__MAIN_TEXT__
feature-image

Page 1

DAF

Nº 126 - Ano 12 - Outubro 2015 • Distribuição gratuita • ISSN 1647–7022

EURO VI

ALTERNATIVA ECONÓMICA

CF 440

www.jornalstrada.com


Formação obrigatória para motoristas de veículos pesados de mercadorias e passageiros.

234 197 770 913 466 142

35 140 horas

CAM

geral@jornalstrada.com

229708-A

t


20$17*;(꿌FLHQW/LQH FRQVHJXHID]HUPHOKRU 0DLVSUHFLVDPHQWHPHQRV 1HFHVVLWDPHQRVGRTXHRVHXDQWHFHVVRU

227072

1mRpFRVWXPHGD0$1PDVQHVWHFDVRHVWDPRVVDWLVIHLWRVFRPPHQRV²HRUJXOKRVRV$DYDOLDomRRÀFLDO7h96G GH6HWHPEURGHFRQÀUPRXTXHR0$1(IÀFLHQW/LQHFRQVRPHPHQRVGHFRPEXVWtYHOGRTXHRVHXMi SRXSDGRDQWHFHVVRU,VWRPLQLPL]DRVFXVWRVRSHUDFLRQDLVHDVHPLVV}HVGH&2HPD[LPL]DRVHXOXFUR2PRWRU 'RSWLPL]DGRFRP7RS7RUTXHFRPDXPHQWRGHELQiULRQDVGXDVPXGDQoDVPDLVHOHYDGDVR(IÀFLHQW&UXLVHFRP DVVLVWHQWH*36DFDL[DGHYHORFLGDGHVDXWRPDWL]DGD0$17LS0DWLF®HRXWUDVVROXo}HVGHSRXSDQoDGHFRPEXVWtYHO tornam este gigante de potência num anão de consumos. 3RUYH]HVPHQRVpPDLV'HVFXEUDPDLVHPZZZPDQWUXFNDQGEXVSW

MAN kann.


NEWS MAN Truck & Bus

Fundada em 1954, a Jacinto Marques de Oliveira, Sucrs, Lda., é uma empresa familiar, que se dedica principalmente à fabricação de super-estruturas e montagem de viaturas de combate a incêndios, socorro e salvamento, e também à fabricação e montagem de préfabricados e estruturas metálicas e à construção de pavilhões industriais. A empresa produz veículos de assistência para o mercado nacional e internacional há já 60 anos. Com o intuito de aumentar cada vez mais a qualidade do produto oferecido, e facilitar o processo de aquisição deste tipo de veículos, esta empresa iniciou o programa de certificação MAN, o qual permite ao carroçador tornarse conhecido no mundo MAN, atuar a nível mundial seguindo os mesmos padrões e promover a cooperação com parceiros MAN. A obtenção do certificado de carroçador internacional da MAN é um processo complexo, que envolve exigentes auditorias de qualidade e prova MAN Compliance. Os carroçadores que o obtêm beneficiam de vantagens inequívocas, como novas possibilida-

Outubro 2015

1ºCAR


des de publicidade e divulgação, estruturas de vendas melhorada e simplificação do processo de encomenda, agilização dos processos e uma estreita e próxima cooperação com a MAN. «A preferência pela MAN deve-se à qualidade e fiabilidade que a marca tem demonstrado ao longo dos anos», afirma Jacinto Oliveira, CEO da empresa Jacinto. Outro dos motivos que levou a empresa a avançar com o processo de certificação foi «a flexibilidade que a MAN apresenta, principalmente em termos de proximidade ao cliente», acrescenta Jacinto Reis, gerente da empresa Jacinto. A entrega do certificado de carroçador internacional MAN foi realizada no dia 16 de Outubro, nas instalações da empresa, em Esmoriz. Estiveram presentes os representantes da empresa, diversos representantes da MAN e a imprensa especializada. A Jacinto Marques de Oliveira, Sucrs, Lda. torna-se assim o primeiro carroçador português com certificação internacional MAN, e um dos apenas 40 carroçadores a nível mundial a obter esta distinção. 0 Strada/MN

RROÇADOR

Outubro 2015


protegendo

www.abnseguros.pt facebook.com/abn.seguros

+351 234 197 770 +351 913 466 142 abnseguros@netvisao.pt

229712-C

a sua frota


229706

Conheça a sensação de estar na pole position

Apenas 26 pilotos vão poder aspirar ao trono da MotoGP. E somente 26 condutores poderão ter um Scania único. Com uma aplicação em vinil exclusiva e acessórios personalizados MotoGP, esta edição limitada inclui o Scania Watch, um relógio inteligente ligado ao camião, um passe Paddock para duas pessoas no Campeonato MotoGP (Campeonato do Mundo de Motociclismo) e os melhores serviços Scania para obter o máximo rendimento. E, claro, conta com o inconfundível motor V8, disponível em 580 ou 730 CV. Um camião único que só a Scania, fornecedora de camiões de MotoGP, poderia oferecer-lhe. *Consulte o seu Concessionário Scania: http://scania.pt/dealer-locator/

2

INCLUI

passes

Paddock

um kit de produtos MotoGP* e o exclusivo

Scania Watch


Scania

NEWS

mai

para Outubro 2015

Trans


is

V8

sWhite

Outubro 2015


NEWS Scania

O imponente Scania R 730, já presente na frota, é acompanhado agora do Scania R 580, fazendo da TransWhite a primeira empresa, em Portugal, a ter toda a gama de potências do motor Scania V8: 520, 580 e 730. A atividade principal da TransWhite concentra-se no transporte de carga geral e a temperatura controlada. Devido ao tipo de transportes que efetua e sendo que 98% dos seus clientes são holandeses, era necessário ter uma frota forte, capaz de cumprir com as elevadas exigências dos seus clientes, por isso a preferência na gama V8. Os camiões da TransWhite percorrem cerca de 28.000 Km por mês e têm uma atividade constante. «Podemos dizer que nunca param. Chegam à Holanda, descarregam e voltam imediatamente a carregar para regressar a Portugal, onde começa novamente o processo. Por isso, necessitamos de camiões fiáveis, para sabermos que vão cumprir as nossas exigências e que respondem perfeitamente a este elevado nível de atividade.

