Albemarle Magazine October/November 2012

albemarle CELEBRATING 25 YEARS

Living in Jefferson’s Virginia

Mapping The Old Dominion

New Book Showcases More Than 300 Maps of Virginia from the Age of Exploration to the Civil War.

October/November 2012 $4.99

www.albemarlemagazine.com

• Virginia Film Festival Celebrates 25 Years • Saving The American Chestnut Tree • October is Wine Month in Virginia EVENTS IN AND AROUND JEFFERSON’S VIRGINIA

701 C LU B D R I V E KESWICK, VIRGINIA 4 3 4.979. 3 4 4 0 K E S W I C K .C O M / F O S S E T T S B A R

EXPAND YOUR VIEW O F A F TER WO R K COC K TA I L S .

Image courtesy of hayesandfisk.com

Fossett’s Bar is Charlottesville’s best kept secret. We’re open to the public and more casual than you’d think. Slip in and see for yourself.

Fhel_Z_d] Ykijec[hi m_j^ j^[ ^_]^[ij ijWdZWhZi e\ i[hl_Y[ i_dY[ '//'¾

oekh `eX ikYY[ii\kbbo$ 9^[Ya ki ekj Wj =h[b[d Jh[[ 9Wh[" ?dY$ mmm$=h[b[dDkhi[ho$Yec je b[Whd ceh[ i[hl_Y[i _dYbkZ[$$$ WXekj j^[ bWdZiYWf_d] i[hl_Y[i m[ e\\[h$ ?di[Yj :_i[Wi[ CWdW][c[dj <ebbem ki ed <WY[Xeea FbWdj 7dWboi_i" <[hj_b_pWj_ed Ie_b =h[b[d Dkhi[ho _i ed[ e\ L_h]_d_WÊi ceij WdZ X[ ikh[ je l_i_j ki _d CWdW][c[dj Fhkd_d]" Ijkcf kd_gk[ dkhi[h_[i e\\[h_d] ^kdZh[Zi e\ Iec[hi[j" L7 \eh ekh (&'( Jh[[ H[celWb 9WXb[" 8hWY_d] lWh_[j_[i e\ jh[[i WdZ i^hkXi ]hemd Wj F_Ya#Oekh#Emd i[Wied Ijehc :WcW][ ?dj[hdWj_edWb IeY_[jo _ji \Whc _d Iec[hi[j" L7$ M^[j^[h oek e\ 7hXeh_Ykbjkh[ 9[hj_Ó [Z =h[b[d Dkhi[ho r '+''' OW][h HeWZ Wh[ beea_d] \eh W ,Ê Ô em[h_d] jh[[ eh W Iec[hi[j" L7 r +*&#,-(#+*,( *&Ê i^WZ[ jh[[" =h[b[d ^Wi j^[ [nf[hj_i[ =h[b[d Jh[[ 9Wh[" ?dY$ mmm$=h[b[dDkhi[ho$Yec WdZ fhe\[ii_edWb i[hl_Y[ je Yecfb[j[ +*&#,-(#,,++

Nestled in the foothills of the Blue Ridge Mountains with breathtaking views, Early Mountain Vineyards makes a perfect location for outdoor dining, wine tasting and conversation with friends and family.

Stop by for a visit & enjoy: • • • • • •

Wine flights that include Best of Virginia wines Outdoor patio seating and picnic area Grand fireplace with cozy seating Locally produced meats, cheeses and fare Games for kids Pet friendly grounds

Photos by Eric Kelley Photography

Earlymountain.com | 540.948.9005 | 6109 Wolftown-Hood Road, Madison, VA 22727 2

ALBEMARLE

© D. YURMAN 2012

Barracks Road Shopping Center Next to Talbots 434.284.4060 ALBEMARLE

3

A prestigious mountain community in Albemarle only ten minutes from downtown.

A whole new perspective on life.

These secluded lots among 974 acres of majestic hardwood forests enjoy panoramic views of Monticello, the Blue Ridge, and downtown Charlottesville. Ten minutes from downtown and up the mountain from the new Martha Jefferson Hospital campus, R.L. Beyerâ&#x20AC;&#x2122;s custom homes on premium lots are priced from the $700,000â&#x20AC;&#x2122;s.

www.ashcroftviews.com

4

ALBEMARLE

For over 40 years, R.L. Beyer has served Charlottesville and Albemarle with homes of distinguished quality, integrity and beauty. A family run company with twenty long-standing employees, Rick Beyer & Diana Beyer, along with their son, Paul, build custom homes that consistently exceed Energy Star guidelines by protecting and preserving the environment [MXL IJ½GMIRX FYMPHMRK TVEGXMGIW

Longevity. Sustainability.

Craftsmanship.

Since 1972 Marketed by Pace Real Estate Associates, LLC 434-817-PACE | www.beyerhomes.com

ALBEMARLE

5

"A MAN PASSIONATE ABOUT AVIATION AND FINE MECHANISMS ONLY SHARES HIS FLIGHTS WITH THE ULTIMATE CHRONOGRAPH LEGEND."

Whether at the controls of one of his jets or his many other flying machines, John Travolta daily plays his own role: that of a first-rate pilot who has notched up over 6,000 flight hours and eight certifications on various types of aircraft. That of a man who is passionate about everything embodying the authentic aeronautical spirit. On his wrist is a Breitling Navitimer with its famous aviation slide rule. A cult-watch for all devotees and professionals of the conquest of the skies, equipped with Breitling Caliber 01, probably the best selfwinding chronograph movement.

For John Travolta, it is simply the ultimate chronograph legend.

5-YEAR BREITLING WARRANTY $7,945

BREITLING.COM 6

ALBEMARLE

EVERYONE HAS A UNIQUE STORY. WE WANT TO HEAR YOURS.

We are Signature, and we can help you reduce the complexity of your wealth with solutions that address every facet of your financial life – investment management, financial planning, tax and philanthropy – in an integrated, personalized way. We are an independent firm of independent thinkers, aligned on one goal: helping you unlock the potential of your wealth. Contact us today and tell us your story.

With over $2.6 billion in assets under management and fewer than 150 client families served by 31 associates from offices in Charlottesville, Norfolk, Richmond and Chicago.

410 East Water Street, Suite 500 Charlottesville, VA 22902 434 295 3191 ALBEMARLE

SignatureUS.com

101 West Main Street, Suite 700 Norfolk, VA 23510 757 625 7670 7

8

ALBEMARLE

Bundoran Farm is comprised of over 2,300 lush acres of protected landscape in the foothills of the Blue Ridge Mountains just 15 minutes from Charlottesville. Today, families live in a protected landscape among rolling pastures, streams, hardwood forests, miles of trails and unparalleled viewsâ&#x20AC;&#x201D;on a land that will be preserved forever.

To learn more or to arrange a personal tour of the property call us at 888.973.3276.

www.bundoranfarm.com/am

This is not intended to be an offer to sell property in Bundoran Farm to, nor a solicitation of offers from, residents of CT, HI, ID, IL, NY, NJ & OR, or to residents of any other jurisdiction where prohibited by law.

ALBEMARLE

9

albemarle

We can help you breathe easier.

Issue No. 150

October/November 2012

Publisher Alison S. Dickie Designer Michael Fitts Photo Editor Alison S. Dickie Project Manager Summer L. Bertram Contributing Editors Louise B. Parsley Contributing Writer Ken Wilson Contributing Photographers and Illustrators Jon Golden Jack Looney Deb Snelson William Van Doren Proofreaders Liz Loewenstein Carden Jennings Publishing Co., Ltd. William T. Carden, Jr. David B. Ern Joseph L. Jennings III

albemarle is a member of

Spencer Payne, MD, is a board certified otolaryngologist offering specialized care for conditions affecting the nose. Common conditions include trouble with sense of smell, chronic sinusitis, nasal polyps and tumors, nosebleeds and septal deviation.

Fellowship trained in rhinology and sinus surgery, Dr. Payne works closely with the Department of Neurological Surgery and UVA allergy specialists to provide comprehensive care for a variety of conditions.

Dr. Payne’s office is conveniently located at Fontaine Research Park where parking is convenient and always free of charge.

Call us today and experience a breath of fresh air.

545 Ray C. Hunt Drive Charlottesville, VA 22903 P: 434.924.5700

BLUE RIDGE

HOME BUILDERS ASSOCIATION

For more information visit

uvahealth.com/rhino

albemarle is published bimonthly, subscriptions U.S. $20 per year, by Carden Jennings Publishing Company, Ltd., 375 Greenbrier Dr., Suite 100, Charlottesville, VA 22901, 434-817-2000. www.albemarlemagazine.com Back issues of albemarle are available. Please inquire at the address above. We would like to hear from you. Please send comments, suggestions, and story ideas to the address above, fax us at 434-817-2020, or e-mail us at albemarle@cjp.com. Periodical postage paid at Charlottesville, VA and additional mailing offices. POSTMASTER: Send form 3579 to: ALBEMARLE, 375 Greenbrier Drive, Suite 100, Charlottesville, VA 22901. Copyright © 2012 by Carden Jennings Publishing Co., Ltd. All Rights Reserved. ISSN 1052-7974. Issue #150 Printed in USA.

10

ALBEMARLE

albemarle

OCTOBER/NOVEMBER 2012 NUMBER 150

™

Th e P e o p l e t h e P l a c e s a n d t h e E v e n t s i n J e f f e r s o n ’ s V i r g i n i a

60 60

COVER FEATURE

72

Mapping The Old Dominion

by Casey Sweren, Images: Reprinted from Mapping Virginia by permission of the University of Virginia Press

OCTOBER IS VIRGINIA WINE MONTH

78

VIRGINIA FILM FESTIVAL

25 Years of the Virginia Film Festival

by Alexandra Parker and Mary C. Wines, Photography by Jon Golden, Jack Looney and Deb Snelson

by Ken Wilson, Images; Virginia Film Office

DEPARTMENTS

16

EVENTS DIGEST

46

MOMENT - WILLIAM VAN DOREN

18

ALBEMARLE ACCOLADES

45

SAVING THE AMERICAN CHESTNUT

24

ART LIFE

49

STAGE LIFE

33

ON THE MARK: Historic Markers

55

HORSE COUNTRY

34

VIRGINIA TRIVIA

82

WHO’S WHO OF REALTORS

37

GOOD SPIRITS

85

EVENTS CALENDAR In and Around Virginia

96

LAST LAUGH The Eyes Have It

In the News: Striped Bass Pale Ale to Support The Chesapeake Bay Foundation, Virginia Wine, Beer, and Cider Country: Trails, Festivals, and Events

Louise B. Parsley

ON THE COVER Bachmann Bird’s-Eye-1861 Quasi-pictorial maps, as in this view, became popular as civilians pondered war strategy.

Reprinted from Mapping Virginia by permission of the University of Virginia Press. © 2012 by the Rector and Visitors of the University of Virginia; all rights reserved; the maps and the copyrights to their reproduced images are owned by the Virginia Cartographical Society and are reproduced with its permission.

11

An Unforgettable Evening With Natalie Cole

October 28

albemarle Issue No. 150

October/November 2012

Publisher Alison S. Dickie Account Executives Alison S. Dickie Jim Lindsey Trafficking Manager Summer L. Bertram Circulation and Subscription Manager Summer L. Bertram Publishing Interns Lindsay Kijewski Alexandra Parker Casey Sweren Alex Shannon Austen Weathersby Mary C. Wines Carden Jennings Publishing Co., Ltd. William T. Carden, Jr. David B. Ern Joseph L. Jennings III

SUBSCRIPTION RATES for the USA: 6 issues $20.00; Canada and all other countries: 6 issues $36.00 (US). New subscriber’s issue will be mailed within 6-8 weeks of order receipt. Please address correspondence pertaining to your subscription to albemarle magazine, 375 Greenbrier Drive, Suite 100, Charlottesville, Virginia 22901, sbertram@cjp.com.

Stay Connected Do you have a new mailing or e-mail address? Or maybe you have a question about albemarle magazine? Help is here!

We are online, on the phone, and at your service.

Online Visit us at albemarlemagazine.com

EDUCATE.. ENCHANT. ENRICH. ENLIGHTEN. EDUCATE

THE PARAMOUNT THEATER Give the Gift of the Paramount Tickets and Gift Certificates Available

www.theparamount.net THE PARAMOUNT THEATER 215 East Main Street, Charlottesville, Virginia 22902 Box Office: 434•979•1333 Administrative Office: 434•979•1922 12

By Phone 434-817-2010 ext. 124

By Mail Write to us at albemarle magazine 375 Greenbrier Drive, Suite 100 Charlottesville, Virginia 22901 For address change, be sure to give us your full name, new, and old addresses.

Find us on Facebook!

Subscribe Not a subscriber yet?

Sign up online or contact Summer Bertram at 434-817-2010 ext. 124, sbertram@cjp.com Please recycle albemarle or pass it on to a friend, neighbor, or waiting room.

ALBEMARLE

ALBEMARLE

13

albemarle Issue No. 150

HERE’S SOMETHING ELSE TO CHEER ABOUT. A HIGH-SPEED INTERNET PRICE THAT WON’T CHANGE FOR 5 YEARS.

October/November 2012

THE EARL OF ALBEMARLE THE HISTORY OF OUR NAMESAKE

S CenturyLink High-Speed Internet ®

CenturyLink is a proud roud supporter of Cavalier lier fans everywhere.

Go ‘Hoos!

19

$

.95

a month for 5 years when you bundle with Unlimited Nationwide Calling*

5 years. 1 price. 0 contract.

Call 434.974.6928

Click centurylink.com/pricelock Come in CenturyLink Experience Center 1240B Seminole Trail, Charlottesville

*Offer ends 1/31/2013. New residential High-Speed Internet and Unlimited Long Distance or existing residential Pure Broadband ™ customers only. Services and offers not available everywhere. Price-Lock Guarantee Offer applies only to the monthly recurring charges for the listed services; excludes all taxes, fees, surcharges, and monthly recurring fees for modem/router and professional installation. Listed monthly recurring charge of $19.95 applies to CenturyLink® High-Speed Internet with speeds up to 10 Mbps and requires subscription to CenturyLink® Home Phone with Unlimited Nationwide Calling. An additional monthly fee (including professional installation, if applicable) and a shipping and handling fee will apply to customer’s modem or router. Offer requires customer to remain in good standing and terminates if customer changes their account in any manner including any change to the required CenturyLink services (cancelled, upgraded, downgraded), telephone number change, or change of physical location of any installed service (including customer moving from residence of installed services). General – CenturyLink may change, cancel, or substitute offers and services – including Locked-In Offer – or vary them by service area, at its sole discretion without notice. Requires credit approval and deposit may be required. Additional restrictions apply.

Terms and Conditions – All products and services listed are governed by tariffs, terms of service, or terms and conditions posted at www.centurylink.com. Taxes, Fees, and Surcharges – Applicable taxes, fees, and surcharges include a Carrier Universal Service charge, National Access Fee or Carrier Cost Recovery surcharge, a one-time High-Speed Internet activation fee, state and local fees that vary by area and certain in-state surcharges. Cost recovery fees are not taxes or government-required charges for use. Taxes, fees, and surcharges apply based on standard monthly, not promotional, rates. Call for a listing of applicable taxes, fees, and surcharges. Monthly Rate – Monthly rate applies while customer subscribes to all qualifying services. If one (1) or more services are cancelled, the standard monthly fee will apply to each remaining service.

High-Speed Internet – Customer must accept High-Speed Internet Subscriber Agreement prior to using service. Download speeds will range from 85% to 100% of the listed download speeds due to conditions outside of network control, including customer location, websites accessed, Internet congestion and customer equipment. Home Phone with Unlimited Nationwide Calling – Service applies to one (1) residential phone line with direct-dial, local and nationwide long distance voice calling from home phone, including Alaska, Puerto Rico, Guam, and U.S. Virgin Islands; excludes commercial use, call center, data and facsimile services (including dial-up Internet connections, data services, and facsimile; each may be billed at $0.10/minute), conference lines, directory and operator assistance, chat lines, pay-per-call, calling card use, or multi-housing units.

Usage will be monitored for compliance and service may be suspended/terminated for noncompliance. An additional charge may be assessed to customer if usage consistently exceeds 5,000 minutes/mo. International calling billed separately. ©2012 CenturyLink, Inc. All Rights Reserved. The name CenturyLink and the pathways logo are trademarks of CenturyLink, Inc. All other marks are property of their respective owners.

14

ir William Anne Keppel was born on June 5, 1702 in London. He was the only son of Sir Arnold Joost van Keppel, First Earl of Albemarle, and Gerturde de Quirna van der Duyn, Countess of Albemarle. In 1723, he married Lady Anne Lennox. The union produced fifteen children. Numerous military successes led to political and diplomatic appointments including ambassador to France, Knight of the Garter, Groom of the Stole, member of the Privy Council, and Governor of Virginia. Despite his appointment as Virginia Governor in 1737, Lord Albemarle never visited his namesake county, the Virginia colony, or America. Instead, Keppel employed Lieutenant Governors, Sir William Gooch until 1749 and Sir Robert Dinwiddie after 1751, to administer the government in Williamsburg.

Power struggles, however, strained these relationships. Keppel wanted to exercise certain powers that undermined the Lieutenant Governors’ political influence.

Consequently, the lasting legacy of Keppel, the Earl of Albemarle, is his role in weakening the ties between the colony and England. On December 22, 1754, Keppel died in Paris at the age of fifty-two.

by Casey Sweren

ALBEMARLE

Our community needs to provide mentors.

WE ARE MAKING SURE THERE IS ONE FOR EVERYONE.

Big Brothers Big Sisters Big Brothers Big Sisters of Charlottesville provide an invaluable source of inspiration to area children each day. Every child is provided a one-on-one mentor to help them gain the confidence to grow and achieve. The Charlottesville Area Community Foundation was proud to provide the funding for an additional 100 mentors for 100 children. And we won’t stop there. To learn more about how we can work together with our community, contact us at 434-296-1024 or online at www.cacfonline.org.

www.cacfonline.org There’s no end to what we can do together.

ALBEMARLE

15

EVENTS

Digest

Compiled by Alexandra Parker and Alex Shannon

Fall Fiber Festival and Montpelier Sheep Dog Trials October 6-7 Montpelier Station Admire the colorful Piedmont foliage, browse the many items for sale by talented artisans and crafters, watch on as the crafters and sheep shearers demonstrate their skill and enjoy specialty foods from a variety of vendors at this autumn festival. Then, turn your attention to the sheep dog trials. The trials will showcase four sheep dog classes including a nursery class, dogs under 30 months of age, and an open class, which is the most advanced of any sheep dog trialing. Saturday 10am5pm, Sunday 10am-4pm. Call 434-973-5764 or visit www.fallfiberfestival.org.

19th Annual

Martha’s Market

Blue Ridge Parade of Homes October 6-7 Charlottesville and the surrounding areas The Parade of Homes, presented by the Blue Ridge Home Builders Association, showcases some of the best neighborhoods and builders in Charlottesville and the surrounding areas. The parade features ready-for-market homes at all price points, with an array of styles, amenities, and special features. This event is open to the public and tours of the houses are free. All of the participating homes are open for visiting from noon until 5pm each day of the event. Call the Blue Ridge Home Builders Association at 434-9738652 or visit www.brhba.org for further details.

October 12-14 John Paul Jones Arena Nearly seventy boutiques from across the country gather together and transform the John Paul Jones Arena into a unique marketplace. Hosted

by Martha Jefferson Hospital’s Women’s Committee, this event raises awareness and funding for women’s healthcare, with an emphasis on breast cancer. Get a head start on your holiday shopping this year—with a wide array of vendors and products, Martha’s Market is sure to have something for everyone on your list. Friday 9:30am7pm, Saturday 10am-6pm, and Sunday 10am-4pm. For additional information call 434-654-5578 or visit www. mjhfoundation.org.

7th Annual

Opportunity Ball October 26 Veritas Vineyard & Winery, Afton

To benefit Nelson County Community Fund Celebrate Halloween with wine and dinner! Featuring live music by Second Nature, the evening starts with a five-course, wine-paired meal in Saddleback Hall at Veritas Vineyard and ends with dancing the night away.

Wear your Halloween best, or black tie optional. Live auction, costume and dance contests, a photo booth, and more will be available. The evening activities start at 6:30pm. Reservations required.

The Opportunity Ball to benefit the Nelson County Community Fund is the culmination of a fundraising campaign in which individuals and corporations have taken the “opportunity” to make a charitable contribution to their community. The fundraising helps to address the need for medical and dental care, improved housing, childcare, and even food for our neighbors in Nelson County.

For more information contact Molly O’Halloran, at 540-456-8000 ext. 108. www.veritaswines.com.

2012 Wildlife Center Annual Gala November 3 Stonewall Jackson Hotel Staunton

The evening’s activities include: - A cocktail and hors d’oeuvres reception - A silent auction featuring wonderful and unique items ranging from inexpensive delights to breathtaking jewelry and original art. Items will include luxury “night-on-the-town” and travel packages, the works of talented artisans and crafters, and gifts for kids and kids-at-heart.

- A Live Auction featuring great travel packages, jewelry, artwork and more!

The cocktail reception begins at 6pm and the dinner and live auction commence at 7:30 pm. The evening is black tie optional.

Reservations required. For information contact Kristen Sluiter at 540-942-9453 or gala@wildlifecenter.org. www.wildlifecenter.org.

25th Annual Virginia Film Festival November 1-4 Charlottesville The opening night Gala, fascinating lectures and onstage interviews with some of the leading movie and cultural voices of today, and fun events for the whole family are only a few of the amazing experiences the Virginia Film Festival has to offer now in its 25 year. This year will also feature the launch of a special “Presidency in Film” series presented in conjunction with the Miller Center at the University of Virginia. One of the highlights of the series’ inaugural year will be a special screening of the political classic All the President’s Men to commemorate the 40th Anniversary of Watergate. The festival not only recognizes films from around the world but also highlights the extraordinary wealth of talent in Virginia’s own thriving film scene.

Call 1-800-UVA-FEST or visit www.vafilm.com.

2nd Annual

Imagine Awards Dinner Jefferson Area Children’s Healthh Improvement Program November 12 UVA Alumni Hall, Charlottesville The Jefferson Area Children’s Health Improvement Program (ChiP) partners with families to ensure that their young children have a healthy beginning in a nurturing, stable, and healthy home. In celebration of their 21st anniversary, Jefferson Area ChiP will host their second annual Imagine Awards, in which families that have demonstrated extraordinary determination and courage to provide healthy homes for their families will be recognized. For further information on the dinner or how to become involved with or sponsor the ChiP program, call 434964-4774 or visit www.jachip.org.

For more events see the Events Calendar on page 85.

ALBEMARLE ACCOLADES

by Austen Weathersby and Mary Wines

We welcome notification of your recent awards or recognitions. Please e-mail us at albemarle.accolades@cjp.com

Charlottesville Makes U.S News Travel’s Top Eleven Wine Vacations

CenturyLink donates laptops to area nonprofit Computers4Kids

Charlottesville has secured the #10 spot in U.S News Travel’s top picks for vacation areas for wine-lovers. The travel website lists the city’s vast vineyards surrounding Monticello, Jefferson Vineyards and its lofty Cabernets and Merlots, and musician Dave Matthew’s Blenheim Vineyards with its variety of Chardonnays as must-visit spots.

CenturyLink, Inc. recently donated six laptops to Computers4Kids (C4K), a Charlottesville-area nonprofit that provides after-school technology mentoring programs for area low-income students in grades seven through 12. The computers donated were given to students starting college this fall.

“Our program uses computers as a catalyst for young students to challenge themselves, become engaged in their own learning, and realize greater possibilities academically, professionally and for their community,” said Kala Somerville, director of C4K.

UVA Community Credit Union Receives Top SBA Award For the third year in a row, the U.S. Small Business Administration (SBA) has recognized UVA Community Credit Union’s success in supporting small businesses by naming it the Top Credit Union in the Richmond District for fiscal year 2011. This honor is given to the credit union with the highest number of loans originated and closed in Virginia outside of the Washington, D.C. metropolitan area.

“UVA Community Credit Union is making a difference by expanding financing opportunities to its members interested in starting and growing their businesses.” said Jayne E. Armstrong, District Director of SBA’s Richmond District office.

“Virginia’s economic recovery depends on the ability of small businesses to gain access to the capital they need to grow and prosper.” says Credit Union President and CEO Alison DeTuncq. “We are very proud to be named Top Credit Union and even prouder to partner with the SBA to make that capital available.”

Eleven MichieHamlett Attorneys Named “Best Lawyers” in America 2013 Elizabeth P. Coughter, James P. Cox III, Gary W. Kendall, John V. Little, Edward B. Lowry, Kevin W. Ryan, William C. Scott IV, M. Bryan Slaughter, Christine Thomson, Ronald R. Tweel, and J. Gregory Webb were selected by their peers this August for inclusion in The Best Lawyers in America 2013. Best Lawyers is based on an exhaustive peer-review survey in which more than 36,000 leading attorneys cast over 4 million votes on the legal abilities of other lawyers in their practice areas.

MichieHamlett is a multi-service law firm dedicated to providing exceptional legal services and value to clients. The firm specializes in family, business, and personal injury law, and its attorneys are experienced, approachable, and responsive.

18

Pictured left to right: Rondi Furgason, CenturyLink; Kala Somerville,Computers4Kids.

“CenturyLink reached out to C4K when we learned we had laptops that were no longer being used by our company,” said Rondi Furgason, CenturyLink’s vice president and general manager for Virginia. “We believe this donation fits perfectly with our own goals to provide service to low-income individuals through our Internet Basics program.”

Service Dogs of Virginia Receives Grant from Planet Dog The Planet Dog Foundation (PDF), the philanthropic arm of award-winning designer and developer of innovative and high-quality dog products Planet Dog, recently awarded $5,000 to Service Dogs of Virginia, an organization that raises, trains, and places assistance, autism, and diabetic alert dogs with the disabled. “Service Dogs of Virginia is thrilled to receive this incredibly generous grant from the Planet Dog Foundation,” said staff member Stacey Lange. “This grant will be used to support the innovative training of diabetic alert dogs...Service Dogs of Virginia is one of the few organizations in the country training diabetic alert dogs, and we couldn’t do it without

the support of caring individuals and foundations like Planet Dog.” Opus, one of their diabetic alert dogs, recently earned Honorable Mention for the 2011 AKC Humane Fund Awards for Canine Excellence.

4 the Wounded 5K Benefits Wounded Warrior Project The University of Virginia Foundation, in partnership with Bad to the Bone Endurance Sports and with the collective effort of firms in the UVA Research Park, corporate sponsors, roughly 1,000 participants, and numerous race-day volunteers, raised over $90,000 for the Wounded Warrior Project (WWP) in the 4 the Wounded 5K this June. WWP provides programs and services to assist injured veterans and their families during their recovery, rehabilitation, and transition.

The lead sponsor of the race was ACAC Wellness & Fitness Centers, who also organized the Kids’ Race. WalMart provided all water and food and encouraged employees to volunteer by agreeing to reward their time with a corporate donation to the WWP. Monticello Media and Charlottesville Newsplex were official media sponsors. The UVA Foundation and its partner, Bad to the Bone Endurance Sports, paid for all race related expenses, allowing 100% of race proceeds to be donated to the WWP.

Local Violinist Receives Heifetz International Music Institute Fellowship Violinist Elise Blake of Charlottesville has received a fellowship to the Heifetz International Music Institute, an internationally recognized summer music program dedicated to the development of talented and promising classical musicians. Blake has been appointed Principal Violin II of the Roanoke Symphony Orchestra and appears with the Wintergreen Performing Arts Festival Orchestra, the Afton String Quartet, the Richmond Symphony, and the Virginia Symphony Orchestra in Norfolk, among others. Blake has performed at many venues, including Lincoln Center’s Alice Tully Hall in New York, the “Globe Theatre” of Villa Borghese in Rome, the Kennedy Center’s Terrace Theater in Washington, D.C., the Chicago Symphony’s Orchestra Hall, and the Palais de la Musique et des Congrès at the Strasbourg International Music Festival.

After completing her Masters of Music ALBEMARLE

Where Opportunity Meets Peace of Mind A personal relationship combined with our independent, disciplined investment approach makes us the best partner to help you reach your long-term financial goals.

We orchestrate our client’s financial affairs to provide a comprehensive and coordinated approach to wealth management. We create a personalized strategy based on the needs of each client that blends achievement of goals with peace of mind.

Reaching your financial goals begins today with a phone call to arrange a discovery meeting.

A.N. CULBERTSON

& C O M PA N Y, I N C.

INDEPENDENT WEALTH MANAGEMENT (434) 972-7766 www.anculbertson.com One Boar’s Head Pointe, Suite 101, Charlottesville, Virginia 22903

Members of the Charlottesville Community for 20 Years.

ALBEMARLE

ALAN N. CULBERTSON

n

GEORGE L. PAYNE, JR.

n

GEORGE H. KIDDER, JR.

19

ALBEMARLE ACCOLADES degree at the Peabody Conservatory of Johns Hopkins University, she studied chamber music with members of the Jupiter, St. Petersburg, Muir, Julliard, and Brentano string quartets. Blake received her undergraduate training from Boston University’s School of Music, where she was a scholarship student of Bayla Keyes.

JABA’s CEO Honored for Outstanding Leadership The National Association of Area Agencies on Aging (n4a) recently bestowed its President’s Award for Leadership in the Aging Network to Gordon Walker, Chief Executive Officer of the Jefferson Area Board for Aging (JABA) in Charlottesville.

The award honors those who advance the organization’s mission to “build the capacity of its members to help older persons and persons with disabilities live with dignity and choices in their homes and communities for as long as possible.”

medic. Making it her mission to improve the local health system’s response to victims of rape and assault, she developed the necessary protocols, met with key players to explain the program, and began single-handedly providing forensic nursing services at UVA, all while working on her master’s degree in nursing.

Thanks to her unwavering commitment, the UVA forensic team has become institutionalized. The Health Sciences Center fully supports the program, paying for training, providing needed equipment, and providing call pay for the team.

Lawson is a nationally known researcher, one of only a handful of PhD-prepared forensic nurses actively conducting research. She is now an assistant professor at the University of Miami School of Nursing and Health Studies.

The Covenant School Names Coach Dave Rocco as Interim Athletic Director for 2012-13 The Covenant School is pleased to announce Varsity Football Coach Mr. Dave Rocco as the school’s 2012-2013 Interim Athletic Director. Rocco offers a wealth of experience to the Covenant Eagles athletic program: after playing linebacker for the Nittany Lions, he served as an undergraduate coaching assistant for three seasons at Penn State and then as the head coach at Staunton River High School in Moneta.

CEO of the Jefferson Area Board for Aging since 1982, Walker has chaired the Albemarle County School Board and served as a professor in the School of Nursing at UVA. At the national level, he was a legislative aide to the U.S. Senate Committee on Aging, and was appointed twice to the White House Conference on Aging as a state representative. He also worked with Just Partners, Inc. in 2007 to create a “Continuing Care Retirement Community (CCRC) in Memorial Stadium, and oversaw the development of four multi-agency community centers in Planning District 10.

