostly Muslim populations, led to a series of clashes and attacks. At least 14 people were confirmed killed in the violence, while around 2,000 of the Balinuraga residents fled their homes. Crucially one of the 10 points in the peace deal calls for police and residents alike not to pursue criminal charges over the death and destruction. Brig. Gen. Boy Rafli Amar, a National Police spokesman, said as quoted by Metrotvnews.com that the police would study that point further, but insisted that the perpetrators needed to be held accountable.

Another requirement under the 10-point agreement is for members of the ethnic Balinese community to be less insular and blend more with their neighbors. Djoko said that besides promoting the peace pact, the provincial and district authorities should also work hard to reduce the wealth gap between the locals and the more enterprising migrants, which has been blamed as a major factor underlying the tensions between the two groups. “We need to reduce the economic disparity between the groups because conflicts can arise from these differences and can even hinder the resolution of the problems,” he said. Other points in the agreement include a pledge by both sides to maintain security, order, harmony, solidarity and peace with one another. They also vowed not to repeat their violent conduct of the past, and agreed that if there were personal disputes with the potential to incite wider violence, the case should be resolved immediately by the concerned parties. Should they be unable to reach a resolution, they must bring the dispute before a council made up of community and religious leaders, youth leaders and local officials, the agreement states. Both sides vowed to admonish and counsel any of their members whose actions or statements had the potential to aggravate tensions or lead to unrest. The agreement stated that if the individuals in question failed to comply with the rules, they could face being exiled from South Lampung. Legislators welcomed the signing of the agreement, but cautioned that security should not be allowed to lapse. “Reason and common sense have prevailed in this matter, but we still need the police and the military in place there to make sure the peace deal holds, said Martin Hutabarat from the Great Indonesia Movement Party (Gerindra). (November 6th 2012)

Tornado Thrashes Bali – Extensive Damage to Buildings A tornado ripped through Denpasar on Wednesday (31/10) causing havoc and destroying several houses and a Hindu temple that were in its path.The tornado with a speed of about 20 knots occurred at about 04.00 am, Wednesday in Jl. Seroja, Denpasar. Three houses and a temple were extensively damaged mostly to roof structures and one car was also damaged by the wind. A ceremony was being conducted at the time the wind struck and the congregation fled for cover. There were no casualties in the incident, but damages are estimated to be in the hundreds of millions of rupiah. (October 31st 2012) Bali Teen Caught Having Sex with Chicken, Cow A 16-year-old boy from Karangasem, Bali was brought to local police after residents of the town caught him having sexual intercourse with a dead chicken. The boy, who has been identified by the initials KS, was discovered committing the act in a vacant lot of the Graha Indah housing complex in the district of Karangasem on Monday (29/10) afternoon. He was soon handed over to police, who released him after some brief questioning. “He committed no crime; he only committed an ethics violation. We have decided to let the local residents handle the problem,” Karangasem Police chief Comr. Putu Wijaya Arsa said on Tuesday. “We suspect that the perpetrator has a mental problem,” he added. Quoting KS, Wijaya said the boy had throttled the hen before having a sexual intercourse with it. KS claimed he did the deed after receiving an order from a spirit. Supposedly, the spirit made him see the chicken as a beautiful girl. Last month, KS was discovered having sex with a cow at the same housing complex. (October 30th 2012) Mt Batur in Bali Recognized as World Geopark UNESCO has officially recognized Mount Batur in Bali, Indonesia, as a world geological park because of its unique and special characteristics, Geology Agency chief M Suchyar said. “UNESCO has already included and recognized Mount Batur as a world geopark and it would be formally made known to the public on November 15, 2012” he said.Suchyar said the Geology Agency has also planned to propose five other locations for being named world geoparks namely Merangin area in Jambi, Sumatra, the Lake Toba old caldera in North Sumatra, Rajaampat in West Papua, limestone mountains in Pacitan, East Java, and Mount Rinjani in Jambi.“We plan to submit the proposal in 2013 and hope they would add to the number of geoparks in Indonesia,” he said.Suchyar said Indonesia actually has a lot of geoparks and until now around 33 locations have been identified such as Cukangtaneuh in South Ciamis, West Java. He said his agency would keep conducting research to identify other potential geoparks. (November 2nd 2012) TripAdvisor Says Indonesian Accommodation Tops TripAdvisor, one of the world’s largest travel sites, said its latest study examining the average of all individual review ratings submitted to its site worldwide showed that Indonesian properties scored above the world average. According to the study, the average review rating travelers give Indonesian properties now stands at 4.15 out of a possible 5, above the global average of 4.01. Accommodation in Indonesia also consistently scored high in terms of cleanliness, service and sleep quality, the site said in a statement over the weekend. TripAdvisor also examined the difference in travelers’ average review ratings for Indonesia’s hotels versus bed and breakfasts. The results showed that B&Bs were slightly ahead of their hotel counterparts with an average review rating of 4.13, versus 4.10 for hotels. “In the last 10 years, there has been a rapid increase in the number of travelers posting reviews about where they have stayed. Today’s findings show the wealth of information now available hasn’t just benefited other travelers, it has benefited the industry as well,” said Christine Petersen, the president of TripAdvisor for Business. “Hotel and B&B owners have, it appears, clearly been listening to the free feedback they have received, and used it to improve the service they provide.” TripAdvisor said the study was based on average review ratings, not property ratings, submitted between Jan. 1, 2012 and Sept. 21, 2012 of Indonesian properties listed on its site. (October 22nd 2012)


Bali Advertiser

Local News

14 November - 28 November, 2012

Some 95% of Teenagers Expected to have Understanding of AIDS by 2015 The government has set a target that approximately 95 percent of Indonesian teenagers should have comprehensive knowledge about HIV/AIDS by 2015, according to a health ministry official.The Health Ministry’s Director General for Disease Control and Environmental Health, Tjandra Yoga Aditama, made the statement here on Monday (5/11), noting that “the targeted age group is 15 to 24 years old”.“This is part of the government’s strategic plan to control HIV/AIDS and other sexually transmitted infections during the 2010-14 period. The target was to raise the number of teenagers with comprehensive knowledge about HIV/AIDS from 65 percent to 95 percent,” he said.“It is also aimed at limiting the prevalence of HIV sufferers in the age group of 15 to 49 years to 0.5 percent, and increasing the number of people aged 15 years or older who have received counseling and undergone HIV tests from 300,000 to 700,000,” Aditama added.He stated that the main objective of the policy was to bring down the AIDS-related mortality rate in Indonesia to zero percent. (November 5th 2012) Nearly 50 Percent of Indonesia’s Damaged Coral Reefs Rehabilitated About half of the damaged coral reefs in Indonesia, which accounted for approximately 67 percent of the total coral reef population in the country, have been rehabilitated, according to Maritime Affairs and Fisheries Minister Sharief Cicip Sutardjo.“We have carried out rehabilitation efforts in cooperation with the World Bank for the past five years, under the Coral Reef Rehabilitation and Management Program (Coremap),” he stated in Boalemo district, Gorontalo province, on Monday (5/11).Sharief said the damaged coral reefs recovered fast, adding that the rehabilitation process was not easy. “The program is in line with the government’s plan to develop a `Blue Economy’ in order to support the national economic growth,” he noted. The Blue Economy plan focuses on sustainable management of Indonesia’s maritime potential to maximize the nation’s economic growth. Indonesia has also established cooperation with Malaysia, Brunei Darussalam, the Philippines, Thailand and Timor Leste to protect the Coral Triangle region. The Coral Triangle program is also supported by Australia and the United States. “It’s like the Amazon of Brazil, the maritime Amazon is located in Indonesia,” Sharief said. (November 5th 2012)

Indonesian Police say Hasmi is New Terrorist Group Police are still investigating possible links between the new Hasmi group and older terrorist groups, Inspector General Suhardi Alius said here on Saturday (27/10).The police anti-terror unit Densus 88 has arrested 11 terror suspects from Hasmi in four cities, including Solo in Central Java, Bogor in West Java, Madiun in East Java and Jakarta. “The Hasmi group is a new group and we are still investigating its link with the old groups,” the head of the public relations division of the National Police Headquarters, Inspector General Suhardi Alius, said.Suhardi added that the group had set four targets to attack: the US embassy in Jakarta; the US consulate general in Surabaya, East Java; Plaza 89 across from the Australian embassy; an office of US mining company Freeport; and Mobile Police Brigade headquarters in Central Java. (October 28th 2012)

So You Love an Alcoholic Take Courage; There Is Hope Hope for families & friends of alcoholics AL-ANON FAMILY & FRIENDS GROUPS Wednesdays, 5:30pm Saturdays, 5:00pm The Ruko, Jl. Dhyana Pura 103 (upstairs at Warung Kita) - Seminyak Space for this ad donated by Bali Advertiser C/NV/R-28 Dec. 2011

Heat in Bali will end in November: Agency The hot weather, which Bali has experienced over the past few months, is expected to end in November, according to the Bali branch of the Meteorology, Climatology, and Geophysics Agency (BMKG).“BMKG announced their weather forecasts for Bali, and it is predicted that the Island will enter the rainy season this month,” the Head of sub services of Bali BMKG, Nyoman Suarsa, said here on Saturday (3/12). Suarsa explained that the weather change is due to a shift in the positions of the sun, which is currently located at the equator, but will begin moving to the south towards the South Pole. He added that some areas are expected to enter the rainy season this month, including Denpasar, the southern part of Badung, western and eastern parts of Jembrana, Buleleng, Gianyar, Klungkung, and the southern part of Karangasem, and that other areas in Bali would enter the rainy season in December such as the North coast of Bali and Nusa Penida. Suarsa further explained that during the rainy season the wind direction, which was originally from the east and carried higher temperatures, will turn into southeast winds, with average speeds of 10 to 28 knots, or about 38 kilometers per hour and could result in Tornado style gusts. (November 3rd 2012)

Space for this ad donated by Bali Advertiser

Ancient Temple Unearthed by Construction Crew in Bali Construction workers in Bali stumbled across what archeologists believe may be the island’s largest ancient stone temple, an official said on Wednesday (24/10). Workers were digging a new drainage basin near a Hindu learning center on Jalan Trengguli, in East Denpasar, when their tools struck a large stone structure one meter underground. The crew excavated a large stone plate, the first of many discovered at the site. The Denpasar Archeology Agency took over the excavation and have uncovered an 11-meter-long structure. “We will continue the excavation until [the whole structure is revealed],” said Wayan Suantika, an official with the agency. Suantika told reporters that, judging by the square structure’s similarity to ancient temples found in East Java, it likely dates back to the 14th Century. Residents also found ceramic wares and stone plates at the site, Suantika said. This discovery is the largest stone temple found in Bali, he said. The Wasa Temple, which was uncovered in Gianyar in 1986, is 11 meters long and 10 meters wide. Bali archeologists later found buried 16 sarcophaguses in 2010 in Gianyar. (October 24th 2012)

67

C/NV/I- 14 Nov. 12

New Roving Check-In Service has been Installed at Indonesia’s two Busiest Airports. Ground handler JAS has introduced the new roving check-in service at Jakarta’s Soekarno-Hatta International Airport and Bali’s Ngurah Rai International Airport. Developed by SITA, the mobile check-in desks, named ‘Mobicheck’, use wireless connectivity in an effort to shorten queuing times.“During peak periods airlines need more counters to check-in passengers. With no space for expansion of existing fixed desks, roving counters provide an effective way to keep queues down. They give us the freedom to move around and open a new check-in area wherever and whenever a queue starts to form,” explained Nazri Othman, Chief Operating Officer of JAS. Mobicheck was implemented at Jakarta airport in April and at Bali in June. A total of five have now been rolled out – three at Jakarta and two at Bali.“Essentially it is a check-in desk on wheels, which means it can be set up anywhere there is a queue and then stored away in a back office when it is not required. This provides much greater flexibility than fixed counters, as well as providing a back-up system for business continuity in the event of a disruption,” said Ilya Gutlin, SITA’s President for Asia Pacific.“Airlines are assured of better service for their passengers and with less bottlenecks at check-in, aircraft delays are reduced. The airport is also happy because it leads to less congestion in the departure halls and a smoother passenger flow. So everybody benefits,” he added. (October 22nd 2012) Space for this ad donated by Bali Advertiser C/NV/U-14 NOV. 12

PRIVATE CLASSIFIED AD FORM

All ads published in the next issue. For sale ads must include location of item (s).

FREE

PLEASE PRINT NEATLY - MAXIMUM 35 WORDS

Expert?

Are you an expert on a topic of interest to BA readers? We are looking for one time Feature Articles. Contact Bali Advertiser with your idea. info@baliadvertiser.biz Look For The Next Issue Of Bali Advertiser On 28 November, 2012

Fax to: (0361) 764 191 or Bring to : Jl. Majapahit No. 46 Kuta Place your ad on line 24 hours a day at www.BaliAdvertiser.biz Or you may email your ad to : <info@BaliAdvertiser.biz>

For Sale Ads Location: (Kuta, Tuban, etc.)

Color Ad Deadline Wednesday November 21 at 12:00 pm Black & White Ad Deadline Tuesday November 23 at 12:00 pm


GREENSPEAK by Ibu Kat

THREE FOR THE TREES

Bali’s environmental problems are glaringly obvious, but there’s good news, too. Here’s an inspiring story about three Indonesians who recently won major national and international awards for their work in conservation and reforestation on some of Bali’s most challenging terrain.

a recent fire caused by a carelessly dropped cigarette set the dry grass alight and destroyed many of these young trees. Bayu will be focusing future reforestation efforts with community planting on another 20 hectare site which will be easier to monitor.

It just takes a few minutes to cut down a tree. Even around Ubud the roar of chainsaws is often heard, cutting down the bigger trees for a fast fistful of rupiah and leaving big holes in the skyline. Out in the jungles, from Sumatra to Irian Jaya, forests are disappearing as swiftly as smoke. The current building boom consumes huge amounts of hardwood, almost none of which is certified as sustainable. Most of those pretty wooden floors come from Indonesia’s national parks and forests. And the densest, most desirable hardwoods are the slowest-growing; a big ironwood tree can be 800 years old. Please think about that when you choose the shingles for your new villa.

The FNPF nursery gives away free saplings to the villagers and encourages people to plant as many as possible in their gardens and farms; this year about 80,000 young trees will be given to Nusa Penida communities. The exceptionally long wet seasons of the past few years has helped with the greening of this arid island. With community support, FNPF has already planted about five kilometres of roadside trees to provide a food and shelter corridor for birds and other wildlife as they travel from place to place.

In October, Bayu received the prestigious 2012 Rainforest Award in San Francisco from the international conservation organization Rainforest Action Network (RAN) “As a Balinese NGO we have an inherent understanding of local communities, culture, spirituality, needs and challenges,” Bayu explains. “This gives us the ability to work closely with the local communities to design programs that benefit them, and the wildlife and habitats located around them.”

Some NGOs are particularly close to my heart and I’ve been following the Friends of the National Parks Foundation (FNPF) for a decade now. Founded by veterinarian Bayu Wirayudha, FNPF now has conservation/reforestation projects in Kalimantan and on Nusa Penida. It also runs the Bali Wildlife Rescue Centre which rescues, rehabilitates and releases native wildlife (which is most often displaced as a result of deforestation). Bayu dedicates himself to the twin causes of wildlife conservation and habitat protection and renewal. In the Indonesian context, habitat means forests. Although FNPF’s work is most visible through its conservation efforts on behalf of the orang utan and Bali Starling, establishing and protecting forests naturally creates habitat for entire ecosystems of insects, birds, mammals and reptiles. About eight years ago Bayu was searching for a sanctuary for the Bali Starlings he was breeding in captivity with another NGO. After two years of negotiations all 41 villages on the nearby island of Nusa Penida agreed to protect the birds under traditional law, and FNPF moved the birds there. Since then many birds have been successfully released from the FNPF centre, and now about 105 Bali Starlings are living and breeding freely on Nusa Penida and nearby Nusa Lembongan. Because the whole island has undertaken protection of the Bali Starling, not one bird has been poached by locals. Education programs in schools and communities help the people understand that a large, healthy population of Bali Starlings in the wild will attract international bird watchers and eco-tourists. FNFP is also using this informal bird sanctuary to release cockatoos, Mitchell’s lorikeets and Java sparrows. But Nusa Penida was almost completely deforested many years ago and lacks habitat for the growing bird population. FNPF was given 100 hectares of barren land by the government for a reforestation project. Although it was a long way from the release centre, Bayu and his team established a nursery at the centre and painstakingly planted about 20,000 trees on 32 hectares of the dry, windy hill top. All the soil had long since eroded away, leaving only limestone to work with. Planting here meant digging holes in the limestone bluff, hauling in compost to fill the holes, planting the trees at the beginning of the rainy season and mulching them, watering them through the first dry season and monitoring them every three months through the first three years of growth. Survival rate of the saplings even in these harsh conditions was over 70%. The new forest was about 150 cm high when

In Kalimantan, FNPF has been active in Tanjung Putung National Park since 2000, restoring the native forest and monitoring the existing forest. Over 50 hectares of a severely degraded slash-and-burn area has been reforested in Pesalat. In Benguruh, 125 hectares has been planted and another 50 hectares of very difficult wetland is now being reforested. The organization’s work in Kalimantan includes the rehabilitation and release of wildlife including orang utan, sea turtles, endangered birds and sun bears. As in Nusa Penida, FNPF runs community development and environmental education programs. In October, Bayu received the prestigious 2012 Rainforest Award in San Francisco from the international conservation organization Rainforest Action Network (RAN). The RAN judges were deeply impressed with Bayu’s work. The award recognized Bayu’s life long commitment to deep activism, species and forest conservation as well as groundbreaking community development projects. Bayu joins a rich history of previous awardees that includes Robert F. Kennedy Jr, Maria Gunnoe, Vandana Shiva and environmental activists from around the world. In 2007 the Bali Governor awarded Bayu as an Environment Pioneer.

with a system called Kantung Hijau, an elegantly simple solution which could revolutionize reforestation in Indonesia and beyond. After much experimentation, they developed a sturdy jute bag shaped like a pyramid about 22 centimetres high and across the base. The pyramid is filled with about two litres of compost and the seedling is planted in an opening at the top. A strong jute handle completes the design. Instead of digging holes, filling them with compost and planting and mulching each sapling, the jute bags can simply be carried into the area to be reforested and placed on the ground at the beginning of the rainy season. The generous quantity of compost contained in the bag is sufficient to give the young tree a good start, and can’t be washed away by the rain. The pyramid shape of the bag ensures that it is stable and can’t be blown over even in high winds. The sapling’s roots will grow right through the jute into the earth, and the bag will gradually decompose and become compost itself. Brilliant. So brilliant that Driya and Probo were awarded the Djaram Black Innovation Award 2012, selected from 900 contestants from across Indonesia. The fourth annual Bali Reforestation Festival takes place on December 2. Volunteers are invited to take part in planting 2,500 trees (some of which will be using the new Kantung Hijau system for the first time). Gather at Pura Jati, Toya Bungkah, Kintamani at 0730 and dedicate a few hours to making Bali’s environment a little bit more sustainable, one tree at a time. T Shirts and lunch boxes will be provided. Please contact bali.reff@gmail.com for more information.

If the dry, windswept hills of Nusa Penida are a challenge to reforest, imagine the difficulties of establishing a new forest in the lava fields of the Mount Batur volcanic crater in Kintamani. Probo Raharjo and his wife Driya Suwindrati are committed to doing just that.

Driya and Probo were awarded the Djaram Black Innovation Award 2012, selected from 900 contestants from across Indonesia Always interested in the environment, Probo studied forestry at university and later joined the Forestry Department. Proud as he was of his green uniform, he felt he could be achieving even more outside of government bureaucracy. So along with his day job, he helped create Yayasan Bali Hijau Lestari (YBHL) with partner Pak Putu Swedia and the Japanese NGO Asian Green Forest Network in 2007. The Yayasan’s goal is to promote environmental activities and education. Beginning in 2007 the Yayasan started an ambitious project to reforest part of the caldera of Gunung Batur in Kintamani. Like FNPF, his team had to laboriously dig holes in the lava field and carry in compost. Workers and volunteers planted trees at the beginning of each rainy season, tucking in each tender sapling with mulch and prayers. Over 40,000 saplings have been planted over the past five years and the survival rate is 50 – 60%, which is amazing in that arid moonscape. Although the results have been good, the young couple felt that there must be an easier and cheaper way to achieve their goal of planting new forests in difficult terrain. They came up

Ibu Kat’s book of stories Bali Daze - Freefall off the Tourist Trail is Available from : - Ganesha Books in Ubud and Seminyak - www.balidazethebook.com downloadable as a PDF file - Amazon downloadable for Kindle

E-mail: ibukatbali@gmail.com Copyright © 2012 Greenspeak You can read all past articles of Greenspeak at www.BaliAdvertiser.biz


Bali Advertiser

The Best kept Secret…...  Debtors Anonymous offers hope & support for:  x x x

Debtors Compulsive Spenders Under-Earners

For Sale; Used wheel chrome + tire R14 - R15 cheap. Call/text 081 7939 9777. Nusa Dua. [227] For Sale; Midori electric stove double burner made in German, Model HIC8003 still like new only Rp. 5 million (nego). Contact 089 8078 1887. [223]

Call : 0821-4757-4545 www.debtorsanonymous.org.au NC/NV/G-18 April 11

List your business here for free! Name

: Thumbs UP! Bali “motivating positive attitudes through activities” (PT Jempol Bali) Address : Umalas, Bali Type of Business : Surfing lessons for kids and family, surf contests and competitions, holiday camps, after school activities, teenage adventure Tel. : 087861928382 Notes : Thumbs Up! provides transportation to a variety of activities espe cially for the expat and local kids in Bali as well as the tourists. Allowing parents to get away and know that their children are having fun! Surfing, Martial arts, biking, parkour, skateboarding, pure adventure activities! Also our annual Adventure Race “Rock the Island”! Name Address Type of Business Tel. Notes

Local News

14 November - 28 November, 2012

: Cultural Connections Gallery : Beachwalk Mall,—main floor, Kuta, Bali : Gallery : 0361 8464940 : “Pop-up-gallery”—perhaps the most beautiful in all of Bali. Gem stones of Indonesia, cutting edge jewels by Irwan, Antiques and Trib al Art, Textiles from Dharma Mulia Galleries (world’s largest gallery of Indonesian Antiques), Batik, Fashion by Ghea et al, Paintings from Tonyraka Gallery, Interiors and lighting by Piment Rouge and much more. 324 sq.meters—“A Plethora of Fabulosity”. Mon-Sat 10 am – 9 pm thru Dec. 15, 2012.

Send your information to info@baliadvertiser.biz for free listing in this column. One time listing per business.

For Sale; LG fridge 2 doors model GN-B562YLC, 460Lt, 1 year old, perfect condition, bought Rp. 5 juta, sell for Rp. 3 juta. Call 081 2380 1989. [234] For Sale; A few pot of curry plants, also Buni (Balinese berry) very good for making jam it has fruits already. Please contact <massabi@ gmail.com> or 0818 0568 1953. Sanur. [215] For Sale; MacBook black laptop. Processor: Intel Core 2 Duo. Processor speed: 2. 16GHz, hard drive 500Gb, 13. 3”. Operating system: Mac OSx10. 7, Lion weight: 5 lb. Primary drive: DVD+/RW/CD-RW. Rp. 4.5 million. Email: <consulti.ching@ hotmail.com>. Ubud. [216] For Sale; (2) New extra kingsize Kingkoil mattresses, size 200x200cm, chiropractor endorsed, just bought Rp.12 million each but they don’t fit in my rental! Sell for Rp. 8 million each Rp. 15 million for both. Each mattress includes protector, 2 new extra kingsize pillows and 2 new extra king-size bolster pillows. Have new mattresses and renters coming soon-first come, first serve! <asianbuyer@yahoo.com> or 0812 4651 4976. [217]

69

ART & ARTISTS Limited Time Exhibitions Cinta Bali: The Spirit of Oneness Artist : Ra’zsal Genre : Paintings Period : October 1 until November 16, 2012 Every day, 10.00 a.m. until 11.00 p.m. Location : Café Des Artistes, Jl. Bisma No. 9X, Ubud Tel: 972706 Please e-mail Bali Advertiser to place your exhibition here free of charge. Bali Advertiser reserves the right to publish or not publish submissions.

HELLO ADS People Meeting People All ads Rp. 7.000 per word. All ads must be paid before printing. Bali Advertiser reserves the right to edit all ads.

Investor Needed for Health Project <peterreijnen2@gmail.com>. [001]

Contact BALI ADVERTISER Jl. Majapahit No. 46 Kuta - Bali Telp: (0361) 755 392 [Hunting] Fax: (0361) 764 191 E-mail: info@BaliAdvertiser.biz

If you conduct yourself as though you expect to be successful and happy, you will seldom be disappointed.

Nom de plume Occasional Articles From Our Readers

Garden Tour from Oz by Richard Creswick gardener, writer and architect, Made Wijaya -- an expatriate Australian also known as Michael White. From a base at the Bali Hyatt, one of the first gardens Wijaya was involved in, the group toured gardens around Sanur including Widjaya’s own beautiful Villa Bebek where Widjaya declaimed in his customary style, answered questions and hosted lunch for the visitors. A visit to Bedugul took in the tranquil gardens of Taman Ayung at Mengwi, the flower and produce markets, lunch at a strawberry farm and then the Bedugul Botanic Gardens where the group was accommodated at the colonial-style VIP guest house. A group of twenty garden-lovers from Australia has spent a week in Bali looking at some of the region’s most attractive gardens. The Bali Garden Tour was organised by Sue Dibbs who is Northern Territory Co-ordinator of Open Gardens Australia and as such organises an annual programme of open gardens which runs on week-ends from May to September. Last year Sue followed her programme of Open Gardens with the inaugural Bali Garden Tour and has followed it up this year with two week-long tours, the first of which ended on Sunday (October 21st).

The final three nights were spent at Made Wijaya’s Taman Bebek Villas at Ubud providing a base for visits to a number of local garden highlights one of which was Puri Ageng Blahbatuh, a royal palace where the group enjoyed a private dinner and a selection of traditional dances hosted by the royal family who also attended.

DEADLINE Details For Bali Advertiser Wednesday 12:00  Color ads  Free ads  Contract ad changes  Half page and full page ads

Friday 12:00  Black and White ads  Employment, Real Estate, Hello & Private

Sue’s tours provide a relaxed but interesting programme of visits and activities with enough leisure time for individual explorations.

Most of the garden lovers on this year’s first tour were from Darwin but the sixteen people on the second tour now taking place are from southern parts of Australia.