É esta a principal razão porque escolhemos a Scania e o seu motor V8, potentes, duradouros e com tecnologia inovadora.» disse José Mota, proprietário da TransWhite. A frota da TransWhite é composta por 62 veículos, 66% camiões Scania. Atualmente conta com 6 unidades Scania R 580 LA 4X2 MNA com cabine CR19TL; no final do ano juntar-se-ão mais três e outras 2 no início de 2016. Com este motor, a TransWhite vai contar com a gama completa de potências V8, pois já tinha anteriormente dois Scania R 520 e adquiriu recentemente um imponente Scania R 730. A TransWhite confia na equipa do concessionário da Scania Portugal em Leiria e da rede Scania. José Mota justifica, dizendo: «A atenção personalizada, a confiança e o profissionalismo da rede de serviços da Scania, em especial do concessionário da Scania Portugal em Leiria, contribuem de forma relevante para que continuemos a contar com a Scania como a marca predominante na frota da nossa empresa. Para mim, a Scania é uma marca de confiança!». 0 Scania

FICHA TÉCNICA Platinum Winner of the European Seal of e-Excellence 2011 Innovation and marketing in digital communication

Outubro 2015

Director: Giancarlo Terrassan e giancarlo.terrassan@jornalstrada.com - Directora adjunta: Ana Bela Nogueira e ana.bela.no e editor@jornalstrada.com - Giancarlo Terrassan, Carlos Jorge Mateus, Patrick Dreux, Nuno Almeida - Design e Layout: Am m +351 968 708 537 - e comercial@jornalstrada.com - Propriedade e edição: Ameise Editora, Lda. - Rua da Cabreira, 83 R/ - e giancarlo.terrassan@jornalstrada.com - URL: www.jornalstrada.com - Cons. Reg. Com. de Aveiro N° 5940/040317 - NIF: para a Comunicação Social - ISSN: 1647–7022. - Toda a reprodução, seja por fotocópia ou por qualquer outro processo, sem pr responsabilidade dos mesmos; a Ameise Editora, Lda. declina qualquer responsabilidade em caso de acção judicial.


ogueira@jornalstrada.com - Redação: e editor@jornalstrada.com - Colaboradores: Marta Santos, Séfora Gouveia, Marlene Mesquita da Silva, Tavares Ribeiro, João Cerqueira, Nuno Almeida - Reportagem fotográfica: meise Editora, Lda. - Paginação: e editor@jornalstrada.com - Ameise Editora, Lda. - Directora Comercial: Marisa Nogueira de Sousa - Marketing e Publicidade: t +351 234 197 770 - f +351 234 197 770 /C Dto - S. Bernardo - 3810-071 Aveiro - Portugal - Contactos: t +351 234 197 770 - f +351 234 197 770 m +351 916 834 742 - m +351 913 466 142 - m +351 968 708 537 - e ameise.editora@netvisao.pt : 506 821 315 - Cap. Social: E 50.000,00 - Fundado: Dezembro de 2003 - Periodicidade: Mensal - Divulgação: Distribuição gratuita Depósito Legal: 203764/03 - Registo N° 124492 ERC - Entidade Reguladora révia autorização do editor, é ilícita e passível de processo judicial. - Todos os textos enviados pelos leitores e publicados no Strada ou em qualquer outro produto de propriedade da Ameise Editora, Lda., são de inteira

Outubro 2015


Formação obrigatória para motoristas de veículos pesados de mercadorias e passageiros.

234 197 770 913 466 142

35 140 horas

CAM

geral@jornalstrada.com

229708-A

t


No meu mundo conta a eficiência. E o meu Cool da Krone.

a Máxima eficiênci de refrigeração.

O Cool Liner Duoplex Steel é o semirreboque frigorífico da KRONE, sendo uma das suas características, um painel em aço contínuo. O Cool Liner Duoplex Steel é robusto, prático e eficiente. O KRONE Cool Liner é feito à medida para o uso diário na circulação de mercadorias com temperatura controlada . Chassis, caixa de frio e acessórios, são fiáveis e bem pensados. Do canal de ar flexível através do prolongamento do fundo de contenção hermético até aos fechos traseiros de inox: mesmo o pormenor mais pequeno deve corresponder às exigências máximas.

229865

www.krone-trailer.com Keytrailer, Lda., Estrada Nacional 1, Km 116 Canoeira, PT- 2440-055 Batalha Tel.: +351 244482619, Fax: +351 211454510


NEWS Krone

10.000

Outubro 2015


0 EIXOS

KRONE

Outubro 2015


NEWS Krone

Outubro 2015


De 0 a 10.000 em apenas um ano, o eixo de reboque da Krone consegue dar um salto em frente. O lançamento do novo eixo, teve lugar na IAA 2014 (Internationale Automobil-Ausstellung), em Hannover na Alemanha. Atualmente mais de 10.000 eixos foram instalados, o diretor administrativo, Bernard Krone, diz estar extremamente satisfeito com este desenvolvimento tão positivo, dizendo «A nossa estratégia para oferecer o “All-in-Krone-Trailer” (tudo de uma única fonte), que incluí o nosso eixo, provou ser a melhor abordagem. Os nossos clientes confiam na marca Krone e estamos gratos pela preferência, este novo eixo é um grande marco na empresa.». O novo eixo da Krone é fabricado na Trenkamp & Gehle, empresa do grupo Krone desde 2013, sediada em Dinklage. O sistema do eixo Krone com travões de disco é distinto e inovador, devido à sua unidade de rolamento isenta de manutenção (maintenance free bearing unit) e ao braço de suspensão pneumático, caraterizado por ser excecionalmente leve e com ligação de aperto aparafusada. 3