Forensic Nurse Sarah Lawson Receives the 2012 Annette DeGregoria Grimm Award Sarah Lawson, a nationally known forensic researcher, was honored last November at the Annual Sexual Assault Resource Agency (SARA) Award Celebration with the Annette DeGregoria Grimm Award. Over 20 years ago, Lawson saw the need for expert, specialized care for the sexually assaulted through her work as an emergency nurse and para20

Rocco. “In addition, I will strive to increase the competitiveness of our sports program, improve our athletic facilities, and inspire Covenant’s coaches and athletes to reach their full potential while demonstrating Christian values and good sportsmanship.”

Virginia Arborist and Tree Climber Honored as ISA “True Professional” Robert Springer, an ISA Certified Arborist, tree climber, and coordinator at Bartlett Tree Experts, has been named a “True Professional of Arboriculture” by the International Society of Arboriculture (ISA).

A leading safety expert in arboriculture, Springer speaks and conducts workshops on safety, has been instrumental in the preservation and removal of heritage trees, including species at Thomas Jefferson’s Monticello estate and George Washington’s home at Mount Vernon, and is the first arborist to assist the U.S. Forest Service in the removal of a U.S. Capitol Holiday Tree.

“When Virginia adopted a tree trimming standard to curb the number of fatalities and accidents among tree workers, Rob willingly stepped forward as an expert arborist to explain the equipment and safety requirements in our industry,” said Colin Bashford ISA President. “His support of such a strong standard paves the way for a safer workplace.”

Three Virginia Inns Earn Top Industry Designation

During his 14 seasons of coaching high school athletes, Rocco has helped over 20 players continue their football careers at the collegiate level, including five at the Division One level.

“I plan to continue the expectations for excellence in athletic performance, spiritual growth, and academic achievement set forth by Covenant’s previous Athletic Director, Doug Smethurst,” remarks

Select Registry, a non-profit organization of over 400 country inns, bed and breakfasts, and small hotels has recognized Charlottesville’s Foxfield Inn, the Inn at Onancock, and Galax’s The Doctor’s Inn, in its portfolio of celebrated B&Bs. “We’re delighted to welcome these outstanding properties,” said Select Registry Executive Director Will Carlson.

“Of the 20,000 inns in North America, only 330 have earned this prestigious designation. Gaining admission to Select Registry is no easy task,” Carlson continued. “Each property must pass rigorous, unannounced inspections to qualify and then to maintain its membership. Our goal is to give guests the assurance of knowing that when they check into a Select Registry inn, they’re in for an exceptional travel experience.”

ALBEMARLE

Virginia Lawyers Weekly Names Ed Lowry “Leader in the Law” Virginia Lawyers Media, publisher of Virginia Lawyers Weekly, announced that Edward B. Lowry, partner at MichieHamlett Attorneys at Law, is an honoree of the 2012 class of “Leaders in the Law.” This recognizes those who are setting the standard for other lawyers in Virginia by changing the law, serving the community, changing practice or improving Virginia’s justice system.

Lowry, a partner at MichieHamlett, handles a variety of commercial transactions and negotiations. His experience includes business torts, construction law, securities arbitration, employment, contract, real estate and banking laws. He served as Virginia State Bar President from June 1997-June 1998; was a member of the Bar Council from 1989-1995; and served as a member of its Executive Committee from 1994-1998.

In 1997 he co-chaired the Southern

Conference of Bar Presidents and was also President of the Charlottesville Albemarle Bar Association from 19881990. A member of the Adjunct Faculty at the UVA School of Law, where he teaches a trial advocacy course, Lowry serves on the Advisory Committee on Rules of Practice and Procedure of the Judicial Council of Virginia and serves on the Special Issues Committee, the Virginia Trial Lawyers Association, the American Board of Trial Advocates, and the American Association for Justice.

He is recognized both in Best Lawyers and Super Lawyers, as well as Virginia Business Magazine’s Legal Elite.

New City Director of Communications Hired Charlottesville City Manager Maurice Jones has named Miriam Dickler the new Director of Communications for the City. Since January of 2005, Dickler has served as the Public Information Officer (PIO) for the City of Harrisonburg, serving as the city’s spokesperson, directing internal and external communication efforts, overseeing community education and outreach, and coordinating public input. “Miriam has done an outstanding job building a strong communications office in

Harrisonburg,” said Jones. “Miriam is an experienced communications professional who is committed to providing high quality customer service to the public. I’m confident she will thrive in this role.”

“It is an honor to have this opportunity with the City of Charlottesville,” said Dickler. “I look forward to working with city staff and the community. There is a valuable tradition of public engagement in Charlottesville, and I am excited to be a part of it.”

Virginia Opera Announces Director Emeritus Appointment After 18 years on the Board of Directors of Virginia Opera, the Official Opera Company of the Commonwealth of Virginia, Joan Barbara Miller has been unanimously conferred as the Director Emeritus. Miller joined the Virginia Opera Board of Directors in 1995, is the Immediate Past President of the Statewide Board of Directors of the Virginia Opera, and serves on the Executive Committee. Miller was Board President from 2009 through 2011 and helped steer Virginia Opera through the first transition in artistic leadership in the company’s 38-year history.

Ross L. Stevens

Seven Oaks c.1847

Ramsay c.1895

Green Lea c.1920

Robert Poore House c.1836

STEVENS & COMPANY One Boar’s Head Place • Charlottesville VA 22903 OfÀce: 434-296-6104 • Cell: 434-981-5268 Email: rstevens@stevensandcompany.net • www.stevensandcompany.net ALBEMARLE

21

“Joan has served on the Board of Directors with remarkable distinction, complete involvement, dedication, and devotion since 1995, providing unparalleled leadership. Her generosity, tireless passion, and notable support of the organization are further illustrated by her extensive travel in and outside of Virginia and her ambassadorship on behalf of Virginia Opera,” said current Board President Alan P. Albert.

Blue Ridge Bank Teaches Tweens Financial Literacy Blue Ridge Bank has announced the launch of MoneyIsland™, an educational, entertaining online world that engages and instructs children ages 8 to 14 in three financial areas: saving and spending, earning and investing and using credit wisely.

“A recent survey found that 45 percent of high school seniors say they aren’t ready to manage their money. As an active

member of the Charlottesville community, we have a responsibility to educate kids about money management,” says Monte Layman, CEO of Blue Ridge Bank.

“Offering MoneyIsland helps parents and teachers address an important challenge for our children and instill lifelong financial literacy lessons.”

Amazement Square Named Recipient of Federal Grant Funds The Institute of Museum and Library Services (IMLS) has named Amazement Square as one of this year’s three Museums for America (MFA) grant recipients of Virginia. More than $379,000 will be brought into the state through Amazement Square in Lynchburg, the Mariners’ Museum in Newport News, and the Virginia Museum of Fine Arts in Richmond.

As a multidisciplinary, hands-on children’s museum, Amazement Square will use the grant to fund its Balance: Healthy Mind & Body initiative, which helps youth and their families make informed health decisions, primarily in the areas of nutrition, exercise, and active play.

This includes a exhibition and a healthfocused curriculum that will be delivered through a range of school, outreach, and in-house programs, complemented by an educational cartoon series.

SNL Financial Named as One of the Fastest-Growing Private Companies in the U.S. for 2012 SNL Financial was recently named to Inc. Magazine’s annual list of fastestgrowing private companies in the U.S. For the fifth consecutive year, SNL was the only Charlottesville-based company to make the 2012 edition of the “Inc. 5000,” a list ranks privately held companies based upon three-year revenue growth through 2011. At 58% over the past three years, SNL’s level of revenue growth placed the company at number 3338 out of 5000 qualifying companies. SNL was one of only thirteen Virginia-based companies on the list with revenues of $100 million or more.

Mike Chinn, SNL’s president remarked, “We are honored, once again, to be recognized by Inc. Magazine for the continued growth of our company. In our 25th anniversary year, we expanded our global footprint with new offices in Hong Kong Singapore, Denver and Milwaukee, introduced a new product for the European market, and made numerous improvements to our existing product offerings. These achievements would not have been possible without the dedication and determination of our more than 2,000 employees around the globe.”

22

ALBEMARLE

Local REALTORS® Build Wheelchair Ramp for Senior Family

CAAR members exceeded their fundraising goal by collecting $10,859; overall, the campaign achieved the mission of raising $25,000 to help low-income senior families make emergency repairs to their homes. Crozet residents Anne and George Thompson are among the first recipients. Overall, the campaign will help eight to ten families.

The three organizations plan to continue building on the success of this year’s campaign with more activities in 2013.

Pictured left to right: Tammy Wilt of New American Mortgage; Denise Ramey of Roy Wheeler Realty Co.; Drake Van de Castle of Piedmont Sotheby's Int. Realty; CAAR CEO Anne Gardner; family friend Dan Tomlin; 2012 CAAR President Brad Conner of Montague Miller & Co.; Martha deJarnette of Loring Woodriff R. E. Associates; Jennifer Klippel of AHIP; Senator Creigh Deeds; family friend Bob Sylvester.

Businesses Win Darden School of Business’ 2012 Resilience Awards

Members of Charlottesville Area Association of REALTORS® helped a senior family in Crozet install a critically needed wheelchair ramp—a project made possible through the Seniors Safe at Home campaign, a partnership created this spring between CAAR, Albemarle Housing Improvement Program(AHIP) and Blue Ridge Home Builders Association.

At a special awards ceremony, the University of Virginia Darden School of Business announced the winners of the 2012 Tayloe Murphy Resilience Awards Competition.

Hailing from Cheriton on the Eastern Shore to Harrisonburg in the Shenandoah Valley, Norfolk in Hampton Roads and Prince George and Sedley in southeastern Virginia, the five winners represent some of the most resilient businesses in Virginia—those which display growth, a dogged entrepreneurial spirit, and commitment to community

in areas facing high unemployment, high poverty and low entrepreneurial activity.

“These winners represent resilience in the classic sense of the word,” said Professor Greg Fairchild, E. Thayer Bigelow Research Chair. “In the face of some daunting challenges, they have bent but not broken, adapted, and become stronger for their efforts. With annual double-digit growth rates in profit and employment and a clear commitment to their communities, these Main Street businesses have accomplished something that anyone interested in business would do well to learn from. It is our pleasure to share their stories and highlight their success.” The winners, listed alphabetically, are: • Retail Sector: A Bowl of Good Café Inc., Harrisonburg • Agriculture Sector: Ballard Fish & Oyster Co. Inc., Cheriton • Chairman’s Award: Hubbard Peanut Co. Inc., Sedley • Service Sector: ODUrent.com, Norfolk • Manufacturing/Wholesale Sector: Service Center Metals, Prince George

Does your investment strategy consider financial potential and social good?

You invest for the future, but are you investing for a Greener future as well? I have helped clients align their investments with their social policies for more than ten years. Call me to see how taking your portfolio to a Greener environment is possible.

William Wolfe, CFP® First Vice President - Investments Wells Fargo Advisors 100 East South Street Charlottesville, VA 22902 (434) 970-2326

Investment and Insurance Products: X NOT FDIC Insured X NO Bank Guarantee X MAY Lose Value Wells Fargo Advisors, LLC, Member SIPC, is a registered broker-dealer and a separate non-bank affiliate of Wells Fargo & Company. ©2012 Wells Fargo Advisors, LLC 0312-2857 4/12

ALBEMARLE

23

ART LIFE

Jean Hélion France, 1904–1987 Composition, 1934 Oil on canvas, 13 3/8 x 17 3/8 in, 33.86 x 44.03 cm Courtesy of Family of Jean Hélion

The Fralin Museum of Art at the University of Virginia 155 Rugby Road, Charlottesville 434-924-3592; www.virginia.edu/artmuseum Jean Hélion: Reality and Abstraction through December 16 The French painter Jean Hélion was a leading figure in the world of abstract art during the 1930s. He created extraordinary geometrical compositions which balance pristine clarity with both a strongly dynamic feeling and a sense of unceasing transformation. At the end of the 1930s, he turned from pure abstraction and took up everyday themes, rendering these in a figurative style.

The exhibition includes eight significant paintings and a substantial number of works on paper—executed in watercolor, charcoal, and ink—whose fluid spontaneity complements the paintings’ immaculate handling. This exhibition is drawn from a private collection, with an additional important loan from the Eleanor D. Wilson Museum at Hollins University in Roanoke.

This exhibit is curated by Matthew Affron, Curator of Modern Art, Academic Curator, and Associate Professor in the McIntire Department of Art.

Making Science Visible: The Photography of Berenice Abbott through December 16 This exhibition explores how the photography of Berenice Abbott has been used in both artistic and scientific contexts. Abbott’s images are important in art, science, documenta24

Jean Hélion France, 1904–1987 Equilibre, 1933 Oil on canvas, 29 3/4 x 36 in, 75.56 x 91.44 cm Courtesy of Family of Jean Hélion

ries, and the history of science education.

Abbott produced images of a variety of objects, from magnets and mirrors to insects and roots, which were included in scientific textbooks. Her images represent a unique melding of science and art, which produces an aesthetic that compels the viewer while also conveying scientific ideas.

Images from the University of Virginia Art Museum’s collection of Abbott’s original photographs, including images reproduced in science texts, will be exhibited.

This exhibit is curated by Hannah Rogers, Lecturer, Science and Technology Studies, and Worthy Martin, Associate Professor of Computer Science.

Ancient Masters in Modern Styles: Chinese Ink Paintings from the 16th-21st Centuries through December 16 The Chinese art of ink painting is an ancient and continuously practiced tradition transmitted and learned in part through the study of the works of past masters. Studying the styles of the greatest artists of the past was seen as the fundamental basis for learning the art of painting in China until the twentieth century.

Nevertheless, Chinese painters were aware of the potentially limiting aspects of imitating the ancient masters too closely. As a result, they self-consciously evoked past masters’ style while simultaneously transforming and even subverting them.

This exhibition of Chinese ink paintings from the University of Virginia Art Museum and Lijin Collections examines the influ-

by Summer Bertram

Jean Hélion France, 1904–1987 Hélion Paris 34, 1934 Ink, gouache & crayon on paper, 8 3/4 x 11 in, 22.23 x 27.94 cm Courtesy of Family of Jean Hélion

ence of this long tradition on later artists, and how they sought to balance reverence for the art of old masters with their own requirements for artistic expression. It will explore this through an investigation of style, subject matter, and the inscriptions on paintings from the early modern period up until the present, as well as the social and historical context of their production.

The aim of the exhibition is to demonstrate the rich variety of ink painting in China over many centuries and the continuing relevance of tradition to Chinese artists today.

Exhibition catalogue by guest curator Kathleen M. Ryor.

The Valley of the Shadow: American Landscape Painting in the Time of the Civil War through December 16 This exhibition will address a central problem faced by artists who depicted the American landscape during the mid-nineteenth century: how to represent a national land that was hotly contested by different groups and increasingly divided by political tensions, a land which, by the 1860s, became the site of unprecedented violence and trauma. The exhibition will demonstrate that American landscape painting of the mid-nineteenth century is as notable for what it did not depict as for what it showed, and that the vision of America that it articulated and imagined remains powerful today.

This exhibit is curated by Jill Baskin, former Lindner-Luzak Fellow and the exhibition catalogue is by Jill Baskin and Margaret Stenz.

ALBEMARLE

“Inspired by Nature, Real Art for an Unreal Time,” Fall Show through December 16 Nichols Gallery Annex 5420 Governor Barbour Street, Barboursville 540-832-3565; www.frednichols.com “Inspired by Nature, Real Art for an Unreal Time,” is the theme of the Nichols Gallery Annex Fall show. With works by over 20 landscape painters, from the classical mountain paintings by Ron Boehmer to the more abstract wildflower paintings by Priscilla Whitlock, the exhibit will offer a “walk in the woods” through the eyes of the artist. Frederick Nichols speaks for his work and the show, saying: “I want my art to be positive and uplifting. I want it to wake people up to the natural world around them. I want it to give them a respite from the stresses of everyday life.”

John Hughes, “Rivanna” oil 40 x 30 in

Remix Redux through December 30 The Chrysler Museum of Art 245 West Olney Road, Norfolk 757-664-6200; www.chrysler.org The Chrysler continues to shake up the -isms of art history with this new exhibition of contemporary art. The threads between society, culture, and the visual arts are presented through a selection of works from the Chrysler vaults. This exhibition mixes contemporary classics with new acquisitions, and is grouped thematically. Visitors can follow the common chords of materials, portraits and figures—even the spaces found in nature—as they travel through a diverse range of artists and artworks. The exhibition is organized by Amy Brandt, Ph.D., the Chrysler’s McKinnon Curator of Modern and Contemporary Art.

Larry Poons (American, b. 1937) Needles, 1972 Mixed media on canvas Gift of Walter P. Chrysler, Jr.

ALBEMARLE

Frederick Nichols “Mountain Laurel” watercolor 18 x 27 in

The Natural Beauty of Tiffany: Selections from the Chrysler Museum through December 30 Louis Comfort Tiffany (1848–1933), one of America’s best known businessmen and most talented artists, directed an artistic empire in the design and creation of stunning leaded glass windows and lamps, blown glass vessels, mosaics, and other objects of luxury. Tiffany found great beauty in the natural world—the primary inspiration for his paintings and decorative work in metal, pottery, and glass. This exhibition presents many of the Museum’s finest examples of his work inspired by flora and fauna.

“Louis Comfort Tiffany was deeply moved by the complex beauty found in nature,” said Kelly Conway, the Carolyn and Richard Barry Curator of glass. “He created an idyllic landscape at his home on Long Island, with many exotic species of plants and flowers. This exhibition features some of Tiffany Studios’ unique interpretations of flowers, vegetation, marine life and other natural elements, executed in glass, ceramics, and bronze.”

Highlights of the exhibition include a garden of blown glass flowers, unique examples of ceramics and enamels, and some of the rarest and most expensive lamps known— the glorious blue Dragonfly and Pond Lily

library lamps. The works of art are all from the Chrysler Museum’s world-famous Tiffany collection, which is nearly comprehensive in the area of blown glass and also includes mosaics, windows and lamps.

Tiffany Studios (New York) Dragonfly Library Lamp, ca. 1905–10 Leaded glass; cast bronze Gift of Walter P. Chrysler, Jr.

25

$11 $5'(1 +RPH )XUQLVKLQJV

Edward Burtynsky: Oil October 19 - January 6, 2013 Taubman 110 Salem Avenue SE, Roanoke 540-342-5760; www.taubmanmuseum.org Over the last 12 years, acclaimed photographer Edward Burtynsky has traveled across the globe to chronicle the production, distribution, and use of oil.

His extensive exploration is organized thematically, surveying a â&#x20AC;&#x153;life cycleâ&#x20AC;? of this critical fuel.

Edward Burtynsky is one of Canadaâ&#x20AC;&#x2122;s most respected photographers. His color photographs of industrially transformed landscapes are in the collections of several major museums around the world. Burtynsky credits this experience as his earliest exposure to the subject of industry, and oil in particular.

Anne Ferrer: Hot Pink October 19 - April 13, 2013

: 0$,1 67 :$<1(6%252 ::: $11 $5'(1 &20 78(6 6$7

This exhibition features a monumental inflated sculpture suspended in the museum atrium, by Parisian artist Anne Ferrer. The playful undulating form, stitched on site during a two monthlong residency, continues Ferrerâ&#x20AC;&#x2122;s interest in using brightly colored sailcloth to create joyous forms that suggest undersea life, French pastry, and the pleasure of floating in air. For over 20 years she has explored sculpture and unconventional textile arts, exhibiting in dozens of venues across France, as well as in New York, Prague, Turin, Bolivia, and Texas. Hot Pink is Ferrerâ&#x20AC;&#x2122;s largest piece to date, and her first museum site project in the United States.

Un-usual Folk October 19 - January 19, 2013 â&#x20AC;&#x153;Un-usual Folkâ&#x20AC;? explores this watershed moment in American art by pairing selections from the Taubman Museumâ&#x20AC;&#x2122;s permanent collection with pieces drawn from the extensive and expansive collection of respected local collectors Barbara and Rick Moeller. Featuring an array of paintings, pottery, and sculpture by noted artists ranging from Sam Doyle, Lanier Meaders, and Georgia Blizzard to rising contemporary outsiders such as Kentuckyâ&#x20AC;&#x2122;s Maurice Ferguson and Missouriâ&#x20AC;&#x2122;s Theresa Disney, â&#x20AC;&#x153;Un-usual Folkâ&#x20AC;? celebrates and explores the strange region where traditional form and technique collide with and are transformed by raw individual creative vision.

26

ALBEMARLE

Earl Staley and Russ Warren: Collage through November 11 Les Yeux du Monde 841 Wolf Trap Road, Charlottesville 434-973-5566; www.lesyeuxdumonde.com Earl Staley and Russ Warren met in 1969 at the University of St. Thomas in Houston where Staley was chairman of the Art Department and Warren was a student. Staley included Warren in the influential Beaumont Texas exhibition in 1973, beginning a long history of collaboration and parallel exhibition history.

They both showed at the Phyllis Kind Galler y in New York and Chicago and in the Marcia Tu c k e r- c u r a t e d Venice Biennale in 1984. The current exhibition will pair the two once Russ Warren, Patti Smith again, yet instead 2011, collage, 14 x 11 in of featuring their epic Magic Realist type paintings, it will hone in on their more modest, but just as powerful and thought-provoking collages, which both artists have been making unbeknownst to each other in the last few years.

Les Yeux du Monde presents Florilegia: Paintings by Anne Adams Robertson Massie and Annie Harris Massie November 16 – December 30 Opening Reception: Friday, November 16, 5:30–7:30pm Anne Adams Robertson Massie is known for her watercolor paintings and has received the American Watercolor Society Gold Medal of Honor and the VA

&RPPHUFLDO 3HUVRQDO 6HUYLFHV 3HUVRQDO ,QMXU\

Edward B. Lowry

John V. Little

Les Yeux du Monde will feature Earl Staley and Russ Warren: Collage from October 5 to November 11. There will be a preview reception on the First Friday, October 5 from 4–6pm, with a talk by Russ Warren at 5pm. The Opening Reception will take place on Friday, October 12 from 5:30–7:30pm. A Collectors Club lunch is planned for Wednesday, October 31 at noon. This lunch is open to the public with reservations. Please call 434-973-5566 or email LesYeuxduMonde@aol.com.

ALBEMARLE

Ronald R. Tweel

Gary W. Kendall

James P. Cox III Elizabeth P. Coughter William C. Scott IV

J. Gregory Webb

Earl Staley, “Paris Series #3: Sacre Coeur” 2012, acrylic collage, 14 x 11 in

Watercolor Society Best in Show award twice. Annie Harris Massie is also known for her oil paintings. Her works reside in major public and private collections.

The paintings by both artists, are mostly derived from floral imagery. Les Yeux du Monde will present Florilegia: Paintings

by Anne Adams Robertson Massie and Annie Harris Massie from November 16 to December 30. There will be an Opening Reception with the mother/daughter artists on Friday, November 16 from 5:30–7:30pm

Christine Thomson M. Bryan Slaughter

Kevin W. Ryan

Congratulations to our colleagues on their selection as

Best Lawyers in America 2013! +HOSLQJ FOLHQWV IRU RYHU \HDUV 500 Court Square, Suite 300, P.O. Box 298 Charlottesville, Virginia 22902 434.951.7200 800.451.1288 Fax: 434.951.7218 www.michiehamlett.com

27

Chihuly through February 10, 2013 Virginia Museum of Fine Arts 200 N. Boulevard, Richmond 804-340-1400; www.vmfa.state.va.us Internationally renowned, Seattle-based artist Dale Chihuly, credited with revolutionizing the Studio Glass movement and elevating the medium of glass from craft to fine art, will have a major, site-specific exhibition in the VMFA’s award-winning, light-infused McGlothlin Wing.

“Chihuly is a phenomenon of the art world,” director Alex Nyerges said. “His magical glass creations have captured the imagination of audiences worldwide, and he is the most popular and recognized artist working in the field today. Indeed, he is one of the most widely-appreciated contemporary artists working in any medium.”

The VMFA exhibit includes many iconic works for which Chihuly is known— Ikebana, Mille Fiori, Chandeliers, Tabac Baskets, Boats, Persian Ceiling—as well as site specific installations.

In the past decade, 97 exhibitions in seven countries have presented artwork

by Chihuly, which have been enjoyed by over 10 million visitors. The presentation at the VMFA is Chihuly’s third major U.S. museum exhibition in recent years.

Fine Arts & Flowers October 24 – October 28 Fine Arts & Flowers is a museum-wide exhibition comprised of floral interpretations by statewide floral designers. This fall’s exhibition will be the event’s 11th staging, combining painting, sculptures, and other works of art in the museum’s permanent collection with unique interpretations in flowers and foliage.

Floral designers from more than 75 garden clubs across Virginia will create arrangements that interpret masterworks of art with a fresh eye to beauty and meaning.

The participants are members of Virginia Federation of Garden Clubs, the Garden Club of Virginia, and Garden Clubs of Virginia. Lectures. Other special events will accompany the free exhibition.

Visions of France: Three Postwar Photographers Through October 28 This exhibition displays the work of three photographers from three generations, who all focused on spontaneous images of daily life in urban areas.

The works of Robert Doisneau, Edouard Boubat, and Joel Meyerowitz are featured in a way to offer audiences an opportunity to view the artists as in conversation with each other, building off of their prior influences while integrating aspects to shed Paris in a new light with varying perspectives.

Doisneau, a native Parisian, let his knowledge of the local culture drive his work, leading him to immortalize scenes that he thought depicted a vanishing way of life in Paris. Boubat, another Frenchman who spent much of his life in Paris, described his approach to photography as a relationship with chance, capturing his final shots after taking very few pictures.

Meyerowitz, the only American in the group, got his start photographing American cities, and used color for his Parisian photographs, drawing inspiration from Doisneau and Boubat while marking a transition to a younger generation.

As Paris is often referred to as “the cradle of street photography,” these artists exemplify a long-running tradition while keeping their own distinct visions of the city.

28

ALBEMARLE

“Woodlands and Whimsy” Recent Works by Jan Heath and Jonathan Heath through October 31 ANGELO 220 East Main Street, Charlottesville 434-971-9256; www.angelojewelry.com

Jonathan Heath’s “Drinks on the Lake” is an acrylic painting.

20 x 16 in

Wills and Trusts Estate Planning Probate Assistance Estate Administration

Guiding you to family harmony in estate planning

Attorney at Law Thomas Nolan Jan Heath’s “Mountain Magic” is a monotype/ linocut. 34 x 22 in

The Berkeley Springs, West Virginiabased Heath Studio Gallery, composed of husband and wife Jonathan and Jan Heath, present their two person show “Woodlands and Whimsy.” Jonathan Heath, a selftaught painter with 40 years of professional painting experience, describes his style as “relaxed realism.” He works in watercolor, oil, and acrylic media to produce paintings that reflect his whimsical take on life by exploring humor in his themes of content and style. Jan Heath has been producing her unique prints for 30 years, and each one is hand-pulled, signed, and numbered, making for truly one-of-a-kind art. Her linocuts, which will be featured in “Woodlands and Whimsy,” are inspired by nature. The pair has been working together at their studio gallery for over 20 years.

On Pantops Mountain, Charlottesville n 434-817-4001 215 Wayles Lane, Suite 125 n www.VaWills.com

Dr. Seuss’s “A Retrospective & International Touring Exhibition” Through October 31 Bella Arte Gallery 3734 Winterfield Road, Midlothian 804-794-1511; www.bellaarte.com This exhibit celebrating the life and art of Theodor Seuss Geisel makes its first appearance in Virginia. Thirty-two special panels present both original and reproduced pieces from 1927 through 1990, along with a selection of exclusive authorized reproductions of estate editions. Visitors to the exhibition will get an in depth look at the beloved Dr. Seuss’s multifaceted artistic career.

ALBEMARLE

29

October Exhibits October 2 – 28 McGuffey Art Center 201 Second Street NW, Charlottesville 434-295-7973; mcguffeyartcenter.com The opening reception for the October exhibits will take place on Friday, October 5 from 5:30-7:30pm. The galleries will be open from 10 am-6pm Tuesdays through Saturdays, and 1-5pm Sundays. The exhibits include: “A Room of Her Own:” acrylic paintings from Joan Soderlund, “Life Over Time:” mixed media work from Lindsey Mears, “Profile Pics:” paintings by Eileen French, and paintings by visiting artists from the Ivuka Arts cooperative in Kigali, Rwanda.

November Exhibits October 30 – November 18 The opening reception for the November exhibits will take place on Friday, November 2 from 5:30-7:30pm. The galleries will be open from 10 am-6pm Tuesdays through Saturdays, and 1-5pm on Sundays. The exhibits include: “Art Ideas and Other Truths:” collages and mixed media art from Judy McLeod, paintings by Jane Skafte, artwork from Rose Hill, and an exhibit of artwork from University of Virginia students.

Make sure not to miss the McGuffey Holiday Group Show, which will run from Tuesday, November 20 through December. The group show will feature fine art and crafts as well as seasonal gifts for the holidays.

Eileen French, Her Name is Spot, oil on canvas, 36 x 30 in Photo by: Kathryn Wagner

Lindsey Mears’ book, Westward Expansion

Joan Soderlund, The Studio, acrylic

30

Judy McLeod, Insight, mixed media, 20 x 20 in

Jane Skafte, Tsunami, colored pencil, 26 x 40 in

ALBEMARLE

ALBEMARLE

31

This holiday season albemarle Magazine has fabulous gift options that will make family, friends, and neighbors feel right at home, even if they’re just around the corner or miles from Jefferson’s Virginia.

25th Anniversary Offer: 3-year subscription For Only

$25

SAVE $65!

albemarle Magazine 1-year Subscription (6 issues)

ONLY

$20

Celebrating 25 Years The people, the places, and the events in Jefferson’s Virginia.

To order, send in the attached order form along with a check or Visa/Mastercard to: albemarle Magazine 375 Greenbrier Drive, Ste 100 Charlottesville, VA 22901

ONLY

$55

Albemarle Book

Text by Avery Chenoweth Photos by Robert Llewellyn $55 (includes discounted book, 1-yr subscription & shipping/handling)

32

Please order multiple copies by calling 434-817-2010 x124 or emailing sbertram@cjp.com. *Book orders must be prepaid ALBEMARLE

ON THE MARK

C

hances are that if you’ve lived in Virginia at any point since 1927, you’ve noticed the distinctive black-on-white signs that pervade the Old Dominion’s roadsides. These “Historic Highway Markers” commemorate events and locations that have characteristic importance in our state’s history. Needless to say, Virginia has many places of historical importance; there are currently more than 2,400 such markers, and the Virginia Department of Historic Resources

has just approved 13 new highway markers. The markers are sponsored by local associations, companies, or individuals, who pay for the cost and maintenance of the signs, though the Department of Historic Resources, which manages and approves the signs, occasionally serves as a sponsor to signs commemorating events they feels to be of particular importance. Below is a list of the most recent.