This time around Sue had the assistance of Luciana Ferrero a professional photographer, Italian expatiate and veteran of thirty-four years living in Indonesia, the past six in Bali. Luciana’s linguistic skills and local knowledge helped pilot the group through many interesting experiences.

The program of garden visits enjoyed by participants included several designed and produced by the famed

Photograph, members of the Bali Garden Tour Group at the entrance to Puri Ageng Blahbatuh Palace.

Classified line ads

Final ad design approval from the customer at 2:00 pm Friday.


BA Feature

Article

She Danced For The President Veteran Balinese dance master, Jero Puspawati By Jennifer Juno

A Balinese Legong dancer is still teaching the art of dance to students at the age of 88 years old. Jero Puspawati, who has danced since she was 10 years old, was the darling dancer of Indonesia’s first president, Sukarno. Ni Jero Made Puspawati was once the ‘dance queen’ of the Balinese stage. For more than 50 years, Jero Puspawati has displayed her outstanding dancing skills, which were incomparable in her time. Ni Made Rupawati was b o r n i n Te g e h K u r i , Kesiman in 1933 and came from a long bloodline of respected Balinese dancers. As a child she loved dancing to traditional gamelan music with flowers placed elegantly in her hair. And by the age of 14 she was selling coffee in the village for 100 rupiah per cup. Due to her outstanding beauty, many men paid much more for coffee, including her husband, (the late) Tjokorda Sayoga. According to Jero, he knew exactly where to find all the beautiful girls in Bali and in 1950 she was married into a high caste family. The journey had already began however, in 1945, when at the age of 15, Puspawati performed for President Sukarno who had seen her mother perform at the State Palace many years before. A talented dancer, Puspawati reached popularity quickly and gained experience when she participated in activities with the Balinese art group Cri Buddhaya Bali, which was led by her husband. In Surabaya Jero Puspa danced with other famous female Balinese dancers such as Ni Rneng and Ni Cawan and mask dancer Pugra. Puspawati has proudly represented Indonesia in a number of countries overseas. She currently teaches dance at Tanjung Sari Hotel Sanur, lecturers the Jaba Temple Dance and is the ‘lecturer extraordinary’ at the Akademi Seni Tari Indonesia ASTI, Denpasar. DANCE IN BALI In Bali, there are various categories of dance, including epic performances such as the omnipresent Mahabharata and Ramayana. Certain c e r e m o n i e s performed at village temples feature a special dance-drama performance depicting a battle between the mythical characters Rangda, a witch representing evil, and Barong, the lion or dragon, representing good. Balinese dancers learn the craft from their mothers as soon as they are born. In the womb they are played Balinese music and small children are taught to dance with their hands before they can walk. Official training as a Balinese dancer starts as young as seven. Multiple levels of articulations in the face, eyes, hands, arms, hips, and feet are coordinated to reflect layers of percussive sounds from the ‘gamelan gong’ musicians. HUMBLE BEGINNINGS Puspawati grew up in a village within Denpasar. One of five children, her mother, grandmother and grandfather were all Janger and Arja dancers. In that time becoming a successful Janger dancer was the dream of every youth. She started her dance practice at 10 years old and it took seven years to learn the moves. At the age of 17, she could perform her first dance with the basic knowledge in place. When she was a teenager Puspawati did not go to school and was illiterate as in her budding professional career. Luckily, a group of educated adults took pity on her and the other female dancers and taught them how to read and write. An outstanding dancer and teacher, Jero has performed around the world to promote Balinese culture on the International Dance Stage. The countries she visited during her hey day include Pakistan and Sri Lanka while touring with the Balinese arts group Cri Buddhaya Bali. The first tour of Balinese dancers was to India,

Sri Lanka and Singapore during 1952. It took three weeks and was led by Mr. Sugriwa as far as Jakarta. When they arrived in Jakarta, the dance group joined other regional dancers from Sumatra, Solo and Jogja and they all went abroad as Indonesian art delegations to spread the nations culture far and wide. Still in her teenage years, the young Puspawati also performed in the Netherlands, other European countries and throughout Japan.

LIVING LEGENDS OF BALI In 2005 Jero Puspawati was one of many veteran dancers who staged performances on Saraswati Day, including Ni Made Anis, 79, from Singaraja, and Ni Gusti Ayu Raka Rasmi, from Peliatan, Ubud. Artistic Directors of the Top Group Gamelan and Dancers in Bali took the bold initiative of inviting many of Bali’s elder aristocrats of dance and gamelan to participate in a three-day workshop with young dancers and musicians of the Puri Agung, Piliatan Ubud. The workshop reasserted the age-old mentorship between guru and student and rekindled an interest in the power and purity of classical Balinese dance. The festival featured 15,000 Balinese artists, grouped in 334 sekaa (traditional art groups). The dance drama performed by local art students at the Open Stage Ardha Candra told the story of Rama, the King of Ayodya, which is an episode of the Ramayana Hindu epic. Dance master Jero Made Puspawati emerged on the stage looking elegant and beautiful in her old age. She performed Candra Metu, The Appearance of The Moon, which symbolizes the beauty of a maiden comparable to the stunning image of a full moon. I Nyoman Kaler first choreographed the dance in l942 and it is still very popular today. Puspawati still displays the grace and beauty of her youth as she approaches 88 years old. On hearing the sounds of the gamelan, her body still sways with exceptional grace and her eyes lash like twinkling stars. Watching her perform is like seeing the queen of the dance from the glorious past. As she greeted me in her home, she wore dark glasses, a pink kabaya with flowers in hair. Energetic and full of Taksu the spiritual charm, which is an important requirement for a Balinese dance master. How could I resist interviewing a lady who recently received the Dharma Kusuma Cultural Award for legendary Balinese artists? Why was the Dharma Kusuma awarded to you? Apparently the government award the public to remember our business efforts and to preserve the art of dance, especially the Legong dance. Legong is a refined form of Balinese dance, characterized by difficult finger movements, complicated footwork, and expressive gestures and facial expressions. How did you pursue the art of dance? I loved playing as a child, making motions such as dancing. I would copy the movement of other dancers, who I had been lucky enough to see perform. No matter what show I watched, the next day I would be able to imitate it. Did your parents teach you dancing? No, I actually was taught to dance by I Wayan Rendi of the Banjar Bees, Sumerta, and Denpasar. Every day he came on his bicycle to train me. After the age of about nine years, I learned to dance

in the hall and I practiced almost every day and my dance teacher stayed in the village. At first I was trained in the basic movements of dance. For example, I learned Nyeledet for a month and then learned the twist fan for another six months. Nyeledet Pong gives empowerment to the dancer while dancing. Can you remember the first time you travelled overseas? Yes very much it’s my hobby! In 1950 the aircraft waggled so hard it resembled a bemo (rickshaw). I remember not liking Indian food and eating Chinese instead. What was the most popular dance of your youth? Obviously, the foreign audience think that all of Balinese dances are fabulous, even Janger and Kupu-kupu Tarum have always received much applause. In the 1960s nearly every village and every school in Bali had its own janger group. In that time becoming a successful janger dancer was the dream of every youth. They hummed the janger song all day long, accompanying all their activities. How did people respond to Balinese dance years ago? Dance was greatly appreciated. If there is a stage, the guests watched quietly and were polite. They focused carefully on the show. Even though some of the dance performances are long, they always felt satisfied afterwards to see Balinese dance live. Not like now, watching a dance performance while people are eating. Were you paid a wage? At the dance, I never thought of reward or money. If you are invited to the stage the heart is happy and you don’t care about how to make money. How do you learn the facial expressions used in Balinese dance? As a dancer you are taught to smile with your eyes. Also we need to look sad, or be angry and display ‘bulging eyes’. At the beginning, with soft gamelan music we usually smile, and when the music gets louder the eyes bulge. We do not look at the audience directly, but we look to the sidelines with ears guided by the music. It often appears we are teasing the audience with a smile and a glance of the eye. Does your son AA Puspayoga dance? My son who was the Mayor of Denpasar loves to dance with my grandson. What do you think of the rise in tourist numbers to Bali? It’s good news for me because I get to teach more students, which is my joy. How do Balinese children learn to dance these days? When I was younger the children were told by their parents to participate in the training hall, and children dare not refuse. These days, modern students learn faster by regularly seeing the show appear on Television, DVD or in other media. How many students have you taught? Thousands! I have at least 50 students coming from Japan. They do remember me, but unfortunately I do not remember them because of my age.

You are welcome to contact Ibu Jeru Puspawati through her agent Pak Agus on 0819 657 5567 for the latest details of her performance schedule.

Copyright © 2012 Bali Advertiser You can read all past articles of BA Feature Article at www.BaliAdvertiser.biz


Bali Advertiser

Local News

14 November - 28 November, 2012

71

Bali Advertiser Nov 14 - Wed

New Edition of Bali Advertiser

Nov 15 - Thu

Muslim Day. Bali Advertiser CLOSED

Bali Advertiser Color Ad Deadline at 12:00

Bali Advertiser Advertising Deadline at 12:00

New Edition of Bali Advertiser

Bali Advertiser Color Ad Deadline at 12:00

Bali Advertiser Advertising Deadline at 12:00

New Edition of Bali Advertiser

Nov 16 - Fri Nov 17 - Sat Nov 18 - Sun Nov 19 - Mon Nov 20 - Tue Nov 21 - Wed Nov 22 - Thu Nov 23 - Fri Nov 24 - Sat Nov 25 - Sun Nov 26 - Mon Nov 27 - Tue Nov 28 - Wed Nov 29 - Thu Nov 30 - Fri Dec 01 - Sat Dec 02 - Sun Dec 03 - Mon Dec 04 - Tue Dec 05 - Wed Space for this ad donated by Bali Advertiser

Dec 06 - Thu Dec 07 - Fri Dec 08 - Sat Dec 09 - Sun Dec 10 - Mon Dec 11 - Tue Dec 12 - Wed Dec 13 - Thu Dec 14 - Fri

NC/NV/U-14 Nov. 12

Space for this ad donated by Bali Advertiser

Space for this ad donated by Bali Advertiser NC/NV/U-31 Oct. 12

NC/NV/U-14 Nov. 12


Employment Place your ad online at www.BaliAdvertiser.biz

VILLA MANAGER WANTED

LOOKING FOR STAFF (Cari Tenaga)

A luxury Villa in Tabanan needs an Experienced English speaking Villa Manager. The applicant must have at least 15 years experience in hospitality with managerial experience. Honest, loyal with strong leadership character. Good remuneration. Please send Detailed Resume with color photograph by email : pa@ketapangvilla.com Only selected applicant will be contacted NC/Es/17 Oct 12

IS LOOKING FOR :

Looking for Electricity Technician, STM / Diploma Graduated, Send CV to email <info@alamrayabali. com>. [556] Looking for art gallery Manager in Seminyak, great selling skills and English. Good salary + commission. Send CV <contact@ thegallerybali.com>. [380]

SALES MANAGER •

International clothing company is looking for its domestic sales manager. • Fluent English, solid experience in similar position, computer literate Excel, managerial and leadership skills. • Must be dynamic, target oriented and able to manage a team of SPG-SPB. • Good package for the right candidate. CV TO : bali.69slam@yahoo.com NC/Es/31 Oct 12

REQUIRED

PROPERTY SALES • • • •

Strong track record in sales Familiar with various areas in Bali & can drive Excellent written & spoken English Result driven, high integrity, and team player with strong interpersonal skill Please send resume to hrd@interasiadev.com NC/Es/14 Nov 12

YOUR BEST CHOICE FOR HOSPITALITY RECRUITMENT AND EXECUTIVE SEARCH

POSITIONS AVAILABLE: Operational Manager (Expat/Local) - Lombok Director of Food & Beverage (Expat) - Jakarta Assistant Restaurant Manager - Ubud Villa Chef - Seminyak Director of Sales - Seminyak Revenue Manager – Seminyak Sales Manager Reactive - Seminyak Sales Manager (Mice) - Nusa Dua Security Manager - Kuta

Villa Supervisor - Seminyak Director of Restaurant & Bar Operations (Expat/Local) - Jimbaran Executive Chef (Expat) - Seminyak Director of Business & Development ((Expat/Local) - Seminyak Director of Sales - Nusa Dua Sales Manager Proactive - Seminyak Sales Manager - Jimbaran Catering Sales Manager – Kuta Director of Human Resources - Batam

Our service is completely free of charge for candidates Please send your CV to jobs@globalexpatrecruiting.com For more jobs, please visit www.globalexpatrecruiting.com Jalan Dewi Sri, Blok C, Nr 3 • Kuta, Bali, Indonesia • Tel / Fax: +62/361.763.324

Positions Vacant: d’Omah Hotel Penestanan Ubud seeking House Keeping, Front Office staff, please drop your current CV to the Hotel. Telephone 976622 for enquiries. Immediate start if right candidate. [402] Butler, honest, must speak English, drive car, housing available. Send CV. <resortposition@gmail. com>. [403] Looking for a part time French Language and Maths teacher/tutor for 11 year old boy in Sanur area. <nick_ kosanovic@msn.com>. [404] Seeking Real Estate Sales, female age up to 32 year old fluent English speaking (Indonesian citizen only), work location Sanur. Candidates do not require experience. Send CV to <info@goodproperty-bali. com>. [405] Food Supplier Hotel Restaurant in Jimbaran need Balinese Salesgirl, fluent English. CV email to: <mareta_bayulestari@ yahoo.com>. [414] Looking for Exp. Promotion/ Floor Manager for Bar in Kuta. Send your CV to email <mainlobar@yahoo. co.id>. [415]

C/Es/G-14 Nov. 12

BALI LUXURY VILLAS The fastest growing Villa Management and Villa Rental companies is inviting applicants for the position of:

CONCIERGE / RESERVATION With qualification: Fluent in English with great communication skills, Background & exp. as Reservations, Concierge, GRO in Villa Rental, Energetic, Service-Oriented, Pro-active & Outgoing personality, Good knowledge of Bali & its tourist activities, Ability to negotiate contracts with vendors & organize guest activities, Proficient in Microsoft Word, Excel and Outlook, Own transport. CV sent to: hrm@baliluxuryvillas.com NC/Es/14 Nov 12

Looking for Girl from 25 years up. Shop Boutique Furniture. Good English, Pintar Jualan. Contact 0818 0569 6658 or 0818 0559 2875. [416] Looking for Marketing Assistant, fluent English with excellent secretary skills, working with foreigners. Plese send your CV in English to 847 6120. [417] Wanted Administration Staff. Need English or Japanese speaker, Can use PC, Can drive car and motorcycles, Indonesian, Age 20y till 35y, Property agent in Sanur. Send CV at <postmaster@ goodproperty-bali.com> or call 747-5909. [428]

BaliPlus Guide Book looking for Sales Executive, D3/S1 background, good communication in English oral and written, self motivated and money oriented with pleasant personality, computer literate. We offer a good salary + commission. Please send CV to <padirector@ trijayadewata.com>. [418] Fast Growing Events Company seeks Accounting, Marketing, PR (Public Relations) , Graphic Design, Personal Assistant, Freelance Bar, Freelance Waiter / Waitress, Face Painters and Kids entertainers. Email : <onestopeventsbali@ gmail.com>. Ph : (0361) 730616. [419] Fulltime/ Part-time Positions Vacant. New International Christian School (ACE Curriculum). Minimum requirements: Teacher; S1 Degree, Teacher’s Assistant; D3 Diploma or mature person. Must have fluent written, spoken English. Applications: <adjisarah@ gmail.com>. [420]

IS LOOKING FOR :

SALES MANAGER •

International clothing company is looking for its domestic sales manager. • Indonesian citizen, fluent english, solid experience in similar position, computer literate Excel, managerial and leadership skills. • Must be dynamic, target oriented and able to manage a team of SPG-SPB. • Good package for the right candidate. CV TO : bali.69slam@yahoo.com NC/Es/31 Oct 12

Karma Royal Group is currently experiencing rapid expansion and urgently requires:

MALE Indonesian In House Executive If you are an Indonesian who speaks fluent English and are interested in earning a potentially high income, working in a positive environment, please forward your CV to:ekayanti@royalperspective.com NC/Es/14 Nov 12

Urgently needed: Susila Jewelry - Fashion Accessories Production is looking for Designer. Ideal candidate should be experienced in fashion accessories with below requirements : • Very good/talented at hand drawing as basic; • Experienced for 4 – 5 years in drawing; • Self sustainable in development of creativity and ideas; • Ability to work with many kind of materials and colors; • Available to work inside office min 2x per week. If you feel you can meet above requirements, please send your CV and portfolio (sample of drawing) to: nisak@susila-jewelry.com or contact directly to 08113883253 (Attn Nisak) NC/Es/14 Nov 12

New luxury villa resort in East Bali is looking for:

Looking for Reservationist, Receptionist. Speak English, written and spoken, with good computer skill. We are on the Bukit Pecatu. Starting at 3million Rp per month. Contact : <jbataillardbali@ gmail.com>. [421] Villas - Hotel Canggu is looking for: 1-Villas Manager/ Supervisor, 1-Driver (Automatic!), 1-Cook Woman and Housekeepings (women). All must speak English. Sent your CV: <villacanggu@yahoo.com>. Thanks. [422] Fast growing travel agency looking for Product and Marketing, familiar with Excel, Word and Power Point. Must speak French and English. General accounting and private driver. Email : <ehersandy@ yahoo.com>. [423]

1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. • • •

Sales Manager Operation Manager Restaurant & Bar manager Spa Manager Butlers/Front Office Staff Chefs and Cooks Waitresses/Waiters Bartenders Engineers Accountants/cashiers Management Assistant Housekeeping Staff Pastry

Fluent or adequate English required (French, Japanese, Korean, Russian skills considered as plus) Managerial positions should have minimum 2 years experience in the same field Open minded and motivated personality required, and ability to work in functional teams (new type of organization) Please send your Application letter and CV by email to: info@thegriya.com NC/Es/14 Nov 12

Jazz Cafe Ubud. Looking for Floor Manager, Waiters, Bartenders, all with very good spoken English and experiences. Email to: <ias@jazzcafebali. com>. [425]

The best selection of candidates for all positions and all levels. All candidates are pre-selected to simplify your choice, saving your time

Dancing Girls Wanted for new bar opening up in Kuta. Email photos to <nitros1@ live.com>. [426]

VISAS AND PERMITS Business / Social - Entry and Exit KITAS - Work Permits Company Formation PMA - PT - CV - Local For additional jobs and information visit: www.concordservices-bali.com CVs welcome for all positions No fee to applicants - completely confidential mail@concordservices-bali.com

Looking for female Sales Marketing, Fluent English, good presentation. Email <mataphoto@gmail. com>. [427]

POSITIONS AVAILABLE: Accounting Mgrs Product Manager Director of Sales Restaurant GM Chief Accountants Secretary / PA Office Manager Area Manager S & M Manager HRD Manager

Tel. 769073 Istana Kuta Galeria PM1 No. 18 C/Es/14 Nov 12


Bali Advertiser

LOOKING FOR STAFF

CAREER WITH US Chief Engineering Human Resources Manager Chef De Party FB Service Supervisor Bar Captain Architect MEP Drafter Secretary Operational PA S1 Female Accounting

English Speaking Security Administration Engineering Bartender PR Server Pastry Bakery Cook Soundman IT Store Keeper

(Cari Tenaga)

Admin Position. We are seeking a woman maximum age 25. Must know Excel, speak English. Email CV <admin@globalindofactory. com>. [429]

Email to : FBkutalegian@gmail.com NC/Es/14 Nov 12

Karma Royal Group is currently experiencing rapid expansion and urgently requires:

OWNER RELATIONS OFFICERS: 2 POSITIONS If you are an Indonesian who speaks fluent English and have excellent English both spoken & written and have the ability to hold meetings with Indonesians & English Speaking Foreigners, please apply as FULL TRAINING will be given. Potential to earn HIGH INCOME. Please forward your CV to pcrowe@royalperspective.com NC/Es/14 Nov 12

Bali Krisna Service

Since 1999 Bali Krisna Service CV, has been the number one and most trusted domestic employee agency in Bali, specialising in housemaids, babysitters and nannies. We can provide domestic placement for • Babysitters • Housekeeping • Gardeners • Cooks • Cleaners • Security • And more English and Indonesian speaking, permanent or temporary, live in and out are available.

PRIVATE ENGLISH LESSON

w w w. b a l i k r i s n a s e r v i c e . c o m Tel: (0361) 744 6932, 264738 Hp. 081 2365 4977 ~ 9am - 5pm C/Es/I-16 May 12

BALI EMPLOYMENT & NANNY SERVICE PHONE 0361 8839741 / 081353149586 www.balinanny.net

We Provide: Housekeeper, Housemaid Babysitter/Nanny freelance & permanent Driver, Security, Gardener, Pool Cleaner Office Staff, Waitress, Cook, etc. English/Indonesia speaking, live in & out, female & male. Good Service With Guarantee C/Es/25 Jan 12

AquaMarine Diving - Bali Seminyak Three office vacancies for Indonesian citizens: Excellent English language skills (spoken and written) Superb organisational / administration skills Excellent keyboard skills (Microsoft Office Suite) Detail-oriented, hard working Able to work independently; pro-active with “can do” attitude Comfortable with dogs

Dive Travel Consultant (Bali & Indonesia) Immediate

E-mails, computer work, creating itineraries, business generation. Prior experience in Travel or related field an advantage.

Operations Manager / Supervisor (Office) ASAP All aspects of office and centre management, stock control, scheduling within a busy dive company. Office Assistant Immediate

Data entry, stock control, inventory.

B2B Telemarketer Native Speaker, strong business acumen. CV <career@ carbonenergy.net.au>. [432] Looking for Executive Secretary with fluent English to coordinate trading and interior projects and keep updates with head office in Jakarta. Accounting knowledge required. Send Complete CV to <Fernando@natko-pacific. com>. [433] Driver / maintenance needed, punya SIM, bisa mobil matic besar. Merangkap kerja villa segera 730785 Umalas. Reference essential. [435] Bali Discovery Tours offers challenging careers for Divisions of Hotel Link Solutions, Product, Operation, MICE etc. Detail at <http://www. balidiscovery.com/careers/ default.asp>. [436] Looking for Web Designer, ready to work with the team and have high artistic soul also Master Programing <info@jagatbali.com>. [437] Growing silver jewelry company in Bali is looking for CS, SPG, PPIC, Inventory Control, and QC. Candidates should have English ability, independent, high motivated person, initiative, hard working, punctual and prefer have similar experience to the field required. Interested candidates to send CV with Recent Photograph and expected salary to <omraphaelhj@gmail. com>. [438] Need Hearing Impaired Therapist Bali Ph. 0853 3749 3620. [453]

Fax CV to 0361 - 4738 021 or E-mail Applications@AquaMarineDiving.com State expected salary and available start date ~~~ Must be available for interview in Bali ~~~ NC/Es/14 Nov 12

WANT TO WORK OVERSEAS ? We are currently seeking local/expatriate FEMALE staff for the following positions in a Luxury Women’s Only Health Club and Spa: • • • • • • • • • • • • • •

Employment

14 November - 28 November, 2012

PERSONAL TRAINERS HEALTH & FITNESS MANAGER CLASS CO-RDINATOR SWIMMING INSTRUCTORS PILATES INSTRUCTORS BALLET TEACHERS YOGA TACHERS TAEKWONDO INSTRUCTORS KARATE INSTRUCTORS TENNIS INSTRUCTORS SPA THERAPISTS BEAUTY THERAPISTS MANICURISTS / PEDICURISTS HAIRDRESSERS

Factory Manager for wooden knock-down (prefab) house factory wanted. Experience in construction, contracting, and management. Skills in leadership, budgeting, cost estimates, efficiency and English. Contact <BruceD@ maui.net>. [439] Seek Senior Accounting & GM Expat, Accounting & Production exp. + bahasa. Send to <jobs@blue-glue. com>. [440]

Located in MIDDLE EAST. Position is for a minimum ONE YEAR contract (can be extended, if desired) and includes Accommodation & Living Costs, Transport, Return Airfare, Working Visa and Medical Insurance. THERE IS NO COST TO YOU FOR THIS APPLICATION Please email your cover letter and CV to: jobs@recruitment-vibe.com NC/Es/14 Nov 12

Looking for western F&B manager or chef with at least 4 years experience to manage 2 small hotel restaurants. Kitas will be provided. Pls send CV to <office@thegreenroombali. com>. [441]

Spa Receptionist for Day Spa, Must speak English and have therapist background, Salary according to qualification. Tel 081 805 477 250. [442] Looking for Bali Wedding Consultant. Require Australian. Wedding experience essential. Good working conditions. Kitas provided. Office based in Legian. Only serious applicants need apply. Please email photo and resume to <baliweddingconsultant@ hotmail.com>. [443] Nanny wanted, Sanur 0813 3727 6061. [445]

73

Looking for Sales Promotion Girl, Good English, Computer skills, Reliable. Send CV : <ssshowroom@ hotmail.com>. [462]

Looking for host. Bar in Petitenget. Fri-Sat, 9pm2am. Good looking, speaks English. 2mill/mth. +62 812 8233 0411. [460]

Looking for 1. Accounting Manager & Female staffs for 2. Sales Executive & 3.Reservation; Experienced with MYOB with proven track record, min 5 years experience in travel related business (1); fluent in English oral & written, good computer skills, proactive & strong work ethic, Hospitality background in 1 years in the same position (2,3). Send CV to <recruitment@ bluewater-express. com>. [459]

New resort on Gili Air is looking for dynamic restaurant manager, Indonesian or western-good package for right person. Please send CV to <info@ waterfront-hotel-gili-air. com>. [461] Growing Kids Fashion label seeking new member: Production assistant - junior position, 2yr exp garment QC, data entry, High salary offerred. CV email to <info@ dandelionkid.com>. [458]

Receptionist female - required for medical center - good English, good presentation, experience required. Email CV to <tj3456@gmail.com>. [447] Looking for Assistant Marketing Manager. Good English, efficient, female. Send resume to <info@ villamarketeers.com>. [448] Opening for PA. Good English, efficient, female preferred. Send resume to <stayingbali@gmail. com>. [449] Private Villa looking Supervisor, Experience, English, Drive, Understand villa facilities. Send CV <villasemerputih@yahoo. com>. [450] Wedding Decorator in Denpasar urgently seeks: Wedding and Event Sales Assistant and Florist. Good salary for best candidates. Email CV to: <redgardenia. bali@gmail.com>. [451]

C/ES/I-16 May 12

K U T A

S Q U A R E

Invites you to join us as:

STORE SUPERVISOR & SPG(B) Must have relevant experience in retail sector, Possess spoken & written English is a must, Japanese is a plus, Computer literate & Well-groomed.