Outubro 2015


Krone

NEWS

3 Uma vantagem extra são as características do material homogéneo para os assentos dos rolamentos, que assegura maior estabilidade. A Krone oferece aos seus clientes 6 anos de garantia no eixo, com quilometragem ilimitada. Adicionalmente, a Krone oferece o “One-Check-Per-Year System” uma única revisão por ano dentro do âmbito do serviço principal. Desde a introdução do “All-inKrone-Trailer” a Krone conseguiu estender significativamente o seu portfólio de serviços. Por exemplo todos os componentes do veículo possuem um número de série da Krone, permitindo assim que os clientes possam encomendar as partes necessárias, diretamente à Krone de forma rápida. «Para benefício dos nossos clientes, disponibilizamos um serviço “all-round”, direcionado aos reboques e aos novos eixos. Os 10.000 eixos Krone, que já foram instalados, são o testemunho real tanto da aceitação do eixo no mercado como da abordagem "All-inKrone-Trailer”.» disse Bernard Krone. 0 Ana Bela Nogueira

Outubro 2015


Outubro 2015


protegendo

www.abnseguros.pt facebook.com/abn.seguros

+351 234 197 770 +351 913 466 142 abnseguros@netvisao.pt

229712-C

a sua frota


A SUA RENTABILIDADE É O NOSSO OBJECTIVO

A DAF conhece o seu negocio e reconhece a importancia da eficiencia para si.

MENOR CONSUMO DE COMBUSTIVEL

É por isso que oferecemos soluções sofisticadas de transporte, camiões que oferecem uma excelente rentabilidade e baixos xustos operacionais. Tambem

MAIOR DISPONIBILIDADE DO VEICULO

disponibilizamos uma ampla gama de serviços que asseguram a maxima disponibilidade do veiculo. Tudo isto esta disponivel num unico lugar: o Seu Concessionario DAF. DAF Transport Efficiency é o nome da nossa filosofia para lhe oferecer o maior rentabilidade por cada quilometro percorrido.

MELHORAR A SUA EFICIENCIA COMEÇA HOJE

229716

Contacte o seu concessionario DAF ou visite www.daf.com

DRIVEN BY QUALITY TRUCKS | PARTS | FINANCE

WWW.DAF.COM

MENORES CUSTOS OPERACIONAIS

MAIOR RESULTADO POR QUILOMETRO

MENOR IMPACTO AMBIENTAL


Outubro 2015

ALTERNATIVA ECONÓMICA

C

Ana Bela Nogueira - Jornal Strada

TESTDRIVE


Giancarlo Terrassan - Jornal Strada

| Giancarlo Terrassan giancarlo.terrassan@jornalstrada.com

EURO VI

F 440 Outubro 2015


TESTDRIVE DAF

Motorização Estávamos equipados com a versão mais potente dos 6 cilindros MX-11 (que agora são 3% mais eficiente de que a geração anterior) Euro VI com SCR (Selective Catalytic Reduction), EGR (Exhaust Gas Recirculation) e DPF (Diesel Particulate Filter) — 10,8 litros de cilindrada, 435 CV (320 kW) de potência disponíveis entre as 1.450 e as 1.700 rpm e um binário de 2.100 Nm (entre as 1.000 e as 1.450 rpm); injecção Common-Rail; turbo com VTG (Variable Turbine Geometry) e Intercooler. Caixa de velocidades A caixa de velocidades automatizada ZF AS Tronic 12 S 2130 DD de 12 relações; rácio 15,86-1,00. Eixos Eixo dianteiro 163N com suspensão de 2 lâminas parabólicas; eixo traseiro SR1344 com redução simples nos cubos i=2, 64 e com suspensão pneumática de 4 foles e estabilizador. Sistema de travagem Travões de disco auto-ventilados em todas as rodas; travão de motor MX que funciona em combinação com o travão de escape, perfeito mesmo a baixas rotações; intarder ZF com um poder máximo de travagem de 500 kW (670 CV).

Outubro 2015


Outubro 2015


Outubro 2015

Ana Bela Nogueira - Jornal Strada

TESTDRIVE


A partir de 2015, a DAF deu início à implementação da sua nova filosofia, de tipo “lego”, com a etiqueta “Edition 2015”, para meter em pratica, lado a lado, inúmeras inovações que visam aumentar substancialmente a eficiência de toda a sua vasta oferta de camiões. Esta filosofia “Edition 2015”, tem como base a escolha do veículo mais apropriado para cada tipo de missão, passando sucessivamente pelo aumento da aerodinâmica, diminuição do peso dos veículos visando elevar o pay load, introdução de mais sistemas tecnológicos de segurança e de apoio à condução, aperfeiçoamento no desenvolvimento dos motores, alongamento dos intervalos de manutenção, melhoramento e ajustamento dos contratos de manutenção e reparação, implementação de sistemas de financiamento mais atractivos e finalmente os a inclusão dos programas de formação dos motoristas para obter o melhor proveito e rendimento dos próprios camiões. A DAF Trucks iniciou este processo com as motorizações MX e as gamas CF e XF. Relativamente às tecnologias que foram integrada nos modelos “Edition 2015”, queremos destacar a optimização do ACC (Adaptive Cruise Control) com a introdução do PCC