A Guidebook to Virginia's Historical Markers by Scott David Arnold The great legacy of Virginia’s past is revealed on these markers, making the book both a handy reference and a stimulus to greater study of the history of the commonwealth.

East Suffolk School Complex African American school which opened in the late 20s. A high school was later added on in 1939, with its first graduating class in 1940. The Final class graduated in 1965.

Sponsor: East Suffolk High School Alumni Association Locality: Suffolk County Gloucester Hall Bacon’s Rebellion effectively ended here with the fatal illness of its leader, Nathaiel Bacon, in 1676. In 1684, it served as the first Virginia residence of Royal Governor Francis Howard. Col. John Pate, a member of the Council of State, built the house in 1650.

Sponsor: A.J. Pate Locality: Gloucester County Greenwood-Afton Rural Historic District The Scots-Irish settled the GreenwoodAfton area in the 1730s, linking the agriculturally rich Shenandoah Valley with eastern Virginia.

Sponsor: Western Albemarle Association Locality: Nelson County Hanover Tavern John Shelton opened the tavern at the Hanover Courthouse in the 1750s. It attracted many important people, including Patrick Henry, Lord Cornwallis, and George Washington.

Sponsor: The Honorable and Mrs. Christopher Peace Locality: Hanover Hickey’s Road Named after John Hickey, a merchant who operated a store at its western limits and peddled his wares along its length.

The road played a major role in European settlement in Southside Virginia in the eigthteenth and nineteenth centuries.

Sponsor: Multiple Sponsors Locality: Pittsylvania County ALBEMARLE

Robert Bolling (1738-1775) In 1766, Robert Bolling, member of the House of Burgesses, wrote an article in which he accused prominent legislators of showing favoritism in allowing their friend, accused murderer, John Chiswell, bail. Lt. Gov. Francis Fauquier instructed a grand jury “to punish the Licentiousness of the Press,” and indict Bolling, but it refused.

Sponsor: Bolling Family Association Locality: Buckingham County

Early English Christmas at Kecoughtan From 30 December 1608 to 5 January 1609, Capt. John Smith and his party of 27 men, lodged with the Kecoughtan Indians. The group celebrated Christmas with the natives. Smith later wrote that the English “were never more merry” and “never had better fires in England than in the dry, warm, smoky houses of Kecoughtan.”

Sponsor: DHR/TEA Locality: City of Hampton

The Valentine Museum The 1892 bequest of Mann S. Valentine II, creator of Valentine’s Meat Juice healthtonic, established the Valentine Museum as one of Richmond’s first museums. The Museam’s collection of Richmond history includes photographs, rare books, fine art, costumes, and textiles.

Sponsor: The Valentine Museum Locality: Richmond

First Virginia Volunteers-Leigh Street Armory In 1895, the City of Richmond opened the Leigh Street Armory for the First Battalion Virginia Volunteers, one of the state’s several African American militia units. After the war it became a school until it closed in 1954.

Sponsor: DHR/TEA Locality: City of Richmond

Wickham-Valentine House Attorney John Wickham lived here beginning in 1790. A prominent lawyer, he helped defend Aaron Burr against treason charges in 1807. Entrepreneur Mann S. Valentine II purchased the property in 1882, displaying his archaeological and ethnographic collections here. In 1898, the house was opened as the Valentine Museum.

Sponsor: The Valentine Museum Locality: Richmond

George Teamoh A member of the Constitutional Convention of 1867 and the Senate of Virginia from 1869 until 1871, George Teamoh was born enslaved, but escaped in 1853.

He resided in Massachusetts until the end of the Civil War when he returned to Portsmouth and became an important community leader.

Sponsor: DHR/TEA Locality: Portsmouth

Confederate Ordnance Lab Explosion In 1861, during the Civil War, Confederates established an ordnance laboratory and complex on nearby Brown’s Island.

On 13 March 1863, worker Mary Ryan acci-dently ignited a friction primer, resulting in a massive explosion that destroyed the building. At least 40 died from the explo-sion and resulting fire.

Sponsor: DHR/TEA Locality: City of Richmond

L’Ouverture Hospital and Barracks L’Ouverture Hospital opened in February 1864 to serve sick and injured United States Colored Troops (USCT). In 1864, more than 400 patients at the hospital led a successful protest demanding that USCTs be buried in Alexandria National Cemetery with full honors rather than being interred at the Freedmen’s Cemetery.

Sponsor: DHR/TEA Locality: Alexandria 33

So, you call yourself a Virginian?

Test your knowledge of our great Commonwealth and see what it means to be a true Virginian.

It was once said, “To be a Virginian either by birth, marriage, adoption, or even on one’s mother’s side, is an introduction to any state in the Union, a passport to any foreign country, and a benediction from the Almighty God.” One can only imagine that someone who knew the beautiful landscape and rich history of Virginia coined this adage.

To what extent could you call yourself a Virginian? Do you know the basics such as the state flower, bird, and nickname? Or are you an Old Dominion expert who celebrates every Virginia landmark from the birthday of Thomas Jefferson in April to the celebration of the Jamestown Landing on May 13?

Test your Virginia IQ. Challenge your friends and family. Dazzle your neighbors. If you are new to our state, learn some exciting facts and get to know Virginia.

Compiled by Casey Sweren

It’s election time and presidential politics are in the air. In fact, Virginia is nicknamed the “Mother of Presidents.” George Washington, Thomas Jefferson, James Madison, James Monroe, William Henry Harrison, John Tyler, Zachary Taylor, and Woodrow Wilson are all Virginia natives. With the Commonwealth well represented in the executive office, presidential trivia is tied to Virginia trivia. So, how much you know about these eight presidents?

“I hope I shall always possess firmness and virtue enough to maintain what I consider the most enviable of all titles, the character of an honest man.”

––George Washington

1. While George Washington was a very handsome man, what affliction left him scarred for life? a. Malaria b. Shingles c. Measles d. Smallpox

2. Which president did not die on July 4th? a.Thomas Jefferson b. John Adams c. James Monroe d. James Madison

3. Eight presidents were born in Virginia. How many presidents’ wives were born in Virginia? a. Six b. Seven c. Eight d.Nine

34

ALBEMARLE

4. True or False: Thomas Jefferson did not care for rituals and traditions, so much so that he would greet fully adorned foreign dignitaries while in slippers. a. True b. False

5. During which of these wars was James Madison president? a. American Revolution b. War of 1812 c. Mexican-American War d. Civil War

6. After being elected president in 1840, how long did Virginia-born William Henry Harrison serve in office? a. Two weeks b. One month c. Six months d. One year

7. It is common for presidents to be nicknamed during their term of office. Sometimes the names are flattering and other times they are not. For example, Abraham Lincoln is frequently referred to as “Honest Abe,” while James Buchanan is called “The Do-Nothing President.” Which of the following was John Tyler’s nickname?

10. What was the nickname given to the James Monroe Presidency? a. The Revolutionary Era b. The White House Era c. The Era of Resilience d. The Era of Good Feelings

11. In January 1918, Woodrow Wilson made his famous “Fourteen Point Speech,” in which he argued in favor of free trade, open agreements, democracy, and self-determination. While the Senate ultimately rejected the proposal, the last point established “a general association of nations.” What was this association called? a. United Nations b. Partnership of Nations c. League of Nations d. Confederation of Nations

12. During his presidency, Woodrow Wilson established national observance of which holiday? a. Mother’s Day b. Father’s Day c. Thanksgiving Day d. Valentine’s Day

a. Old Tippecanoe b. Young Hickory c. His Accidency d. Old Rough and Ready

8. Upon being elected to the presidency in 1848, Zachary Taylor became the first U.S. president to _________.

Get the answers on page 95

a. Be photographed b. Not be married c. Ride in a car d. Have never held any previous elected office

9. In 1820, James Monroe’s daughter Maria and Samuel L. Gouverneur married. It was the first wedding to ever take place in the White House.

The happy occasion was stifled, however, by what? a. The ring was stolen by a staff member moments before the wedding b. A patron was murdered in a duel at one of the celebration balls c. Inclement weather d. A patron objected to the wedding during the service

ALBEMARLE

35

MILITARY VETERANS LIKE DOMINION LINEMAN DEVON MCFADDEN ARE REMOVING ONE PROUDLY WORN UNIFORM FOR ANOTHER.

Supporting our military—when they’re abroad and when they come home—is an important part of who we are. That’s one of the reasons we’ve helped pilot the national Troops to Energy Jobs program, which links military veterans to jobs in the energy sector.

We’re proud that our company’s commitment to service members and their families was recognized when we received the Secretary of Defense Employer Support Freedom Award—the highest honor given to companies employing military veterans. It’s also led to Dominion being named a “Top 100 Military Friendly Employer” three years in a row. But what we’re most proud of are the dedicated men and women who’ve served our country so bravely. We’re honored to stand behind them—and work beside them.

dom.com

GOOD SPIRITS

“He

was a

wise man whoinvented

beer.”

- Plato

Local Breweries Win Awards at first Virginia Craft Brewers Festival

(Left to right) Founder Steve Crandall, Virginia Eagle Distributing COO Scott Heinz and CBF’s Discovery Program Manager John Rodenhausen

Devils Backbone Brewing Company Releases New Beer That Supports The Chesapeake Bay Foundation Like the “stripers” for which it is named, Devil’s Backbone Brewing Company’s newest craft brew, Striped Bass Pale Ale, is closely linked to the local waters of the Chesapeake, and, in the words of Devil’s Backbone’s founder and avid outdoorsman Steve Crandall, is “working to leave this land a little better.” A purchase of this crisp, invigorating American Pale Ale, which pairs well with local seafood from the Chesapeake, will not just help to satisfy thirst: Devil’s Backbone

Brewing Co. and its distributors will donate a portion of the proceeds from the ale - up to $30,000 - to support the Chesapeake Bay Foundation’s “Save the Bay” campaigns and conservation programs. These vital programs promote clean water for both the Chesapeake wildlife and the Chesapeake watershed, which extends all the way to the Blue Ridge Mountains. Available for distribution as of Labor Day 2012, this invigorating brew comes with a QR code, found on the back of every bottle, which will provide the ale’s drinker with access to even more information about clean water and a healthy Chesapeake environment.

Local Wineries Win Awards at International Competition

At the San Francisco International Wine Competition, four Central Virginia vineyards proved that Virginia wines can stand up to national, and even international, competition. Virginia vineyards and their specific local varietals took home a total of twenty-four medals for unique wines, which were selected from a field of over 4,500 options originating in 26 states and 29 countries. Barboursville Vineyards, no stranger to awards, received particularly high honors in the form of a Best in Show award in the dessert wine category, as well as a double gold medal distinction, for its 2007 Malvaxia Reserve Passito. Additionally, Barboursville took home silver and bronze medals for several other specialty wines, including the 2009 Petit Verdot, 2009 Nebbiolo, and 2009 Cabernet Franc. Fellow Central Virginia winners continued to uphold the quality standards of the area: Keswick Vineyards received a double gold medal for its 2009 Cabernet Sauvignon, a silver medal for its 2011 Verdelho and bronze medals for its 2010 Viognier, Reserve, and 2010 Merlot. Another gold medal was awarded to Pollak Vineyards, which submitted a 2009 Cabernet Sauvignon as well as a bronze-winning 2009 Premium Bordeaux Blend. The competition did not only recognize wineries: local winemaker Michael Shaps was given a bronze medal for his finely-crafted 2009 Viognier.

For the first time in Virginia’s history, 24 of the state’s most accomplished craft breweries gathered together at Devil’s Backbone Brewing Company for a day of friendly competition and craft brew camaraderie – and Central Virginia’s local breweries did not disappoint. A double blind panel of beer experts ranging from writers to members of the Beer Judge Certification Program confirmed that Albemarle and its surrounding areas produce exceptional quality brews, which were honored in almost every competitive category. Devil’s Backbone, the host of the event and fresh off a recent victory at the World Beer Cup, took home the gold medal in the Lager category, as well as the Best in Show Craft Brewers Cup, for their distinguished Schwartz Beer. A community event, the Virginia Craft Brewers Festival also featured local artisan food vendors and a variety of Virginia-based music, showing off all that Central Virginia has to offer.

(Left to right) Devil’s Backbone Founder Steve Crandall, Devil’s Backbone Brewermaster Jason Oliver with Lead Brewer Nate Olewine, Brewer Aaron Reilly and Head Judge Lyle Brown

2012 Virginia Craft Brewers Fest Winners List Pale Ale Category: Gold: Port City Brewing Company – Monumental IPA Silver: Starr Hill Brewery – Double Platinum Bronze: Mad Fox Brewing Company – English Summer Ale Dark Category: Gold: Capital City Brewing Company – Oatmeal Stout Silver: Hardywood Park Brewing Company – Gingerbread Stout Bronze: Port City Brewing Company – Porter Lager Category: Gold: Devils Backbone Brewing Company – Schwartz Bier Silver: Lost Rhino Brewing Company – Rhinofest Bronze: Starr Hill Brewery – Festie Belgian Category: Gold: Wild Wolf Brewing Company – Blonde Hunny Silver: Devils Backbone Brewing Company – Azrael Bronze: Port City Brewing Company – Optimal Wit Specialty Category: Gold: The River Company Brewery – Farmhouse Heffeweizen Silver: Lost Rhino Brewing Company – Rye Wit Bronze: Wild Wolf Brewing Co – Ginger Lager Best of Show & Winner of the VA Craft Brewers Cup Devils Backbone Brewing Company – Schwartz Bier

For more information visit www.virginiawine.org or www.brewridgetrail.com ALBEMARLE

37

38

ALBEMARLE

GOOD SPIRITS

Virginia Wine, Beer, And Cider TRAILS Festivals & Events October/novemBER

OCTOBER First Wednesday at King Family Vineyards Oct 3—Toast the arrival of crisper weather and colorful leaves with extended hours at King Family Vineyards’ final First Wednesday celebration in the 2012 series. The Tasting Room will be open for bottle and glass sales. Bring your favorite company and relax on the patio. $.

5-8:30pm. 434-823-7800. www.kingfamilyvineyards.com Fall Wine Festival and Sunset Tour at Mount Vernon Estate and Gardens Oct 5-7—Join “George and Martha Washington” for an extraordinary evening of wine, live music, and candlelit tours of the Mount Vernon mansion. Sample offerings from 16 Virginia wineries while looking over the Potomac River. $. 6-9pm. 703-780-2000. www.mountvernon.org Peak Foliage Open House at Peaks of Otter Winery Oct 5-7, 12-14, 19-21, 26-28—Enjoy breathtaking views from the Peaks of Otter.

Sample apples, fresh cider, and Fruit of the Farm wines. Bring the whole family to visit with the farm animals! 12-5pm. 540-5863707. www.peaksofotterwinery.com Early Mountain Vineyard “Sippin Into Sunset”Oct 5, 12, 19, 26—Enjoy the views, live music, wonderful wines and delicious food from the Market Place. Feel free to bring your own picnic items to enjoy on the spectactular outdoor pinic area! A mix of select Early Mountain wines and a showcase of the Best of Virginia wines: Barboursville, Breaux, Chatham, King Family, Linden, and Thibaut-Janissonare available for purchase. $. 6pm-8pm. 540948-9005. www.earlymountain.com Fox Meadow Winery Sunset in the Vineyard Oct 6—Enjoy music and a peaceful evening watching the sun set over the vineyard.

Entertainment provided by acoustic guitarist Alan Grant. $. 11am-8pm. 540-6366777. www.foxmeadowwinery.com ALBEMARLE

All Things Olive at Villa Appalaccia Oct 6—Olives, olive oils, and pasta. There will be a variety of olives, including cerignolo, kalamata, niçoise, gaeta and more. Also enjoy olive oils from different parts of Italy as well as several fascinating flavored oils (black and white truffles, porcini mushroom, and lemon). The highlight of the evening will be a plate of artisanal pasta prepared with pecorino romano cheese and the oil of your choice. Includes a glass of wine. Reservations required. $.

540-593-3100. www.villaappalaccia.com Oktoberfest at the AmRhein Wine Cellars Oct 6—Enjoy famous barrel-rolling and barrel riding competitions, live music by The Kings, and more. Food available for purchase or pack a picnic; no coolers or outside alcohol permitted. Bring chairs, blankets, and jackets. $. 2-7pm. 540-9294632. www.amrheins.com Woodland Vineyard Harvest Party Oct 6—Celebrate the end of harvest season, learn about the fermentation process, taste Woodland Vineyard’s wines, and enjoy light hors d’oeuvres as well as the famous wine ice cream. $. 12-5pm. 804-739-2774. www.woodlandvineyard.com Oktober Wein Fest at North Mountain Vineyard Oct 6—Enjoy this annual festival’s authentic German food samples, sit in the wine tent, and taste Shenandoah Valley wines. Local artisans will display unique crafts, food, flowers, herbs, and fruit.

Admission includes a souvenir wine glass, wine tasting, and all entertainment. Rain or shine. $. 11am-5pm. 540-436-9463. www.northmountainvineyard.com Annual Harvest Festival at Rockbridge Vineyard Oct 6—Experience the beauty of the Shenandoah Valley in autumn with live music and award-winning wine. Bring the kids for grape stomping and hayrides. Food is available for purchase; ticket price covers wine tasting and a souvenir glass. $. 12-6pm.

888-511-9663. www.rockbridgevineyard.com

Foggy Ridge Cider Fall Open House with Dogtown Pizza Oct 6—Taste the fruits and beverages of the season with samples of award-winning hard cider along with Grimes Golden, Newtown Pippin, Ashmead’s Kernel and Pomme Gris apples with nationally known apple expert, Tom Burford. Bring your own “mystery apples” for identification. Dogtown Pizza will bring its brick pizza oven for a special treat of freshly baked thin crust pizzas, made with local ingredients and available for purchase. $. 11am-5pm. 276-398-2337. www. foggyridgecider.com.

Wine and Soup Weekend at Veramar Vineyard Oct 6, 7—Come and take the chill off at Veramar with a bowl of soup and a glass of wine, a great combination to warm you up from the inside out. Sit and relax with friends and family in front of the grand fireplace. Advanced reservations requested. $. 12-5pm. 540-955-5510. www.veramar.com 11th Annual Norton Wine & Bluegrass Festival at Chrysalis Vineyards Oct 6, 7— Enjoy the bluegrass pickings of Jackass Flats, Circa Blue, and A Good Natured Riot, craft and food vendors, hayrides, vineyard tours, a wine tasting with commemorative glasses, and more. $. 540687-8222 ext. 206. www.chrysaliswine.com Fall Foliage Open House at Hill Top Berry Farm and Winery Oct 6, 7—Enjoy nature’s bounty and beauty on this autumn weekend.

Pack a picnic and taste food samples paired with the farm’s True to the Fruit wines and historical honey meads. $. 11am-5pm. 434361-1266. www.hilltopberrywine.com Annual Apple Harvest Celebration at Carter Mountain Orchard Oct 6-7, 13-14, 20-21, 27-28—Head up to Carter Mountain for music, crafts, food, hayrides, apple butter, apple cider, apple pie, and all things apple. View the orchard’s wine selection and partake in a complimentary tasting. 8am-7pm. 434-977-1833. www. cartermountainorchard.com 39

&KDUORWWHVYLOOH $OEHPDUOH 5HDO (VWDWH 6SHFLDOLVW

/HW 8V +HOS <RX

'RZQWRZQ &ÂśYLOOH +LVWRULFDO FODVVLF ZLWK SDQHOHG VWDLUFDVH DQG KHDUW SLQH IORRUV $UFKLWHFWXUDO GHVLJQHG DQG HFR IULHQGO\ V\VWHPV DQG XSJUDGHV D UDUH GRZQWRZQ JHP

+LVWRULF 6FRWWVYLOOH &RORQLDO VW\OH ZLWK VODWH URRI DQG EULFNV IURP WKH ÂśV ,PSUHVVLYH SXEOLF DQG SULYDWH URRPV

)HDWXUHG 2IIHULQJV

+XQW &RXQWU\ 6WXQQLQJ VTXDUH IRRW UHVLGHQFH ZLWK IDUPODQG YLVWDV LV MXVW PLQXWHV IURP GRZQWRZQ

3XQNLH )HLO

SXQNLHIHLO#JPDLO FRP

,Y\ )DUPV 6XSHU RSSRUWXQLW\ OHVV WKDQ PLQXWHV IURP 89$ /DUJH DQG HOHJDQW HQWHUWDLQLQJ VSDFHV LQVLGH DQG RXW

(OL]DEHWK )HLO 0DWWKHZV

HOL]DEHWKIHLO PDWWKHZV#JPDLO FRP

BEAUTY AND QUALITY. EVERY. SINGLE. TIME. An American tradition since 1946, those who own Kincaid furniture come back for more. The high quality craftsmanship is evident in every piece of bedroom, dining room and living room furniture. Visit the Kincaid Gallery exclusively at Grand Home Furnishings and see for yourself how solid wood Kincaid Furniture will add beauty and character to your home. Choose from a wide array of Kincaid furniture in-stock for immediate delivery or special order from hundreds of additional choices. Grand Home Furnishings: the areaâ&#x20AC;&#x2122;s largest selection of furniture and mattresses. Look for us on facebook.

1801 Seminole Trail | Charlottesville | 434-974-6480 www.grandhomefurnishings.com

40

Live Music and Gourmet Specials at North Mountain Vineyard Oct 7â&#x20AC;&#x201D;Enjoy live music

by Robbie Limon and taste wonderful Shenandoah Valley wines as well as gourmet, German-style cheese platters. $. 2-5pm. 540436-9463. www.northmountainvineyard.com Keswick Vineyards Yappy Hours Oct 7, 14, 21, 28â&#x20AC;&#x201D;Attend the weekly event every Sunday while the weather is mild. Bring your four-legged friends to play while you mingle with other animal lovers. A portion of the purchase price of each bottle of wine sold that day will be donated to local animal rescue groups. On select Sundays, some of these groups will attend with friends available for adoption! 9am-5pm.

434-244-3341. www.keswickvineyards.com Movie Night at The Winery at La Grange Oct 7, 14, 21, 28â&#x20AC;&#x201D;Bring a blanket and enjoy a special adults-only evening under the stars.

Your reservation includes picnic fare and a bottle of your choice of La Grangeâ&#x20AC;&#x2122;s classic wines to be savored on the lawn with your favorite friends. At dusk the screen lights up.

Reservations required. $. 7-9:30pm. 703-7539360. www.wineryatlagrange.com Band Night at Valhalla Vineyards Oct 12, 26â&#x20AC;&#x201D;Bring your lawn chairs, blankets, and picnics to enjoy live music from 5:30-7:30pm on the outdoor deck, weather permitting.

4-8pm. 540-725-9463. www.valhallawines.com Black Dog Wine and Music Festival at Château Morrisette Oct 13â&#x20AC;&#x201D;Join the party as music lovers fill the fields with lawn chairs, barefoot dancing, and frivolity.

Enjoy live music as well as winery tours and tastings. Crafters, vendors, food, and more abound. $. 540-593-2865. www.thedogs.com Fall Arts and Crafts Festival at The Winery at La Grange Oct 13â&#x20AC;&#x201D;Browse the handmade wares of local artisans and craftsmen and sample the best of what the vineyard has to offer. $. 7-9:30pm. 703-7539360. www.wineryatlagrange.com The Octagon Feast at Barboursville Vineyards Oct 13â&#x20AC;&#x201D;Take in spectacular views of the vineyard and enjoy a delicious four-course feast prepared by Chef Melissa Close Hart paired with four distinct vintages of Octagon. Dinner will be preceded by Barboursville Brut and canapĂŠs in the Octagon Cellar.

Reservations required. $. 7pm. 540-8327848. www.barboursvillewine.com Virginia Wine and Garlic Festival at Rebec Vineyards Oct 13, 14â&#x20AC;&#x201D;Drink wine and savor a variety of delicious garlicky foods. Arts and crafts, specialty foods, Virginia wine, and hundreds of varieties of garlic to go around. A petting zoo and bounce area will thrill the children. $. 10am-5pm. Rain or shine. 434-946-5168. www.rebecwinery.com Words and Wine Fundraiser Oct 14â&#x20AC;&#x201D;Escape the familiar at WriterHouseâ&#x20AC;&#x2122;s third annual Words and Wine celebration in the special setting of Glass House Winery in Free Union. Enjoy delicious wines, an abundant spread of hors dâ&#x20AC;&#x2122;oeuvres, and Glass Houseâ&#x20AC;&#x2122;s own gourmet chocolates, all to the smooth jazz notes of the Rick Olivarez Trio. Words and Wine supports the mission of WriterHouse, a four-year-old non-profit ALBEMARLE

promoting the creation and appreciation of literature and encouraging the development of writers of all levels. Based in downtown Charlottesville, WriterHouse provides beautiful, affordable work and meeting spaces, a variety of writing courses taught by talented instructors, and numerous literary events for the public. $.

2-5pm. 434-296-1922. www.writerhouse.org Rockbridge Vineyard Uncorked and Unplugged Oct 14—Bring the lawn chairs and the whole family and relax on the deck with live music while sampling Rockbridge wines. Lunch available for purchase or bring your own picnic. 2-5pm. 540-3776204. www.rockbridgevineyard.com Fridays on the Patio at James River Cellars Oct 19—The beautiful patio comes alive for this monthly event featuring local musicians, tours, wine tastings, and good cheer. Bring a picnic to share with friends or purchase something from the food vendors. Food prices a la carte. Rain or shine. $. 6:30–9:30pm. 804-5507516. www.jamesrivercellars.com Naked Mountain Winery Winemakers Dinner Oct 20—Enjoy an evening of awardwinning Naked Mountain wines paired with food prepared by Chef Eric Stamer.

Reservations required. $. 6:30-9:30pm.

540-364-1609. www.nakedmtnwinery.com Harvest Celebration at Ingleside Oct 20—Ingleside celebrates its 33rd harvest with artwork, crafts, winemaking demonstrations, and guided tours of the vineyard and winery. Bring the kids for

hayrides and more. Admission includes live music, tours, tastings, and a souvenir glass. Food concessions available, or bring a picnic. Reservations required. $. 11am-4pm.

804-224-8687. www.inglesidevineyards.com 26th Annual Barrel Tasting at Autumn Hill Vineyards Oct 20-21, 27-28—Barrel samples and a tasting of newly fermented 2012 wines. Savor the full range of wines and enjoy the spectacular fall foliage. $. 12-5pm.

434-985-6100. www.autumnhillwine.com Halloween Treats at Foggy Ridge Cider and Blacksnake Mead Oct 27—Visit the haunted orchard for this special Halloween Open House and nearby neighbor Blacksnake Mead. Expect scary costumes and sweet treats for adults and kids alike.

Everyone (over twenty-one) in costume gets a free cider tasting. Sample cider and mead paired with seasonal treats. $. 276-398-2337. www.foggyridgecider.com Haunted Halloween at Tomahawk Mill Winery Oct 24—Tomahawk Mill Winery celebrates Halloween in the haunted Grist Mill. Readings from Edgar Allen Poe will set the mood. Wine and gourmet food will be served for this adults-only event.

Reservations required. $. 7-11pm. 434-4321063. www.tomahawkmill.com Chesapeake Virginia Wine Festival Oct 27— Join the party at Chesapeake City Park to enjoy wines not only from Virginia’s finest wineries but also from wineries around the world. Enjoy foods from the region’s best restaurants as well. Live music by Lewis

McGehee, Jesse Chong, and friends will accompany the many festive wine and culinary celebrations. $. 12-6pm.757-573-8940. www. chesapeakevirginiawinefestival.com Wood Fired Pizza at Barrel Oak WineryOct 27—Brick Oven Pizza by Wood Fired Foods will be at Barrel Oak Winery. All ingredients are fresh and the pizzas are hand tossed and made to order. Bring the kids and plan on pizza and wine (or juice boxes for the little ones) for lunch! 11am-5pm. 540-364-6402. www.barreloak.com Halloween Celebration at North Mountain Vineyard Oct 27—Be prepared to meet witches, warlocks, and goblins. A special “Witches Brew” will be served upon request.

Be sure to wear your witch costume and enjoy live music with “My Lukcy Fish” $. 2-5pm. 540436-9463. www.northmountainvineyard.com Autumn Barrel Tasting at Barboursville Vineyards Oct 27, 28—Enjoy samples of Barboursville’s vintages, a chance to buy and taste rare wines from the cellar and live music. Caromont Farm’s artisan cheeses and light fare from Palladio Restaurant are available for an additional fee. $. 11-4:30pm.

540-832-3824. www.barboursvillewine.net Stone Mountain Vineyards Open House Oct 29, 30—Spectacular fall colors abound from the scenic overlook. Enjoy small private tours of the vineyard’s wine cave, and sample directly from the barrel with general manager Kate Breiner. Bring a picnic and spend the day up on the mountain. $. 11am-5pm. 434990-9463. www.stonemountainvineyards.com

Go ahead, make your night (434 4)2 )2 200-8437 7

Say goodnight with a one-touch button that turns off the lights, locks the doors, and sets the alarm.

Tell me more

™

email em e mail ail info@ahtva.c info@ahtva.c co om m for or a frre ee h ho o ome m eva me v lu luati tion to o dette errm miine n what Control4 and AHT can control in your home!

From m TVs to mu usi sic c, light ig ght htiin htin ng to ng to sec e urrity,, and nd fire repl plac plac pl ace es to water sprinklers. Whether in Virginia or Venezuela, es iff it can n be e plugg gge ed d int nto o a re rece ce eptacle, we w can control it!

Home Ho me Theaters • Di D st stri ribu ri bute ed Au Audi dio • Au di dio Auto uto oma mati to on n • Lighting Control • Structured Wiring S st Sy s em m De es sig gn • Ce entral Vacu cu uum • Com omme m rc rcia i l • PC Networking ALBEMARLE

41

NOVEMBER Tales of Suspense Dinner Theater at Château Morrisette Nov 2, 3, 10—Join Château Morrisette for a three-course dinner followed by a suspenseful evening of theater performed by the NoneSuch Playmakers. Reservations required. $. 7pm.

540-593-2865. www.thedogs.com Peak Foliage Open House at Peaks of Otter Winery Nov 2-4, 9-11—Enjoy breathtaking views from the Peaks of Otter. Sample apples, fresh cider, and Fruit of the Farm wines. Bring the whole family to visit with the farm animals! 12-5pm. 540-586-3707. www.peaksofotterwinery.com Early Mountain Vineyard “Sippin Into Sunset”Nov 2, 9 —Enjoy the views, live music, wonderful wines and delicious food from the Market Place. Bring your own picnic items to enjoy on the spectactular outdoor pinic area! A mix of select Early Mountain wines and a showcase of the Best of Virginia wines: Barboursville, Breaux, Chatham, King Family, Linden, and Thibaut-Janissonare available for purchase. $. 6pm–8pm. 540-948-9005. www. earlymountain.com Stories & Songs at MountainRose Vineyards Nov 3—Enjoy dinner and the music of the guitar and mountain dulcimer played by Jack Beck and Wendy Welch. $. 276-3282013. www.mountainrosevineyard.com Heart of Virginia Harvest Wine Trail Nov 3, 4—Enjoy the beautiful Virginia countryside as you drive from winery to winery. Taste

selectively crafted, award-winning wines of exceptional quality and character. Your ticket includes tastings at four wineries: Lake Anna Winery, Cooper Vineyards, James River Cellars, and Grayhaven Winery. Ticket purchase includes a souvenir wineglass, snacks, wine trail specials, and a chance to win a special gift upon completion of the trail. $. The Heart of Virginia Wine Trail can be completed anytime during normal hours of operation. 540-8945253. www.hovawinetrail.com Horton Vineyards Fall Barrel Tasting Nov 5—Come and taste 2011 and 2012 wines from the barrel and enjoy the autumn colors in beautiful Orange County. $. 11am-5pm.