Billabong, Kuta Square, Blok A 8/9 Or email us to: kutasquare@billabongstoreasia.com NC/Es/14 Nov 12

Sales and Marketing Our company, specialized in furniture business, looking for an Indonesian man/woman who has experience in sales and marketing for local market in Bali. • Fluent in English. • Have knowledge in furniture. Please send us your CV to : admin.bali@yuni-furniture.com

Looking for energetic and motivated Female Assistant for art related company. <julio_1964@hotmail. com>. [452] Full Time English Speaking Professional Driver/ Gardener wanted. 5 days per week: Monday - Friday. Driving RT between Batuan and Sanur. Daily garden/ pool maintenance. Contact: <swalentukfoster@gmail. com> or call 0878 628 21363 from 3:00pm - 5:00pm. [454] Required a shop manager / interior designer. Please send CV. to <lisadewi@ hotmail.com>. [457] Urgently needed drafter for int’l wood/interior company. Send CV to 847 2105 or email: <vacancydrafter@ yahoo.co.id>. [455] Looking for experienced full-time Pembantu who can speak English, cook, clean and work flexible hours for a busy family in Umalas. Please contact me on 081 3377 12745. [456]

NC/Es/14 Nov 12

NC/Es/14 Nov 12

Avilla Hospitality, the growing hospitality management company is now inviting passionate, good character & qualified candidates to join our FUNtastic team for the following positions:

1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14.

GM’s Chief Accountant’s Corporate Sales Manager Sales Manager Corporate E-Commerce Manager Corporate Digital Marketing Design Graphic Assistant Corporate Finance Secretary Finance Controller Corporate Finance Controller Corporate Revenue Manager Sales Executives Personel Manager

Mention clearly on the e mail “subject” position required Please send your application to hrd@avilla.co.id

NC/Es/14 Nov 12


74

Employment

Bali Advertiser

14 November - 28 November, 2012

La Lucciola Restaurant in Seminyak is looking for: Restaurant Manager / Asst. Restaurant Manager Between 30 – 38 y.o with leadership qualities. Experience in quality Restaurants or Hotel Excellent English, energetic, motivated, charming healthcare and full benefits. Please send CV to: humanresources@lalucciolabali.com or Fax to 0361 730839

BukitVista, Villas and U

villa management, events and eats Our new Jimbaran-based company is looking for motivated individuals who have a positive work attitude, creative minds and the energy to put ideas into practice. Admin: Accountant, Personal Assistant, Event Organizer Tech: Social Media Manager, Webmaster, Graphic Designer, Video operators, Photographers Food and Beverage: Restaurant Manager, Sous Chef, Waiters/esses, Real Estate: Villa managers, Real estate agents Phone: 087861519680 Email: uolo@bukitvista.com or bukitvista@gmail.com FB: www.fb.com/BukitVista NC/Es/14 Nov 12

Looking for a job in Bali Managerial level or above in Office Operational, Hospitality, Sales & Marketing. 20 years experience in the field. Female, attractive and easygoing. Computer and English literate. Contact e-mail: dolora71@yahoo.com NC/Es/14 Nov 12

Bali Animal Welfare Association (BAWA) is seeking an experienced PROGRAM MANAGER (Indonesian Nationals only). Location in Ubud, Bali. The successful applicant will have management experience and a wide range of skills relating to the management of staff and program development. Previous NGO management exp a plus. Requirements • 5 years (NGO/INGO) work experience in program and staff management • Relevant education background with a minimum of a Bachelors Degree • Strong managerial experience leading the development of programs within Bali • Excellent organizational skills including the ability to prioritize, work independently, while meeting conflicting deadlines. • Ability to communicate effectively in English and Bahasa Indonesia, both verbally and in writing with staff, local and foreign expats and government officials • Proficient command of Microsoft Office applications • Excellent interpersonal skills and a team player

Silver Maiden International need a professional

SALES MANAGER To manage it’s regional sales for international acclaimed jewelry designer Janice Girardi. Working out of the headquarters in Ubud but travel throughout Bali, and some regional travel. Ideal candidate will speak both English and Bahasa with some previous sales experience, and experience in fashion jewelry/ gemstones a plus. Excellent career opportunity for the right person. To Apply: Email cover letter, salary history and CV to : info@bawabali.com

LOOKING FOR WORK (Cari Kerja)

Expat seeking employment as Project Manager / Supervisor or can build for you. 081 2362 9939. <balicontractor@dps. centrin.net.id>. [050] Looking for job, English graduated, tourism background, experience in teaching and travel industry, speak fluent English. Email: <ngurah_prasara@ymail. com>. 0819 9988 2647. [555] Expat, high university level, fluent English, Indonesian, French, Spanish, very good computer skills including webdesign, organized, reliable, would consider any position with responsibilities. 0878 8803 1829 <cyrillepeters@gmail. com>. [430] Kids Tutoring & home schooling for kinder to grade 7, call 0852 3429 2211. [396] Freelance accountant and tax consultant (0878 6002 2239). [466] Looking for job. Experienced in Supervisor sales counter. Bahasa only. Please call 0818 0546 1133. [406]

Experienced GM, very focussed on achieving strategic objectives, admn operations, human resources, guest relations, F&B, overall brand growth, ensuring return on investment to owners, is looking for a placement as General Manager in Hotels or reputed villa properties. For my CV please call +62 858 1129 1917 / <snainpal@ yahoo.com>. [407] Experienced Solo Guitarist Vocalist available for Gigs/ Wedding/ Restaurant. 0821 4483 3668. [408] Physiotherapist, German license. Phone 0812 3636 9241. [467] Brilliant Graphic Designer. Rei 0815 5818 1750. [431] Very experienced hotel GM with emphasis on boutique properties, very strong in marketing both locally and internationally, very good in finance, F & B and overall operation. A real team leader and good in people skills, have a lot of pre opening experience, seeking a position as consultant, technical advisor or development in Bali. For my CV please contact 081 2384 2473, <philhill@indo. net.id>. [346]

EMPLOYMENT SECTION ADVERTISING INFORMATION 1. Place your ad at www.BaliAdvertiser.biz for the quickest service. 2. You may also email, fax or post your ad into our office and we will email, fax or telephone you with the price. You may also visit our office to place your ad. 3. Ads looking for work are charged at Rp. 7.000 per word. 4. Ads looking for employees are charged at Rp. 11.000 per word 5. Ads for business services are charged at Rp.11.000 per word 6. All ads must be paid before printing. All payments must be made at our office or by money transfer to our bank.

Only shortlisted candidates will be contacted.

Office Assistant, young and energetic needed for busy restaurant. Good grooming and communication skills for guest contact. Excellent written and spoken English, Excel, Word, administrative and telephone answering skills required. Full benefits including Surya Husada health care. Please send CV to: humanresources@lalucciolabali.com or call 0361 730 838

NC/Es/14 Nov 12

PT. SAKURA INTER BUANA is seeking candidates for various position to form and join our Team : - 5 Expedition Administrator (Single Male) ; • • • • • • • • • •

Experience and qualifications required: At least 2 years experience as an Administrator Exceptional computer literacy Highly motivated, Honest, Hard worker Initiative Maturity to handle a range of situations Able to work as team An ability to work to tight deadlines Outstanding verbal and written English communication skills Loyalty and a high level of confidentiality ;

- 2 Supervisor (Male) ; • • • • • • • • • • • •

Experience and qualifications required: At least 2 years experience as a Supervisor ; Organizational departmental planning; Performance management and improvement systems; Organization development; Highly motivated, Honest, Hard worker Initiative Maturity to handle a range of situations Good leadership and able to work as team An ability to work to tight deadlines Outstanding verbal and written English communication skills Loyalty and a high level of confidentiality ;

- 2 Accounting (Female) ;

• Experience and qualifications required: • At least 2 years experience as an Accounting ; • Able to operate computer, daily input & making monthly report (P&L and Balance Sheet) and tax reporting • Highly motivated, Honest, Hard worker • Initiative • Maturity to handle a range of situations • An ability to work to tight deadlines • Outstanding verbal and written English communication skills • Loyalty and a high level of confidentiality ;

Please send CV to : sakura.recruitment@gmail.com NC/Es/14 Nov 12

NC/Es/14 Nov 12

Food and Beverage Manager We are a Boutique Villa Resort located on the pristine beach of Selong Belanak, Lombok. Our Restaurant Laut Biru Café has become a well known tourist destination. As we expand and grow, we are looking for a true professional with a minimum of 3 years experience in a similar role. We offer an attractive salary package that can include accommodation. For more information on our property visit us on Facebook and Trip Advisor. Send CV, photo and references to roxharvey@gmail.com C/Es/14 Nov 12

NC/Es/14 Nov 12


Bali Advertiser

All your photography needs. Wedding, villas, product, etc. Call 781 7447 or 081 2389 5551 for further discuss or portfolio please visit the website: <www.thenbagus. com>. [553] Web Designer. I can help you to develop website with personal price, including hosting or domain name also printing project. Call 781 7447 or 081 2389 5551 for further discuss or portfolio please visit the website: <www.thenbagus.com>. [554] For Bahasa course + Interpreter service. Call Moko 0812 3651 4990. [488] Private teacher Bahasa Indonesian for foreigner. Dwi 0813 3870 5158, <dwi. astari@yahoo.com>. [074] <www.BaliShoot.com>. Professional photographer product photograpy. [654] Indonesian lessons. Experienced teacher 0857 3804 2206. [411] Visa Extension @ very competitive prices. 0813 5308 7789. [409] Work from home, or the beach, or your home on the beach. Ready for an Internet Lifestyle? Free info <p ro elead@gm ail. co m >. [ 947]

Composite decking specialist & carpentery. E-mail: <woodworking. bali@yahoo.co.id> / 0819 9985 7305. [033]

Car for Rent with experienced Driver tour Jawa Sumatra, excellent English. Phone (0361) 7812023. [412]

Professional Photography services. Affordable price. Call: 0813 1017 7700 < w w w. A r i o s G a l l e r y. com>. [708]

Handling monthly/annual financial and tax. Email <gutaridewi@yahoo. com> or SMS 0821 4655 7055. [413]

Private home care/nurse by qualified registered nurse for expats/ foreigners. French/English/ Indonesian speaking. More info : 0878 6050 8919, <homenursebali@gmail. com>. [344] Professional Web Design, graphic design and photography, portfolio <www.fulqentius.com> call (0361) 900 3832. [371] Man2Man Fullbody Massage/ Deep-Cleansing Bodyscrub. Kuta Areas 150.000/Hour. Arif 0812 3933 0987. [390] Interested in learning ‘Bahasa Indonesia’? A qualified and certified teacher (TOEFL) is ready to assist you. Call us on +62 81 2395 7333. [217] Professional Translators for legal documents, articles, books, etc. Contact Windi 0818 0543 4616/ <luh. windiari@gmail.com>. <www.translationpapers. com>. [410]

Need project management to supervise your project, control budget and progress, 081 755 7496 or <www. balibramsavisi.com>. [434] Fun, joyful, top-qualified Tutors for children. Free first classes. Contact 0878 5950 3343 <easylifeinbali@live. com>. [225] Sawer, Pattern Maker, will call to you. Please call 0821 4479 8255. [446] Hear Say Reflexology by Hearing Impaired. Sunset Rd. Kuta Bali (Near Simpang Siur) @Rp.45thou. Ph. 0853 3749 3620. [463] Physiotherapist, German license. Phone 0812 3636 9241. [464] Learning Bahasa Indonesia with professional female tutor <www.baliindonesia-language.com> - <bahasabengkel@yahoo. com> - 081 839 1811 - BBpin 3141D749. [465]

75

Aqueo is an Australian business and is the only importer and distributor of Havaianas in Australia and Indonesia. The Indonesian arm of the business is growing rapidly and we are offering exciting opportunities for the positions: IT Support/Data Admin

Responsible to 50% IT development and maintenance, 30% database admin and 20% ad-hoc job on help. Required Qualifications/Skills • Degree/Diploma in Computer Science/Information Systems • At least 5 years experiences in network, infrastructure, and computer trouble shooting • System knowledge within a specific area (i.e. Finance & Administration, Marketing, Warehousing, Customer Master Data and Point of Sales) • Systems and process integration expertise • Data extraction and conversion • Some hands-on experience in installation/configuration, operation support and administration of various basic hardware & software that are are required in a typical Exchange service environment (i.e. server, storage, backup system, SMTP, anti-spam/virus, archival, My SQL, etc.) • Able to manage and support Proxy, Firewall, Exchange 2008, VPN/ Remote Access, and other common internal application and services • Have a deep knowledge of domain server, CPanel base mail server, exchange server, web server, TCP/IP and network security • Able to manage and support Windows Servers, Active Directory and Linux Operating System • Knowledge of Zahir Accounting System is an advantage • Proficient in English, attention to data detail and can work with repeat data order • Self-motivated and be able to work independently or by team

Accountant Responsible for all company accounting, financial controls and for preparing the monthly Financial Package. • General Ledger. • Tax Compliance. • Familiar with PSAK. • Retail, Wholesale operations. • Strong analytical skill with strong business acumen. • Be able to multi-task in a fast-paced environment. • Energetic, proactive, attention to details, problem solving skills. • Self-motivated with initiative and able to work independently

Required Qualifications/Skills • Minimum 5 years’ experience • S-1 or D-3 accounting • Experienced with ERP Accounting Software

Sales Admin

Responsible to the sales data entry and orders release to warehouse, this role will be in daily contact with our account base and operational arm to ensure smooth stock replenishment. Required Qualifications/Skills • One or two years of retail/wholesale sales experience • Excellent organization and problem solving skills • Energetic, proactive and attention to details • Excellent communications and customers service skills – written and spoken English is a bonus

Retail Sales Assistant (SPG/SPB)

Performs all activities associated with selling and customer service Required Qualifications/Skills • Min 2 years experiences in Retail Sales. • Well-presented and groomed. • Fluent in English. • Minimum SMA. • Hardworking and able to work independently or with others. • Exposure in Life Style/Fashion/Retail Industry is an advantage. • Fluent in English both written and spoken. • Excellent organization, planning and problem solving skills. • Excellent Computer Skills- MS Office, Internet. • Located in Bali. To be considered for this role you must be able to speak fluent Indonesian, have local experience in a similar role with demonstrated responsibility, be a team worker and have a strong desire to learn and be challenged. If you fulfill the above criteria and are up for an exciting challenge, please send your current CV to : nita.shintasari@aqueo.co.id stating clearly, your expected salary, recent photo and date of commencement. NC/Es/14 Nov 12

Space for this ad donated by Bali Advertiser

BUSINESS SERVICES

Employment

14 November - 28 November, 2012

• Space for this ad donated by Bali Advertiser NC/NV/U-14 Nov. 12

NC/NV/G-14 Nov. 12


BA Feature

Article

Styrofoam Packaging for Food Is So Not Necessary Supermarket shoppers and restaurant patrons are familiar with the ubiquitous Styrofoam trays and containers that are routinely used for the packaging of fresh food, take-out meals and restaurant leftovers. Styrofoam is also used extensively as packing and shipping material, like those pesky “peanuts” that take up more space than the items they protect. These containers look innocuous enough until you start thinking about the enormous amount of waste they create in our landfills. Styrofoam is difficult to recycle because it is not readily accepted by recyclers or waste management systems. Consequently it is responsible for the huge volume it takes up in landfills, sometimes a whopping 30%. It is bad for the environment because it takes a very long time to break down. It is banned in some communities because it is linked to cancer in humans. The name of the actual material is polystyrene or EPS (Expanded Polystyrene), but most people know it by its brand name “Styrofoam”, a trademark of the Dow Chemical Co. This plastic material is made from petroleum. The Wikipedia definition of polystyrene is a polymer made from the monomer styrene, a liquid hydrocarbon that is commercially manufactured from petroleum by the chemical industry. Polystyrene was first discovered in 1839 by Eduard Simon, a German apothecary. He distilled an oily substance from storax, the resin of the Turkish sweetgum tree (Liquidambar orientalis) that he named styrol. Uses - Styrofoam is widely used all over the world for various purposes. Supermarkets, fast food chains and take-out food outlets routinely use it for food service and packaging (cups, plates, bowls, trays, clamshells, egg cartons, etc.). Other industries use it for protective packing materials like the loose fill “peanuts”, as shaped end pieces used to ship electronic goods and household appliances, and molded packing material for cushioning fragile items inside shipping cartons. It is also used as insulation in the homebuilding sector.

soon as polystyrene is contaminated by food it is no longer recyclable. Non-contaminated polystyrene products are currently not widely recycled either due to the lack of economic incentive to invest in the machinery, compactors and logistical systems required to repurpose this material. Styrofoam must be shredded, compacted or melted down before it can be reused. Current Styrofoam Recycling and Reuse Programs - Some effort is being made to find alternatives to the use of polystyrene, especially in restaurant settings. Restricting the use of polystyrene takeout food packaging is a priority of many solid waste environmental organizations. In 2007 Canada launched a campaign in Toronto to achieve the first ban of polystyrene in the food & beverage industry. About one hundred cities in the United States currently have some sort of ban on the use of polystyrene in restaurants. For instance, in 2007 restaurants in Oakland, California were required to switch to disposable food containers that will biodegrade if added to food compost. McDonald’s, the iconic American fast food chain, has faced mounting pressure to replace the polystyrene packaging used for its take-out burgers and sandwiches. They have launched a plan for a smaller waste and packaging footprint with the (eventual) elimination of the polystyrene clamshells. Starbucks has announced their goal of switching to 100% recyclable paper cups by 2015. Meanwhile, Dunkin’ Donuts lags far behind on the green front. The company still uses styrofoam cups for most of its hot beverages. On the FAQ’s of its web site, Dunkin’ Donuts claims that Styrofoam is recyclable. While that may be technically true, it is a bit of an ingenious claim as it is well know that most recyclers do not accept the material, especially from contaminated food packaging. In Germany, polystyrene is widely collected as a consequence of a stringent packaging law that requires manufacturers to take responsibility for recycling or disposing of any packaging material they sell. In the US and many other countries, the interest in recycling polystyrene has led to the establishment of collection points. Several producers of large quantities of polystyrene waste (50 tons per year or more) have invested in the EPS compactors and are able to sell the compacted blocks to plastic recyclers. Some American manufacturers have produced insulating concrete forms made with approximately 80% recycled EPS since 1993.

Environmental Impact and Health Hazards - Polystyrene is not widely recycled and discarded polystyrene does not biodegrade for hundreds of years. Styrofoam constitutes roughly 30% of the total plastic waste that gets dumped in our landfills and in the oceans. It is a major component of plastic debris in the ocean, where it becomes toxic to marine life. It breaks down into small indigestible pellets which animals perceive as food. When ingested by birds and marine mammals, it often blocks their digestive tracts, causes starvation, and ultimately death. Polystyrene is hazardous to human health. It contains the neurotoxins styrene and benzene, which are widely accepted to be carcinogens. These toxins can leach into food that is hot, acidic, alcoholic or oily and into the environment after exposure to rain. In 2011 the U.S. Department of Health and Human Services released its Report on Carcinogens identifying styrene as one of the “agents, substances, mixtures, and exposure circumstances that are known or reasonably anticipated to cause cancer in humans.” Many cities in the US have banned or restricted the use of polystyrene because of the threats it poses to human and environmental health and wildlife. Health officials worldwide are now beginning to see the danger of styrofoam leaching toxins into food, and environmentalists point at the carcinogenic substances released into the atmosphere when styrofoam is burned. At the source, the manufacturing of polystyrene is contributing to the growing hole in the ozone layer. Difficult to Recycle - Styrofoam is the worst of the packaging offenders. It is made of non-renewable petroleum and once manufactured, it is not biodegradable. There are relatively few facilities that accept this material for recycling, especially when used as food packaging due to the high rate of food contamination and clean-up costs before it can be processed for recycling. As

Greatpac is a Malaysian company which produces biodegradable food packaging containers as an alternative to styrofoam for the food industry. These containers and plates are similar in consistency as regular styrofoam containers and are oil-and water-proof. Their partners are KFC, Tesco and Pizza Hut. Sadly, they have no customers in Indonesia.

A company in Austria produces a brick product called RASTRA. RASTRA is an Insulating Concrete Form (ICF) that is structurally strong, energy-efficient, sound absorbent, non-combustible, resistant to high wind, mold & pests. It is made from 85% recycled styrofoam and 15% cement. RASTRA is an alternative building solution for economical and environmentally-friendly construction. British company STI-EcoTech Ltd uses thermal compaction and a Styromelt machine that essentially melts polystyrene to form a dense block of material that is reduced in volume by over 95% of the original material. So a 2 cubic meter load of polystyrene comes out of the machine as a small block approximately 90cm x 25cm x 5cm. The blocks can be sold to recycling companies who then turn it into fuels such as diesel or new products such as garden furniture. Bio-degradable Alternatives - Biodegradable packing materials are gaining momentum. There are manufacturers out there who produce biodegradable products such as food containers, tableware, cups, etc. US company Genpak in New York produces a line of environmentally friendly containers that are either fully compostable or are greatly reduced in the amount of normal raw resources required to produce them. There are no petrochemical resin sources used in the process. They are starch products derived from a hybrid material that replaces a full 60% of the traditional plastic material with natural starches. Another American company called Puffy Stuff produces a plant-based compound that is an all-natural packaging material and post-use, can be recycled as fertilizer in your garden. It breaks down into inert proteins after coming in contact with water and is consumed by soil bacteria. If not reused, Puffy Stuff can be put in a landfill where it is completely biodegradable by ISO definition, i.e. 100% consumed by bacteria. No petrochemicals are used in its production. In a similar vein, scientists at Sony have discovered that EPS completely dissolves when sprayed with limonene, a natural oil extracted from the skin of oranges or other citrus fruits.

In Bali, Carrefour supermarkets have been in the news lately with the welcome introduction of a plastic reduction program. Carrefour ostensibly stopped giving away free plastic bags to shoppers and is now encouraging customers to bring their own bags or purchase the store’s reusable green cloth bags or biodegradable plastic bags which will decompose in two years. However, the program does not include the reduction or elimination of styrofoam trays and packaging currently still in use in the Carrefour stores, as they are in all other supermarkets and food outlets in Bali. Most organizations in Bali that are involved with waste management and recycling do not have specific programs per se to tackle styrofoam. Most will gladly handle paper, plastic, metal, glass, fabric scraps, Tetra-Pak cartons etc. But styrofoam is a challenge because most of it has to be commercially recycled and those facilities are totally lacking in Bali. Eco Bali and Bali Recycling will accept styrofoam though it is currently not recyclable. The Sukunan Solution. Sukunan is an eco-tourism village in Yogyakarta with a successful waste management system that was started in 1997 by Pak Iswanto, an enterprising visionary who realized that solid waste should be managed in an environmental friendly way. His motto: Begin from small and begin from now to reduce the waste. He initiated a Community Empowerment Process to implement the Sukunan Waste Management System. It was a resounding success and the formula spread to other areas. When an earthquake destroyed many houses and buildings in the village, the idea to use styrofoam as rebuilding material emerged. By grinding the styrofoam into granules and mixing it with cement, sand and water to make bricks, this pesky material could finally be put to a useful purpose. What can you do to recycle styrofoam? - Many communities have banned the use of styrofoam. Until it is banned in its entirety, it may be beneficial to know how to recycle it. Though recycling efforts for EPS are a little more complex than for paper and other plastics, it is worth taking the time and initiative in order to keep this obnoxious material in use and out of landfills. • •

• •

Check with local cargo companies and shipping businesses to see if they can reuse styrofoam packing materials such as peanuts in their shipping. Keep polystyrene products to reuse as packaging materials for shipping or to separate breakable items on moving day; use as storage containers, gift containers (by wrapping them in foil, gift wrap, fabric scraps, etc.) Some of the most common uses for reusing Styrofoam are craft projects. Cut out shapes for holiday ornaments, make toys and figurines; fashion a bean bag; make a cat or dog house with the bigger pieces, even a kid’s playhouse; create maquettes for sculptures and sets for theatrical productions; tunnels, hills and various components for model train sets, Use as floating devices and floaters for fishing and boating For the intrepid gardener: use as seedling containers; cut up and use as drainage material in the bottom of potted plants; place underneath pumpkins and squashes to protect them from damp earth, There are many recycling ideas on the internet. For starters, check “How to recycle styrofoam” on www.ehow.com

Story by Ines Wynn

Copyright © 2012 Bali Advertiser You can read all past articles of BA Feature Article at www.BaliAdvertiser.biz


Bali Advertiser

77

14 November - 28 November, 2012

For information about taxation, please contact us:

DIRECTORATE GENERAL OF TAX REGION OFFICE OF BALI Call Center : (0361) 241555, 263894 Faximile: (0361) 263895 Email : humas.bali@pajak.go.id SMS Center : 081 238 88250 C/Ns/S-29 August 07

For Sale; Deuter eXp Air. 12liter+3liter. Helmet holder. Hidration system H2O. Rain cover. Wet pocket. Bag for biking/running etc. 100% brand new. Color red black. Rp. 450.000. Will send picture by email. Call/SMS 0858 8000 2500. [224] For Sale; Yamaha 200HP outboard mint condition less than 3 years old 3 units available. Call/text 081 7939 9777. Nusa Dua. [225] For Sale; Desktop computer Dual Core with 19” Samsung flat screen 4 sets available great condition bought Rp. 4.5 million, sell for Rp. 2.8 million ONO. Call/text 081 7939 9777. Nusa Dua. [226]

C/Ns/G-22 August 12

For Sale; Surfboard Tom Currens own board fish shape 5.11x19x2. 25 swallow/ pin. Very collectable good condition for 12 years old can surf or go on your wall. New deckpad and has f.c.s fins Rp. 1.8 million. Russ +62 812 3614 1022. Kuta. [209] For Sale; Ibach piano Germany black upright good condition and classic mahogany pool table good condition. Price negotiable. Phone 0853 3331 3206. Canggu. [210] Everyone has talent. What is rare is the courage to follow the talent to the dark place where it leads.

Moving sale : TV JVC HDZ70RX5 70” rear projection television, Fully operational and good condition, new Rp. 45 million, sell for Rp. 10 million. 2 Advante digital powered mixer MA1090 come with 5pcs sound system Advante and Peavey, work well for Rp. 8 million. Antique wardrobe teak & glass shelf, suitable for display, Rp. 4 million. Coffee table, teakwood, size 100cm x100cmx35cmH Rp. 500.000, rattan sofa seater with cushion, Rp. 2 million, water pump cheap price. Polytron stereo, radio, casette, CD (not working) for Rp. 300.000. Abby car seat from Ace Hardware, suit for kids 1-5 years Rp. 350.000, kids toy & clothes age 1-3 years old. Contact 780 0587 for pictures and detail. Ubud. [218]

SEMER VETERINARY CLINIC & PET SHOP Praktek Bersama

Drh Listriani & Associates Hours: Monday - Saturday 9:00 - 5:00 Jl. Raya Semer 882, Kerobokan, Kuta-Bali Telp: 0361 - 8544476 C/Ns/G-02 May 12

NC/Ns/U-14 NOV. 12

For Sale; MacBook Pro Core i7 processor 2.2GHz, memory 4Gb, hard disk 500Gb Tunderbolt, Ati Radeon HD 6750 M 512 MB, monitor 15.4” late 2011. Sell for Rp. 13 million. Please call/SMS 0831 1964 5264. [219] For Sale: 2nd iPad 3, 32Gb 4G+WiFi black colour complete with box, manual book and charger, only Rp. 6 million. Contact 089 8078 1887. [220] We are never more discontented with others than when we are discontented with our selves.

C/Ns/I-14 Nov 12

C/Ns/G-19 Sept. 12

Pet Parade Pet owners: Please sterilize your dogs & cats to preserve the natural environment.

Pets To Give Away / Wanted / Lost / Found These ads are free. E-mail to: info@baliadvertiser.biz

Cute, healthy, vaccinated pups for adoption from Bali Adoption Rehab Centre BARC call Linda 081 855 0947. [001]

ages and personalities plus.These smart companion cats will bring you joy to your family and rid your home of rats. Visit Villa Kitty Beautiful Bali cats and Lod Tunduh or call (0361) Save a Bali puppy today! kittens, fully immunised and 981 1651 or 0815 5870 L o v e a b l e p u p p i e s sterilized, sleek, all colors, 1737. [003] desperately looking for temporary foster homes. Contact BAWA (0361) 977 217. [002]

Pets For Sale

For Sale Line Ads Rp. 7.000 per word. Photo ads Rp. 435.000. All ads must be paid before printing. For sale pure breed German Sheperd, 2 months, vaccinated. 0812 3672 2812. [004]

For sale 4 months old pure breed female Greatdane (Scoobydoo), fawn color. <gery@vinplus.biz> / 0857 3713 1720. [007]

Dachshund / Tekel for sale. 2 months, cute & healthy, black, 2 males, 2 females, non-certificate. 0818 0556 0693. [010]

Dog-whispering with amazing guaranteed results. Rotweiller puppies, 9 month, Any strange behaviour. male, only 1. 0878 5107 <doggiesparadise@gmail. 3568 / (0361) 234 238. [008] com>. [005] Bird for sale; Parrots Available now. German (macaws, sunconures, etc), Shepherd puppy and eagle, peafowl, Bali Starling, Labrador puppies. All with legal document. Info: pedigree and vaccinated. < b a l i b i r d n e s t @ y a h o o . Call 0878 8039 7958. [006] com>. [009]

Beautiful Pedigree Rottweiler puppy 12 weeks old, wormed, house trained, perfect family dog very loving and playful. Must go to a loving home. Dog responds all commands in English sit, come, bed, out etc. serious enquires only please. 0812 3633 7813. [011]

0Q[\WZaQ[UW^QVOJMaWVL\PMWTLIVL\PMVM_ _WZTL :QOP\ NZWU \PM MY]I\WZ ;IJIJIa QV^Q\M[aW]\W\PMVM`\KPIX\MZWN \PMOTWJIT RW]ZVMa QV OZIXM OZW_QVO IVL _QVM UISQVO NZWUIVM_TI\Q\]LM.ZM[PIVLTQ^MTaW]Z_QVM Q[MI[QTaIKZW_LNI^WZQ\MXI[[QWVI\MTaKZMI\ML NWZ aW]Z MVRWaUMV\ IVL IXXZMKQI\QWV \W W]Z JMI]\QN]TVI\]ZM

Contact Bali Advertiser

Telp: (0361) 755 392 [Hunting] Fax.: (0361) 764 191 E-mail : info@BaliAdvertiser.biz Make your ad online at www.BaliAdvertiser.biz C/Ns/I-27 June 12


SCHEDULE THAT Adam Lambert (31 December 2012)

Bali has been graced with the presence of a few international stars and once again Bali plays host to international singer-songwriter, Adam Lambert, runner up American Idol 2009. Adam Lambert has had a string of successful albums and singles and has been nominated for Grammy awards. His concerts have been sell outs. For this concert, there are 3 categories of tickets, bronze, silver and gold which include a gala dinner available at a premium. Not cheap but guaranteed to be a fantastic evening for Adam Lambert fans and the Mulia Resort offer accommodation packages too. Do find out more at the contact details below and book soon as this is for sure to be another sell out evening for fans who will flock in from Bali and beyond.

top quality food and wine are featured. The Conrad and ewineasia.com will host this unique wine evening featuring 24 leading Old World Wine producers paired with scrumptious cuisine which is what the food at the Conrad Bali Resort is all about. This all part of ewineasia.com’s the Vintners’ Wine Tour that encompasses Asia during the last week of November. Diners will enjoy a buffet which features European and Asian fusion and local delicacies. Fine cheeses which always compliment good wine will also be served. Wines will be served from France, Spain, Italy and Austria. As far as wine evenings go, this has got to be the top valuable for money and highly recommended. Do make a reservations though as places are limited.

Cost : from USD488 Where : The Mulia, Mulia Resort & Villas, Nusa Dua Contact : 3017777 reservation@themulia.com www.themulia.com

When Cost Where jung Contact

Connecting Kids and Parents Day Retreat (24 November)

Healing and Spiritual Development (2 – 8 December)

We all receive some kind of formal training in the job we choose to do and yet, when it comes to the most important job, we are expected to raise children naturally and know what to do. In the early stages of birth, toddlers and early childhood, hundreds of books are written with advice on what to do which pitters out as children get older and once the teenage years hit, oh boy! Where is that manual? So often parents are focused on the basic needs of children and supporting them in material terms that the connections between kids and parents can get lost in the process of just getting through each day. The purpose of this retreat is to help you and your child foster deeper heart connections, release unhealthy blocks and beliefs, develop open and honest communications and reconnect to the job and love inside. Ultimately this retreat will enable you to learn the tools needed to support healthy connections with your child and gain a new found sense of lightness and cooperation that will deepen your bond for years to come. Children really are for life, not just for a few years and it is often a shame to see bonds severed or not created as parent children relationships are very special, and as with any relationship requires nurturing, time and often, real effort. If you feel you want to deepen your relationship with your child, find yourself getting to stressed to really ‘be’ with your child and see your child craving attention when you are overwhelmed, then this retreat offers a real opportunity to get closer to your child. Sharon Turton has been presenting workshops in Australia since 2004 and has a wealth of expertise in this area. As a mum, qualified teacher, counsellor, naturopath and journey practitioner Sharon Turton will bring her knowledge and skills to Bali. The book “Connecting Kids – with their inner potential” was written by Sharon Turton and you can find out more details about the book at the website below. Sharon Turton is passionate about helping parents and children clear their limiting beliefs and emotional blocks and live to the fullest potential. This is a great opportunity to develop the bond with your child that can be so fragile and yet so deep. It is not easy being a parent and this course may provide the support you have been looking for.

: 7 pm - 10 pm : IDR650,000 : The Conrad Bali Resort, Jl. Pratama No. 168 TanBenoa : 778778 restaurants@conradbali.com www.conradbali.com

Bali seems to be synonymous with retreats, the beauty, ambience, culture, spirituality all playing a major part to compliment the process. This retreat as its title indicates is aimed at helping the healing process through yoga, a form of spiritual development which strengthens your physical, emotional, mental and spiritual bodies. This yoga retreat will teach you different tools for self-healing including relearning how to breathe, learn to channel energy within your body, understand and activate your chakras, explore the connection between the breath, posture and emotion, connect with your inner power, activiate your intuition and initiate you to the first level of Mudtra Pranala a Balinese healing system. Linda Madani will be leading this retreat and her teacher, Tjokorda Rai, a renowned healer in Bali will also be present. Linda Madani, has a wealth of experience and knowledge as a spiritual healer and yoga teacher. The retreat includes 6 nights accommodation at this beautiful setting, a spa treatment, meals, some excursions, tax and service. Each day offers a combination of morning and afternoon practices, activities and time for relaxation. Everyone is welcomed at their own level and will be guided further in the process of healing and spiritual development. If you feel that you need support and time to develop yourself, this is a great way to do that with like minded people and in the safe and trusted hands of the leaders. Cost : from IDR12,550,000 Where : ONEWORLD retreats, Kumara, Ubud Contact : 289752, reservation@oneworldreteats.com www.oneworldretreats.com/ubud_bali

The Iskandar Challenge Celebration (16 November)

Many of you may know Christina Iskandar, long term resident of Bali and a committed philanthropist with a big heart and a big smile, always committed to helping a good cause. Christina is well known for making things happen for the Bali Community, whether it is organising a school Idol for the kids or a DIVA lunch for the grownups, she makes it happen. Ever committed to action, this is exactly what Christina did when she decided to embark on her own personal challenge. On Monday 20 August, she decided to lose 15 kg in 12 weeks with a higher purpose of raising money for her chosen charity, YPAC, a cause very close to Christina’s heart. In partnership with Motion Fitness Bali, Christina began her fitness and nutrition programme with her goal in mind, to raise much needed funds to purchase a vehicle for the YPAC centre. As the three months intense regime draws to a close, the community is invited to join Christina and celebrate her accomplishments as well as help raise money for this cause. The evening begins with a 3 course meal and for those who wish to do so can join later. DJs will provide the entertainment, and there’s a raffle with an array of amazing prizes. This is a ticket only event so you do need to purchase tickets in advance. If you would like to make a cash donation you can by placing your donation in an envelope marked The Iskandar Challenge and drop this off at the Canggu Club Reception, Motion Fitness or Warisan Restaurant. Once again, Christina has managed to make a difference to the lives of so many and her passion and efforts are an inspiration.

Cost : $355 (parent and child 5 – 12 years) Where : Power of Now Oasis, Sanur Contact : 085857316802 nairana@nairana.com www.journeynaturopath.com www.connectingkidsbook.com

Cost When Where Contact

Fine Wines on Tour (27 November)

The Raw Kitchen and Detox Course (24 - 25 November)

Here is another one of those wonderful evenings in which

: : : :

IDR250,000 (dinner and party) IDR100,000 (party only) 6.30 pm (7.30 pm dinner) 9.30 pm (party) Warisan Restaurant, Jl Raya Kerobokan 731175 info@warisanresaurant.com

Raw foods are by their nature the healthiest foods and more

By Dawn Chorus

and more restaurants are featuring raw foods on their menus. In the age of too much stress and not enough time, more and more people are turning to raw foods and a detox to recharge and ensure their bodies are receiving the required daily nutrients for optimum health. Anyone who is interested in the benefits of the raw food kitchen and how to detox then this is a course worth taking. Saturday focuses on simple to sophisticated recipes for all occasions, kitchen skills and practical knowledge, how to set up a raw kitchen, stapes, stocking and meal planners, proper food combining, low glacemic and little nut use. Sunday is all about detoxing with cleansing raw food recipes and specific cleansing practices, emotional cleansing, personal guidance and how to continue. Let’s face it, being inspired to continue with any project requires effort and motivation which is the key to ensuring good health, in this case. If you are unable to join this course, the same course will be offered on 29 - 30 December. Cost : AUD $225 Where : Ubud (further details upon enquiry) Contact : 081 239 165702 amy@amyrachelle.com www.amyrachelle.com

Santa’s Trivia Quiz Night (21 December)

It is hard to be believe that it is less than six weeks to Christmas and yet another year almost over! A very special time for many and often a time of reflection and giving. This is what this event is all about, giving to the International Humanity Foundation of Bali. This organisation provides a basic education for over 200 children in Kampung Buitan, Karang Asem. The centre is run by volunteers and is dependent on donations to continue their work. Many of the students, through learning basic English, maths and computer skills are in a much better position to seek employment when they graduate. This fundraiser will enable their valuable work to continue. You can find out more about this charity at the website below. The community is invited to come along to this trivia night with great prizes and a raffle. Gather a team together, head out to Candidasa and enjoy the Christmas spirit. Santa costumes welcome! Do call ahead to reserve your team’s table as it is going to be a popular evening. It might also be worth staying the night at one of Candidasa’s hotels or guest houses. Remember to put plenty of cash in your wallet and come along for what is going to be a festive evening and lots of fun. When Cost Where Contact

: : : :

7.30 pm IDR20,000 New Queen Pub & Restaurant, Candidasa 081337519181 emelies4@ihfonline.org www.ihfonline.org

Wind Festival (16 - 18 November)

This festival is about documentary films and photo exhibitions regarding South East Asia’s cultural diversity. As part of a travelling festival, new in the region, the festival will be initiated in what better place than the heart of Bali’s cultural capital, Ubud. Screen Below The Wind Festival will present approximately 20 documentary films and a photography exhibition. Many documentaries have been produced in the region particularly in the past 20 years, but many are not known to a wider audience. It is the goal of this project and indeed the vision of founder and director, Iwan Setiawan to encourage and celebrate South East Asia’s cultural diversity, to stimulate the documentary film industry in South East Asia, to inspire the art of documentaries as unique cultural products and to foster collaboration and cooperation through media. The programme line up also includes discussion and sharing sessions on topical issues such as documentary - passion and profit, the role of documentaries as part of South East Asia’s identity and media, investing in documentaries as well as workshops, a creative forum and coffee session. On the last evening there will be a film, performance and an opportunity to get together with the representatives from South East Asia. For more details of the programme, times and locations, do contact Iwan Setiawan, the founder and director. Once again, Bali is the setting for delegates and representatives and an opportunity for those interested in learning more about film documentaries. Where : Campuhan College, IDEP Foundation and ARMA Gallery Contact : 081 23051717 info@creenbelowthewindfest.net

Add Dawn to your mailing list and send her information on all up-coming events. Contact Dawn at <dawnchorusbali@gmail.com>

Copyright © Bali Advertiser 2012


Bali Advertiser

79

14 November - 28 November, 2012

.. .

a p

C/Ns/G-02 May 12

a i S ?

Frederic Saenger: Cancer Awareness on Bali Frederic Saenger was born in Lausanne, Switzerland in 1974 and grew up in Geneva, the French-speaking part of Switzerland. He attended catholic school as a child and teenager. First with his parents and younger sister and then later as an adult Frederic has travelled to the Americas, Australia, Polynesia, Europe, North Africa and Asia. As a young man he co-managed a small independent record label. Frederic worked in the hospitality industry for many years and was the Chief Business Development Officer in Bali’s new Internet radio station, Baliradio.net. Having lost his own mother to cancer, in 2011 Frederic became involved in the Bali Pink Ribbon Foundation which helps fight against breast cancer, the disease with the highest fatality rate among Balinese women.

C/NS/I-07 Mar. 12

the Pink Ribbon Foundation raises awareness of breast cancer among the population through support groups and education, raises money for the hospital and buys digital and mobile mammogram machines. Is there anything that can be done to prevent cancer? First, it can simply be just a question of hygiene and lifestyle. Many scientific studies show that eating a lot of vegetables (containing Vitamin C and E, Selenium and Polyphenols) can decrease the risk of developing cancer. Those same studies showed that being overweight after menopause could put women in a higher risk category. Being physically active and drinking less alcohol are beneficial. Though following these guidelines will not cure cancer and may not prevent one from having cancer, they do help to reduce the risk. Second, undergo systematic examinations. Prevention must be taught to teenagers and women through school programs and ad campaigns. Employers must talk to their employees. Mass screenings must become a priority for the government. It is vital that every woman from at least age 30 should do an annual check-up, palpate their breasts once a month and consult with a doctor if they feel something strange. After age fifty, women should take a mammography every year. Are there problems treating cancer on Bali? C/Ns/G-31 Oct. 12

First, one of the biggest problems is the high cost of breast cancer treatment in a developing country as Indonesia. Second, there is no radiation therapy available which helps shrink tumours and kill cancer cells. Third, there are no massscreening programs offered here because of the lack of diagnostic equipment in hospitals and clinics. Fourth, there is lack of education. People in Bali don’t believe that much in modern medicine and prefer to use alternative or ancestral medicine. Fifth is fear. Most Balinese women are afraid that the results of tests will be bad, so they prefer to just avoid the tests. It is totally irrational but very human to act this way. But they should realize that having a breast removed, going through chemotherapy and radiotherapy for years and not knowing if they will die or not is what they should fear, not the examination.

What is your educational background?

What are the best cancer treatment facilities in Indonesia?

I went to university for a couple of years to study law, but it was too academic, so in 1999 I enrolled in the Ecole Hôtelière de Lausanne, one of the world’s best and oldest hospitality management schools. I graduated in 2003 with a bachelor of science and a business economist diploma.

Indonesia has 13 teaching hospitals that can handle cancer problems. The top one is Dharmais Cancer Center in Jakarta. In Bali cancer patients should go to Prima Medika Hospital in Denpasar.

How did your involvement with Bali Pink Ribbon begin?

Do victims of cancer have anywhere to turn if they don’t have the money for treatment?

Last year at the Bali Garden Party in Taman Bhagawan, I noticed the Pink Ribbon booth and went over to talk to the charming “pink ladies.” I told them that my mother had been fighting breast cancer for three years. After our inspiring conversation, I decided to help the foundation. Do you have any first-hand experience with this disease? As a son who recently lost his extraordinary mother from this terrible disease, I am still angry by what happened. The best doctors in the best private clinic in Switzerland treated my mother. She was surrounded by all the love you can imagine from my father, my sister and my whole family. She fought bravely against the disease, against all the draining chemotherapy and radiotherapy. She never complained and tried to live her life as normally as possible. But the Lord decided to take her away. My mother apparently was diagnosed too late.

C/Ns/G-14 Nov. 12

Unfortunately, no. The majority of Balinese don’t have any insurance and even if they did, most insurance policies don’t cover all the costs. The average cost for breast cancer treatment is around Rp.100 million/month! At that level, even cancer associations can’t help. It is the role of the government to give more support to help its citizens. One out of every eight women in Bali will have breast cancer. That’s a lot.

C/Ns/I-18 April 12

Can you offer any advice to the families of those who are suffering from cancer?

What associations are involved in cancer prevention on Bali?

It is really important to love and support women who have breast cancer, to let them know that this horrible disease can be cured. Be there for your wife, your sister, and your daughter. Show them love and encouragement. Whatever happens, at least the family is there to show support. Psychological support is important in the treatment of this disease, and emotional support is as important as medical support. Traditional medicine must be complemented with modern medicine. Fighting breast cancer is a complex war that needs all kind of soldiers – chemical, traditional and emotional.

The Pink Ribbon Foundation, the Inner Wheel Club and the Rotary Club Seminyak recently held a luncheon and fashion show at Café Métis with all the proceeds going to the new Breast Cancer Support Centre at Prima Medika Hospital in Denpasar which educates women about the importance of early breast cancer detection and to provide free mammograms for underprivileged women in Bali. Of all the yayasans, only

For anyone interested in being considered for Siapa, please contact: <dariskm@gmail.com> Copyright © 2012 Bill Dalton You can read all past articles of Siapa at www.BaliAdvertiser.biz

mano@mrtrusted.asia C/Ns/G-16 May 12


Windows Upgrade offer: The new version of Windows made available to Indonesian users last month can run on laptops, tablets and desktops, allowing users to both buy and create content using only one device. In Indonesia, Windows comprises 97% of the total PC market. Of these, according to the Jakarta Post, around 45% of consumers use Windows XP which is due to expire in 2014 when it will not be supported anymore. Old versions such as Windows XP, Windows Vista and Windows 7 can now be upgraded to Windows 8 Pro by going to http://www.windowsupgradeoffer.com. If your PC runs a version of Windows dated from before June 2012, you pay US$39.99 to upgrade to Windows 8 Pro. If you have a newer version of Windows, you pay only $14.99 (normal Windows 8 Pro licenses cost $69.99). This offer is valid until January 31st, 2013. Eyeglasses in a hurry: One size fits all AdSpecs selfadjustable eyeglasses (Rp345,000) saves money and trouble of going to a t r a i n e d optometrist (specialis mata) in Bali for expensive prescription eyeglasses (Rp750,000-Rp1.5 million). In a process known as self-refraction, AdSpecs allow the wearer to instantly correct their own vision by changing the amount of oil in the lenses with removable syringes until the strength of each lens is just right—the perfect remedy in the case of emergency, broken glasses, lost contact lenses or to share between family members. AdSpecs can be continuously adjusted until the syringes on the side of the glasses are removed. As soon as those syringes are removed, they can no longer be continuously adjusted. However, if someone just keeps the glasses as reading glasses at home, they may never want to remove the syringes, making them continuously adjustable. A less expensive model, costing only Rp200,000, is the Adlens® Emergensee™ Glasses, which can also be continuously adjusted to fit most prescriptions for both near and far vision. Both models are available at Kopernik, Pondok Wisata Sayan Ayu, Jl. Raya Kedewatan in Sayan, Ubud, tel. (0361)976-417. Kos cheaper than storage units: It’s almost four times cheaper just to rent a room in a kos (boarding house) than it is to store your stuff in a storage locker in one Bali’s long-term public self-storage businesses. Kos cost only Rp350,000 per month for a 3 m X by 3.5 or 3 m X 4 m lockable room whereas a storage unit in a self-storage business costs much more for the same amount of space. However, public storage units are pest, mold and climate controlled, offer 24-hour security cameras and guards, and do not have whole working families living in adjoining rooms. Note: Although motorcycles can be stored in the rooms, kos usually do not offer enough parking space to park cars long-term. Doctor, is this test really necessary? The June 2012 issue of Consumer Reports cites a number of medical tests that can trigger risky follow-up overtreatments, lead to expensive referrals to specialists, needless radiation, dangerous drugs and even surgery. EKG tests (available at Laboratorium Quantum in Denpasar), which record the heart’s electrical

activity through electrodes attached to the chest, are only critical for people who either have regular chest pain and irregular heartbeat or who are at high risk of heart disease. X-rays for lower back pain (at BIMC the test costs Rp350,000 plus require a doctor’s appointment) are often unnecessary because people who have the test don’t recover any faster within the first month, yet people who have the test are eighttimes more likely to have surgery. CT Scans for headaches (at BMIC Rp5,745,000) rarely help in the diagnosis of a serious illness like a brain tumor. All it usually takes for a diagnosis is studying the patient’s medical history and a careful neurological exam. Also often unnecessary are Bone Density Scans (available at the International Wing of Sanglah Hospital) for low-risk women or women under 65. Although up to 20% of cold-sufferers are prescribed antibiotics, it’s often completely unnecessary because the congestion and discharge is almost always the result of a viral infection and not a bacterial one (antibiotics don’t work against viruses). Best a/c for heat wave relief: Portable air con units are noisy and not very effective, as you have to exhaust the unit through a window or hole in the wall. An oscillating fan is just as good. Evaporative or “swamp” coolers sold in Mitra 10 and Ace stores are not suitable for Bali’s high-humidity. Though they cost a bit more, the best air conditioners are “inverter” types because their compressors don’t start and stop when the thermostat directs them to. Instead, these more efficient air cons continuously adjust the speed of the motor, gently ramping up and down according to changing temperatures. They are also considerably quieter, require less maintenance and save on electricity costs. The best brands available on Bali (if a run hasn’t been made on all stock!) are Mitsubishi, Daikin, LG, Panasonic. New city minibuses launched: A fleet of 56 bright green minibuses now serve four routes in Denpasar that intersect each other and with the Trans Sarbagita integrated mass transportation system. Route 1: between GOR Ngurah Rai and Renon; Route 2: Matahari Terbit to Simpang Teuku Umar; Route 3: connects Simpang Teuku Umar and Jl. Bypass Ngurah Rai; Route 4: connects Jl. Sudirman–Jl.Waturenggong– Jl. Sidakarya. This makes citywide transportation more accessible to a greater number of people because these feeder buses take them to and from the nearest Trans Sarbagita bus stops. Even better, they are free of charge until Dec. 31st, 2012. Starting January next year, adults will pay Rp2,000 for a one-way ticket which compares favorably to public minibuses (bemo) which charge Rp5000 per ride. Operating in two shifts every day, the minibuses go a long way in reducing southern Bali’s worsening traffic congestion. As a bonus, drivers don’t smoke, operate punctually according to GPS-monitored timetables, and don’t drive off their routes. By 2014 even more bus corridors will have opened up, such as from Kuta Sentral Parkir to Tanah Lot, from Sanur to Nusa Dua via Ngurah Rai airport and from Sanur to Ubud. Mango season is upon us! This quintessential tropical fruit is native to S.E. Asia and was one of the earliest tropical fruits to be cultivated by humans starting around 4000 years ago. Plump juicy sweet mangos on Bali normally cost up to Rp13,000 per kilo, but now mangos sell (while they last!) for as little as Rp3000-Rp5000 per kilo. In Hardy’s, they’re currently going for under Rp7000 per kilo. You need full sun and a dry climate to grow mangos successfully, so they don’t grow well in south Bali or areas that are too cool. Thus the dry

Buleleng district of north Bali grows the biggest variety, called Poh Madu. From dry East Java comes the yellowish Poh Mana Lagi (meaning “give-me-more-mango”), Manga Harum Manis and Manga Golek (long and thin with hourglass shaped “hips”) which are considered the tastiest types grown in Bali and all over Java. While not traditionally used in Balinese cooking, the Balinese love mangos as snacks, blended into juices or diced with es campur (mixture of fruit with sugar and shaved ice). Unripe mangos are firm and have green skin, becoming soft and golden brown as they ripen. The best mangos for rujak (sweet and sour vegetable salad) are unripe Poh Madu and Wani (both Rp3500 per kilo. Free books on sustainable agriculture: Pdfs of 34 books can be downloaded free from the Agromisa Knowledge Centre for Small Scale Sustainable Agriculture (http://journeytoforever. org/farm_library/agrodok. html) which is linked to Holland’s Wageningen University, one of the world’s leading research institutes on tropical agriculture. Clear, concise and well illustrated, the guides are written from first-hand experience and focus on small-scale production in the tropics. Titles cover such topics as compost preparation and use, rainwater harvesting, freshwater fish farming, mushroom cultivation, erosion control, beekeeping in the tropics, seed production, food storage, preservation of fruit and vegetables, etc. All 44 Agrodok books can be downloaded as pdf files from the Agromisa website: http://www.agromisa.org. Digitize those old photos: What to do with all those thousands of old color and black & white film negatives and Kodachrome color slides in long-term storage in your closet? If you digitized them, they’d be much easier to sort, sell, enjoy or whatever else you wanted to do with them. Bali photo shops charge Rp2000 (or around Rp15,000 per roll) for each negative they scan to create a digital copy, and professional scanners cost a fortune. The cheapest way is to “scan” the images using a digital SLR camera. If you do it right, you can achieve higher resolution and superior image quality than what the street labs can give you on CD and have more precise control over colors, highlights and shadows. This method is also tons faster than using a scanner. Ideally, you should use a macro lens, but if you don’t have one your kit lens can also do the job, with only slight loss in usable resolution due to cropping. Put the photo against a flat bright light source such as a light box, computer monitor or iPad. Paint surroundings flat black to stop reflections bouncing off your camera’s sensors. Rig a frame to hold the negatives firmly in place (a neg carrier from an old enlarger is perfect), then set your camera on a secure flat surface and snap you’ve instantly made a digital copy! All you need to do now is invert the image. If you have a lot of negatives to scan, group them by film type, finding the best exposure for each type, then batch process each set. Individual images that are too yellow or too blue just might need a bit of digital tweaking. Information on how to pull off low-budget digital copies is found all over the Internet. The Instructables website has some useful instructions and photos. Individuals and businesses may send moneysaving tips to: dariskm@gmail.com Copyright © 2012 Bill Dalton You can read all past articles of The Frugal Balinist at www.BaliAdvertiser.biz


Bali Advertiser

14 November - 28 November, 2012

81

STARS WITH VIBHUTI HOROSCOPE NOVEMBER 14 - NOVEMBER 28, 2012

This fortnight begins with the total solar eclipse at 22 degrees Scorpio and ends with the lunar eclipse at 7 degrees Gemini. The Sun and Moon are sitting very close to the Moons Node or destiny point at the time of the Suns eclipse and Saturn also in Scorpio is in a very close trine to Chiron in Pisces. We collectively have an opportunity for immense healing during this month even with our retrograde Mercury. Uncovering the hidden facets of disease and disharmony are more than likely as Scorpio uses its depth of analysis to investigate and expose the truth of situations and events. Breakthroughs in many areas will become obvious as instant revelations take place. Some may hit the wall rather hard, although this will bring them into an awareness of their mortality and the potential of immortality. Scorpio is about death, endings and resurrection. It’s also about resources and many will receive windfalls or inheritances that will pave the way for a new future. By the time the Full Moon comes around, Mars will be joining Pluto and its lower octave will activate this transformational potential. By then Mercury is out of retrograde, and returns to its turning degree mid-December. Mars enters Capricorn on the 17th and the Sun, Sagittarius on the 22nd, with Venus entering Scorpio on the same day. If you are feeling the urge to do something but not sure what that is, then you are probably in the throes of transformation and transition. FULL MOON 6 Gemini 47 November 28, 2012 10:47 p.m. (Lunar Eclipse)

ARIES Mars transition into Capricorn and its meeting with Pluto at the end of the fortnight makes for an interesting fortnight. Saturn rules Capricorn and it is working hard to bring healing into your life. Here’s the thing though, you will need to let go of some aspects of your life that really aren’t working for you anymore. These may be relationships, jobs, mental constructs or homes, to name but a few. Mars too will follow in the footsteps of Pluto and create a square to Uranus. Actions will be unpredictable and instant insights probable. Welcome the chaos as it brings these radical changes and transformations to your life.

LIBRA As your ruler Venus moves into Scorpio, the mood most definitely changes and you find yourself becoming much more serious and more passionate. Romance moves out of the head and into the lower chakras. For those in long-term relationships, this is a welcome relief and for those in new ones, a word of caution, think carefully with whom you are sharing that depth of your being. The bond that is created is strong and more psychically so than ever before. Better to get to know someone first when the passions run this high, as the temptation is hard to resist. It’s always your call though, of course.

TAURUS Venus transitions into Scorpio this fortnight and meets up with Saturn. Scorpio is your opposite sign and that means confrontations and projections within your relationships.Saturn brings a certain holding pattern to highlight issues and promote healing. The pressure cooker effect will last throughout this month and into the months to come. If you are looking for a permanent solution and ongoing stability you are not going to find it. Learn to flow with the ever changing situations and loosen the hold you have on life and the structure of it. You will be remodeling much of it this fortnight. Let go where it is necessary.

SCORPIO Pluto your ruler is heavily highlighted during these times and for now a lot of activity in your sign as well. The healing between Saturn and Chiron connections is bringing structure to your higher-self promptings. The urges and instincts that have been so strong, are showing you what to do and how and when to do it. As you follow this guidance you find a renewed sense of faith and trust. Firstly in your guidance and secondly through the synchronicity of events you know that there appears to be some grand orchestration taking place that is bringing support as you willing release and surrender to it.

GEMINI It’s that Mercury retrograde time of year again. It turned in Sagittarius and will retrace steps through Scorpio. Whatever you overlooked or simply glossed over, this is your opportunity to go more deeply into it. The mental letting go is deep. Old ideas are flying out through revelations of past programming particularly in the psychological realms. As you get to see the working of the mind and it’s training through life situations, you are offered the opportunity to radically alter the way you perceive the world and filters through which you’ve viewed situations. Take the time to digest, assimilate and integrate all of this.

SAGITTARIUS Jupiter your ruler won’t be too far off the Full Moon this month and brings some expansion around your capacity to adapt to new ideas. When the lights go out we don’t always appreciate everything that was obvious before, but when it returns we have a renewed sense of gratitude. This gratitude will be your guiding light to the new things that are coming into your life and those that are leaving. Being thankful for both is the way to go now. Endings and beginnings have their place in your life and treat them with the respect and honor that they deserve. You are that much freer to make a new set of decisions.

CANCER An extra potent moon cycle and with this you are in line for a lot of transformation and insights. This is an amazing time for change on the planet and the way you view situations will truly color your world. The solar eclipse is when the moon crosses the face of the Sun and in this case will completely obscure it. Sun and Moon in Scorpio brings intensity and passion. At the end of the month the earth comes in between the Sun and the moon and brings a hidden emotional agenda. Usually it takes a few months to work through these challenges and transformations. A great time to delve into your psychological nature.

CAPRICORN There’s a lot of focus on the Saturn/Chiron connection as we move through these times of transitions and change. By now, you are getting use to transformation as it brings death and renewal. Sometimes it is hard to see the wood for the trees, and this is where that spiritual healing enters your life and takes you by the hand and allows you to take up residence in your heart. So much love is apparent as you pass through these challenging times. Certain quietude overtakes the business of everyday life and you feel deeply into your true self and authenticity, also discovering what truly does matter to you.

LEO The Sun is eclipsed by the Moon. For a moment you get to feel the darkness and as the light returns you are not ever quite the same again, for what has been revealed to you brings the necessity for change. Transformation can be a challenging ordeal if we jump into the mental realms and try to work it all out and with the Full Moon at the end of the month in Gemini this is exactly what we’ll be trying to do. Confusion will ensue if you stay too cerebral. It’s apt to happen anyway during retrograde times, although you really won’t be able to integrate all of it until well after the event. Follow your instincts.

AQUARIUS Uranus makes a brief trine to the Sun at the end of the month and finally sheds some inspiration on your life. Some times the motivation to carry on dims and we can’t quite find our passion. You have a little reprieve from this then, as the Sun highlights your forward motion. Be bold and act in ways and do things that you haven’t dared before. Seize the opportunity to make amends and to make new inroads on old territory. There is a depth to your relationships now that is bringing much needed healing through mental understanding and the tangible feelings of compassion. Allow your compassionate heart to expand.

VIRGO What’s motivating you at this time? Take a close look at the driving force behind your actions and decisions. This is a great time, during retrograde Mercury to take a close look at your motives and cognitive processes. Saturn trine Chiron is bringing healing to your life through introducing new structures and a renewal in your spiritual practices. As you delve more deeply into your emotional self, possibly more than ever before, a new understanding awakens in your mind and is followed by transitions in your outer world. The very way you relate to others is being deeply modified with this understanding.

PISCES Neptune has moved forward and although is leaving the ranks of Saturn, will meet up again to take new directions in May/June next year. This is also the time of the next Pluto/Uranus bash and promises to bring in even larger changes to your life. Be prepared by doing your grounding work now and doing as much as you possibly can to keep your connection to your Divinity always on track. Intuition is going to be your guiding light through these times and when reality alters so much that it becomes unrecognizable you’ll be really glad that it is functioning so acutely. Listen to the still small voice within when everything else confuses you.

C/Ns/G-30 May 12

C/Ns/I-19 Sept 12

C/Ns/I-19 Sept 12

Follow daily updates on my facebook page vibhutianjali Copyright © 2012 Vibhuti-Teri Norris You can read all past articles of Horoscope at www.BaliAdvertiser.biz C/Ns/G-08 August 12


Place your ad online at

www.BaliAdvertiser.biz

e

ve r

e al E

ea al Estsatate • Bali AAd dver r

• te

l state • Bali Ad er a e l E te • Bali ve

eal

r • te • Bali Addvveertiser R te Bali A rtiser R R

ali Advertis e r •B dve te Bali A rtise R

e • Bali Ad t a t Es v

rt dveer

e a l E s t a

Bali Advertiser

a

Ba l

d ve iA

t se ti

Es dv r i A dverrttiisseer RReeaal Est ta l E iA st a

ti ser R eal Estate • Ba l i rR • l

iA

al Estate • e R r al Esta B e t e s e ti ser R eal Estate • Ba al


Seminyak:

Batu Belig:

Umalas:

Location, location, location! Though set on only 2 are land this well designed villa gives a much spacier feeling. Only walking distance to the beach and shops this open plan villa is a perfect investment/rental object. Already in operation since May 2011, this villa will give the new owner a healthy return for the years to come. Available with an 18 years or as a 25 years lease contract. Leasehold: IDR2.5000.000.000 (18 yrs)/ IDR3.150.000.0000 (25yrs)

In a strongly upcoming area in Batu Belig, though set on almost 4 are land, this well designed villa gives a much spacier feeling. Only walking distance to the beach and close to Canggu Club and restaurants, this open plan villa is a perfect investment/rental object. Already in operation since 2010, this villa will give the new owner a very healthy return for the years to come. Available with a 24 years lease contract extendable with another 20 years. 24 years leasehold: IDR 3.150.000.000

VILLA “PURI Bali-Passion”, is a new and stunning unique, modern tropical villa with private pool. The VILLA is THE AFFORDABLE alternative for hotels and super luxury private Villas. The VILLA consist of 6 bedrooms and 2 guestrooms, all large en-suite rooms with sitting corner and balcony. Tropical style with classic Balinese inÁuences with thatched roofs, a chef’s kitchen and a half open dining and sitting/TV area. The 2 master suites in front of the pool and the ground Áoor guestroom contain a half open garden bathroom with terrazzo bath tub. Leasehold 47 years: IDR935.000.000

Contact Mark: 081237893294/mark@indohomes.com

Contact Mark: 081237893294/mark@indohomes.com

Contact Mark: 081237893294/mark@indohomes.com

Canggu:

Sanur:

Sanur:

Located in a small and authentic village Tumbak Bayuh/ Canggu area, this beautiful and uniquely designed two-story luxury villa is surrounded by lush tropical garden, bordering a river, providing a calming and natural atmosphere in utmost privacy. It has its own private access road, giving the villa maximum calmness, while only half an hour from ‘where it all happens’. The open living area is situated under the villa’s soaring roof. The Bali pool villa also has a dining area complete with a fully-equipped kitchen and a bar. The villa features 4 air-conditioned en-suite bedrooms. Freehold: USD1.000.000

This magniÀcent, 4-5 bedroom with en-suites, villa comes with 45 years remaining lease, with an option for a further 50 years. The Land area is 12 ARE. The built-up area is approx 500m2. All rooms have air-conditioning and the villa is supplied by well water which is puriÀed with activated carbon Àltration. The price includes all Àtted Àxtures, white goods, appliances, etc but not loose furniture. All the legal documents are in good order and have been checked by Indonesian law Àrm. Leasehold 50 years: USD790.000

Built in 2005, with a 50 years lease, the villa features two bedrooms/two bathrooms and a private pool; the design is unique among the Bali Emerald Villas. Construction combines Balinese and modern architecture design with superior building standards throughout. Fully air-conditioned, High-quality wooden doors and windows Àtted with screens for all-season comfort. This is your perfect rental unit in central Sanur, guaranteeing a very nice return for the years to come. Adjacent parking area included. Leasehold 43 years: USD275.000 -

Contact Mark: 081237893294/mark@indohomes.com

Contact Mark: 081237893294/mark@indohomes.com

Contact Mark: 081237893294/mark@indohomes.com

Candi Dasa:

Ubud:

Ubud:

Jasri absolute beachfront land is located 15 minutes from Candi Dasa. A 4.5 meter wide access road has been constructed which land locks (meaning the buyer will control) up to an additional 2 Hectares of surrounding land. A clean water river runs beside the land all the way to the front of the land. The land is facing the ocean and has a full mountain view on the back; it is surrounded by 50 hectares rice Àelds. Excellent for investment, or Eco village retreat. Currently 3 villas are located within 500 meters of the land. Freehold: IDR9.180.000.000

This beautiful villa offers what most people are looking for: modern tropical style, killer rice paddy view, quiet location yet minutes away from shops and restaurants, nice size garden, perfect dimensions. If you think this is all, there is more: The villa was built by Bali’s nr. 1 home builder; Populaire Residences, which means that termites will never be an issue, all electric wiring to western standard, high quality kitchen, doors, and Ànishing etc. This villa is perfect for residential or commercial use! Villa with land lease for 24.5 years will be US$ 265,000 Villa with land lease for 34.5 years will be US$ 280,000 Villa with land lease for 44.5 years will be US$ 295,000 Villa with land lease for 55.5 years will be US$ 315,000

IF YOU WANT THE BEST, BUY THE BEST, 31 are top quality. Áat riverfront land with stunning views land in Singakarta, Ubud with possibility to buy 10 are more; all riverside with rice terrace views, no neighbors, 6 minutes to Ubud. No more land left like this guaranteed. IDR295.000.000 PER ARE Freehold: IDR9.145.000.000

Contact Mark: 081237893294/mark@indohomes.com

Contact Mark: 081237893294/mark@indohomes.com

Contact Mark: 081237893294/mark@indohomes.com

Private Villa Rental & Villa Management Services Respected companies like Indovillas are commonly family run and offer much more personalised and warm business dealings. Indovillas have been in business since 1998 so know the market well. They specialise in Bali villa rentals, villa management, real estate, as well as activity arrangements. A turnkey solution. If you are looking for a reliable business to manage & promote your property investment in Bali then you have come to the right place.

Call us on 0361 8475942 or email: info@indovillas.com

C/Re/G-14 Nov. 12


84

Real Estate

Bali Advertiser

14 November - 28 November, 2012

House for Sale Located only 15 minutes to Seminyak and 10 minutes to Denpasar City. Two-story House, land size 144 SQM, building size 200 SQM freehold. Living/Dining Room, 5 Bedrooms (3 with AC), 1 Office room, 4 Bathrooms, Kitchen, Balcony, Cable TV (indovision) and carport 2 line phone and Facsimile, Wifi (internet Connection) Address: Bali Griya Residence Jalan Gunung Atena, Denpasar Price Rp 1.300.000.000

Contact : 081 238 31444

Ubud - brand new 2 bedroom pool villa 150 sqm living Space on 600 sqm land. Overlooking rice fields. Master and guest bedrooms w. AC & en suite semi open bathrooms. Fully equipped kitchen,dining & living room. Infinity pool, deck & gazebo. 24 hour maid service & security Info contact : rollandlickert@yahoo.com Hp. 081 812 380 2358

● Sanur close to the beach fully furnished

2bdr villa lease 42 yrs US$ 320.000. ● Jimbaran near the beach 3bdr hse fully furn. on 22 are with 1000m2 vacant land for any other business purpose. Lease 23yrs US$ 395,000 ext. ● Kuta - Tuban near airport & Jl. Kediri 11are land Rp.160mill/yr, min 15 yrs! ● Jimbaran-Taman Griya Semi furn. 2/3 bdr villa on 275 m2 for sale US$ 270,000; rent per 2 years Rp. 250 mill. ● Tabanan - Kelecung 845m2 land near the beach Rp. 65 million /are.

& near the bch beautiful 3 bdr Eur. style villa on 10 are for $ 385,000. Also 11 are ready to build walled land for only Rp. 900,000,000! ● Sanur - Padang Galak near the river 3 are land for Rp 350 million / are. ● Tabanan - Kerambitan Villa Sawa; cozy 4bedr colonial style villa on 13 are freehold Euro 175,000. ● Tanah Lot - Munggu near Canggu and the beach 18,5 are land with rice field & mountain view Rp.80 million / are. ● Sanur - Fully furnished villas for rent; 4 bdr Rp. 130 mill/yr - 2yrs Rp. 250mill & 3 bdrm Rp. 120 mill/year - 2 years Rp. 230 million.

“APEX” is Dutch owned and also specialized in Visa Info 0361 724 262 I 081 835 8707 baliconsult@apexpertise.com & Business Consultancy www.apexpertise.com Visit our website for more exciting properties! NC/Re/P-14 Nov. 12

Indonesian : +62 858 5994 4900 , + 62 81 755 0031 English : +62 821 4757 1967

LAND FOR LEASE Quiet hill top location near Greenbelt.

Madenan, Tejakula 7.5 are land for sale hillside ocean and mountain views ready to build 45 min from Singaraja. Ashpalt road electric and water. Invest Now price nego. Bali contact Putu Mandala 0878 6139 4855 Australia Jenny Farrell e-mail <koogah1508@yahoo.com>. [5859]

Please call :

DENPASAR

Land for sale 2.27 hectare location Tegalalang Ubud, great view, water spring, road access 4.5m. Phone: 0852 3714 4456 Made Hayer. [1869] Villa for sale Country Estate near Ubud. Ideal for private home, villa or retreat center, ricefield & river view. Lap pool steam room & spa. Call 0812 394 8595 for inspection. [1143]

Land for sale in Tegalalang Ubud. 150 are, very good view. In front of Hotel Puri Bagus Jati. Please contact 0852 3714 4456. [4870] Brand new luxury riverside villas for sale. 3bedrooms with ensuite bathrooms, open living/dining room+kitchen, pool and garden in secure and quiet location. Call : 0818 0562 9333 or <austinone23@gmail.com>. [5833]

avanee residence BALI

Land for sale located North of Ubud from central Ubud less than 10 minutes. Land size 4400m2. Good for villa and resort. Contact person 0812 3999 1763. [5895] Land for sale located North of Ubud from central Ubud less than 10 minutes. Land size 1170m2 including small house, 3 bedrooms, 1 bathroom, kitchen and terrace. Contact person 0812 3999 1763. [5896] “Fully furnished studio apartment for your short and long stay needs”

ONLY Rp. 2 million / month

Perumahan Graha Kencana Jl. Imam Bonjol, Denpasar Bali - Indonesia Phone: +62 361 8888033, 081 999 696 334 www.AvaneeResidence.com C/Re/G-18 April 12

DENPASAR House for rent 1 living room, 2 bathrooms, 2 bedrooms with 1 bathroom inside + family room, kitchen, garden. No garage for car, 150m2 building. Rp. 15 juta/year. Call 0823 4172 5253 for inspection. [5461] House for rent. Minimalist 2 storey house, 3 bedrooms + AC, 2 livingrooms, kitchen, garage, garden. Jl. Marlboro XVII No. 16, Teuku Umar Barat. Call 081 7979 0278 or (0361) 857 7145. [5646] Kost exclusive, strategic location. Facilities: AC, LCD TV 32”, hot water, refrigerator, kitchen set, full furniture, back terrace, carpark. IDR 225.000/day, IDR 1.100.000/week, IDR 1.800.000/month. Casa Nemo; Jl. Palapa 11 Gg. Nemo No. 4 Sesetan Denpasar. Please email <crescent.freija@ yahoo.com> or SMS 0852 3754 2274. [5588] Overcontract Kost Exclusive, 15 years, 14 rooms, fully furnished, LCD TV, hot water, refrigerator, kitchen set, carpark. Good investment. Price IDR 2.5 Billion (nego). Please email: <nyomanaril@gmail.com>. [5589] Overcontract futsal, Renon area. Two fields, 5.5 years. Only serious, please contact : Yuli 0813 8216 1248 or e-mail : <info.soccerrepublicca@gmail.com>. [5888] 2 storey house for sale located in Jalan Tukad Balian, Renon. Land 1.5 are, good access, Rp. 1.65 billion (nego). Please call 081 2394 8595. [5864]

C/Re/G-11 July 12

NC/RE/U-14 Nov. 12

CANGGU / ECHO BEACH

Land for sale in Payangan, 24 are, very good view. Contact 0852 3714 4456 Made Hayer. [1553]

NC/RE/U-22 Aug. 12

(address correction)

For private sale, beachfront land, Pantai Gorontolo, Labuhan Bajo, Flores, next to Jayakarta Hotel, Sealed road access, PLN and PAM. 26154 M2. SMS only to 0819 1612 4192, or <labuhanbajosite@gmail.com>. Buyers only. [5370]

UBUD

Full title deeds available for inspection by appointment with owners on:

Contact: petitengetrestaurant@gmail.com

OTHERS

Balian beach surf land for sale. 3 hectare, ocean views, easy access, price Rp. 90.000.000 per are (negotiable). Land for sale in Karangasem. 54 are in this land plant about 500 teak trees growing very well, Rp. 65.000.000 per are. For any further info please feel free to contact Ayu @ 081 2363 5278 or via e-mail: <ayushankari@ gmail.com>. [5883]

4 Are absolute beachfront freehold land with spectacular ocean views at Bunutan Beach Karangasem, East Bali, in the beautiful fishing village of Amed. Rp. 120jt/Are

Located on Jalan Petitenget with neighbors include a luxury hotel, existing restaurants, spas, and bars. High traffic, successful existing business, serious inquires only - no brokers

C/Re/G-14 Nov. 12

NC/RE/U-14 Nov. 12

● Padang Bai in the high lush green outcrops

Restaurant For Sale in Petitenget (next to L Hotel)

081999982990 / 081916404769 NC/G/M-17 Oct. 12

Beautiful Hill-Side Property For Sale By Owner 7km from and overlooking central Negara city (West Bali). Fantastic views (Jimbaran to Java). Lots of trees (clove, cocoa, coconut, lemon, etc). Small 2 bedroom house, 2,200 watt elecetricity. Mountain water piped in, asphalt road. 100 Are, 1 Hectare Rp. 10,000,000 (ten million rupiah) per are.

Telp. 0813 3753 4054 or 081 138 7767 b_kens@yahoo.com NC/RE/U-03 Oct. 12

TAMAN AYU VILLAS Located in the hilly area of Jl.Taman Giri - Mumbul Nusa Dua near the new toll road & University Hospital Unique 3x4 bdr Villa depelopment designed by Dutch & Balinese architects and built under Dutch supervision Villa is semi-furnished with a landsize of 235 m2 and living area of 200 m2 From second floor view over the hills, the ocean and Tanjung Benoa!

FREEHOLD: US$ 385,000

“APEX” is Dutch owned and also specialized in Visa Info 0361 724 262 I 081 835 8707 baliconsult@apexpertise.com & Business Consultancy www.apexpertise.com Visit our website for more exciting properties! NC/Re/P-14 Nov. 12

BONA VILLAGE INN FOR SALE LOCATED IN GIANYAR - BONA BLAHBATUH NEAR BYPASS, SANUR, UBUD, SABA & KERAMAS BEACH, SAFARI & MARINE PARK, OFFERING 12 UNITS ON 2750M2 WITH ALL FACILITIES & LICENSES, RESTAURANT, BILLIARD & FITNESS ROOMS, SPA & FINLAND SAUNA Price reduced from Euro 750,000 Now Euro 540,000 Info 0361 724 262 I 081 835 8707 baliconsult@apexpertise.com Visit our website for more exciting properties! www.apexpertise.com NC/Re/P-14 Nov. 12

BERINGIN PROPERTY Local Agent and Local Prices

The only Property Agent based on the west coast of Bali

LAND FOR SALE CANGGU - Padang Lenjong 15 Are, 3.5m Road access, villa residential, Ready to build. Freehold. PRICE : IDR 375 Mill/Are - Padang Lenjong 5 Are, 4m Road access, Rice paddy views, Ready to build. Freehold. PRICE: IDR 500 Mill/ Are - 25 Are, Main Road access, Ready to build. Freehold PRICE: IDR 400 Mill/ Are PERERENAN - 24 Are, 4m Road access, Ready to build, Frreehold PRICE: IDR 450 Mill/ Are SEMINYAK - 2 Are, 5m Road access, Ready to build. Freehold. PRICE : IDR 900 Mill/ Are TUMBAK BAYUH - 20 Are, 4m Road access, rice field paddy views, Ready to build. Freehold. PRICE : IDR 210 Mill/ Are

LOMBOK - 1.3 HA, Beachfront Labuhan Lombok, Sealed Road access, Ready to build. Freehold. PRICE : IDR 10 Mill /Are - 2.8 HA, Beachfront Labuhan Lombok, Sealed Road access, Ready to build. Freehold. PRICE : IDR 10 Mill /Are

Jl. Darmawangsa No. 1, Tanah Lot - Bali - Indonesia Phone: +62 361 8483743 Fax: +62 361 8483743 Web: www.beringinproperty.com Email: info@beringinproperty.com / beringinproperty@yahoo.com C/Re/I -14 Nov 12


A brand new development of luxury villas with fantastic OCEAN VIEW and 5 stars resort FACILITIES including on Site Management, Beauty Salon and spa, restaurant/bar, 24 hours room service, Communal 25 meter lap pool, secure off street parking, Gym, Security Post, Wireless broad band Internet, Minimart etc. located just 5 minutes from Dreamland.

ä&#x17D;&#x192;âˇ&#x2014;ăŚ&#x152;㞣âł&#x192;ä?&#x161;⭼⟥âż&#x2039;â˘&#x2018;ă­&#x153;áˇ?ä&#x2021;ąă&#x2014;Żâż¤â&#x;&#x201E;â­Ľâź&#x201E;ă&#x2C6;&#x2018;⟎㞨ă&#x201A;&#x2014;â°Šă&#x201A;şâŤ&#x2020;â­ĽăŞ&#x2030;ăŹ&#x160;áˇ?â&#x;?ă&#x17D;&#x2030;㝡â§&#x201A;âš˝ă?&#x17D;㾌ⰴáˇ?ă&#x2014;ĄăŚžăŠ&#x201D;ă&#x2019;&#x203A;⟎ăŻ?ă&#x2018;§áˇ?⤎ăł?áˇ? ă&#x2C6;§â&#x17E;Şáˇ?ăž&#x201A;ăŹ&#x2019;ă&#x2039;Žâł â´&#x;ăš&#x2019;áˇ?⪏ăŞ&#x2C6;ă¤&#x2122;âš&#x152;ä&#x2021;¤â­Ľă&#x2014;¸â§&#x2026;ä&#x2021;&#x;⧚áˇ?â&#x17E;&#x201C;ăŚ&#x152;â­Ľăľ&#x201E;â§&#x2013;â§&#x201A;áˇ?ă&#x2026;&#x201A;ăŞ&#x17D;âł áˇ?âĄ&#x201E;â&#x17E;&#x201C;âśťă¸&#x153;áˇ?㸿ăź&#x20AC;ă&#x152;&#x17D;âŤ&#x2122;㊰ăś&#x2122;áˇ?ăž&#x201A;â§?㏹ â­Šáˇ?ă°?ă?&#x152;â&#x17E;Žă?&#x2020;â­&#x203A;â­Ľă&#x2014;Żă&#x2C6;&#x201D;(Dreamland)âź&#x201E;ă˛&#x201C;ă&#x2020;&#x2014;ⳡä?´áą&#x201E;

presents...

7+(2&($19,(:6

BENEFITS:

ăž&#x2C6;ä&#x2026;&#x2021;áˇ&#x203A;

- Own freehold villa with 5 star resort facilities  ä&#x2021;&#x2013;ä&#x2021;ą㞨ă&#x201A;&#x2014;â°Šă&#x201A;şâŤ&#x2020;ăŞ&#x2030;ăŹ&#x160;â­Ľâ˘&#x2018;ă­&#x153; - Early purchase will enable you to maximize your capital gain  ă&#x2C6;&#x201A;ä&#x2039;&#x2C6;âš&#x203A;ă&#x2022;&#x201C;áˇ?  ăŹ&#x161;ă&#x203A;&#x203A;ă&#x161;˝ă&#x2026;&#x152;ä&#x201C;ŤâĄ&#x;㏜ä&#x2026;&#x2021;ä&#x201D;?ă&#x201A;˛âż? - 3 years guarantee rental return 24%  âĄ&#x201E;ä?&#x2026;ă&#x203A;&#x2039;â­Ľä&#x201D;&#x192;ă&#x2020;&#x2018;âżšâĄ&#x2030;ă&#x201D;Ťă¸&#x2039;áˇ&#x2020; - Located among the famous tourism destination area in Bukit  ă¸&#x153;ä&#x2021;ťâ&#x17E;Žă?&#x2020;ă&#x161;°â&#x;&#x152;â­&#x203A;ăš&#x2026;ă&#x201A;&#x2039; %XNLW ä&#x2018;&#x2122;ă&#x2DC;&#x153;â­Ľ  ă&#x2C6;&#x2018;âŽ&#x201E;ă¤&#x2122;ä&#x2C6;&#x201C;ä?ą - Fantastic ocean views  ă&#x2039;ŞâšźăŠŽă&#x2014;Ąă&#x2DC;?â­Ľâź&#x201E;ă&#x2C6;&#x2018; - Minutes away from international airport, Dreamland Championship  *ROI&RXUVH ÂżQHEHDFKHVLQ  Bali  ă?&#x152;âş&#x203A;ă&#x201A;Ťă&#x20AC;&#x203A;â§&#x201A;áˇ?ă&#x2014;Żă&#x2C6;&#x201D;ă&#x2020;&#x2013;â˘&#x2039;ă§?âˇ&#x20AC;âą&#x153;â´&#x201C;ă¤&#x201C;  â§&#x201A;áˇ?⟎ä&#x201E;&#x153;ăž&#x160;ă&#x2014;Ąâź¤â­Ľâź&#x201E;ă˛&#x201C;ă&#x2020;&#x2014;ăŹ?ă&#x201A;&#x2122;ⳡä?´

WHY BUY THE OCEAN VIEWS?

ă¸&#x2039;⟯ä&#x201E;&#x2039;âš&#x203A;ă&#x2022;&#x201C;âź&#x201E;ä&#x201A;&#x201D;â´&#x2C6;ă&#x2C6;&#x2018;â˘&#x2018;ă­&#x153;ᡠ GOLDEN INVESTMENT ä&#x17D;&#x192;㏨âˇ&#x2014;ăŁ&#x2C6;ä&#x160;šă&#x161;˛â´&#x2039;â­Ľăľ&#x2014;ä&#x201C;Ťă&#x20AC;&#x203A;ă&#x20AC;&#x201A;

TOURISM DESTINATION CENTRE â˘&#x2018;ă­&#x153;â­šâŽ&#x201E;ă¸&#x153;ä&#x2021;ťă&#x201D;¤ä&#x2021;Żă&#x161; â­Ľâ­šâ­Ľä?ąăžĽ

200% better than bank deposit ⥊ä&#x2026;&#x2122;ăžąâŤ&#x2021;ă&#x152;?⟤áˇ&#x2020; Bali to be the host of Miss World 2013 event and Miss World Contest in 2014 â&#x17E;Žă?&#x2020;â­&#x203A;ă&#x2026;&#x152;ă&#x2C6;şâ&#x;?ă&#x203A;&#x2039;㏥ă&#x2020;&#x2C6;ăž&#x201A;ă&#x2020;&#x201E;ă&#x20AC;?â°?áˇ?â¤&#x192;ä&#x2018;&#x2DC;â&#x;? ă&#x203A;&#x2039;㏥ă&#x2020;&#x2C6;ăž&#x201A;ă&#x2020;&#x201E;ă&#x2C6;&#x203A;ă§?

Minutes away from Dreamland Golf Championship Course, International Airport, Padang-padang and Uluwatu beach ă?&#x152;ä&#x201E;ľăťŁâ­šâŽ&#x201E;ă&#x2020;&#x2014;ăŹ?ă&#x201A;&#x2122;ⳡä?´áˇ&#x203A;âş&#x203A;ă&#x201A;Ťă&#x20AC;&#x203A;â§&#x201A;áˇ?ă&#x2014;Żă&#x2C6;&#x201D;ă&#x2020;&#x2013;â˘&#x2039;ă§?âˇ&#x20AC;âą&#x153;â´&#x201C;ă¤&#x201C;â§&#x201A;áˇ? 㸝ă&#x201D;&#x201D;ăś&#x20AC;ăľ?âź&#x201E;ă˛&#x201C; (Uluwatu)áˇ? â&#x17E;Žâ°&#x152;âź&#x201E;ă˛&#x201C; (Padang Padang)

THE BEST QUALITY CHOICE âˇ&#x20AC;ä?Ťă&#x2018; â­Ľä&#x201D;?ă&#x201A;˛ä &#x201A;ä&#x2039;&#x2019;

REASONABLE PRICE ă&#x201A;źâˇ&#x2019;âź°ă?&#x17D;

Developed by a trusted contractor ä&#x2021;Şă&#x2039;ŞăžŚă&#x17D;&#x2013;⭼⧹â&#x;?㊭ă°&#x161;ă&#x2039;&#x2039;âł&#x192; APEC Summit 2013 to be held in Bali 2013ă&#x203A;&#x2039;ä ¨ă˛&#x152;ă&#x2C6;&#x17D;âź°ä&#x201D;&#x160;ä??â´&#x2020;ă&#x20AC;&#x201A;ă&#x2026;&#x152;ä&#x160;ťâ&#x17E;Žă?&#x2020;â­&#x203A;ă&#x2C6;şăžą

At US$368K you can own a freehold villa with 5 star resort facilities âż&#x2030;$368,000ă&#x2014;Ąä&#x160;&#x2039;ă&#x203A;&#x203A;ă&#x201A;&#x2022;ă&#x2039;Şä&#x2021;&#x2013;ä&#x2021;ąâ&#x;?âź?5㞨ă&#x201A;&#x2014;â°Šă&#x201A;şâŤ&#x2020;ăŞ&#x2030;ăŹ&#x160;â­Ľâ˘&#x2018;ă­&#x153;

Websites ăś&#x2122;ä?&#x;: www.bali1stop.biz, www.theoceanviews.com For further information ă§&#x2C6;ăż&#x2030;âˇ?âą ä&#x201C;Ťä &#x2014;Email ä&#x2021;Ťăź&#x2026;: info@bali1stop.biz Phone âŽ&#x2C6;âż&#x2018;: +62 361 782 2202, +62 361 895 4035 Mobile ㏡ă&#x20AC;&#x203A;: +62 816 57 4867 C/Re/I-25 July 12


86

Real Estate

Bali Advertiser

14 November - 28 November, 2012

CANGGU

CANGGU

NUSA DUA

Villa for rent: area 3 are, 2 bedroom, living room, kitchen, aircondition, hot water, swimming pool, big garden. Contact Made: 081 2363 0309 / 0819 1665 9151. [4134]

200m to Canggu Club: New villa for sale. 3 are. 3 bedrooms. Swimming pool. Leasehold 25+25 years. Modern apartment for rent/sale. 1,2,3 bedrooms. Full furnished. TV/DVD/ cable-TV. Internet. Housekeeping. Security. Contact: <nanidbali@yahoo.com> / +62 81 6180 0699. [5919]

2 houses for rent, 2/4 bedroom (daily, weekly, longterm rental), furnished/unfurnished possible, quiet area - Land for rent/sale 5 - 30 are - All locations close to Geger Beach, 0361-777 092, 0361-877 1711 or e-mail <balifamily2000@ yahoo.de>. [5041]

New villa for rent in Canggu Echo Beach, 3 bedrooms, furnished, pool, garage, breezy and nice views. Call 081 7974 0798 / e-mail: <tnr_789@yahoo.co.id>. [5922]

For sale car wash with workshop (car repair station). Land 10are with stainless roof. Rp. 3,5 billion (nego). Call Made for inspection (direct owner) 0818 0555 5594. No broker. [5259]

For sale freehold or rent 2 villas, 3BR on 500m2 with pool, luxury 4 BDR on 700m2 with pool + jacuzzi, full paddies + river view, 5 min from Canggu Club. Jl. Pantai Brawa, Gg. Bisma. 0812 3672 2812 / 0812 3619 9241. [5132] Exclusive location. Sale land of 3000m2 located between Batubelig and Brawa, 200m from the beach, leasehold 30 years, renewable. Call 081 1224 7419 / <dna.natalie@ yahoo.com>. Contact Math. [5807] Daily rent. 2 bedrooms villa in Canggu + car/driver/fuel. 100 Euro per night. Minimum 3 nights. Check : <www. adailystay.com>. Villa photo : Matahari Villa Bali. <info@ adailystay.com>. [5842] 2 storey 3 bedroom 3 bathroom furnished villa with pool. Master bedroom upstairs with sun deck and lounge area. At end of lane overlooking rice paddies. $12,000 Aus/year. Contact Cathy at <cathy.rowe88@yahoo.com.au> or Made 081 734 6505 / 0812 3642 9537. [5868] Villa for rent in Canggu area, 500m from the beach5 bedrooms, 1 pembantu bedroom + bathroom, big garden and swimming pool. Rp. 160.000.000/year. Please contact directly the owner Hp: 081 7471 0208. [5870] House in Canggu for rent only in second floor, private with balcony, connecting 2 bedrooms with AC every room, fully furnished, 32â&#x20AC;? LCD TV, washing machine, CD player, Rp. 600.000/month/2 rooms. 0812 3636 3597 / e-mail: <noniekawaty@yahoo.com>. [5871] Daily and monthly new modern tropical style villa. Best location in Berawa. 7 minutes walking to the beach and Canggu Club. 3 bedroom and bathroom, livingroom, kitchen, study room, pool, small garden, carpark, and ricefield view. Yearly available from February 2013. Contact : (0361) 871 5116 / 0818 0551 4128. [5873]

Beautiful villa for rent. Located Echo Beach, 2 bed, 3 bath, full kitchen, fully furnished, private pool, great location 2 mins to beach, boutique shops, cafe, restaurants. Yearly Rp. 180 million, min 2 years available Feb. 2013. Call 0878 6237 4036 pics <justinmckinley@live.com>. No agent. [5814] 4 beds villa for rent. Swimming pool, garage, volcano view, all equipment, calm area, 1 year contract Rp. 90 million. Call 0878 6087 5729. [5891] For rent daily/monthly near Echo Beach. Beautiful villa on 660sqm, big pool, garden, gazebo, ricefield view with 3 bedrooms, 3 bathrooms, open livinroom and kitchen. TV-sat, Wifi and maid. Please contact 081 890 0480 for more info. [5784]

Available from November onwards.

Area: Seminyak 2 and 3 bedrooms. Umalas 3 bedrooms. Private swimming pool + WiFi + TV Satelite + Staff service Call: +62 (0) 85333566990 & +62 (0) 81999906535 Email: merlindabali777@gmail.com

3 BEDROOM VILLA FOR SALE LEASEHOLD

17 years from Feb. 2013 3 bedroom, 31/2 bathroom, fully furnished with all new mod cons, including leather lounges, recycled teak furniture, new kitchen with ice maker fridge and 90cm stove.

For rent nice and quiet bungalow. Full wooded 47sqm, 1 bedroom, small kitchen and living area, AC, Wifi, safety box, staff night Rp. 500.000 week Rp. 2.500.000 month Rp. 6.500.000, no agency please. 0819 1671 2667. [5909] Beautiful land in Pererenan, surrounded by paddies field (freehold). Very suitable for villa complex or residential with plot size 1.130 sqm (35m x 32m). 5 minutes driving to the beach. Price IDR 6.5 million/meter. Contact 0858 5106 6866 / 081 1380 4417. [5912] Beautiful 2 bedrooms villa for rent in Batubelig great location, 5 minutes drive to Canggu Club & beach. Fully furnished with kitchen, living room, swimming pool, garden and parking space. 2 years minimum and direct owner. Call 0812 3707 1762 / 0878 6223 9327. [5913]

Villa project standing 3 room / livingroom, garden, swimming pool, 2 floor, green zone / river view, very relax area, last land in street, price Rp.1.500.000.000 20 year/ 20 year. Contact 0819 3306 1984 (English) / 0819 9966 0007 (French). [5640]

Freehold land 965m2 and 2700m2 (will split). Amazing views, flat land, good access road and elec, close to Brawa beach, Seminyak & Echo Beach, perfect for private villa $40,000/are. <integrity.fyi@gmail.com> / Steve: +62 812 3612 6802. [5916]

Berawa Beach, small villa/holiday home. Walk to beach. Great investment. Great location. Freehold. Town water. 5000watt. Land 169sqm. Must sell Rp. 1.850.000.000. No SMS. Phone 0819 3303 6636. [5884]

Brand new house for sale. 2floors, two bathrooms (one with bathtub, Western toilet, shower), hot water, 3 bedrooms, one laundry room, TV-cable, telephone cable, PDAM and well water, electricity, IMB, garage, kitchen set, granite bar table, built on Western style. Land 1Ara, building surface 168m2. Ask for Rp. 925 million. Location: Dalung-Canggu, 20mins from Canggu Club. Call owner Kadek @ 0819 9971 3591 or e-mail: <kadek_sari@ hotmail.com>. [5440]

Villa for sale freehold close to Brawa Beach. 3 bedrooms+ 1 staff room, carport, private pool, living room and kitchen. Ricefield view, Jl. Pantai Berawa, Gg. Toya. Contact 0818 0539 9311 / <gentaproperti@gmail.com>. [5886]

HOLIDAYS RENTAL VILLA

Pool, Internet, cabel TV, nothing to spend just move in. Reluctant sale and priced to sell at AUD 235,000. Loc. off Jl. Nakula in Campuan 2 Legian.

NC/Re/M-14 Nov. 12

Canggu Set amidst pristine rice fields in Canggu, a leisurely 2 minute drive to the famous Echo Beach, 15 minutes drive to Seminyak area. This is a villa complex of peace & tranquility. 2 private villas ready & 2 more being built. The complex is set to feature three & four bedroom villas. Each villa, furnished with custom-made tropical-contemporary style furniture that suits the indoor outdoors climate in Bali & private swimming pool. Contact: Andre Tittle: Hak Milik 3 bedroom: IDR 4,000,000,000 0361 8889993 4 bedroom: IDR 5,000,000,000 andrewijaya_email@yahoo.com C/Re/I-17 Oct 12

LOOKING FOR

REAL ESTATE All ads Rp. 7.000 per word All ads must be paid before printing

We are looking for land and villas for sale, location in Jimbaran, Bukit and Nusa Dua. Contact us in Exotiq Property Jimbaran. Agung 0819 3613 7610, Wayan - 0819 1645 0672, Luki - 0819 9984 9123. [001]

Contact BALI ADVERTISER

Jl. Majapahit No. 46 Kuta - Bali Telp : (0361) 755 392 [Hunting] Fax : (0361) 764 191 E-mail: info@BaliAdvertiser.biz C/Re/I-14 Nov 12


exotiqproperty.com Prime Oberoi Retail Space

Canggu

BB-B207

The lease is for three years with a three year guaranteed extension. The space is suitable for fashion, interior, coffee shop or ofÀce. Lease starting January 2013. Rentals payable upfront for 3 years. Seminyak

• Three-bedroom single level Canggu paradise villa • Sit on 500m2 plot for 25 years lease with option to extend based on market price • Open plan living/ dining and kitchen area with high ceilings, hardwood Àoors and built in furniture, additional guest toilet available • Large garden, 13 x 3 metre swimming pool and two parking spaces for cars • Six-minute drive from the beach &close to int.schools, restaurants and shops

• 120 m2 (10 m streetfront x 12 m) plus 70 m2 (10 m x 7 m) parking at IDR 540 million per annum • 90 m2 (7.5 m streetfront x 12 m) plus 52 m2 (7.5 m x 7 m) parking at IDR 440 million per annum • 60 m2 (5 m streetfront x 12 m) plus 35 m2 (5 m x 7 m) parking at IDR 300 million per annum

• • • •

For Sale IDR 2,500,000,000 Adami Gilberto (62) 812 4658 8471 Seminyak Of¿ce (62 361) 737 358

Contact: Josephine (62) 361 747 5895 Erika (62) 361 745 3434

For Sale USD 1,700,000 Patrick Clancy (62) 817 973 3031 Seminyak Of¿ce (62 361) 737 358

Umalas

BB-V1035

Dreamland

• • • •

Umalas freehold new built villa Open plan three bedroom modern minimalist villa sit on 255sqm of land Build with quality and attentive details to a western standard, fully furnished Nestled secluded amongst the natural green of trees and rice ¿eld in well established community of exclusive villa in the neighbourhood • Only takes 10 minutes to enjoy the beautiful scenery on the Seminyak beach

• • • • •

For Sale USD 365,000 Eric Livesey (62) 812 3766 3111 Seminyak Of¿ce (62) 361 737 358

For Sale USD 760,000 Stephen Williams (62) 857 381 285 89 Jimbaran of¿ce (62) 361 703 208

Nusa Dua • • • • •

BA-A38

Great Investment Opportunity within Established Resort Situated within established 5 star resort Fully furnished apartment boasts 3 good sized bedrooms Short distance from many shops and restaurants 25 minutes from the Bali International airport

For Leasehold USD 425,000 39 years Luki Purwanti (62) 819 998 491 23 Jimbaran of¿ce (62) 361 703 208

Tegal Besar

BA-B69

Dream Home on Dreamland A contemporary 3-4 bedroom furnished with a high standard Sitting on 1124sqm of FREEHOLD land with a build size of 475sqm Only minutes away from white sandy beaches and surf breaks Jimbaran bay is only 10 minutes away and airport is 20 minutes.

Jimbaran Beach

BA-V467

• • • •

Family home in Popular Jimbaran Bay A uniquely Modern home nestled in the heart of Jimbaran Village A two storey family home is 160 sqm of build, set on 140 sqm of land A charming property situated within exclusive world - class luxury properties • Less than 15 minutes from the Bali International airport

Ubud

Seminyak freehold 3 bedroom villa, quintessentially Balinese in design Comprised of three separate thatched pavilions sit on 735 sqm plot of land Open living area which serves as living room, dining room and dry kitchen 10 x 3 meter peanut-shaped swimming pool is fed by a waterfall and surrounded by a sundeck with 4 sun loungers and a Bale situated around the landscaped grounds • 5 mins walking distance to Ku De Ta and Seminyak famous restaurants and shops

Ungasan • • • • •

BA-B66

Simple villa with Balinese design Beautiful villa complete with rental license Available on a 24 year lease option, will provide a wonderful holiday home Just a few mins drive from some of stunning white sand beaches 20 minutes from the airport

For Sale Euro 115,000 24 years Leasehold Eugene Shivnan (62) 819 998 859 04 Jimbaran of¿ce (62) 361 703 208

Sanur

BC-B135

• Simple and stylish designed and superbly laid out approximately on 475 sqm of land size and 285 sqms of Àoor size • Freehold, 3 bedrooms luxury villa, high quality material of building • Furnished with built-in furniture, kitchen set, beautiful tropical garden and landscape • Features; Open plan living / dining / kitchen area with high-pitched Alang Alang roof, swimming pool, spacious living room, dining area, lotus pond • Located at beach environment in Sanur, close to international school, shops and other public activities

For Sale USD 395.000 Mediani (62) 818 55 6309 Sanur Of¿ce (62) 361 28 7642

For Freehold USD 189,500 Siti Purba (62) 878 628 220 02 Jimbaran of¿ce (62) 361 703 208

BC-V685

BB-V1041

BC-L499

• REDUCED PRICE!!! Spectacular Villa with Spectacular View • Freehold, Absolute beachfront, 1000 sqms villa sit on 7500 sqms of land, 5 bedrooms with ensuite bathroom. • Spectacular ocean view through Nusa Lembongan. • 1.5 hours drive from airport, fully furnished, home theater room • Fantastic opportunity to own your private paradise

• Beautiful hillside land ¿lled with absolutely magni¿cent views settled on the Ayung River • Electricity & water supplied and access road available • Perfect for resort development or private villa estate • With the size over 20.000 sqm, the land can be subdivided and offers a fabulous view of the rice terraces and volcano

For Sale EURO 1,800,000 Mediani (62) 818 55 6309 Sanur Of¿ce (62) 361 28 7642

For Sale – Freehold IDR 10.000.000.000 Mediani (62) 818 55 6309 Sanur Of¿ce (62) 361 28 7642

Lembongan Island

BC-B126

• Stunning 3 Bedrooms villa, located very close to the sea, only 20m away from the beautiful white sandy beach of Tamarind bay, beautiful pool and stunning seaview. • 3 en-suite bedrooms have double bed with air-con and fans + ensuite bathrooms with hot/ cold shower • Fully furnished and equipped (nego) and in the center of the vil a there is a big living room with dining area, • A 1,000 sqm garden, beautiful manicured with nice Àowers, banana-palms, papaya-trees, stone-buddhas and water-fountains. • Very beautiful home or holiday-home on a unique location with good rental possibility – or just a good investment with the ever rising, Rental License (Pondok Wisata)

For Sale – Leasehold AUD 440,000 Mediani (62) 818 55 6309 Sanur Of¿ce (62) 361 28 7642

C/Re/G-14 Nov. 12


88

Real Estate

Bali Advertiser

14 November - 28 November, 2012

LAND FOR SALE & RENT Kuta - Seminyak: 4A, 6.5A, 9A, 28.5A Petitenget - Batubelig: 3A, 7A, 18A, 20A, 40A, 46A, 50A Umalas - Kerobokan: 4A, 10A, 19A, 20A Canggu: 2A, 3A, 4A, 7A, 8A, 10A,12A, 18A, 20A, 26A, 28A, 50A, 61.5A Jimbaran: 7A, 50A, 55A, 75A, 1.5Ha, 2.2Ha, 4.4Ha

HOTLIST VILLAS FOR SALE

Brawa Beach Villa: Fully Furnished 2BR, kitchen, living room, pool, garage, garden, land 400m2, building 200m2. 500.000 USD. ● New luxurious villa: 4BR semi furnished, pool, old antique joglo, garden, landsize 1000m2, 300m from beach, Rp. 16 billion. ●

Call : 081236333693, 08179725265, 0361 7870334 E-mail : balivillaland@gmail.com C/Re/A-14 Nov 12

FOR SALE FresAir Villa is a new Luxury Villa development that has been designed by one of Bali’s Best Architects and will be developed to a very high standard. The project will consist of 3 villas that will all have amazing location of Subak Pangi Pererenan Canggu. Each villa has a land area of 4000sqm2 and will consist of 14 unit Luxury villa with a Freehold Ownership title the project is located with in a private and high gated community of Pererenan surfing beach. Canggu Club with easy access to the Batu Belig, Seminyak area, Airport and some of the best beaches in Bali. The villa design are open for modification to make this investment suitable for your requirements and site inspection can be carried out upon your request , a must see location and very attractive Investment Opportunity. C/Re/G-17 Oct. 12

C/Re/G-14 Nov. 12

Absolute Beach/Cliff front land in Bali 40 Are Located on Balian Beach in Tabanan. Relax in your own private cove on the beach. Ideal piece of land to build your dream villa, from where you can watch amazing sunsets.

Contact: 0811833810 NC/Re/G-14 Nov. 12

SEMINYAK

SEMINYAK

3 & 4 bedroom villa at Drupadi Seminyak. Daily or weekly. Swimming pool, daily maid, Wi-Fi, hot water, open living and kitchen. And also have 2 bedrooms in Legian. Please call +62 819 1636 2285. Special rates for last minute bookings. [3866]

Exclusive villa 2 bedrooms, fully furnished, open

Jl.Saraswati - off Jl. Bidadari. 5mins to the heart of Seminyak. 4 bedrooms/ensuite in every room, AC, huge swimming pool, garden, maid quarter and overly expansive open plan joglo for lounge and kitchen. Now available for long term enquiries (min 5 years). Call 0878 6189 7970. [5647] For rent yearly, 3+2 bedrooms villa in Mertanadi, 800m2 land, 350m2 building, half furnished, prvt pool, rice-paddyview, wifi, phoneline, H/W system, fully-equipped-kitchen, dining-room, garage, maid-quarter. IDR. 175 mio/year. +62 878 6033 7119/ +62 813 3766 9851 / <micaeljulie@ me.com>. [5517]

livingroom, pool, small garden, longterm, behind Sunset point Jl. Merthanadi. Also 1 bedroom joglo near the beach for rent behind Bintang. Call 081 7979 9922 or 0857 1109 3547, e-mail: <ceaderphoenix@yahoo.com>. [4066] Jl. Kunti 2- town house for rent, over contract, 2 bedroom, 2 bathroom, quiet location, carport, aircond, semi furnished. 3 year contract for Rp 165 million. Phone 0812 3648 4409, 0813 3789 0794 / <shell.ade@hotmail.com>. [5918] Villa for rent (100m2), 2 bedroom, terrace (50m2), garden (350m2-no pool), sleeps 6, safe, quiet, furnished, AC, hot water, wifi, Indovision, maid, all inclusive. Rp. 10 Juta/ month. Prefere 3-6 month rent. Email: <uspjesanpomak@ gmail.com>, 0818 0566 5019. [5920] New, modern villa. Ideally located for Seminyak road, Bali

Apartments for short and long term rental. 1 bedroom air conditioned double storey with kitchenette, dining and lounge room. Cable TV, housekeeping, security, wifi internet. Plunge pool at lobby. <info@balisunsetterrace. com> / 081 2366 8110. [5853] House/villa for sale or rent in Kunti 2. Land 360m2, 4 bedrooms, 2 maidrooms, swimming pool, water heater, large livingroom, fully furnished. Contact person 081 2384 8150 or 081 826 0415. [5872]

Deli and Oberoi in a quiet residential road. Fully furnished, 3 generous bedrooms, 3 bathrooms (shower and tub), fully equipped kitchen and dining, swimming pool, AC to all rooms, Wifi, satellite TV (3 flat screens), security, maid and much more. Yearly rent Rp. 220 million, longer periods (nego). 0813 3719 6105. <info@landofbali.com>. [5843] 2 storey house furnished, 2 bedrooms with ensuite bathrooms, kitchen set, s.pool, jacuzzi, Wifi, 2AC, water heater, TV-cable, behind Ultimo Rest, close to restaurants

NC/Re/G-8 August 12

Located near Sunset Road Seminyak, 3 unit new minimalist villas are available for 23 years lease. Featuring 2 storeys, 3 BR & private pool @ IDR 2.75M. Info: <www.asthanavillas.com>, call: (0361) 794 2000. [5887]

Oberoi, villas area, short term. 0821 1495 4431 / <jasmin010112@gmail.com>. [5903] Room available at Gg. Baik baik just 5 min from Bintang Supermarket. 3 Bedroom villa leasehold available January

Rent Bidadari Seminyak villa. 120m2, 2 rooms AC, 2 bathroom, garden, parking car, pool, furnished until September 2013 : Rp. 68.000.000 or Rp. 430 millions until September 2017. 0812 3939 1788. [5889] Apartment for rent in Seminyak, brand new, self contained, satelite TV, mainroad, free Wifi, close to gym. Daily Rp. 350.000, monthly USD 500 net. Call Now 0878 6197 1117. [5900]

2013 in Bidadari Seminyak. Holiday rent villa 2 and 3 bedroom close to Kudeta Oberoi. 2 bedroom house at Canggu Brawa monthly and yearly. Land for sale in Kerobokan size 2.3 are Rp 380 mill/ara (Freehold). [5904] Overcontract. We are moving and looking for expressions of interest. Located in Jl. Laksmana / Oberoi. Well established building with 100sqm possible for extension on 2nd floor. For enquiries please call 0816298168 / 0813

Villas for rent / for sale Seminyak 1,2,3,4 bedrooms, modern style, fully equipped kitchen, cable TV, pool, internet connection, tropical garden US$ 100 - US$ 800 per night. For sale from US$ 60,000. Available now. +62 (0) 361 735 953 / +62 (0) 81 7973 5110 / +62 813 3773 7443 / +62 (0) 361 794 4555. [5633] Private villas are still available, Seminyak and Canggu. Daily, monthly and yearly rental, Christmas and New Year Period. Amazing price. E: <info@gotobalivillas.com> / 081 2377 0943 / 0821 4652 1446 / 0818 0565 3319. [5901] Seminyak : leasehold 13 yrs with opp to renew 2 bed 2 bathrooms immaculate fully furnished near new house 200 meters Bintang supermarket quite location with pool. $175,000US. Phone David 0877 6154 5414. Email <larpa50@hotmail.com>. [5902] C/Re/G-14 Nov. 12

3750 7979. [5905] New house for rent, central Seminyak, 5 min from Bintang, large livingroom, 1 bedroom, nice, fresh, simple house, 1 year for Rp. 60 million. AC, hot water, small tropical garden, furnished. +62 818 0568 8748 / +62 81 2399 2294 / +31-6 2204 2656 (owner) / <www.joullasrentestate.com>. [5908] House for rent, simply city 2 story fully furnished, located at Seminyak. Land 150m2, building 160m2, 3 bdrms AC with bthrm, carport, garden space at front and inside. One gate system, public swimming pool, landscape garden, rice terrace view, close to Batubelig beach, water heater and 24 security. Rp.150 million/year. Contract start December 2012. For appointment call Made 081 2389 0634. [5862]


WHAT’S IN STORE AT SEA SENTOSA

RETAIL OPPORTUNITIES AT SEA SENTOSA Sea Sentosa has given some of the world’s leading designers the opportunity to put their heads and their hearts together to create something very special in luxurious beachfront apartment living. This Italian designed award winning apartment resort is situated at Echo Beach; one of Bali’s finest beaches. With culinary attractions from some of the finest international restaurant operators, the Sea Sentosa Retail Centre will become a major destination for locals and holidaymakers alike. We are scheduled to open in July 2013 and with 70% of the apartments sold we are now looking for quality retailers! If you would like to be part of this award winning formula we are offering unique opportunities for a quality Supermarket/Delicatessen and Surf Store within the Sea Sentosa Centre. Contact us for more information on +62 361 888 1234 or email ian@seasentosa.com

+62 361 888 1234 w w w. s e a s e n t o s a . c o m

NC/RE/I-14 Nov 12


90

Real Estate

Bali Advertiser

14 November - 28 November, 2012

LEGIAN 2 bedroom, 2 bathroom, TV room, study, big yard, share pool, 200m from Padma beach, prime location in quiet street. Rp. 80 million for 5 years (nego). Call/SMS 0878 6125 2353 or e-mail: <agourlay3@hotmail.com>. [5869] Luxury furnished private villa for rent Legian/Seminyak, 10 minutes walk Double6 Beach, quiet gang, 2 bedrooms with AC, 2 bathroom, pool, garden, internet. Rp. 160 million per year (minimum 4 years). <lanceshay@hotmail. com>, 0821 4590 3667. [5684] New 2x2 & 3x3 villas for rent. Modern design, Wifi, private pool, garage, ensuite, furnished. Yearly rental: from $20,000 nego. for longer term. Email <integrity.fyi@gmail. com> or call Steve +62 812 3612 6802. [5914] Investment - Dewi Sri - Legian opportunity. Prime office location. Huge ROI, completion due 2013. 20 years land + office lease. Expressions of interest. Email <integrity.fyi@ gmail. com> or call Steve +62 812 3612 6802. [5915]

Brand new townhouse, 27 units, close to Kuta & Denpasar, modern furniture, deluxe bedroom, fully equipped kitchen, sat TV, hot water IDD telephone, laundry, room service, 24 hours security. Jalan Pulau Galang 324, Denpasar. Call: 081 139 2666 or 484999 info@tamanayu.com www.tamanayu.com C/Re/G 3 Oct. 12

FOR SALE Bar / Restaurant in Legian. Very well known with 8 years lease. Will consider equity partner with strong management skills.

Email : bar666bali@gmail.com

TABANAN

LOMBOK For sale beachfront and hill land at Serewei, (East Lombok), Selong Belanak, and north Lombok. Call owner at 0878 6521 0886 , 0812 4667 3322. [5631] 1.05 Ha beachfront block in Tanjung (with view to the Gilis) for sale by motivated vendor. Suitable for bungalow resort or smart investment as the new coastal road will lead right along the front. Rp 12.5 Juta/are only. Putu 0813 3837 3005. [5739] Land for sale Gili Trawangan, 300m from beach, coconuts trees, beach access. L: 105 are, freehold certificate, Rp. 60 million/are. Can be sold in plot of 10 are. Call owner Eric 081 5570 0079 / <eltravel2000@hotmail.com> or Olivier 0819 3301 4448 / <cocoliveolive@hotmail.com>. [5805] Guest house for rent: Ready to move in nice and secured, 2 bedroom with AC, hot water, swimming pool, fully furnished, kitchen, quiet area (daily, weekly, longterm rental). Please call owner 0819 1660 4000 Setya. [5899]

NC/RE/U-25 July 12

For Sale, directly from owner: Freehold land 10 until 20 are located in Arto Sari near Soka Beach. This plot of land sits on the highest point in this area with stunning sea views that cannot be blocked, comes complete with access road, all certificates and is rezoned for building. Price: Rp. 39 Mill per are. Tel: +6281 855 5010. E-mail: <info@ florynproperty.com>. [1382] Minimalist house for sale in Kediri Tabanan. 2 bedrooms, 1 bathroom, livingroom, kitchen, wastafel, small garden, garage plus 1 extra room for storage, etc. Clean, quiet, ricefield view. Price Rp. 275 million nego. Contact owner 081 805 369 219, <livelong_june@yahoo.com>. No agent please. [5444] Are you looking for land to buy in Tabanan area, small of big plots. Contact or e-mail directly to owner: Tel: +62 81 855 5010. E-mail: <info@florynproperty.com>. [5452] Land for sale in Nyanyi (freehold), amazing view riverside and green valley with palm trees and wide selection of big trees. Electricity and water available, boundary wall. 17.5 are, Rp. 200 juta per are nego. +62 81 7476 3325. [5910] C/Re/G-14 Nov. 12

WWW.XPJIMBARAN.COM

RV-1353 TRULY UNCOMPARABLE

AP-007 ABSOLUTE BEACHFRONT

6HWZLWKLQDULYHUYDOOH\ODQGVFDSHDORQJ%DOLÂśVVDFUHG$\XQJ5LYHU\RXZLOOÂżQGDPDVWHUSODQQHGFRPPXQLW\ORFDWHG within walking distance to the Green School based on the architectural concepts of sustainable principles and artisan FUDIWVPDQVKLSWKDWKHOSHGFUHDWHWKHZRUOGIDPRXVFDPSXV7KLVSDUWLFXODUYLOODLVDQDFWXDOULYHUIURQWSURSHUW\WKDWLV RQH RI WKH YHU\ IHZ WKDW DUH EHLQJ VROG RQ D IUHHKROG EDVLV :LWK GLUHFW SXEOLF URDG DFFHVV DQG LWV RZQ SRRO ZLWK VSHFWDFXODUVFHQHU\VXUURXQGLQJHYHU\ZD\\RXORRN\RXDOVRKDYHWKHRSWLRQWRXVHWKHFRPPXQLW\IDFLOLWLHVDQG VKDUHGSRRO,I\RXDUHORRNLQJIRUVRPHWKLQJWUXO\XQLTXHWKDWLVERWKHQYLURQPHQWDOO\IULHQGO\DQGDOVREUHDWKWDNLQJ WKHQ\RXZLOOQRWÂżQGDQ\WKLQJWRFRPSDUHZLWKWKLV 7LWOH)UHHKROG_%HGURRP_%DWKURRP_/RW6L]H640_+RXVH6L]H640_/RFDWLRQ0HQJZL

7KLVDEVROXWHEHDFKIURQWEHGURRPDSDUWPHQWUHDOO\LVDXQLTXHRSSRUWXQLW\RIIHUHGLQ%DOL7KLVERXWLTXHJURXSRI DSDUWPHQWVLVORFDWHGULJKWRQWKHEHDFKDW7DQMXQJ%HQRDPLQXWHVIURPWKHDLUSRUW7KHDSDUWPHQWRQRIIHULVRQ WKHJURXQGĂ&#x20AC;RRURIIHULQJ\RXGLUHFWDFFHVVIURP\RXUDSDUWPHQWWRWKHSRRODQGWKHEHDFK7KHVTXDUHPHWUHV LQFOXGHHQVXLWHEDWKURRPVVSDFLRXVOLYLQJGLQLQJDQGNLWFKHQDUHDRSHQLQJWREDOFRQ\ZKLFKLQFOXGHVD-DFX]]LVSD DQGORRNVRYHUWKHVDQGDQGRXWWRWKHRFHDQZLWKXQLQWHUUXSWHGYLHZV7KLVZRQGHUIXODSDUWPHQWLVEHLQJVROGIXOO\ IXUQLVKHGDQGHTXLSSHG,WLVPDLQWDLQHGDQGPDQDJHGE\DORFDOPDQDJHPHQWFRPSDQ\ %HGURRP_%DWKURRP_+RXVH6L]H640 /RFDWLRQ7DQMXQJ%HQRD

Price: USD 550,000

Price: USD 345,000

RV-1332 FREEHOLD IN BUKIT

RV-782 SEMINYAKâ&#x20AC;&#x2122;S SMART INVESTMENT

7KHVHÂżYHEUDQGQHZSULYDWHIUHHKROGYLOODVDUHORFDWHGRQWKH%XNLWLQWKHVRXWKRI%DOLQHDUWKHPRVWEHDXWLIXO EHDFKHVRIWKHLVODQG1HVWOHGLQOXVKJUHHQHU\HDFKEHGURRPYLOODKDVDPEXLOGVL]HRQDSORWRIPODQG DQGHDFKKDVDJDUGHQDVZLPPLQJSRRODQGRZQSDUNLQJDUHD3HUIHFWIRU\RXURZQKROLGD\KRPHLQ%DOLIRU\RXDQG \RXU IDPLO\ RU IULHQGV WR HQMR\ WKH SOHDVXUHV RI WKH ,VODQG RI WKH *RGV ZKHQHYHU \RX ZDQW EXW ZLWK D JUHDW RSSRUWXQLW\WRPD[LPL]H\RXULQYHVWPHQWE\HDVLO\UHQWLQJRXW\RXUYLOODZKHQ\RXDUHQRWKHUH*UHDWYDOXHIRUPRQH\ ZRQÂśWVWD\ORQJRQWKHPDUNHW 7LWOH)UHHKROG_%HGURRP_%DWKURRP /RW6L]H640_+RXVH6L]H640_)XUQLWXUH,QYHQWRU\)XUQLVKHG_/RFDWLRQ%XNLW

7KLVEHDXWLIXOO\DSSRLQWHGEHGURRPDSDUWPHQWLVSDUWRIRQHRIWKHODWHVWFRQGRPLQLXPKRWHOVLQ6HPLQ\DN7KH FRPSOH[LVPDQDJHGE\RQHRI%DOLÂśVOHDGLQJKRWHOPDQDJHPHQWFRPSDQLHVDQGSURYLGHVJUHDWUHQWDOUHWXUQV7KH DSDUWPHQWKDVLWVRZQVZLPPLQJSRRODQGJDUGHQ7KHXQLWLVPRGHUQIXUQLVKHGDQGÂżWWHGZLWKWKHODWHVWDSSOLDQFHV 7KHFRPSOH[KDVDJRRGUHVWDXUDQWDJ\PQDVLXPDVSDDQGDODUJHFRPPRQSRRO:KHQ\RXDUHORRNLQJIRUDJRRG SODFHWRVWD\DQGDJRRGLQYHVWPHQWDWWKHVDPHWLPHWKLVLVDJRRGFKRLFH 7LWOH/HDVHKROG_%HGURRP_%DWKURRP +RXVH6L]H640_6ZLPPLQJ3RRO6L]H[0 /RFDWLRQ6HPLQ\DN

Price: USD 200,000

Price: USD 99,000

Jl. By Pass Ngurah Rai no 963, Jimbaran - Bali | Phone : 0361 703361 | info@xpjimbaran.com NC/Re/I-14 Nov 12


Bali Advertiser

Real Estate

14 November - 28 November, 2012

91

SANUR Villa for rent daily, weekly, monthly, yearly. Available 1, 2 & 3 bedrooms, fully furnished, hot & cold water, cable TV, swimming pool, parking lot, free Wi-Fi, 5 minutes to the beach & International school. Call 0361-887 6679 / 081 138 5315, e-mail <juarez@balileisurems.com>. [4105]

801 4498 C/Re/I-03 Oct 12

For sale money changer in strategic location in Sanur area. Complete permit, license, and Bank Indonesia certificate.Good for investment, 14 years lease. Reason for sale because need money. Sell Rp. 1.45 billion (nego). Please contact 081 2361 0079 or 0852 2212 0341. [5362]

C/Re/I-17 Oct 12

Villa for rent, quiet area, 2 large ensuite bedrooms with AC, open plan kitchen lounge, 3.7m pool, titled garden with storage room, shared garage, semi-furnished, Rp. 90 juta/ year. Call 0819 9988 6718. [5885] Space Available for lease of partnership: Nice Shop 10x15 meters on Jalan Danau Tamblingan, near Batu Jimbar Sanur. Suitable for resto, cafe or showroom. Please contact: 081 6113 4485 / email: <vt.galih@gmail.com>. [5893] Space available for lease short or long term (mezzanine floor) in Sanur Beach Hotel. Spacious, 12x6 meter, suitable for shop, showroom or office. Contact +62 361 288 011, ask for Jonny or email : <hsb.sales@ aerowisatahotes.com>. [5907] New villa for rent quiet location, 2 bedroom, 2 bathroom, room-maid, garage, open dining and livingroom, furnished, AC, water heater, kitchen-set, s.pool, 15mins to beach, Rp. 75 million/year longterm negotiable. 081 6474 5896 / facebook: yunimjyunimj / <arthamas@hotmail.com>. [5911] Over contract at Sanur/Sidakarya. 2 storey house, 3 bedrooms + 3 AC, 3 bathroom, big living room with dining room, garden, swimming pool, maid room. Very good location. Price negotiable. Please call 0821 4765 0341. [5381] NC/Re/G-14 Nov. 12

Call: 0819 9941 3821 Email: putu.takumi@gmail.com NC/Re/P-8 Aug. 12

PROPERTY

Prime Oberoi Retail Space The lease is for three years with a three year guaranteed extension. The space is suitable for fashion, interior, coffee shop or office. Lease starting January 2013. Rentals payable upfront for 3 years. • 120 m2 (10 m streetfront x 12 m) plus 70 m2 (10 m x 7 m) parking at IDR 540 million per annum • 90 m2 (7.5 m streetfront x 12 m) plus 52 m2 (7.5 m x 7 m) parking at IDR 440 million per annum • 60 m2 (5 m streetfront x 12 m) plus 35 m2 (5 m x 7 m) parking at IDR 300 million per annum

Contact: Josephine, tel: 0361 7475895 Erika, tel: 0361 7453434 C/Re/G-03 Oct. 12

C/Re/G-31 Oct. 12

Without the right advice it’s a jungle out there.

NC/Re/G-14 Nov. 12


92

Real Estate

KEROBOKAN Villa for rent in Banjar Pengubengan. AC, swimming pool, hot/cold water. Call 081 2363 0309 / 0878 6202 6999. [4870] Brandnew Guesthouse in the heart of Antik business. Great quiet location, all facilities, pool, AC, hot water, Europe TV, DVD player, parking, free Wifi in Jl. Tangkuban Perahu No. 89. Telp 0815 5962 1263. <www.perahu89.com>. [4434] New house in Kerobokan for rent with 3 bedrooms + fully furnished + sharing pool, special price Rp. 80.000.000 min 2 years (nego). Call +62 361 802 6669 or +62 813 3761 3773. [5877] House for rent Kerobokan. 400m2, house size 200m2, 4 bedrooms, jacuzzi, 3 showers, 3 toilet, table tennis. Furniture, 3 aircon, safe place. Fridge near have big supermarket, hot water, internet. Can provide maid Rp. 500.000-600.000/month. Finish rent 9/06/2013. Nice garden. 0812 4651 6539. [5881] Fully furnished 2bedrooms with plunge pool near Seminyak rented Rp.125 million/year or Rp. 15 million/ month. <www.OmahEyang.com> drop email to : <info@OmahEyang.com>. Cable TV / AC / internet / hot water / carpark / garden - Jalan Raya Kesambi Gang Permatasari 11 Kerobokan, Badung. [5882] A beautiful villa for rent longterm. 3/4 bedrooms, bathroom, pool, garden, between Seminyak and Kerobokan area. Call 081 7971 1123. [5894] New villa in Batubelig. 3 beds, 3 baths, dining, living area, pool, kitchen, bale, carpark, large garden, 6sqm land, quiet area. Close to beach, Canggu, Seminyak, minimum 3 years rent. 0813 3735 4687. [5906]

Bali Advertiser

14 November - 28 November, 2012

GIANYAR

APARTMENTS & VILLAS

Ruko for sale on 4 are land, 2 floors, 2 bedrooms, 4 toilets, AC, hot water, kitchen set. Contact 081 2394 8595. [1150]

Wireless broadband Short or long term Private or shared pool Well-equipped kitchens

RARE ANGON VILLAS, Kerobokan Call: 736 339 or 081 138 6450 C/Re/A-22 Feb 12

VILLA 9 ARE KEROBOKAN LEASE 26 YEARS

• 3 BEDROOMS/4BATHROOMS • TERRACE VIEWS RICE FIELDS • FULLY FURNISHED • SWIMMING POOL 3X12 • INTERNET/TV SATELLITE

DIRECT OWNER 2.8 MILLIARDS RPS 081337556306/081338038595 C/Re/I-03 Oct 12

Are your PROPERTIES being MANAGED EFFICIENTLY? Hiring the RIGHT property management company is essential to the performance of your investment. www.newlifevillas.com. info@newlifevillas.com tel: +62.361.848.2771 +62.81338.522.069

supported by HousesofAsia.com NC/Re/I-03 Oct 12

Umalas villa for yearly rent. 3 bedrooms AC, 2 bathrooms, open living, TV room, laundry room, pool, garage, land 3.6 are, private road, security guard, quiet area. Direct owner 0813 3855 0640. [5766]

VILLA FOR SALE - FREEHOLD Location: Jl. Kuwum II, Br. Kuwum - Kerobokan

Beautiful house villa style for rent Jl. Gunung Salak, near Lollipop Preschool. 2 floors, 5 bedrooms, 7 bathrooms, AC, water heater, minibar, pool, garden, garage and fully furnished, cleaning staff. Rp. 120 mill/year. Min 2 years, long term negotiable. Call 0813 3848 7427. [4941]

For sale freehold beautiful house villa style, two storey, swimming pool, 3 rooms, 2 bathroom, 1 toilet guest, kitchen set, living and dining area, new fully furnished AC, TV, garden, carport, 2 years building. Strategic location, 5 minutes from Sunset Road. Only US$147,000. More information contact owner 0812 3955 5544 or <bagusarthana@yahoo.com>. [5531] Villa for sale Br. Semer (behind cafe Moka). 27 year leasehold, 9 are of building + 15.50 are of view land (ricefield), 5 bedroom, swimming pool, pool house, parking, backup kohler generator, solar water heater 300lt. Fully furnished modern villa based on beautiful old teak house structure. extremely peaceful in a central location. Excellent price/quality. Contact: <quantumode@hotmail. com> (photos) / 081 2382 7604. [5809]

Land for sale in Gianyar. Land size 4960m2. River view, good for villa and resort. Contact person 0812 3999 1763. [5897] For sale new house 2.25are on Pejeng Kelod Village, 20 minutes from Ubud. 4 bedrooms, 3 bathrooms, Western kitchen, backyard. Surrounded by ricefields, quiet location. IDR 1.5 billion. Contact: 081 2301 8140 / <buyungm@ yahoo.com>. [5898]

BUKIT Freehold land for sale in Bukit Ungasan. Good location and stunning views. Call 081 2380 2626. Please speak in Bahasa. [1547] Land for sale on the main road next to STP Nusa Dua ready to build for villa as licence completed. Call 081 2394 8595. [1149] Land for sale in Bukit Ungasan. 1.35 hectare, full ocean view, near the beach, 4mtr road access. Rp. 100 million/ are. 1 hectare with full seaview, hot mix road access, Rp. 200 million/are. 2 hectare, good view, ashpalt road, Rp. 150 million/are. 50 are Rp. 200 million/are, 4.5 are Rp. 150 million/are. Negotiable. Contact 0821 4587 7675. [5282] Magnificent slopy land for sale in Ungasan-Balangan. 26,5 are freehold with views over greenbelt and sea towards the airport. 4m access road in villa area with w/e on site. Easy to build terracing land. Rp. 100jt/are. <mail4pn@yahoo.com>, 0821 4409 4572. [5563] For sale Dreamland new Australian design villa. 7 bedrooms, 7 bathrooms, magnificent ocean, volcano views, beautiful horizon pool, double garage, garden 2 gazebos, freehold, hotel license. Located above golf course, beach. AUD$ 750,000. Call/SMS owner 085 6384 5701. [5710]

Modern deluxe new apartments 1 & 2 bedrooms, fully furnished, large parking, beautiful garden, pool, free Wi-Fi, from 50 to 150 m2, monthly from Rp. 4 to 7.5 million. 2 location off West Marlboro and close to Carrefour. Call +62 81 2388 9173. [3429] Umalas new villa for rent. 4 bedrooms, 4 bathrooms, pool 4x12m, gardens, gazebo, fully equipped, AC, Wifi, TVsatellite, private road, private carpark. SMS only 081 2369 1864 or e-mail: <laurasama@yhaoo.com>. [5917]

House for sale-Saba. 2-storey, swimming pool, guesthouse, hot water, AC, Australian build, ocean view, mountain view surrounding ricefield, nice+quiet, furnished, 15mins from Sanur. 3.25are, Rp. 2.3 billion (nego). 081 2395 3454. [5880]

For rent - one & two bedroom apartments overlooking Dreamland, fully furnished, pool and BBQ area, great views and breeze. Nightly/ weekly /monthly. Ph/SMS between 9am and 5pm on 0878 6184 3997. [5539] 27.5 are land for sale, freehold, located in Goa Gong, Ungasan, 2km from Beverly Hills. Please contact 081 2389 0554. [5892]

SELL PRICE :

Rp. 2.9 BILLION LAND SIZE 3.7 ARE, 2-STOREY, 4 BEDROOM, AC, FULLY FURNISHED, HOT WATER, TV CABLE, POOL, KITCHEN, GARAGE, GARDEN. CALL PUTU:

0813 3964 9404

Restaurant to let or partnership location Uluwatu street, Jimbaran. 400m2 and 200m2 parking space. Private location good for business. Please call me (0361) 786 8169 or 081 2380 2169 or e-mail me: <alamsyahz@ yahoo.com>. [5808] Shop for rent. Large 80sqm new shop on mainroad with high traffic volumes. Jalan Raya Uluwatu, Pecatu. Suit surfshop, spa, boutique, tattoo, restaurant, bar, tours. 4.5 yr lease Rp. 80 million/year nego. 0878 6057 9666. <info@ balisurf.org>. [5704] Sale 2 unit freehold private villa in 5-star resort Karma Kandara. 3 bedroom, 3 bathroom, ocean view, large swimming pool, fully furnished, 2-storey, 350m2 and 500m2. Rp. 11 billion and Rp. 13 billion. 0878 6027 2724 / <taufikpartono@ymail.com>. [5876]

NC/Re/P-14 Nov. 12

Paradise is finding the perfect property to match your own outlook on life.

NC/Re/G-14 Nov. 12


Bali Advertiser

Real Estate

14 November - 28 November, 2012

93

OLD S % 0 7 E ONE S A H P

OM

EDRO

ONE B

TWO BEDR

OOM

The perfect set up for the ideal Bali lifestyle. Now Selling Enjoy living near one of Bali’s most beautiful uncrowded beaches or have your own holiday villa cared for by a professional management company. The combination of Balangan Wave Resort and Balangan Beach’s waves is simply perfect. Choose from 48 one or two bedroom fully furnished villas with own garden and plunge pool. Enjoy the private Surf Club with two floors of entertainment and chilling areas, restaurant, swimming pool and Surf Cam. It doesn’t get much better in Bali. Ray White Projects - the most exciting development in Bali real estate services.

Enjoy priority, contact: Siska cell: +62 (0) 81 5574 9228 siska@raywhiteparadise.com

www.raywhiteparadise.com

NC/Re/G-14 Nov. 12

JIMBARAN Land for rent 12 are in Jl. Bypass Ngurah Rai about 200m from Benoa Square, mainroad access, prospective area for your business. Rp. 10 million/are/year (nego), min 5 years, max 20 yrs. Call 081 7066 0650 (English) / 081 2383 4011 (Bahasa Indo). [5803] New house for rent @Umah D’Jimbaran. Cluster complex with 24H security. Fully furnished, 2 bedrooms, 1 bathroom, 2 livingrooms, kitchen, 2 gardens, 3.200W electricity, PDAM, water-heater, 3-way shower panel, carport. Natalia 081 6149 4400 / Edie 0813 3700 4554. [5706] Open for longterm rental. Nice view, new minimalist house, 2-storey, 10 minutes to the beach, fully furnished, 2 bedrooms, hot water, AC, internet, garage, garden. Call 081 2392 9925 for inspection / <eckoindo@yahoo.com>. [5875] Land for sale. 4 are freehold in Jalan Kampus Unud. 5 minutes to KFC, 15 minutes to Nusa Dua, 15 minutes to airport, great investment. Call Kadek 0819 9914 6668 / <kds_2000@ymail.com> negotiable. [5878] For rent. Fully-furnished 2BR house+A/C, 2bathrooms+ hotwater, phone-line, internet, TV/DVD, fridge, kitchenset, balconies, carpark, garden. Excellent location Permata Ariza near Ayana/4Seasons Jimbaran Bay. Flexible payment. P: 081 657 0666 / e: <ten.swaratama@yahoo. com>. [5879] Room for rent at Jimbaran, Jln. Bukit Hijau no. 6. Fully furnish, kitchen, bathroom, parking, maid, free Wifi. Free electricity for monthly. 2,5 mill monthly or 200k daily. Call

BEFORE YOU SETTLE ON ANY PROPERTY, CHECK THE A LIST A List Land Kuta Beachfront. 20 are freehold next to Holiday Inn. 38m white sand beachfront. 35m street frontage. Square shape. Last of its kind – don’t miss it! Rp4 billion/are. Petitenget. 4.6 are. Freehold. Square shape. Street frontage. Walk to beach. Under market. Rp1.2 bill/are. LS-004* Canggu 17.5 are bargain. Square shape. Excellent access. Between Canggu Club and Beach. 29 yr lease Rp4.5 mill/are/yr. Jl Oberoi. Bargain. 13.8 are. Good shape and access. 1 min. walk to restaurants, shops. Rp1.2 billion/are Batu Belig Street frontage. 13 are, 18 are, 15 are, 39 are. All freehold. From Rp1.3 billion/are. A List Villas Umalas Tunon. Enchanting modern 2 br villa with pool on 2 are. Pool. Stylishly furnished and decorated. Only €160K Berawa. Close to Canggu Club, beach. Stylish 4br/4.5bth villa on 4 are. Lap pool. Ricefield views. 28 yr lease US$420K. VL-047* Petitenget freehold. Close to Potato Head. Exceptional brand new 3br/3bth villa on 2.95 are. Nothing but the best. Best position, best furniture and appliances. Best finishes and fittings $US990. Umalas 1. Lovely 3-4br/5bth villa on 7.8 are. Close to Seminyak. Genset, big pool and gardens, garage. Fully furnished. Rp7.5 bill. VS-060* Pecatu. Stylish 5 br/5bth villa. Balangan beach and ocean view with beautiful lawns and garden. Plus a 25m lap pool and jacuzzi. US$980,000. VS-035* A List Hotels/Restaurant Petitenget. Freehold Boutique Resort on 32 are. 9 stylish 4y.o. pool villas.Total 20 rooms. Spa, parking. 5 min walk La Lucciola beach. Fully operational with great forward bookings. Current occupancy 85%. Good ROI. US$8 mill. Neg Oberoi bar/restaurant 8 are. Fully operational beer garden and BBQ restaurant. 350m2. Huge potential. All licenses. 8 yr lease. Rp 4M or Rp2M joint venture. Umalas Jl Bumbak. 6 x 2 br/2 bth new, self-contained pool villas on 12 are. Wonderful business opportunity. €390K leasehold. VL-046* Lovina beachfont fr. AUD75,000! Villas, apartments and penthouse right on the beach. Beautifully furnished. Fabulous gardens. All at the new Lovina Beach Resort. Great rental investment or live-in Ultra-safe investment with great returns. Already 75%sold. Call us! *reference numbers for info from website: www.balalist.com. Enter number in ‘keyword’ top right.

081 2395 8971. [4592]

land at the high hill of Goa Gong Jimbaran. 4.5mtrs road, Owner 0813 3793 7251 / <rainarta@yahoo.com>. [4921]

Freehold land for sale in Gerokgak. 50 are, 5000sqm or 7 separate plots with building permission. 30 mins from Lovina. Call 0821 4600 2269 / 0821 4616 6219 English speaking. [5798] Freehold land in Seririt Buleleng for sale, 201are, total price in USD 283,000. Beautiful hills views with land elevation, great investment, under market price. Call Sari 0852 3720 3399 / email: <merrycherry26@yahoo.com>. [5890]

KUTA For Sale: overcontract ruko at Sunset Road ex restaurant, very good location, perfect condition, fully renovated, sell with or without equipment and furniture. 63m2, 2 storey with 23.000Watt 6 years left, excellent location for restaurant, boutique, spaoffice. Direct owner call +62 813 8920 1707. [5731] Private room 1 bedroom, 1 bathroom, AC, kitchen, hot-water, freezer, TV, fully furnished. Close to airport/ beach 5 mins. Nice room/safe. Call 0813 5767 8881. Rp. 4 million / Rp. 4.5 million / month, Rp. 200.000 fan/day, Rp. 250.000 AC/day. [3617] Bar for rent. Fully furnished including all equipment, new renovated, central location Jalan Benesari. Call 085 7375 7304. [5874] Central Kuta rent rooms, 250m to the beach, fully furnished, AC, TV, DVD, fridge, fan, share kitchen, secure from Rp. 2 million - 3.5 million/month. Call 0818 0566 4926. [5605] Holiday villa, beautiful, private, quiet, good price, weekly/ monthly, 2 storey, large 1 bedroom, pool, AC, hot-water, full kitchen, TV/DVD, Wifi, 24hour security, cleaned daily, more details, photos, quick response, e-mail: <kaowenoz@ hotmail.com>. [5579] Kuta studio apartments, Poppies Lane. Buy one or both. 2 x one bedroom one bathroom, fully renovated and furnished. Private balconies, resort pool. 91/2 year lease, extendable. AUD$38,000 each negotiable. Photo’s and inclusions. <n-e-d@bigpond.net.au>. [4142]

For sale 2plots SHM 1Are each Benoa’s Harbour view water, electricity available Rp. 400 juta and Rp. 350 juta.

SINGARAJA

Jl. Raya Kerobokan No. 72 ,Tel/Fax: (0361) 735469 Website: www.balialist.com | email: manager@balialist.com C/Re/I-14 Nov 12


KALYANA BAY LUXURY VILLA DEVELOPMENT. Candi Dasa Kalyana Bay villa development is set on a one hectare stunning section of land overlooking the ocean and each villa will have amazing panoramic views. Designed D to maximize tropical outdoor living, each villa carefully optimizes light,, space, space air circulation and ocean views. All villas embrace both Balinese and European pean ele elements; en the s en alongside alo open plan architecture, over sized windows and classical columnss as seen koi ponds, tropical frangipani gardens and stone carvings. There ere are a e now 5 villas remaining to complete the investments consisting of 3 and 4 bedroom room villas v llas ra ranging g in land size from 680m2 for the second row villas and up to the impressive press sssivve 1440m2 144 40 0 2 fron front fro ont on row villa which is currently under development. Contact : Karl Wilkins +62 (0) 8155 701 729 karl@raywhiteparadise.com

Title : Freehold / Hak Milik Prices from : USD 735.000 – USD 1.395.000

TIARA VISTA LUXURY VILLA DEVELOPMENT Jimbaran Tiara Vista is a new luxury villa development that has been designed by one of Bali’s best architects and will be developed to a very high standard. The project will consist of 3 high end villas that will all have amazing panoramic views of Tanjung Benoa and Jimbaran Bay. Each villa has a land area of between 1000m2 – 1437m2 and will consist of 4 bedrooms with a Freehold ownership title. The project is located within the private and high end gated community of Tiara Nusa with easy access to the airport and some of the best beaches in Bali. The villa designs are open for modifications to make this investment suitable for your requirements and site inspections can be carried out upon your request. A must see location and a very attractive investment opportunity. Contact : Karl Wilkins +62 (0) 8155 701 729 karl@raywhiteparadise.com

Title : Freehold / Hak Milik Prices from : USD 1.400.000 – USD 1.750.000

AN INVESTMENT IN THE HEART OF PETITENGET YOU’LL LOVE.

Umah Jegeg. Seminyak Umah Jegeg will be a small exclusive development of only 7 villas hidden away right in the middle of the new heart of Seminyak, Petitenget. Each will be fully furnished feauturing high end finishes with 2 bedrooms, 2 bathrooms, private swimming pool and parking. Strolling distance to Ku de Ta and Potatoe Head. Managed by Ray White Resorts. Lease thirty years with a thirty year option.

Price : US $320,000 Ray White Paradise mark@raywhiteparadise.com +62 (0) 85 857 365 338 mark@raywhiteparadise.com

/FFICESLOCATEDIN3EMINYAKs.USA$UAs*IMBARANs3ANURs#ANDI$ASA

Umah Jegeg ‘Beautiful Home.’

* prices and availability subject to change without prior notification.

Tel : +62 (361) 737 357 | 773 540 | 701 154 | 285 525 info@raywhiteparadise.com www.raywhiteparadise.com

NC/Re/G-14 Nov. 12


We’ve got Bali covered.

LE

K

SA

IC

QU

SSEM295 Seminyak

2

2

5

Arama Riverside Villa Bali is a villa complex in Nakula street. These plush private villas are located within walking distance of the fashionable boutiques and restaurants of Seminyak and a gentle ten minutes stroll to the attractions of Double Six beach. There are only 2 units from 11 villas still available. DON’T MISS IT....CONTACT ME... LEASEHOLD FOR 42 YEARS. Contact : Amber + 62 (0) 81 804 188 644 Title : Leasehold

Prices From : USD 295,000 amber@raywhiteparadise.com

SBUK014 Bukit

2

2

SUBD725 Kemenuh

1

Located within the a peaceful and scenic area of Goa Gong the Bukit this new villa development consists of 14 high quality villas including common facilities. The show villa is nearing completion and available to inspect at your preferred time. This investment represents excellent value for money and provides a very secure property ownership of a 60 year leasehold title. A perfect residence for you here in Bali! Title : Leasehold / 60 years. Price : USD 240,000

Contact : Karl Wilkins +62 (0) 8155 701 729 karl@raywhiteparadise.com

2

2

1

A beautiful property at Kemenuh and situated in the middle of rice fields with private road access, 2 bedrooms, stylish western standard kitchen, ample size pool, large open area and full view of rice terrace furnished. Land size 2500m2, build size 500 m2.

Title : Hak Milik

Price : USD 725,000

Contact : Haryono + 62 (0) 85 857 442 601 haryono@raywhiteparadise.com

TS EN S TM CE AR FFI P A &O

STAB100 Tabanan

6

6

4

These two impressive 3 bedroom villas are situated less than 100 meters from the ocean. Each villa set on 10 are land, surrounded by rice fields and offering panoramic ocean views, a spacious garden, lounge-terrace and swimming pool in front and mountain views in the back. Price for one single Villa: USD 580.000. The whole Villa complex, set on a total of 43.5 are freehold land is offered for only USD 1.650.000 Title : Hak Milik Price from : USD 580.000

STAB666 Tanah Lot

Contact : Ray White Paradise + 62 (0) 87 860 053 153 amadeus@raywhiteparadise.com

2

2

1

This peaceful two bedroom Villa is located on the 18-hole Golf course within the Pan Pacific Nirwana Bali Resort. The Resort area is situated on top of a cliff, overlooking the ocean and the famous Tanah Lot Temple. The Villa is set on 518m² freehold land, facing the golf course with a protected view and lush vegetation. All rooms feature high quality and partly antique furniture. Enjoy 100% privacy in Bali’s most quiet location! Title : Hak Milik Price : USD 755,000

Contact : Ray White Paradise + 62 (0) 87 860 053 153 amadeus@raywhiteparadise.com

SCGU001 Canggu Apartments & Offices in Prime Location!

3

6

8

Three private 2-story Apartments, located in Canggu, each with 60 m² living area and additional 35 m² of private gardens. Imposing Office building on 10 are, in prime location, on Jalan Raya Canggu with three offices and a total of 380m² office space on two floors, rising more than 10 meters above the street level. These offices will soon belong to the most representable ones in Bali. Main Office: 210 m² (2 floors) Office 2: 145 m² (2 floors) Office 3: 25 m² (1 floor). The construction will be completed by beginning of 2013. 25 years lease for the whole office and living complex are priced at IDR 5.95 billion. One apartment offered from only IDR 890.000.000 Title Price from

Contact : Ray White Paradise +62 (0) 87 860 053 153 amadeus@raywhiteparadise.com

: Leasehold : IDR 890.000.000

LSEM132 Petitenget

3.3 Are

LCGU002 Echo Beach

32.19 Are

Rare opportunity small plot of land for lease. Over contract 20 years lease located in Petitenget. Situated just 5 minute from the beach and a short walking distance to the many restaurants, shops and spas of Petitenget Road. 3.3 are and a prime location ideal plot on which to build a private villa.

Development opportunity to produce great returns! This prime land is located only 100m away from the ocean & within an area that is receiving excellent infrastructure. Road access in place & permits can be easily obtained. Ready to entertain a beneficial project!

Contact : Annie + 62 (0) 81 339 455 009 annie@raywhiteparadise.com

+ 62 (0) 81 55 749 228 Title : Leasehold Price : IDR 7,000,000/year/are siska@raywhiteparadise.com

Title : Leasehold Price : IDR 1,320,000,000

/FFICESLOCATEDIN3EMINYAKs.USA$UAs*IMBARANs3ANURs#ANDI$ASA

Contact : Siska

* prices and availability subject to change without prior notification.

Tel : +62 (361) 737 357 | 773 540 | 701 154 | 285 525 info@raywhiteparadise.com www.raywhiteparadise.com

Global experience. Local knowledge.

The Paradise Property Group NC/Re/G-14 Nov. 12


THESE ARE ONLY A FEW, 500 MORE FOR YOU TO VIEW

WWW.XPBALI.COM

RV-1318 SUPER INVESTMENT IN PETITENGET 7KLVOX[XU\EHGURRPOHDVHKROGYLOODLQDSRSXODUDQGVXFFHVVIXO&RPSOH[LVORFDWHGLQWKHPRVW ZDQWHGWRXULVWDUHDRI6HPLQ\DNDQGLVDSHUIHFWFKRLFHIRUWKHLQYHVWRUVORRNLQJIRUH[FHOOHQWUHQWDO UHWXUQVDQGKROLGD\YLOODDWWKHVDPHWLPH&RXUW\DUGYLOODLVGHVLJQHGLQPRGHUQ%DOLQHVHVW\OHZLWK ZHVWHUQFRPIRUWVLWKDVLWVRZQJHQHURXVO\VL]HGOLYLQJNLWFKHQGLQLQJDUHDVDQGORXQJHSDYLOLRQ ORRNLQJRYHUWKHSRROVXQGHFNDQGODQGVFDSHGJDUGHQ&RQWDFWXVIRULQVSHFWLRQQRZ 7LWOH/HDVHKROG %HGURRP_%DWKURRP /RW6L]H64_+RXVH6L]H640_/RFDWLRQ6HPLQ\DN

Price: USD 375,000

RV-1309 ECO LUXURY IN CANGGU %HDXWLIXOO\ GHVLJQHG HFRORGJH RIIHUV D WDVWH RI WURSLFDO OLYLQJ LQ VW\OH KLGGHQ DZD\ LQ D TXLHW YLOODJH RQO\  PLQXWHVIURP&DQJJXEHDFK$UHDOUHWUHDWIURPWKHKXVWOHDQGEXVWOHRIVRXWKHUQ%DOLWKHSURSHUW\HQMR\VDFRRO EUHH]H FRPLQJ LQ IURP QHDUE\ ULFH ¿HOGV DFFRPSDQLHG E\ WKH KXP RI D VPDOO ULYHU WKDW SDVVHV E\ LWV HGJH :HOOGHVLJQHGRSHQDLUVSDFHVWDNHIXOODGYDQWDJHRIWKHSHDFHIXOQDWXUDOVXUURXQGLQJVFUHDWLQJLGHDOFRQGLWLRQV IRUFRPIRUWDEOHWURSLFDOOLYLQJ7KHHFRORGJHLVPDGHIURPQDWXUDOPDWHULDOVVXFKDVEDPERRDQGFRFRQXWWUHH ZRRG JLYLQJ LW DQ RULJLQDO UXVWLFFKLF IHHO $Q DUFKLWHFWGHVLJQHG NLWFKHQ DQG ODUJH OLYLQJ VSDFH WDVWHIXOO\ GHFRUDWHGZLWKYLQWDJH(XURSHDQVW\OHIXUQLWXUHPDNHWKHORGJHLGHDOIRUHQWHUWDLQLQJODUJHJURXSVRIIULHQGV7KH $UHJDUGHQDQGDPHWHUODSSRROFRPSOHWHWKHUHOD[HGDWPRVSKHUHRIWKHORGJH6LWXDWHGRQO\PLQXWHV IURP6HPLQ\DNDQGPLQXWHVIURPWKHQHZ6HD6HQWRVD5HVRUW&DQJJX%HDFKDQG&DQJJX&OXEWKHSURSHUW\ LVRQO\PLQXWHVDZD\IURPVHYHUDOYHU\JRRGVXUIEUHDNVDORQJ(FKR%HDFK

Price: USD 350,000

RV-616 MODERN DESIGN IN A GREAT LOCATION /RFDWHGRQ-DODQ5D\D.HURERNDQRQO\PLQXWHVIURPDOOWKHDFWLRQWKLVPRGHUQGHVLJQYLOODRIIHUV VSDFLRXVOLYLQJRQDUHORWEHGURRPVEDWKURRPVODUJHWHUUDFHZLWKDSLFWXUHSHUIHFWYLHZLVDQ H[DPSOHRISHUIHFWPL[ZLWKFRPIRUWDQGGHVLJQ/DUJH[SRROLQDPDQLFXUHGJDUGHQ 7LWOH/HDVHKROG %HGURRP_%DWKURRP /RW6L]H640_+RXVH6L]H640 )XUQLWXUH,QYHQWRU\)XUQLVKHG_6ZLPPLQJ3RRO6L]H[0 /RFDWLRQ.HURERNDQ Price: EURO 275,000

RV-928 A PERFECT BEACH FAMILY HOME /RFDWHGLQ6HVHKMXVWPHWHUVIURPWKHEHDFKWKLVEHGURRPEDWKURRPYLOODLVDIUHHKROGUDULW\ QHVWOHG EHWZHHQ PLOOLRQ GROODU KRPHV (DV\ DFFHVV VWDII TXDUWHUV FDU SDUN SRRO DQG D EHDXWLIXO RSHQGLQLQJOLYLQJDUHDEXLOWWRWKHKLJKHVWVWDQGDUG7RSRIWKHOLQHNLWFKHQDQGDSSOLDQFHVRFHDQ YLHZVIURPWKHVHFRQGÃ&#x20AC;RRUWKLVLVDPXVWVHHIRUWKHEHDFKORYHU 7LWOH)UHHKROG %HGURRP_%DWKURRP_/RW6L]H640IUHHKROG/HDVHKROG640 +RXVH6L]H640_)XUQLWXUH,QYHQWRU\)XUQLVKHG_6ZLPPLQJ3RRO6L]H;0 /RFDWLRQ&DQJJX

Price: USD 375,000

RV-1350 AMAZING MASTERPIECE IN NUSA DUA 7KLV DPD]LQJ SURSHUW\ ORFDWHG LQ 1XVD 'XD FRQVLVWV RI D  DUH SORW ZLWK D EHDXWLIXO YLOOD ZLWK DQRWKHU$UHRIDGMDFHQWODQGDOVRDYDLODEOH7KHYLOODFRPSULVHVRIDPDLQKRXVHZLWKHQVXLWH DQGWZRVHSDUDWH-RJOREHGURRPVJLYLQJ\RXWRWDORIEHGURRPVLQDOO7KLVSURSHUW\KDVDYHU\ XQLTXHGHVLJQDQGFRPHVZLWKORWVRIDQWLTXHIXUQLWXUH7KHYLOODIHDWXUHVDQRSHQOLYLQJURRPDQG GLQLQJDUHDKRZHYHUWKHPRVWLQWHUHVWLQJSDUWRIWKLVYLOODLVWKHYLHZ,WRIIHUVSHUPDQHQWRFHDQDQG PRXQWDLQYLHZ7KHRZQHUVSDUHGQRGHWDLOVZKHQEXLOGLQJWKLVSODFHDQGLWVGHVLJQLVHQKDQFHG WUHPHQGRXVO\ZLWKWKHDQWLTXHIXUQLWXUH7KHYLOODDOVRLQFOXGHVKRXVHVWDIITXDUWHUVDIXOO\HTXLSSHG NLWFKHQODXQGU\DQGVWDIIEDWKURRP3DUNLQJLVDYDLODEOHIRUFDUV Land and Villa = Euro 325.000 Villa = Euro 262.500 | Land = Euro 63.000

RV-1253 YOUR FUTURE IN BALI IS HERE! $ SUHWW\ XQLTXH RSSRUWXQLW\ KHUH WR VHW XS WKH OLIHVW\OH \RX KDYH DOZD\V ZDQWHG 6HW DPRQJVW VWXQQLQJULFH¿HOGVDQGYLHZVWR0RXQW$JXQJLQWKHXSDQGFRPLQJDUHDRI%DQ\DU$QMDU.HURERNDQ WKLVFRPSOH[ZLOOSURYLGHDKRPHDQGLQFRPH%XLOWZLWKDEOHQGRI%DOLQHVHDQG-DSDQHVHLQÃ&#x20AC;XHQFHV LWKDVDWRWDORIEHGURRPVWKHPDLQEXLOGLQJZLWKEHGURRPVDQGWKHQWZRVHSDUDWHYLOODVOLYHLQ RQHDQGUHQWWKHRWKHUDQGUXQWKHPDLQEXLOGLQJFRPSOHWHZLWKGLQLQJDUHDDQGZHOOVHWXSNLWFKHQDV DERXWLTXHUHVRUWWKHUHDUHHQGOHVVFRPELQDWLRQVKHUHIRUDIRUZDUGWKLQNLQJLQYHVWRU6ROGRQD \HDUOHDVHLWVQRWKDUGWRZRUNRXWWKH¿JXUHV /RFDWLRQ.HURERNDQ Price : Villa 6 bedroom 600SQM ; Rp. 9,193 Billion | Villa 2 bedroom 135SQM ; Rp. 2,253 Billion Villa 2 bedroom 165SQM ; Rp. 2,646 Billion | Total price All villa : USD 1,500,000

L-307 PRIME INVESTMENT LAND IN SEMINYAK L-329 FANTASTIC LAND IN KERAMAS 7KLVDUHIDQWDVWLFSDUFHORIIUHHKROGODQGLVPHWHUVWR.HUDPDVEHDFK+DVDVSKDOWDFFHVV DUHRIOHDVHKROGODQGLQ6HPLQ\DNVHWRQDORYHO\ORQJERXOHYDUGDVKRUWZDONWRWKHEHDFKFORVH DQGOLFHQVHWREXLOG7KLVODQGLVDJUHDWLQYHVWPHQWIRUGHYHORSPHQWDVWKHORFDWLRQLVDJUHDWDUHD WR6HPLQ\DNDQG2EHURL5HVWDXUDQWVDQG6KRSSLQJDUHD6XSHUEGHYHORSPHQWRSSRUWXQLW\DWYHU\ UHDVRQDEOHSULFHRI5SSHU$UHSHU\HDU2IIHUHGIRUVDOHZLWKSORWVRIDUHLQDWRWDORI 7LWOH)UHHKROG DUHJLYHV\RXPDQ\RSWLRQVWDNHRQHEORFNRUDOO7KLVGH¿QLWHO\ZRQ¶WEHRQWKHPDUNHWORQJ /RW6L]H640 /RFDWLRQ*LDQ\DU 7LWOH/HDVHKROG Price :Rp. 252,5000,000/ARE /RFDWLRQ6HPLQ\DN Price: Rp. 12 M /are

<28521(67233523(57<6+23 35(6(17,1*3523(57,(6)5208686 +HDG2I¿FH-O6XQVHW5RDG;.HURERNDQ%DOL 3K_)D[_ZZZ[SEDOLFRP_LQIR#[SEDOLFRP

C/Re/I-14 Nov 12


BA_14 November 2012