(Predictive Cruise Control) e do Predictive Shifting, o EcoMode, as novas funções da AS-Tronic, o TPMS (Tire-Pressure Monitoring System), o DPA (Driver Performance Assistant). A optimização do ACC com a introdução do PCC e do Predictive Shifting, segundo a DAF Trucks, vai permitir uma redução de até 3% no consumo de combustível. Apoiandose ao sistema de GPS, o PCC reconhece as características topográficas é a geomorfologias do percurso nos próximos 2 quilómetros, adaptando a velocidade e a relação da caixa para poder melhorar o rendimento do veículo em função do tipo de percurso. Também a gestão electrónica da caixa automatizada ASTronic foi melhorada, contando também com a implementação das novas funções Fast Shift e Eco-Roll. A função Fast Shift permite uma mudança extremamente rápida entre a 10ª, a 11ª e a 12ª relação, diminuindo, desta forma, o “gap” que origina uma perca de rendimento e velocidade especialmente nos troços em subida — uma das causas de aumento drástico no consumo de combustível. A função EcoRoll, bem conhecida por todos, permite diminuir os consumos aproveitando o próprio peso do veículo e a força de inércia. O programa EcoMode reduz

3

Outubro 2015


DAF

TESTDRIVE

3 de cerca 10% o binário nas primeiras 11 relações da caixa e inibe a utilização da caixa no modo manual, permitindo uma ulterior poupança de cerca 1% no consumo de combustível. O EcoMode pode ser activado ou desactivado através de um botão colocado na alavanca da gestão da caixa e do retarder. O TPMS (Tire-Pressure Monitoring System) permite um constante controlo da pressão dos pneumáticos, através do display central, para melhorar o rolamento do veículo e diminuir a resistência criada pelo atrito ao asfalto — mais um importante factor a não descurar, para a redução dos consumos de combustível. Finalmente, o DPA (Driver Performance Assistant), um interessante sistema de monitorização constante do comportamento do motorista. Através do DPA, o condutor poderá verificar a qualquer momento o resultado da eficiência da sua condução. O DPA consente ainda, analisar o comportamento do motorista e proceder a eventuais correcções para melhorar o seu desempenho. O ALM (Axle Load Monitoring) um importante sistema de monitorização do peso sobre o eixo. O camião Recentemente tivemos a oportunidade de testar um exem-

Outubro 2015

plar da família CF, representante desta nova geração “Edition 2015”, que, segundo a DAF, deverá proporcionar poupanças de combustível de 5%, no mínimo, graças à nova tecnologia implementada. O nosso veículo de teste era uma unidade tractora, com semitrailer (carregado, com peso bruto de 40 toneladas), do novo modelo CF 440 Euro VI “Edition 2015”, com configuração 4x2 (FT) e cabina SpaceCab com interiores em pele. Estava já apetrechado com os mais recentes sistemas de segurança e apoio à condução que se tornarão obrigatórios a partir do próximo dia 1 de novembro — ACC (Adaptative Cruise Control), FCW (Forward Collision Warning), LDWS (Lane Departure Warning System), AEBS (Advanced Emergency Braking System). A condução Externamente o aspecto do CF é elegante e gracioso. O acesso à cabina é extremamente fácil, graças aos largos degraus antiderrapantes. No interior, mais uma vez, somos impressionados pela elegância e harmonia das linhas e das cores — típicas em casa DAF. O interiores em pele, mesmo no volante, acentuavam ainda mais o aspecto luxuoso e de elevado conforto que este CF oferece. 3


Outubro 2015


Outubro 2015

174950

DAF

DAF

TESTDRIVE


3 Ajustados o banco e o volante, todos os comandos estavam ergonomicamente posicionados. A visão exterior, com a grande superfície vidrada, era clara e ampla, um factor muito importante, quando estamos a conduzir em zona urbanas. O conjunto dos espelhos garantia também uma boa visualização, sendo eles muito funcionais. Ao dar a chave, reparei no conforto acústico do interior desta cabina, conforto que tive ao longo de todo o teste, realmente silencioso, mesmo quando estava pedindo um pouco mais ao motor. A escolha do percurso Considerando a localidade onde me encontrava e o tempo que tinha à disposição, tive que escolher um percurso que me permitisse ter uma aprecia-

ção mais realista possível, portanto, exclui a condução em zona montanhosa, que ficava demasiado longe (factor tempo) e a condução em autoestrada por ser claramente fácil demais e de certo modo óbvia. Optei, assim, por um percurso mais exigente, a estrada nacional Nª 1 entre Castanheira do Ribatejo, o famoso Ponderosa, Vila Franca de Xira e novamente Castanheira do Ribatejo — com troços em subida e descida misturados com curvas estimulantes, com passagem em zonas urbanas, muitas zonas com limitação de 50 kmh, rotundas, semáforos, muito transito —, enfim o ideal para testar, ao longo de 60 quilómetros, o desempenho deste CF em situações de constantes travagens, paragens e arranques. 3