540-832-7440. www.hortonwine.com Veteran’s Day at Gadino Cellars Nov 10— Come celebrate Veteran’s Day at Gadino Cellars. Special discounts will be offered on all wine purchases to those with military identification. Live music by Magick Kat on Saturday afternoon. 1:30-5pm. 540-987-9292. www.gadinocellars.com “How Sweet It Is” Wines and Chocolates at Veramar Vineyard Nov 10—Enjoy a “sweet” evening filled with expert tips on how to pair two of your favorite treats, wine and chocolate. Taste a variety of decadent artisan chocolates, each paired with a wine. Reservations required. $. 7pm. 540955-5510. www.veramar.com Reserve Cabernet Sauvignon Gala Release Party at Gray Ghost Vineyards Nov 10— Celebrate the release of the Gray Ghost’s exquisite Reserve Cabernet Sauvignon

from 2009. This is the only time Gray Ghost opens the Reserve Cabernet Sauvignon.

The evening’s festivities include live music by the Seth Kibel Jazz Trio (winner of over 20 WAMMIES), open wine bar, and buffet dinner. Advance ticket purchase required. $. 7:30-10:30pm. 540-937-4869. www. grayghostvineyards.com Fall Barrel at Tasting at Ingleside Nov 10—The leaves are falling and winter is coming, so warm up with premium wine directly from the barrels and see how the wines are maturing. Includes tasting and an Ingleside wine glass. Live music and light fare provided. Reservations recommended. $. 1-4pm. 804-224-8687. www.inglesidevineyards.com Naked Mountain Winery Winemakers Dinner Nov 10—Enjoy an evening of awardwinning Naked Mountain wines paired with food prepared by Chef Eric Stamer.

Reservations required. $. 6:30-9:30pm. 540364-1609. www.nakedmtnwinery.com Chili and Wine Weekend at James River Cellars Nov 10, 11—Come out and warm up with a bowl of chili, wine tasting, tours, and the chance to find some great wines for the holidays. $. 11am-5pm. 804-5507516. www.jamesrivercellars.com 9th Annual Oyster Roast at Cardinal Point Nov 10, 11—Live music and plenty of regional oysters from Rappahannock River Oyster Co. Make this a quality afternoon of seafood. The Cashmere Jungle Lords play Saturday followed

by The Atkinsons on Sunday. $. 12-5pm. 540-

Happy Birthday Charlottesville Celebrating 250 Years

www.Celebrate250.org 42

Photographer Ed Roseberry

ALBEMARLE

456-8400. www.cardinalpointwinery.com Fall Food and Wine Pairing at DelFosse Vineyards and Winery Nov 11—Enjoy an elegantly prepared Lunch by Chefs Genevieve and Yvette. The seasonal menu includes four dishes paired with four generous samplings of award-winning wines.

Reservations required. $. 1pm. 434-263-6100. www.delfossewine.com Thanksgiving for the Bounty of the Harvest at Peaks of Otter Winery Nov 16, 17, 18— The sweetest cider, the most succulent apples, the jars of preserves, jams and jellies, the warmth of wine and conversation are here to share. You can also picnic and visit the National D-Day Memorial, Bedford Museum, and Poplar Forest. 12-5pm. 540586-3707. www.peaksofotterwinery.com AmRhein Wine Cellar’s Harvest Soup and Wine Nov 17, 18—Taste a selection of gourmet soups paired with AmRhein wines.

Pick your favorite and relax with a bowl and a glass. Reservations required. $. 11am-5pm.

540-929-4632. www.amrheins.com Holiday Kick-off at Gray Ghost Vineyards Nov 23—Jump start the holiday shopping season in style. Enjoy light hors d’oeuvres, live music by Valerie VonFange, and browse new gifts for the holidays. 3:30-5:30pm. 540937-4869. www.grayghostvineyards.com Holiday Open House at Barboursville Vineyards Nov 23, 24—Celebrate the holidays by sampling Barboursville’s award-winning wines by the fireplace and enjoy special samplings from Palladio

ALBEMARLE

Restaurant. 12-4pm. 540-832-3824. www. barboursvillewine.com “Get in the Spirit” Holiday Open House at Wintergreen Winery Nov 23-25—Get in the holiday spirit with hot mulled wine, unique gift shopping, warm hospitality, and a festive atmosphere.

Enjoy complimentary tastings of awardwinning wines and delicious holiday refreshments. 10am-5pm. 434-361-2519. www.wintergreenwinery.com Thanksgiving Open House at Burnley Vineyards Nov 23-25—Taste Burnley Vineyards new releases, including Cabernet Sauvignon and the festive flavor of the Spicy Rivanna hot mulled wine. Items to nibble on will be available. 11am-5pm. 540-832-2828. www.burnleywines.com Hickory Hill Vineyards & Winery’s Holiday Open House Nov 23-25—Join Hickory Hill Vineyards for a country Christmas in the festive farmhouse, sip hot mulled wine, taste seasonal snacks, and find something for the wine lovers on your holiday gift list. 11am5pm. 540-296-1393. www.smlwine.com Christmas Time’s A’Coming Open House at Peaks of Otter Winery Nov 23-25, 30— Enjoy warm apple cinnamon wine and cider by the fire in the wine tasting room.

Wine gift packs and canned specialty products that make wonderful Christmas gifts are available for purchase. 12-5pm.

540-586-3707. www.peaksofotterwinery.com Foggy Ridge Cider’s Thanksgiving Open House Nov 24—Add another reason to be thankful at

this joint event between Foggy Ridge and the nearby Blacksnake Meadery. Enjoy cider and Natasha’s Famous Turkey Soup at Foggy Ridge, then some honey-glazed pork, sweet potatoes, and mead at Blacksnake. Bring your late season apples for expert identification. $. 11am-5pm.

276-398-2337. www.foggyridgecider.com and www. blacksnakemead.com Sugarleaf Vineyards 5th Annual Thanksgiving Weekend Cuvee Tasting Nov 24, 25— Celebrate Thanksgiving with a very special tasting of the Cuvee Neubia. Taste the estategrown Cabernet Sauvignon which has been patiently aging in ultra premium oak barrels for more than 18 months. $. 11am-6pm. 434984-4272. www.sugarleafvineyards.com Soup and Sip at Blue Ridge Vineyard Nov 25—Enjoy complimentary soups, holiday snacks, mulled wine, and music as a thank you to patrons and friends, and as a Christmas gift to you. 1-5pm. 540-798-7642. www.blueridgevineyard.com Horton Vineyards Thanksgiving Open House Nov 25, 26—Enjoy a bowl of hot soup or Horton Norton chili then take a stroll through the vineyard and walk off some of that Thanksgiving feast. Fee includes glass. $. 540-832-7440. www.hvwine.com

Explore and Visit Virginia Wine and Beer Trails www.virginiawine.org www.brewridgetrail.com

43

HISTORY OF CIDER Now Virginians will have much more to choose from when they thirst for an artisanal beverage.

Cider was a very popular table drink consumed with dinner in colonial times, and though it is less common today, there are still several orchards and cideries in Virginia who pride themselves on their cider making. During the colonial era, cider was even more popular than beer for a time since it was so simple to make, and apple trees grew easily throughout the East Coast. Hard cider is simply fermented apple juice, which, like beer, was safer to drink than water due to the yeast fermentation that killed bacteria.

Thomas Jefferson cared a great deal about his cider, from the types of apples used to make it, to the preparation and cleanliness, all the way to the bottling. He even had a separate cellar in which he stored only cider, which he often created from Virginia Hewe’s Crab apples, and that tasted similar to champagne. His presidential predecessor, John Adams, was also known to drink a tankard of hard cider, his favorite beverage, at breakfast each day.

Cider became less popular as Americans moved into cities or out West to areas that would not support apple orchards. This is because apples, unlike grain, are nearly impossible to transport, and thus, the entire cider making process had to take place at the orchards, which by that time made up a small portion of America.

Finally, German immigrants brought with them speedier ways of fermentation, making brewing easier, and thus, cider lost its edge. Following a long decline in its popularity, Prohibition was the final straw for cider making. We are glad to say that Virginia is bringing cider to the forefront. a

October 6

Beer and Cider Links

Saturday 10:00 am-5:00 pm

Albemarle CiderWorks www.albemarleciderworks.com

October 7

Blue Mountain Brewery www.bluemountainbrewery.com

Sunday 10:00 am-4:00 PM

Bold Rock Hard Cider www.boldrock.com

Castle Hill Cider

On the Grounds of

www.castlehillcider.com

James Madison’s Montpelier

Champion Brewing Company www.championbrewing.tumbler.com

Montpelier Station, VA

Devils Backbone Brewing Company www.dbbrewingcompany.com

Adults - $5 16 & under FREE

James River Brewing Company www.jamesriverbrewing.com

South Street Brewery

* Pets are not allowed

www.southstreetbrewery.com

Starr Hill Brewery www.starrhill.com

Michele Mangham

434-882-2222 44

www.fallfiberfestival.org

Wild Wolf Brewing Company www.wildwolfbeer.com ALBEMARLE

N AT U R E

S AV I N G T H E A M E R I C A N C H E S T N U T

O

ver a century ago, the American chestnut, known formally as Castanea dentate, dominated the Appalachian forests. In Eastern North America, the trees numbered around four billion. To put this quantity into perspective, one out of every four trees in the Appalachian forests was an American chestnut tree! When fully grown, the tree reached upwards of 100 feet and featured massive, widespread branches and a broad-rounded crown.

Due to its size and number, the American chestnut was central to the regional ecosystem. The nuts, which fell every autumn, fed and fattened regional wildlife, such as white-tailed deer, black bears, and wild turkey. The chestnuts were so abundant that not only were rural farmers able to feed themselves and their livestock, they also had enough chestnuts to ship boxcar loads to large towns and cities. The powerful appearance of the tree and cultural significance inspired poets, writers, and musicians alike. For example, have you ever heard the classic Christmas song “Chestnuts Roasting on an Open Fire” by Nat King Cole? It speaks to the tree’s influence that sixty years after an untimely demise, the American chestnut is still culturally relevant.

Beyond dimension and influence, the tree was economically important. The chestnuts were a lucrative cash crop and sold in towns across the East coast. Yet the real value was in the wood. American chestnut wood was lightweight, easy to split, rot resistant, and grew up to fifty percent faster than oak. Consequently, throughout eastern America, industries sprang up to use the straight-grained American chestnut wood for industrial purposes. Railroad ties, split-rail fences, poles, log cabins, furniture, caskets, and more were all made with American chestnut wood. Additionally, its bark and wood was rich in tannic acid, which provided tannins used in tanning leather. At its height, nearly half of the vegetable tannin used by the American leather industry was from American chestnut trees.

Around the turn of the 19th century, an Asian fungus, Cryphonectria parasitica, entered the United States. Cryphonectria parasitica, commonly called the chestnut blight, was unintentionally introduced through imported Chinese chestnut trees. In 1904, Herman W. Merkel, a mycologist at the Bronx Zoo, first discovered the fungus in America.

At the time, few could have imagined the disastrous impact brought by the fungus. The damage was swift, acute, and unmatched. In fact, in “New Hope for the American Chestnut,” the author states that the chestnut blight is “possibly the most efficient host-specific tree destroyer known in the world.” Consequently, within fifty years of the chestnut blight discovery, the American chestnut population was devastated. The blight ALBEMARLE

destroyed nearly all four billion–that’s right, four billion—American chestnut trees in eastern North America.

But how and why was this blight so comprehensive and deadly? The fungus produces two types of spores: one that is dispersed by wind and another by rain. These spores infect the tree through natural cracks in the bark. The fungus penetrates into the tree’s interior, encircles the stem, and causes cankers that block the flow of food and water. As a result, above the point of infection, limbs and trunk die. Within ten years, the fungus ultimately encircles the entire trunk and the tree dies.

Normally, trees have built-in defensive responses that can prevent such large-scale disaster. For example, the American chestnut can resist the American forms of the fungus. Where the spores enter the bark, the American chestnut grows “wound tissue” to isolate and localize the infection. Likewise, the Asian chestnut could naturally resist the Asian fungus. The American chestnut, however, produces no response to the Asian fungus and the chestnut blight continues unchecked.

Nevertheless, the American chestnut tree is not endangered. There are many young American chestnut trees, not aged enough to have naturally occurring cracks in the bark. Additionally, American chestnut trees have been planted outside of their normal range and, as of today, away from the deadly spores of Cryphonectria parasitica.

But the surviving young trees are neither particularly numerous nor able to produce chestnuts and the mature trees are outside of the historic range. Accordingly, there is a movement to bring the mighty American chestnut tree back to prominence. One solution is to crossbreed the American chestnut with the naturally resistant Asian chestnut. By interbreeding the offspring with American chestnuts over multiple generations, the hybrid can be 15/16ths American chestnut and only 1/16th Asian chestnut. Therefore, it can display all the characteristic features of an American chestnut, while still being naturally resistant to the chestnut blight.

The American Chestnut Foundation is a foundation dedicated to saving and bringing awareness to the American chestnut tree. On October 6, 2012, the Virginia Chapter, located in northern Fauquier County, will host their Annual Chestnut Gala to celebrate past accomplishments and raise money to continue and expand their work in 2013. Guests will enjoy the Chestnut Soufflé, a roasted pig, live music, and a silent auction.

Visit http://vachestnut.org for more information about the organization, the American chestnut tree, and the Annual Chestnut Gala.

by Casey Sweren

45

albemarle moment

46

ALBEMARLE

IN THE GLOAMING Painting by William Van Doren Sunset from Stony Point, Albemarle County, Va. Oil on watercolor block, 13 x 19. www.veryrichhours.com Go to page 48 for more information on William Van Doren and “The Very Rich Hours.”

ALBEMARLE

47

The Very Rich Hours Artist William Van Doren

B

ill Van Doren started painting the sunset in 1995, after he rented a farmhouse in Stony Point with a good view of the sky over the Blue Ridge. “At first,” he says, “it was really just a way to get outside, paint, and get it done right then, instead of working on it forever, like I was used to doing.”

Also, he admits, “I think I just wanted that time of being with the sunset, a kind of meditation. It’s become a kind of ritual for staying in touch with a larger reality.”

In 1997, he decided to paint the sunset every single day, which he did through 1998. Then on New Year’s Day 2006, he started again ... and he’s now in the seventh year of that series.

Bill calls his collection The Very Rich Hours, a name inspired by the famous 15th-century illuminated manuscript Très Riches Heures du Duc de Berry.

As Bill explains, “Most of these paintings come from the same place” — that same farmhouse. “Otherwise I paint the view from wherever I happen to be. Even if I have to do them later from a sketch, these paintings are alla prima — wet in wet without later revision or overpainting — and are done in around the same time it takes to watch the sun go down.”

Bill was born in Leesburg, Virginia, and grew up in Lorton, which he says at the time was “a forgotten rural pocket of north-

ern Virginia.” Having received a full scholarship to Johns Hopkins University, he studied history and English and earned early election to Phi Beta Kappa, but also immersed himself in a study of painting. Completely self-taught, he began selling his work during his last year at Hopkins.

After graduation Bill worked in a New York literary agency while painting at night, then began freelance ghostwriting of books and film in Los Angeles, still pursuing his art. During his time in L.A., he published original posters and then an experimental publication, The Wall Paper, in a poster-size format. Novelist Steve Erickson, reviewing The Wall Paper, said, “The Word and the Image are one. The word is the image and the image is the word.” His employment ranged from day labor, to copyediting magazines such as Popular Hot Rodding and Wild World of Skateboarding, to adapting novels for film, to interviewing such figures as B.B. King and Don Cornelius for Soul magazine.

When he moved back to Virginia, Bill was hired to edit and design albemarle, which he did for the magazine’s first year and a half before going freelance. He had several art exhibitions in Charlottesville before launching The Very Rich Hours. In 2011 he exhibited all of the sunsets of 2010 in one big space at the Baker Gallery at Woodberry Forest.

Bill Van Doren lives with his wife, Laura Sutherland, their rescued foxhound, Flint, Flint’s feline sidekick, Pi, and twentyyear-old alpha cat, Stokey. He posts his work every night on the website veryrichhours.com and on the Facebook page The Very Rich Hours.

Bill Van Doren

“Snowset” Snowing at Sunset, February 19th, 2012

“Thunderball” Sunset with lightning over Piney Mountain, May 16, 2011

“Heavy Metals” Sunset, October 2, 2011 looking at the Blue Ridge past Piney Mountain on the right.

“Blue Moon Rising” August 31, 2012 moonrise over the Southwest Mountains at sunset

We go way back The April May 1988 issue of albemarle magazine featured one of Bill Van Doren’s paintings.

“Flat Sky Society” Sunset, March 18, 2012 48

“Out From Under” Sunset, April 21, 2012 ALBEMARLE

S TA G E L I F E

The Paramount Theater His Holiness, the 14th Dalai Lama of Tibet: “Compassionate Care in 21st Centur y Medicine”Oct 11—The Foundation for American Heritage Voices, the Tibetan Association of Charlottesville, the UMA institute for Tibetan Studies, and the City of Charlottesville are proud to welcome Tenzin Gyatso, His Holiness the 14th Dalai Lama and the spiritual leader of Tibetan Buddhism, back to Charlottesville, following previous visits in 1979 and 1998. Already a world leader in human rights and the winner of the 1989 Nobel Peace Prize, His Holiness will demonstrate his compassionate worldview as he leads a panel of experts from the University of Virginia in a discussion of modern medicine, Tibetan mindfulness, and compassionate care as medical progress is made in the 21st century. Moderated by former Charlottesville Mayor and city councilman Dr. David Brown, this panel at the Paramount Theater on Charlottesville’s historic Downtown Mall will explore the benefits of mindfulness, and the strategies for its use, as it is integrated into Western Medicine and Nursing.

Pairings with Chef Sarich Oct 22—Chef John Sarich joined Chateau Ste Michelle in Washington State when it first opened its doors in 1976. Today, Chef Sarich, author of Chef in the Vineyard, will entertain, educate and delight wine aficionados and foodies alike during his interactive stop in Charlottesville! Learn about pairing food and wine, sample food and wine pairings, and experience an expertly prepared VIP dinner after the event.

Mark Nizer’s One Man Show Oct 25— Mark Nizer has thrilled audiences around the world with his invention of new juggling tricks, combined with his unique wit.

Imagine, four lasers being juggled at 1000 rpms, with spinning laser beams dancing just above the audience.

Waynesboro Symphony Orchestra Oct 26—Waynesboro Symphony Orchestra: Heroes of America is brought to you by Stellar One Bank and co-sponsored by the Oak Ridge Fox Hunt Club. The Program: “Divertimento Concertant for Double Bass & Orchestra,” Duke Ellington and Gershwin tributes arranged for Tuba and Orchestra, Williams: “Hymn to the Fallen,” Tchaikovsky: “The Year 1812, Festival Overture,” featuring Aaron Clay, Base Virtuoso; Patrick Sheridan, Tuba; Dr. Peter Wilson, violinist.

ALBEMARLE

Natalie Cole Oct 28—Nine-time Grammy award-winning singer, songwriter, and performer Natalie Cole has proven to be one of the most beloved performers of all time. Cole rocketed to stardom in 1975 with her debut album, Inseparable, earning her a #1 single and two Grammy awards for Best New Artist, and Best Female R&B Vocal Performance.

Virginia Film Festival Nov 1-4—The Virginia Film Festival traditionally features as many as 100 films and nearly as many guests that showcase the best of contemporary and classic films alike while shining a spotlight on a wide variety of cultural issues and themes. From traditional screenings and lectures to dynamic parties and special events, the festival appeals to a broad spectrum of audience interests.

Starr Hill Presents: Joshua Radin and A Fine Frenzy Nov 5—From Ohio via New York and California, Joshua Radin is a uniquely word-of-mouth success story. His debut, We Were Here (Columbia), drew critical acclaim and a four star review from Rolling Stone. 2008’s follow up, Simple Times, which hit number one on the overall iTunes chart upon release, saw Radin collaborating with producer Rob Schnapf (Beck, Elliott Smith). A Fine Frenzy is the enchanting musical world of Alison Sudol, and her sprawlingly ambitious new album PINES reaches for the stars. It is nothing less than the story of our age: an elegy for a planet on the brink of catastrophe.

Huck Finn Nov 8—America’s most beloved coming of age tale is also its most controversial. Set against the racially charged backdrop of a pre-Civil War American South, The Adventures of Huckleberry Finn examines the nature of friendship and freedom in the face of shocking prejudice. Bring the whole family and dare to escape with us down the Mississippi and learn that thinking for yourself is the bravest act of all.

Lyle Lovett & His Acoustic Group Nov 14—Lyle Lovett has evolved into one of the most infectious and fascinating musicians in popular music. Though initially labeled as a country singer, Lyle Lovett has more in common with ‘70s singer/ songwriters like Guy Clark, Jesse Winchester, Randy Newman, and Townes Van Zandt, combining a talent for incisive, witty lyrical detail with an eclectic array of music, ranging from country and folk to big-band swing and traditional pop.

Velveteen Rabbit Nov 16—“When a child loves you for a long, long time . . .then you become Real,” says the Horse to the Velveteen Rabbit in Margery Williams’ famous literary classic. A plush rabbit, given as a gift to a young boy, yearns for the day the boy will choose him as his special playmate so that he can become real.

Music, life-size puppets, masks, and magic bring to life this charming tale of love and devotion, creating an unforgettable theatrical experience.

The Temptations Nov 21—For more than 40 years, The Temptations have propelled popular music with a series of smash hits and sold-out performances throughout the world. The current lineup, Otis Williams, Terry Weeks, G. C. Cameron, Ron Tyson, and Joe Herndon, stays true to the group’s tradition of style, class, and unparalleled singing ability.

Alternative Gift Fair Holiday Spotlite: Miracle on 34th Street Nov 23—Run to the stores for the Black Friday Sales and then kick off the holiday season at The Paramount. See local singers and musicians perform in the Holiday Spotlite, join in the holiday spirit with the alternative gift fair by “purchasing” gifts for family members in the form of donations to area nonprofits, and then top it all off by watching Miracle on 34th Street! Sure to be a holiday treat!

United Nations of Comedy Tour Dec 1— United Nations of Comedy Tour will feature five of today’s funniest comedians, as seen on Comedy Central, BETComic View, HBO, Showtime, and other national programs. FunnyMan Skiba, Sheng Wang, Erin Foley, Jon Laster, and Jason Andors make up this diverse cast of some of the nation’s best entertainers, which promises to keep the crowd laughing all through the night.

The Metropolitan Opera Live at The Paramount Theater Performances are broadcast in high definition live from the Metropolitan Opera House in New York.

Donizetti’s L’Elisir d’Amore Oct 13 Verdi’s Otello Oct 27 Adès The Tempest Nov 10 The Paramount Theater 215 East Main Street, Charlottesville 434-979-1333 www.theparamount.net 49

nTelos Wireless Pavilion

Live Arts

tale for all eras. Directed by Marianne Kubik. Helms Theatre.

His Holiness, the 14th Dalai Lama of Tibet: “Beyond Religion: Ethics for a Whole World” Oct 11— Charlottesville Mayor Satyendra Singh Huja will recognize the Dalai Lama for his contributions to peace, nonviolence, human rights, and religious understanding.

Clybourne Park Oct 12-Nov 10—This Pulitzer Prize-winning play revolves around a house in the suburbs of Chicago. In 1959 the Youngers, a black family, move in. In 2009, a white family buys the property. In part a riff on—and an homage to—Lorraine Hansberry’s masterful A Raisin in the Sun (where the Younger family originated), Bruce Norris’s whip-smart dark comedy takes on the specter of gentrification in our communities, and the unsettling question of what we talk about when we talk about race.

Spring Awakening Nov 28-29, Dec 1-5— Capturing eight Tony Awards including Best Musical, the show features an infectious score by Grammy-winning artist and composer Duncan Sheik. Directed by Robert Chapel. Culbreth Theatre.

The Avett Brothers Oct 19—Two North Carolina legends are teaming up to present a groundbreaking concert that will raise funds for family-aid organizations across the country. The legendary soft drink of the South, Cheerwine, and bestselling indie-rockers The Avett Brothers will demonstrate how music brings people together through a Legendary Giveback concert. The show will be live-streamed nationally. nTelos Wireless Pavilion 700 East Main Street Charlottesville 434-245-4910 www.thenteloswirelesspavilion.com

The Jefferson Theater Mutemath Oct 8

Live Arts 123 East Water Street Charlottesville 434-977-4177 www.livearts.org

Martin Luther King Jr. Performing Arts Center Live and Out Loud—A Music, Dance and Literary Arts Event Oct 7—A free performance open to the community, showcasing the talents of local musicians, dancers, writers and photographers of all ages.

Culbreth Theater, University of Virginia 109 Culbreth Road, Charlottesville 434-924-3376 www.virginia.edu/drama

Old Cabell Hall Mikhail Simonyan & Alexandre Moutouzkine Oct 9—Spend a lovely Tuesday evening listening to the skillfully blended sounds of Simonyan’s violin and Moutouzkine’s piano.

Yuri Yakonov Ensemble Oct 12—From a Gypsy sax solo to Bulgarian wedding music, the Yuri Yunakov Ensemble is one of the leading acts on the world music scene. A member of the famed Gypsy Caravan Tour, the ensemble has performed at Lincoln Center, The Kennedy Center, The Smithsonian Institution, and throughout the United States and abroad.

The Melvins Lite Oct 9 An Evening with The Legwarmers Oct 12 La Fiesta Del Syd featuring The Futurebirds Oct 13

UVA Symphony Youth Concert Oct 18—A performance by the UVA Symphony, featuring some of the university’s most talented classical musicians.

Rebelution Oct 17 Easy Star All-Stars Oct 19 Papdosio Oct 25 Dinosaur Jr. Oct 26 The Jefferson Theater 110 East Main Street, Charlottesville 800-594-TIXX, 434-245-4980 www.jeffersontheater.com

The Southern Tift Merritt Oct 12 Ben Taylor Oct 13 Electric Guest Oct 17

The Martin Luther King Performing Arts Center 1400 Melbourne Road Charlottesville 434-979-9532

Play On! The Theatre at IX Jekyll and Hyde Oct 26-Nov 10—This horror classic recounts the strange case of Dr. Henry Jekyll, whose errant scientific tinkering turns him into the beastly Mr. Hyde.

Through a dramatic story and soaring music, the audience is transported to Victorian London for a chilling look at the true nature of good and evil.

Milo Green Oct 20 Tim O’Brien Nov 3 The Whigs Nov 5 Marco Benevento Nov 7

Play On! The Theatre at IX 983 Second Street S.E. Charlottesville 434-872-0184 www.playontheatre.org

Charlottesville & University Symphony Orchestra Youth Concerts Oct 18—This project always proves popular with students and has enthusiastic support and assistance from local music teachers. Because of the continuing support of area foundations, businesses, and individual contributors, citizens can ensure that future generations experience our Youth Concerts and the thrill of symphonic music.

Virginia Gentlemen Oct 27—An evening of a cappella from the premier musical ambassadors of the University of Virginia. The group offers the widest repertoire of music in the area, ranging from 1940s Sinatra hits and 1960s Beatles singles to power ballads of the 80s and chart topping songs pulled daily from contemporary radio stations.

Piotr Anderszewski, Piano Nov 27—Piotr Anderszewski is regarded as one of the outstanding musicians of his generation, recognized for the intensity and originality of his interpretations.

Griffin House Nov 8 The Southern 103 South 1st Street, Charlottesville 434-977-5590 www.thesoutherncville.com 50

Culbreth Theater Rhinoceros Oct 4-6, 10-13—This funny, bizarre, and biting satire is a cautionary

Old Cabell Hall, University of Virginia 112 Old Cabell Hall Charlottesville 434-924-3052 www.virginia.edu/music www.virginiagleeclub.com ALBEMARLE

Wayne Theatre Alliance

Garth Newel Music Center

Larry Kirwan Oct 5

Autumn Meditations Nov 23 Autumn Celebrations Oct 19

Fall Foliage Festival Oct 12-14 River City Radio Hour Oct 19, Nov 16 Mojo Saturday Oct 20, Nov 17

Garth Newel Music Center 403 Garth Newel Lane, Hot Springs 540-839-5018 www.garthnewel.org

Comedy Night Oct 27 River City Boysâ&#x20AC;&#x2122; Jamboree Nov 2 Childrenâ&#x20AC;&#x2122;s Musical Nov 3 Richard Adams Nov 4 Music Trivia Night Nov 23 Barbara Lawson Nov 24 Wayne Theatre Alliance Waynesboro 540-943-9999 www.waynetheatre.org www.waynesborogateway.com

Hamner Theater Improv Monday Oct through Novâ&#x20AC;&#x201D;Test your reaction skills and ability to think creatively on you feet every Monday this fall!

Hamner Theater 190 Rockfish School Lane Afton 434-361-1999 www.hamnertheater.com

Blackfriars Playhouse The Merchant of Venice through Nov 23â&#x20AC;&#x201D; From Shylockâ&#x20AC;&#x2122;s unjust Venice to Portiaâ&#x20AC;&#x2122;s golden Belmont, The Merchant of Venice is at once a comic love story and a passionate discourse on justice and mercy. Both entertaining and disturbing, this magnificent comedy will have you asking â&#x20AC;&#x153;who are the heroes and who are the villains?â&#x20AC;?

The Two Gentlemen of Verona through Nov 23â&#x20AC;&#x201D;A gleeful look at love and a dramatic examination of friendship, Two Gents has one of Shakespeareâ&#x20AC;&#x2122;s most engaging comic heroines, one of his funniest clowns, and the best role ever for a dog.

Jealous lovers, a cross-dressing heroine, and a daring escape into the forest make this romp simultaneously a familiar and completely surprising trip.

The Lion in Winter through Nov 24â&#x20AC;&#x201D;The Lion in Winter plays out the spectacular strategies for power and love between two of Englandâ&#x20AC;&#x2122;s most formidable and most human rulers, King Henry II and Queen Eleanor, and their three crownhungry sons. Telling the story of what happens before Shakespeareâ&#x20AC;&#x2122;s King John, The Lion in Winter is a modern theatrical masterpiece.