Outubro 2015


Outubro 2015

Ana Bela Nogueira - Jornal Strada

TESTDRIVE


3 Em pequenos percurso dentro e fora das localidades, experimentei um pouco o Eco-Mode e efectivamente notei a diferença no desempenho do CF, é claro que não é muito interessante utilizar o Eco-Mode em percursos mais exigentes, mas é muito bom quando temos percursos “livres” em nacionais ou autoestradas. As dificuldades Durante todo o percurso, tive que enfrentar os maiores “obstáculos” para a obtenção de bons consumos, estes “obstáculos” foram o horário (logo a seguir do almoço), o trânsito e as travessias de peões em zonas habitacionais (especialmente na primeira e última parte do percurso), que me obrigaram a efectuar vários pára e arranca. As entradas em rotundas obrigavam a abrandar substancialmente para depois, em saída, ter que voltar a acelerar. Em quase todos os semáforos que encontrei, tive que parar, devido ao desrespeito da velocidade indicada, por parte dos condutores de ligeiros que me antecediam e que faziam desparrar o vermelho. Relativamente aos semáforos, existe um sistema pouco dispendioso e fácil de implementar, que permitiria reduzir os consumos de combustível evi-

tando a paragem dos veículos e, ao mesmo tempo, aumentaria a segurança rodoviária. Este sistema mantem o semáforo sempre em posição vermelha, passando para verde somente quando detecta que o condutor ajusta a sua velocidade à indicada no lugar. O resultado Chegados ao nosso destino, tive uma sensação mista, satisfeito pela fantástica máquina e triste ao mesmo tempo, para não poder ter tido mais tempo para desfrutar deste pequeno grande prazer. No fim do teste, fiquei também satisfeito por outro motivo, o meu desempenho na condução, sempre verde com um elevado nível de “ECO performance”, 86 na avaliação total; 88 na “Anticipation” (antecipação) por ter aproveitado bem o andamento livre; 82 na “Efficient Braking” (travagem eficiente) obtido graças à elevada utilização de sistemas de travagem auxiliários, nomeadamente o retarder e travão de motor. Os consumos foram ligeiramente acima do espectado, todavia, os 33,6 l/100km foram bons, considerando os inúmeros “obstáculos” que encontrei ao longo do meu percurso. 0

Outubro 2015


EVENTS Renault Trucks

O VENCE ES

Outubro 2015


DOR É... SPANHOL

Outubro 2015


Outubro 2015

Renault Trucks

EVENTS


Giancarlo Terrassan - Jornal Strada

| Ana Bela Nogueira ana.bela.nogueira@jornalstrada.com

No dia 7 de outubro, decorreu em Lisboa a final internacional do “Optifuel Challenge”, onde 37 condutores de 20 países (Bélgica, Bulgária, República Checa, França, Alemanha, Reino Unido, Hungria, Itália, Polónia, Lituânia, Luxemburgo, Marrocos, Portugal, Roménia, Rússia, Eslováquia, Espanha, Suíça, Tunísia e Turquia) aceitaram o desafio da “eco-driving” e “cost efficency” ao volante do Renault T, vencedor do “International Truck of the Year 2015”. O vencedor desta terceira edição da competição “Optifuel Challenge”, organizada pela Renault Trucks, foi José Ramón Jano Gago, condutor e diretor da transportadora espanhola Janocargo. O segundo lugar foi ocupado por Vytautas Luotè, condutor lituano na Stella Nova. Finalmente, o terceiro lugar do pódio foi para o português Vítor Pereira, condutor na empresa JLS.

3

Outubro 2015


Renault Trucks

EVENTS

3 Após a sua vitória José Ramón declarou «Eu não conduzo todos os dias para a minha empresa, mas apesar de toda a preparação, estava muito nervoso, especialmente porque a rota realizada nos testes era bastante técnica. Estou realmente feliz com este resultado e acho que os condutores da minha empresa terão orgulho em mim.». A frota da Janocargo é composta por 22 veículos, 17 dow quais são da Renault Trucks. Além disso, José Ramón, salientou as excelentes características do Renault T, «Eu aprecio as qualidades técnicas destes veículos, particularmente todas as tecnologias acrescentadas com a finalidade de reduzir o consumo de combustível. Eu sempre presto muita atenção ao conforto dos meus condutores e estou muito satisfeito com o que o Renault T oferece nesta área.». O prémio de José Ramón consiste num voucher de compras, a ser usado na loja da sua preferência, no valor de €8.000. A Janocargo com esta vitória ganha um ano de serviço de aluguer completo de um Renault Trucks Optifuel. 3

Outubro 2015


Outubro 2015


Renault Trucks

EVENTS

3 O lituano Vytautas Luotè, segundo classificado, é motorista na empresa Stella Nova, a qual conta com uma frota de 12 veículos da Renault Trucks, que recentemente aumentou para 16 com a entrada de 4 novos Renault T. Vytautas Luotè, após os resultados disse «Fiquei muito satisfeito com o meu resultado, especialmente pela dificuldade técnica da rota, em particular as rotundas e as curvas da estrada.». A sua experiência de 6 anos ao volante de um Renault Magnum e a condução do Renault T no último deramlhe a prática que necessitava para esta competição. Vytautas Luotè explicou «Eu aprecio as opções de segurança que o Renault T oferece, nomeadamente o Optiroll e o Soft Cruise Control, o isolamento da cabine é outra característica que aprecio neste veículo, pois oferece-me grande conforto durante a condução.». O prémio de Vytautas Luotè consiste num voucher de compras, a ser usado na loja da sua preferência, no valor de €2.000. A Stella Nova com esta vitória ganha um voucher de €3.000 para compras da Renault Trucks. 3

Outubro 2015


Outubro 2015


O último lugar do pódio foi conquistado pelo motorista português Vítor Pereira, da JLS, que neste momento, possui 3 Renault T. Depois da competição, Vítor Pereira explicou qual foi o motivo que o motivou a entrar nesta competição «Eu decidi concorrer, porque queria demons-

Renault Trucks

EVENTS

3

Outubro 2015

trar o que era capaz de fazer relativamente à condução racional, especialmente por ser um ponto que a JLS valoriza bastante, todos os 250 condutores são colocados em treinos de condução. No fim fiquei bastante satisfeito com o meu resultado.». Salientou ainda que gosta da condução que es-

te veículo lhe oferece «Sinto-me particularmente confortável com o uso do Optiroll e o conforto da cabine.». O prémio de Vítor Pereira consiste num voucher de compras, a ser usado na loja da sua preferência, no valor de €1.000, A JLS com esta vitória ganha um voucher de €2.000 para


compras na Renault Trucks. A competição decorreu em duas fases: na primeira, os finalistas tiveram que responder a um questionário sobre condução económica e na segunda tiveram que percorrer um trajeto em via pública, de aproximadamente 40 minutos ao volante do Renault T Optifuel.

Durante o percurso os finalistas foram monitorizados através de um software desenvolvido pela Renault Trucks, Optifuel Infomax, que serviu para a analisar o seu desempenho. No resultado final, a fase de condução teve um peso de cerca de 90% da avaliação, dividida em 3 parâmetros: a qua-

lidade da condução, a velocidade e o consumo de combustível. Terminada esta fase, cada finalista teve a oportunidade de falar sobre poupança de combustível e condução económica com um especialista da Renault Trucks, para permitir ao júri ter uma visão mais abrangente da abordagem de cada um. 0

Outubro 2015


NEWS VolvoTrucks

TRUCK OF T

Outubro 2015


THE FUTURE

Outubro 2015


Outubro 2015

VolvoTrucks

NEWS


Atualmente, existem cerca de 175.000 camiões Volvo ligados online nas estradas da Europa. Alguns deles já podem enviar informações quando precisam de manutenção e parte do trabalho de manutenção necessário pode até ser efetuado remotamente. Isso, no entanto, é apenas o início. «Nos próximos anos, por exemplo, o camião poderá monitorizar o seu próprio estado em tempo real, promovendo uma assistência mais fácil e rápida, o que resulta numa maior produtividade de todos os envolvidos – motoristas, oficinas e empresas de transporte», diz Hayder Wokil, diretor de Qualidade e Período Operacional na Volvo Trucks. No futuro, o camião também tornará mais simples a administração ao nível da oficina, agendando a sua própria manutenção conforme necessário, reservando os mecânicos adequados para os trabalhos em questão e encomendando antecipadamente as peças necessárias para entrega na oficina. As reparações poderão ser realizadas onde quer que o camião esteja e serão efetuadas num período adequado no respetivo horário de trabalho. «A assistência será sincronizada com o horário de funcionamento do camião e será agendada na oficina mais próxima, a uma hora em que o veículo

não estaria, de qualquer das formas, a trabalhar, por exemplo à noite ou quando o motorista tem de fazer uma pausa imposta por lei. Através de ligação online, o camião também poderá efetuar remotamente reparações automáticas simples», complementa Hayder Wokil. O camião do futuro também permitirá uma maior flexibilidade. À medida que o potencial de conectividade dos camiões continuar a crescer, os veículos poderão ser especificados segundo cada serviço individual, o que, por sua vez, promove um funcionamento mais eficiente. «A próxima geração de camiões será cada vez mais personalizada e poderá, por exemplo, ser personalizada de acordo com as necessidades e o estilo de condução do operador. Também poderá atualizar a sua própria configuração de acordo com serviços de transporte específicos», explica Hayder Wokil. Um pré-requisito importante para ter acesso aos benefícios da conectividade é a recolha de grandes quantidades de dados. Segundo Per Adamsson, diretor de Desenvolvimento Estratégico e Comercial no Departamento de Telemetria do Grupo Volvo, os camiões dos nossos dias seguirão a tendência

3

Outubro 2015


Outubro 2015

VolvoTrucks

NEWS


3 demonstrada pelos smartphones em anos recentes. Na indústria automóvel, fala-se na “Evolução Smartphone Sobre Rodas”. «Num futuro próximo, os camiões poderão comunicar com outros utentes da estrada e com dispositivos móveis de ativação remota, como capacetes de bicicleta, ajudando a reduzir o risco de acidentes e o número de paragens não planeadas», revela Per Adamsson. «Graças à conectividade online, no futuro, o camião também poderá monitorizar o tráfego de forma independente e selecionar a rota mais eficiente se existirem congestionamentos de trânsito ou trabalhos na estrada mais à frente», continua Per. No entanto, ainda que muita da tecnologia para concretizar o camião do futuro já exista atualmente, poderá levar algum tempo até que o cenário da próxima geração se torne realidade. «O maior desafio está em filtrar a enorme quantidade de dados que recolhemos dos nossos veículos. A infraestrutura de conectividade em todo o mundo também precisa de ser mais desenvolvida antes de ser possível transformar esta visão da próxima geração na realidade do dia a dia», diz Hayder Wokil. 0 Strada/VT

Outubro 2015


Formação obrigatória para motoristas de veículos pesados de mercadorias e passageiros.

234 197 770 913 466 142

35 140 horas

CAM

geral@jornalstrada.com

229708-A

t


227118

Iveco com


174950

Giancarlo Terrassan - Jornal Strada

EVENTS

| Ana Bela Nogueira

ANTRAM

ana.bela.nogueira@jornalstrada.com

No EPIC SANA Algarve Hotel, em Albufeira, decorreu o 15º Congresso da ANTRAM (Associação Nacional de Transportadores Públicos Rodoviários de Mercadorias), que marca os 40 anos da associação, com o tema “Sinergias que nos unem”.