Cymbeline Oct 6-Nov 25â&#x20AC;&#x201D;In this magical, violent, and beguiling comedy, Imogenâ&#x20AC;&#x201D; Shakespeareâ&#x20AC;&#x2122;s brave and virtuous heroineâ&#x20AC;&#x201D;must endure a series of humiliating trials before all is set right through the astonishing revelations that end the play.

Loved for its ravishingly beautiful language and enthralling storytelling, Cymbeline has long been a cult favorite in which Shakespeare forces his characters to take a leap of faith and, when they do, they and the audience discover that miracles can happen even when it seems all is lost.

Loveâ&#x20AC;&#x2122;s Labourâ&#x20AC;&#x2122;s Lost through Novâ&#x20AC;&#x201D;The King of Navarre and his three schoolmates are ripe for an education in love from the Princess of France and her three ladies.

Joining the lovers is a brilliantly goofy troupe of clowns, including the love-warrior Don Armado and the lust-sick rogue

TV time deserves better sound

Bose ÂŽ CineMate ÂŽ 1 SR home theater speaker system t "O FMFHBOU TPMVUJPO UIBU TPVOET BOE MPPLT HSFBU t %Ă?DPS GSJFOEMZ XJUI QSBDUJDBMMZ OP DMVUUFS t 8JEF TQBDJPVT TPVOE XJUI EFFQ SJDI CBTT Only $1499 00 *UFN $*/ 43

Get personalized, expert guidance Charlottesville: Rio Hill Shopping Center | (434) 817-1100 Harrisonburg: Cloverleaf Shopping Center | (540) 434-1000 Store hours: Mon.-Sat.: 10am-7pm; Sunday: Noon-5pm

ALBEMARLE

51

At the foothills of the Blue Ridge Mountains, Hill & Wood Funeral Service has been serving the families of this community for over 100 years. We will carefully plan our services to suit your needs and encourage as much or as little involvement as you prefer. Our knowledgeable staff is ready to guide you through your difficult time and help with careful decisions. When the time comes, remember us.

We’re here for you!

Costard, who ardently pursue the affections of a winsome country maid and perform an unforgettable pageant for the royals. Written around the same time as Romeo and Juliet and A Midsummer Night’s Dream, this giddy and extravagant romantic comedy is Shakespeare’s most exuberant wordfest—a joyful carnival of love, loss, and hope.

The Duchess of Malfi through Nov—John Webster’s brutal and astonishing play tells the story of one of the stage’s greatest women and two of its greatest villains. The widowed Duchess of Malfi tragically defies her two powerful brothers by secretly marrying her household steward. When they uncover her deception, the brothers plot a series of horrific events that leads them all to destruction in this dark tapestry of sibling rivalry, forbidden love, unquenchable ambition, and ensuing madness.

Hill & Wood Funeral Service 201 North First Street, Charlottesville 434.296.6148 • HillandWood.com

Locally owned for over 100 years

Twelfth Night through Nov—Writing at the height of his powers, Shakespeare provides a feast of language and songs—and a stage full of memorable characters— from the lovesick Orsino and Viola to the alesick Toby Belch, from the acquiescent Sir Andrew Aguecheek to the pompous Malvolio. Sublime and subversive, Twelfth Night breaks rules and bends gender roles to show love in all its guises and disguises.

King John Oct 6-Nov—One of Shakespeare’s most exciting plays, King John continues the thrilling story of The Lion in Winter. John, now king, continues his family’s outrageous game of capture the crown. Mad world. Mad kings. Madly entertaining. Don’t miss this rare chance to see King John and The Lion in Winter performed in repertory with actors playing the same characters who appear in each.

Blackfriars Playhouse 10 South Market Street Staunton 540-885-5588 www.americanshakespearecenter.com

Jefferson Center Cashore Marionettes Oct 14—The Cashore Marionettes bring art to life in an unforgettable theatrical experience that pays tribute to the richness of the human spirit.

Through a combination of virtuoso manipulation, beautiful music, theatrical illusion, and poetic insight, Joseph Cashore creates an intricate and compelling spectacle— sometimes comic, sometimes nostalgic, always fascinating—that will enrapture the entire family. Each one of the marionettes is not only an artistic and engineering 52

ALBEMARLE

masterpiece, but also a poignant reminder of what it means to be alive.

circumstances they may just discover they truly need each other.

Hanover Tavern

Esperanza Spalding: Radio Music Society Oct 23—The 2011 Grammy Awards’ Best New Artist showcases her breathtaking voice, eclectic music, and a stage presence as bright as the Mill Mountain Star, as well as a new series of tunes that infuse Jazz and Pop into one incredible experience.

The Sunset Limited Oct 3-7—The brilliantly articulated story involves two strangers and their struggle over the meaning and value of life. Death seems to be the desired escape for one, while a life filled with hope and faith provides meaning for the other. Hope and despair clash in a battle that strikes both men to the core of their existence. Opposing beliefs and rich dialogue unfold in this intense, gripping and thought-provoking story.

A Lug Nuts Christmas Nov 23—In the mid-1960s, the Lug Nuts were all the rage. Five teenage grease monkeys formed an a cappella group and doo-wopped their way into the hearts of Mechanicsville. After a slight misunderstanding involving homecoming princess Betty Lou Alsop, the guys went their separate ways.

Now, in 1991, the leaders of Barksdale Theatre have decided to celebrate the 200th anniversary of Hanover Tavern by inviting the Lug Nuts to join voices once again for a holiday reunion concert.

And Merrily Goodall, the new music teacher at Hanover County Public Schools, has agreed to whip the “boys” back into shape. Great guys, great music, and a hub cap full of holiday fun!

Jefferson Center Shaftman Performance Hall 541 Luck Avenue, Suite 221, Roanoke 540-345-2550, 866-345-2550 www.jeffcenter.org

Olin Hall Theater, Roanoke College Anthology: 25 Years with Anonymous 4 Oct 2 The New Yorkers Company Oct 5 RC Wind Ensemble with Blacksburg Community Band Oct 11 The 25th Annual Putnam County Spelling Bee Nov 9, 10 Roanoke College Choir: Lessons and Carols XXVIII Nov 25 Olin Hall Theater 221 College Lane Roanoke College, Salem 540-375-2333 www.roanoke.edu

Barter Theatre Zombie Prom Oct 2-Nov 10—What’s a pretty senior to do when her rebel-withouta-cause boyfriend drives his motorcycle into an atomic power plant, only to come back as an oozing zombie hell-bent on winning her back? With supercharged doses of Little Shop of Horrors and Grease, this girl-meets-ghoul musical explodes with exciting mutations of doo-wop, teen ballads, and rock music to release a radioactive, feel-good glow upon the entire nuclear family!

Tarzan the Stage Musical Oct 2-Nov 17— Based on the original story, Tarzan of the Apes, this award-winning musical captures Tarzan’s adventures from the shipwreck that stranded him on the shores of Africa, leading him to be brought up by she-ape Kala to his unlikely love story with beautiful explorer Jane Porter.

October, Before I Was Born Oct 2-Nov 17— This suspenseful story follows a Kingsport family stranded at their rural farm, desperate for news regarding their loved ones after the October 1960 Tennessee Eastman Company explosion. Amid the ALBEMARLE

Miss Nelson Is Missing Oct 3-Nov 12—At Horace Smedley Elementary School the kids of Room 207 are famous...for being bad. Despite the best efforts of their kind teacher, Miss Nelson, these fifth graders wreak havoc each day in the classroom.

Spitballs fly, paper airplanes soar, and no one has done their homework in weeks.

After one particularly bad day, Miss Nelson simply does not return to school. In her places, comes a substitute teacher who would make a crocodile look cuddly: the nefarious Viola Swamp. She is dressed like a witch and gives so much homework the students are certain they will die. Finally the kids of 207 decide to take matters into their own hands by hiring a detective to find their dear Miss Nelson, and FAST! An Evening with Bill Cosby Oct 4—One of America’s most beloved comedians of all time, Bill Cosby has captivated generations of fans with his comedy routines, iconic albums and best selling books, such as Fatherhood. His comedy transcends age, gender, and cultural barriers and he’s coming to Barter Theatre for a very special evening.

The Wind Farmer Oct 11-Nov 11—Ramona has been chained to the family farm her entire life, and her controlling father forbids her to leave. Her only chance for freedom lies in the hands of a rookie wind developer, Leo, who is stranded at their doorstep. An alliance forms as Leo realizes a green opportunity and Ramona sees a doorway to freedom. Making either dream a reality will take convincing Ramona’s father that the only way to keep what he holds dear is to let something go. Will the fate of Leo and Ramona, and possibly the world, hang in the balance of a dead man’s signature?

Barter Theatre 127 West Main Street, Abingdon 276-628-3991 www.bartertheatre.com

Hanover Tavern 13181 Hanover Courthouse Road Hanover 804-282-2620 www.va-rep.org

Theatre Gym The Pillowman Oct 19-Nov 10—With echoes of Stoppard, Kafka, and the Brothers Grimm, McDonagh’s dark comedy, The Pillowman centers on a writer in an unnamed totalitarian state who is being interrogated about the content of his short stories. The result is an urgent work of theatrical bravura and an unflinching examination of the very nature and purpose of art.

Theatre Gym at Virginia Repertory Center 114 West Broad Street Richmond 804-282-2620 www.va-rep.org

Richmond Ballet Duo Concertant Nov 1-11—Duo Concertant exemplifies the interaction between the choreographer and composer: the dancers per form on stage with the musicians, at times pausing to listen to the music between intricate passages in which their movements mirror the music and each other.

Richmond Ballet 407 East Canal Street Richmond 804-344-0906 www.richmondballet.com

53

U V A H E A LT H Dr. James Bergin

What has been your proudest moment as a doctor?

‘I always wanted to be a doctor’ For Dr. James Bergin, working in healthcare was practically preordained. His father was a doctor, while his mother and two older sisters were both nurses. Asked what he would have chosen for a career if he hadn’t become a doctor, Bergin said: “I thought about this and I have no idea. It seems that to me that I always wanted to be a doctor.”

A cardiologist, Bergin has lived out his lifelong goal to be a doctor for the past 25 years at the University of Virginia Health System, where he serves as medical director for the heart failure and heart transplant programs and the Coronary Care Unit.

Why did you choose to work at UVA? My wife is from Texas and she drew a line that extended from about Washington, D.C., to San Francisco and said we could not go north of that. My mentor during my residency at the Texas Medical Center suggested UVA. When I interviewed here, I thought the place was beautiful and the people I interviewed with (George Beller and Lockhart McGuire) were great.

What is the most rewarding part of your job?

I see a lot of very sick patients in the hospital and clinic and it is very rewarding when they come back in and talk to me about how much better they feel. I think it is great when they tell me about how they have been able to be with their spouse or children, or be at a graduation or wedding or something special that they would not have been able to do otherwise.

WHEN AND HOW SHOULD WOMEN GET SCREENED FOR BREAST CANCER?

What do you enjoy most about working at UVA? The high quality of care that is provided, the people I work with, and the teaching environment.

What’s your favorite food in the UVA cafeteria?

The peanut butter protein smoothie.

What is one thing you do outside of work that you really enjoy?

I have enjoyed the time with my family. I have a very special and very tolerant wife who has put up with my hours and two great kids who have grown up here.

Is there a cause or volunteer effort you are involved in that you would like people to know more about?

I like supporting the American Heart Association, World Vision and the American Red Cross.

What do you do for relaxation or fun?

I ride my bike out in the countryside for exercise, which also fits my definition of fun. Relaxation is usually reading or watching sports on TV. To learn more about treatments for heart failure patients available at UVA Health System, visit uvahealth.com/services/heart-failure. To learn more about UVA Heart Center, visit uvahealth.com/heart.

breast cancer due to a known or suspected gene mutation (BRCA 1 or 2) that increases the risk of cancer.

Changing ‘one-size-fits-all’ recommendations

By Dr. Jennifer Harvey According to the American Cancer Society, about 1 in 8 women in the U.S. will develop breast cancer at some point in their lives. When detected early, breast cancer can be effectively treated. The good news is that the current approach to breast cancer screening works. Certainly, fewer women are dying of this disease than 20 years ago – but we can do better.

Some women may benefit from more frequent screenings using different techniques, while other women could possibly be screened less frequently. I am leading a team of researchers at the University of Virginia Health System who are working to create a new model to determine how often women should be screened for breast cancer.

Here’s a look at the current recommendations for when women should have mammograms, as well as more information on our research at UVA on breast cancer screening.

Today’s mammogram recommendations Screening mammograms are recommended for women every year beginning at age 40. Annual screenings reduce the risk of death from breast cancer by approximately 30 percent. Having a mammogram every other year is not as effective, and reduces the benefit of mammography by approximately 15 percent. At UVA, we also recommend a screening breast MRI with mammography for women that are at higher risk for 54

There have been several that I recall. I thought being at the wedding of someone we started caring for as a child with heart failure, who had grown to be an adult and now has their own family was one. I think being recognized by my peers for work I have done has been another.

Right now, we are unable to accurately predict which women may benefit from more frequent screening for breast cancer, and which women can safely have less-frequent screenings. Some women, especially those with a family history of breast or ovarian cancer and dense breast tissue, would likely benefit from additional screening tools such as breast ultrasound or breast MRI. Breast density, identified by the whiteness of the tissue on the mammogram, increases breast cancer risk but has so far not been accounted for in making screening recommendations.

On the other hand, there are probably many women that are at low risk for breast cancer and can probably be screened less frequently than every year. We need to develop a smarter approach to breast cancer screening that personalizes recommendations for screening based on all of a woman’s risk factors.

The UVA Mammography Project The UVA Mammography Project aims to build a screening model that will include breast density to help women make decisions about the frequency and type of breast cancer screening they need for breast cancer based on their personal risk factors. This $5.5 million study is funded by the Congressionally Directed Mandated Research Program and is administrated by the Department of Defense. For more information about participating in a clinical trial that is part of the project, contact Kathy Repich at 434.243.4543 or klr3b@virginia.edu or visit uvahealth.com/ services/cancer-center/conditions-treatments/mammography-project.

Dr. Jennifer Harvey is a board-certified radiologist, head of the Division of Breast Imaging and Co-Director of the Breast Care Center at UVA Health System. For more information about cancer care at UVA, visit uvahealth.com/cancer.

advertorial

ALBEMARLE

HORSE COUNTRY

MONTPELIER HUNT RACES Montpelier Hunt Races Nov 3—World-class, exhilarating steeplechase racing, as well as Jack Russell Terrier races and flat track races. New driving exhibition for the 2012 race--four horses moving in tandem to execute difficult maneuvers. Come in your finest steeplechase fashions and participate in the second annual Hat Contest. Gates open 9 am, terrier races begin at 10:30am, first post is 12:30pm, and last post is at approximately 4:30pm. $. 11407 Constitution Highway, Montpelier Station. 540-672-0014. www. montpelierraces.org

2012 Original Painting by Clarice Smith for Montpelier Hunt Races. See more of her work at www.claricesmith.com

EQUINE EVENTS, LECTURES, AND ACTIVITIES National Sporting Library and Museum Bob Kuhn: Drawing on Instinct opens Oct 12—Bob Kuhn: Drawing on Instinct, is a traveling exhibition organized by the National Museum of Wildlife Art in Jackson Hole, Wyoming. Drawing on Instinct focuses on a selection of masterpieces from Kuhn’s oeuvre and, with equal prominence, the preparatory sketches created by the artist.

A life-long student of drawing, the late, great wildlife artist Bob Kuhn left behind more than 5,000 studies in his studio after his death in 2007. The exhibition is accompanied by a book edited by Adam Harris, also entitled Bob Kuhn: Drawing on Instinct and published by the University of Oklahoma Press. This exhibition is generously presented by Karen and Tim Hixon.

National Sporting Library and Museum, Middleburg. 540-687-6542. www.nsl.org.

VHCF Equestrienne’s Barn Tour Oct 6—Experience some of the most beautiful, historic, and unique properties of Middlebrook, Lexington, Staunton, and beyond by participating in the Virginia Horse Center Foundation’s Equestriennes’ Fall Barn Tour. Participating barns include Airy Mount, Bill Heizer Stables, Blue ALBEMARLE

Willow Farm, Boxwood Hill, Goose Creek Highlands, Greenwood Farm, Grey Gables, Honeysuckle Farm, Harmony Farm, and Winbrooke Farm. From 10am-4pm the properties will be open for visitation and for special demonstrations. All proceeds will benefit the Virginia Horse Center Foundation’s “Turn Up the Lights” campaign to replace the lighting system in the Anderson Coliseum. 540-348-1152. www. horsecenter.org.

Central Virginia Paint Horse Club Fall Color Classic Futurity Paint-O-Rama Oct 6-7—This classic show features a full line-up of halter and performance classes, plus breeders and open futurity classes. Virginia Horse Center, Lexington. 540-464-2950. www.centralvirginiapainthorseclub.org Therapeutic Riding Association of Virginia Fall Horse Show Oct 6-7—This annual show for riders with disabilities will feature a variety of classes including dressage, equitation, obstacles, pole bending, costume and United Professional Horseman’s Association classes. Lynda McGarry at 540.344.709. www.travinc.org NHS Crystal Crown Judged Pleasure Ride Oct 16—A 10-mile competitive ride over natural and man-made obstacles.

Horse and rider will be judged on ability

to negotiate these obstacles safely, trail manners, general horsemanship, and ability to complete the course within the allotted time. $. Sky Meadows State Park, Delaplane. 703-402-3726. www.nokesvillehorsesociety.com International Gold Cup Races Oct 20—Enjoy a full day of entertainment, including the world famous steeplechase race, terrier races, and a tailgate contest.

Ticket sales support The Great Meadow Foundation. $. Great Meadows Events Center, The Plains. 800-69-RACES or 540347-1215. www.vagoldcup.com 54th Annual Washington International Horse Show Oct 23-28—If you enjoy championship sport and fast-paced entertainment, this event is for you. This show holds the distinction of being the last of the classic, major metropolitan indoor horse shows. $. Verizon Center, Washington, DC. 301-987-9400. www.wihs.org Virginia Horse Trials Nov 1-4—This event is an abbreviated version of a threeday eventing competition that draws hundreds of eventing riders from around the country. Virginia Horse Trials and International CCI* Adult Team Challenge. Virginia Horse Center, Lexington.

540-348-1152. www.vahorsetrials.com

55

The late Mr. Charles T. “Chuck” Hoovler Honored at The Warrenton Horse Show

T

he 113th Annual Warrenton Horse Show, a beloved Labor Day weekend tradition, took place from August 29 to September 2 in Warrenton,Virginia.

The event is organized and run by the Warrenton Horse Show Association, which prides itself on being the oldest continuously operating corporation in the Commonwealth of Virginia, is the fifth largest equine state in the country.

The show, which is now a Virginia mainstay, was founded in 1899 by several native Warrenton horsemen, when Warrenton was considered to be one of the centers of equine breeding and show hunting. It has been a spectator favorite since its establishment. The Warrenton

Wilma Hoovler in the new judges' stand with daughters (from left) Cynthia Hair, Karen Crane and Shelley Payne, just after unveiling the plaque Monday evening.

Equine Extravaganza at the Richmond International Raceway November 2-4 600 East Laburnum Avenue, Richmond The 2012 Equine Extravaganza, to be held at the Richmond International Raceway November 2-4, 2012, will feature an expansive and exciting array of exhibitions and attractions, shows clinicians, and sponsors.

The Extravaganza will feature the Equestrian College Fair, a dedicated exhibit and informational program for colleges and universities with equestrian offerings, including equine majors and minors and intercollegiate competitive equestrian teams. While Equine Extravaganza, now in its eighth year, has always had a college section, the Equestrian College Fair formalizes their dedication and substantial commitment to this exciting 56

Horse Show Association works to uphold the deep sense of tradition that the show represents as a monument to horse showing and breeding, and serve the interests of Virginia’s equine enthusiasts, of which there are many. Virginia is home to almost 200,000 horses, and the equine industry contributes over $1.2 billion to the Commonwealth’s economy.

This year’s show season included a special memorial for Mr. Charles T. “Chuck” Hoovler. Hoovler, who passed away in September of 2011, served the show as a volunteer ringmaster for decades, earning the title of “Ringmaster Extraordinaire.”

Two days before the show’s opening, a gathering of about 80 individuals, includ-

ing members of the Hoovler family and the president of the Warrenton Horse Show Association, came together to honor Hoovler’s memory and dedicate the judge’s stand in his name. He also devoted his talents to other horse shows, including the Warrenton Pony Show, the Upperville Colt & Horse Show, and the Virginia Gold Cup. Because of the Warrenton Horse Show’s exceptional equine showcasing, the quality of the competition, and its philanthropic generosity, it earned the designation of a United States Equestrian Federation Heritage Competition in August. In all, the 2012 Warrenton Horse Show was a huge success, filled with enjoyable events for equine enthusiasts from all over the country.

Friends and family members listen as Warrenton Horse Show Manager Tommy Lee Jones recalls decades of work and fun with the late Charles T. “Chuck” Hoovler of The Plains, the "ringmaster extraordinaire."

program. The fair will be an interactive opportunity for prospective students and their families to learn about a wide variety of educational initiatives for equestrian students. Additional Information will be available concerning careers in the equine industry, resumé building, pre-vet and veterinary programs, college application and financial aid processes, and recruitment videos.

The “Rags-to-Riches” Horse Rescue Talent Search is the newest component of Equine Extravaganza’s Horse Rescue Initiative, a program in its third year at the Extravaganza, which promotes horse rescues and showcases horses available for adoption. The First Annual Rags-to-Riches Talent Search will feature rescued super stars and their come-back journey, giving the selected rescuers and their rescued steeds the chance to share their story and strut their stuff for Equine Extravaganza fans, both online and at the event. The live competition will begin with a presentation of the horse’s rescue or adoption story, and a talent competition.

Other events at the Extravaganza will

Tommy Lee Jones and Helen Wiley.

Photos by Lawrence Emerson/FauquierNow.com

include the Breed Pageant & Stallion Showcase, Andalusians, Pura Raza Espanolas, Fresians, Rocky Mountain Horses, Tennessee Walking Horses, Gypsy Vanners, Paso Finos and more, as well as the BLM Mustang Adoption, the Trail Blazers Competitive Trail Challenge, a kids corral with plenty of activities, and exhibitions of Virginia food and wines. It is bound to be a good time for all!

Equine Extravaganza®, a production of Maryland-based Moonlark, Inc., is a comprehensive, all-breed, all-discipline horse (and dog) expo, and is one of the largest of its kind on the East Coast.

Friday 10:00am – 7:00pm Saturday 9:00am– 7:00pm Sunday 9:00am* – 5:00pm *Breakfast with the clinicians begins at 9am, exhibit halls will open at 10am.

Visit www.equineextravaganza.com for more details, and to register for certain events and exhibitions.

ALBEMARLE

Country Living in Virginia frank hardy

Edgewood Farm, c. 1852 Near Somerset. This historic manor home has been meticulously renovated and LPSURYHG 'HSHQGHQFLHV LQFOXGH QHZ JXHVW TXDUWHUV RIÂżFH JDUDJH FRPSOH[ QHZ pool, gardens and farm managerâ&#x20AC;&#x2122;s home. The estate is located on 200 gently rolling acres with a mile of frontage on the Rapidan River The majority of the land is open in pastures, hay meadows and fenced paddocks ideal for horses. There is also a newly constructed equestrian center. Frank Hardy (434) 296 - 0134

5LYHUVBend

On the James River and historic Kanawha Canal - Jeffersonian Palladian designed home. Features include hand painted muraled walls, octagonal 3rd floor observatory and solarium spanning 2 floors. 35 acre horse property with park like setting and pool. Includes multiple private islands on the ULYHU PLQXWHV WR 5LFKPRQG $QQ +D\ +DUG\

(GJHV $ ERDUG DQG EDWWHQ FXVWRP KRPH GHVLJQHG DQG EXLOW XVLQJ 0RXQWDLQ OXPEHUÂśV 100 yr-old cypress wood, 5,700s.f., 4 bedrooms 4.5 baths on 21 acres overlooking a DFUH ODNH DQG WKH %OXH 5LGJH 0RXQWDLQV &RSSHU URRÂżQJ WHUUDFHV SRUFKHV fenced gardens, car barn and shop, meandering wooded trails, open land and beautifully sited. Quality craftsmanship, nothing overlooked. located 15 min.

VRXWKZHVW RI &KDUORWWHVYLOOH DQG 89D 0XUGRFK 0DWKHVRQ

6XQQ\ÂżHOGV, c. 1830 $GMDFHQW WR 0RQWLFHOOR DQG PLQXWHV WR &KDUORWWHVYLOOH +LVWRULFDOO\ VLJQLÂżFDQW home of Thomas Jeffersonâ&#x20AC;&#x2122;s builder. Neighbor to Ash Lawn. Over 11,000 sf with 5 bedrooms. Amenities include a pool, tennis court, and guest house.

Recently reduced. $QQ +D\ +DUG\

Cove Lawn Farm

Eagle Hill

%HDXWLIXOO\ UHVWRUHG KLVWRULF IDUPKRXVH LQ D SLFWXUHVTXH FRXQWU\ VHWWLQJ :LWK RYHU DFUHV WKH SURSHUW\ KDV WKUHH FUHHNV DQG H[SDQVLYH PRXQWDLQ YLHZV LQ DOO GLUHFWLRQV :LWK D UHFHQW FRPSOHWH UHQRYDWLRQ WKH F KRPH IHDWXUHV DOO RI WKH PRGHUQ FRQYHQLHQFHV $SS[ VI IHDWXUHV RI WKH KRPH LQFOXGH SDLQWHG ZRRG Ă&#x20AC;RRUV EHDXWLIXO VHFRQG VWRU\ VXQ URRP FDUYHG ZRRG PDQWOHV DQG FURZQ molding. Guest cottage, separate 1bd apartment, studio, storage sheds and garage VSDFH DOO RQ SURSHUW\ $QQ +D\ +DUG\

202-acres with a 6,500 s.f. French Colonial manor house c. 1969 has 5 bedrooms, 5 full and 2 half baths. The lower level and upper level porches encircle the home with over 2900 s.f. outside living area. A 7-bedroom guest house, 2 EHGURRP FRWWDJH DQG VLQJOH EDUQ HIÂżFLHQF\ DSDUWPHQWV $ IW RYDO SRRO DQG SRRO KRXVH ZLWK IXOO NLWFKHQ FKDQJLQJ URRPV DQG ÂżWQHVV URRP 0LOHV RI WUDLOV wooded and open, with many fenced paddocks and numerous run-in sheds.

Horse facilities once had stalls to accommodate 43 horses. Indoor riding arena, RXWGRRU ULQJ DQG D UHQRYDWHG RIÂżFH DSDUWPHQW 6WDJJHULQJ %OXH 5LGJH 0RXQWDLQ YLHZV RQO\ PLOHV IURP &KDUORWWHVYLOOH 9$ DQG 89$ 0XUGRFK 0DWKHVRQ

FRANK HARDY, INC. REALTORS FARM AND ESTATE BROKERS

3DUN 6W Â&#x2021; &KDUORWWHVYLOOH 9$ www.farmandestate.com ALBEMARLE

57

albemarle magazine

Celebrating Twenty-Five Years.

The people, the places, and the events in Jefferson’s Virginia.

The Cover Collection—October/November issues For 25 years, we here at albemarle magazine have been celebrating what makes autumn great in Jefferson’s Virginia—and there is certainly plenty of reason to celebrate. From pumpkin picking under the gorgeous fall foliage, to the first chill in the breeze at the football stadium, to days spent wine tasting or catching a flick at the Virginia Film Festival, each autumn in Albemarle just seems to outdo the last!

58

ALBEMARLE

To commemorate 25 years of the magazine, we present to you the covers of all of the October/November issues of albemarle.

Thank you for marking this milestone with us. We hope the images of fall in albemarle over the years bring you pleasant memories. If you wish to complete your collection, back issues are available. Make sure to keep up-to-date with all of us here at albemarle by following us on Facebook and Pinterest, too!

ALBEMARLE

59

MAPPING VIRGINIA Bill Wooldridge’s new book explores Virginia’s history though centuries of Maps

By Casey Sweren 60

M

aps and mapmaking were essential components of Colonial America and its rising prominence. Beginning with Jamestown, in 1607, the first permanent English settlement in the New World, maps were a crucial survival tool, presenting the geographical landscape to settlers in a comprehensive, digestible manner. In a new and unpredictable world, maps brought a sense of order through information. Moreover, maps provided a wealth of knowledge beyond geography.

They facilitated trade, promoted land acquisition, endorsed settlements, and both created and reconciled boundary disputes.

Additionally, maps are windows in to the perceptions, attitudes, and

desires of a specific place in time. At the least, colonial mapmakers had aspirations for the usage of their map, and, at the most, had a blatant agenda. Bill Wooldridge, a Graduate of University of Virginia’s School of Law, in an interview on his upcoming book Mapping Virginia, elucidated on mapmakers’ messages: “Geography is the language the mapmaker speaks, not the entire substance of what he is saying.” He further states, “Maps could communicate the celebration of a victory, or the assertion of rights to a territory, or the magnification of the importance of a particular place.”

As explored in Mapping Virginia, Virginia maps, like other colonial maps, featured these characteristics.

ALBEMARLE

Opposite Page.

Browne-Senex - 1685/1719 A reissueof the 1685 Browne map; little has changed on the ground or on the map in the intervening thirty-four years.

Right. de Bry Arrival - 1590 “Such was our arrival in that part of the New World which we call Virginia.”

Below. Miniature Mercator - Hondius 1608 A 1606 prototype map was copied for generations, beginning with this smaller version by Hondius himself.

Images ©2012 by the Rector and Visitors of the University of Virginia; all rights reserved; the maps and the copyrights to their reproduced images are owned by the Virginia Cartographical Society and are reproduced with its permission.

ALBEMARLE

61

62

ALBEMARLE

For example, a 1753 Virginia map

by Albemarle residents Joshua Fry and Peter Jefferson, (Thomas Jefferson’s father), reveals motivated manipulation. The Fry-Jefferson map projected stability, wealth, and prominence beyond truthful representation. Moreover, the detailed appearance represented Virginia as a mature and developed political territory. This is how the mapmakers wanted Virginia to be perceived. The Fry-Jefferson map was how Joshua Fry and Peter Jefferson relayed their hopes for their colony to others and influenced the geographical perception of Virginia for generations to come.

Another significant feature of the Fry-Jefferson map was that Albemarle County was placed at the center, which disrupted a long-held tradition of depicting Virginia as the area surrounding the Chesapeake Bay. In 1780, 27 years after the map’s debut, the capital of Virginia moved inland from Williamsburg to Richmond.

The Fry-Jefferson map captured the changing political and economic atmosphere before it became a physical reality. When asked if the Fry-Jefferson map was a driver in the movement of the capital, Wooldridge responded that the “map may have functioned as a driver by putting the new reality starkly before [the] people’s eyes, but that [viewpoint] is conjectural.” Rather, the map was

de Bry - 1590 Part of America, now called Virginia; rotate the map ninety degrees to the left and the Outer Banks come into view.

ALBEMARLE

63

Coast Survey Chesapeake - 1855 The Coast Survey was the foremost scientific establishment in America and achieved striking accuracy with its system of triangulation.

64

ALBEMARLE

Smith - 1612 Captain John Smith’s decision about which territory to include on this map defined a new Virginian geography.

a reflection of the already changing political and economic focus.

Nonetheless, while Virginian maps were similar to those of other colonies in their purpose and usage, Virginia as a colony was unique for two main reasons. Firstly, the earliest permanent British colony was located in Virginia. Because of its importance as the first, and, at the time, only, North American colony, it was named after Queen Elizabeth, the “Virgin” Queen. The significance of Virginia to Britain was so great that it was referred to as a realm or kingdom of its own. In fact, Elizabeth was referred to as the “Queen of Four Kingdoms”: England, France, Ireland, ALBEMARLE

and Virginia. Secondly, the Virginia territory was expanding rapidly.

From modest beginnings as a small settlement at Jamestown, the colony grew to include much of the the land northwest of Jamestown. By 1753, Virginia’s boundaries could contain all of England, Wales, and Scotland three times over with room to spare.

The conclusion for such an important and vast territory was manifest: Virginia could itself be a powerful, sovereign country.

In many ways, in fact, the story of Virginia is the story of American independence, and Virginia maps capture this narrative. While other colonies share this evolution in

geographic thinking, Wooldridge states that “none of the other [colonies have] a fuller or more beautiful cartographic record than Virginia.” Additionally, Wooldridge describes how the initial maps show “a precarious coastal enclave looking across the Atlantic to Britain,” yet through expansion in population, culture, and autonomy in the days prior to the Revolution, Virginia was, as Wooldridge stated, “visually, a large, rich, and seemingly selfcontained polity.”

Virginia is a crucial facet of colonial America and the road to independence. Its significance as a colony and its expansive size made 65

66

ALBEMARLE

Very Large Boye-Buchholtz 1827/1859. It took ten years and $80,000 (in antebellum dollars) to survey, compile, engrave, and print this mammoth map of Virginia.

ALBEMARLE

67

68

ALBEMARLE

Bachmann Birdâ&#x20AC;&#x2122;s-Eye - 1861 Quasi-pictorial maps, as in this view, became popular as civilians pondered war strategy.

ALBEMARLE

69

70

ALBEMARLE

Fry-Jefferson - 1753/1768 This example of Virginia's most famous map, printed in about 1768, still carries the original 1751 imprint (though the map did not appear until about 1753); most surviving examples have a 1775 imprint. The map was segmented and mounted on linen so it could be folded up and conveniently carried. Joshua Fry and Peter Jefferson give us a picture of Virginia completely different from the Chesapeake-centered version which had prevailed for 150 years (see the Senex map on page 58). The rapid settlement of Piedmont Virginia and interest in the Ohio country, then part of Virginia, explain the new focus. Albemarle County, the home of the mapmakers, lies near the very center of Virginia in this new visualization.

the territory extremely valuable to Britain. When the Fry-Jefferson map refocused the region, Albemarle County became the center of England’s fourth kingdom. It is somewhat ironic that Thomas Jefferson, an Albemarle native and son of the 1753 cartographer, would continue on to write the “Declaration of Independence.” Consequently, Albemarle County played an important role in not only mapping Virginia, but also in mapping Virginia’s history. a

Montanus Southeast - 1671 The map shows more attention to Indians than geography.

mapping virginia From the Age of Exploration to the Civil War

William C. Wooldridge

Bill Wooldridge’s upcoming book Mapping Virginia addresses the

question of what Virginia maps say about Virginia history. More than presenting a history of Virginia’s borders, Wooldridge analyzes and explores each map’s underlying message to uncover a comprehensive and captivating story. Ultimately, Mapping Virginia is a book about Virginia’s evolving identity represented through mapping. For more information please visit www.upress.virginia.edu. For orders: www.upress.virginia.edu/2012/09/11/albemarle-readers-mapping-virginia Mapping Virginia From the Age of Exploration to the Civil War William C. Wooldridge.

Foreword by John T. Casteen III

ALBEMARLE

Mariners’ Museum

D

espite being raised on various Naval Air Stations thanks to his father, a carrier pilot in World War II, William C. Wooldridge, author of the new book Mapping Virginia, has considered Virginia his home since he and his family moved to Lynchburg at the age of 11. A 1965 graduate of Harvard College and 1969 graduate of University of Virginia School of Law, Wooldridge became a Virginia cartography enthusiast after finding a 17th-century Virginia map – the first of many such maps that he would later collect – while serving in the Army JAG in Heidelberg in 1970.

Although he has published various cartographic history and legal articles, as well as a history of government monopolies entitled Uncle Sam the Monopoly Man, he considers himself to have “always been a history buff,” with interests in state, local, and micro history.

In particular, he has focused his historical pursuits on the genealogical history

of the Wooldridge family by annually visiting the LDS Library in Salt Lake City and the British National Archives in Kew, United Kingdom tracing his family’s history back to John Wooldridge, an indentured servant who arrived in Virginia in the 1690s. After retiring from Norfolk Southern, Bill published The Wooldridge Family, a 1231 page compilation of his findings. He has served as the president of both the John Marshall Foundation and the Norfolk Historical Society in addition to serving on the boards of both the public radio station WHRO and the Library of Virginia Foundation. He describes the process of working on Mapping Virginia, and in particular on the chapter about the Revolution in Virginia, as “sheer fun.” Although both Wooldridge and his wife Joyce have ties to the Lynchburg-Roanoke and Norfolk areas, they have resided in Suffolk, Virginia, for the past 17 years.

71

WINE COUNTRY

Veritas Vineyard & Winery - Afton Virginia Photo by Jack Looney www.jacklooney.com

72

ALBEMARLE

is wine month in virginia

C

BY ALEXANDRA PARKER AND MARY C. WINES

ALBEMARLE

onsidering the fact that the Commonwealth is home to over 200 award-winning wineries and vineyards, it’s no surprise that Wine Enthusiast magazine selected Virginia as one of the Top 10 Best Travel Destinations for 2012, or that the state was cited as one of the most favored wine destinations in the country. Although Virginians have made wine for over four centuries, the state wasn’t always the major wine destination of the East Coast. The wine industry was brought to the Americas by Thomas Jefferson, considered by some to be America’s founding wine connoisseur. Our third president made exhaustive attempts to grow European grapes at Monticello, but the vines did not thrive in Virginia soil. Almost 200 years later, Jefferson’s vision came to fruition. The 1970s saw renewed efforts in grape planting, yielding the wineries that established the Virginia wine industry. These groundbreaking vineyards included Barboursville, Oakencroft, Jefferson, Pearmund, and Horton vineyards. By 1996, Virginia had established 46 wineries, and by 2005, the number had grown to 107. Now with over 200 wineries, Virginia’s wine industry is flourishing. Since 2011, wine sales have increased by eleven percent. To celebrate its world-class wineries and vineyards, October has been designated Virginia wine month. This autumn, local vineyards will promote their finest wines with over 30 tastings and events. Virginia wine trails are among the most historically rich and aesthetically pleasing in the country.

Adventure-seeking wine lovers will find kayaking, canoeing, biking, and rafting among the offerings on their wine trail blazing. This fall, join other wine lovers in celebrating Virginia viticulture by taking advantage of special events and exploring the rich variety of vineyards. Bring a picnic lunch or purchase a special cheese at one of the wine shops offering food as well as tastings.

73

For 25 years, albemarle has supported the growth of the Virginia wine industry by keeping readers up to date with developments vis-à-vis Virginia vineyards, wine tastings, and vineyard touring opportunities on a bimonthly basis.

From Charlottesville, whether you travel north, south, east, or west, you’ll very likely encounter a Virginia winery, with the vast majority dotting the landscape parallel to and within 40 miles east of Interstate 81 and with notable clusters just outside of Charlottesville, Front Royal, and Leesburg. In October, if you are looking for a unique experience for out-of-town guests, consider taking a day trip to a nearby winery to walk the vineyards, sample their offerings, and spend a memorable afternoon enjoying the color of the hillsides, the crisp fall air, and the clear blue skies that make autumn in Virginia such a special time of year.

Afton Mountain Vineyards - Afton Virginia Photo by Deb Snelson www.debsnelsonphotography.com

Virginia Wine Regions Blue Ridge Interstate 81 bisects the Blue Ridge Wine Region, which runs south of Roanoke to the North Carolina border. You’ll find the meandering Appalachian Trail to the west and the scenic Blue Ridge Parkway to the east, and plenty of fun things to do in between, from boating on expansive Smith Mountain Lake to taking in a play at Barter Theater in Abington. The Old Fiddler’s Convention in Galax is a must-attend in early August as are fall football games at Virginia Tech in Blacksburg. The windy and picturesque mountainsides of southwest Virginia are home to a number of well-established wineries thanks to loamy and gravelly soil with good drainage at ideal elevations. Any of a large number of fine white and red wines can be tasted and purchased at Blue Ridge wineries. Of the whites, selections include Pinot Grigio, Petit Manseng, Saugivnon Blanc, Traminette, Vidal Blanc and Viognier; and of the reds, Cabernet Franc, Cabernet Sauvignon, Chambourcin, Merlot and Pinot Noir.

Central Virginia No wonder Thomas Jefferson started making wine at his home Monticello in the 1770s. The eastern slopes of the Blue Ridge and the rolling countryside to the east offer excellent topography, fertile granitebased clay soil and a growing season of over 200 days. This combination yields grapes with a rich and multilayered old world flavor. You’ll find numerous wineries clustered around Charlottesville and to its north, several south of Lynchburg, and a few east and closer to Richmond. You’ll also find plenty to see and do year-round. The Richmond and Petersburg areas offer Civil War battlefields and cultural attractions; Charlottesville boasts the University 74

From the rolling mountains in the state’s west to the low-lying beaches on its eastern coast, Virginia is characterized by its geographic and topographic variety. This variety is perhaps best exemplified by Virginia wine, which acquires unique taste and body from the conditions in its region of origin. Each of Virginia’s nine geographic regions produces spectacular wines of almost every type and varietal, and many are home to officially designated AVAs. No matter which one you visit, take some time to explore Virginia’s rich culture and history in addition to its great wine. of Virginia and a captivating downtown pedestrian mall; Wintergreen is a destination for hiking, golf, and skiing; and Lynchburg is home to four colleges and the launch site for the annual Batteaux Festival, where crews dressed in period clothing navigate their flat-bottom boats down the James River to Richmond. Central Virginia wineries produce Cabernet Franc, Cabernet Sauvignon, Chambourcin, Chardonnay, Gewurztraminer, Malbec, Merlot, Muscat Canelli, Muscat of Alexandria, Norton, Orange Muscat, Petit Manseng, Petit Verdot, Pinot Gris, Pinot Noir, Riesling, Rkatsiteli, Sauvignon Blanc, Seyval Blanc, Syrah, Tannat, Touriga Nacional, Traminette, Vidal Blanc, Viognier and Zinfandel.

Chesapeake Bay This historic Tidewater region of the Northern Neck and Middle Peninsula falls between the Potomac and York rivers, with the Chesapeake Bay to the east. Here in the winter of 1607-08, Captain John Smith was made a prisoner of the Powhatans. Here were born three presidents—George Washington, James Madison and James Monroe—two signers of the Declaration of Independence and Confederate general Robert E. Lee. Here you’ll discover charming small towns that date to colonial times, thousands of miles of shoreline, local museums, the Urbanna Oyster Festival and the Tides Inn Resort in Irvington. The land of these peninsulas provides sandy loam soil and a temperate climate year round. Many wineries call this area home. Awaiting discovery by your taste buds are such Chesapeake Bay varietals as Cabernet Franc, Cabernet Sauvignon, Chambourcin, Chardonnay, Merlot, Petit Verdot, Pinot Grigio, Seyval Blanc, Syrah, and Vidal Blanc.

Eastern Virginia Virginia’s scenic Eastern Shore is an enchanting peninsula of family farms, small towns, waterside villages, and hundreds of miles of pristine shoreline between the Atlantic Ocean and Chesapeake Bay. The area is famous for its Chincoteague ponies, which run wild by the sea on a barrier island, except during one annual roundup. On a 1608 voyage to explore the Eastern Shore, Captain John Smith said that “... Heaven and earth never agreed better to frame a place for man’s habitation.” Today, beach-lovers, eco-tourists, fishing enthusiasts, boaters, and local residents still agree with that sentiment. So do wine lovers, who began visiting in the early 1980s soon after the birth of the wine industry here, thanks to the moderate, maritime climate and long growing season. This area’s three wineries produce a good selection of varietals, including Chardonnay, Merlot, Cabernet Franc, Cabernet Sauvignon, and Petit Verdot.

Hampton Roads Historic Jamestown, Colonial Williamsburg, Yorktown, and the first battle between two ironclads, the Monitor and CSS Virginia—the names alone tell the rich and enduring history of this area that attracts millions of visitors every year. The names of modern attractions lure them, too: Busch Gardens, Water Country USA, The Mariners Museum, Newport News Shipbuilding, and the cities of Norfolk and Virginia Beach. Here you’ll find the nation’s second oldest institution of higher learning, the College of William and Mary, as well as nearby Christopher Newport and Old Dominion universities. And among ALBEMARLE

Virginia’s five distinct climate regions The Tidewater, Piedmont, Northern Virginia, Western Mountain, and Southwestern Mountain regions provide a temperate climate that’s not too hot or cold for extended periods.

Virginia’s varying weather patterns see the mountainous southwest and Shenandoah Valley average a 160-day growing season, and east of the Blue Ridge, an average of 200 days.

WHITES

REDS

Chardonnay Viognier Vidal Blanc Sauvignon Blanc Riesling Petit Manseng Seyval Blanc

Cabernet Sauvignon Merlot Cabernet Franc Norton Petit Verdot Chambourcin

the many interesting things to see and do, be sure to include visits to wineries on the Lower Peninsula. The year-round temperate climate and fertile soil provide ideal conditions for a variety of grapes and the varietals they produce.

Among the wines found here are such popular choices as Cabernet Franc, Cabernet Sauvignon, Chardonnay, Merlot, Seyval Blanc, Vidal Blanc, and the Norton grape, which is native to Virginia. Blends and dessert wines are also available.

Heart of Appalachia The western tip of Virginia offers the visitor a mountainous and rolling countryside with a distinct rural charm.

Here you’ll find verdant woodland broken by fertile farmland and lush orchards. Small towns, antique shops, local eateries, and friendly residents characterize this area’s appeal. Two National Wilderness Areas, which offer numerous hiking and mountain biking trails, draw outdoors types during spring and summer months. The temperate year-round climate and rocky slopes provide ideal grape growing topography and thus a good number of varietals can be grown here—and they are. For your tasting pleasure, you’ll find Cabernet Franc, Cabernet Sauvignon, Norton, Chambourcin, Villard Blanc, Viognier, Tinta Cão, and Traminette, plus fruit wines made from the produce of local growers.

Northern Virginia Visitors to Northern Virginia see entertaining and historic destinations in every direction, from George Washington’s Mount Vernon and the National Air and Space Museum near Dulles to Wolf Trap National Park for the Performing Arts and Arlington National ALBEMARLE

FUN FACTS There are seven main white grapes and six main red grapes grown in Virginia. Chardonnay is the most planted white varietal in Virginia; Cabernet Franc is the most planted red.

According to the Virginia Wine Board, the state ranks fifth in the country in wine grape production, and produces more than 500,000 cases of wine per year. Other top-producing states include California, Washington, Oregon, and New York.

There is more technology used in the Virginia Wine Industry than in any other state’s industry.

The grapes wining the highest accolades in Virginia are straight Viognier (whites), straight Cabernet Franc, and Meritage blends. Other newer varieties include Petit Manseng, straight Petit Verdot, and straight Malbec.

“Meritage” is a Bordeaux-style blend (a similar combination of grapes as those used in Bordeaux, France) of any of the following five grapes: Merlot, Cabernet Sauvignon, Cabernet Franc, Malbec, or Petit Verdot.

At the 1873 Vienna World’s Fair, wine made from the native Virginian Norton grape earned the highest wine award, beating out wines from around the world.

Virginia is one of very few states in which you can kayak to a winery.

Cemetery. Civil War history is prevalent too, with Harper’s Ferry National Historical Park, Manassas National Battlefield Park, and the Fredericksburg & Spotsylvania National Military Park being the most notable. Virginia’s oldest juried crafts fair is an annual event in the historic landmark village of Waterford. The Skyline Drive and Appalachian Trail are both nearby. And across the Northern Virginia area, you’ll discover a large number of wineries thanks to relative elevations that offer perfect sites for grape vines. The rolling landscape, with its rich soils from eons of granite and sandstone erosion, gives good air and drainage for wine grapes. Add the moderate winters and a generous growing season and the result is very productive ground for winemaking grapes. Northern Virginia wineries produce fine examples of every wine Virginia offers, including Cabernet Franc, Cabernet Sauvignon, Chambourcin, Chardonnay, Mandolin, Merlot, Norton, Petit Verdot, Riesling, Sauvignon Blanc, Seyval, Vidal Blanc, Traminette and Zinfandel as well as many fruit wines.

Shenandoah Valley A short drive from the D.C. area, this breathtaking valley with its rolling landscape of pastures and historic towns, stretches from the Maryland state line to just south of the city of Roanoke. College towns abound.

Attractions include numerous small museums, Luray Caverns, Natural Bridge, and the Woodrow Wilson Presidential Library and Museum. You can see Shakespeare plays year-round at the Blackfriars Playhouse in Staunton and take in the early fall Apple Harvest Festival in Winchester.

Visits to wineries here make an especially fun

travel destination; and at no time is this truer than during the fall when the leaves turn to dazzling reds, oranges and yellows. The Valley’s rocky, fertile soil and warm, relatively dry growing season lend themselves to nearly every varietal, including Cabernet Franc, Cabernet Sauvignon, Chambourcin, Chardonnay, Mandolin, Merlot, Norton, Petit Verdot, Riesling, Sauvignon Blanc, Seyval, Vidal Blanc, Traminette and Zinfandel as well as many fruit wines.

Southern Virginia Running across the middle of Virginia’s border with North Carolina, this mostly rural and rolling landscape of farms and woodland takes visitors into the south-side Virginia version of small-town America. It’s an area rich in Revolutionary War and Civil War history and Civil Rights heritage. You’ll find walking tours and small local museums in town after town – and gracious Southern hospitality throughout. Kerr Lake (also known as Buggs Island Lake) is Virginia’s largest fresh water lake. Near Clarksville is Prestwould, the eighteenth century plantation home of Sir Peyton Skipwith. In Danville you can visit Langhorne House, the home of Lady Astor, and further west, Martinsville is home to a historic district and a NASCAR speedway. Southern Virginia has a warm to temperate climate with good soil for winemaking in selected areas. In this area of Virginia along the North Carolina border, Cabernet Franc, Cabernet Sauvignon, Chardonnay, Merlot, Syrah, Pinot Grigio, and Vidal Blanc are the varietals you’ll find along with a few wines made from and other fruits native to the area.

Information Provided by Virginia Wine Board Marketing Office www.virginiawine.org 75

Destination Virginia

Wine Trails to Explore Artisanal Wineries of Rappahannock

Chesapeake Bay Wine Trail

The Artisanal Wineries of Rappahannock are located in Central Virginia and feature five wineries. www.artwinerc.com

The Chesapeake Bay Wine Trail in the Chesapeake Bay region highlights six different wineries. www.chesapeakebaywinetrail.com

Bedford County Wine Trail

Colonial Virginia Wine Trail

The Bedford Wine Trail in the Central Virginia region includes five vineyards and wineries. www.bedfordwinetrail.com

The Colonial Virginia Wine Trail features four of Virginia’s best wineries all within a one hour drive. No matter where you start or finish your wine trail adventure, you are sure to enjoy great wines, great food, and lots of fun along the way. www.colonialvirginiawinetrail.com

Blue Ridge Wine Trail The Blue Ridge Wine Trail features five wineries and vineyards in the spectacular mountains all within minutes of the Blue Ridge Parkway. www.blueridgewinetrail.com

Blue Ridge Wine Way The Blue Ridge Wine Way features eight wineries and vineyards in the Northern Virginia region. www.blueridgewineway.com

Blue Ridge “Whiskey Wine Loop” The Blue Ridge “Whiskey Wine Loop” includes six stops to numerous remote “treasures” including Virginia Wineries, a whiskey distillery, eateries, and other interesting featured locations along the way. www.discovershenandoah.com/whiskeywine-loop

Eastern Shore Wine Trail The Eastern Shore of Virginia Wine Trail hosts three wineries located along the Land Between Two Waters. www.esvatourism.org

Explore Nelson Wine Trail Explore Nelson includes ten wineries and vineyards in the Nelson County area. From the corners of the County, the thirty miles of the Blue Ridge Parkway and the James River, wine lovers will find ten award winning wineries with scenic settings and memorable views. www.americaswinetrails.com

Fauquier County Wine Trail Botetourt County Wine Trail The Wine Trail of Botetourt County features three wineries in the Blue Ridge Mountains. www.botetourtwinetrail.com

76

Fauquier County is home to twenty-four wineries and vineyards each with its own unique flavor. www.fauquiertourism.com

ALBEMARLE

Foothills Scenic Wine Trail The Foothills Scenic Wine Trail features two small, family-run wineries in gorgeous mountain settings at the edge of the Shenandoah National Park. www.foothillsscenicwinetrail.com

destination for Virginia wine, craft beer, food, and outdoor recreation lovers. The seven wineries, two breweries, as well as local restaurants and farms. www.nelson151.com

Nelson Wine Trail Heart of Virginia Wine Trail The Heart of Virginia Wine Trail in Central Virginia presents several events throughout the year at four wineries located in the Central region of the state. www.hovawinetrail.com

Jefferson Heritage Trail From Thomas Jefferson’s Monticello to Poplar Forest, his retreat home near Lynchburg, this trail follows the Route 29 corridor south of Charlottesville. This new Wine Trail boasts many wineries, a cidery, brewery, and distillery, along with many fine dining establishments, antique shops and outdoor recreation opportunities. www.jeffersonheritagetrail.com

Loudoun Wine Trail Loudoun’s Wine Trail in Northern Virginia takes you through Virginia’s historic hunt country to 23 wineries. www.visitloudoun.org

Monticello Wine Trail The Monticello Wine Trail leads to 29 wineries from its hub in Charlottesville. www.monticellowinetrail.com

Mountain Road Wine Experience The Mountain Road Wine Experience offers three wineries, a meadery, and cidermaker all near the Blue Ridge Parkway in southwest Virginia. www.mountainroadwineexperience.com

Nelson 151 Located at the base of the Blue Ridge, Nelson 151 is Main Street for the Rockfish Valley.

This northern part of Nelson County is the

Wine lovers will find ten award winning wineries with scenic settings and memorable views. www.nelsoncounty.com/visit/wineriesbrewery

Shenandoah County Wine Trail The Shenandoah County Wine Trail will lead you to four wineries that exemplify why the Valley is famous for growing grapes. www.shenandoahvalley.com

Shenandoah Valley Wine Trail The Shenandoah Valley Wine Trail is an association of six vineyards and wineries. www.svwga.org

Southern Virginia Wine Trail The Southern Virginia Wine Trail is home to nine wineries and vineyards within close proximity to both Virginians and Carolinians alike. www.sovawinetrail.com

Tuskie’s Wine Trail The Tuskie’s Wine Trail offers a user friendly guide to 28 wineries, three wine tasting rooms, five great restaurants, 18 B&B’s, 33 hotels, and three limo services. www.tuskies.com/winetrail

Vintage Piedmont Vintage Piedmont is a select group of premium Virginia wineries that share a passion for providing excellent wine, unique experience, and true value to our customers. Each VP winery brings you the story of excellence in winemaking combined with our shared passion for connecting our local foods to the community and preserving the land for family farming. www.vintagepiedmont.com

Virginia Wine American Viticultural Area’s Virginia’s varying terrain and climate makes it home to six unique American Viticultural Areas (AVAs), or federally designated wine-growing areas. The variations in soil composition and regional weather allow each AVA to produce exceptional wines infused with local and original flavors and tastes.

The Shenandoah Valley AVA This AVA is composed of 12 counties in Virginia and West Virginia, located in the Ridge and Valley region. It is bounded by the Blue Ridge Mountains and the Appalachian Plateau.

The Monticello AVA Home to Thomas Jefferson’s Monticello and the location of many of the founding father’s wine experiments, this AVA is located in the Piedmont region at the foot of the Blue Ridge Mountains.

Virginia’s Eastern Shore AVA Located on the southern end of the Delmarva Peninsula, this AVA benefits from the breezes off of the Atlantic Ocean and the Chesapeake Bay. George Washington Birthplace AVA Home to the nation’s first president, this AVA has produced exemplary wines from each of its five counties.

The North Fork of Roanoke AVA Spanning Roanoke and Montgomery counties, the North Fork AVA sits on the eastern slopes of the Allegheny Mountains.

The Rocky Knob AVA The eastern slopes of the Blue Ridge Mountains are home to this AVA, which lies in Southwestern Virginia around the Blue Ridge Parkway.

Barboursville Vineyard Photo by Jon Golden www.jongolden.com

ALBEMARLE

77

F E AT U R E

TWENTY FIVE YEARS OF THE VIRGINIA FILM FESTIVAL

78

ALBEMARLE

T

he exact dates for this year’s Virginia Film Festival are November 1-4, but everyone knows that early November is movie time in central Virginia. It was twenty-five years ago that Virginia Governor Gerald Baliles and local power couple John and Patricia Kluge approached University of Virginia president Robert O’Neil with an idea for celebrating great American films and promoting the Commonwealth as a setting for more.

Serving as a state legislator in the 1970s, Baliles had read about a film shot in Hampton Roads that “had left forty percent of its budget to the locality,” and introduced legislation that created the Virginia Film Office. As governor, Baliles remembers today, “I noted the emergence of the Sundance and Cannes festivals and was impressed with the opportunities to promote Vir-

ginia in such a setting. It seemed to me to be appropriate to fashion an economic development initiative that would provide assistance and guidance to film directors and producers.”

And so in consultation with industry insiders including Nelson County’s Earl Hamner, Jr., writer and producer of the TV hit, The Waltons, the “Virginia Festival of American Film” was born.

Billed as “a Virginia Homecoming,” that first festival celebrated the state’s film history and honored film folk with local ties, including Shirley MacLaine, Warren Beatty, and Samuel Goldwyn, Jr. More than just the films themselves, Baliles says, what really impressed was the star power and scholarship, the “conversations with the major players” that took place in post-screening panels and the chance to mingle with those same players at the gala. “There

was a lot of glamour and dash,” Baliles says. “I think the participation of the producers, directors, and stars in an academic village really was quite different from what the Commonwealth had experienced in years past.”

“Wildly successful” as both art and economic initiative, the 1988 festival is credited with bringing production of two major films and $6.3 million in spending to the state.

Now presented by UVA’s College and Graduate School of Arts & Sciences, the four-day smorgasbord of panels, parties, and motion pictures has long been regarded as one of the Commonwealth’s choicest cultural offerings, and is an annual pilgrimage event for film buffs out of state and overseas. And the pros love it too.

“Filmmakers find the VFF a rare and delightful opportunity to screen and discuss their work with colleagues

An audience including the likes of Gregory Peck and John and Patricia Kluge looks on as Jimmy Stewart is honored at the 2nd annual VA Film Festival.

ALBEMARLE

79

Left: Film critic Roger Ebert is interviewed on Charlottesville’s Downtown Mall during the 15th annual VA Film Festival in 2002.

Below: The inimitable Sydney Poitier attends the 5th annual VA Film Festival in 1992.

and smart appreciative audiences,” says Virginia Film Office director Rita McClenny.

Over the years, the festival has brought Jimmy Stewart, Vanessa Redgrave, Matthew Broderick, and many other screen stars to town, and has honored acclaimed directors Robert Altman, John Sayles, and Arthur Penn.

It has educated its audience with shotby-shot workshops on such classic films as Vertigo, Sunset Boulevard, and The Third Man conducted by venerable film critic Roger Ebert, and has used documentary films as jumping off points for the discussion of events important to the community.

Since Jody Kielbasa came to town as festival director in 2009, he has increased the number of films shown to more than 100 each year, partnered with the Library of Congress to spotlight classics from the National Film Registry Series, and established an ongoing partnership with the University of Virginia Center for Politics to screen socially relevant films for high school students and general audiences. And this year he’s gone back to the well.

“Governor Baliles proposed the idea of a new series that focuses on the American presidency and how it is and has been portrayed in film over the years,” Kielbasa says. “I thought that was simply a fascinating idea. A partnership with the Miller Center of Public Affairs, which Baliles now directs, the series will launch with a showing of All the President’s Men to mark the 40th anniversary of Watergate.” Renowned journalist and Watergate sleuth Bob Woodward will be on hand to discuss the film and the scandal he investigated.

80

Political junkies as well as students of America’s foremost political dynasty can also look forward to Ethel, a documentary about Ethel Kennedy directed by daughter Rory that Kielbasa says “features an incredible segment about Bobby and Ethel’s time in Charlottesville when Bobby attended law school here.”

As always, this year’s fest will draw the patronage and participation of the next generation of film fans and filmmakers.

“Action!” is the festival’s brand new, statewide, high school director’s competition. Seventeen parties have submitted works under five minutes long in the four possible categories: narrative, documentary, animation, and experimental.

Adrenaline Film is a 72-hour competition, first held in 2004, in which teams of three filmmakers write, cast, shoot, edit, and screen a film while the festival takes place.

Young Filmmakers Academy, introduced in 2008, puts teachers and festival staff to work with local elementary and middle school students making short films on a common theme. As many as 400 kids from twelve different

The 25th VIRGINIA FILM FESTIVAL CHARLOTTESVILLE, VIRGINIA November 1-4, 2012

www.vafilm.com 1-800-UVA FEST

schools are expected to take up this year’s theme, “Celebration 25,” picking a subject of their choice and incorporating, in one form or another, the concept of a quarter.

Kids of all ages will revel in the riotous—well, high-spirited—grab bag of free film, food, fun and photography called Family Day. “Over its twenty-five years the Virginia Film Festival has been a good demonstration of how an economic development initiative can coincide with an important medium,” Baliles says today. Rita McClenny agrees, noting that “out-of-town visitors produce a significant impact for the Charlottesville region and the local economy.

Further, the economic impact of film production as a result of the festival participants filming in Virginia is an estimated $60 million.”

As for Kielbasa, “the community’s response to the program has been remarkable,” he says, reflecting on the 24,077 tickets sold last year, and the twenty-seven sold out screenings. “Each year we’ve topped the prior year. What I am particularly proud of is not just the number of sellouts, but the diversity of kinds of films that sold out. What this means to me is that we are continuing to engage our audiences across a wide spectrum of issues and topics—which is exactly what we are trying to do.”

Ken Wilson is a Charlottesville-based writer who loves the arts.

ALBEMARLE

Ancient AncientMasters MastersininModern ModernStyles Styles Chinese Chinese InkInk Paintings Paintings from from the the 16th 16th – 21st – 21st Centuries Centuries Ancient Masters in Modern Styles Ink Paintings from the 16th – 21st Centuries Special Specialexhibitions exhibitions Chinese The TheValley Valleyofofthe theShadow Shadow American American Landscape2 Landscape2 in the in the Time Time of the of the Civil Civil War War Special exhibitions through through December December 1616 The Valley of the Shadow through December 16

American Landscape2 in the Time of the Civil War

Jean JeanHélion Hélion Reality Reality and and Abstraction Abstraction Jean Hélion Reality and Abstraction Making MakingScience ScienceVisible Visible TheThe Photography Photography of Berenice of Berenice Abbott Abbott Making Science Visible The Photography of Berenice Abbott

a a a UV UV M M The The Fralin Fralin UV M The Fralin The TheFralin FralinMuseum MuseumofofArt ArtUniversity UniversityofofVirginia VirginiaArt ArtMuseums Museums The Fralin Museum of Art University of Virginia Art Museums Tuesday Tuesday – Sunday, – Sunday, 12–5 12–5 PM PM . 155 . 155 Rugby Rugby RD RD Charlottesville Charlottesville VA VA . 434.924.3592 . 434.924.3592 www.virginia.edu/artmuseum www.virginia.edu/artmuseum Tuesday – Sunday, 12–5 PM . 155 Rugby RD Charlottesville VA . 434.924.3592 www.virginia.edu/artmuseum UVaMUVaM programming programming mademade possible possible by thebygenerous the generous support support of TheofJoseph The Joseph and Robert and Robert CornellCornell Memorial Memorial Foundation.

Foundation.

Image:Image: Zhao Shao’ang, Zhao Shao’ang, Chinese, Chinese, 1905–1998.

1905–1998.

DetailDetail of Landscape, of Landscape, n.d., Ink n.d., onInk color on on color paper, on paper, 12 x 3312in, x 33 30.48 in, 30.48 x 83.82 x 83.82 cm. Courtesy cm. Courtesy The Lijin TheCollection, Lijin Collection, #147 #147 UVaM programming made possible by the generous support of The Joseph and Robert Cornell Memorial Foundation.

Image: Zhao Shao’ang, Chinese, 1905–1998. Detail of Landscape, n.d., Ink on color on paper, 12 x 33 in, 30.48 x 83.82 cm. Courtesy The Lijin Collection, #147

ALBEMARLE

81

albemarle’sWho’s Who’sWho WhoofofREALTORS Realtors ® albemarle’s albemarle magazine, an affiliate member of the Charlottesville Area Association of REALTORS® (CAAR), is pleased to support our area’s REALTORS® in promoting this beautiful and unique part of the country.

Living in Jefferson’s Virginia offers the best of all possible worlds, from homes and estates, to farms and commercial properties. “Who’s Who of REALTORS® in albemarle magazine” is published twice yearly, appearing in the April/May and October/November issues. To become a member of “Who’s Who” and begin your campaign with the April/May 2013 issue call 434-817-2010 by February 14, 2013.

The Charlottesville Area Association of REALTORS® (CAAR) is a trade association for real estate professionals in the Greater Charlottesville area. The term REALTOR® is a registered collective membership mark that may be used only by real estate professionals who are members of the NATIONAL ASSOCIATION OF REALTORS® and subscribe to its strict Code of Ethics.

Byrd Abbott, ABR, CRS, GRI, SRES Associate Broker Roy Wheeler Realty, Co 1100 Dryden Lane Charlottesville, VA 22901 434-242-9600 or 434-951-5104 byrd@byrdabbott.com; www.byrdabbott.com

Betty Aguilar 434-996-9699; Aguilar.Betty@gmail.com Whether purchasing a home or selling one, Betty will make sure you get the real estate service YOU need and then she’ll give 10% of her commissions to a local charitable cause that NEEDS YOU. WinWinForACause.com

Bridget Archer Gayle Harvey Real Estate, Inc. 434-981-4149; bridgetarcher1@earthlink.net CharlottesvilleCountryEstates.com CharlottesvilleEquestrianProperties.com CharlottesvilleFarmsandEstates.com CharlottesvilleCountryProperties.com

Kelly Ceppa Nest Realty Group www.KellyCeppa.com Kelly@NestRealty.com www.NestRealtyGroup.com

434-981-2506 or 800-325-6378 “Let me be your Guide on the road to home!”

Brian W. Chase The Chase Team - Roy Wheeler Realty Co. 1100 Dryden Lane Charlottesville, VA 22903 434-296-9860 or 877-296-9860 bchase@TheChaseTeam.com www.TheChaseTeam.com 82 82

Pam Dent, SRES, e-PRO, SFR Womens Council of Realtors Montague, Miller & Co. Realtors® Charlottesville, VA 434 960-0161; pam@pamdent.com www.JumpintoGreenerPastures.com

James Friend Dickerson

Homes-Farms-Land 434-466-4663 Certified Investment Specialist, e-PRO Earth Advantage Sustainability Trained www.VirginiaHomesFarmsLand.com

RE/MAX Assured Properties

Judy Drayer Better Homes and Gardens Real Estate III 500 Faulconer Drive Charlottesville, VA 22903 434-984-7419; Mobile 434-981-3904 judydrayer@realestateiii.com www.judysellscharlottesville.com

Anita Dunbar, CRS, SRES, Serving Central Va for 20+ years

www.anitadunbar-realtor.com adunbar@cfw.com 434-951-7135 (Direct); 800-793-5393 ext. 135 Montague, Miller & Company

Alice Nye Fitch, Assoc. Broker, CRS, GRI, ABR Montague, Miller & Co. 500 Westfield Road Charlottesville, VA 22901 434-981-4562 Alice@AliceNyeFitch.com www.AliceNyeFitch.com ALBEMARLE ALBEMARLE

albemarle’sWho’s Who’sWho WhoofofREALTORS Realtors ® albemarle’s Lynn T. Fox

David Hendon, GRI, SRS

Pace Real Estate Associates, LLC 660 Hunters Place, Suite 101 Charlottesville, VA 22911 434-962-1830 lynn@pace-homes.com www.pace-homes.com

126 Garrett Street, Ste D, Charlottesville, VA 434242-3283 or 434-566-0121 David@DavidHendon.com www.DavidHendon.com The Professional to Count On

Bunny French, Real Estate Associate 434-996-1029

Bunnyfre@gmail.com

Loring Woodriff Real Estate Associates 214 West Water Street, Suite 100 Charlottesville, VA 22902 www.loringwoodriff.com

Erin Garcia, REALTOR®, Eco Broker® 434-981-7245

eringarcia@gmail.com www.eringarciarealtor.com www.loringwoodriff.com

Loring Woodriff Real Estate Associates 214 W.Water St, Suite 100, Charlottesville

Virginia Gardner, CRS Roy Wheeler Realty Co. CharlottesvilleHOME.com Phone or Text 434-981-0871 Virginia@CharlottesvilleHOME.com Daily blog at CharlottesvilleTALK.com

Gabrielle Hall ERA Bill May Realty Co. 249 Zan Road Charlottesville, VA 22901 434-293-3766 434 981 0070 (c) gabyhall@comcast.net realestate-charlottesvilleva.com

Terry Hamlett, Associate Broker, GRI Better Homes and Gardens Real Estate III 2271 Seminole Trail Charlottesville, VA 22901 Mobile 434-466-4165 TerryHamlett@realestateiii.com www.realestateiii.com/TerryHamlett

ALBEMARLE

Nest Realty Group

Anne Hughes Better Homes and Gardens Real Estate III 500 Faulconer Drive Charlottesville, VA 22903 434-989-2041 ahughesrealtor@gmail.com www.PracticingTheArt.com

Jim McVay Local Realtor since 1978 Roy Wheeler Realty Company 434-962-3420 jim@jimmcvay.com www.jimmcvay.com

Beth Monaco Loring Woodriff Real Estate Associates 214 West Water Street, Ste 100 Charlottesville, VA 22902 434-242-0798 charlottesvilleproperties@gmail.com www.bethmonaco.com

Suzie Pace Pace Real Estate Associates L.L.C. 660 Hunters Place, Suite 101 Charlottesville, VA 22911 434-981-3385 suzie@pace-homes.com www.pace-homes.com

Courtney Sargeant Roy Wheeler Realty Company 1100 Dryden Lane Charlottesville, VA 22903 434-293-4319, 434-962-3100 cell courtneysargeant7@gmail.com www.roywheeler.com

Sabina Harvey, CRS, GRI, ABR, SRES

Jan Shiflett

Better Homes and Gardens Real Estate III Associate Broker 500 Faulconer Drive Charlottesville, VA 22903 434-981-1147, sabinamharvey@gmail.com

Roy Wheeler Realty Co. 1100 Dryden Lane Charlottesville, VA 434-242-6057 janshiflettsells@yahoo.com

www.bghrealestateiii.com/sabinaharvey

www.janshiflett.com 83 83

albemarle’sWho’s Who’sWho WhoofofREALTORS Realtors ® albemarle’s Edwina St. Rose Montague, Miller & Co REALTORS 245 Ridge-McIntire Road, Ste. 1 Charlottesville, VA, 22903 434-227-4431 or 434-284-0094 strose@montaguemiller.com www.historiccville.com

Betsy Swett, GRI, CRS McLean Faulconer, Inc., Associate Broker 503 Faulconer Dr., Suite 5 Charlottesville, VA 22903 434-249-2922 betswett@gmail.com

Shann Whited, CBR, GRI Montague, Miller & Co. Realtors 500 Westfield Road Charlottesville, VA 22901 434-962-4741 swhited@ntelos.net

John Updike, GRI Roy Wheeler Realty 1100 Dryden Lane Charlottesville, VA 22903 434-951-5174; 434-242-7711 Mobile jbupdike@comcast.net www.jbupdike.com

Melina Vaughan Montague, Miller & Company 245 Ridge-McIntire Road Charlottesville, VA 22903 (434)466-8144 melina@cvillehomesnow.com www.melinavaughan.com

Arleen Yobs, CRS, SRES, Associate Broker Keller Williams Realty Mobile/Text 434-981-4108 Serving the Greater Charlottesville Area for 28 years

www.uniquehomesofcharlottesville.com arleen@uniquehomesofcharlottesville.com President Elect Womens Council of Realtors

Photographer Ed Roseberry

Albemarle County and Charlottesville represent one of our nation’s most exceptional communities.

Endowments, both natural and manmade, are what make this historic area the residence and travel destination of choice for so many people in diverse professions.

The CharlottesvilleAlbemarle region’s natural beauty and mild climate make it a most desirable place to live and visit, to work and 84 84

play. Venues such as the John Paul Jones Arena, The Paramount Theater, and the Historic Downtown Mall give residents and visitors alike the chance to experience a wide range of arts, culture, and dining experiences.

Patients and retirees from all over the state come to Charlottesville for the outstanding health care facilities, such as the UVA Medical Center and Martha Jefferson Hospital. The

town and surrounding county have become identified with the values of Thomas Jefferson. His legacy has helped the area grow and prosper, exemplified through one of the best public universities in the nation, the University of Virginia.

Keep In Touch With albemarle

www.albemarlemagazine.com Find us on Facebook!

ALBEMARLE ALBEMARLE

EVENTS CALENDAR

by Austen Weathersby

October

SUNDAY

MONDAY

TUESDAY

WEDNESDAY

THURSDAY

FRIDAY

SATURDAY

1

2

3

4

5

6

Virginia Longrifle Exhibition

America’s Music

Magnificent Midlothian Food Festival

74th Annual Rose Show

23rd Valor Awards Breakfast and Ceremony

30th Manassas Fall Jubilee

A historic exhibit featuring never-beforeseen rifles crafted in the Shenandoah Valley during the18th and 19th centuries.

Luray Caverns.

Discover the origins of American music by studying the influences or various cultures and instruments. DeWitt Wallace Decorative Arts Museum.

Williamsburg.

A fun-filled day of food, music, and dancing.

Westchester Commons Shopping Center Midlothian.

The Garden Club of Virginia proudly hosts this annual event.

Lewis Ginter Botanical Garden.

Richmond.

Come honor Richmond’s First Responders from Police, Sheriff, Fire, and EMS for their dedication.

Greater Richmond Convention Center.

A rain-or-shine community event that showcases an assortment of live entertainment for both kids and adults.

Old Town Manassas.

7

8

9

10

11

12

13

25th Fall Fiber Festival & Montpelier Sheep Dog Trials

Apple Harvest Festival

Pumpkin Picking and Spookfest

Culpeper Restaurant Week

20th Kiwanis Harbor Party and Seafood Feast

Richmond Folk Festival

A day of cobbler and cider, live music, a cow train, and wagon rides around the farm.

Market-Miller Orchard.

Winchester.

Enjoy pumpkin picking, hayrides, slides, petting farm, moonbounce, and more.

Old Mine Ranch.

Dumfries.

Use this week’s specially priced menu options as an excuse to revisit old favorites or try something new.

Downtown Culpeper.

Dine on fresh seafood, interact with business and political leaders, and take part in a silent auction.

Town Point Park.

Norfolk.

The Virginia Folklife Area explores music and crafts in the Commonweath.

Downtown Richmond.

6th Annual Step Up for Downs Syndrome 5K & Family Festival

Workshops, contests, animal exhibits, sheep dog trials, and demonstrations make this event unique fun.

Montepelier.

A 5K followed by live music, prizes, exhibitors, a fashion show, and the Great DSAGR Pumpkin Patch.

Short Pump Town Center.

14

15

16

17

18

19

20

19th Martha’s Market

Wintergreen Nature Foundation’s Pumpkin Party

President Lincoln’s Cottage Experience

Green Valley Market

28th Shriners Central Virginia Pork Festival

Yorktown Day

10th Powhatan’s Festival of the Grape

Visit Abraham Lincoln’s country home, where multimedia technology brings history to life.

Washington D.C.

Come by for your mid-week, homegrown, fresh-food fix.

Lynchburg Community Farmers’ Market.

Lynchburg.

Dance to upbeat music while taking advantage of the all-you-can-eat barbeque.

Richmond Raceway Complex.

Support women’s health by visiting this unique collection of fundraising boutiques at the John Paul Jones Arena.

This seasonal event features face painting, pumpkin carving, and all manner of Halloween games and crafts.

A parade, fifes and drums, and demonstrations by “The Old Guard” commemorate the 231st anniversary of America’s Revolutionary War victory.

Yorktown Battlefield.

Experience the excellence of 30 Virginia wineries as well as live music and arts and crafts.

Powhatan Courthouse Square.

21

22

23

24

25

26

27

25th Annual AT&T Town Point Virginia Wine Festival

Hoecakes and Hospitality: Cooking With Martha Washington

54th Washington International Horse Show

Cous Cous Karaoke

22nd W.M. Jordan Company Charity Golf Classic

Craftsmen’s Classic Art and Craft Fest

Edible Landscaping’s Persimmon Festival

Experience over 200 of Virginia’s finest wine varieties that encapsulate the flavor and flair of the region.

Town Point Park Norfolk.

28 Halloween Spooktacular Gather for an afternoon of music, costumes, trickor-treating, and a petting zoo for the little ones.

Kennedy Center Washington D.C.

ALBEMARLE

Experience a behindthe-scenes look at the Washingtons’ kitchen at Mount Vernon.

29

A family-freindly show that includes the President’s Cup Grand Prix and the Puissance high-jump competition.

Verizon Center Washington D.C.

Belt it out at the winner of Style Magazine’s “Second Best Place for Karaoke” with Nard’s Professional DJ Service.

Cous Cous Restaurant.

Richmond.

31 Trick or Treat!

Have a Safe & Happy Halloween.

Benefits the Children’s Hospital of the King’s Daughters. Includes lunch and cocktail reception.

Golden Horsehoe Golf Resort.

Willimasburg.

There’s something for everyone’s taste, style, and budget at this fair that celebrates the creativity of local artisans.

Richmond Raceway Complex.

A day dedicated to the delicious persimmon, be it in a dessert or freshly picked.

Edible Landscaping Afton.

E-mail albemarle@cjp.com or send your event listing to albemarle events at 375 Greenbrier Drive, Suite 100, Charlottesville, VA 22901 PLEASE NOTE: All events, times, dates, and locations are subject to change. Please call venues to confirm.

85

EVENTS CALENDAR

November MONDAY

SUNDAY

TUESDAY

WEDNESDAY

E-mail albemarle@cjp.com or send your event listing to albemarle events at 375 Greenbrier Drive, Suite 100, Charlottesville, VA 22901

4

5 Joshua Radin and A Fine Frenzy

Enjoy folk art and a silent auction of gourd art, a variety of vendors, gourd crafting classes.

Richard’s Fruit Market.

Middletown.

From Ohio via New York and California, Joshua Radin is a uniquely word-ofmouth success story.

6

FRIDAY

SATURDAY

1

2

3

Open Conversation: The Art of Practice of Carole Conde & Karl Beveridge

55th Annual Urbanna Oyster Festival

Wildlife Center Annual Gala

Featuring all types of oysters, as well a fireman’s parade, the oyster festival parade, and waterfront activities.

Urbanna.

Support the Wildlife Center of Virginia!

The evening will begin with cocktails and a silent auction.

The Stonewall Jackson Hotel.

Staunton.

7

8

9

10

The Valley of the Shadow Exhibition

Champagne ‘n’ Shopping

Duo Concertant

The 18th Annual Artisans Studio Tour

This exhibition addresses how artists represented the American landscape: a nation that was ruthlessly divided by political tensions.

UVA Art Museum.

The Paramount.

Charlottesville.

THURSDAY

This exhibition explores these artists’ collaborative practice.

Richmond Art Gallery.

Richmond.

PLEASE NOTE: All events, times, dates, and locations are subject to change.

Please call venues to confirm.

Virginia Chord Festival

by Alexandra Parker

A special evening of holiday shopping.

Champagne and sparkling cider; door prizes and live music.

Lewis Botanical Garden.

Richmond.

Choreographer George Balanchine and composer Igor Stravinsky collaborated over six decades to create a new era in music and ballet.

Richmond Ballet.

Artists will make a public showing of their work, including pottery, furniture, fabric, jewelry, stained glass, and more.

Faber.

11

12

14

15

16

17

Veterans Day at Montpelier

ChiP Imagine Awards Dinner

Cymbeline

America Recycles Day

48th Annual Craft and Design Show

Thomas Jefferson Wine Festival

Montpelier salutes all veterans with free admission for those who are serving or have served in the U.S. Armed Forces.

Montpelier Station.

The Imagine Awards will recognize families that have demonstrated determination and courage to provide healthy homes.

UVA Alumni Hall.

A program of Keep America Beautiful, it is a nationally recognized day dedicated to promoting and celebrating recycling!

The show offers visitors three full days to encounter a select group of 70 unforgettable artists.

Science Museum of Virginia.

Richmond.

Join “Mr. Jefferson” for an afternoon on the lawn, featuring Virginia wineries, artisans, food purveyors, and music.

Poplar Forest.

This magical, violent, and beguiling comedy is celebrated for its ravishingly beautiful language and enthralling storytelling.

Blackfriars Playhouse.

Staunton.

18

19

21

23

24

Vinegar Making Wokshop

Christmas at Oatland

Thanksgiving on the Mountain

Dominion Garden Fest of Lights

Mount Vernon By Candelight

Join wine-maker and master chef Gabriele Rausse in reviewing the basic principles of vinegar-making.

Thomas Jefferson Visitor Center.

Monticello.

Enjoy the spirit of the season and view holiday decorations at this historic 17thcentury plantation.

Oatlands Plantation.

Leesburg.

Enjoy a thankful day with traditional feasts, workshops, and a grand illumination of the courtyard.

Wintergreen Resort.

Featuring over half a million lights which focus on this year’s theme, Wings of Wonder. Lewis Ginter Botanical Garden.

Richmond.

“Mrs. Washington” hosts an enchanting evening of candlelit tours, fireside Christmas caroling, and hot cider and ginger cookies Mount Vernon.

86

26

27

28

Celebration of Holiday Lights

Tuesday Evening Concert Series

Dark Star Orchestra

The light display at Gypsy Hill Park is organized by a group of community citizens who each decorate a small area.

Staunton.

Pianist Piotr Anderszewski has received many awards throughout his career, including the prestigious Gilmore award.

Old Cabel Hall. UVa.

Performing worldwide for 13 years, Dark Star Orchestra continues the Grateful Dead concert experience.

Jefferson Theater.

Charlottesville.

30 Make time for your family and friends this holiday season!

Pick Your Own Apples An Apple A Day. Go to the mountains and pick your own Golden Delicious, Empire, Red Delicious, and Jonagold apples.

ALBEMARLE

Albemarle County Established in 1744

by an act of the General Assembly, Albemarle County was named for the second Earl of Albemarle, then Governor General of the colony. Charlottesville, the county seat, is located 70 miles from Richmond, 120 miles from Washington, D.C., and 20 minutes from the Skyline Drive and the Blue Ridge Parkway. The Charlottesville-Albemarle Airport (CHO) offers 60 flights daily. The airport is located eight miles north of the City of Charlottesville, one mile west of Route 29 on Airport Road. When visiting this spectacular region, be sure to take advantage of its many cultural and educational amenities: Monticello, home of Thomas Jefferson; James Monroe’s Ash Lawn-Highland and its renowned Summer Music Festival; the University of Virginia and its associated institutions; and Historic Garden Week in the spring. An outstanding place to vacation all four seasons, Albemarle County offers fine dining, accommodations, scenic landscapes, and many links to our American heritage.

The Peyton Map, dated 1875.

Courtesy Albemarle County Historical Society

There is always something happening in Albemarle, Charlottesville, and the surrounding areas.

Use albemarle’s calendars to make plans to attend area events and activities.

ARTS, CRAFTS, & ANTIQUES Waterford Homes Tour and Craft Fair Oct 5-7—The oldest juried crafts fair in Virginia is held in the National Historic Landmark village of Waterford. Come tour their historic homes and see the 155 juried artisans demonstrate their crafts. Children’s activities, timehonored dance and music, Colonial-era militia encampments, Civil War reenactors, and marching fife and drum corps. $. 10am-5pm. Waterford. 540-8823018. www.waterfordva.org 74th Annual Rose Show Oct 3-4— “The world is a rose…smell it and pass it to your friends,” says a Chinese proverb.

Come celebrate the beauty of life and the rose at the 74th Annual Rose show, hosted by The Boxwood Garden Club of Richmond. Register online. Nonmembers may enter certain horticultural and artistic exhibits. Wed 2-6pm, Thurs ALBEMARLE

9am-1pm. 1800 Lakeside Avenue, Lewis Ginter Botanical Garden, Richmond. 804643-4137.

8th Annual Port Warwick Art & Sculpture Festival Oct 13-14—This is the area’s premier outdoor art festival, featuring the freshest and most original art by more than 100 nationally recognized artists.

Port Warwick. 757-369-3032. www.pwartfest.org Crozet Arts & Crafts Festival Oct 1314—Over 100 art exhibits in pottery, textiles, leather, glass, wood, metal, photography, and art provide an enticing array of beautiful handmade articles for sale. Food, live entertainment, wine tasting, and children’s activities are also part of this exciting festival. $. Claudius Crozet Park, Crozet. 434-823-2211. www. crozetartsandcrafts.com 41st Annual Virginia Fall Foliage Festival Art Show Oct 13-14—This annual juried fine art and craft show sponsored by

the Shenandoah Valley Art Center is recognized as one of the premiere shows on the East Coast, drawing artists from 14 states and Canada. Enjoy a weekend of incredible creativity, with about 200 artists’ booths brimming with paintings, photography, sculpture, pottery, metalwork, glasswork, jewelry, and other media. Sat 10am-5pm, Sun 12-5pm.

Downtown Waynesboro. 540-949-7662. www.svacart.com 15th Annual Library of Virginia Literary Awards Oct 20—Annual Literary Awards Celebration and presentation of awards at the Library of Virginia featuring host Adriana Trigiani and Lifetime Achievement Award recipient Tom Robbins. Cocktail reception followed by dinner and ceremony. Tickets include seated dinner, choice of book, and open bar. Reservations required. 6pm. The Library of Virginia, Richmond. 804-6923900. www.lva.lib.va.us 87

Blow Your Own Glass Pumpkin at Sunspots through Oct and Nov—Chase the frost off the pumpkin with 2000ºF hot glass at Sunspots Studios. Step into the studio and help the glass blower create a oneof-a-kind, keepsake pumpkin ornament, blown by you. Traditional ornament designs will also be available. Reservations are suggested, but walk-ins will be taken as time allows. Ornaments will be ready for pick up or shipping the following day. $.

Mon-Sat 11am-4pm, Sun12-4pm. Staunton, 540-885-0678. www.sunspots.com

Virginia Artisans Studio Tour Nov 1011—Visit a select number of professional artisans in their working studios in Charlottesville and surrounding counties during the 18th Annual ACV Artisans Studio Tour. Each studio will feature professional artisans selling unique and high quality crafts in an artisan’s working environment. The tour also offers food and beverage samples provided by some of the area’s finest establishments. 10am-5pm.

Charlottesville and surrounding areas. 434984-5308. www.artisanscenterofvirginia.org

48th Annual Craft & Design Show Nov 16-18—The show offers visitors three full days to encounter a select group of seventy unforgettable artists—past Craft & Design Show award winners, the highest scorers in a competitive jury process, and a number of up and coming artists. There will be various works in clay, glass, fiber, jewelry, wood and other media. $. Science Museum of Virginia, Richmond. 804-3530094. www.visarts.org Bizarre Bazaar’s 37th Christmas Collection Nov 28-Dec 2—An exceptional holiday marketplace featuring over 475 exclusive exhibitors selected from the best craft and gift shows in America. The Bizarre Bazaar’s pre-eminent exhibitors will showcase a unique offering of gourmet foods, toys, clothing, and accessories, imported and handmade jewelry, quality crafts and fine arts, antiques, reproduction and hand-painted furniture, and of course, holiday treats, ornaments, and decorative accessories just to mention a few. $. Wed 5-9pm, Thur-Fri 8am-7pm, Sat 10am7pm, Sun 10am-5pm. Richmond Raceway Complex, Richmond. 804-673-7015. www. thebizarrebazaar.com EXHIBITIONS & LECTURES Friday Lunchtime Forum Sept 14– Nov 16—St. Paul’s Episcopal Church announces the 2012 Eyes on Richmond season. The schedule this year includes speakers on a range of issues: housing, the environment, downtown redevelopment, arts and culture, healthcare and medicine, November elections, and more.

Lunch is catered by local restaurants. $.

Fri 12:30pm-1:30pm. 815 E. Grace Street, Richmond. 804-643-3589.

FAIRS, FESTIVALS, & OPEN HOUSES 35th Annual Suffolk Peanut Fest and Swamp Roar Motorcycle Rally Oct 4-7— Celebrate Suffolk’s peanut history with this family-oriented festival with entertainment, fireworks, a shrimp feast, demolition derby, peanut butter sculpture contest, carnival rides, crafts, and more. Proceeds benefit educational programs about the swamp.

Suffolk Executive Airport. 757-539-6751. www.suffolk-fun.com Oktoberfest Oct 6—Enjoy a traditional Oktoberfest complete with authentic music, dancers, singers, food, and beverages, children’s activities, and more. $. Frontier Culture Museum, Staunton.

540-332-7850. www.frontiermuseum.org Fall Fiber Festival & Sheep Dog Trials Oct 6-7—Stroll through the displays, demonstrations, and workshops of the many weavers, spinners, talented artisans, and crafters at this festival, and see the

88

ALBEMARLE

Virginia Bed & Breakfasts and Country Inns

Experience a blend of antiquity and comfort as we offer you a sampling of spectacular southern hospitality. Reflections of the grace and charm of a past era, each country inn and B&B is unique and varies in style and offering. From historic accommodations to mountain hideaways…from weekend trips to business retreats…from romantic getaways to family vacations…we extend a warm welcome and invite you to discover the best places to visit and the most exciting things to do and see.

B&B LISTINGS BY REGION NORTHERN VIRGINIA: Ashby Inn & Restaurant 692 Federal Street Paris, VA 20130; 540-592-3900 www.ashbyinn.com info@ashbyinnparis.com Black Horse Inn 8393 Meetze Road Warrenton, VA 20187; 540-349-4020 www.blackhorseinn.com relax@blackhorseinn.com Briar Patch Bed & Breakfast Inn 23130 Briar Patch Lane Middleburg, VA 20117 703-327-5911 or 866-327-5911 www.briarpatchbandb.com info@briarpatchbandb.com

Strathmore House on the Shenandoah 658 Wissler Road, Quicksburg, VA 22842 888-921-6139 or 540-477-4141 www.strathmorehouse.com strath@shentel.net

Greenock House Inn 249 Caroline Street, Orange, VA 22960 540-672-3625 or 800-841-1253 www.greenockhouse.com reservations@greenockhouse.com

Sunset Hills Farm 105 Christmas Tree Lane Washington, VA 22747 540-987-8804 or 800-980-2580 www.sunsethillsfarm.com farmpeach@aol.com

High Meadows Vineyard Inn 55 High Meadows Lane Scottsville, VA 24590 434-286-2218 or 800-232-1832 www.highmeadows.com highmeadowsvineyard@hotmail.com

CENTRAL VIRGINIA:

Holladay House Bed & Breakfast 155 West Main Street Orange, VA 22960; 540-672-4893 www.holladayhousebandb.com innkeeper@holladayhousebandb.com

Afton Mountain Bed & Breakfast 10273 Rockfish Valley Highway Afton, VA 22920; 800-769-6844 www.aftonmountain.com stay@aftonmountain.com

Columnwood Bed & Breakfast 233 North Main Street Bowling Green, VA 22427 804-633-5606 or 866-633-9314 www.columnwood.com patmike@bealnet.com

Mountain Valley Farm Bed & Breakfast 12955 Dyke Road, Stanardsville, VA 22973 434-985-8874 www.mvfarm.net stay@mvfarm.net

Heritage House Bed & Breakfast 291 Main Street Little Washington, VA 22747 888-819-8280 www.heritagehousebb.com hhbb@shentel.net

Brightwood Vineyard & Farm Cottage Bed & Breakfast 1202 Lillard’s Ford Road Brightwood, VA 22715 540-948-6845 www.brightwoodvineyardandfarm.com svidal@hughes.net

Inn at Narrow Passage US 11 South, Chapman Landing Woodstock, VA 22664; 800-459-8002 www.narrowpassage.com innkeeper@narrowpassage.com Lackawanna Bed and Breakfast 236 Riverside Drive Front Royal, VA 22630; 540-636-7945 www.lackawannabb.com stay@lackawannabb.com The Longbarn Bed and Breakfast 37129 Adams Green Lane Middleburg, VA 20118 540-687-4137 www.longbarnmiddleburg.com thlongbarn@aol.com The Richard Johnston Inn 711 Caroline Street Fredericksburg, VA 22401 540-899-7606 www.therichardjohnstoninn.com rjohnstoninn@staffnet.com ALBEMARLE

Cottages at Chesley Creek Farm 2390 Brokenback Mountain Road Dyke, VA 22935 434-985-7129 or 866-709-9292 www.chesleycreekfarm.com info@chesleycreekfarm.com Dawson’s Country Place Bed & Breakfast 5224 Shelby Road, Rochelle, VA 22738 540-948-3119 or 866-538-0138 www.aviewofamerica.com dawsctryplac@aol.com Ebenezer House Bed & Breakfast 122 Seville Road, Madison, VA 22727 888-948-3695 www.theebenezerhousebb.com dmwebb@hughes.net Frederick House 28 North New Street, Staunton, VA 24401 540-885-4220 www.frederickhouse.com stay@frederickhouse.com

Inn at Westwood Farm 12256 Montford Road Orange, VA 22960 888-661-1293 www.innatwestwoodfarm.com info@innatwestwoodfarm.com Mayhurst Inn 12460 Mayhurst Lane Orange, VA 22960; 888-672-5597 www.mayhurstinn.com mayhurstbandb@aol.com Meander Inn 3100 Berry Hill Road Nellysford, VA 22958 434-361-1121 or 800-868-6116 www.meanderinn.com meanderinn@aol.com Ridge View Bed & Breakfast 5407 South Blue Ridge Turnpike Rochelle, VA 22738 540-672-7024 www.virginia-ridgeview.com edamico@virginia-ridgeview.com South River Country Inn 3003 South River Road Stanardsville, VA 22973 434-985-2901 www.southrivercountryinn.com jabraun@earthlink.net The Buckhorn Inn 2487 Hankey Mountain Highway Churchville, VA 24421 540-337-8660 or 877-337-8660 www.thebuckhorninn.com welcome@thebuckhorninn.com 89

B&B LISTINGS BY REGION CONTINUED The Guest House at Walnut Grove 7508 Belmont Road Spotsylvania, VA 22551 540-854-7993 walnutgrove.spotsy.va@netzero.com Winterham Plantation Bed & Breakfast 11441 Grub Hill Church Road Amelia, VA 23002 804-561-4519 www.winterham.com info@winterham.com

CHARLOTTESVILLE: Arcady Vineyard Bed & Breakfast & Wine Tours 1376 Sutlers Road Charlottesville, VA 22902 434-872-9475 www.arcadyvineyard.com arcadyvineyard@gmail.com Clifton Inn 1296 Clifton Inn Drive Charlottesville, VA 22911 434-971-1800 www.cliftoninn.net reservations@cliftoninn.net The Cope-Foster House P.O. Box 5737 Charlottesville, VA 22905 434-979-7264 www.va-guesthouses.com info@va-guesthouses.com Dinsmore House Bed and Breakfast 1211 West Main Street Charlottesville, VA 22903 434-974-4663 www.dinsmorehouse.com info@dinsmorehouse.com Guesthouses Cottages & Vacation Homes P.O. Box 5737 Charlottesville, VA 22905 434-979-7264 www.va-guesthouses.com info@va-guesthouses.com Inn at Court Square 410 East Jefferson Street Charlottesville, VA 22902 434-295-2800 www.innatcourtsquare.com info@innatcourtsquare.com Inn at Monticello 1188 Scottsville Road, Route 20 South Charlottesville, VA 22902 434-979-3593 or 877-Relax-VA www.innatmonticello.com stay@innatmonticello.com Inn at Sugar Hollow Farm 6051 Sugar Hollow Road Crozet, VA 22932 434-823-7086 www.sugarhollow.com theinn@sugarhollow.com 90

Prospect Hill Plantation Inn & Restaurant Box 6909 (Near Zions Crossroads) Charlottesville, VA 22906 800-277-0844 www.prospecthill.com innkeeper@prospecthill.com

Ivy Creek Farm Bed and Breakfast 2812 Link Road Lynchburg, VA 24503 434-384-3802 www.ivycreekfarm.com info@ivycreekfarm.com

Silver Thatch Inn 3001 Hollymead Drive Charlottesville, VA 22911 434-978-4686 www.silverthatch.com info@silverthatch.com

Rockwood Manor Bed and Breakfast 5189 Rockwood Road Dublin, VA 24084 540-674-1328 www.rockwood-manor.com info@rockwood-manor.com

SOUTHWESTERN VIRGINIA:

EASTERN VIRGINIA:

1817 Norvell-Otey House 1020 Federal Street, Lynchburg, VA 24504 434-528-1020 www.norvelloteyhouse.com norvellotey@aol.com The Babcock House 106 Oakleigh Avenue, Appomattox, VA 24522 434-352-7532 or 800-689-6208 www.babcockhouse.com babcockhouse@earthlink.net Cliff View Golf Club & Inn 410 Friels Drive, Covington, VA 24426 540-962-2200 or 888-849-2200 www.cliffviewgolf.com cliffviewinc@aol.com Evergreen: The Bell-Capozzi House 201 East Main Street Christiansburg, VA 24073 540-382-7372 or 888-382-7372 www.evergreen-bnb.com evrgrninn@aol.com Historic Inns of Abingdon 224 Oak Hill Street, Abingdon, VA 24210 276-623-1281 or 800-475-5494 www.abingdon-virginia.com rcano@naxs.com House Mountain Inn 455 Lonesome Dove Trail Lexington, VA 24450 540-464-4004 www.housemountaininn.com housemtninn@hughes.net Hummingbird Inn 30 Wood Lane, P.O. Box 147 Goshen, VA 24439; 800-397-3214 www.hummingbirdinn.com stay@hummingbirdinn.com Inn at Riverbend 125 River Ridge Drive, Pearisburg, VA 24134 540-921-5211 www.innatriverbend.com stay@innatriverbend.com

A Primrose Cottage Bed & Breakfast 706 Richmond Road, Williamsburg, VA 23185 800-522-1901 www.primrose-cottage.com ingecurtis@aol.com Atherston Hall 250 Prince George Street Urbanna, VA 23175 804-758-2809 www.atherstonhall.com judith@atherstonhall.com Inn at Warner Hall 4750 Warner Hall Road Gloucester, VA 23061 804-695-9565 or 800-331-2720 www.warnerhall.com info@warnerhall.com Williamsburg Sampler Bed and Breakfast Inn 922 Jamestown Road Williamsburg, VA 23185 757-253-0398 www.williamsburgsampler.com wbgsampler@aol.com

EASTERN SHORE OF VIRGINIA: 1848 Island Manor House 4160 Main Street Chincoteague Island, VA 23336 800-852-1505 www.islandmanor.com hosts@islandmanor.com Cape Charles Hotel Historic Inn 235 Mason Avenue, Cape Charles, VA 757-331-3130 www.capecharleshotel.com info@capecharleshotel.com Nottingham Ridge Bed and Breakfast 28184 Nottingham Ridge Lane Cape Charles, VA 23310 757-331-1010 www.nottinghamridge.com nottinghamridge@msn.com

TO RECEIVE A FREE GUIDEBOOK OF VIRGINIAâ&#x20AC;&#x2122;S INNS AND BED AND BREAKFASTS call 1-800-BNB-1293 or visit www.innvirginia.com ALBEMARLE

diverse breeds of sheep and goats that produce the fiber. $. Sat 10am-5pm, Sun 10am-4pm. Montpelier, Orange County.

434-973-5764. www.fallfiberfestival.org 42nd Festival of the Leaves Oct 13— Enjoy the beauty of autumn in Warren County with a 5K race and walk, a parade, children’s activities, live entertainment, craft vendors, food, tours of Belle Boyd Cottage and Balthis House, apple-butter making, and blacksmith demonstrations.

9am-6pm. Downtown Front Royal. 540636-0702. warrenheritagesociety.org 9th Annual Vinton Fall Festival Oct 13—Activities throughout the day include a 5K run/walk, crafters and business showcase, food vendors, live entertainment, agricultural judging, children’s activities, a doggy dress-up contest, and more! Vinton. 8am-4pm.

540-343-1364. www.vintonchamber.com Wilderness Road Heritage Festival Oct 13— Step back to a time in Southwest Virginia’s past with eighteenth century Appalachian crafters, bluegrass music, home cooking, and a host of historical figures. $. 10am-6pm. Karlan Mansion, Wilderness Road State Park. 276-4453065. www.dcr.virginia.gov 43rd Annual Graves Mountain Apple Harvest Festival Oct 6, 13, 20—Enjoy fun-filled days of food, bluegrass music, cloggers, arts and crafts, hayrides, horseback rides, and apple-picking.

10am–4:30pm. Graves Mountain Lodge, Syria. 540-923-4231. www.gravesmountain. com/appleharvest Blue Ridge Folklife Festival Oct 27— Enjoy ballads and banjo tunes from gospel to bluegrass to blues played by authentic regional musicians who have played Southwest Virginia’s music all their lives. $. 10am-5pm. Ferrum College campus, Franklin County. 540-365-4416. www.blueridgeinstitute.org 55th Annual Urbanna Oyster Festival Nov 2-3—Featuring all types of oysters, as well as a fireman’s parade, waterfront activities, the Oyster Festival Queen, Little Miss Spat pageants, and an oyster shucking contest, this event has grown to be quite a large annual celebration. Fri 9am-midnight, Sat 9am-5pm. Urbanna. 804-758-0368. www. urbannaoysterfestival.com 10th Annual Smith Mountain Lake Fall Chili and Craft Festival Nov 3— This festival features music, arts and crafts, and a heated chili cook-off competition with several awards. $.

11am-4pm. Moneta. 540-721-1203. www. smithmountainlake.com 11th Annual Virginia Gourd Festival Nov 3-4—If you enjoy folk art and learning from the artisans themselves, the Virginia Gourd Society is for you! The festival ALBEMARLE

$/%(0$5/( &+$5/277(69,//( :,17(5*5((1 5($/ (67$7(

Brian W. Chase Associate Broker

UVA Darden School MBA 1992 Top Producer & Gold Medallion Sales Leader Sales of $45+ Million from 2006-2011 Outstanding Achievement Award 2007, 2009, 2011 Marketing & Professional Development Award 2008, 2010

® ®

91

THE

BIZARRE BAZAAR® presents...

The 3 th Christmas Collection Thursday, Friday, Saturday, Sunday,

/PWFNCFS tI /PWFNCFS UI December TU December OE

10-7 10-7 10-7 10-5

RICHMOND RACEWAY COMPLEX 600 E. Laburnum Avenue, Richmond, VA 23222

ADVANCE TICKETS Please call (804) 673-6280 or visit our website: thebizarrebazaar.com

Laser Treatment for Clear Nails

BEFORE

8 MONTHS POST

BEFORE

8 MONTHS POST

Photos courtesy of Steven Brook, DPM; Mineola, NY

s 1UICK IN OFl CE PROCEDURE s 3AFE EFFECTIVE TREATMENT

s 6IRTUALLY PAINLESS PROCEDURE WITH NO DOWNTIME FROM YOUR REGULAR ACTIVITIES s !LTERNATIVE TO PRESCRIPTION MEDICATIONS

www.cooltouch.com

* The CoolTouch VARIABreeze laser is FDA cleared for the temporary increase in clear nail for patients with onychomycosis and for general podiatry use.

Robert J. Baglio, DPM, FACFAS Samuel H. Schustek, DPM, FACFAS Diplomates, American Board of Podiatric Surgery

Albemarle-Charlottesville Podiatry Associates, Ltd

434.295.4443 !BBEY 2D s 0ANTOPS s "EHIND $-6 www.virginiafootandankle.com ©2012 CoolTouch Inc. 7140-0058 Rev. A

92

will have a Silent Auction of gourd art, a variety of vendors, gourd crafting classes, Sat 9am-5pm, Sun 10am-4pm. Richards Fruit Market, Middletown. 540-869-1455. americangourdsociety.org Champagne ‘n’ Shopping Nov 8—The Garden will host a special evening of holiday shopping. Guests are greeted with a glass of champagne or sparkling cider; door prizes and live music. 5-8pm. Lewis Ginter Botanical Garden, Richmond. 804262-9887. www.lewisginter.org Holly Jolly Christmas on Lakeside Avenue Nov 9-10—Lakeside-area merchants (including the Garden) will offer special hours and promotions in time for the holidays. Nov. 9 hours are extended to 9pm. Regular hours on Nov. 10. Lewis Ginter Botanical Garden, Richmond. 804262-9887. www.lewisginter.org 32nd Annual Capital of the Confederacy Civil War Show Nov 17-18—This non-profit event features exciting and educational displays assembled by hundreds of collectors and museums, including thousands of original items for sale, such as uniforms, weapons, accoutrements, documents, images, books, and art. $. Sat 9am-5pm, Sun 9am-3pm.

Richmond Raceway Complex, Richmond.

770-630-7296. www.cvcwca.com 15th Annual Virginia Dare Flotilla for Toys Christmas Boat Parade Nov 24—An evening event, with a parade of boats 'decked out' for the holiday season with lights and displays. The boats leave port from the Virginia Dare Marina at 7 pm, travel to Halesford Bridge at Bridgewater Plaza, circle past the SML State Park and return to the Virginia Dare Marina. This event is a local toy drive with all gifts distributed by the Lake Christian Ministries. 540-721-1203. www. smithmountainlake.com FOR CHARITY Charlottesville Challenges AIDS 5K Walk, 2012 Oct 6—Walk against AIDS on the Downtown Mall, through the Corner and on Main Street. With amusements and shows along the way and a one-mile shortcut available, everyone can join.

Maps will be provided to all participants at check-in. Come bright an early for coffee, Bodo's bagels, face painting, sign making, and more! Charlottesville nTelos Wireless Pavilion. 434-981-2160. www.asgva.com.

SPCA’s Shake, Rattle and Roll Critter Ball Oct 6—The 2012 SPCA Critter Ball promises to be a rootin’ tootin’ good time! Don your best Southwestern, Latin, or Country/Western attire and enjoy cocktails, dinner, dancing, live and silent auctions, and the special dance competition. All proceeds will benefit the ALBEMARLE

Charlottesville-Albemarle SPCA. Slaughter Gym at the University of Virginia. 434-9643305. www.SPCACritterBall.com 19th Annual Martha’s Market Oct 12–14— Nearly 70 boutiques from across the country will transform John Paul Jones Arena into a beautiful marketplace with something for everyone. Hosted by the Women’s Committee of Martha Jefferson Hospital, this event benefits women’s healthcare in Central Virginia.

Fri 9:30am–7pm, Sat 10am–6pm, Sun 10am–4pm. John Paul Jones Arena, Charlottesville. www.johnpauljonesarena. com or www.mjhfoundation.org 2012 Start! Charlottesville Heart Walk Oct 13—Come together to raise funds to fight the nation’s number one and number three most common killers— heart disease and stroke. 434-973-5072. www.americanheart.org.

Mountaintop Montessori’s Fall Festival Oct 21---Celebrate the season with Mountaintop Montessori’s Fall Festival.

Enjoy the school’s geodesic dome greenhouse, garden and mountain views and let the kids take part in the games and crafts–including face painting, pony rides, and gourd crafts. Yummy organic food and a children’s used book sale, too!

Proceeds benefit the scholarship fund for SEED, a garden-to-table and ecology day camp for kids from all over the area that is held at Mountaintop during spring and summer breaks. 434-979-8886. www. mountaintopmontessori.org.

Vintage Maymont: The 15th Annual Auction Oct 26—Maymont’s annual auction of wine, travel, entertainment, and culinary treasures features a dinner, silent auction, and a spirited live auction. $. The Jefferson Hotel, Richmond.

804-358-7166. www.maymont.org.

7th Opportunity Ball with a Halloween Twist Oct 26—Come dance, play, trick, or treat! Enjoy a five-course gourmet dinner paired with wine at Veritas Vineyard and Winery. Dress in your Halloween best and get your picture taken in a photo booth (accessories will be available!). Win prizes in the twist and costume contests. Join in the fun with silent and live auctions for lots of great experiences, including cruises and wine dinners. All proceeds benefit the Nelson County Community Fund, supporting over 40 qualified nonprofits helping people in Nelson County.

Veritas Vineyard and Winery, Afton. 540447-6823. www.nelsonfund.org.

The Wildlife Center’s 28th Annual Gala and Benefit Nov 3—Support the Wildlife Center, a community organization dedicated to providing health care to native wildlife. This event begins with cocktails and a Silent Auction featuring a variety of inexpensive items, as well ALBEMARLE

as original artwork and jewelry. During dinner there will be a live auction. $. The Stonewall Jackson Hotel, Staunton. 540942-9453. www.wildlifecenter.org.

2nd Annual Discover Virginia Chili Cook Off Nov 10—Cooks from around Virginia and our own community will come together to test their chili cooking skills. As an International Chili Society member, the cook off will berecognized as a district event. Greene County Economic Development Authority. 434-985-6663. www.gatewaytocharlottesville.com 31st Annual Boar’s Head Inn Turkey Trot Nov 22—This 5K walk/run benefits UVA’s Children’s Hospital. Costumes welcome. Reservations. $. Boar’s Head Sports Club, Charlottesville. 434-9726074. www.boarsheadinn.com Friends of the Library 7th Annual Fall Book Sale Nov 10-18—Thousands of good-quality books and recordings at great prices. HalfPrice days are on Nov 17 & 18. 10am-7pm.

Gordon Ave. Library, Charlottesville. 434977-8467. www.jmrlfriends.org.

ChiP Imagine Awards Dinner Nov 12— The Jefferson Area Children’s Health Improvement Program (ChiP) partners with families to ensure that their young children have a healthy beginning in a nurturing, stable, and healthy home.

In celebration of their 21st anniversary, Jefferson Area ChiP will host their second annual Imagine Awards, which families that have demonstrated extraordinary determination and courage to provide healthy homes for their families will be recognized. 434-964-4774. www.jachip.org.

GARDEN Scottsville Community Farmers' Market through Oct—Offering organic vegetables, baked goods and bread, fresh produce, cheese, meat and poultry, crafts, and more.

Sat 8:30am–12:30pm. New permanent building in Downtown, Scottsville. 434-2962955. www.scottsvilleva.com/market.

Charlottesville City Market through Oct— Vegetables, fruits, shrubs, flowers, herbs, baked goods and crafts. Saturdays 7amnoon. H&R Block Parking Lot on Water Street, Charlottesville. 434-970-3371. www.charlottesvillecitymarket.com Crozet Farmers’ Market through Oct— Locally grown vegetables, produce, fruits, plants, flowers, and homemade edibles.

Saturdays 8am-12pm. United Methodist Church, Crozet Ave. and Jarman’s Gap Rd., Crozet. 434-823-7878.

Orange County Farmers Market through Oct—Vegetables, fruits, shrubs, flowers, herbs, baked goods, and crafts. Saturdays 8am-1pm. Market is in the Historic Orange Train Station, Orange. 540-672-2540. www. visitorangevirginia.com

Dominion GardenFest of Lights Nov 23–Jan 7—This holiday tradition features over half a million lights which focus on this year’s theme, Wings of Wonder.

Grand Illumination: 5-10pm. Lewis Ginter Botanical Garden, Richmond. 804-262-9887. lewisginter.org GREAT OUTDOORS Shenandoah Fall Foliage Bike Festival Oct 19–21—These routes challenge cyclists from all over the country in all skill levels.

Enjoy winding country lanes, steep climbs, mountain views, or leisurely flat stretches. $. Shelburne Middle School, Staunton.

540-416-0267. www.shenandoahbike.org Creepy Tales Oct 26, 27, 29,-30—Enjoy these short plays performed around the Museum in the spirit of Halloween. $.

Frontier Culture Museum, Staunton.

Reservations required. 540-332-7850. www.frontiermuseum.org POPLAR FOREST 434-525-1806 www.poplarforest.org Poplar Forest 5K Race Oct 13—5K race 8:30am. Kids run 9:30a.m.

Thomas Jefferson Wine Festival Nov 17—Join “Mr. Jefferson” for an afternoon on the lawn, featuring Virginia wineries, artisans, food purveyors, and music. $. www.thomasjeffersonwinefestival.com.

ASH LAWN-HIGHLAND 434-293-8000 www.ashlawnhighland.org Veterans Day Nov 11—Open to all, this commemoration of U.S. Veterans will include a ceremonial folding of the American Flag, presented by an honor guard of UVA Air Force ROTC, as well as a wreath laying, and a playing of TAPS. 11am.

Annual Fall Open House Nov 18— Experience history and learn about President James Monroe's involvement in both the Louisiana Purchase and the Monroe Doctrine. 1-4pm.

MONTPELIER 540-672-2728, 540-672-0003 www.montpelier.org Fall Fiber Festival and Sheep Dog Trials Oct 6—View fiber art displays, demonstrations, and workshops while you take in the colorful Virginia Piedmont foliage. Organized by the Fall Fiber Festival of Virginia, Inc. $.

Sat 10am-5pm, Sun 10am-4pm. www. fallfiberfestival.org Fall Big Woods Walk Oct 14—Tour the 200-acre old-growth James Madison 93

Landmark Forest known as the "Big Woods," designated a National Natural Landmark. The Big Wood Walk will begin at the Montpelier Visitor Center at 2pm.

Archaeology Exhibition and Excursions Oct 7-13—Make your way to Montpelier to assist with an excavation. Learn how to dig and work with trained archaeologists as they unearth evidence for the stables and slave quarters. 540-672-2728, ext 160 Montpelier Hunt Races Nov 3— Experience the thrill of steeplechase horse racing at the 78th running of the

Montpelier Hunt Races. Jack Russell Terrier races, stick horse races, dog agility demonstrations, and more. 540-672-0027. www.montpelierraces.org.

MONTICELLO 434-984-0922 www.monticello.org Natural History Walk Oct 13—Peggy Cornett, Curator of Plants at Monticello, will lead this trek through the forests of Monticello. Examine flowers, trees,

mammals, birds, insects, and geology with the historical perspective of Jefferson ever in mind. Reservations. $. 9:30am. Meets at the Garden Center, Thomas Jefferson Visitor Center.

Montalto Trek Oct 6—Join Jason Stevens and Peter Hatch for a strenuous, 1,000-foot vertical hike up Montalto, Jefferson’s “high mountain.”

Walk through a mature forest then break onto cleared pastureland with unobstructed views of Charlottesville, Albemarle County, the Blue Ridge Mountains, and, of course, Monticello.

This is a two-and-a-half-hour trek for the fittest. 9:30 am. Trailhead of the Monticello Trail (Kemper Park).

Apple Tasting Oct 20—Tom Burford, “Professor Apple,” will provide tastings of numerous apple varieties, each introduced with a discussion of its history and culture. Reservations. $. 9:30am.

Meets at the Tufton Farm nursery.

Cooking Unusual Vegetables Nov 3—Join Chef Gabriele Rausse in transforming garden produce into delicious meals. Reservations. $. 9:30am.

Meets at the Jordan Classroom, Thomas Jefferson Visitors Center.

Vinegar Making Workshop Nov 17— Most people are unaware of the rich traditions of using vinegar in cooking.

Join wine-maker and master chef Gabriele Rausse in reviewing the basic principles of vinegar making, and then learn how to use it in preparing vegetables and meat and in concocting delicious aromatized dressings.

Reservations. $. 9:30am. Meets at the Jordan Classroom, Thomas Jefferson Visitor Center.

FRONTIER CULTURE MUSEUM 540-332-7850 www.frontiermuseum.org Home School Day Oct 5—Join the Museum for a day packed with hands-on history, colonial artisans, and lots of fun!

Reservations. $. 9am-5pm. 540-322-7850.

WINTERGREEN 434-325-2200, 1-800-266-2444 www.wintergreenresort.com Pumpkin Party Oct 5-7—Join the Nature Foundation for all manner of pumpkin fun! Carve your holiday pumpkins using our patterns or create your own masterpiece. Show the world your seasonal spirit with a pumpkin face painting, make a pumpkin keepsake to use year after year, and play a pumpkin game. On your way home, pick up some pumpkin treats to share.

94

ALBEMARLE

Colombus Day Weekend Fun Oct 5-8— Wintergreen has mapped out a weekend full of activities, Tickets may be purchased at the resort’s front desk and at the top of Blue Ridge Express.

Halloween Activities Oct 19-21, 26-28—A weekend of family-friendly Blue Ridge Mountain Halloween events including pumpkin carving, resort trick-or-treating, and storytelling. For information, call Activities, 434-325-8180.

The Turkey Day 5K Nov 22—Work up an appetite for Thanksgiving Dinner on Thursday morning at our Turkey Day 5K! Last year 200 runners participated in the innaugural event. Proceeds over $1,600 went to the Nelson County Community Fund, who will receive the proceeds from this year's 5K as well. Awards will be given for Fastest Turkey (age 18+) and Fastest Poult (under 18), Fastest Leashed Dog, Best Dressed Leashed Dog, and Best Costume!

Have A Safe And Happy Thanksgiving From All Of Us At albemarle.

VIRGINIA TRIVIA Answers (from page 34)

NEW EXTENDED SCHEDULE 2200 Old Ivy Rd, Charlottesville charlottesville@purebarre.com www.purebarre.com 434.245.1119 Follow us on Facebook and Twitter (@Purebarrecville)

1. d). Smallpox.

2. d) James Madison.

3. a) Six. 4. a) True.

5. b) War of 1812.

6. b) One month.

7. c) His Accidency.

8. a).Be photographed.

9. b) A patron was murdered in

a duel at one of the celebration balls.

10. d) The Era of Good

Feelings.

11. c) League of

Nations.

12. a) Mother’s Day.

Reines Jewelers WHERE CHARLOTTESVILLE GETS ENGAGED.

434-977-8450 | reinesjewelers.com | 240 Shoppers World Court | Charlottesville

ALBEMARLE

95

LAST LAUGH

The Eyes Have It

By Louise B. Parsley

W

atch out! my inner voice shrieked as I passed my hallway mirror yesterday.

It’s Mom, I thought, hitting the stone cold floor.

Heart pounding, within seconds I realized that it wasn’t, couldn’t be her … unless she’d returned from the grave – to opine that my hair color is too brassy, my lipstick too weak and honestly, Louise stand up straight.

Trundling upward for another peak, it was as plain as the old nose on my face. That reflection was mine. And I am no longer a young woman.

I am now the age I once thought was old. Really old. As in, almost dead.

In fact, I am only a few months away from the number of years, days, hours that my father was when he died unexpectedly from complications following open heart surgery. Now I embrace the murmurings at the time, “He was so young.”

I defend fervently, if not wholly truthfully, the creepy brown spots on the back of my hands are traces of indelible ink, faded handwritten notes to myself … from high school. And those lines between my eyes – the ones that look like a designated parking space? I draw those in with eyebrow pencil … for emphasis when I go into a menopausal rage-blackout over the blind man who doesn’t card me at the liquor store or dares to say, “Have a good day … ma’am.”

Given my father’s genes, I watch my bad cholesterol. I do pilates and yoga. I even stand on my head when I can – not only to transport red corpuscles to my gray matter, but also to restore my butt to its proper place on the planet. If only I could walk around on my head, I would look so much better in pants.

But I can’t. So, I walk around in my head.

Hanging with younger people, like my twenty-something children, helps me stay young at heart. They remind me of those days when I was hell-bent on being unequivocally unique, marching to that distant drummer (now tinnitus); when I cut my hair, but only on one side and looked like a lopsided Chiapet marked down in a fire sale. I was always lying in wait for someone to say You can’t do that, just so I could reply, Watch.

But now that my children and I are the same age, I realize that I can’t keep up with their tempo, but I feel their beat. And become energized with their joie de vivre.

No longer do I focus solely on their hair, hygiene or how they act, but who they are becoming. Together, we face learning curves, albeit different ones. They are forming their own voices and I am learning not to share my opinion. I am, effectively, in “time out.”

So, I live vicariously through them. Elizabeth, on the precipice of 30, is laser-focused on her career, one rung at a time. The upshot of being the eldest of three, she is the responsible one; the punc-

96

tual, organized one who remembers birthdays and the anniversaries of the days we lost loved ones. She savors each rung, reaching back to pull up those behind her.

By contrast, her younger brother Bayless is as far from conventional as his indifference to money will take him. Utterly uninterested in doing anything predictable (old school for grad school), his beautiful mind travels the globe, pursuing and absorbing foreign cultures as though he had a hot tip on the Holy Grail. He charges through life like a speeding bullet, ricocheting between fear of failure and fear of success. Hoping to find balance – and himself – at a yet-unknown point on the pendulum.

One craves advancement and financial security; is reserved and strategic. The other thrives on adventure and the unknown, is anxious and combative.

One writes the memo. The other pushes the envelope.

Garland, now 21, and her friends are quick to form opinions as if to say they know who they are. Yet, few know where they are going. They plan because that is what we taught them to do. But they do not yet have the experience to know that life is what happens when the wheels fall off and the plan goes haywire. John Lennon was right.

When I was their age, my father lent me his wisdom, advice born from experience, words that largely went ignored. It wasn’t until his voice was silenced forever that I began listening.

Reflecting on elders’ lessons while witnessing the formation of my children helps me form a better understanding of who I am.

And who I want to be. I admire Elizabeth’s ability to show up every day and be the best she can be. Bayless’ boundless curiosity and audacity to step outside his comfort zone. And Garland’s grasp of people, love of life, and fearlessness.

Who is the role model now?

Almost six decades of looking in the mirror and I don’t recognize the older reflection staring back at me. Lifting the puddling cascades of skin shrouding my eyes, I see – even without readers – that whatever is left ahead, I want to live those years that my father never experienced as genuinely as possible.

Hoping for the best, yet planning for the worst, we cannot know what the future holds. I no longer lie in wait for someone to say, You can’t …

I simply say, Watch.

An award-winning writer, Louise has strong ties to Central Virginia, having attended Hollins University. Her husband, Bob, and two of her three children are graduates of UVA, and her youngest daughter is a fourth-year at UVA. Living in Houston, Texas, the family considers Charlottesville its second home.

ALBEMARLE

Let us orchestrate your dream.

For the perfect products for your kitchen or bath, stop by a Ferguson showroom.

It’s where you’ll find the largest range of quality brands, a symphony of ideas, and trained product experts to help orchestrate your dream. With showrooms from coast to coast, come see why Ferguson is recommended by professional contractors and designers everywhere.

APPLIANCES

FAUCETS

Charlottesville North: Harrisonburg:

FERGUSON.COM

PASSIONATE PEOPLE

2325 Seminole Ln, Ste C & D 1820 Eveyln Byrd Ave, Ste 170

FIXTURES

LIGHTING

(434) 817-1775 (540) 438-6400

©2012 Ferguson Enterprises, Inc. All Rights Reserved.

When it comes to color, nobody does it better!

Reines Jewelers Where Charlottesville Gets Engaged

434.977.8450

I

reinesjewelers.com

I

240 Shoppers World Court

I Charlottesville. Virginia