3

XV CONGRES

ANTRA

Outubro 2015


SSO

AM

Outubro 2015


ANTRAM

EVENTS

3 Durante este congresso, a ANTRAM mostrou a sua nova imagem institucional, mais moderna e dinâmica, que espelha os desafios assumidos pela associação como representante do sector dos transportes rodoviários de mercadorias. A implementação desta nova imagem será gradual para assegurar toda a logística da associação e a utilização de materiais anteriormente produzidos. Numa plateia de cerca de três centenas de pessoas, foram várias as entidades e empresas ligadas ao sector que fizeram parte deste congresso. Este ano o evento contou igualmente com a presença da conceituada piloto portuguesa Elisabete Jacinto, que distribui alguns autógrafos aos presentes. Sobre os desafios no contexto europeu, foi referida a importância de se desenvolver um trabalho sistemático junto das instâncias europeias, nomeadamente REPER e Comissão Europeia. Neste mesmo contexto, foi abordada a questão da aplicação do salário mínimo alemão a todo o transporte internacional com origem ou destino na Alemanha que é contrário à liberdade de circulação, violando os princípios fundamentais do Tratado da União Europeia. A ANTRAM defende o reforço da intervenção do

3

Outubro 2015


Outubro 2015


ANTRAM

EVENTS

3 Governo junto da Comissão Europeia e das autoridades alemãs, com o intuito de obter uma alteração legal que seja justa e razoável sobre esta questão. A ANTRAM defende igualmente a concretização de medidas compensatórias previstas no acordo de entendimento de 2011 sobre o aumento da contribuição do serviço rodoviário, a criação da taxa de carbono e a manutenção da taxa adicional no gasóleo rodoviário. No âmbito do acesso à profissão de motorista, foi sugerido ponderar a possibilidade de redução dos custos para a obtenção do CAM (Certificado de Aptidão do Motorista) e para a carta de condução, sendo que as aulas de condução dever ser substituídas por formação prática em contexto de trabalho. Foi ainda salientada a possibilidade de antecipação da idade máxima para a obtenção da carta de condução de pesados de mercadorias para os 18 anos, idade permitida no Reino Unido. A ANTRAM anunciou neste congresso a criação de um programa de gestão de líderes, em parceria com a Jason Associates. 0

Outubro 2015


Outubro 2015


I n v is t a com i nte li g ê n c i a , l ucr e com a I n t e r mod m a l 2 0 16 Par t icipe e garanta seuu espaço na Inter modal 2016, o evento mais impor tante das Amér icas dedicado à logíst ica, transpor te de cargas e comércio ex ter ior. É aqui que você v ai encontrar as maiores opor tunidades de negócio para o seu setor, confer ir v isibilidade à sua marca, encontrar um público qualificado e tratar diretamente com executi vos com al to poder de decisão. A Inter modal é o per fei to invest imento para sua empresa: e

• Melhor opor tunidade p a r a g e r a r o m a i o r n ú m e r o d e l ea d s em apenas 3 dias e garantir negócios pa r a o a n o t od o

• Maiores playyers do setor presentes: 600 marcas nacionais e inter nacionais

85%

68%

80%

dos v isi tantes par t icipam do pr ocesso de compr a

dos v isi tantes são embar cador es d e ca r g a em b us ca de no v as soluções

dos o expositores fizeram novos contatos de negócio

Ligue para +55 11 4878 5990 ou env ie um e-mail para info@inter modal.ccom.br Acesse inter modal.com.br e descubra mais

229704

RESERVE O SEU ESPAÇO AGOR A MESMO E COMECE A PROJE TAR SEUS LUCROS!


227074


Giancarlo Terrassan - Jornal Strada

EVENTS

SEMINĂ R

Outubro 2015


RIO ANTP Giancarlo Terrassan - Jornal Strada

em FAMALICÃO

| Ana Bela Nogueira ana.bela.nogueira@jornalstrada.com

A Associação Nacional de Transportadoras Portuguesas (ANTP) realizou na Casa das Artes de Vila Nova de Famalicão, em Braga, um seminário onde foram debatidos alguns dos temas atuais e mais relevantes, que preocupam os profissionais de transportes rodoviários de mercadorias. Neste seminário estiveram presentes algumas entidades e convidados, realçamos, Ricardo Mendes, vice-presidente da Câmara Municipal de Vila Nova de Famalicão, António Teixeira, presidente da ARAN (Associação Nacional do Ramo Automóvel), Alberto Franco do IMT (Instituto da Mobilidade e Transportes) e Miguel Berbereia Costa da ACT (Autoridade para as Condições do Trabalho).

3

Outubro 2015


Giancarlo Terrassan - Jornal Strada

EVENTS

3 Durante o seminário foram abordados temas de crucial relevância para os profissionais do sector, nomeadamente sobre os tacógrafos, a segurança rodoviária, a regulamentação relativa a pesos e dimensões e as perspectivas para o futuro. José Alberto Franco, diretor de serviços de regulação jurídicoeconómica, do Instituto da Mobilidade e Transportes, fez uma reflexão sobre as perspectivas de futuro para o transporte rodoviário de mercadorias. Em seguida, Miguel Berbereia Costa, ACT, deu a conhecer a “Campanha de Segurança e Saúde no Trabalho da Condução Automóvel Profissional” e do projecto OiRA (Online Interactive Risk Assessment), uma plataforma on-line Europeia para criar ferramentas gratuitas, de fácil utilização, para a avaliação de riscos sectoriais em pequenas e microempresas. Sandra Ramalho, da ANTP, abordou o tema tos tacógrafos e dos pesos e dimensões dos veículos, esclarecendo algumas duvidas sobre a regulamentação social dos transportes rodoviários de mercadoria. Rosa Veloso, responsável comercial na Process Advice, em-

Outubro 2015


Outubro 2015

Giancarlo Terrassan - Jornal Strada

presa de consultoria, auditoria e formação, destacou o Programa 2020, dando a conhecer as oportunidades para o sector no que diz respeito aos fundos comunitários, outros sistema de incentivos e qualificação das PME. Sobreiro Duarte, trainer e coach da empresa Sentidos Dinâmicos, realçou a importância da formação, na sua intervenção com o tema “As pessoas fazem a diferença”, que por vezes é desvalorizada sem causa justificada. Sobreiro Duarte elogiou ainda a iniciativa da ANTP, salientando «A dinâmica desta direção, vai permitir a união do setor dos transportes rodoviários de mercadorias, podem contar com o nosso Sentido». Jorge Teixeira, da BlueChem, falou sobre as vantagens da utilização do AdBlue, produto que comercializam e é recomendado pelos principais fabricantes da indústria automóvel. Jorge Teixeira, frisou ainda que o AdBlue é uma marca registada pelo VDA (Verband der Automobilindustrie) com utilização licenciada a BlueChem. O evento terminou com a assinatura de novos protocolos de parceria com a ANTP. 0


NEWS Michelin

MICHEL

TIRE CA

Outubro 2015


A Michelin acompanha desde sempre as empresas de transporte a fim de analisar o seu modo de funcionamento, identificar as suas necessidades e implementar serviços inovadores. Compreende que estas operam cada vez mais em ambientes difíceis, de dura competência e de grandes exigências e que factores como a garantia de segurança, a rapidez, a eficiência, a fiabilidade e a redução de custos devem ser assegurados. Com este intuito, a Michelin lança para as empresas a Michelin Tire Care.

3

ARE

Michelin

LIN

Outubro 2015


NEWS Michelin

3 A Michelin desta forma oferece não só um pneu de excelência, como também um conjunto de soluções digitais adaptadas às suas expetativas. Três ofertas formam a Michelin Tire Care, que permitirão aos clientes aproveitar ao máximo todo o potencial dos pneus da Michelin. Estas ofertas, adaptadas às necessidades de cada empresa de transporte, são a aplicação TireLog, iCheck e iManage. TireLog é uma aplicação gratuita para smartphones (funciona para sistemas da Apple e Android), que permite às frotas de transporte, especialmente às com menos de 20 veículos, garantir o seguimento dos seus pneus de maneira muito simples e eficaz. A oferta iCheck disponibiliza um kit com uma ferramenta que permite realizar facilmente as inspeções, obter relatórios sobre os pneus e receber alertas. Controla a pressão, a profundidade da escultura da banda de rolamento e o estado geral dos pneus. 3

Outubro 2015


Outubro 2015


NEWS Michelin

Outubro 2015


3 O iManage permite levar a cabo um seguimento individual de cada pneu, durante toda a sua vida útil, numa frota de veículos que possua a sua própria oficina de manutenção. A identificação por um chip RFID (Identificação por Radiofrequência, nas suas siglas em inglês) proporciona uma rastreabilidade total dos pneus em stock e nos veículos. A inovação é o pilar da estratégia da Michelin. Consiste em fornecer aos utilizadores soluções criativas de valor que proporcionem mais performance. Atualmente, a vigilância e o controlo dos pneus fazem-se manualmente, o que limita a frequência das inspeções dos veículos e torna a recolha de dados insegura e morosa. Realizar eficazmente o controlo dos pneus numa frota através de ferramentas digitais constitui, assim pois, um progresso fundamental para a empresa de transporte. As soluções digitais implementadas permitem reduzir três vezes o tempo dedicado à revisão dos pneus. A rastreabilidade dos pneus permite à empresa de transporte saber exatamente o estado da sua frota e as suas necessidades futuras 0 Strada/MH

Outubro 2015


NEWS MAN Truck & Bus

A Goodyear anuncia que passará a ser o único parceiro de pneus da iniciativa ProfiDrive® de MAN, destinada à formação de condutores em toda a Europa. Como marco desta colaboração, a Goodyear vai equipar os 25 tratores e reboques usados pela MAN ProfiDrive® com os pneus Premium. Isto inclui os FUELMAX de baixo consumo de combustí-

vel, os KMAX da linha de elevada quilometragem e Omnitrac II de serviço misto que podem operar tanto em estrada como off-road. A Goodyear vai assegurar a manutenção dos pneus, o que inclui assumir a responsabilidade pela oficina de reparação de pneus. A parceria consolida a participação da Goodyear na formação de for-

madores da MAN em questões de pneus. Este projeto assenta na estreita colaboração de longa duração entre a Goodyear e a MAN ligada ao equipamento original para camiões. Há já algum tempo que as duas empresas trabalham em conjunto em iniciativas como as Jornadas MAN Trucknology®. "Estamos muito satisfeitos por

PARCEIR Outubro 2015


ampliar a nossa atual parceria com a MAN equipando em exclusivo os veículos MAN ProfiDrive® com os nossos pneus de camião Goodyear Premium", esclareceu Peter Platje, diretor de Vendas de Pneus para Camiões OE

Goodyear Europa, Médio Oriente e África. "A nossa formação profissional e prática melhora graças à colaboração com a Goodyear. A combinação dos pneus de alta gama Goodyear com a formação especializada que

os nossos formadores ProfiDrive® proporcionam sobre pneus de camião é verdadeiramente valiosa”, referiu Andreas Griem, responsável de MAN ProfiDrive®. 0 Strada/GD

GOODYEAR

O ÚNICO

Outubro 2015


protegendo

www.abnseguros.pt facebook.com/abn.seguros

+351 234 197 770 +351 913 466 142 abnseguros@netvisao.pt

229712-C

a sua frota

Profile for Ameise Editora

Strada Truck #126  

Strada Truck #126 2015-10-31

Strada Truck #126  

Strada Truck #126 2015-10-31

Profile for ameise
Advertisement

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded