Page 1

MONDAY   EDITION

ADDISON COUNTY

INDEPENDENT

Vol. 25 No. 30

Middlebury, Vermont

X

Monday, September 23, 2013

X

36 Pages

75¢

Shoreland  law  hearing  draws  big  crowd

Vermont’s top chef

By  JOHN  FLOWERS MIDDLEBURY  —  The  Legislature’s  ongoing   HIIRUWWRGUDIWDQHZODZUHJXODWLQJGHYHORSPHQW RQVKRUHODQGORWVFRQWLQXHVWRGUDZFRQFHUQIURP $GGLVRQ &RXQW\ UHVLGHQWV VRPH RI ZKRP IHDU QHZUHJXODWLRQVZLOOHPHUJHWKDWZLOODIIHFWWKHLU property  rights. ³7KLVLVDWDNLQJRISURSHUW\ZLWKRXWGXHSUR FHVV´ VDLG RQH RI PRUH WKDQ  SHRSOH ZKR showed  up  at  a  public  hearing  convened  in  Mid

dlebury  on  Thursday  by  the  Shoreland  Protection   Commission.   7KLVZDVWKHIRXUWKVXFKKHDULQJWKHFRPPLV VLRQKDVKHOGWKLVVXPPHUDVLWJDWKHUVLQSXWIRU a  potential  shoreland  protection  bill.  Such  a  mea VXUH²NQRZQDV+²SDVVHGWKH9HUPRQW +RXVHGXULQJWKHOHJLVODWLYHVHVVLRQ%XWWKH Senate  tabled  the  bill  in  order  to  get  more  input   EHIRUHUHYLVLWLQJWKHLVVXHQH[W-DQXDU\ 7KH FRPPLVVLRQ LV FRPSULVHG RI OHJLVODWRUV

IURPWKURXJKRXWWKHVWDWHLQFOXGLQJ5HS:LOOHP -HZHWW'5LSWRQZKRDOVRVHUYHVDV+RXVH0D MRULW\/HDGHUDQGLVDPHPEHURIWKH)LVK:LOGOLIH and  Water   Resources   Committee.   Accompanied   E\ 9HUPRQW $JHQF\ RI 1DWXUDO 5HVRXUFHV RI¿ FLDOV²LQFOXGLQJ$156HFUHWDU\'HE0DUNRZLW] —  the  commission  has  been  trying  to  make  a  case   IRUVKRUHODQGSURWHFWLRQUXOHVWKDWWKH\DUJXHZLOO EH FULWLFDO LQ SURWHFWLQJ WKH ZDWHU TXDOLW\ RI WKH (See  Shoreland,  Page  24)

‡7KHFKLHIRIWKHNLWFKHQDW &DIp3URYHQFHLQ%UDQGRQKDV ZRQDSUHVWLJLRXVDZDUG6HH 3DJH

Loss of bridge in Bristol hurts ‡%ULGJHFRQVWUXFWLRQOHDYHV VRPH%ULVWROUHVLGHQWVFXWRII WRZQVD\VWHPSRUDU\VSDQLV QRWIHDVLEOH6HH3DJH

Big weekend for rivalry games ‡7KH0W$EHDQG98+6 JLUOV·DQG08+6(DJOHDQG 98+6ER\V·VRFFFHUWHDPVDOO PHW6HH3DJHV

Show  time

THE  BAND  SAILS  puts  on  a  free  show  at  The  Hub  teen  center  in  Bristol  last  Thursday  afternoon.  Sails,  an  indie,  punk,  folk  band  from  Lyndon,   features  Mount  Abraham  Union  High  School  graduate  Aaron  Gingras  on  drums. Independent  photo/Trent  Campbell

GD\VRIÀUHV for Bristol man ‡&KULV&DVH\VSHQWPXFKRI WKHVXPPHURXW:HVWÀJKWLQJ EOD]HVLQ&RORUDGRDQG0RQ WDQD,W·VDMREKH·VEHHQGRLQJ IRUGHFDGHV3DJH

United  Way  boosts  its Event builds community 2013  fundraising  goal with films and history

By  JOHN  FLOWERS MIDDLEBURY   —   The   Unit HG :D\ RI $GGLVRQ &RXQW\ ZLOO NLFN RII LWV  FDPSDLJQ WR UDLVH  ZLWK LWV FXVWRPDU\ ³'D\V RI &DULQJ´ WKLV 7KXUVGD\ DQG6DWXUGD\6HSWDQG,WLV DQHYHQWWKDWKDVWKXVIDUDWWUDFWHG  FRPPXQLW\ YROXQWHHUV ZKR ZLOO SHUIRUP GR]HQV RI KHOSIXO MREVIRUWKHYDULRXVORFDOQRQSUR¿W DJHQFLHVWKDWUHFHLYH¿QDQFLDOVXS port  through  the  UWAC.

7KH  JRDO LV  more  than   last   year’s   target   and   UHSUHVHQWV WKH ¿UVW WLPH LQ IRXU years   the   local   United   Way   has   UDLVHG LWV DQQXDO IXQGUDLVLQJ EDU The  organization  closed  the  books   RQ WKH  FDPSDLJQ HDUOLHU WKLV \HDU DIWHU KDYLQJ UDLVHG  ²RUSHUFHQWRILWVWDUJHW But   organizers   this   year   are   FRQ¿GHQW WKH\ FDQ VHW WKHLU VLJKWV higher,  and  that  they  can  meet  the   (See  United  Way,  Page  32)

By  ZACH  DESPART BRISTOL   —   Mount   Abraham   Union   High   School   on   Thursday   HYHQLQJ ZLOO KRVW D ¿UVWRILWV kind   summit   that   will   screen   two   VKRUWGRFXPHQWDU\¿OPVDERXWOLIH in  Addison  County  in  the  past  and   SUHVHQWDVZHOODVIHDWXUHKLVWRUL cal   presentations   by   Mount   Abe   students. )DFXOW\RUJDQL]HUVRIWKH$GGL son   County   Community   Summit  

hope  it   will   provide   an   opportu QLW\ IRU ORFDO SHRSOH DFURVV JHQ erations  to  make  new  connections   with   each   other   and   strengthen   community  ties.   The  summit  will  be  held  at  the   school   beginning   at   6   p.m.   Two   ¿OPVZLOOEHVFUHHQHGDQG0RXQW Abraham  juniors  and  seniors  will   present   history   projects   they   pro duced   while   researching   their   (See  Community,  Page  25)


PAGE  2  —  Addison  Independent,  Monday,  September  23,  2013

Weybridge  to   decide  use  of   embezzlement   settlement  funds

ROB Â DEBRUYN

NATASHA Â CAUSTON

DOUG  AIGNER  

SANDI Â HALL

Middlebury schools welcome new teachers, students Enrollment  from  1990  to  2013 900 800 700 600                        

500

Middlebury  Union  High  School

400 300                        

200

Middlebury  Union  Middle  School

100 Sources:  National  Center  for  Education  Statistics,  U.S.  Dept  of  Education,  MUHS  and  MUMS

0

199 0 199 1 199 2 199 3 199 4 199 5 199 6 199 7 199 8 199 9 200 0 200 1 200 2 200 3 200 4 200 5 200 6 200 7 200 8 200 9 201 0 201 1 201 2 201 3

By  JOHN  FLOWERS MIDDLEBURY   —   Students   en-­ tering   Middlebury   Union   Middle   DQG +LJK VFKRROV IRU WKH ÂżUVW WLPH are   not   alone.   Both   schools   have   HDFKZHOFRPHGVHYHUDOQHZWHDFKHUV WREHJLQWKHDFDGHPLF\HDU MIDDLE  SCHOOL MUMS   enters   the   2013-­14   aca-­ GHPLF \HDU ZLWK D VPDOOHU VWXGHQW population   and   a   lot   of   new   faces   DPRQJLWVWHDFKLQJVWDII 3ULQFLSDO 3DWULFN 5HHQ FRQÂżUPHG D IDOO HQUROOPHQW RI  VWXGHQWV GRZQ IURP ZKDW ZDV DQ XQFKDUDF-­ teristically  large  student  body  of  315   last  year.  This  year’s  7th-­grade  class   KDVVWXGHQWVZKLOHWKHUHDUH WKJUDGHUV Âł3URMHFWHGHQUROOPHQWIRUWKHIRUH-­ seeable  future  looks  to  hover  around   250   students   with   what   looks   like   a   slight  spike  in  2015-­16  and  slight  dip   LQ ´ 5HHQ VDLG Âł:H KDYH had   several   conversations   as   a   staff   DERXWWKLVRYHUWKHSDVWVHYHUDO\HDUV and  we  are  keenly  aware  we  will  need   WRDGGUHVVWKHGHFOLQHLQHQUROOPHQW´ Reen   announced   16   new   addi-­ WLRQV WR WKH 0806 VWDII WKLV \HDU LQFOXGLQJ (QFRUH 3URJUDP 'LUHFWRU 6DQGL +DOO (QJOLVK WHDFKHU &RXUW-­ QH\.UDKQVFLHQFHWHDFKHU0LFKDHO *UD]LDGHL 'RXJ$LJQHU DV WKH QHZ 7LJHU 3URJUDP GLUHFWRU 5RE 'H-­ %UX\Q DV WKH QHZ EDQG GLUHFWRU DO-­ JHEUDWHDFKHU-DPHV+HĂ€LQ6SDQLVK WHDFKHU 1DWDVKD &DXVWRQ DQG VHY-­ eral  paraprofessionals. Âł7KDWÂśV TXLWH D ORW LQ RQH \HDU´ Reen  said  of  the  new  staff.  “It’s  the   PRVW,ÂśYHVHHQLQWKHVL[\HDUV,ÂśYH

EHHQKHUH´ Math  and   English   teachers   spent   VHYHUDOGD\VWKLVVXPPHUORRNLQJDW ZD\VWRWUDQVLWLRQFXUULFXOXPWRWKH &RPPRQ&RUH6WDWH6WDQGDUGVWKDW all  public  schools  will  need  to  adopt   E\QH[W\HDU7KLVIDOOVFLHQFH(QJ-­ OLVK VRFLDO VWXGLHV DQG PDWK WHDFK-­ ers  will  be  attending  conferences  to   OHDUQ PRUH DERXW WKHVH FXUULFXOXP FKDQJHVDQGDERXWWKHQH[WJHQHUD-­ WLRQRIVFLHQFHVWDQGDUGVDFFRUGLQJ to  Reen. HIGH  SCHOOL 0HDQZKLOH08+63ULQFLSDO:LO-­

OLDP /DZVRQ UHSRUWHG DQ LQFRPLQJ VWXGHQWSRSXODWLRQRIXSVOLJKW-­ O\IURPWKHVWXGHQWVVHUYHGODVW \HDU$QGWKHVKRUWWHUPHQUROOPHQW news  is  looking  good  at  MUHS. ³:H¶OO JHW D VLJQL¿FDQWO\ ODUJHU FODVVQH[W\HDU´/DZVRQVDLGSRLQW-­ LQJ WR WKH ELJ FXUUHQW 0806 WK JUDGH FODVV ³2XU QXPEHUV GXULQJ WKHIROORZLQJIRXURU¿YH\HDUVZLOO EHSUHWW\VWDEOHDWDURXQG´ 7KDW QXPEHU FRXOG RI FRXUVH FKDQJHGHSHQGLQJRQQHZEXVLQHVV DFWLYLW\LQ$GGLVRQ&RXQW\ Lawson   said   there   are   a   lot   of  

WKLQJVWREHH[FLWHGDERXWRQFDPSXV beginning  at  the  top. ³7KH PRVW H[FLWLQJ WKLQJ WR PH is  we  are  starting  off  the  year  with  a   SHUPDQHQW VXSHULQWHQGHQW´ /DZVRQ VDLGUHIHUULQJWRWRSH[HFXWLYH3HWHU %XUURZV³,WEULQJVPRUHVWDELOLW\WR WKHGLVWULFW´ Lawson   introduced   four   new   fac-­ XOW\6SDQLVKWHDFKHU1DWDVKD&DXV-­ WRQPDWKWHDFKHU-LP+HÀLQ/HDUQ-­ LQJ /DE &RRUGLQDWRU %HQ .UDKQ and  driver  education  teacher  George   5RRQH\ZKRZLOODOVRVHUYHDV1D-­ tional  Honor  Society  co-­advisor. 7KLUW\WZRVWXGHQWVDWWHQGHGVXP-­ PHUVFKRROWKLV\HDUIRFXVLQJRQKLV-­ WRU\VFLHQFHPDWKDQG(QJOLVK2QH of  those  students  was  able  to  earn  his   GLSORPDDVDUHVXOWRIWKHH[WUD ZRUNDFFRUGLQJWR/DZVRQ 08+6 VWXGHQWV HQWHUHG DQ LP-­ SURYHGEXLOGLQJ:RUNHUVFRPSOHWHG XSJUDGHV WR WKH EXLOGLQJœV KHDWLQJ ventilation  and  air-­conditioning  sys-­ WHP1HZFDUSHWLQJZDVLQVWDOOHGLQ WKH ( & % DQG ' ZLQJV$QG RI¿-­ FLDOV FRPSOHWHG WKH ¿UVW SKDVH RI D SURMHFW WR XSGDWH WKH VFKRROœV ¿UH VDIHW\ V\VWHP 7KDW LQYROYHG UHZLU-­ ing   the   horn/strobes   throughout   the   EXLOGLQJ DQG LQVWDOOLQJ D QHZ PDLQ panel.  The  second  phase  will  include   UHSODFHPHQW RI DOO VPRNH DQG KHDW detectors. Lawson   is   looking   forward   to   a   good  year. ³,WœV DQ H[FLWLQJ WLPH´ KH VDLG ³(YHU\RQHKDVFRPHLQZLWKDORWRI HQWKXVLDVP´ Reporter   John   Flowers   is   at   johnf@addisonindependent.com.

By  JOHN  FLOWERS :(<%5,'*( ² :H\EULGJH residents   will   gather   at   their   local   VFKRRO WKLV :HGQHVGD\ 6HSW  to   decide   what   to   do   with   an   in-­ VXUDQFHVHWWOHPHQWRIQHDUO\KDOID PLOOLRQ GROODUV VWHPPLQJ IURP DQ HPEH]]OHPHQW FDVH LQYROYLQJ IRU-­ PHU7RZQ&OHUN.DUHQ%ULVVRQ ,WZDVRQ-XO\WKDW86'LV-­ WULFW &RXUW -XGJH &KULVWLQD 5HLVV sentenced   Brisson   to   two   years   in   MDLO DORQJ ZLWK SD\LQJ UHVWLWXWLRQ following  her  guilty  plea  to  having   HPEH]]OHG IXQGV IURP WKH WRZQÂśV FRIIHUVRYHUDSHULRGRIDWOHDVWVL[ years. The   townâ&#x20AC;&#x2122;s   insurance   carrier   re-­ LPEXUVHGWKHWRZQIRULWVORVVHVWR WKH WXQH RI  7KH VHOHFW-­ ERDUGQRZZDQWVWRKHDUIURPWKH FRPPXQLW\RQZKDWWRGRZLWKWKH SD\RXW DQG KDYH FDOOHG WKH 6HSW VSHFLDOPHHWLQJWRSURSRVHVHY-­ HUDOSRVVLEOHXVHVLQFOXGLQJ Â&#x2021; 6SHQGLQJ  WR SDYH DSSUR[LPDWHO\PLOHRIWRZQKLJK-­ way.   Â&#x2021; $OORFDWLQJ  IRU D SUR-­ UDWHGSURSHUW\WD[UHEDWHLQDPDQ-­ QHUWREHGHWHUPLQHGDIWHUFRQVXOW-­ LQJ ZLWK WKH 9HUPRQW /HDJXH RI &LWLHVDQG7RZQVDWWRUQH\WRSURS-­ HUW\RZQHUVRIUHFRUGRQ1RY 2012.   Â&#x2021; 8VLQJ  IRU HQHUJ\ related   upgrades   to   be   done   at   the   WRZQ JDUDJHÂżUH GHSDUWPHQW WKDW ZRXOG VDYH DQ HVWLPDWHG  per  year  in  heating  costs. Â&#x2021; 6HWWLQJ DVLGH  IRU D ÂłKLJKZD\ PDMRU HTXLSPHQW IXQG´ WREHXVHGWRZDUGPDMRUSXUFKDVHV VXFK DV ORDGHUV RU WDQGHP WUXFNV for   the   town.   Those   future   equip-­ PHQW SXUFKDVHV ZRXOG RI FRXUVH have  to  be  authorized  by  voters. Â&#x2021; 8VLQJ  WR FUHDWH D SHUPDQHQWUHVHUYHIXQGWREHXVHG WR UHIXQG LI QHHGHG HVWDEOLVKHG DFFRXQWV ZKLFK PD\ KDYH EHHQ drawn  down;Íž  to  reduce  the  need  to   ERUURZ PRQH\ LQ DQWLFLSDWLRQ RI WD[UHFHLSWVWRSD\ELOOVGXULQJWKH VXPPHU DQG IRU QHZ SURMHFWV RU initiatives  in  the  future  that  would   be  voted  on  by  the  town  at  a  regular   RUVSHFLDOWRZQPHHWLQJ :H\EULGJH 6HOHFWZRPDQ *DOH Hurd   said   voters   on   Sept.   25   will   KDYHWKHRSSRUWXQLW\WRDPHQGWKH SURSRVHGDPRXQWVOLVWHGDERYHRU SLWFKFRPSOHWHO\GLIIHUHQWXVHVIRU the  funds. â&#x20AC;&#x153;Voters  are  absolutely  free  to  do   DVWKH\ZLVK´+XUGVDLG Reporter   John   Flowers   is   at   johnf@addisonindependent.com.

email us: You can reach us at

news@addisonindependent. com GEORGE Â ROONEY

JAMES Â HEFLIN

COURTNEY Â KRAHN

BEN Â KRAHN


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  3

%ULVWROSROLFHQDEVXVSHFWHGGHDOHU BRISTOL  â&#x20AC;&#x201D;   Bristol   police   have   arrested  a  man  they  say  was  selling   drugs.   Terrence   Devon   Diggs,   33,   was  arrested  on  Thursday,  Sept.  19,   and  is  accused  of  the  selling  heroin.     After   a   â&#x20AC;&#x153;lengthy   investigation,â&#x20AC;?   Bristol   and   Vergennes   police   ob-­ tained   and   executed   a   search   war-­ rant   at   a   South   Street   residence   in   Bristol.  According   to   police,   Diggs   was   found   to   be   in   possession   of   crack   cocaine,   heroin   and   narcotics   known   bath   salts.   Diggs   also   had   a   â&#x20AC;&#x153;substantial  amount  of  cashâ&#x20AC;?  on  his   person,  according  to  press  release  is-­ sued  by  Police  Chief  Kevin  Gibbs.   Diggs,   of   Waterbury,   Conn.,   was   jailed  at  the  Chittenden  County  Cor-­ rectional  Center  for  lack  of  $25,000   bail.

TERRENCE  DEVON  DIGGS

For  the  record CORRECTION:   The   lead   item   in   the   Vermont   State   Police   log   in   last  Thursdayâ&#x20AC;&#x2122;s   edition   of   the   Inde-­ 7+(6287+675((7%ULGJHLQ%ULVWROKDVEHHQFORVHGWRFDUWUDIÂżFVLQFHDQGODVWZHHNWKHURDGEHG pendent   gave   the   incorrect   age   for   ZDVUHPRYHGZKLFKQRZPHDQVWKDWSHGHVWULDQVFDQQRORQJHUXVHLWHLWKHU6HYHUDO6RXWK6WUHHWUHVLGHQWV the   dog   that   had   been   reported   sto-­ ZLWKRXWFDUVDUHQRZHIIHFWLYHO\FXWRIIIURPWKHYLOODJH$QHZEULGJHLVVFKHGXOHGWRRSHQQH[WVXPPHU Independent  photo/Trent  Campbell len   from   a   Ripton   home   on   Sept.   16.   The   item   should   have   reported   that  an  11-­week-­old  Rottweiler  was   reported  stolen,  along  with  a  laptop  

Residents  decry  loss  of  bridge library,   she   had   to   walk   back   down   that  road,â&#x20AC;?  Jackson  said.  She  added   that  many  residents  on  South  Street   have  young  children. While   there   is   an  Addison   Coun-­ By  ZACH  DESPART BRISTOL  â&#x20AC;&#x201D;  Residents  of  homes   ty   Transportation   Resources   bus   just  south  of  Bristol  village  are  com-­ route   in   Bristol,   the   nearest   stop   is   plaining  about  the  long  detour  they   DW +HZLWW 5RDG DQG /RYHUÂśV /DQH have  to  take  to  get  to  town,  as  a  con-­ which  Jackson  says  is  too  far  for  her   demned   bridge   on   South   Street   is   children  to  walk. Jackson   believes   that   there   is   no   slowly  torn  down.   $IWHU VWDWH RIÂżFLDOV GHWHUPLQHG safe   or   convenient   route   to   get   to   the   bridge   to   be   unsafe   in   2010,   it   town   on   foot   in   lieu   of   the   bridge.   was   closed   to   all   vehicular   and   pe-­ She   said   the   town   should   build   a   GHVWULDQ WUDIÂżF +RZHYHU UHVLGHQWV temporary   pedestrian   bridge   while   still  walked  across  the  bridge  to  get   the  new  span  is  being  constructed. â&#x20AC;&#x153;The  town  is  cutting  a  lot  of  peo-­ to   schools,   the   grocery   store   and   shops,   about   one   quarter   of   a   mile   ple  off  down  here,â&#x20AC;?  she  said. Patti   Smith,   who   also   lives   on   up   the   hill.   In   the   process   of   tear-­ South   Street,   owns   ing  down  the  bridge   a   vehicle,   but   said   to   make   room   for   a   new   one,   construc-­ â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a two-mile walk she  understands  how   inconvenient   it   is   tion   workers   re-­ to go around ... The moved   the   concrete   town is cutting a lot for   the   bridge   to   be   closed  for  her  neigh-­ bed   of   the   bridge   of people off down bors   without   their   Sept.   16,   rendering   own  transportation.   it  impassable  for  pe-­ here.â&#x20AC;? â&#x20AC;&#x201D; Lori Jackson Smith   said   it   was   destrians. nice   that   the   bridge   Lori   Jackson,   ZDV FORVHG WR WUDIÂżF a   mother   of   three   school-­age   children,   lives   on   South   and  said  it  would  be  better  if  the  new   Street,   about   50   feet   west   of   the   bridge  only  served  pedestrians.  Smith,   bridge.   She,   like   several   others   on   who   has   six   children,   complained   the   street,   does   not   own   a   vehicle,   about   motorists   who   used   to   speed   and   relied   on   the   bridge   to   walk   down  the  narrow,  winding  street. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s  going  to  be  a  nightmare  when   to   town   for   groceries   and   errands.   When  the  bed  of  the  bridge  was  re-­ LWÂśVUHRSHQHGWRWUDIÂżF´6PLWKVDLG moved,   Jackson   last   week   walked   â&#x20AC;&#x153;There   were   a   number   of   accidents   while   it   was   open   â&#x20AC;&#x201D;   people   whip   through  the  water  to  get  to  town. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s   a   two-­mile   walk   to   go   down  that  hill.â&#x20AC;? Smith   said   she   feared   someone   around,â&#x20AC;?  she  said. Jackson   said   she   had   heard   that   would   be   struck   by   a   passing   car,   WRZQ RIÂżFLDOV GLG QRW ZDQW SHGHV-­ and  that  she  would  welcome  a  foot-­ WULDQV WR ZDON DORQJ 6WRQ\ +LOO bridge  instead. Dustin  Quade,  who  lived  with  his   Road,   the   quickest   way   to   get   to   town  without  the  bridge,  because  of   parents   on   South   Street   while   at-­ KHDY\WUDIÂżFDQGVPDOOVKRXOGHUVRQ tending   high   school,   also   recalled   that   route,   which   is   also   known   as   dangerous   drivers   while   the   bridge   was  open. Route  116. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve   seen   a   lot   of   speeding,   and   Jackson   agreed   that   road   is   dan-­ people   walking   on   the   road   nearly   gerous. â&#x20AC;&#x153;When   my   12-­year-­old   daughter   clipped  by  farm  equipment,â&#x20AC;?  Quade   stayed  after  school  and  went  to  the   said.

Town:  temporary   span  not  feasible  

Bristol  Town   Administrator   Bill   Bryant   said   building   a   new   bridge   that   could   accommodate   vehicles   was  vital,  as  it  will  allow  police  and   ÂżUH FUHZV WR HDVLO\ JHW WR WKDW SDUW of  town. The  new  bridge  will  be  wider  and   safer   for   both   vehicles   and   pedes-­ trians.  Bryant  said  the  idea  to  build   a   temporary   pedestrian   bridge   was   never   seriously   considered   because   RI WKH GLIÂżFXOW WHUUDLQ ULJKWRIZD\ issues  and  the  fact  that  surrounding   land  is  privately  owned.  Bryant  esti-­ mated  the  cost  of  a  temporary  bridge   at  around  $100,000,  and  said  he  did   not  believe  that  to  be  the  best  use  of   town  resources. â&#x20AC;&#x153;I  feel  for  (the  affected  residents),â&#x20AC;?   Bryant  said.  â&#x20AC;&#x153;I  understand  their  bur-­ den  â&#x20AC;&#x201D;  three  miles  in  a  vehicle  is  a   lot  different  than  walking.â&#x20AC;? Bryant   acknowledged   that   walk-­ LQJDORQJ6WRQ\+LOO5RDGLVGDQJHU-­ ous,  especially  at  night,  but  said  the   town  did  not  prohibit  or  discourage   people  from  doing  it. Bryan  said  Vermont  transportation   RIÂżFLDOV OHDUQHG D ORW DIWHU7URSLFDO 6WRUP,UHQHDERXWKRZWRHIÂżFLHQWO\ rebuild  roads  and  bridges. â&#x20AC;&#x153;We   learned   these   projects   can   be   faster   and   cheaper   without   also   building   a   detour   route,â&#x20AC;?   Bryant   said. The  residents  of  South  Street  will   have  to  wait  another  year.  The  new   bridge  is  expected  to  be  open  by  the   summer  of  2014.

Ride, Roast, and Rock! Middlebury Town Green Saturday, September 28 www.addisonteens.com

computer,  from   a   Ripton   home   that   day.   Anyone   with   information   on   this  incident  is  asked  to  contact  VSP   at   802-­388-­4919.   Information   can   also  be  submitted  anonymously  on-­ line  at  www.vtips.info  or  by  texting   â&#x20AC;&#x153;CRIMESâ&#x20AC;?   (274637)   to   Keyword:   VTIPS.

50% OFF All Merchandiseâ&#x20AC;&#x201C; excluding cat & dog food* DOOIRRGZLOOEHPRYHGWR *UHJ¡VDVRI  â&#x20AC;&#x201C;  \RXFDQ EX\DQGRUGHUIURPWKHUH

Everything must go by 9/28/13! 63 Maple St., Middlebury VT 802-388-0110Â&#x2021;'HE7D\ORU3URSULHWRU


PAGE  4  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

A DDIS ON   INDE P E NDEN T

Editorial

H.526: A matter of public trust To  understand  Vermontersâ&#x20AC;&#x2122;  concerns  with  the  proposed  shoreline  protection   bill,  H.526  as  passed  by  the  House  this  past  session,  you  have  to  answer  just   one  question:  Do  you  trust  the  Agency  of  Natural  Resources  to  create  the  rules   and  administer  it  in  a  way  that  doesnâ&#x20AC;&#x2122;t  create  an  unreasonable  burden?   To  most  shoreline  homeowners  the  answer  is  no.   That  has  been  demonstrated  at  each  of  the  four  public  meetings  that  have   been   held   throughout   the   state   by   the   Shoreland   Protection   Commission.   More  public  hearings  are  planned.   We  applaud  the  Legislature  for  establishing  the  commission  to  seek  the  pub-­ licâ&#x20AC;&#x2122;s  input  â&#x20AC;&#x201D;  although  it  was  done  belatedly  and  only  after  public  outcry  in   the  aftermath  of  House  passage  of  the  bill.  But  we  question  the  commissionâ&#x20AC;&#x2122;s   changed   format   (see   story,   Page   1)   that   now   only   allows   written   questions   that  the  panel  answers  to  clarify  the  intent  of  the  law.  No  public  comments  are   allowed.  The  commission  moved  to  that  format  because  in  earlier  hearings   they  received  too  many  opposing  arguments  and  commission  members  said   they  didnâ&#x20AC;&#x2122;t  feel  as  if  the  public  left  learning  anything  â&#x20AC;&#x201D;  despite  starting  each   public  hearing  with  a  45-­minute  presentation  to  explain  the  proposal.   Peel  that  onion  back  a  layer  and  the  motive  is  obvious:  In  the  commissionâ&#x20AC;&#x2122;s   mind,  these  public  hearings  are  not  so  much  to  ascertain  if  Vermonters  think   the  proposal  is  sound,  as  it  is  to  learn  how  they  might  tweak  the  proposal  to   ensure  it  passes. 7KDWLVREYLRXVE\VRPHRIWKHVWDWHPHQWV$15RIÂżFLDOVDQGFRPPLVVLRQ members  present  when  they  championâ&#x20AC;&#x201D;  like  good  salespeople  â&#x20AC;&#x201D;  the  pro-­ SRVHGODZÂśVEHQHÂżWV+HUHÂśVDQH[DPSOH Â&#x2021;0DLQHDQGeven  New  Hampshire  have  had  a  similar  law  since  the  1970s   and  â&#x20AC;&#x153;property  values  along  lake  shores  in  both  states  have  increased  in  value!â&#x20AC;?   No  kidding.  They  have  in  Vermont,  too.  Probably  Kansas  as  well.  Property   values  have  gone  up  in  the  past  40  years  almost  everywhere. And  then  there  is  this  trumped  up  charge  to  justify  pushing  the  bill  along:   Â&#x2021;$FWLVDELOOSDVVHGLQWKDWRIIHUHGWRZQVWHFKQLFDODVVLVWDQFHDQG grants  to  create  their  own  shoreline  protection  ordinances  or  bylaws.  Of  the   173  towns  that  have  lakes  or  ponds  over  10  acres,  only  42  have  implemented   local  shoreline  protection  laws. Sounds  terrible,  right?  Itâ&#x20AC;&#x2122;s  meant  to.  But  really  itâ&#x20AC;&#x2122;s  not  so  bad.  Town  plans   DUHXSGDWHGHYHU\ÂżYH\HDUV,WÂśVDODERULRXVSURFHVVWKDWWRZQVVSHQGVHYHUDO years  to  study  and  implement.  No  doubt  many  towns  are  in  the  midst  of  incor-­ porating  this  new  state  initiative,  but  just  donâ&#x20AC;&#x2122;t  have  it  completed.  That  almost   25  percent  of  the  towns  have  done  it  in  less  than  three  years  is  pretty  good   considering  there  was  no  state  mandate.   Finally,  the  real  snake  oil  in  this  whole  initiative  is  that  itâ&#x20AC;&#x2122;s  a  crisis  that  has   to  be  addressed  immediately.   It   is   not,   and   does   not.   Lake   Champlain   has   a   pressing   problem   but   ad-­ dressing  farm  run-­off  and  river  pollution  has  a  far  bigger  impact.  The  rela-­ tively  small  impact  this  measure  will  have  on  lake  water  quality  needs  to  be   TXDQWLÂżHG DQG SXW LQ SHUVSHFWLYH 7KH$15 DQG WKLV 6KRUHODQG 3URWHFWLRQ Commission  want  to  project  â&#x20AC;&#x153;shoreland  pollutionâ&#x20AC;?  as  a  crisis  to  justify  their   HIIRUWEXWLQPDQ\RIWKHVPDOOHUODNHVWKHUHDUHELJJHUÂżVKWRIU\&RQVLGHU this  one  example:   Â&#x2021;7KHVWDWHFXWPRUHWKDQRXWRIWKHPLOIRLOHUDGLFDWLRQIXQGLQJIRU just  Lake  Dunmore  in  this  past  year.  Ask  anyone  familiar  with  Lake  Dunmore   as  to  what  is  the  bigger  threat  to  water  quality  â&#x20AC;&#x201D;  run-­off  or  milfoil  â&#x20AC;&#x201D;  and  the   unanimous  answer  will  be  milfoil.  The  simple  fact  is  that  if  milfoil  consumes   the  lake,  youâ&#x20AC;&#x2122;ve  lost  the  lake  to  public  recreation  and  land  values  plummet.   Yet,   the   state   is   taking   money   away   from   the   milfoil   funding   and   creating   another  program  of  lesser  value  to  monitor.   Proponents  will  argue  that  the  bill  does  not  take  any  money  away  from  any-­ thing  else,  but  rather  fees  on  those  affected  landowners  will  cover  expenses.   7KHHVWLPDWHLVWKDWIRXUWRÂżYHIXOOWLPHHPSOR\HHV ÂżJXUHDPLQLPXPRI HDFKZLWKEHQHÂżWV ZLOOEHDGGHGWRWKHVWDWHSD\UROO%XWLIIHHVGRQÂśW cover  the  expenses,  you  can  bet  those  employees  wonâ&#x20AC;&#x2122;t  be  let  go,  but,  as  bu-­ UHDXFUDFLHVJRWKH\ÂśOOÂżQGQHZZD\VWRHQIRUFHWKLQJVWKDWUHTXLUHIHHVWRSD\ their  salaries  â&#x20AC;&#x201D;  or  the  funding  will  be  found. Thatâ&#x20AC;&#x2122;s  just  the  nature  of  government.   And,  generally,  Iâ&#x20AC;&#x2122;m  OK  with  that.  Iâ&#x20AC;&#x2122;m  not  anti-­government.  I  belong  to  the   OLEHUDOVLGHRISROLWLFVWKDWEHOLHYHVJRYHUQPHQWZRUNVEHVWZKHQLWLGHQWLÂżHV a  public  good  that  is  being  neglected  and  steps  in  to  solve  a  problem. And  that  is  the  legislationâ&#x20AC;&#x2122;s  strength.  The  intent  is  good.  We  all  want  the   best  water  quality  feasible.  But  is  the  ANR  to  be  trusted? Hereâ&#x20AC;&#x2122;s  a  suggestion  for  the  Commission  and  the  ANR:  Invite  a  dozen  con-­ tractors  to  share  their  stories  about  costs  associated  with  ANR  rules  and  regu-­ ODWLRQV$VNWKHPLIWKHDJHQF\UXQVWKLQJVHIÂżFLHQWO\RUHIIHFWLYHO\ Then,  before  the  Senate  takes  up  the  bill  this  coming  session,  report  what   you  hear  and  answer  why  the  public  doesnâ&#x20AC;&#x2122;t  trust  the  ANR.  If  the  commission   ZRXOGDGGUHVVWKDWSUREOHPWKH\ÂśGÂżQGVXSSRUWIRUWKLVOHJLVODWLRQ Angelo  S.  Lynn

5RRĂ&#x20AC;LQHV

THE  ROOFLINES  OF  four  different  buildings  intersect  at  Douglas  Orchards  in  Shoreham.

Independent  photo/Trent  Campbell

Letters to the Editor 7RZQRI¿FHGHDOSURFHVVZDVTXHVWLRQDEOHUXVKHG In  the  rush  to  cram  through  a  vote   on   a   multi-­part   land   swap   between   the   town   of   Middlebury   and   the   college,  the  origins  of  this  deal  have   not   been   adequately   scrutinized.   Two   selectbooard   members,   one   of   whom   has   strong   ties   to   the   college,   approached   the   college   on   their   own   initiative.   The   college   responded  with  a  proposal  that  gave   it   what   it   has   sought   for   decades:   the  prominent  plot  of  land  on  which   WKHWRZQRI¿FHVDQGPXQLFLSDOJ\P now  sit. This  process  is  highly  questionable   and   deserves   more   attention   than   it   has   received.   Like   the   U.S.   legal  

principle  of   â&#x20AC;&#x153;fruit   of   the   poisonous   tree,â&#x20AC;?  the  way  this  deal  was  hatched   WDLQWVHYHU\WKLQJWKDWĂ&#x20AC;RZVIURPLW Its  origins  were  rotten,  and  the  smell   remains. Adding   insult   of   unseemly   haste   to   injury   of   backroom   dealings,   a   scant   majority   of   the   selectboard   continues   to   aim   for   a   vote   on   this   scheme  in  December  â&#x20AC;&#x201D;  despite  the   fact   that   three   board   members   who   listen  to  their  constituents  argue  that   the   project   should   be   discussed   at   town  meeting  and  voted  on  the  next   day.  A  vote  after  town  meeting  makes   sense  if  your  goal  is  the  widest  likely   participation   of   townspeople.   If,   on  

the  other  hand,  your  goal  is  to  pass   this   deal   as   soon   as   possible   with   minimal   opportunity   for   evaluation   and   organized   objection,   then   you   aim   for   the   soonest   vote   you   can   get,  during  the  Thanksgiving  to  New   Year   holiday   season,   when   people   travel  and  are  otherwise  occupied. So  I  ask,  even  if  you  think  this  deal   is  a  good  one,  why  canâ&#x20AC;&#x2122;t  a  vote  wait   until  the  traditional  ballot  after  town   meeting?   Are   construction   costs   really   climbing   so   fast   that   three   months   would   blow   the   budget?   Even   if   thatâ&#x20AC;&#x2122;s   so,   does   it   warrant   a   vote   timed   to   minimize   rather   than   (See  Letter,  Page  5)


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  5

Looking  beyond  the  lake  view

Letters

For  many   Vermonters,   the   aquatic   plants.   When   they   are   shorelines   along   lakes   and   ponds   protected,   shorelines   help   create   are   synonymous   with   ducks   interconnected   habitat   types   that   DQG JHHVH Ă&#x20AC;\LQJ LQ ORZ ZLWK provide  greater  mobility  and  cover   shorebirds   walking   delicately   IRU WKH ÂżVK DQG ZLOGOLIH WKDW OLYH among   the   grasses,   feeding   and   there,   and   minimize   exposure   to   raising   their   young,   and   with   predators   and   disturbance   from   VFKRROVRIKXQJU\SDQÂżVKZDLWLQJ some  types  of  human  activity. for  a  young  anglerâ&#x20AC;&#x2122;s  cast.  Indeed,   While   clearing   trees   from   a   shorelines   provide   some   of   the   natural  lakeshore  to  create  a  lawn,   richest,   most   valuable   aquatic   wall  or  beach  may  seem  harmless   habitat   for   countless   to   us,   the   resulting   VSHFLHV RI ÂżVK DQG biological   changes   wildlife.   These   vital   are   profound.   The   areas   are   also   home   historic  reluctance  of   to   many   Vermonters,   Vermont   towns   and   some   of   whom   have   This   weekâ&#x20AC;&#x2122;s   writer   state   government   to   made   investments   to   is   Patrick   Berry,   regulate   lakeshore   afford   views   of   the   commissioner   has   of   development   water  and  the  critters   the   Vermont   Fish   &   led   to   widespread   that  live  there. habitat   deterioration.   Wildlife  Department. So   how   do   we   In  fact,  more  than  80   balance   the   needs   of   percent  of  Vermontâ&#x20AC;&#x2122;s   lakefront   dwellers   of   all   species?   large   lake   shorelands   have   been   And   how   do   we   enjoy   the   view   found   by   the   U.S.   Environmental   without   compromising   the   Protection  Agency  to  be  in  fair  or   wildlife  and  water  quality  that  are   poor  condition,  a  statistic  that  puts   integral   to   the   enjoyment   of   that   us  behind  most  other  Northeastern   view?  That  discussion  is  currently   states. taking   place   across  Vermont,   and   Sites   without   shoreline   tree   is   manifested   in   the   form   of   bill   cover   provide   less   habitat   in   the   + )URP D ÂżVK ZLOGOLIH DQG form   of   woody   structure   and   leaf   water-­quality  perspective,  there  is   litter   along   the   lake   bottom   that   much  at  stake. serves   as   the   basis   of   the   aquatic   The  boundary  between  lake  and   IRRGFKDLQ $QG LI QRW ÂżOWHUHG E\ land   provides   critical   habitat   for   a   buffer   of   natural   vegetation,   a  wide  diversity  of  terrestrial  and   silty   and   nutrient-­rich   runoff   DTXDWLF RUJDQLVPV ² IURP ÂżVK IURP FOHDUHG VKRUHOLQHV FDQ Ă&#x20AC;RZ to   aquatic   insects,   to   birds   and   unchecked   into   lakes   and   ponds   mammals.   Vegetated   shorelines   which   are   sometimes   only   a   few   support  these  species  by  fostering   yards  away.  So  as  we  acknowledge   a   variety   of   bottom   types   with   WKHGLIÂżFXOWZRUNDKHDGWRHQVXUH boulders   and   cobbles,   woody   that   all   sources   of   sediment   and   snags,   and   a   healthy   diversity   of   pollution  are  checked  before  they  

Shumlin  is  selling,  not  governing

Community

Forum

reach  the  stateâ&#x20AC;&#x2122;s  public  waterways,   we  recognize  that  the  regulation  of   shorelands   should   be   part   of   that   comprehensive  effort. 7KHĂ&#x20AC;RRGLQJRILOOXVWUDWHG the  value  of  natural  lake  shoreland   vegetation  in  preventing  shoreline   erosion.   Most   of   the   sites   where   erosion   occurred   on   Lake   Champlain   were   areas   where   the   native   vegetation   had   been   removed  and  replaced  with  lawns   or   retaining   walls.  A   diverse   mix   of   woody   vegetation   provides   EDQNVWDELOLW\DQGĂ&#x20AC;RRGUHVLOLHQFH important  factors  in  adapting  to  a   changing  climate. The   shoreland   protection   legislation,   H.526,   was   created   with   the   importance   of   shoreline   habitats   in   mind.   The   foresight   that   created   Act   250,   and   now   underlies  this  legislation,  has  been   critical   in   protecting   not   only   the   wildlife   and   birds   within   these   habitats   but   also   in   working   to   protect  the  Vermont  quality  of  life   we  all  treasure.   Lakeshore   habitats   provide   more  than  just  a  window  onto  the   elegance   of   aquatic   ecosystems   â&#x20AC;&#x201D;   they   provide   a   home   to   the   species   that   depend   on   them   for   their  survival.  We  are  not  meeting   our   own   environmental   standards   along  many  of  our  lakeshores,  and   it  is  time  to  take  action  to  protect   this   diminishing   natural   resource.   Remembering   this   should   inform   our   support   for   the   lakeshore   protection   bill,   and   strengthen   our   commitment   to   preserving   more  than  just  the  view  for  future   generations  to  enjoy.  

to the Editor

A  carpenter   wants   to   nail   it.   A   surgeon   wants   to   operate   on   it.   A   realtor  wants  to  list  it  and  sell  it. While   listening   to   Gov.   Peter   Shumlin   on   â&#x20AC;&#x153;Vermont   Editionâ&#x20AC;?   at   VPR,  it  occurred  to  me  that  he  really   is  more  realtor  than  governor. He  is  off  to  showcase  the  Northeast   Kingdom  to  Chinese  investors.  Heâ&#x20AC;&#x2122;s   hoping  to  sell  it  to  them. He  has  also  listed  Addison  County.  

Heâ&#x20AC;&#x2122;s  hoping  to  sell  it  to  Canada  and   New  York. The  governor  personally  has  done   very   well   in   his   real   estate   ventures   (maybe   not   always   ethically   or   fairly).  Jeremy  Dodge  ring  a  bell? Peter   Shumlin   should   be   representing  the  people  of  this  state,   not  selling  us  out. Mary  Martin Cornwall

Letter (Continued  from  Page  4) maximize   voter   participation   for   a   bond   issue   that   could   commit   all   residents   and   businesses   to   more   taxes? I   encourage   all   Middlebury   residents,  no  matter  where  you  stand   on  these  issues,  to  tell  the  selectboard  

what  you  think.  Call  them  and  write   them;Íž  their  contact  information  is  on   the   town   website.   Letâ&#x20AC;&#x2122;s   make   sure   WKHLU GHFLVLRQV DQG DFWLRQV UHĂ&#x20AC;HFW the   majority   of   the   people   they   are   supposed  to  represent. Barbara  Shapiro Middlebury

ADDISON COUNTY

INDEPENDENT Periodicals  Postage  Paid  at  Middlebury,  Vt.  05753

Postmaster,  send  address  change  to  Addison  Independent, 0DSOH6WUHHW0LGGOHEXU\9HUPRQWÂ&#x2021;Â&#x2021;)D[Â&#x2021;:HEZZZDGGLVRQLQGHSHQGHQWFRP (0DLOQHZV#DGGLVRQLQGHSHQGHQWFRPÂ&#x2021;(0DLO$GYHUWLVLQJDGV#DGGLVRQLQGHSHQGHQWFRP 3XEOLVKHGHYHU\0RQGD\7KXUVGD\E\WKH$GGLVRQ3UHVV,QF0HPEHU9HUPRQW3UHVV$VVRFLDWLRQ1HZ(QJODQG3UHVV$V VRFLDWLRQ1DWLRQDO1HZVSDSHU$VVRFLDWLRQ 68%6&5,37,215$7(69HUPRQWÂą0RQWKV0RQWKV0RQWKV0RQWKV2XWRI6WDWHÂą 0RQWKV0RQWKV0RQWKV0RQWKV'LVFRXQWHGUDWHIRU6HQLRU&LWL]HQVFDOOIRUGHWDLOV  7KH,QGHSHQGHQWDVVXPHVQRÂżQDQFLDOUHVSRQVLELOLW\IRUW\SRJUDSKLFDOHUURUVLQDGYHUWLVHPHQWVEXWZLOOUHSULQWWKDWSDUWRIDQ DGYHUWLVHPHQWLQZKLFKWKHW\SRJUDSKLFDOHUURURFFXUUHG$GYHUWLVHUZLOOSOHDVHQRWLI\WKHPDQDJHPHQWLPPHGLDWHO\RIDQ\ HUURUVZKLFKPD\RFFXU 7KH$GGLVRQ,QGHSHQGHQW8636

Letters to the Editor Improvements  to  Weybridge  building  merit  support Weybridge  voters  have  been   asked  to  attend  a  special  town   meeting  on  Wednesday,  Sept.  25,  at   7  p.m.  for  the  purpose  of  deciding   what  to  do  with  the  embezzlement   insurance  payout  of  $475,980.   There  are  several  warned  items  sug-­ gesting  ways  that  this  money  might   be  used. Of  special  interest  to  me  is  Article   4,  which  reads:  â&#x20AC;&#x153;To  see  if  the  Town   ZLOOYRWHWKHVXPRIRIWKH insurance  payout  for  energy-­related   upgrades  to  be  done  at  the  Town   Garage/Fire  Dept.  that  would  save   an  estimated  $3,000  per  year  in  heat-­ ing  costs.  (To  be  coordinated  by  the   Weybridge  Energy  Committee.)â&#x20AC;? The  Weybridge  Energy  Com-­ mittee  is  supporting  this  proposal   WRZHDWKHUL]HWKHWRZQJDUDJHÂżUH department  based  on  an  energy  au-­ dit  performed  by  Structural  Energy   Corp.  of  Middlebury.  We  believe   this  will  substantially  decrease  heat-­ LQJFRVWVDQGVDYHWKHWRZQVLJQLÂż-­ cant  money  in  the  coming  years. The  Weybridge  Energy  Committee   is  encouraging  Weybridge  voters  

to  support  this  improvement  to  an   important  town  building  by  coming   to  town  meeting  on  Sept.  25.  This  is   not  an  Australian  ballot  item  â&#x20AC;&#x201D;  the   only  way  to  vote  on  this  article,  and  

all  the  other  articles,  is  to  show  up   in  person.  We  look  forward  to  see-­ ing  you  there. Gwen  Nagy-­Benson Weybridge

SEPT 27-29 15 YEAR ANNIVERSARY SALE 10-60% OFF STOREWIDE CLOTHING

CAMPING

FLYFISHING

Smartwool  Socks  â&#x20AC;&#x201C;   Buy  2  get  one  FREE!

Lowest  prices  of  the  year!

1BSL4USFFU .JEEMFCVSZttNNWUDPN


PAGE  6  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

Obituaries

ADDISON COUNTY

Patricia Shaw, 82, Weston WESTON  â&#x20AC;&#x201D;   Patricia   Mullen   Kelley  Shaw  passed  away  on  Sept.   17,   2013,   at   her   home   in   Weston,   Vt. She  was  born  March  10,  1931,  the   youngest  in  a  large  and  loving  Irish   family   in   Waterbury,   Conn.   She   married   Jack   Kelley   and   settled   in   Cheshire,  Conn.,  where  they  raised   Lauren  and  lived  a  typical  suburban   life  in  the  1950s  and  â&#x20AC;&#x2122;60s.  Holidays   were   a   highlight,   celebrating   with   her   mother,   Nora;Íž   brother,   Father   Bill;Íž   and   with   the   Mullen,   Shutts,   Collins  and  Kelliher  families. In   the   1970s   the   Shaw   family   moved   in   next   door   and   Patâ&#x20AC;&#x2122;s   life   was  never  the  same.  Pat  Shaw  was   her  best  friend,  and  the  two  of  them   became  known  as  â&#x20AC;&#x153;The  Pats.â&#x20AC;?  After   Jack  died  Pat  moved  to  Weston,  Vt.,   in  order  to  be  close  to  the  Brothers   of   the   Weston   Priory   and   to   her   brothers   and   sisters.   Several   years   after   Pat   Shawâ&#x20AC;&#x2122;s   death,   Lee   Shaw   and   Pat   Kelley   married,   sharing   a   love   of   sailing   and   skiing.   They   enjoyed   many   happy   years,   until   Leeâ&#x20AC;&#x2122;s  death. Pat   and   daughter   Lauren   called   each   other   almost   daily   and   she   enjoyed   watching   her   grandchil-­ dren,   Nora   and   Molly,   grow.   A   woman   of   few   words,   she   loved  

!

living  in  the  home  she  had  designed   for   her   old   age.  As   her   healthcare   provider   said,   â&#x20AC;&#x153;She   was   a   very   strong,  independent  lady.  Someone   to  learn  from!â&#x20AC;? Pat   is   survived   by   her   daugh-­ ter,   Lauren   Parren,   and   her   family   (Steve,   Nora,   Molly)   of   Monkton;Íž   by   her   sisters   Marie   Kelliher   and   Nancy   Collins   and   their   fami-­ lies;Íž   by   cousin   Sr.   Rosita   Hyland;Íž   and   by   special   friend   of   30   years,   0DULDQQD0F*XIÂżQ She   was   predeceased   by   her   husband   Jack;Íž   friend   Pat;Íž   husband   Lee;Íž   brother   and   sister-­in-­law   Jim   and   Mickey   Mullen;Íž   brothers-­in-­ law  Emmett  Shutts,  George  Collins   and   John   Kelliher;Íž   and   brother   Monsignor   William   Mullen.   Her   sister  Betty  Shutts  passed  away  the   morning  after  Pat,  on  Sept.  18. A   funeral   service   (shared   with   Betty)   was   due   to   be   on   Monday,   Sept.   23,   at   St.   Thomas   Beckett   Church,  Cheshire,  CT.  A  Mass  will   be  celebrated  at  the  Weston  Priory   on  Saturday,  Sept.  28,  at  11:30  a.m.   Pat  will  be  buried  next  to  Lee  at  the   Priory. ,Q OLHX RI Ă&#x20AC;RZHUV GRQDWLRQV may   be   sent   to   Londonderry   Rescue   Squad,   6068   Route   100,   /RQGRQGHUU\97¸

"

Patricia Chamberlain, 68, Starksboro STARKSBORO  â&#x20AC;&#x201D;   Patricia   (Grant)   Chamberlain,   68,   of   Starksboro,   died   on   Sept.   19,   2013,   in  Burlington,  after  a  long  and  coura-­ geous   battle   with   heart   and   vascu-­ lar   disease.   She   was   born   on   April   23,   1945,   in   Hancock,   the   beloved   daughter   of   Edward   and   Helen   (Faivre)   Grant.   She   was   married   on   May  19,  1962,  in  Bristol  to  Thomas   Chamberlain. Pat  attended  school  in  Middlebury.   She   poured   her   heart   and   soul   into   caring   for   her   family,   and   had   a   rewarding   career   as   a   tax   preparer   in   Vermont   and   in   Texas,   achieving   status  as  an  Enrolled  Agent  for  many   years.   She   will   be   missed   by   her   devoted  clients. She   was   predeceased   by   her   husband  Thomas   Ross   Chamberlain   on  Jan.  30,  2013. She   is   survived   by   her   son,   Richard   Chamberlain;Íž   daughter   and  

son-­in-­law,  Joni  and  Michael  Ladue;͞   daughter,   Christine   Chamberlain;͞   brother   and   sister-­in-­law,   Raymond   and   Connie   Grant;͞   sister   and   brother-­in-­law,   Nancy   and   Andy   Baumgartner;͞   sister   and   brother-­in-­ law,   Marie   and   Jerry   Nazworthy;͞   sister,  Marjorie  Grant  Webb;͞  brother,   John  Grant;͞  grandsons,  Jacob  Jimmo   and   Ross   Carr;͞   and   many   nieces,   nephews   and   other   extended   family   members. She   was   predeceased   by   her   parents;͞  and  a  brother,  Edward  Grant   Jr. Calling   hours   will   be   Sunday,   Sept.   22,   2013,   from   6   to   8   p.m.   at   Brown-­McClay   Funeral   Home   in   Bristol.   A   funeral   will   be   held   at   Brown-­McClay  Funeral  Home  at  11   a.m.  on  Monday,  Sept.  23,  2013,  with   interment   to   follow   at   Greenwood   Cemetery   in   Bristol.   A   luncheon   will  be  held  at  the  American  Legion  

!

PATRICIA Â CHAMBERLAIN

in  Bristol   following   the   services.   In   OLHXRIĂ&#x20AC;RZHUVFRQWULEXWLRQVPD\EH made   to   the   Bristol   Rescue   Squad,   32%R[%ULVWRO97¸

"

Betty Godfrey, 75, Brandon BRANDON  â&#x20AC;&#x201D;  Betty  Godfrey,  75,   of  Brandon  died  Sept.  11,  2013,  after   a  short  battle  with  cancer She   was   born   Bessie   Louise   Godfrey  on  Sept.  17,  1937,  to  Arthur   and  Florence  (Webster)  on  the  family   farm  in  West  Fairlee  where  she  grew   up  with  three  brothers  and  two  sisters   and  a  large  extended  family  of  aunts,   uncles  and  cousins. She   attended   school   in   West   Fairlee.   Relatives   say   she   was   never   afraid   of   hard   work,   which   started   on   the   farm   with   household  

chores  where  she  gained  her  love  for   cooking,   helping   with   the   animals,   gardens,   haying,   working   in   the   sugarbush   and   the   apple   orchard   alongside  her  family. Her  adult  livelihood  was  in  house-­ keeping  both  in  the  Fairlee  area  and   the  Mad  River  Valley.  She  also  cared   for  elders  in  the  Brandon  area  where   she  lived  for  the  past  several  years. Her  relatives  say  she  loved  music,   especially  country.  She  played  guitar   from   her   early   20s   until   her   illness   no  longer  made  it  possible  for  her  to  

!

do  so.  She  attended  many  gatherings   and  made  numerous  taped  recordings   of  music  being  played  by  family  and   friends. She  is  survived  by  her  sister  Nellie   )UHHPDQ RI :DLWV¿HOG DV ZHOO DV several  nieces,  nephews  and  cousins. She  was  predeceased  by  her  parents   as  well  as  siblings  Evelyn,  Arthur  II,   Edward,  Kenneth  and  Eleanor. Services  will  be  held  at  a  later  date   in   Post   Mills   at   the   convenience   of   the  family.  The  date  and  time  will  be   announced.

"

Donald Fortune, 51, Rutland RUTLAND  â&#x20AC;&#x201D;   Donald   Adam   Fortune,  51,  died  Wednesday,  Sept.   18,  2013,  at  his  home  in  Rutland. He   was   born   March   25,   1962,   in   Avon,  Conn.,  to  Gerard  and  Virginia   (Stupcenski)   Fortune.   He   received   his   education   in   Leicester   schools   and   at   Otter   Valley   Union   High   School   in   Brandon.   He   married   Dawn   Crickmore   on   Oct   27,   1987,   and   lived   in   the   Rutland   area   for   many  years.

Obituary Guidelines

He  was   employed   by   Terry   Hill   Trucking  in  Milton.  His  family  says   his  interests  included  outdoor  cook-­ ing   on   the   grill,   bargain   shopping   DQG¿VKLQJ Surviving   are   his   wife   of   Center   Rutland;͞   three   sons,   Adam   L.   Fortune   of   Georgia,   Vt.,   and   Michael   D.   Fortune   and  Andrew   J.   Fortune,   both   of   Rutland;͞   a   daugh-­ ter,   Heather   Fortune   of   Center   Rutland;͞  a  brother,  David  Fortune  of  

Massachusetts;͞  four   sisters,   Diane   Fortune-­Smith   of   Massachusetts,   Donna  Fortune  of  New  Hampshire,   Debra   Longley   of   Florida   and   Doreen   Fortune-­Lavallee   of   Arizona;͞   six   grandchildren;͞   and   many  nieces  and  nephews. A   service   of   remembrance   will   be   held   Monday,   Sept.   23,   2013,   at   4   p.m.   in   the   Miller   &   Ketcham   Funeral   Home,   26   Franklin   St.,   Brandon.  There  are  no  calling  hours.

The Addison Independent considers obituaries community news and does not charge to print them, as long as they follow certain guidelines. These guidelines are published on our web site: addisonindependent.com. Families may opt for uned-­ LWHGSDLGRELWXDULHVZKLFKDUHGHVLJQDWHGZLWK´š¾DWWKHHQG

Planning for your funeral, the smart thing to do... Many people are planning for their funeral in advance in a sincere effort to ease the stress loved ones will face at an emotional time. It takes only a little time and can be handled in the privacy of your home or at 6DQGHUVRQ'XFKDUPH)XQHUDO+RPH

Sanderson-Ducharme Funeral Home 6RXWK0DLQ6W0LGGOHEXU\97Â&#x2021; sandersonfuneralservice.com

Funeral, Cremation & Memorial Services, Pre-Planning Services

BROWN-McCLAY FUNERAL HOMES

Bristol 453-2301

Vergennes 877-3321


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  7

ADDISON COUNTY

StudentBRIEFS Alix  Kauffman,   a   student   at   Vergennes  Union  High  School,  has   been   selected   as   a   member   of   the    1$I0( $OO1DWLRQDO +RQRU Mixed   Chorus   sponsored   by   the   National   Association   for   Music   Education   (NAfME).   Kauffman   ZLOO MRLQ PRUH WKDQ  PXVLFDOO\ talented  and  skilled  U.S.  high  school   students  to  perform  at  a  gala  concert   RQ2FWLQ1DVKYLOOH7HQQ Kauffman   is   a   member   of   the   VUHS  Concert  Choir,  Commodore   Singers   and   Commodore   Jazz   Ensembles.   She   accompanies   for   the   Middle   School   Chorus   and   the   newly  formed  Vergennes  Childrenâ&#x20AC;&#x2122;s   Choir.   Elizabeth   Huizenga   of   New   Haven   and   Cody   Randall   of   /HLFHVWHUEHJDQWKHLUÂżUVW\HDUDW6W Michaelâ&#x20AC;&#x2122;s  College  this  semester. Huizenga,   daughter   of   David   and   Robin   Huizenga,   graduated   from   Mount  Abraham  Union  High  School. Randall,   son   of   Diane   and   Greg   Randall,   graduated   from   Otter   Valley  Union  High  School.

Addison  residents  ponder  Town  Hallâ&#x20AC;&#x2122;s  future By  ANDY  KIRKALDY FOHUNÂśVRIÂżFH$GGLVRQÂśV\HDU ADDISON  â&#x20AC;&#x201D;  A  lightly  attended   old  town  hall  has  never  had  running   Sept.   16   public   informational   water   or   septic,   and   Spencer   said   meeting   did   little   to   settle   the   the   other   buildings   all   have   ques-­ future   of   the   now   vacant  Addison   tionable  individual  systems. Town  Hall  on  Route  22A,  accord-­ The   church   now   owns   Addison   ing   to   the   chairman   of   Addisonâ&#x20AC;&#x2122;s   Town  Hall,  per  a  deed  that  stated  its   s e l e c t b o a r d -­ ownership  reverted   appointed   Town   to   the   church   The town hall committee Hall  Committee. when   the   town   Committee  head   has recommended a no   longer   used   John   Spencer   said   community septic system it.   Church   lead-­ only  about  a  dozen   that could serve not only ers   have   agreed   to   residents   showed   that building, but also deed   the   building   up   that   Monday   the Addison Community back  to  Addison  in   evening   at   the   Baptist Church and the exchange  for  septic   Addison   Central   WRZQ¡VQHDUE\Ă&#x20AC;UHVWDWLRQ service. School   to   learn   DQGFOHUN¡VRIĂ&#x20AC;FH The   system   more   about   the   is   proposed   for   ownership   and   septic   issues   that   land   west   of   the   central   school.   are   complicating   the   buildingâ&#x20AC;&#x2122;s   Construction,  engineering,  permit-­ future. ting   and   purchase   of   an   ease-­ â&#x20AC;&#x153;There   were   too   few   people   ment   for   the   site   are   estimated   at   there  to  get  any  clear  message  out    EXW 6SHQFHU LV RSWL-­ of  it,â&#x20AC;?  Spencer  said.   mistic   the   state   would   pick   up   35   The   town   hall   committee   has   SHUFHQW RI WKH WDE RU  recommended  a  community  septic   by   awarding   Addison   a   Pollution   system   that   could   serve   not   only   Abatement  Grant. that  building,  but  also  the  Addison   The   Town   Hall   Committee,   Community   Baptist   Church   and   IRUPHG LQ  DOVR KDV SODQV WKH WRZQÂśV QHDUE\ ÂżUH VWDWLRQ DQG drawn   up   for   a   $1   million  

renovation  of  Addison   Town   Hall   as  a  replacement  for  what  Spencer   and   others   call   an   increasingly   LQDGHTXDWH WRZQ FOHUNÂśV RIÂżFH ZKLFKKDVOLWWOHVWRUDJHRIÂżFHDQG meeting   space   and   a   nearly   full   vault.   Experts   have   determined   the  town  hallâ&#x20AC;&#x2122;s  structure  is  sound,   Spencer  said.   Spencer   said   that   several   resi-­ dents   at   last   weekâ&#x20AC;&#x2122;s   meeting   wondered  about  money. â&#x20AC;&#x153;Most   of   them   were   saying   we   KDYH WR ÂŤ ÂżQG D ZD\ WR SD\ IRU the   renovation   before   we   move   forward,â&#x20AC;?  he  said.   The   problem,   Spencer   said,   is   that   other   towns   have   discovered   that   government   and   foundation   grants  will  not  be  awarded  to  towns   if  they  do  not  own  the  building  for   which  those  grants  are  sought.   And   Addison   cannot   own   the   EXLOGLQJ ZLWKRXW ÂżUVW LQYHVWLQJ in   the   community   sewer   system,   he   said,   putting   the   years-­long   discussion   back   to   square   one   â&#x20AC;&#x201D;   although  he  had  hoped  for  a  Sept.    FRQVHQVXV WR ERUURZ  to   monitor   the   proposed   septic   VLWHLQWKHVSULQJDQGFRQÂżUPWKDW

it  would   meet   all   the   buildingsâ&#x20AC;&#x2122;   needs.   â&#x20AC;&#x153;You   have   to   have   title   to   (the   building),â&#x20AC;?   Spencer   said.   â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re   back  to  Catch-­22.â&#x20AC;? Spencer   said   he   or   another   committee   member   will   report   on   Oct.   1   to   the   selectboard,   which   called   for   the   Sept.   16   meeting.   One   possibility   is   a   discussion   on   Town   Meeting   Day,   when   more   residents   will   be   on   hand,   but   Spencer  said  selectboard  members   will  ultimately  make  the  call. â&#x20AC;&#x153;I  donâ&#x20AC;&#x2122;t  know  what  the  next  step   will   be,â&#x20AC;?   Spencer   said.   â&#x20AC;&#x153;I   have   to   talk   to   the   committee   and   think   about  this,  and  the  selectboard.â&#x20AC;? Selectboard   chairman   Jeff   Kauffman   said   he   was   able   to   attend   only   part   of   the   Sept.   16   PHHWLQJDQGKHVDLGRIÂżFLDOVZLOO have   to   talk   over   the   townâ&#x20AC;&#x2122;s   next   moves  on  the  complicated  issue.   â&#x20AC;&#x153;The   next   steps   will   be   deter-­ mined  when  the  selectboard  meets   again,   so   I   am   not   sure   of   those   steps  at  this  time,â&#x20AC;?  Kauffman  said   in  an  email. Andy  Kirkaldy  may  be  reached  at   andyk@addisonindependent.com.


PAGE  8  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

communitycalendar

Sep

23

MONDAY

Directorâ&#x20AC;&#x2122;s  talk  on  â&#x20AC;&#x153;The  House  I  Live   Inâ&#x20AC;?   at   Middlebury   College.   Monday,   Sept.  23,  4:30-­6  p.m.,  Twilight  Auditorium.   Film   director   Eugene   Jarecki   talks   about   his   documentary   â&#x20AC;&#x153;The   House   I   Live   In.â&#x20AC;?   Free.   Info:   388-­3168.  

Sep

24

TUESDAY

research  professor  of  public  policy  at  the  College   of   William   and   Mary,   discusses   the   state   of   U.S.   immigration,   including   the   effects   of   immigration   on  the  wages  and  employment  of  natives,  current   immigration  policy  options  and  more.   Silent  art  auction  in  Middlebury.  Tuesday,  Sept.  24,    SP $PHULFDQ )ODWEUHDG 0DUEOH :RUNV Annual   fundraiser   for   Quarry   Hill   School.   Silent   auction  features  artwork  donated  to  the  preschool.   Live   music   provided   by   2002-­2003   Quarry   Hill   DOXPQL0D[0D\RQHDQG-DFRE.OHPPHU$SRUWLRQ RIHDFKPHDOVDOHEHQHÂżWV4XDUU\+LOO5HVHUYDWLRQV accepted.  Info:  388-­7297  or  www.quarryhillschool. org.   Library   parent   discussion   group   in   Middlebury.   Tuesday,   Sept.   24,   6-­8   p.m.,   Ilsley   Library.   â&#x20AC;&#x153;The   ,PSRUWDQFH RI 1RQ)LFWLRQ IRU .LGV´ 3DUHQWV DUH LQYLWHGWROHDUQDERXWKRZWRUHDGPRUHQRQÂżFWLRQ with   their   children   and   get   recommendations   from   Youth   Services   Librarian   Tricia   Allen.   Info:   388-­4097.   Archaeology  talk  in  Vergennes.  Tuesday,  Sept.  24,    SP %L[E\ 0HPRULDO /LEUDU\ $UFKDHRORJLVW Andrew   Beaupre   discusses   the   French   colonial   archaeology   of   the   Lake   Champlain-­Richelieu   Valley.  Free.  Info:  877-­2211.  

Start  Your   Own   Business   work-­ shop   in   Middlebury.   Tuesday,   Sept.     DP SP $&('& RIÂżFH  Route   7   South,   Suite   8.   The   Vermont   Small   Business   Development   Center   offers   this   work-­ shop   on   how   to   determine   if   there   is   a   market   for   your   business,   identify   target   customers,   do   market   research,   prepare   to   write   a   business   SODQ DQG ÂżQG RXW DERXW ÂżQDQFLQJ )HH  Call   (802)   728-­9101   with   a   credit   card   number.               PHOTOGRAPHY WORKSHOP WITH CALEB KENNA â&#x20AC;&#x201D; Join   Caleb and special guests for a four week series that will improve   your photos. Classes are Thursdays: October 3,10, 17 & 24 from     6-7:30 at the Compass Music and Arts Center, Brandon. Space is  

limited, registration required. $130; MC/Visa accepted, Contact Maria at 802-247-3000.

     Tai  Chi  for  Arthritis  class  in  Vergennes.  Tuesday,   6HSWQRRQSP1RUWKODQGV-RE&RUSV 7KH ÂżUVW LQ D VHULHV RI EHJLQQHU WDL FKL FODVVHV PHHWLQJ7XHVGD\VDQG7KXUVGD\VWKURXJK1RY Sponsored  by  CVAA,  these  free  classes  can  help   LPSURYHEDODQFHĂ&#x20AC;H[LELOLW\DQGPXVFOHVWUHQJWKLQ VHQLRUV5HJLVWHUDWH[WRU visit  www.cvaa.org.   Tai  Chi  for  Arthritis  class  in  Middlebury.  Tuesday,   6HSW   SP 0LGGOHEXU\ )LWQHVV 7KH ÂżUVW in  a  series  of  beginner  tai  chi  classes  for  seniors,   PHHWLQJ7XHVGD\VDQG7KXUVGD\VWKURXJK1RY Sponsored  by  CVAA,  these  free  classes  can  help   LPSURYHEDODQFHĂ&#x20AC;H[LELOLW\DQGPXVFOHVWUHQJWKLQ VHQLRUV5HJLVWHUDWH[WRU visit  www.cvaa.org.   Sustainable   population   talk   in   Middlebury.   Tuesday,   Sept.   24,   3-­4:30   p.m.,   EastView   at   0LGGOHEXU\ *HRUJH 3OXPE H[HFXWLYH GLUHFWRU RI Vermonters   for   a   Sustainable   Population   pres-­ ents  â&#x20AC;&#x153;The  Optimal  Population  for  Vermont  and  the   World.â&#x20AC;?  Info:  vspop.org.   â&#x20AC;&#x153;The  New  Immigrants  â&#x20AC;&#x201D;  Blessing  or  Bane?â&#x20AC;?  talk   at  Middlebury  College.  Tuesday,  Sept.  24,  4:30-­6   p.m.,   Twilight   Auditorium.   Harriet   Orcutt   Duleep,  

Community  chorus   rehearsal   at   Middlebury   College.   Tuesday,   Sept.   24,   7-­8   p.m.,   Mead   Chapel.   Rehearsal   of   the   Middlebury   College   Community   Chorus   2013   fall   season,   preparing   IRU WKH DQQXDO 7KDQNVJLYLQJ FRQFHUW RQ 1RY  Open  to  all  interested  singers  without  audition.  Info:    Milk   &   Honey   Quiltersâ&#x20AC;&#x2122;   Guild   meeting   in   Middlebury.  Tuesday,  Sept.  24,  7-­9  p.m.,  American   /HJLRQ 6X]DQQH 0F1HLOO ZLWK /\QGD 5KHDXPH will  present  â&#x20AC;&#x153;Ten  Minute  Block.â&#x20AC;?  Learn  to  create  a   quilt  block  in  less  than  an  hour.  Bring  your  machine.   If   you   are   not   on   the   guild   e-­mail   list,   call   Lynda   at   247-­3771   for   material   and   supply   information.   (OHFWLRQRIRIÂżFHUVVKRZFRPPLWWHHGLVFXV-­ sion.  Show  and  tell  as  always.  Info:  388-­7127.   Discussion   of   VPTâ&#x20AC;&#x2122;s   â&#x20AC;&#x153;March   on   Washingtonâ&#x20AC;?   at   Middlebury  College.  Tuesday,  Sept.  24,  7:30-­9:30   p.m.,  216  McCardell  Bicentennial  Hall.  A  screening   RIH[FHUSWVIURPWKH937GRFXPHQWDU\IROORZHGE\ a  panel  discussion.  Free  and  open  to  the  public.

Sep

25

WEDNESDAY Tai  Chi   for   Arthritis   class   in     Middlebury. :HGQHVGD\ 6HSW 

his  past   ss  in  Middlebury  t 6WD\Ă&#x20AC;H[LEOH  LEADS  a  free  Tai  Chi  for  Arthritis  cla ain  this    ag up g   tin ar  st 0  â&#x20AC;&#x201D;  is

RUTH  BARENBAUM  classes  â&#x20AC;&#x201D;  open   to  anyone  over  5 r  individual  listings  or  visit   ar  fo f  fall spring.  A   series  o ison  County  towns.  See  the  calend O dd A l   ra ve  se RWR7UHQW&DPSEHO week  in ,QGHSHQGHQWÂżOHSK  schedule. cvaa.org  for  the  full

9 : 3 0 -­  DP (DVWYLHZ 7KH ÂżUVW LQ D series  of  beginner  tai  chi  classes  for  seniors,  meet-­ LQJ :HGQHVGD\V DQG )ULGD\V WKURXJK 1RY  Sponsored  by  CVAA,  these  free  classes  for  people   DJHRUROGHUFDQKHOSLPSURYHEDODQFHĂ&#x20AC;H[LELOLW\ DQG PXVFOH VWUHQJWK 5HJLVWHU DW  H[W Senior   night   meal   in   Bridport.   Wednesday,   Sept.     SP %ULGSRUW *UDQJH &9$$ VSRQ-­ sors  this  last  evening  meal  of  the  year,  catered  by   5RVLHÂśV'LQQHUVHUYHGSURPSWO\DWSPIROORZHG E\ D VLOHQWWHDFXS DXFWLRQ IRU JLIW FHUWLÂżFDWHV home   baked   goodies   and   more.   Menu:   chicken   and   biscuits,   Ronnieâ&#x20AC;&#x2122;s   signature   coleslaw   and   IUXLW FULVS 6XJJHVWHG GRQDWLRQ  5HVHUYDWLRQV UHTXLUHG)UHHORFDOWUDQVSRUWDWLRQ by  ACTR:  388-­1946.   Local   author   in   Shoreham.   Wednesday,   Sept.     SP 3ODWW 0HPRULDO /LEUDU\ /RFDO ZULWHU Sue   MacIntire   will   sign   copies   of   her   new   book,   â&#x20AC;&#x153;Shoreham,â&#x20AC;?  and  give  a  short  talk  with  â&#x20AC;&#x153;insider  infor-­ mation.â&#x20AC;?  Light  refreshments.  Co-­sponsored  by  the   library   and   the   Shoreham   Historical   Society.   Info:   897-­2647.   Youth   hockey   registration   in   Middlebury.   :HGQHVGD\ 6HSW   SP 0HPRULDO 6SRUWV Center.   Middlebury   Area   Hockey   Association   is   holding  signups  for  all  of  its  youth  hockey  programs,   including  Learn  to  Skate  sessions  for  4-­  to  7-­year-­ olds.  Info:  www.middleburyhockey.org.   College   essay-­writing   workshop   in   Middlebury.   :HGQHVGD\6HSWSP,OVOH\/LEUDU\ Community   Room.   Strategies   for   College   invites   high  school  juniors  and  seniors  to  attend  â&#x20AC;&#x153;Writing   a   Winning   College   Essay.â&#x20AC;?   Free,   but   registration   required:  andrea@strategiesforcollege.com.  

Sep

26

Ready  to  roll RIDERS  CHECK  THEIR  bikes  at  last  yearâ&#x20AC;&#x2122;s  Ride,  Roast  and  Rock  fundraiser  in  Middle-­ bury.  The  annual  event,  an  all-­ages  bike  tour  followed  by  live  music  and  a  pig  roast  on  the   WRZQJUHHQLVRQ6DWXUGD\6HSWVWDUWLQJDWDP,WEHQHÂżWV$GGLVRQ&HQWUDO7HHQV

THURSDAY

Clifford  Symposium   keynote   address   at   Middlebury   College.   Thursday,   Sept.   26,   4:30-­6:30   p.m.,   Mahaney  Center  for  the  Arts.  David  Bellos,  direc-­ tor  of  the  Program  in  Translation  and  Intercultural   Communication   at   Princeton   University,   delivers   a  keynote  for  the  2013  Clifford  Symposium,  Sept.   26-­28,   titled   â&#x20AC;&#x153;Translation   in   a   Global   Community:   Theory  and  Practice.â&#x20AC;?  Free.   Holistic   health   center   grand   opening   in   Middlebury. 7KXUVGD\ 6HSW   SP 7KH 9LWDO :HOO  0DSOH 6W 6XLWH  &HOHEUDWLQJ the  opening  of  The  Vital  Well  in  the  Marble  Works.   $WJXHVWVSHDNHU5DFKHO(GZDUGV06/$F will   present   â&#x20AC;&#x153;Practicing   Health   From   the   Inside   Out:  An  Introduction  to  Chinese  Medicine  and  the   Cultivation   of   Wellness.â&#x20AC;?   Info:   rachelbaird@gmail. com.   Top   Chef   Shenanigans   for   teens   in   Middlebury.   7KXUVGD\ 6HSW   SP ,OVOH\ /LEUDU\ Think   youâ&#x20AC;&#x2122;ve   got   what   it   takes   to   create   the   best   concoction   out   of   limited   ingredients?   For   teen   in   grade   7-­12.   Hosted   by   Ilsleyâ&#x20AC;&#x2122;s   VolunTeens.   Info:   388-­4097.   Addison   County   Community   Summer   in   Bristol.  

T h u r s d a y,  Sept.  26,  6-­8  p.m.,  Mount  Abraham  Union   +LJK6FKRRO)HDWXULQJVFUHHQLQJVRIDPLQXWH movie   about   Addison   County,   featuring   several   Bristol  residents;  the  movie  â&#x20AC;&#x153;How  to  Live  to  Be  100,â&#x20AC;?   featuring  the  Bristol  Stampede;  and  student-­made   PRYLHVDERXW%ULVWRO/LQFROQ0RQNWRQ1HZ+DYHQ and  Starksboro.  Organized  by  Sen.  Bill  Doyle  and   the  MAUHS  Social  Studies  Department.   â&#x20AC;&#x153;Beekeeping   in   Addison   Countyâ&#x20AC;?   talk   in   New   Haven.7KXUVGD\6HSWSP1HZ+DYHQ &RPPXQLW\ /LEUDU\ .LUN :HEVWHU RZQHU RI Champlain  Valley  Bees  &  Queens,  will  speak.  Info:    Connie   Dover   and   Skip   Gorman   in   concert   in   Bristol.  Thursday,  Sept.  26,  7-­9  p.m.,  First  Baptist   Church,   Park   Street.   Singer   Connie   Dover   and   ÂżGGOHUJXLWDULVWVLQJHU 6NLS *RUPDQ H[SORUH WKH Celtic   roots   of   cowboy   music.   Doors   open   at   Tickets  available  at  Recycled  Reading  of  Vermont,   $0DLQ6W$GYDQFHWLFNHWSXUFKDVHUV receive  a  special  premium.  

Sep

27

FRIDAY

Clifford  Symposium   keynote   address  at  Middlebury  College.  Friday,   Sept.   27,   noon-­2   p.m.,   Mahaney   Center   for  the  Arts.  Emily  Apter,  professor  of  French  and   FRPSDUDWLYHOLWHUDWXUHDW1HZ<RUN8QLYHUVLW\DQG author  of  â&#x20AC;&#x153;The  Translation  Zone,â&#x20AC;?  delivers  a  keynote   for  the  2013  Clifford  Symposium,  Sept.  26-­28,  titled   â&#x20AC;&#x153;Translation   in   a   Global   Community:   Theory   and   Practice.â&#x20AC;?  Free.   Table  of  Grace  free  meal  in  Vergennes.  Friday,  Sept.     SP 9HUJHQQHV &RQJUHJDWLRQDO &KXUFK 0RQWKO\ GLQQHU VSRQVRUHG E\ WKH 1RUWK Ferrisburgh  United  Methodist,  St.  Paulâ&#x20AC;&#x2122;s  Episcopal,   Vergennes   Congregational   and   St.   Peterâ&#x20AC;&#x2122;s   churches.   Free,   but   donations   accepted.   Menu:   FKLFNHQDQGELVFXLWVZLWKVWXIÂżQJSHDVFUDQEHUU\ sauce  and  dessert.   Artistâ&#x20AC;&#x2122;s  talk  and  reception  in  Bristol.  Friday,  Sept.   27,  6-­8  p.m.,  WalkOver  Gallery.  Celebrating  Chepe   &XDGUDÂśVH[KLELWRIODUJHVFDOHSDLQWLQJVWLWOHGÂł%DFN 3RUWUDLWV$6HDUFKIRU,GHQWLW\´2QH[KLELWWKURXJK 2FW5HFHSWLRQIHDWXUHVWUDGLWLRQDO1LFDUDJXDQ IRRG DQG VRXQGV RI WKH 1LFDUDJXDQ VWUHHWV 7KH Spanish-­speaking   community   is   most   welcome   to  attend  this  cultural,  multi-­sensory  evening.  Info:   H[W Snake   Mountain   Bluegrass   and   the   Connor   Sisters  in  Middlebury.  Friday,  Sept.  27,  8-­10  p.m.,   7ZR %URWKHUV 7DYHUQ /RFDO EOXHJUDVV H[SHUWV WHDPXSZLWKWKHH[WUDRUGLQDU\&RQQRU6LVWHUVZKR VLQJLQWKHSXUHVWEOXHJUDVVVW\OH7LFNHWV VWXGHQWVDYDLODEOHDWWKH7+7ER[RIÂżFH or  www.townhalltheater.org.  

Sep

28

SATURDAY

Ride,  Roast  and  Rock!  in  Middlebury.   Saturday,   Sept.   28,   8   a.m.-­3   p.m.,   Middlebury  town  green.  Fourth  annual  pig   roast,  bike  tour  and  live  music  by  local  teen  bands,  


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  9

communitycalendar WREHQHÂżW$GGLVRQ&HQWUDO7HHQV5LGHDQG%%4 VWXGHQWVDGXOWVLQDGYDQFHRURQUDFH GD\%%4RQO\VWXGHQWVDGXOWVIUHHIRUNLGV DQG\RXQJHU,QIRDQGUHJLVWUDWLRQIRUPVDYDLODEOH DW$&7  0DLQ 6W LQ 0LGGOHEXU\ RU KWWSDGGL-­ VRQWHHQVFRP DV ZHOO DV DW WKH 0LGGOHEXU\ %LNH &HQWHU 0LGGOHEXU\ )LWQHVV 6NLKDXV DQG &DUROÂśV +XQJU\0LQG&DIp GED  testing   in   Middlebury. 6DWXUGD\ 6HSW   DP SP 9HUPRQW $GXOW /HDUQLQJ  %RDUGPDQ 6W 3UHUHJLVWUDWLRQ UHTXLUHG &DOO IRULQIRDQGWRUHJLVWHU)UHH*('SUHS DYDLODEOH â&#x20AC;&#x153;Classic   Cruise-­inâ&#x20AC;?   food   drive   in   Ferrisburgh.   6DWXUGD\6HSWDPSP9HUPRQW(QHUJ\ &R5RXWH9HUPRQW(QHUJ\&RDQG%& 0RWRUVSRUWVLQYLWHHYHU\RQHWRFUXLVHLQ²E\FDU ELNH WUXFN RU WUDFWRU ² DQG GRQDWH D QRQSHULVK-­ DEOHIRRGLWHPWRWKH$GGLVRQ&RXQW\)RRG6KHOIÂśV 3URMHFW+23( Bristol   Harvest   Festival. 6DWXUGD\ 6HSW   DP SP %ULVWRO WRZQ JUHHQ )UHH IDPLO\ IXQ ZLWKSOXVFUDIWHUVYHQGRUVFKLOGUHQÂśVYHQXHZLWK SRQ\ ULGHV SHWWLQJ ]RR SLH FRQWHVW EDQGVWDQG PXVLFSROLFHSURSHUW\VDOHDUWVKRZ.UDFHDQG PRUH,QIRH[WRUZZZEULVWROKDUYHVW-­ IHVWFRP 6LOHQW DUW DXFWLRQ DQG UDIĂ&#x20AC;H LQ %ULVWRO 6DWXUGD\ 6HSWDPSP%ULVWROWRZQJUHHQ3DUW RI%ULVWROÂśV+DUYHVW)HVW:LGHYDULHW\RIIRRGDQG SURGXFWV JLIW FHUWLÂżFDWHV KRWHO VWD\V VHUYLFHV ORFDO FUDIWV DQG DUWZRUN DQG PRUH 7R EHQHÂżW$UW RQ0DLQÂśVQRQSURÂżWFRPPXQLW\H[KLELWVDQGDFWLYL-­ WLHV ,QIR  RU LQIR#DUWRQPDLQQHW 2Q )DFHERRNDW$UWRQ0DLQ97 7RZQ RIÂżFH RSHQ KRXVH LQ 6KRUHKDP 6DWXUGD\ 6HSW   DPQRRQ 6KRUHKDP 7RZQ 2IÂżFH &RPH FHOHEUDWH WKH RSHQLQJ RI 6KRUHKDPÂśV QHZ WRZQRIÂżFHEXLOGLQJ5HIUHVKPHQWVVHUYHG Translingual   poetry   slam   at   Middlebury   College.   6DWXUGD\ 6HSW   DP SP 0DKDQH\ &HQWHUIRUWKH$UWV)HDWXULQJHQWULHVDQGZLQQHUV LQ WKH VWXGHQW MRXUQDO 7UDQVOLQJXDOÂśV WUDQVODWLRQ FRQWHVWDVZHOODVLPSURPSWXSRHWU\WUDQVODWLRQV )UHH ,QIR  3DUW RI WKH  &OLIIRUG 6\PSRVLXP Âł7UDQVODWLRQ LQ D *OREDO &RPPXQLW\ 7KHRU\DQG3UDFWLFH´ Staged   reading   of   â&#x20AC;&#x153;Pentecostâ&#x20AC;?   at   Middlebury   College. 6DWXUGD\ 6HSW   SP 0DKDQH\&HQWHUIRUWKH$UWV$VQHDNSHHNDWWKH XSFRPLQJSURGXFWLRQRI'DYLG(GJDUÂśVPXOWLOLQJXDO SOD\ Âł3HQWHFRVW´ ZLWK VWXGHQW DQG IDFXOW\ DFWRUV JLYLQJ D VWDJH UHDGLQJ RI VHOHFWHG VFHQHV )RU PDWXUHDXGLHQFHV)UHH3DUWRIWKH&OLIIRUG 6\PSRVLXP Âł7UDQVODWLRQ LQ D *OREDO &RPPXQLW\ 7KHRU\DQG3UDFWLFH´ Archaeological   conservation   workshop   in   Ferrisburgh. 6DWXUGD\ 6HSW   SP /DNH &KDPSODLQ 0DULWLPH 0XVHXP Âł$UFKDHRORJLFDO 'RFXPHQWDWLRQ'UDIWLQJDQG3KRWRJUDSK\´3DUWRI DVHULHVRIEHKLQGWKHVFHQHVKDQGRQZRUNVKRSV LQ WKH PXVHXPÂśV &RQVHUYDWLRQ /DE ,QIR ZZZ OFPPRUJ Living   history   presentation   in   Orwell. 6DWXUGD\ 6HSW   SP 0RXQW ,QGHSHQGHQFH 6WDWH +LVWRULF 6LWH (QJOLVK DFWRUSOD\ZULJKW +RZDUG %XUQKDPSUHVHQWVÂł/RVLQJ$PHULFD/W*HQ-RKQ %XUJR\QH´LQZKLFKDV%XUJR\QHKHJLYHVDUXHIXO DFFRXQW RI KLV  1RUWKHUQ &DPSDLJQ H[SHUL-­ HQFHV 0XVHXP DGPLVVLRQ  DGXOWV NLGV XQGHU IUHH,QIR â&#x20AC;&#x153;Caesar   Must   Dieâ&#x20AC;?   screening   at   Middlebury   College. 6DWXUGD\ 6HSW   SP 'DQD $XGLWRULXP 6HW LQVLGH WKH KLJKVHFXULW\ ZLQJ RI 5RPHÂśV5HELEELDSULVRQZKHUHDJURXSRILQPDWHV DUHSURGXFLQJÂł-XOLXV&DHVDU´)UHH Exhibit  opening  reception  in  Vergennes.6DWXUGD\ 6HSW   SP %DU $QWLGRWH  1RUWK *UHHQ

Ride, Roast, and Rock!

$XGLWRULXP 6HW LQVLGH WKH KLJKVHFXULW\ ZLQJ RI 5RPHœV5HELEELDSULVRQZKHUHDJURXSRILQPDWHV DUHSURGXFLQJ³-XOLXV&DHVDU´)UHH

Sep

29

Shoreham  stories LOCAL   WRITER   SUE   MacIntire   comes  to  the  Platt  Memorial  Library  in   Shoreham  on  Wednesday,  Sept.  25,  at  6   p.m.  to  sign  copies  of  and  give  a  short   talk  about  her  new  book,  â&#x20AC;&#x153;Shoreham.â&#x20AC;?   Light  refreshments  will  be  served. 6W &HOHEUDWLQJ QHZ ZRUNV SKRWRJUDSK\ E\ 0DU\ %UHYGDDQGSDLQWLQJVE\+RPHU:HOOV Family   potluck   movie   night   in   Middlebury.   6DWXUGD\6HSWSP0LGGOHEXU\8QLWHG 0HWKRGLVW &KXUFK Âł6RXO 6XUIHU´ UDWHG 3* )RRG DYDLODEOHRUEULQJDGLVKWRVKDUH1RFKDUJH,QIR  Radio  host  Joel  Najman  in  Middlebury.6DWXUGD\ 6HSW   SP 7RZQ +DOO 7KHDWHU 935 FHOHEUDWHV 1DMPDQÂśV WK DQQLYHUVDU\ RI KRVWLQJ Âł0\ 3ODFH´ DQG KLV \HDU FDUHHU LQ EURDGFDVW-­ LQJ1DMPDQZLOOVSLQWXQHVIURPWKHÂśVDQGVKDUH VWRULHV (YHQW LQFOXGHV GDQFLQJ 7ZLVWHU WRXUQD-­ PHQW SUL]HV IRU WKH EHVW KDLUGR JRJR GDQFHUV UHIUHVKPHQWV DQG PRUH 0RG FRVWXPHV KLJKO\ HQFRXUDJHG $GPLVVLRQ LV D QRQSHULVKDEOH IRRG GRQDWLRQWR+23(,QIRZZZWRZQKDOOWKHDWHURUJ Shine   a   Light   on   Domestic   Violence   auction   in   Middlebury. 6DWXUGD\ 6HSW   SP  0DLQ/RFDODUWLVWVKDYHWUDQVIRUPHGVHFRQGKDQG ODPSVLQWRDUWIRUDVLOHQWDXFWLRQWRUDLVHPRQH\ IRU GRPHVWLF YLROHQFH SUHYHQWLRQ DQG HGXFDWLRQ /LYHPXVLFZLWKIDWKHUDQGGDXJKWHU-LPDQG$QQD /LHQDXRI%DQG$QQD Contra   dance   in   Middlebury. 6DWXUGD\ 6HSW   SP 0XQLFLSDO J\P $FFODLPHG PXVL-­ FLDQ DQG EDUQ GDQFH FDOOHU 'XGOH\ /DXIPDQ ZLOO EHFDOOLQJ$OOGDQFHVWDXJKWQRSDUWQHURUH[SHUL-­ HQFHQHFHVVDU\:HDUVRIWVROHGQRQVWUHHWVKRHV $GPLVVLRQ  &RVSRQVRUHG E\ WKH 0LGGOHEXU\ 5HF'HSDUWPHQWDQGWKH9HUPRQW)RONOLIH&HQWHU ,QIR Emily  Mure  in  concert  in  Brandon.6DWXUGD\6HSW   SP %UDQGRQ 0XVLF  &RXQWU\ &OXE 5RDG 0XUH LV D FODVVLFDOO\ WUDLQHG RERLVW WXUQHG VLQJHUVRQJZULWHU ZKR LQWHJUDWHV KHU FODV-­ VLFDO EDFNJURXQG ZLWK D IRON VW\OH RI VLQJLQJ $GPLVVLRQ  5HVHUYDWLRQV HQFRXUDJHG  RULQIR#EUDQGRQPXVLFQHW â&#x20AC;&#x153;Caesar   Must   Dieâ&#x20AC;?   screening   at   Middlebury   College. 6DWXUGD\ 6HSW   SP 'DQD

:RXOG \RX OLNH WR LQIRUP RXU FRPPXQLW\DERXWDQHYHQW"

For Sale

Weathered,  Hand-­â&#x20AC;?Split     Middlebury Town Green Saturday, September 28 www.addisonteens.com

Sep

SUNDAY

30

Last-­Sunday-­of-­the-­month  break-­ fast   in   Vergennes. 6XQGD\ 6HSW   DP 'RUFKHVWHU /RGJH 6FKRRO 6WUHHW7KH'RUFKHVWHU/RGJH) $0ZLOOVHUYHLWV UHJXODU DOO\RXFDQHDW EUHDNIDVW ZLWK SDQFDNHV )UHQFKWRDVWEDFRQVDXVDJHKRPHIULHVVFUDP-­ EOHGHJJVMXLFHDQGFRIIHH Vermont  Sun  Run  in  Salisbury.6XQGD\6HSW DPSP%UDQEXU\6WDWH3DUN&KRRVHIURPD ..RUKDOIPDUDWKRQ7KH.DQG.DUHDQ RXWDQGEDFNUXQRQ5RXWH,QIR Chicken  pie  dinner  in  West  Addison.6XQGD\6HSW   SP :HVW $GGLVRQ &RPPXQLW\ +RXVH 3OXV KRPHPDGH SLHV DQG SLFNOHV )LUVW VHDWLQJDWSP$GXOWVFKLOGUHQ FKLOGUHQDQGXQGHUIUHH Guided  history  walk  across  the  Lake  Champlain   Bridge. 6XQGD\ 6HSW   SP PHHW DW WKH &URZQ 3RLQW 1< PXVHXP 6WDWH KLVWRULF VLWH PDQDJHUV (OVD *LOEHUWVRQ RI &KLPQH\ 3RLQW 9W DQG7KRPDV +XJKHV RI &URZQ 3RLQW 1< SUHV-­ HQWÂł7KH6KRUWHVW'LVWDQFH%HWZHHQ7ZR3RLQWV´ D JXLGHG ZDON DFURVV WKH EULGJH H[SODLQLQJ WKH KLVWRU\RIZKDWFDQEHVHHQ%ULQJELQRFXODUV5DLQ RUVKLQH&RVW,QIR Hayride   in   Waltham. 6XQGD\ 6HSW   SP &RUFRUDQ IDUP *UHHQ 6WUHHW 7ZR ULGHV  DQG  SP 7KH %L[E\ /LEUDU\ VSRQVRUV WKLV IXQ DQG HGXFDWLRQ SURJUDP ZLWK SUHVHQWDWLRQV HQ URXWH WR LQWURGXFH QHZ ERRNV WR FKLOGUHQ RI DOO DJHV 9HUPRQW FLGHU DQG GRQXWV VHUYHG $GXOWV  FKLOGUHQ  IDPLOLHV  5HVHUYDWLRQV DQG LQIR 5DLQGDWH2FW7KH&RUFRUDQIDUPLV PLOHVIURP9HUJHQQHVPLOHVIURP5RXWH Young  childrenâ&#x20AC;&#x2122;s  story  presentation  in  Brandon.   6XQGD\ 6HSW   SP &RPSDVV 0XVLFDQG$UWV&HQWHU/RFDODXWKRU0DULO\Q7D\ORU 0F'RZHOOZLOOVKDUHVLPSOHVWRULHVIURP$SSDODFKLD XVLQJDĂ&#x20AC;DQQHOERDUG&KLOGUHQZLOOEHHQFRXUDJHG WRSDUWLFLSDWH5HIUHVKPHQWVZLOOEHVHUYHG7LFNHWV ,QIRZZZFPDFYWRUJ Hayride   in   Waltham. 6XQGD\ 6HSW   SP &RUFRUDQ IDUP *UHHQ 6WUHHW 7ZR ULGHV  DQG  SP 7KH %L[E\ /LEUDU\ VSRQVRUV WKLV SURJUDP IRU DGXOWV ZKLFK LQFOXGHV D SUHVHQWDWLRQ RQ QHZ ERRNV E\ 9HUPRQW DXWKRUV 9HUPRQW FLGHU DQG GRQXWVVHUYHG&RVWSHUSHUVRQ5HVHUYDWLRQV DQGLQIR5DLQGDWH2FW7KH&RUFRUDQ IDUP LV  PLOHV IURP 9HUJHQQHV  PLOHV IURP 5RXWH Story  presentation  in  Brandon.6XQGD\6HSW SP&RPSDVV0XVLFDQG$UWV&HQWHU3DUN 9LOODJH/RFDODXWKRU0DULO\Q7D\ORU0F'RZHOOZLOO WHOOVWRULHVWRFKLOGUHQ\HDUVDQGROGHUDVZHOO DVDGXOWVIRFXVLQJRQKHUKLJKO\DFFODLPHG\RXWK QRYHO Âł&DUROLQD +DUPRQ\´ 0F'RZHOO ZLOO WDON DERXWKHULQVSLUDWLRQIRUWKHVWRU\VHWLQWKH%OXH 5LGJH0RXQWDLQVDQGDQVZHUDXGLHQFHTXHVWLRQV 5HIUHVKPHQWV ZLOO EH VHUYHG 7LFNHWV  ,QIR ZZZFPDFYWRUJ Chicken  and  biscuit  supper  in  Middlebury.6XQGD\ 6HSWSP0LGGOHEXU\8QLWHG0HWKRGLVW &KXUFK&KLFNHQDQGELVFXLWVYHJHWDEOHVVDODGV DQGGHVVHUWV$OO\RXFDQHDW6XJJHVWHGGRQDWLRQ DGXOWVFKLOGUHQXQGHUIUHHEXWQR RQHWXUQHGDZD\,QIRRU Jamaican  Hymn  Sing  in  Shoreham.6XQGD\6HSW   SP 6KRUHKDP &RQJUHJDWLRQDO &KXUFK$QDQQXDOFHOHEUDWLRQLQVRQJSUHVHQWHG E\ WKH SHRSOH ZKR FRPH IURP -DPDLFD HDFK IDOO WR SLFN DSSOHV LQ ORFDO RUFKDUGV 5HIUHVKPHQWV

email us:

news@addisonindependent.com

50/Â&#x2022;Â&#x201C;Â&#x2014;Â&#x192;Â&#x201D;Â&#x2021;

$

Â&#x2014;Â&#x192;Â?Â&#x2013;Â&#x2039;Â&#x2013;Â&#x2039;Â&#x2021;Â&#x2022;Â&#x2021;Â&#x2030;Â&#x2018;Â&#x2013;Â&#x2039;Â&#x192;Â&#x201E;Â&#x17D;Â&#x2021;Ǩ

Â&#x2021;Â&#x2020;Â&#x2021;Â&#x2020;Â&#x192;Â&#x201D;Â&#x2018;Â&#x2018;Ď?Â&#x2039;Â?Â&#x2030;Â&#x160;Â&#x192;Â?Â&#x2021;Â&#x2022; Please Call Bristol Cliff Farms 453-3567

)UHHZLOORIIHULQJZLWKSURFHHGVJRLQJWRWKHVLQJ-­ HUVœKRPHFKXUFKHVLQ-DPDLFD

MONDAY

Author  talk   with   S.S.   Taylor   in   Middlebury. 0RQGD\ 6HSW   SPOOVOH\/LEUDU\$OODJHVDUHLQYLWHG WRPHHW667D\ORUDXWKRURI³7KH([SHGLWLRQHUV´ D '&)QRPLQDWHG VWHDPSXQN DGYHQWXUH %ULQJ TXHVWLRQVDQGERRNVWREHVLJQHG,QIR

Oct

2

WEDNESDAY

Flu  vaccine   clinic   in   Bridport.   :HGQHVGD\ 2FW   DPQRRQ %ULGSRUW *UDQJH +DOO 3DUW RI D VHULHV RI Ă&#x20AC;X YDFFLQH FOLQLFV DURXQG WKH FRXQW\ &RVW  EXWDUUDQJHPHQWVZLOOEHPDGHIRUWKRVHZKRFDQÂśW DIIRUG WKH IHH 0HGLFDLG DQG 0HGLFDUH UHFLSLHQWV DUH FRYHUHG 1RWH IUHH IRRW FOLQLF ZLOO EH KHOG DW WKHVDPHWLPH â&#x20AC;&#x153;Baby   and   Meâ&#x20AC;?   story   time   in   Middlebury.   :HGQHVGD\ 2FW   DP ,OVOH\ /LEUDU\ %RXQFH VLQJ DQG SOD\ ZLWK \RXU EDE\  PRQWKV DQGVLEOLQJVDWWKLV0RWKHU*RRVHLQVSLUHG VWRU\ WLPH 2QJRLQJ :HGQHVGD\V WKURXJK 'HF ,QIR Angelique   Kidjo   lecture   at   Middlebury   College.   :HGQHVGD\ 2FW   SP 0F&XOORXJK 6RFLDO 6SDFH *UDPP\$ZDUGZLQQLQJ DUWLVW DQG VRFLDODGYRFDWH$QJHOLTXH.LGMRZLOOMRLQ0LGGOHEXU\ IDFXOW\PHPEHU'DPDVFXV.DIXPEHLQFRQYHUVD-­ WLRQ)UHHDQGRSHQWRWKHSXEOLFZLWKSULRULW\VHDW-­ LQJJLYHQWRFROOHJH,'KROGHUV â&#x20AC;&#x153;Capture   the   Flag:   A   History   of   American   Patriotismâ&#x20AC;?  talk  in  Shoreham.:HGQHVGD\2FW SP6KRUHKDP(OHPHQWDU\6FKRRO$XWKRU :RGHQ7HDFKRXWH[DPLQHVKRZWKH$PHULFDQĂ&#x20AC;DJ KDVEHHQFDSWXUHGDQGFODLPHGE\DZLGHUDQJH RIRXUIHOORZFLWL]HQVWRXSKROGWKHLUYHUVLRQVRIWKH $PHULFDQ GUHDP$ 9HUPRQW +XPDQLWLHV &RXQFLO HYHQWKRVWHGE\WKH6KRUHKDP+LVWRULFDO6RFLHW\ )UHH,QIR â&#x20AC;&#x153;Margaret   Bourke-­White,   Courageous   Photographerâ&#x20AC;?   living   history   presentation   in   Middlebury. :HGQHVGD\ 2FW   SP ,OVOH\ 3XEOLF/LEUDU\$FWUHVVDQGHGXFDWRU6DOO\0DWVRQ SRUWUD\V0DUJDUHW%RXUNH:KLWHZKRVHLQĂ&#x20AC;XHQWLDO LPDJHV RI LQGXVWU\ ZDU ]RQHV DQG ZRUOG OHDGHUV HVWDEOLVKHGKHUDVDJURXQGEUHDNLQJSKRWRJUDSKHU IURPWKHVWRWKHV$9HUPRQW+XPDQLWLHV &RXQFLOHYHQW)UHH,QIR

LIVEMUSIC Standup  comedy   in   Middlebury. 7KXUVGD\ 6HSW SP7ZR%URWKHUV7DYHUQ BandAnna  in  Middlebury.)ULGD\6HSWSP 7ZR%URWKHUV7DYHUQ The   Cynthia   Braren   Trio   in   Middlebury. )ULGD\ 6HSWSP0DLQ Rehab  Roadhouse  in  Middlebury.)ULGD\6HSW SPDP7ZR%URWKHUV7DYHUQ Tumbleweed   Highway   in   Middlebury. 6DWXUGD\ 6HSWSPDP7ZR%URWKHUV7DYHUQ Pete   Sutherland   in   Shoreham. 6XQGD\ 6HSW  SP&KDPSODLQ2UFKDUGV Eight  02  in  Middlebury.)ULGD\2FWSP 0DLQ See  a  full  listing  of  

O N GO IN G EV ENTS in  the  Thursday  edition  of  the

Addison Independent and  on  the  Web  at  www.addisonindependent.com

APPLES! at

DOUGLAS ORCHARD

are ready for picking! call ahead for picking conditions

897-5043

1 mile west of Shoreham Village on Route 74


PAGE  10  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

&

Dining nm tai e

Enter

nt

Cynthia  Braren  Trio Friday,  Sept  27,  8-­â&#x20AC;?10pm The  Cynthia  Braren  Trio  showcases   a  blend  of  originals  and  current   covers  in  a  soulful  indie  jazz  style.

Shine  a  Light  for   ŽžÄ&#x17E;Ć?Ć&#x;Ä?sĹ?ŽůÄ&#x17E;ĹśÄ?Ä&#x17E; Saturday,  September  28  |  7-­â&#x20AC;?10pm The  Addison  County  Council   Ĺ?Ä&#x201A;Ĺ?ĹśĆ?Ć&#x161;ŽžÄ&#x17E;Ć?Ć&#x;Ä?Ä&#x201A;ĹśÄ&#x161;^Ä&#x17E;Ç&#x2020;ĆľÄ&#x201A;ĹŻ sĹ?ŽůÄ&#x17E;ĹśÄ?Ä&#x17E;Ĺ?Ć?ŽŜÄ?Ä&#x17E;Ä&#x201A;Ĺ?Ä&#x201A;Ĺ?ĹśĹ&#x161;Ĺ˝Ć?Ć&#x;ĹśĹ? Ć&#x161;Ĺ&#x161;Ä&#x17E;Ĺ?Ć&#x152;Ä&#x201A;ŜŜƾÄ&#x201A;ĹŻĆ?Ĺ?ĹŻÄ&#x17E;ĹśĆ&#x161;Ä&#x201A;ĆľÄ?Ć&#x;ŽŜŽĨ Ć?Ä&#x17E;Ä?ŽŜÄ&#x161;ͲĹ&#x161;Ä&#x201A;ĹśÄ&#x161;ĹŻÄ&#x201A;ĹľĆ&#x2030;Ć?Í&#x2022;Ä?Ä&#x17E;Ä&#x201A;ĆľĆ&#x;ĨƾůůÇ&#x2021; Ä?Ć&#x152;Ä&#x201A;Ĺ&#x152;Ä&#x17E;Ä&#x161;Ĺ?ĹśĆ&#x161;Ĺ˝Ć&#x2030;Ĺ?Ä&#x17E;Ä?Ä&#x17E;Ć?ŽĨÄ&#x201A;Ć&#x152;Ć&#x161;Ä?Ç&#x2021;ĹŻĹ˝Ä?Ä&#x201A;ĹŻ Ä&#x201A;Ć&#x152;Ć&#x;Ć?Ć&#x161;Ć?Í&#x2DC;ĹŻĹŻĆ&#x2030;Ć&#x152;Ĺ˝Ä?Ä&#x17E;Ä&#x17E;Ä&#x161;Ć?ĨĆ&#x152;ŽžĆ&#x161;Ĺ&#x161;Ä&#x17E; Ä&#x201A;ĆľÄ?Ć&#x;ŽŜÇ Ĺ?ĹŻĹŻĹ?Ĺ˝Ć&#x161;Ĺ˝Ç Ä&#x201A;Ć&#x152;Ä&#x161;^sÍ&#x203A;Ć? Ä?ŽŜĆ&#x;ŜƾÄ&#x201A;ĹŻÄ&#x17E;ÄŤĹ˝Ć&#x152;Ć&#x161;Ć?Ć&#x161;Ĺ˝Ĺ&#x161;Ä&#x17E;ĹŻĆ&#x2030;Ä&#x17E;Ä&#x161;ĆľÄ?Ä&#x201A;Ć&#x161;Ä&#x17E; our  community  and  service   Ć&#x2030;Ć&#x152;Ĺ˝Ç&#x20AC;Ĺ?Ä&#x161;Ä&#x17E;Ć&#x152;Ć?Ĺ?ĹśĆ&#x161;Ĺ&#x161;Ä&#x17E;Ć&#x2030;Ć&#x152;Ä&#x17E;Ç&#x20AC;Ä&#x17E;ĹśĆ&#x;ŽŜŽĨ Ä&#x161;ŽžÄ&#x17E;Ć?Ć&#x;Ä?ÍŹĆ?Ä&#x17E;Ç&#x2020;ĆľÄ&#x201A;ĹŻÇ&#x20AC;Ĺ?ŽůÄ&#x17E;ĹśÄ?Ä&#x17E;Í&#x2DC;>Ĺ?Ç&#x20AC;Ä&#x17E; žƾĆ?Ĺ?Ä?Ä?Ç&#x2021;:Ĺ?ĹľÄ&#x201A;ĹśÄ&#x161;ŜŜÄ&#x201A;>Ĺ?Ä&#x17E;ĹśÄ&#x201A;Ćľ of  BandAnna

Every Tuesday Night BURGER  &  BREW $

6

VERMONT BURGERS

$

3

SNAKE  MOUNTAIN  BLUEGRASS  &  THE  CONNOR  SISTERS

Goodtime bluegrass music comes to THT Friday Bluegrass  is   the   ultimate   good-­ time   music,   and   Snake   Mountain   Bluegrass   plays   some   of   the   best   around.  The  band  returns  to  Middle-­ bury   on   Friday   to   play   their   annual   gig  in  Town  Hall  Theater  at  8  p.m. Snake   Mountain   Bluegrass   is   a   four-­piece   band   based   in   Middle-­ bury.   Middlebury   College   teacher  

Ride, Roast, and Rock! Middlebury Town Green Saturday, September 28 www.addisonteens.com

Gregg  Humphrey   and   Middlebury   with   Connorâ&#x20AC;&#x2122;s   nieces,   the   Connor   construction   company   owner   Mike   Sisters  â&#x20AC;&#x201D;  Monica,  Katie  and  Megan.   Connor   formed   Snake   Mountain   Raised  on  a  local  farm,  they  started   Bluegrass   about   25   years   ago.   At   to   play   instruments   and   sing   under   the   time,   both   Humphrey   (guitar   WKHLQĂ&#x20AC;XHQFHRIWKHLUXQFOHÂł,ORYH the   sound   they   make,â&#x20AC;?   and   vocals)   and   Connor   says   THT   executive   di-­ (banjo  and  vocals)  were   rector   Douglas   Ander-­ living  near  Snake  Moun-­ son.  â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s  authentic  blue-­ tain,  and  when  someone   JUDVVDQGWKH\ÂśUHWHUULÂżF asked  them  what  style  of   musicians  as  well.â&#x20AC;? bluegrass   they   played,   Tickets  are  $17  gener-­ â&#x20AC;&#x153;Snake   Mountain   Blue-­ al,  $10  students,  and  may   grass,â&#x20AC;?   was   their   imme-­ diate  response.  Itâ&#x20AC;&#x2122;s  been   BY GREG PAHL be   purchased   at   town-­ halltheater.org,   382-­ the   bandâ&#x20AC;&#x2122;s   name   ever    DW WKH 7+7 ER[ RIÂżFH GDLO\ since. They   have   recently   released   two   except  Sunday,  noon  to  5  p.m.)  and   CDs,   â&#x20AC;&#x153;â&#x20AC;&#x2122;Bout   Time,â&#x20AC;?   which   features   at  the  door,  if  available. their  unique  blend  of  bluegrass  mu-­ EMILY  MURE  IN  BRANDON On   Saturday   at   7:30   pm,   Bran-­ sic   and   tight   harmony   singing,   and   â&#x20AC;&#x153;Under  the  Radar,â&#x20AC;?  where  they  have   don   Music   presents   Emily   Mure,   a   classically   trained   musician   turned   included  seven  original  songs. Lately  the  band  has  joined  forces   singer-­songwriter.  Mure  has  extraor-­ dinary  talent  for  integrating  her  clas-­ sical  background  with  a  folk  style  of   singing  and  songwriting. After  high  school,  Mure  furthered  

arts beat

her  music   education   at   Ithaca   Col-­ lege  where  she  discovered  folk  and   bluegrass  music  and  learned  to  play   guitar.  It  is  there  that  she  fell  in  love   with   Irish   traditional   music,   which   inspired   her   to   study   Irish   Celtic   music  at  the  University  of  Limerick.   After  graduation,  she  moved  to  Gal-­ way  and  began  her  performance  ca-­ reer  as  a  songwriter,  making  her  liv-­ ing  busking  on  the  streets  of  Ireland   for  six  months. Mure   returned   to   New   York   in    ZKHUH VKH UHOHDVHG KHU ÂżUVW full-­length  album,  â&#x20AC;&#x153;Where  I  Began.â&#x20AC;?   Her   second   album,   â&#x20AC;&#x153;Odysseyâ&#x20AC;?   was   released  this  summer.  Mureâ&#x20AC;&#x2122;s  songs   have  been  featured  on  TV  networks   including  ABC  and  PBS. General   admission   is   $15   with   a   pre-­concert  dinner  available  for  $15.   Reservations  are  encouraged.  Venue   is   BYOB.   Call   465-­4071   or   e-­mail   info@brandon-­music.net   for   res-­ ervations   or   information.   Brandon   Music  is  located  at  62  Country  Club   (See  Arts  Beat,  Page  11)

VERMONT PINTS

Every Wednesday Night FAMILY  GAME  NIGHT Bring in your favorite board game or play one of ours! Kids Under 10 Eat Free! (off the kids menu with each adult meal purchased).

Cleverly located at 51  Main  Street    Middlebury,  V T

go51main.com

SHINE  A  LIGHT  ON  DOMESTIC  VIOLENCE


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  11

Cosmic Forecast For the week of September 23

EMILY Â MORE

Arts  Beat (Continued  from  Page  10) Road  in  Brandon.  For  additional  in-­ formation,  visit  brandon-­music.net. DUDLEY  LAUFMAN On   Saturday,   at   7:30   p.m.,   re-­ nowned   musician   and   caller   Dud-­ ley   Laufman   of   Canterbury,   N.H.   will   play   for   a   contra   dance   at   the   Middlebury  Municipal  Gymnasium.   Laufman  will  be  joined  by  his  wife,   -DFTXHOLQHZKRLVDOVRDÂżGGOHUDV well  as  a  number  of  other  local  mu-­ sicians. At  82,  Laufman  has  been  dubbed   an  â&#x20AC;&#x153;elder  statesman  of  the  American   folk  dance  scene,â&#x20AC;?  having  called  his   ÂżUVWGDQFHLQ+HLVWKHEULGJH generation   between   the   old-­time   New   England   village   dance   tradi-­ tion   and   the   counterculture   revival   of   contra   dancing   that   began   in   the   1970s.   â&#x20AC;&#x153;Dudley   dancesâ&#x20AC;?   in   such   communities   as   South   Strafford   were  legendary  events. The   dance   will   be   held   in   the   gymnasium   adjoining   the   Middle-­ EXU\WRZQRIÂżFHV$OOGDQFHVZLOOEH taught.   No   partner   or   prior   experi-­ ence  is  necessary.  All  ages  are  wel-­ come.   Soft-­soled,   non-­street   shoes   are  required.  This  dance  is  part  of  a   long  local  heritage  of  social  dances,   which  offer  an  excellent  way  to  meet  

new  people. For   more   information   call   the   Middlebury  Rec  Department  at  388-­ 7828   or   visit   the   Vermont   Folklife   Centerâ&#x20AC;&#x2122;s  website  at  vermontfolklife-­ center.org. â&#x20AC;&#x2DC;VPR  A-­GO-­GOâ&#x20AC;&#x2122;  AT  THT Heâ&#x20AC;&#x2122;s  been  on  the  air  with  Vermont   Public   Radio   for   30   years,   and   his   show,   â&#x20AC;&#x153;My   Place,â&#x20AC;?   has   thousands   of  loyal  fans.  But  he  started  his  Ver-­ mont  broadcasting  career  in  Middle-­ bury. Joel  Najman  attended  Middlebury   College   and   in   1965   he   worked   at   station   WFAD.   His   50-­year   broad-­ casting   career   is   being   celebrated   back   in   the   town   where   he   got   his   start,  as  Vermont  Public  Radio  pres-­ ents  â&#x20AC;&#x153;VPR  A-­Go-­Goâ&#x20AC;?  at  Town  Hall   Theater  on  Saturday,  at  7  p.m. In  a  sense,  Najman  has  never  left   the  1960s  and  the  preceding  decade,   as  he  mines  that  period  every  week   on   his   radio   show   for   classic   rock-­ and-­roll  hits  and  forgotten  gems. At   Town   Hall   Theater,   Najman   will   be   spinning   his   favorite   tunes,   sharing  stories  and  getting  everyone   on  their  feet.  There  will  be  a  Twister   tournament,  prizes  for  the  best  hair-­ do,  go-­go  dancers  and  refreshments.   (See  Beat,  Page  13)

LIBRA:  SEPTEMBER   23-­OCTOBER   23   You   LQJ ZHHNV VR ÂżQG QHZ LQVSLUDWLRQ DQG WKLQJV ZLOO may   be   excited   about   an   upcoming   event   or   get-­ go  smoothly. away,  but  donâ&#x20AC;&#x2122;t  let  your  anticipation  get  the  best  of   GEMINI:   MAY   22-­JUNE   21   Keep   your   head   you.   Remember,   you   do   on   straight   over   the   next   need  to  plan  and  pack. ZHHNZKLFKÂżJXUHVWREH SCORPIO:   OCTOBER   hectic.  Cool  heads  always   24-­NOVEMBER   22   Em-­ prevail,  and  your  calm  ap-­ brace   a   challenge   that   proach  will  be  noticed  by   presents   itself   this   week.   others. No  matter  the  scale  of  the   CANCER:   JUNE   22-­ challenge,   you   will   soon   JULY   22   Your   ingenuity   ÂżQG\RXÂśUHXSWRLWDQGVR is   treasured   among   the   will  those  around  you. people  closest  to  you,  but     SAGITTARIUS:   NO-­ those   who   do   not   know   VEMBER   23-­DECEM-­ you   may   be   unfamiliar   383  Exchange  Street BER   21   Be   open   to   new   with   the   tricks   you   have   Â&#x2026;ÂĄÂ&#x153;Â&#x153;¤Â?Â&#x161;­ª¹Ă&#x2C6;388-­2221 experiences,   as   you   do   up  your  sleeve.  Take  time   not   know   when   surprises   to  show  them.   are  going  to  come  around   www.cacklinhens.com LEO:   JULY   23-­AU-­ the   bend.   This   week   may   GUST   23   Someone   prove   to   be   a   real   eye-­ wants   to   take   your   rela-­ opener. tionship  to  another  level,   CAPRICORN:   DE-­ so   let   this   person   know   CEMBER   22-­JANUARY   you  are  on  the  same  page.   20   Itâ&#x20AC;&#x2122;s   time   to   ditch   any   Otherwise,  you  both  may   bad   habits   that   have   been   EHĂ&#x20AC;RXQGHULQJDURXQGIRU holding   you   back.   Set   some  time. a   new   course,   with   new   VIRGO:   AUGUST   goals,   and   those   old   hab-­ 24-­SEPTEMBER   22   its   will   soon   be   an   after-­ Good   news   awaits   on   thought.   the   job   this   week,   even   388-2800 AQUARIUS:   JANU-­ if   it   is   totally   unexpect-­ Friendly  Service!  Convenient  Location! ARY   21-­FEBRUARY   ed.   Nonetheless,   it   can   Located  in  The  Little  Red  School  House   18  A   heightened   sense   of   be   exciting   to   know   that   on  Route  7  South,  Middlebury urgency   may   have   you   someone   is   watching   out   Mon.-­Fri.  9-­5:30,  Sat.  9-­2   jumping   into   a   situation.   for  you. ZZZPLGGOHEXU\Ă&#x20AC;RUDODQGJLIWVFRP But  give  this  situation  the   careful   consideration   it   FAMOUS deserves.   Keep   your   eyes   BIRTHDAYS on  the  future.   SEPTEMBER  22 Save on PISCES:   FEBRUARY   Bruce  Springsteen,   Hardwood, 19-­MARCH   20   Now   is   Singer  (64) the   time   to   redirect   some   SEPTEMBER  23 Laminates, of  your  professional  ambi-­ Robert  Irvine, Cork, Bamboo, tions  to  your  personal  life.   Chef  (49) Carpeting, Itâ&#x20AC;&#x2122;s   an   effort   worth   mak-­ SEPTEMBER  24 ing. Mark  Hamill, Tile & More! ARIES:   MARCH   Actor  (62) 21-­APRIL   20   Someone   SEPTEMBER  25 whose   opinion   matters   to   Shawn  Stockman,   you   may   disagree   with   Singer  (41) you  on  an  important  point.   SEPTEMBER  26 &UHHN5G0LGGOHEXU\Â&#x2021;0)Â&#x2021;6DW Use   your   powers   of   per-­ Meat  Loaf,  Singer  (66) Â&#x2021; www.countrysidecarpetandpaint.com suasion,   and   both   of   you   SEPTEMBER  27 will  be  better  for  it. Gwyneth  Paltrow,   TAURUS:   APRIL   21-­ Actress  (41) MAY  21  Take  your  upbeat  attitude  to  new  heights   SEPTEMBER  28 this  week.  New  challenges  will  emerge  in  the  com-­ Hilary  Duff,  Actress  (26)

Give   someone    a   handmade    hug.   Come    see    our    yarns    for   a    blanket    or    shrug.

Is your home ready for winter? Plan  ahead  with  our

House & Home Issue JOEL Â NAJMAN

Coming October 3rd


PAGE 12  —  Addison  Independent,  Monday,  September  23,  2013

PUZZLES

Sponsored by:

help keep the mind independent and active throughout life.

This week’s  puzzle  is  rated Across

67. Microbes

1. Sunrise  direction

69. “___  Heartbeat”   (Amy  Grant  hit)

5. Be  in  the  red 8.  Land  area 12.  Javelin 14.  3ROLVKWKHÀRRU 15.  Fuzzy  food 16.  Lean

19. Without  exception 20.  Damage  beyond  use   or  repair 23.  Cheerful 24.  “I  agree” 25.  Not  happy 26.  Transmit 27.  Espies 30.  Beaver’s  place 32.  Popped  up 36.  Black,  of  a  spider 40.  Takes  off  the  outside 41.  Container 43.  Divorced 44.  Swap 45.  Stole 47.  Hoary 49.  Water  plant 50.  Weaver’s  apparatus 53.  “___  alive!” 56.  “Dear  old”  guy 59.  Grimm  character 60.  Productive,  of  soil 63.  “We  ___  the  World” 64.  Animated 66.  Piece  of  corn

1

37. Red___  sight

71. Kind  of  salad

42. Correlative  neither

72. Advanced

46. Basic  unit  of  life

73. %R'HUHN¿OP

48. Fail

74. Combines  numbers

50. Carpenter’s  tool

32

51. Greenish

40

52. Usually

1. Short  literary   composition

54. Dutch  item

4. Cigarette  component 5.  Mice  catchers 6.  Hangs  around  for   something

4

5 13

19

39. Bound

Down

3. Elite  military  group

3

16

38. Undivided

2. I-­pod  maker

2

12

35. Swim

70. “Give  it  ___!”  (2   words)

17. 6HWD¿UH 18.  Correspond

Easy

20

15

17

18

21

22

33

28

34

35

47

59

60. Pant  zipper

64

42

51

48

52

53

11

37

38

39

56

57

58

31

43 46

49 54

60

55 61

65

10

23

36

45

55. Set  up

58. Pulpits

30

41

9

26

29

44

50

8

25 27

57. Prepared  for  war

7

14

24

56. Ventured

6

62

66

67 71

63 68

61. “The  Masters”  need

7. Crowd  actor  in  a   movie

62. Easter  item

69

70

65. *DUIXQNHO¿UVWQDPH

72

73

8. Place  to  hang  your   hat

68. Notable  time

74

9. The  “L”  of  XXL 10.  Slew 11.  They  would

5

13. Comedian  Skelton 15.  Salary 21.  By  any  chance 22.  “The  __  Couple”

1

7 5 2

3

4 8

26. Made  a  happy  face 27.  Not  often 29.  All  the  china

4 2

8

3

31. Not  out

1

7

4

32. Inclined

6

28. Atelier  item

33. The  “p”  in  r.p.m. 34.  Stew  morsel

-1,*,- Ê-œ“iœ˜iÊ-«iVˆ> with great gifts from Rainbow Room!

ÇÓÊ>ˆ˜Ê-ÌÀiiÌ]ʈ``iLÕÀÞÊUÊÎnn‡ÈnΣÊUÊ"«i˜Ê ÛiÀÞÊ >Þ

This week’s  puzzle  solutions can  be  found  on  Page  35.

5

7

8 9

2

8

4 6

5 1 8

9

3

2

9 4

Sudoku Each Sudoku  puzzle  consists  of  a  9x9  grid  that  has  been   subdivided  into  nine  smaller  grids  of  3x3  squares.  To  solve  the   puzzle  each  row,  column  and  box  must  contain  each  of  the   numbers  1  to  9.  Puzzles  come  in  three  grades:  easy,  medium   DQGGLI¿FXOW Level:  Medium.    


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  13

Beat (Continued  from  Page  11) Mod   costumes   are   highly   encour-­ aged. To  be  admitted  to  the  event  people   need  only  to  present  a  non-­perishable   food   item   that   will   be   donated   to   HOPE. TWO  BROTHERS  TAVERN There  will  be  four  live  musical  per-­ formances  this  week  at  Two  Brothers   Tavern  in  Middlebury.   On   Thursday,   Two   Brothers   pres-­ ents   the   Vermont   Comedy   Club   Showcase,  at  8  p.m.  Experienced  lo-­ cal  comedians  provide  laughs  in  the   Lounge  â&#x20AC;&#x201D;  with  a  little  something  for   everyone.  All  ages  welcome.  There  is   a  $3  cover  charge. At  6  p.m.  on  Friday,  Two  Brothers   presents   BandAnna.   With   powerful,   soulful  vocals  backed  by  a  tight  group   of   veteran   blues   players,   BandAnna   plays  an  exciting  mix  of  music  styles.   Reservations   and   walk-­ins   welcome   for   this   special   dinner-­hour   show   in   the  Lounge.  There  is  a  $3  cover. Then,  at  10  p.m.  on  Friday,  Rehab   Roadhouse  takes  to  the  stage.  Rehab   5RDGKRXVH FRPELQHV WKH LQĂ&#x20AC;XHQFHV of  Bruce  Springsteen,  AC/DC,  Phish   and  the  Grateful  Dead  together  into  a   sonic  stew  that  is  sure  to  satisfy  your   aural  palette.  There  is  a  $3  cover. Finally,   at   10   p.m.   on   Saturday,   Tumbleweed  Highway  will  perform.   Their  shows  are  known  for  extended   jams,  zydeco  grooves,  soulful  ballads  

and  upbeat   honky-­tonk   tunes.  There   is  a  $3  cover.  For  more  information,   call  388-­0002. LIVE  MUSIC  AT  51  MAIN There   will   be   two   live   musical   events  this  week  at  Middleburyâ&#x20AC;&#x2122;s  51   Main.  On  Friday,  the  Cynthia  Braren   Trio  will  perform  at  8  p.m.  The  trio   showcases   a   blend   of   originals   and   current  covers  in  a  soulful  indie  jazz   style. Then,   at   7   p.m.   on   Saturday,   51   Main  presents  Shine  a  Light  on  Do-­ mestic  Violence.  The  Addison  Coun-­ ty   Council   Against   Domestic   and   Sexual   Violence   is   once   again   host-­ ing   its   annual   silent   auction   of   sec-­ ond-­hand   lamps,   beautifully   crafted   into  pieces  of  art  by  local  artists.  All   proceeds  from  the  auction  will  go  to-­ ward  ACCADSVâ&#x20AC;&#x2122;s   continual   efforts   to   help   educate   our   community   and   service  providers  in  the  prevention  of   domestic/sexual   violence.   Live   mu-­ sic  will  be  provided  by  Jim  and  Anna   Lienau  of  BandAnna. All   ages,   no   cover.   For   additional   information   visit   www.go51main. com  or  phone  388-­8209. DOVER  &  GORMAN   Connie   Dover   and   Skip   Gorman   will   perform   in   the   First   Baptist   Church,   10   Park   St.   in   Bristol,   on   Thursday  at  7  p.m. Join   this   wonderful   duo   as   they   explore   the   Celtic   roots   of   cowboy   PXVLF ZLWK ÂżGGOH PDQGROLQ DQG

guitar.  â&#x20AC;&#x153;Just   occasionally,   a   voice   arrives   on   the   folk   scene   that   is   so   pure,  so  beautiful,  so  magical,  that  it   tells  you:  This  is  how  to  sing  a  song.   Such   a   voice   has   Connie   Dover,â&#x20AC;?   says   The   Scotsman   (Scotlandâ&#x20AC;&#x2122;s   na-­ tional  newspaper). Tickets   are   $20   in   advance   or   at   the  door.  All  tickets  purchased  prior   to  4  p.m.  on  Thursday  include  a  $10   Bobcat   Cafe   &   Brewery   Gift   Cer-­ WLÂżFDWH YDOLGRQWKHGD\RIWKHSHU-­ formance,  before  or  after  the  show).   For  more  information  or  to  purchase   tickets,  call  453-­5982.  To  make  din-­ ner   reservations   at   the   Bobcat,   call   453-­3311. INTâ&#x20AC;&#x2122;L  FILM  SERIES The   exciting   2013-­2014   Middle-­ bury   College   International   Film   Se-­ ries   continues   on   Saturday   with   the   ,WDOLDQÂżOPÂł&DHVDU0XVW'LH´ Set   inside   the   high-­security   wing   RI 5RPHÂśV 5HEELD SULVRQ WKLV ÂżOP follows  a  group  of  inmatesâ&#x20AC;&#x2122;  produc-­ tion   of   â&#x20AC;&#x153;Julius   Caesar.â&#x20AC;?   Directors   Paolo  and  Vittorio  Taviani  use  pris-­ oners   as   their   actors,   mixing   narra-­ tive   and   documentary   together.   Ul-­ WLPDWHO\WKHÂżOPH[SORUHVWKHHIIHFW of  art  on  life  and  vice  versa. 7KH ÂżOP LQ ,WDOLDQ ZLWK (QJOLVK subtitles,   will   be   shown   at   3   and   again  at  8  p.m.  in  Dana  Auditorium.   ,WÂśV IUHH 6RPH RI WKH ÂżOPV LQ WKLV series  may  be  inappropriate  for  chil-­ dren.

KIRK Â WEBSTER

Beekeeping  presentation  on  tap NEW  HAVEN  â&#x20AC;&#x201D;  Kirk  Webster   of   Champlain   Valley   Bees   and   Queens,  will  be  at  the  New  Haven   Community  Library  on  Thursday,   Sept.   26,   at   7   p.m.   to   present   a   program   titled   â&#x20AC;&#x153;Beekeeping   in   Addison  County.â&#x20AC;? Webster,   who   has   been   keep-­

ing  bees  in  Addison  County  since   the   1980s,   will   answer   audience   questions   about   beekeeping   and   share  his  extensive  knowledge  of   bees   and   their   environment.   All   are  welcome. For  further  information,  call  the   library  at  453-­4015.

'"--41&$*"-4

Field Ready Fall Service Specials Fall  Service  for  your  compact  tractor,  ZD  and  ZG   Zero  turn  mowers:  Fuel  Filter,  Engine  Oil,  Engine   Oil  Filter,  Hydraulic  Filter,  Grease  &  Sharpen   Blades.  Full  unit  inspection. Pickup  &  delivery  included  (within  30  mile  radius)

NEW HOLLAND 18-­26HP  $360 27-­34HP  $395 35-­45HP  $475

KUBOTA

BX  Series  $360 B  Series  $395 L  Series  $475

KUBOTA ZG/ZD

ZG  100  Series  $300 ZD/ZG  Series  $405

Kubota Mower Sale Kubota GR 2020 w/48â&#x20AC;?  mower  deck,  gas,  4wd  ....... $7,536* Kubota GR 2120 w/48â&#x20AC;?  mower  deck,  diesel,  4wd  ... $8,144* Kubota GR 2120 w/54â&#x20AC;?  mower  deck,  diesel,  4wd  ... $8,410* Kubota ZD 221 w/48â&#x20AC;?  mower  deck,  demo  ............ $9,977* Kubota ZG 326 w/60â&#x20AC;?  mower  deck  .................... $11,776* Kubota ZG 332 w/72â&#x20AC;?  mower  deck  .................... $12,132* *Prices  limited  to  in-­store  stock  only.    Must  present  a  copy  of  this  ad    for  the  above  prices.

End of Season Implement Close Out TENNESSEE RIVER IMPLEMENTS: Rear Blades  starting  at  $377  w/adjustable  off  set. Box Scrapers  starting  at  $483 Rotary Cutters  starting  at  $939  &  free  local  delivery TAYLOR PITTSBURG ROTARY TILLERS: Model 923  â&#x20AC;&#x201C;  48â&#x20AC;?  gear  drive  $1,579 Model 962  â&#x20AC;&#x201C;  60â&#x20AC;?  gear  drive  $1,785

Winterâ&#x20AC;&#x2122;s Almost Here!

Donâ&#x20AC;&#x2122;t forget about your winter equipment needs. Come see us for great deals on: TIRE  CHAINS,  TRACTOR  MOUNTED  SNOW   BLADES,  SNOW  BLOWERS,  WOOD  SPLITTERS,   CHAIN  SAWS,  FARMI  LOGGING  WINCHES  AND  MORE!

&YDIBOHF4USFFUt.JEEMFCVSZtt$IBNQMBJOWBMMFZFRVJQNFOUDPN


PAGE  14  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

A  winning  college  essay

Brandon chef receives top Vt. honors

BRANDON  â&#x20AC;&#x201D;  Chef  Robert  Barral,  ex-­ ecutive   chef/owner   of   CafĂŠ   Provence   in   Brandon,  has  been  selected  as  Chef  of  the   Year   by   the   Vermont   Chamber   of   Com-­ merce.   The   award   was   bestowed   at   the   Vermont   Chamber   Hospitality   Gala,   held   at   the   Mountain   Top   Inn   and   Resort   on   Sept.  10  in  Chittenden. Barral  is  originally  from  the  Montpelier   area  in  France.  He  has  been  the  executive   FKHILQVRPHRIWKHÂżQHVWNLWFKHQVLQWKH world,  including  the  Four  Seasons  in  Bos-­ ton,   the   New   England   Culinary   Institute   and   CafĂŠ   Provence,   which   he   opened   in   2004. %DUUDOFRQWLQXHVWRWHDFKFRRNLQJFODVV-­ HVHYHU\ZHHNLQWKHUHVWDXUDQWÂśVFXOLQDU\ theater.   He   is   a   regular   contributor   to   :&$;79ÂśV PRUQLQJ QHZV VKRZ ZKHUH KHGHPRQVWUDWHVJUHDWFRRNLQJWHFKQLTXHV He,   along   with   his   business   partner   Line  Barral  recently  received  the  Brandon   &KDPEHURI&RPPHUFH3UHVLGHQWÂśV$ZDUG Other  honorees  at  the  gala  include  Beth   .HQQHWW RI /LEHUW\ +LOO )DUP ,QQNHHSHU RIWKH<HDU7RGG3DWRQRI5RFNRI$JHV Allied   Member   of   the  Year;Íž   and   Jed   Da-­ vis,  Rob  Downey,  Paul  Sayler  and  Phillip   Clayton  of  The  Farmhouse  Group,  Restau-­ rateurs  of  the  Year.

Ilsley  Library  to  host workshop  for  students

CHEF  ROBERT  BARRAL

MIDDLEBURY  â&#x20AC;&#x201D;   Strategies   mont  and  Andrea  L.  Torello.  Verman   for   College   (SFC)   will   offer   a   free   KDV  \HDUVÂś H[SHULHQFH JXLGLQJ ZRUNVKRSFDOOHGÂł:ULWLQJD:LQQLQJ young  people  as  a  teacher,  a  leader  in   College  Essayâ&#x20AC;?  on  Wednesday,  Sept.   innovative  education,  a  principal  and   25,   from   6:30   to   8:30   p.m.   in   the   as  partner  at  SFC.  He  has  visited  135   Community   Room   at   the   Ilsley   Li-­ colleges   and   advised   students   from   EUDU\LQ0LGGOHEXU\7KHZRUNVKRS six   states   and   Canada.   Torello   has   is  for  high  school  juniors  and  seniors   VSHQW  \HDUV ZRUNLQJ ZLWK \RXWK who  are  planning  to  go  on  to  college   as  a  teacher,  a  guidance  director  and   DQGZKRDUHVHHNLQJKHOSEHJLQQLQJ founder   of   College   Bound.   Torello   drafting   or   editing   their   college   es-­ is  also  a  senior  associate  with  SFC.   says. Torello   has   visited   col-­ 7KHZRUNVKRSZLOOEH The workshop leges   across   the   United   led  by  author,  editor  and   will be led by States,   Canada,   and   the   theater   director   Eliza-­ Kingdom.   The   author, editor United   beth   Leroux.   Leroux   three  presenters  have  30   will   facilitate   a   number   and theater \HDUVÂśH[SHULHQFHLQWKH of  activities  from  getting   director college   consultant   busi-­ LGHDV WR Ă&#x20AC;RZ WR ÂżQGLQJ Elizabeth ness. your   voice,   to   editing   a   7KH ZRUNVKRS LV ÂżQDOGUDIW6WXGHQWVZLOO Leroux. limited   to   30   partici-­ be   actively   involved   in   Leroux will SDQWV 7KH ZRUNVKRS exercises   throughout   facilitate a is   free   but   registration   WKH ZRUNVKRS LQFOXG-­ number of LVUHTXLUHG7RUHJLVWHU ing   reviewing   accepted   contact   Andrea   Torello   VWXGHQWVÂś HVVD\V DQG activities at   andrea@strategies-­ ZLOOOHDYHWKHZRUNVKRS from getting forcollege.com.   Reg-­ with  ideas,  direction  and   LGHDVWRĂ RZ LVWUDWLRQ FRQÂżUPDWLRQ resources. DQGVRPHSUHZRUNVKRS WRĂ&#x20AC;QGLQJ Leroux   brings   20   reading  will  be  sent  via   years   of   experience   your voice, to return  email. ZRUNLQJ ZLWK KLJK HGLWLQJDĂ&#x20AC;QDO SFC   has   been   coun-­ school   students   to   her   draft. seling   students   and   ZRUN 6KH LV D FHUWL-­ families   on   the   col-­ ÂżHG VHFRQGDU\ (QJOLVK lege   search   and   ap-­ teacher  with  an  MA  from  Columbia.   SOLFDWLRQ SURFHVV DQG RQ ÂżQDQFLQJ She  is  also  a  seasoned  theater  direc-­ post-­secondary   education   for   the   tor  with  25  productions  to  her  credit.   SDVW  \HDUV 6)& KDV ÂżYH RIÂżFHV Her   combined   experience   in   writ-­ in   Vermont,   New   Hampshire   and   LQJ HGLWLQJ DQG WKHDWHU PDNH KHU D Massachusetts,   including   its   new-­ dynamic   presenter.   She   currently   HVWRIÂżFHLQ0LGGOHEXU\LQWKH6WDUU advises   50   seniors   on   their   college   0LOO %XLOGLQJ RQ 3DUN 6WUHHW )RU essays.   PRUH LQIRUPDWLRQ RQ 6)&ÂśV XQLTXH Leroux  will  be  joined  by  two  ex-­ DSSURDFK WR ÂżQGLQJ DQ DIIRUGDEOH perts  in  the  college  search,  selection   post-­secondary  solution  go  to  www. DQG DSSOLFDWLRQ ÂżHOG +RZDUG 9HU-­ strategiesforcollege.net.  


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  15

READ. LEARN. GIVE.

Best of Luck in the future to all Addison County Students!

We reward each Student of the Weekâ&#x20AC;&#x2122;s achievement!

[]

www.vermontbookshop.com 38 MAIN ST Middlebury

802-388-2061

ADDISON COUNTY

INDEPENDENT

VERMONTâ&#x20AC;&#x2122;S TWICE-­WEEKLY NEWSPAPER 0LGGOHEXU\97Â&#x2021;  Â&#x2021;ZZZ$GGLVRQ,QGHSHQGHQWFRP

Students of the Week from area High Schools

Middlebury Union High School

Middlebury  Union  High  School  is  pleased  to  recognize  Katherine   â&#x20AC;&#x153;Kateâ&#x20AC;?  Knowles  as  its  Student  of  the  Week.  Kate  is  the  daughter  of   Larry   Knowles   of   Middlebury   and  Anne   Knowles   of   Cornwall.   She   was  presented  with  the  Dorey  Cup  last  June,  an  honor  bestowed  on   RQHPDOHDQGRQHIHPDOHVWXGHQWLQJUDGHVLQFHIRURYHUDOO athletic  ability,  leadership,  scholarship  and  moral  integrity. ,QJUDGH.DWHUHFHLYHGWKH+LJK+RQRU$ZDUGIURPWKH6RFLHW\ of   Women   Engineers.   Kate   has   achieved   academic   High   Honors   and   Honors   for   the   past   three   years   and   received   the   Presidentâ&#x20AC;&#x2122;s   $ZDUGIRU$FDGHPLF([FHOOHQFHLQJUDGHVDQG6KHUHFHLYHG Honorable   Mention   for   the   American   Legion   Department   Awards   LQ (QJOLVK LQ JUDGHV  DQG  DQG VFLHQFH LQ JUDGH  .DWH KDV completed  AP   U.S.   History,  AP   Calculus   I   and   II   and  AP   Biology.   She  is  currently  enrolled  in  AP  courses  in  World  History,  Statistics   and  English. Kate  is  a  member  of  the  National  Honor  Society  and  is  a  peer   OHDGHU IRU JUDGH  VWXGHQWV WR DLG LQ WKH VXFFHVVIXO WUDQVLWLRQ WR KLJK VFKRRO 6KH KDV FRPSHWHG RQ WKH YDUVLW\ ÂżHOG KRFNH\ WHDP all   four   years,   serving   as   its   captain   this   year.   Kate   has   been   a   representative   to   the   Student   Senate.   She   plays   bassoon   in   the   Katherine  â&#x20AC;&#x153;Kateâ&#x20AC;?  Knowles MUHS  Concert  Band,  and  traveled  to  New  York  City  to  play  in  the   M.U.H.S. 6W3DWULFNÂśV'D\3DUDGHLQJUDGH Last  April,  Kate  traveled  to  France  with  the  MUHS  French  Program.  Kate  has  been  involved  in  community  service  projects.   6KHYROXQWHHUHGDVDWXWRULQWKH/HDUQLQJ/DELQJUDGH.DWHKDVDVVLVWHGZLWKDÂżHOGKRFNH\FOLQLFIRUHOHPHQWDU\VFKRRO VWXGHQWVIRUWKHSDVWIRXU\HDUV6KHKDVDOVRYROXQWHHUHGIRUFRPPXQLW\VXSSHUVDVZHOO7KLVIDOOVKHZLOODVVLVWLQD classroom  at  the  Cornwall  Elementary  School. Outside  of  school,  Kate  participates  in  Eventing  Competitions,  showing  her  horse,  Nugget,  all  over  New  England  and  in   WKH$UHD&KDPSLRQVKLSV7KLVSDVWVXPPHUVKHZRUNHGDWWKH1RUWK)HUULVEXUJK$UEURRNEDUQLQDGGLWLRQWRDWWHQGLQJ the  Middlebury  College  Field  Hockey  Camp.   7UDYHOKDVEHHQSDUWRIKHUOLIHVKHZDVERUQLQ:DOHV6KHDWWHQGHGWKH2O\PSLFVLQ/RQGRQ$VDQDYLG$OSLQH VNLHU.DWHWUDYHOVRXW:HVWHYHU\\HDUWRVNLLQSODFHVOLNH8WDK%ULWLVK&ROXPELDHWF7KLV\HDUVKHLVORRNLQJIRUZDUGWR skiing  in  Jackson  Hole,  Wyo. .DWHZLOODWWHQGDIRXU\HDUFROOHJHDQGLVSODQQLQJWRJUDGXDWHZLWKD%DFKHORURI$UWVGHJUHH2XUFRPPXQLW\ZLVKHV Kate  the  very  best  in  all  her  future  endeavors.  Congratulations  Kate  from  everyone  at  MUHS!

Middlebury  Students  of  the  Week  receive  a  free  pizza  from  Green  Peppers.

Vergennes Union High School

Vergennes  Union   High   School   is   pleased   to   recognize   Phoebe   Plank  as  its  Student  of  the  Week.  Phoebe  lives  in  North  Ferrisburgh   with  her  mom,  Karen  Petersen,  and  dad,  Kurt  Plank.  She  has  two  older   sisters,  Margo  Plank  who  graduated  from  UVM  and  Karla  Plank  who  is   attending  nursing  school. Phoebe  was  elected  to  the  National  Honor  Society  as  a  junior  and   is   currently   the   vice   president.   She   has   been   on   the   honors   or   high   honor  roll  since  freshman  year.  Phoebe  has  completed  both  Advanced   Placement   Calculus   and   Language/Composition.   Currently,   she   is   taking  AP  Biology  and  European  History.     As  a  member  of  the  VUHS  community,  Phoebe  has  played  varsity   soccer  and  varsity  softball.  Phoebe  is  a  very  active  in  the  high  schoolâ&#x20AC;&#x2122;s   band  and  chorus,  and  has  been  elected  the  president  for  both.  She   plays  in  the  Commodore  jazz  band.  Also,  she  has  performed  in  VUHS   musicals  since  her  freshman  year  and  has  also  represented  her  class   in  student  council  and  at  Girlsâ&#x20AC;&#x2122;  State  and  in  the  Vergennes  area  Rotary   Club.     3KRHEHKDVZRUNHGSDUWWLPHDVDVWRUHDVVRFLDWHDWWKH6KHOEXUQH Museum   Gift   Store.   Also,   she   worked   as   a   camp   counselor   at   the   Basin  Harbor  Club  this  summer.  Phoebe  has  volunteered  at  several   Shelburne  Museum  events,  such  as  Haunted  Happenings  and  Goes   Phoebe  Plank to  the  Dog.  When  Phoebe  isnâ&#x20AC;&#x2122;t  at  school,  working,  or  volunteering,  she   V.U.H.S. likes  to  sing  for  fun,  go  hiking  or  camping,  play  sports,  and  spend  time   with  friends.     When  asked  about  what  she  has  learned  from  high  school  Phoebe  replied,  â&#x20AC;&#x153;High  school  is  where  you  discover  who  you  are.   7DNHDGYDQWDJHRIHYHU\RSSRUWXQLW\DQGGRQÂśWOHWDQ\WLPHJRWRZDVWH7KHVHIRXU\HDUVKDYHĂ&#x20AC;RZQE\EXW,EHOLHYHWKDW,KDYH developed  the  skills  needed  for  success  in  the  future.  I  personally  want  to  thank  each  and  every  person  who  has  helped  me   through  each  leg  of  this  journey.    Without  their  support  I  wouldnâ&#x20AC;&#x2122;t  be  where  I  am  today,  and  even  though  this  chapter  of  my  life  is   coming  to  a  close,  I  know  that  these  people  that  have  supported  me  throughout  will  forever  be  part  of  my  life.â&#x20AC;? About  Phoebe,  VUHS  English  teacher  and  her  morning  meeting  adviser  Chris  Wyckoff  said,  â&#x20AC;&#x153;Phoebe  breaks  all  of  the   traditional  stereotypes  and  clichĂŠs  that  are  associated  with  high  school.  She  is  an  incredible  athlete  but  she  is  also  a  scene   stealer  in  the  musical  with  her  radiant  smile  and  strong  vocals.  She  is  outgoing,  popular  and  involved  in  her  community,  yet  she   VWLOOÂżQGVWKHWLPHIRUKHUDFDGHPLFVDQGLVLQWKH1DWLRQDO+RQRU6RFLHW\6LPSO\SXW3KRHEHURFNV´ Following  graduation  from  VUHS,  Phoebe  plans  to  attend  college  and  major  in  the  sciences.  Her  main  interests  are  biology,   psychology  and  environmental  sciences. 7KHIDFXOW\VWDIIDQGVWXGHQWVRI98+6ZLVK3KRHEH3ODQNWKHYHU\EHVWLQWKHIXWXUH

Vergennes  Students  of  the  Week  receive  a  free  sandwich  and  drink  from  3  SQUARES.

Students of the week from all area high schools will receive a gift certificate from Vermont Book Shop. Students of the Week are chosen by school teachers and administration. Congratulations on a great kick start for your future!

Weâ&#x20AC;&#x2122;re proud to support all area students and want to say â&#x20AC;&#x153;Thanksâ&#x20AC;? to those who volunteer with us!

Prepare for black beltâ&#x20AC;&#x201C; prepare for life. TaeKwon Do classes, Self defense classes, Birthday parties & After school programs.

To volunteer call 388-­7044 or visit www.unitedwayaddisoncounty.org

377-0476 tkdkicks101@yahoo.com

Barash  Mediation  Services 3KRHEH%DUDVK )DPLO\'LYRUFH0HGLDWLRQÂ&#x2021;)DFLOLWDWLRQ &RQĂ&#x20AC;LFW0DQDJHPHQW7UDLQLQJV

ations

l Congratu Name  & KATE & Name PHOEBE

32%R[%0DLQ6WÂ&#x2021;%ULVWRO97 Â&#x2021;SKRHEH#EDUDVKPHGLDWLRQFRP www.barashmediation.com

VERGENNES

REDEMPTION CENTER Congratulations Students! &RPSOHWH'HOLÂ&#x2021;6QDFNVÂ&#x2021;%HYHUDJHV

877-­6768 0DLQ6WUHHW9HUJHQQHV

FERRISBURGH

BAKE SHOP & DELI Celebrating 10 Years

Warmest Congratulations,

Kate & Phoebe

Congratulations Congratulations Taylor&& Casey Kate Phoebe Two locations to help serve you better...

Plumbing  &  Heating  

125 Monkton Rd. Bristol, VT 453-2325

Fuel  /Oil  Delivery

185 Exchange St., Middlebury, VT 388-4975

859 Route 7 South Middlebury 802-388-9500

68 West Street Bristol 802-453-3617

Telecommunications Sales and Service Data Cabling & Fiber Optic Solutions

802-388-8999 Middlebury

Great Job Students! 5 6 R287( OUTE  7  S287+ OUTHÂ&#x2021; 5RXWH6RXWKÂ&#x2021; 0)Â&#x2021;6 $7 AT  0)Â&#x2021;66

Congratulations, Name Name! Kate &&Phoebe 877-3118 Main St., Vergennes, VT


PAGE  16  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

Learn more about local history through lively programs ORWELL/WEST  ADDISON   â&#x20AC;&#x201D;   Two   Vermont   State   Historic   Sites   in   Addison   County   are   offering   history   programs   on   the   weekend   of  Sept.  28  and  29.   First,  British  Lt.  Gen.  John  Bur-­ goyne  will  come  to  life  and  visit  the   Mount  Independence  State  Histor-­ ic  Site  in  Orwell  on  Saturday,  Sept.  

28,  at  2  p.m.,  to  ruefully  reminisce   about   his   experiences   during   the   American   Revolutionâ&#x20AC;&#x2122;s   Northern   Campaign   of   1777.   British   actor-­ playwright  Howard  Burnham,  now   based   in   California,   will   present   his   lively   and   highly   acclaimed   one-­man  costumed  program. Burnham   will   portray   Burgoyne  

WINTER STORAGE

Addison  County  Fair  &  Field  Days 1790  Field  Days  Road,  New  Haven,  VT  05742 Looking   for   a   place   to   store   your   car,   boat   or   camper   during  the  long  winter  months?    Look  no  furtherâ&#x20AC;Ś.bring   your  vehicles  to  Addison  County  Fair  &  Field  Days.  Our   buildings   are   secured   with   a   state   of   the   art   security   system  and  our  prices  are  competitive! Storage  in  Dates: Saturdays,  October  12th  &  19th                                9:00-­3:00 Sundays,  October  13th  &  20th                                  12:00-­3:00 Storage  out  Dates: Saturdays,  April  12th  &  19th                                        9:00-­3:00 Sundays,  April  13th  &  20th                                            12:00-­3:00 RATES: $11  per  foot  under  9â&#x20AC;&#x2122;6â&#x20AC;?                          in  secured  building $12  per  foot  over  9â&#x20AC;&#x2122;6â&#x20AC;?                              in  secured  building $8  per  foot  under  cover  only          (not  in  secured  building) If  you  would  like  an  application,  please  call   RUHPDLOÂżHOGGD\V#JPDYWQHW

in  his   later   years   looking   back   at   cans  Thomas  Paine  and  Gen.  Hora-­ his  time  in  the  Americas,  some  of   tio  Gates. the  memorable  characters  he  inter-­ Mount   Independence,   one   of   acted   with,   and   his   ultimate   sur-­ Vermontâ&#x20AC;&#x2122;s   state-­owned   historic   render  after  the  Battles  of  Saratoga   sites,   is   a   National   Historic   Land-­ in  October  1777.  The  news  of  this   mark  and  one  of  the  best-­preserved   surrender   encouraged   the   French   Revolutionary   War   sites   in  Amer-­ to   enter   the   Revolutionary   War   ica.   It   is   located   near   the   end   of   on   the   American   side,   Mount   Independence   considered   a   major   Road,   six   miles   west   turning   point   in   his-­ British actor- of  the  intersections  of   tory. VT  Routes  22A  and  73   In   early   July   1777,   playwright in   Orwell.   Call   802-­ Burgoyneâ&#x20AC;&#x2122;s   troops   Howard 948-­2000   for   more   were   threatening   the   Burnham, information.  It  is  open   American   forces   at   now based daily   9:30   a.m.   to   5   Mount   Independence   p.m.,  through  Oct.  14. and   Fort   Ticonderoga,   in California, GUIDED  HISTORY   leading   to   the   dramat-­ will present TOUR ic   withdrawal   of   the   his lively Then   on   Sunday,   American   Northern   Sept.   29,   2013,   at   1   and highly Army   on   the   night   of   p.m.   history   buffs   acclaimed July  6  and  7.   can   enjoy   a   leisurely   The   program,   spon-­ one-man guided   walk   back   sored  by  the  Mount  In-­ costumed and   forth   across   the   dependence   Coalition   new   Lake   Champlain   and   Vermont   Division   program. Bridge   connecting   for   Historic   Preserva-­ Vermont   and   New   tion,   is   $5   for   adults   York,   and   learn   about   and  free  for  children  younger  than   the  history  all  around  it.  State  his-­ 15.   It   includes   admission   to   the   toric  site  managers  Elsa  Gilbertson   museum  and  all  the  trails. at   Chimney   Point   in   Vermont   and   Burnham  has  given  nearly  yearly   Tom   Hughes   at   Crown   Point   in   performances   at   Mount   Indepen-­ New  York   will   lead   the   tour.  This   dence,   including   interpretations   is  the  last  guided  tour  of  the  year,   RI5HYROXWLRQDU\:DUÂżJXUHV/RUG and  is  one  of  Septemberâ&#x20AC;&#x2122;s  Vermont   Cornwallis,  Banastre  Tarleton,  the   Archaeology  Month  events. Marquis   de   Lafayette,   and  Ameri-­ The   area   has   a   rich   and   united  

history,  with  humans  crossing  and   traveling  there  since  glacial  waters   receded   nearly   9,000   years   ago.   The   narrow   channel   and   peninsu-­ las,   or   points,   on   each   side   made   this  one  of  the  most  strategic  spots   on  Lake  Champlain  for  the  Native   Americans,   French,   British,   and   early  Americans.  It  continues  to  be   an   important   crossing   today,   with   much  to  see  and  do  in  the  area.  The   new   bridge,   with   its   sidewalks   on   both   sides,   provides   an   extraordi-­ nary  opportunity  to  experience  the   lake  from  above  and  view  the  sce-­ nic  and  historic  surroundings. Meet   at   the   Crown   Point   State   Historic   Site   museum   in   New   York,   near   the   New   York   foot   of   the  bridge.  The  fee  is  $6  for  adults,   free   for   children   under   15,   and   includes   admission   to   both   the   Chimney   Point   and   Crown   Point   museums  after  the  tour. The  Chimney  Point  State  Histor-­ ic  Site  is  located  at  8149  VT  Route   17.   Call   802-­759-­2412   for   infor-­ mation.  The   site   is   regularly   open   Wednesdays   through   Sundays   and   Monday  holidays  through  Oct.  14,   9:30   a.m.   to   5   p.m.   The   Crown   Point  State  Historic  Site  is  located   at  the  New  York  foot  of  the  bridge.   Call   518-­597-­3666   for   the   Crown   Point  museum. For   more   information   about   the   Vermont   State   Historic   Sites   visit   historicsites.vermont.gov.

County  educator  Abi  Session  to  offer  memoir  workshop MIDDLEBURY  â&#x20AC;&#x201D;  We  each  have   stories  to  tell  from  our  memories  â&#x20AC;&#x201D;   stories   of   inspiring   formative   life   experiences,   stories   of   risks   taken   or   obstacles   overcome,   and   stories   of   small   memorable   moments.   Abi   Sessions,   an   experienced   Addison   County   educator   and   Addison   In-­ dependent   columnist,   will   teach   a  

seven-­session  workshop   at   St.   Ste-­ phenâ&#x20AC;&#x2122;s  Church  in  Middlebury  to  help   people  tell  the  stories  from  their  life   and  write  them  as  memoirs.   A  personal  memoir  allows  the  au-­ thor  to  revive  and  relish  memorable   moments   and   to   share   insights   and   observations.   Sometimes   writing   about  a  memory  can  help  the  author   achieve   a   clearer   understanding   of   WKHVLJQLÂżFDQFHRIWKHHYHQW0HP-­ oirs   of   a   beloved   family   member   give   succeeding   generations   a   way   to   know   that   person   in   a   rich   and   personal   way.   Memoirs   are   a   fam-­

ilyâ&#x20AC;&#x2122;s  history  and  folklore. The  workshop  will  be  held  weekly   at   St.   Stephenâ&#x20AC;&#x2122;s   Church   in   Middle-­ bury  for  seven  weeks,  Sept.  30â&#x20AC;&#x201C;Nov.   ZLWKDFKDUJH7KHÂżUVWVHV-­ sion  will  be  Monday,  Sept.  30,  2â&#x20AC;&#x201C;4   p.m.   at   St.   Stephenâ&#x20AC;&#x2122;s   parish   hall   (downstairs).   No   pre-­registration   is   necessary.   All   ages   are   welcome,   and   the   space   is   accessible.  Assistance   will   be  available  for  any  participants  who   are  physically  unable  to  write.   For   more   information   call   Abi   Sessions  at  462-­2363.

Grow  your  business  within  the  Real  Estate  Community

Business  Mixer Sponsored  by  the  National  Bank  of  Middlebury

You  are  cordially  invited  to  the  Addison  County  Board  of  Realtorsâ&#x20AC;&#x2122;   Fall  Mixer  at  the  Middlebury  Inn  on  Thursday,  September  26,  2013,   sponsored  by  the  National  Bank  of  Middlebury. Join  the  Addison  County  Board  of  Realtors  as  we  say  â&#x20AC;&#x153;thank  youâ&#x20AC;?  to   you  and  many  other  folks  whom  we  interact  with  daily  throughout  our   real  estate  transactions.   Come  and  enjoy  some  light  appetizers  and  drinks,  and  get  to  know   your  local  real  estate  agents  and  many  other  professionals  that  work   with  buyers,  sellers  and  homeowners  each  and  every  day.     Where: Middlebury  Inn 14  Court  Square  Middlebury,  Vermont  05753   When: Thursday,  September  26,  2013  5:00  PM  -­  7:00  PM         Donâ&#x20AC;&#x2122;t  Miss  Out  On  Exciting  Door  Prizes!  


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  17

72:(5,1*3,1(6$%29(DUHUHGXFHGWRHPEHUVLQVRXWKHUQ&RORUDGRDWDÂżUHZKHUH%ULVWROUHVLGHQW &KULV&DVH\ZRUNHGZLWKWKH1DWLRQDO)RUHVW6HUYLFH$WULJKWDFROXPQRIVPRNHWRZHUVRYHUWKH%HDYHU &UHHN)LUHQHDU/ROR0RQW%HORZÂżUHÂżJKWHU&KULV&DVH\WDNHVDEUHDNIURPÂżJKWLQJDZLOGÂżUHLQ0RQWDQD 3KRWRVFRXUWHV\RI&KULV&DVH\

Wildfire fighter

Bristol man battles blazes in Colorado, Montana By  ZACH  DESPART ample,  is  a  Type  I  in-­ BRISTOL   â&#x20AC;&#x201D;   Chris   cident. Casey   of   Bristol   re-­ &DVH\ ZKR ZRUNV turned   to   Addison   Leaves9HUPRQWIRU&RORUDGRÂą:HVW)RUN)LUH directly   under   the   in-­ County   on   Sept.   10   af-­ 7ZRGD\VRII cident   commander,   WHU ÂżJKWLQJ ZLOGÂżUHV LQ /HDYHVIRUÂżUHLQ/ROR0RQW has   to   develop   strat-­ Colorado   and   Montana.   )LYHGD\VRII HJLHV DQG WDFWLFV IRU Casey  spent  a  total  of  50   6HQWWR%HDYHU&UHHN)LUHLQ0RQWDQD ÂżJKWLQJ WKH ÂżUH DV days  out  West  this  sum-­ each   one   presents   a   5HWXUQVKRPHWR9HUPRQW PHUÂżJKWLQJIRXUGLIIHU-­ different   set   of   chal-­ HQWZLOGÂżUHV OHQJHV When   heâ&#x20AC;&#x2122;s   not   bat-­ Âł, KDYH WR PDNH in  the  Rio  Grand  National  Forest.     WOLQJZLOGÂżUHV&DVH\ZRUNVIRUWKH )LUH FUHZV EDWWOHG KLJK WHPSHUD-­ VXUHÂżUHÂżJKWHUVDUHQÂśWWDNLQJXQGXH *UHHQ 0RXQWDLQ DQG )LQJHU /DNHV WXUHV H[WUHPHO\ ORZ KXPLGLW\ DQG ULVNVDQGORRNDWHYHU\SRVVLEOHKD]-­ division   of   the   U.S.   Forest   Service   ZLQGJXVWVRIPLOHVSHUKRXU DUG2XUJRDOLVWRPDNHVXUHHYHU\-­ as  a  silviculturist,  a  specialist  in  for-­ Casey,   59,   has   to   maintain   the   RQHFRPHVKRPHDWQLJKW´ HVWPDQDJHPHQW Still,  Casey  said  there  are  frequent   VDPHSK\VLFDOÂżWQHVVOHYHOVDVZKHQ ,Q DGGLWLRQ WR KLV GXWLHV LQ 1HZ KHVWDUWHGÂżJKWLQJZLOGÂżUHV\HDUV close  calls. <RUN DQG 9HUPRQW IRUHVWV &DVH\ DJR Âł<RX SXOO XS LQ \RXU WUXFN DQG LV D VDIHW\ RIÂżFHU ZLWK WKH 1RUWK-­ Âł,ÂśPRXWWKHUHZLWKJX\VKDOIP\ WKHUHÂśVÂżUHRQERWKVLGHVRIWKHURDG HUQ 5RFNLHV :LOGODQG 0DQDJHPHQW DJH´&DVH\VDLG DQGDEXUQLQJWUHHFRPHVVPDVKLQJ Team,   one   of   dozens   of   similar   re-­ $V D VDIHW\ RIÂżFHU &DVH\ RIWHQ across  the  road  behind  you,â&#x20AC;?  Casey   sponse   teams   all   over   the   country.   JRHV RXW DORQH WR REVHUYH WKH ÂżUH VDLG Âł<RX MXVW ZRQGHU ZKDW LI \RX 7KLVW\SHRIWHDPVSHFLDOL]HVLQÂżUHV OLQH WR HVWDEOLVK ORRNRXW SRVLWLRQV had  been  in  that  spot.â&#x20AC;? LQ IRUHVWV ZLWK WKH WRXJKHVW DFFHVV ZLWK D JRRG YDQWDJH SRLQW IURP Casey  is  responsible  for  develop-­ RIWHQLQWKHPRVWUHPRWHUHJLRQVRI ZKLFKWRYLHZWKHÂżUH LQJ PHGLFDO SODQV PHGHYDF URXWHV the  country. Âł,ÂśP ZKDW WKH\ FDOO D VLQJOH UH-­ and  evacuation  plans.  As  a  safety  of-­ &DVH\ OHIW 9HUPRQW -XQH  WR VRXUFH´&DVH\VDLGH[SODLQLQJWKDW KHOSEDWWOHDÂżUHLQRQHRIWKHVHUH-­ KH RIWHQ JRHV RXW E\ KLPVHOI WR LQ-­ JLRQV²GHHSLQWKH5LR*UDQGH1D-­ VSHFW WKH ÂżUH OLQH +H KDV WR FDUU\ tional  Forest  of  Colorado. DOOKLVHTXLSPHQW²WRROVVOHHSLQJ 7KH:HVW)RUN&RPSOH[)LUHZDV EDJ ÂżUH EODQNHW ² DQG EH FRP-­ VSDUNHGE\OLJKWQLQJRQ-XQHDQG SOHWHO\VHOIVXIÂżFLHQW EXUQHG LQ 'HO 1RUWH DQG 3DJRVD â&#x20AC;&#x153;I   have   to   be   prepared   for   any-­ 6SULQJV&RORQHDUWKHVWDWHÂśVERU-­ WKLQJ IURP WKH$UL]RQD KHDW WR WKH GHU ZLWK 1HZ 0H[LFR ,W JUHZ WR $ODVNDFROG´ more  than  110,000  acres.  More  than   This   summer   Casey   participated   ÂżUHÂżJKWHUVEDWWOHGWKHEOD]HDW in   daily   helicopter   reconnaissance   LWV SHDN LQ PLG-XQH MXVW DV &DVH\ Ă&#x20AC;LJKWV RYHU WKH :HVWHUQ ZLOGÂżUHV arrived. 7KHVH ORZOHYHO Ă&#x20AC;LJKWV QHFHVVDU\ Âł7KDW ÂżUH EOHZ ULJKW DFURVV WKH WRJHWDJRRGYLHZRIWKHGHYHORSLQJ &RQWLQHQWDO'LYLGHDORQJWKH5RFN\ EOD]H ZHUH GDQJHURXV DV YLVLELOLW\ Mountains,â&#x20AC;?  Casey  said. ZDVRIWHQREVFXUHGE\VPRNH 0LNH%ODNHPDQRIWKH5LR*UDQGH &DVH\ ZRUNV ZLWK 7\SH ,, LQ-­ 1DWLRQDO )RUHVW H[SODLQHG WKDW HP-­ FLGHQWV 7\SH 9 LQFLGHQWV DUH WKH bers  from  the  blaze,  then  contained   VPDOOHVW ZKLOH7\SH , DUH WKH ODUJ-­ WR WKH 6DQ -XDQ 1DWLRQDO )RUHVW HVW RIWHQ UHTXLULQJ WKRXVDQGV RI EOHZRYHUWKHIRRWSHDNVWKDW ÂżUHÂżJKWHUV 7KH 5LP )LUH EXUQLQJ PDNHXSWKHGLYLGHDQGLJQLWHGWUHHV LQ <RVHPLWH 1DWLRQDO 3DUN IRU H[-­

Chris Caseyâ&#x20AC;&#x2122;s summer

¿FHULWLVKLVMREWRDQWLFLSDWHHYHU\ possible  scenario  that  could  arise. +H VDLG KH QHYHU FRPPLWV ¿UH-­ ¿JKWHUVWRD¿UHLILWFDQQRWEHEDW-­ tled  safely.       ³6RPHSHRSOHDUHFRQIXVHGZKHQ ZHLGHQWLI\D¿UHEXWGRQœWDWWDFNLW´ &DVH\ VDLG ³%XW ZH OHW ¿UHV EXUQ XQWLOZHFDQ¿JKWWKHPVDIHO\´ 7KDWœV H[DFWO\ WKH DSSURDFK ¿UH-­ ¿JKWHUV WRRN WR EDWWOLQJ WKH :HVW )RUN)LUH ³:HOHWLWZRUNLWVZD\GRZQIURP WKH PRXQWDLQV ZKHUH ZH FRXOGQœW

JHW DW LW VDIHO\´ %ODNHPDQ VDLG Âł:KHQLWJRWFORVHWRFRPPXQLWLHV KHOLFRSWHUVGXPSHGZDWHUWRVORZLW GRZQ´ 7KHUHZHUHQRVHULRXVLQMXULHVRU IDWDOLWLHVLQWKDWÂżUH2QO\RQHVWUXF-­ WXUHZDVGHVWUR\HG Every  day   there   are   hundreds   or   WKRXVDQGV RI ÂżUHV DFURVV WKH FRXQ-­ try,  and  accidents  do  happen.  Thirty   ÂżUHÂżJKWHUV KDYH GLHG WKLV VHDVRQ WKH KLJKHVW GHDWK WROO LQ  \HDUV DFFRUGLQJ WR VWDWLVWLFV FRPSLOHG E\ WKH 1DWLRQDO ,QWHUDJHQF\ )LUH &HQ-­ ter  in  Boise,  Idaho.  The  most  recent   ÂżUHÂżJKWHUGHDWKRFFXUUHGMXVWEHIRUH &DVH\UHWXUQHGWR9HUPRQW Âł:H WDNH WKHVH OHVVRQV DQG OHDUQ from  them,â&#x20AC;?  he  said. Itâ&#x20AC;&#x2122;s   been   a   busy   summer.   Casey   VSHQWGD\VDWWKH:HVW)RUN)LUH $IWHUWZRGD\VRIIKHZDVDVVLJQHG WR D EOD]H WKDW KDG EURNHQ RXW QHDU /ROR 0RQW +H WKHQ VSHQW  GD\V WKHUH DQG DIWHU ÂżYH GD\V RII ZDV VHQWEDFNWR0RQWDQDWRDVVLVWÂżJKW-­ LQJ WKH %HDYHU &UHHN )LUH QHDU WKH WRZQRI%LJ+ROH &DVH\URVHXSWKHUDQNVRYHUWKUHH GHFDGHV WR EHFRPH D JURXS VXSHU-­ YLVRU SDUW RI WKH FRPPDQG JHQHUDO VWDII+HIRXJKWKLVÂżUVWÂżUHLQ&DOL-­ fornia   in   1977,   at   a   blaze   that   en-­ FRPSDVVHGDFUHV ,W ZDV WKHUH KH UHDOL]HG KH KDG IRXQGKLVFDOOLQJ


PAGE  18  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

SPORTS MONDAY

Eagle  girlsâ&#x20AC;&#x2122;  soccer  rolls  past  Commodores 0W$EHPLG¿HOG key  to  the  victory By  ANDY  KIRKALDY VERGENNES   â&#x20AC;&#x201D;   In   a   rivalry   game   between   two   local   highs   VFKRRO JLUOV¶ VRFFHU WHDPV RII WR JRRG VWDUWV YLVLWLQJ 0RXQW $EUD-­ KDP URGH VROLG PLG¿HOG SOD\ WR D ZLQDW9HUJHQQHVRQ)ULGD\ 7KH (DJOH PLG¿HOGHUV QRW RQO\ FRQVLVWHQWO\ZRQWKHEDWWOHVIRUWKH EDOO EXW DOVR VHW XS WKHLU IRUZDUGV WR DWWDFN WKH98+6 JRDO UHVXOWLQJ LQDDGYDQWDJHLQVKRWVDWQHW 6HQLRU VWULNHU DQG WULFDSWDLQ 0HJKDQ /LYLQJVWRQ ZKR GULOOHG KRPH WKH ¿UVW 0RXQW $EH JRDO LQ WKH IRXUWK PLQXWH VDLG WKH (DJOHV DOVRUHPHPEHUHGWKHWZRORVVHVWKH &RPPRGRUHV KDQGHG WKHP D \HDU ago.   ³:HZHUHDOOZRUNLQJYHU\KDUG 9HUJHQQHVLVDOZD\VDYHU\PHQWDO HPRWLRQDO JDPH DQG ODVW \HDU ZH ORVWWZLFHWRWKHP´/LYLQJVWRQVDLG ³:H¶YHDOOEHHQZRUNLQJWRZDUGWKH VDPHJRDOVDQGRXUPRWWRLVEHLQJ WHQDFLRXVDQGRXUFRYHQDQWLVWKDW ZHVZHDWWRJHWKHUZHVWLFNWRJHWK-­ HU7KLVJDPH,WKLQNLWVKRZHGWR-­ GD\:HZHUHDOOYHU\WHQDFLRXV´ (DJOH&RDFK'XVWLQ&RUULJDQVDLG WKHSOD\RIKLVPLG¿HOGHUV²VHQLRU 0. &KDUQOH\ MXQLRU $P\ 1DXOW DQG VRSKRPRUH -XQLSHU 1DUGLHOOR 6PLWK ZHUH HVSHFLDOO\ HIIHFWLYH EXWVHYHUDORWKHU(DJOHVDOVRPDGH LPSDFWV²PDGHWKHGLIIHUHQFHIRU 0RXQW$EHZKLFKLPSURYHGWR ³, ZDV SOHDVHG ZLWK GH¿QLWHO\ WKH HIIRUW DQG WKH ZD\ RXU JLUOV ZHUHDEOHWREH¿UVWWRWKHEDOODQG JHWLWGRZQWRWKHJURXQGDQGSRV-­ VHVV LW DQG SXW EDOO DIWHU EDOO LQWR WKHJRDOPRXWK´&RUULJDQVDLG³:H ZHUHDEOHWRSOD\PRVWRIWKHJDPH LQWKHLUHQG´ &RFRDFK 'ZLJKW ,ULVK¶V \RXQJ &RPPRGRUHV ZHUH FRPLQJ RII ELJ ZLQVRYHU5LFHDQG0RQWSHOLHUEXW GURSSHGWRZLWKWKHVHWEDFN+H VDZ VRPH WKLQJV WR OLNH RQ )ULGD\ EXW VDLG WKH (DJOHV¶ EDOOZLQQLQJ SUHYHQWHGKLVWHDPIURPGHYHORSLQJ RIIHQVLYHUK\WKP ³3DUWVRILW,IHOWZHUH2.«7R PHWKHGLIIHUHQFHZDVWKHLUZLOOLQJ-­ QHVV WR JHW WR WKH EDOO´ ,ULVK VDLG DGGLQJ ³:H KHOG RXU RZQ DQG GLG DOOULJKWEXW«WKH\ZHUHRXWZRUN-­ LQJXVWRWKHEDOODQGWKDWZDVWKH ERWWRPOLQH´ 7KH (DJOHV DWWDFNHG HDUO\ HDUQ-­ LQJ WZR TXLFN FRUQHU NLFNV 7KH SUHVVXUH SDLG RII ZKHQ IUHVKPDQ VWULNHU (UQHVWD 0F,QWRVK PDGH D UXQGRZQWKHOHIWVLGHDQGVHUYHGWR /LYLQJVWRQMXVWLQVLGHWKHWRSRIWKH ER[ /LYLQJVWRQ ZKHHOHG VKLHOGHG WKH EDOO IURP D GHIHQGHU DQG ¿UHG DOHIWIRRWVKRWLQWRWKHULJKWVLGHRI

Sports BRIEFS Tiger  girls  fall   to  Rebels  in   field  hockey

SOUTH  BURLINGTON   â&#x20AC;&#x201D;   De-­ IHQGLQJ 'LYLVLRQ , FKDPSLRQ 6RXWK %XUOLQJWRQ GHIHDWHG WKH YLVLWLQJ 0LGGOHEXU\8QLRQ+LJK6FKRRO¿HOG KRFNH\WHDPRQ6DWXUGD\ 7KH  5HEHOV JRW D ¿UVWKDOI JRDO IURP &RXUWQH\ %DUUHWW DQG D VHFRQGKDOIVWULNHIURP&DVH\-RKQ-­ VRQ ZKLOH JRDOLH $OH[ :DUVKDZ VWRSSHG WKH RQH 7LJHU VKRW RQ KHU cage. 08+6JRDOLH%DLO\5\DQVWRSSHG QLQH VKRWV 7KH  7LJHUV ZKR have   been   competitive   in   every   JDPH ZLOO KRVW &KDPSODLQ 9DOOH\  RQ:HGQHVGD\

0W$EHÃ&#x20AC;HOGKRFNH\ FDQ·WJHWSDVW&98 HINESBURG  â&#x20AC;&#x201D;   The   Mount   $EUDKDP 8QLRQ +LJK 6FKRRO ¿HOG hockey   team   outshot   host   Cham-­ SODLQ 9DOOH\ RQ 6DWXUGD\ EXW FDPH away  with  a  1-­0  setback.   7KH 'LYLVLRQ , 5HGKDZNV¶ .DWLH $UPV VFRUHG WKH JDPH¶V RQO\ JRDO ZLWKDERXWPLQXWHVWRJR&98 ZKLFKUHFHLYHG¿YHVDYHVIURPJRDO-­ LH(YDQJHOLQH'XQSK\LPSURYHGWR DQGUHPDLQHGQHDUWKHWRSRIWKH ',VWDQGLQJVZLWKWKHYLFWRU\ 7KH (DJOHV VXUUHQGHUHG RQO\ RQH RWKHUVKRWRQJRDOLH'DQLHOOH0RUVH EXWGURSSHGWRZLWKWKHLUVHFRQG VWUDLJKW VHWEDFN ERWK WR VWURQJ ', 0HWURWHDPVRQWKHURDG Another   Metro   challenge   is   next:   'HIHQGLQJ',FKDPSLRQ6RXWK%XU-­ lington  will  visit  the  D-­II  Eagles  at  4   SPRQ:HGQHVGD\

0LGGOHEXU\JLUOV¶ VRFFHUGURSVWZR 0,/721 ² 7KH 0LGGOHEXU\ 8QLRQ +LJK 6FKRRO JLUOV¶ VRFFHU WHDP GURSSHG D SDLU RI URDG JDPHV ODVWZHHNDQGIHOOWRRYHUDOO 2Q :HGQHVGD\ KRVW 0LVVLVTXRL VFRUHG WKUHH WLPHV LQ WKH ¿UVW KDOI LQDZLQRYHUWKH7LJHUV7KRVH ZHUHWKH¿UVWJRDOV08+6KDGVXU-­ COMMODORES  SARA   STEARNS,   left,   and   Kareena   Vorsteveld,   right,   put   the   crunch   on   Eagle   Meghan   UHQGHUHG WKLV VHDVRQ (PLO\ 5RE-­ Livingston  last  Friday  in  Vergennes.  Mount  Abraham  won  the  game,  3-­1 LQVRQ VFRUHG IRU WKH 7LJHUV ZLWK DQ Independent  photo/Trent  Campbell DVVLVWIURP6RSKLD$EGXO6DWHUDOVR WKHJRDODW PDQ 0HJDQ 5RRQH\ URWDWHG LQ ² VWURQJJDPHDOVRPDNLQJVDYHV LQ WKH ¿UVW KDOI DQG JRDOLH 0ROO\ 2WKHU WKDQ WKDW WKH 9HUJHQQHV KHOGIDVWLQWKH¿UVWKDOI IRU WKH &RPPRGRUHV DQG UHSHDW-­ &DPSEHOOPDGHVDYHV GHIHQGHUV ² VHQLRU 3KRHEH 3ODQN ³:HKDGJRRGPRPHQWVZRUNLQJ HGO\FRPLQJRIIWKHOLQHWREUHDNXS 2Q )ULGD\ KRVW 0LOWRQ GHDOW DQG VRSKRPRUH .DUHHQD 9RUVWH-­ WKHEDOODQGGHIHQVLYHO\«ZHGLG plays.   08+6DVHWEDFNGHVSLWHDQRWKHU YHOGVWD\HGRQWKH¿HOGDQGVHQLRUV ZHOOHQRXJKNHHSLQJWKHLUIRUZDUGV ³.&GLGDJRRGMRE´,ULVKVDLG GR]HQVDYHVIURP&DPSEHOO 6DPDUD 6DXVYLOOH DQG .H\DQQDK LQIURQWRIXV´,ULVKVDLG ³:HKDYHDNHHSHUDWNHHSHU´ The   Tigers   play   at   Mill   River   on   6PLWK MXQLRU 7LD +XQW DQG IUHVK-­ -XQLRUJRDOLH.&$PEURVHKDGD (See  Soccer,  Page  20) 0RQGD\DQGKRVW5LFHRQ:HGQHVGD\


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  19

Score BOARD HIGH SCHOOL SPORTS

Football 9/20  MUHS  vs.  Rutland    ........................35-­0 9/21  Mt.  Abe  vs.  Spaulding  ...................  38-­6 Field Hockey 9/19  Rutland  vs.  OV    ..............................  3-­2 9/21  CVU  vs.  Mt.  Abe  .............................  1-­0 9/21  S.  Burlington  vs.  MUHS  ..................  2-­0 Girlsâ&#x20AC;&#x2122; Soccer 9/18  Missisquoi  vs.  MUHS    ......................3-­1   9/19  Mill  River  vs.  OV  .............................  1-­0 9/20  Milton  vs.  MUHS  .............................  7-­0 9/20  Mt.  Abe  vs.  VUHS    ..........................  3-­1 Boysâ&#x20AC;&#x2122; Soccer 9/19  Mt.  Abe  vs.  VUHS    ...............  2-­1  (2OT) 9/19  Milton  vs.  MUHS    ............................  4-­2 9/21  VUHS  vs.  MUHS    ............................2-­1     9/21  Mt.  Abe  vs.  Milton    ...........................1-­0

COLLEGE SPORTS

Field Hockey 9/21  Bowdoin  vs.  Midd.    .........................  4-­2 Menâ&#x20AC;&#x2122;s Soccer 9/21  Midd.  vs.  Bowdoin    .........................  1-­1 Womenâ&#x20AC;&#x2122;s Soccer 9/21  Midd.  vs.  Bowdoin    .........................  2-­1 Football 9/21  Midd.  vs.  Bowdoin    .......................  27-­5

OTTER  VALLEYâ&#x20AC;&#x2122;S  MAIA  Edmunds  battles  for  control  of  the  ball  during  last  weekâ&#x20AC;&#x2122;s  game  against  Rutland.

Photo  by  Lee  Kahrs/Brandon  Reporter

Rutland deals Otter Valley its first loss of season By  LEE  KAHRS BRANDON   â&#x20AC;&#x201D;   It   was   a   skillful,   fast-­paced   contest   between   two   of   WKH EHVW KLJK VFKRRO ¿HOG KRFNH\ WHDPVLQWKH0DUEOH9DOOH\/HDJXH but   in   the   end   Division   I   Rutland   KDQGHG ',, 2WWHU 9DOOH\ LWV ¿UVW loss  of  the  season  last  week,  3-­2. 7KH 295XWODQG ULYDOU\ WKDW KDV GHYHORSHGLQUHFHQW\HDUVPDNHVIRU JUHDW ¿HOG KRFNH\ DQG 7KXUVGD\¶V game  was  no  exception.

5XWODQG¶V&DWKHULQH'L3DOPDKDG D ELJ GD\ VFRULQJ DOO WKUHH 5DLGHU goals,  two  late  in  the  second  half  as   RHS  rallied  for  the  win. 5XWODQGZDVRQWKHERDUG¿UVWDW LQWKH¿UVWKDOIEXW29FRXQ-­ WHUHGZLWKDJRDOIURP$OOLVRQ/RZ-­ ell   at   7:09   on   an   assist   from   Brit-­ WDQ\%XVKH\ ,QWKHVHFRQGKDOI%XVKH\VFRUHG on  her  own  at  21:34  to  make  it  2-­1,   EXW 'L3DOPD ZDV RQ ¿UH 6KH UH-­

sponded  with  two  goals  at  9:34  and   7:27  to  give  the  3-­1  Raiders  the  tie   and  then  the  win.   The   5-­1   Otters   had   a   number   of   scoring  opportunities,  thanks  to  the   long,   hard   hits   of   talented   sopho-­ PRUHPLG¿HOGHU0DLD(GPXQGV But   the   Raiders   got   a   lift   from   their  own  effective  transition  game   after   a   timeout   with   10:14   to   go   in   the   game   with   OV   leading,   2-­1.   7KDW¶V ZKHQ 'L3DOPD VWUXFN DQG

WKH 5DLGHUV VWD\HG RQ WKH DWWDFN protecting  the  lead  to  win. OV   had   six   shots   on   goal,   while   5XWODQG WDOOLHG VHYHQ 7KH 2WWHUV¶ IUHVKPDQ JRDONHHSHU 0\OLDK 0F-­ Donough   had   six   saves,   and   Rut-­ ODQG¶V/DXUD+HZLWWPDGH¿YH The   Otters   will   have   another   FUDFN DW WKH 5DLGHUV ZKHQ WKH\ travel   to   Rutland   for   a   rematch   on   7XHVGD\

Mt.  Abe  boysâ&#x20AC;&#x2122;  soccer   wins  MUHS  tourney   0,''/(%85< ² 7KH 0RXQW $EUDKDP8QLRQ+LJK6FKRROER\V¶ soccer   team   improved   to   6-­0   and   ZRQ 0LGGOHEXU\¶V DQQXDO -3 &DU-­ rara  tournament  late  last  week.   7KH (DJOHV NQRFNHG RII 0LOWRQ LQ6DWXUGD\¶V¿QDODIWHUZRUN-­ ing   overtime   to   beat   Vergennes   in   7KXUVGD\¶V ¿UVW URXQG 98+6 SUH-­ YDLOHG LQ 6DWXUGD\¶V FRQVRODWLRQ RYHU08+6ZKLFKIHOOWR0LO-­ WRQRQ7KXUVGD\ EAGLES  WIN ,Q 6DWXUGD\¶V ¿QDO WKH (DJOHV picked  their  second  win  over  Milton    RIWKHZHHN8QOLNHWKH ¿UVWYLFWRU\E\RQ0RQGD\6DW-­ XUGD\¶VJDPHZDVDGHIHQVLYHEDWWOH GHFLGHGE\RQHVWULNHTheo  Weav-­ erâ&#x20AC;&#x2122;s\DUGERPEWKDWKHXQOHDVKHG after   taking   a   Charlie   Mayer   free   WKURZ7KDWZDVWKHRQO\RQHRIVL[ (DJOHVKRWVWKDW0LOWRQJRDOLH1DWH 'RROH\ GLG QRW VWRS ZKLOH WKH (D-­ JOHV¶Ira  Fisher  worked  a  two-­save   shutout.  Milton  dropped  to  1-­5-­1.   VUHS  VS.  MUHS

,Q WKH FRQVRODWLRQ 98+6   URGHDELJ¿UVWKDOIWRDZLQRYHU WKH  7LJHUV 7KH &RPPRGRUHV WRRN D  ¿UVWKDOI OHDG RQ JRDOV E\Josh  Benning  and  Liam  Hayes,   but  the  Tigers  pressed  in  the  second   half  and  got  one  back  when  Calder   Birdsey  knocked  the  ball  in  during  a   goal-­mouth  scramble.     EAGLES  VS.  VUHS 2Q 7KXUVGD\ WKH &RPPRGRUHV VFRUHG ¿UVW DQG SXVKHG WKH (DJOHV to   two   overtimes.   Liam   Godfreyâ&#x20AC;&#x2122;s   ¿UVWKDOIJRDORIIDFRUQHUNLFNJDYH 98+6 WKH OHDG EXW Rider   Mac-­ CrellishDVVLVWHGE\Aiden  White-­ Pifer,  equalized  in  the  second  half.   Two   minutes   into   the   second   over-­ time,  Ethan  White  netted  the  game-­ ZLQQHURIIDQRWKHU:KLWH3LIHUIHHG 98+6 JRDOLH Dylan   Raymond   made  seven  saves.   MILTON  VS.  MUHS 2Q 7KXUVGD\ 0LOWRQ EHVWHG WKH EAGLE  JUNIOR  AIDEN  White-­Pifer  connects  with  the  ball  in  front  of   Tigers,   4-­2,   despite   second-­half   Commodore  junior  Liam  Hayes  during  last  Thursdayâ&#x20AC;&#x2122;s  game  in  the  Mid-­ JRDOV E\ Drew   Barnicle   and   Sul-­ dlebury   Union   High   School   boysâ&#x20AC;&#x2122;   invitational   soccer   tournament.   The   Eagles  won  the  game  in  double  overtime,  2-­1. (See  Boys,  Page  20) Photo  by  Alan  Kamman

Schedule HIGH SCHOOL SPORTS Football 9/27  CVU  at  MUHS    ..........................  7  p.m. 9/28  MSJ  at  OV    ................................  1  p.m. 9/28  Mount  Abe  at  Windsor    ..............  1  p.m. Field Hockey 9/23  OV  at  Fair  Haven    ......................  4  p.m. 9/25  OV  at  Rutland    ...........................  4  p.m. 9/25  CVU  at  MUHS    ..........................  4  p.m. 9/25  S.  Burlington  at  Mt.  Abe    ............  4  p.m. 9/27  Essex  at  Mt.  Abe    .......................  4  p.m. 9/28  MUHS  at  Colchester    ...............  11  a.m. 9/28  Hartford  at  OV    ........................  11  a.m. Girlsâ&#x20AC;&#x2122; Soccer 9/23  MUHS  at  Mill  River    ...................  4  p.m. 9/25  Rice  at  MUHS    ......................  4:30  p.m. 9/25  OV  at  Woodstock    .................  4:30  p.m. 9/25  Mt.  Abe  at  Missisquoi    ...........  4:30  p.m. 9/25  VUHS  at  Milton    .........................  7  p.m. 9/28  Proctor  at  OV    ..........................  10  a.m. 9/28  Missisquoi  at  VUHS    ................  10  a.m. 9/28  Mt.  Abe  at  MUHS    ....................  10  a.m. Boysâ&#x20AC;&#x2122; Soccer 9/24  Milton  at  VUHS    ....................  4:30  p.m. 9/24  MUHS  at  Rice    ......................  4:30  p.m. 9/24  Mt.  Abe  at  Missisquoi    ...........  4:30  p.m. 9/25  OV  vs.  TBA  in  Arlington    ..........5/7  p.m. 9/27  OV  vs.  TBA  in  Arlington    ..........5/7  p.m. 9/28  Missisquoi  at  VUHS    ..................  2  p.m. 9/28  Green  Mt.  Union  at  OV    ........  4:30  p.m. Cross Country 9/24  OV  at  Mill  River    ....................  4:30  p.m. 9/24  Mt.  Abe  Hosts    ......................  4:15  p.m. 9/28  VUHS/MUHS  at  U-­32    .............  10  a.m.

COLLEGE SPORTS Field Hockey 9/25  Midd.  at  Castleton    .....................  7  p.m. 9/28  Colby  at  Midd.    ..........................11  a.m. Menâ&#x20AC;&#x2122;s Soccer 9/25  Colby-­Sawyer  at  Midd.    ..............4  p.m. 9/28  Colby  at  Midd.    ............................. Noon Womenâ&#x20AC;&#x2122;s Soccer 9/24  Lesley  at  Midd.    .........................  4  p.m. 9/28  Colby  at  Midd.    ..........................11  a.m. Football 9/28  Colby  at  Midd.    ............................1  p.m. Volleyball 9/24  Colby-­Sawyer  at  Midd.    ..............7  p.m. 9/26  S.  Vermont  at  Midd.    ...................7  p.m. 9/28  Midd.  at  Hamilton    ......................  2  p.m. Spectators   are   advised   to   consult   school   websites  for  the  latest  schedule  updates.  


PAGE  20  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

Spaulding  football  is  no  match  for  Eagles By  JOHN  FLOWERS BRISTOL  â&#x20AC;&#x201D;  Football  teams  who   face  the  Mount  Abraham/Vergennes   Union  High  School  teams  this  year   know  they  are  going  to  be  fed  dan-­ gerous  doses  of  the  teamâ&#x20AC;&#x2122;s  powerful   running  back  tandem  of  Tommy  Lee   Hodsden  and  Austin  Lafayette.   Visiting  Spaulding  was  no  differ-­ ent  on  Saturday,  though  they  also  got   a  glimpse  of  the  Eaglesâ&#x20AC;&#x2122;  developing   passing  attack,  which  produced  two   scores  en  route  to  the  Eaglesâ&#x20AC;&#x2122;    38-­6   victory. The  Eagles  got  off  to  a  quick  start.   They   won   the   toss   and   promptly   VFRUHGRQWKHÂżUVWSOD\IURPVFULP-­ mage   when   Hodsden   took   a   hand-­ off  from  quarterback  Joey  Payea  and   ran   64   yards   for   a   touchdown.   The   mercurial  back  was  handed  a  game   ball  just  before  half-­time  for  break-­ ing  the  1,000-­yard  rushing  mark  af-­

ter  only  three-­and-­a-­half  games  this   season. Hodsdenâ&#x20AC;&#x2122;s  lightning  was  followed   by  Lafayetteâ&#x20AC;&#x2122;s  thunder,  as  the  Eagle   fullback   rumbled   in   for   the   two-­ point   conversion,   making   it   8-­0,   Mount  Abe. The  Eaglesâ&#x20AC;&#x2122;  stingy  defense  did  its   part,  consistently  stopping  the  Crim-­ son  Tide  â&#x20AC;&#x201D;  which  did  not  punt  once   during  the  game  â&#x20AC;&#x201D;  on  fourth  down. Division   II   Spauldingâ&#x20AC;&#x2122;s   constant   need   to   focus   on   Hodsden   and   La-­ fayette   helped   open   up   the   Eaglesâ&#x20AC;&#x2122;   passing   attack.   Payea   hit   tight   end   Tyrus   Keith   with   a   10-­yard   touch-­ down  pass,  followed  by  a  Hodsden   two-­point   run,   to   give   the   Eagles   a   OHDGODWHLQWKHÂżUVWSHULRG Lafayette   rushed   in   from   four   yards   out   for   the   only   score   in   the   second  stanza,  giving  Mount  Abe  a   22-­0  halftime  lead.

MOUNT  ABRAHAM  UNION  High  School  freshman  Ernesta  McIntosh,   OHIWDQG9HUJHQQHV8QLRQ+LJK6FKRROIUHVKPDQ0HJDQ5RRQH\ÂżJKW for  a  loose  ball  Friday  afternoon.  McIntosh  had  a  goal  and  an  assist  in   the  Eaglesâ&#x20AC;&#x2122;  3-­1  win. Independent  photo/Trent  Campbell

Soccer (Continued  from  Page  18) At   the   other   end,   the   Eagle   de-­ fense  of  seniors  Harlie  Vincent  and   Addie  Campbell  in  the  middle  and   senior   Brittany   Atkins   and   sopho-­ PRUH -HVVH 0F.HDQ RQ WKH Ă&#x20AC;DQNV stepped   up   to   support   the   Eagle   PLGÂżHOG DQG FRQWDLQHG WKH UXQV made   by   the   VUHS   forwards,   se-­ nior  Ruby  Dombek  and  sophomore   Tea  Keifer.  Eagle  sophomore  goal-­ ie   Zoe   Cassels-­Brown   made   two   saves,  both  in  the  second  half. The   scoring   did   pick   up   after  

the  break,   but   not   before  Ambrose   came   out   to   deny   Eagle   senior   Quinn   Gervia   on   a   nice   ball,   and   Vorsteveld  stopped  Livingston  on  a   feed  from  Nault. But   at   30:32   Nault   sent   a   long   through   ball   down   the   middle   to   McIntosh,  who  won  the  battle  with   a  defender  and  from  about  the  pen-­ alty  stripe  left-­footed  the  ball  inside   the  right  post. Almost   before   the   Mount   Abe   cheers   died   down   it   was   2-­1.   Dombek   sent   Keifer   into   the   right  

Spaulding  mounted  a  nice  drive  to   open   the   second   half,   one   that   cul-­ minated  in  an  8-­yard  TD  pass  from   Josh  Gosselin  to  Kevin  Collins. Mount  Abe  responded  with  a  63-­ yard   touchdown   play.   Payeaâ&#x20AC;&#x2122;s   tight   spiral   creased   a   heavy   wind   and   dropped   into   the   arms   of   speedy   receiver   Michael   White,   who   out-­ ran   his   pursuers   along   the   Spauld-­ ing  sideline.  A  Lafayette  conversion   made  it  30-­6. The  Eagles  subbed  in  a  lot  of  play-­ ers   in   the   fourth   quarter,   and   they   joined  in  the  fun.  The  Eagles  capped   the   scoring   on   a   6-­yard   touchdown   run  by  Nate  Rowell,  followed  by  an   Ethan   Gendreau   two-­point   run   to   make  it  38-­6. +RGVGHQ ÂżQLVKHG ZLWK  FDUULHV for   137   yards,   while   Lafayette   had   12  carries  for  60  as  the  D-­III  Eagles   move  to  3-­1  Eagles.

Eagle  Coach   Ernie   Senecal   was   pleased  with  his  teamâ&#x20AC;&#x2122;s  performance   on  both  sides  of  the  ball. â&#x20AC;&#x153;Our   defense   came   to   play   to-­ day,â&#x20AC;?   he   said.   â&#x20AC;&#x153;We   played   well.   It   was   a   physical   game.   Our   defense   has   really   staggered   the   last   couple   RIJDPHVEXWZHÂżQDOO\IRXQGRXU-­ selves,  I  think.â&#x20AC;? Senecal   was   also   excited   about   the   teamâ&#x20AC;&#x2122;s   budding   passing   game,   and  gave  kudos  to  his  running  backs.   Senecal  called  Lafayette  one  of  the   best   fullbacks   in   D-­III   and   called     Hodsdenâ&#x20AC;&#x2122;s   1,000-­yard   feat   â&#x20AC;&#x153;amaz-­ ing,â&#x20AC;?  especially  in  light  of  the  major   knee  injury  he  sustained  last  year. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s   like   he   hasnâ&#x20AC;&#x2122;t   lost   a   thing,â&#x20AC;?   Senecal  said. The   Eagles   will   play   at   Windsor   on  Saturday  at  2  p.m. Reporter   John   Flowers   is   at   johnf@addisonindependent.com.

Sports BRIEFS

MUHS  football   routs  Rutland,   CVU  up  next

RUTLAND  â&#x20AC;&#x201D;   The   Middlebury   Union   High   School   football   team   on   Friday   scored   21   points   in   the   ÂżUVW TXDUWHU DQG  SRLQWV LQ WKH ÂżUVW KDOI RQ WKH ZD\ WR D  ZLQ at   Rutland   that   pushed   the   Tigersâ&#x20AC;&#x2122;   record  to  4-­0. The  Tigers  remained  tied  on  top  of   the  Division  I  standings  with  Cham-­ plain  Valley,  who  they  will  host  on   Friday,   and   South   Burlington,   who   they   are   scheduled   to   host   on   Oct.   11.  The  Raiders  dropped  to  2-­1.     The   Tigers   got   production   from   several  athletes  on  Friday,  as  backs   Nicholas   Felkl,   Jakob   Trautwein,   Cullen  Hathaway,  and  Samuel  Smith   and  quarterback  Austin  Robinson  all   UDQZHOOLQWKHÂżUVWKDOI The  Tigers  took  a  7-­0  lead  on  their   second  play  from  scrimmage,  a  47-­ yard  Trautwein  run,  followed  by  the   ÂżUVWRIÂżYH-RVK6WHDUQVSRLQWVDIWHU Stearns,  a  linebacker,  also  picked   off  two  passes  and  returned  them  to   JLYHWKH7LJHUVJRRGÂżHOGSRVLWLRQ Smith  darted  home  from  36  yards   out   to   make   it   14-­0,  and   the  Tigers   made  it  21-­0  less  than  a  minute  later:   After   a   Raider   turnover,   Hathaway   bolted  for  a  12-­yard  touchdown. Robinson  capped  the  scoring  with   two   second-­quarter   touchdowns,   runs  of  16  and  1  yards.     The  Raiders  lost  starting  QB  Nick   %ROHVWRDÂżUVWTXDUWHULQMXU\%DFN up  Andrew  Kenosh  completed  11  of   VERGENNES  UNION  HIGH  School  sophomore  Tea  Kiefer  tees  up  the   20  attempts  for  122  yards.  Wyatt  So-­ ball  and  scores  the  Commodoresâ&#x20AC;&#x2122;  only  goal  in  the  teamâ&#x20AC;&#x2122;s  3-­1  loss  to   cinski   led   the   Raider   ground   game   Mount  Abraham  last  Friday ZLWKUXVKHVIRU\DUGV Independent  photo/Trent  Campbell side  of  the  Eagle  box,  and  Keiferâ&#x20AC;&#x2122;s   Champlain   Valley,   and   they   have   hard   shot   went   into   the   upper   left   defeated   Division   IIâ&#x20AC;&#x2122;s   No.   2   team,   corner  at  30:11. Milton,   and   dealt   defending   D-­III   The   Eagles   refused   to   surrender   champion  Fairfax  its  only  loss.   momentum,   however,   and   despite   That   competition   has   helped   the   some   good   work   by  Ambrose   they   Eagles,  Livingston  said.   made  it  3-­1  at  17:22.  Charnley  took   Âł7KH\ÂśYH GHÂżQLWHO\ SUHSDUHG XV a   corner   kick   from   especially   for   this   the   left   side,   and   it   match,   because   itâ&#x20AC;&#x2122;s   GHĂ&#x20AC;HFWHGLQRIIDGH-­ â&#x20AC;&#x153;Our covenant is always   aggressive   fender.   and   you   always   that we sweat toDown   the   stretch,   KDYHWRÂżJKWIRUWKH gether, we stick toAmbrose   saved   an   V´/LYLQJVWRQ Ashlie   Fay   penalty   gether. This game, said. kick.   The   Eagles   I think it showed The   Eagles   are   also  made  two  good   today. We were all excited   about   their   defensive   plays   as   very tenacious.â&#x20AC;? prospects,  she  said.   the   Commodores   â&#x20AC;&#x201D; Eagle tri-captain â&#x20AC;&#x153;I   think   we   look   kept   plugging:   At-­ really   strong   this   Meghan Livingston year,â&#x20AC;?   Livingston   kins   came   over   to   break  up  a  nice  feed   said.   â&#x20AC;&#x153;We   have   to  Hunt  by  Dombek,   some   really   good   and   as   time   wound   down   two   de-­ VSHHG DQG RXU PLGÂżHOG LV UHDOO\ fenders   denied   Keifer   on   another   strong.â&#x20AC;?         Dombek  setup. Corrigan  is  also  optimistic.   Irish   remains   optimistic   despite   â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ve  been  off  to  a  good  start.   the  setback.  After  all,  the  Commo-­ Weâ&#x20AC;&#x2122;ve   played   a   lot   of   the   tough   dores  have  a  winning  record  against   teams,â&#x20AC;?   Corrigan   said.   â&#x20AC;&#x153;We   feel   a  tough  schedule.     like  we  can  compete  with  anybody.   â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re  young  and  getting  better,â&#x20AC;?   That   gives   the   girls   a   lot   of   con-­ Irish   said.   â&#x20AC;&#x153;Hopefully,   at   playoff   ÂżGHQFH JRLQJ IRUZDUG JRLQJ LQWR time  it  will  all  come  together.â&#x20AC;? the  rest  of  the  league  and  the  play-­ The  Eagles  have  also  taken  on  a   offs.â&#x20AC;? challenging  slate:  Their  only  losses   Andy  Kirkaldy  may  be  reached  at   have   been   to   D-­I   foes   U-­32   and   andyk@addisonindependent.com.

Late  goal  dooms   OV  girlsâ&#x20AC;&#x2122;  soccer EAST   CLARENDON   â&#x20AC;&#x201D;   The   Otter   Valley   Union   High   School   girlsâ&#x20AC;&#x2122;  soccer  team  came  up  just  short   against   undefeated   Mill   River   on   Thursday,  1-­0.   Thanks  to  a  strong,  17-­save  effort   from  senior  goalie  Cortney  Poljacik,   WKH 2WWHUV KHOG RII WKH  0LQXWH-­ men   until   about   14   minutes   left   in   the  second  half.  But  then  Haley  Hull   poked   home   an   Ella   Bankert   feed   for  the  gameâ&#x20AC;&#x2122;s  only  goal.   MRU   had   scored   22   goals   in   its   four  previous  wins.  OV  dropped  to   DQGZLOOORRNWRERXQFHEDFNDW Woodstock   on   Wednesday   and   at   home  on  Saturday  vs.  Proctor  at  10   a.m.

Boys (Continued  from  Page  19) livan   Swearingen.   Coach   Bret   Weekes   said   Max   Livingstone-­ Peters  played  well  defensively,  and   Evan  Ryan  and  Birdsey  also  creat-­ ed  chances  on  the  attack.  Nate  Cary   notched  two  goals  for  Milton.  


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  21

Out of towners compete with Sodbusters Share  the  Harvest  to  hold %5,672/ ² 6HYHQW\RQH SLWFK-­ ers  participated  in  the  Fall  Roundup   tournament  hosted  by  the  Sodbusters   +RUVHVKRH 3LWFKLQJ &OXE LQ %ULVWRO on  Sept.  15. 3HUHQQLDOSRZHUKRXVH%ULDQ6LP-­ PRQGV RI %ULVWRO KHOG RII 'HEUD %URZQ IRU WKH FKDPSLRQVKLS LQ &ODVV $ FRPSHWLWLRQ %XW WKH\ JRW competition   from   several   out-­of-­ staters,  including  Sylvianne  Moisan   DQG$QGUH/HFOHUFRI4XHEHF+RZH 5LFN RI 0DVVDFKXVHWWV DQG 'HDQ Squires  of  New  Hampshire. The   full   results,   including   won-­ loss   record   and   ringer   percentage,   were  as  follows:   CLASS  A  %ULDQ 6LPPRQV    'HEUD%URZQ6\OYLDQQH 0RLVDQ5LFN+RZH   *HRUJLD 0F&RUPLFN    $QGUH /HFOHUF    'HDQ 6TXLUHV    *DOH *UHHQH CLASS  B -RUGDQ'UDSHU%UL-­

DQQD0F&RUPLFN%UHQGD 3UHVWRQ'DQ$WZRRG (GZDUG/RZH 5RJHU/DPRXUHX['LDQD 0DUWLQ  6KHOO\0DUWLQH]  CLASS  C 0LFKDHO%URZQ5RE-­ HUW:ULJKW(G2¶5RXUNH    6WHYH .QXGVHQ  5RQ:LOOLDPVRQ  3DXO :LOVRQ    7KHUHVD 0HVKQLFN'RQQD/HZLV  CLASS  D  'HVWLQQLH :LONH    -RKQ5HP\6WHYH&URVV 6WHYH&ODUN 'DZQ&ROHPDQ*UDQW /HZLV-U-RKQ%DEFRFN 6DUD:LOVRQ CLASS  E 'HQQ\<RXQJ%UXFH 2OGHQEXUJ%UXFH'XFK-­ DLQH-HVVLFD0DUWHOO $ODQ&DUSHQWHU -XDQLWD5DWWD%LOO7LQ-­ NHU CLASS  F &UDLJ%URZQ'DYH

$GDPV5DQG\/LWWOH6U    %LOO /LWWOH   /DUU\6DQWRU7RQ\0F-­ &XOORXJK CLASS  G  5REE 'RHNHO    -HQQ\ 3DFNDUG    -HI-­ IUH\:RRGFRFN    +HDWKHU 6HOOHFN(OEHUW7UDVN 'DYLG3DTXHWWH 0DWW&ROHPDQ%LOO$O-­ H[DQGHU-U CLASS  H  &KULVWRSKHU 3ULP    -RKQ 3ODQWH    0DXULFH &\U$QJHOD&KHOOLV %HYHUO\)RUJXHV  6WHYH *HUPDLQ    7LP 7LQNHU CLASS  I  0LVW\OHH %DLUG    7KRPDV%URRNV-U0D[-­ LQH %UDQGDOLN    6FRWW +DQ-­ VHQ CLASS  J   0\URQ6HOOHFN-HQ 3ULP-RH+LOO .ROE\&DUSHQWHU&HG-­ ULF&ROXPE5REHUW0DUWL-­ QH]-HUHP\0HQWLSO\

Master  endurance  athlete  recognized VERMONT   â&#x20AC;&#x201D;   The   Vermont   Sports   Media   Association   picked   a   71-­year-­old   endurance   athlete   as   its   August  Athlete  of  the  Month.   Phil  Alderman  of  Wallingford  was   chosen   in   a   statewide   vote   of   the   960$ PHPEHUVKLS RYHU ÂżYH RWKHU candidates   for   the   monthly   honor.   Each   was   nominated   by   a   VSMA   member.   On   Aug.   18,   Alderman   was   one   of   only   three   competitors   in   his   age   group  (70-­74)  among  2,700  athletes  at   the  Mont  Tremblant  Subaru  Ironman   UDFHLQ4XHEHF7KHFRXUVHFRQVLVWHG of  a  2.4-­mile  swim,  a  112-­mile  bicycle   ULGHDQGDPLOHUXQWRWKHÂżQLVK Aldermanâ&#x20AC;&#x2122;s   competitors   dropped   out  

after  the  swim,  but  he  went  on  to  com-­ SOHWHWKHPLOHHYHQWLQKRXUV and  29  minutes  â&#x20AC;&#x201D;  even  though  he  has   WZRDUWLÂżFLDONQHHV,WZDV$OGHUPDQÂśV ÂżUVW,URQPDQHYHQW Among  those  Alderman  outpolled   for  Athlete  of  the  Month  was  another   senior   endurance   athlete,   swimmer   'RQ 0F,QWRVK RI 0LGGOHEXU\ 0F-­ Intosh,   a   70-­year-­old   retired   Mid-­ dlebury   Union   Middle   School   PE   teacher,  added  to  his  roughly  dozen   mastersâ&#x20AC;&#x2122;   swimming   championships   on  Aug.   17,   when   he   won   the   U.S.   Open  Water  Two-­Mile  swim  for  his    DJH JURXS LQ /DNH 3ODFLG 1<0F,QWRVKFRPSOHWHGWKHVZLP LQ0LUURU/DNHLQDERXW

VERMONT  â&#x20AC;&#x201D;   The   Northeast   Organic  Farming  Association  of  Ver-­ mont   (NOFA-­VT)   has   announced   collaboration  with  approximately  70   restaurants,   food   markets   and   food   cooperatives  throughout  Vermont  for   the  19th  annual  â&#x20AC;&#x153;Share  the  Harvestâ&#x20AC;?   fundraising   event.   On   Thursday,   Oct.   3,   participating   restaurants   and   food  stores  will  donate  a  percentage   of   their   sales   to   NOFA-­VTâ&#x20AC;&#x2122;s   Farm   Share  Program. The   Farm   Share   Program   is   dedi-­ cated   to   working   with   Vermont   individuals   who   cannot   afford   to   purchase   fresh,   local   produce   on   a   regular   basis.   All   funds   raised   on   2FW  ZLOO EHQHÂżW WKHVH LQGLYLGXDOV by  subsidizing  the  cost  of  farm-­fresh   produce   from   local   community   sup-­ ported  agriculture  (CSA)  farms. The  Farm  Share  program  has  been   helping   limited-­income   Vermonters   purchase  food  from  local  farms  since   1994.  In  those  18  years,  thousands  of   LQGLYLGXDOVDQGIDPLOLHVKDYHEHQHÂżW-­

minutes  faster   than   his   closest   age   peer. Also   nominated   were   Thunder   5RDG GULYHU 'HUULFN 2œ'RQQHOO RI North  Haverhill,  N.H.,  and  three  high   school  football  players,  senior  Robert   .HOO\RI%)$6W$OEDQVVHQLRU1LFN %ROHV RI 5XWODQG DQG MXQLRU &KULV McClellan  of  Milton.   The   VSMA   honors   only   one   ath-­ lete   during   the   months   of   July   and   August.   With   the   start   of   the   high   school   season,   the   organization   will   return  for  the  next  10  months  to  hon-­ oring  a  Female  High  School  Athlete   of   the   Month,   a   Male   High   School   Athlete   of   the   Month,   and   an   Open   'LYLVLRQ$WKOHWHRIWKH0RQWK

MCTV  SCHEDULE  Channels  15  &  16 MCTV  Channel  15 Tuesday, Sept. 24   4  a.m.    Public  Affairs   4:30  a.m.   Lakeshore  Protection   7:30  a.m.   Jamie  Gaucher  with  Peter  Burrows   8  a.m.   Congregational  Church  Service   9:30  a.m.   Rep.  Betty  Nuovo   10  a.m.   Selectboard  11:50  a.m.   Public  Meeting/Public  Affairs   3  p.m.   Mid  East  Digest   4  p.m.   Chronique  Francophone   4:30  p.m.   Vershire  Bible  Church  Service   6  p.m.   Community  Bulletin  Board   7  p.m.   Selectboard   11  p.m.   PSB  Hearing:  Pipeline Wednesday, Sept. 25   4  a.m.    Public  Affairs  DP 7RZQ2I¿FHV0HHWLQJ   6:30  a.m.   Mid  East  Digest   7:30  a.m.   Memorial  Baptist  Church  Service   10  a.m.   Selectboard   Noon   Jamie  Gaucher  with  Peter  Burrows  12:30  p.m.   Lakeshore  Protection   4:30  p.m.   Words  of  Peace   5  p.m.   Community  Bulletin  Board   5:30  p.m.   Las  Promesas  de  Dios     6  p.m.   Chronique  Francophone   6:30  p.m.   Rep.  Betty  Nuovo   7  p.m.   Vermont  Health  Connect   8:30  p.m.   Las  Promesas  de  Dios   9  p.m.   Selectboard   11  p.m.   Lakeshore  Protection Thursday, Sept. 26   4  a.m.   Public  Affairs   4:30  a.m.   PSB  Hearing:  Pipeline  11:30  a.m.   Chronique  Francophone   Noon   Selectboard/Public  Meeting/Public  Affairs   5  p.m.   Community  Bulletin  Board

fundraising  event  on  Oct.  3

 SP 7RZQ2I¿FHV0HHWLQJ  9:30  p.m.   Jamie  Gaucher  with  Peter  Burrows   10  p.m.   PSB  Hearing:  Pipeline  Friday, Sept. 27   4  a.m.   Public  Affairs   6  a.m.   Jamie  Gaucher   6:30  a.m.   Vermont  Today   8:15  a.m.   Community  Bulletin  Board   8:30  a.m.   Chronique  Francophone   9  a.m.   Las  Promesas  de  Dios   9:30  a.m.   Jamie  Gaucher  DP 6HOHFWERDUG7RZQ2I¿FHV0HHWLQJ   3:30  p.m.   Lifelines   4  p.m.   Memorial  Baptist  Church  Service   5:30  p.m.   Community  Bulletin  Board   6  p.m.   Mid  East  Digest   7  p.m.   Vermont  Today   8:30  p.m.   PSB  Hearing:  Pipeline Saturday, Sept. 28   4  a.m.    Public  Affairs   5  a.m.   Lakeshore  Protection   8:30  a.m.   Chronique  Francophone   9  a.m.   Las  Promesas  de  Dios   9:30  a.m.   Rep.  Betty  Nuovo   10  a.m.   Selectboard/Public  Affairs  SP 7RZQ2I¿FHV0HHWLQJ   4  p.m.   Memorial  Baptist  Church  Service   5:30  p.m.   Community  Bulletin  Board   5:45  p.m.   For  the  Animals   6:30  p.m.   Lakeshore  Protection Sunday, Sept. 29   4  a.m.   Public  Affairs     6:30  a.m.   For  the  Animals     7  a.m.   Words  of  Peace   7:30  a.m.   Chronique  Francophone   8  a.m.   Las  Promesas  de  Dios   8:30  a.m.   Community  Bulletin  Board   9  a.m.   Catholic  Mass

ed  from   a   seasonâ&#x20AC;&#x2122;s   worth   of   locally   grown   vegetables   and   fruits   as   well   as  farm  education  initiatives.  In  2013,   the   program   has   served   over   1,400   individuals   and   families,   leveraging   over  $73,000  of  income  for  Vermont   farmers. â&#x20AC;&#x153;Share   the   Harvestâ&#x20AC;?   participating   businesses   in  Addison   County   as   of   Sept.  17  are: Â&#x2021; 9HUPRQW &RRNLH /RYH 1RUWK Ferrisburgh. Â&#x2021; $PHULFDQ )ODWEUHDG 0LGGOH-­ bury. Â&#x2021; )LUHDQG,FH0LGGOHEXU\ Â&#x2021; *UHHQ3HSSHUV5HVWDXUDQW0LG-­ dlebury. Â&#x2021; 0LGGOHEXU\ 1DWXUDO )RRGV &R op,  Middlebury. Â&#x2021; 2WWHU&UHHN%DNHU\0LGGOHEXU\ Â&#x2021; 6WRQH /HDI 7HDKRXVH 0LGGOH-­ bury. Â&#x2021; 5HG0LOO5HVWDXUDQW9HUJHQQHV Visit   www.nofavt.org/STH   for   a   complete   listing   of   participating   Vermont  businesses.

Bristol Electronics 453-­2500

MIDDLEBURY COMMUNITY TELEVISION: P.O. Box 785, Middlebury, Vt. 05753

Please  see  the  MCTV  website,  www.middleburycommunitytv.org,  for  changes  in  the  schedule;  MCTV  events,   classes  and  news;  and  to  view  many  programs  online.  Submit  listings  to  the  above  address,  or  call  388-­3062.

 9:30  a.m.   Public  Affairs   11  a.m.   Memorial  Baptist  Church  Service   1  p.m.   Vershire  Bible  Church  Service   4  p.m.   Congregational  Church  Service   5:30  p.m.   Community  Bulletin  Board/Public  Affairs   6:30  p.m.   Las  Promesas  de  Dios   7  p.m.   Catholic  Mass   7:30  p.m.   Lakeshore  Protection  10:30  p.m.   Words  of  Peace Monday, Sept. 30   8:30  a.m.   Chronique  Francophone   9  a.m.   Lifelines   9:30  a.m.   Public  Affairs   10  a.m.   Selectboard/Public  Meetings   4  p.m.   Congregational  Church  Service   5:30  p.m.   Las  Promesas  de  Dios   6  p.m.   Community  Bulletin  Board   6:30  p.m.   Public  Affairs METV Channel 16 Tuesday, Sept. 24   5  a.m.   Vermont  Media  Exchange   8:30  a.m.   Community  Health  Talk   10  a.m.   Mansour  Farhang:  Islam  and  Democracy   in  the  Middle  East   Noon   ID-­4  Board   2:30  p.m.   New  England  Review   4  p.m.   Lights,  Camera,  Action   6  p.m.   UD-­3  Board   10  p.m.   State  Board  of  Education Wednesday, Sept. 25   5:30  a.m.   Understanding  Climate  Change  I  and  II   8  a.m.   ID-­4  Board   Noon   UD-­3  Board   4  p.m.   Mansour  Farhang:  Islam  and     Democracy  in  the  Middle  East   6:30  p.m.   ACSU  Full  Board   10  p.m.   Middlebury  Five-­0

 10:30  p.m.   Green  Mountain  Club  (GMC) Thursday, Sept. 26   4  a.m.   GMC     6  a.m.   Middlebury  Five-­0   6:30  a.m.   Storytelling,  Arts  and  Performance   8  a.m.   State  Board  of  Education     1  p.m.   ACSU  Board   4  p.m.   Our  Natural  Environment   6:30  p.m.   Middlebury  Five-­0   7  p.m.   UD-­3  Board Friday/Saturday, Sept. 27/28   5:30  a.m.   Our  Natural  Environment     8  a.m.   ID-­4/Other  School  Boards   Noon   UD-­3/ACSU  Boards   5  p.m.   Middlebury  Five-­0   5:30  p.m.   Lights,  Camera,  Action   6:30  p.m.   Storytelling,  Arts  and  Performance   8  p.m.   Mansour  Farhang:  Islam  and     Democracy  in  the  Middle  East   9:30  p.m.   Understanding  Climate  Change  I  &  II Sunday, Sept. 29   6  a.m.   Lights,  Camera,  Action   6:30  a.m.   UD-­3  or  HCC  Board   9  a.m.   ACSU  Full  Board   Noon   Middlebury  Five-­0   4:30  p.m.   Our  Natural  Environment   5  p.m.   Middlebury  Five-­0   6  p.m.   Storytelling,  Arts  and  Performance   10  p.m.   Mansour  Farhang:  Islam  and     Democracy  in  the  Middle  East  Monday, Sept. 30   5  a.m.   Mansour  Farhang:  Islam  and     Democracy  in  the  Middle  East   8  a.m.   State  Board  of  Education   2:30  p.m.   New  England  Review   5  p.m.   GMC   7  p.m.   ID-­4  or  Other  School  Board,     State  Board  of  Education


PAGE  22  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

How does your pet become a

First,  send  us  a  photo

e h t W f e o e t k? e P

Weâ&#x20AC;&#x2122;ll  print  it  large,  so    if  possible,   VHQGXVWKHRULJLQDOXQFURSSHGÂżOH that  came  from  your  digital  camera,   attached  in  an  email.  If  you  bring  in   or  mail  us  a  photograph,  we  can  scan   it  into  our  computers.  Photos  printed   out  on  a  printer  never  look  as  good   DVWKHRULJLQDOÂżOH\RXSULQWHGIURP so   if   possible   send   us   the   original   GLJLWDOÂżOH Sometimes,   we   get   photos   taken   from   a   web   page   like   Facebook.  Al-­ though  these  look  good  on  a  computer   screen,  often  they  look  fuzzy  in  print.   We  will  try  our  best  to  make  them  look   as   good   as   we   can,   but   the   original,   high  quality  imge  is  always  best.

Next,  write  something

about  your   pet,   include   your   petâ&#x20AC;&#x2122;s   name,   gender,   approximate   age   (if   you   know   it),   along   with   comments   about  the  petâ&#x20AC;&#x2122;s  favorite  activities,  your   favorite  activity  with  the  pet,  what  the   pet  enjoys  eating,  and  any  particular   stories  or  incidents  you  might  like  to   share  concerning  your  pet.

Send  the  photo  and  story  

by  email   to   news@addisonindepen-­ dent.com,  or  via  physical  mail  to  the   Addison   Independent,   Pet   Page,   58   Maple  St.,  Middlebury,  Vt.,  05753.

Itâ&#x20AC;&#x2122;s easy! and itâ&#x20AC;&#x2122;s Free!

Clip  it  out  and  put  it  on   your  fridge!

Champlain Valley Small Animal

Ride, Roast, and Rock!

MOBILE CLINIC Randall Ross, VMD Middlebury Town Green Saturday, September 28 www.addisonteens.com

On-site Diagnostics Wellness Exams - Vaccines Lyme & Heartworm Testing Flea & Tick Products Home Euthanasia

S  â&#x20AC;&#x2122;S   WHAT E  WEB  THI ON  TH ? WEEK

Check  out  our  new   features  and  additional   content www.  

 s 6ERMONTMOBILEVETCOM

addisonindependent  .com

PETS IN NEED HOMEWARD BOUND ANIMAL WELFARE CENTER If  you  are  looking  for  a  spunky,  fun  and  entertaining   feline,   Iâ&#x20AC;&#x2122;m   the   cat   for   you!   Iâ&#x20AC;&#x2122;m   playful   and   have   a   youthful  and  energized  spirit.  Iâ&#x20AC;&#x2122;m  one  of  those  kitties   who   will   chatter   and   loll   around   on   her   back   for   DWWHQWLRQ0\QDPHLV0XODQDQG,ZRXOGORYHWRÂżQG my  new  forever  home!     I   have   lived   with   other   cats   before,   but   my   experience  with  dogs  and  small  children  is  unknown.   Iâ&#x20AC;&#x2122;m   simply   a   fun,   petite   and   silly   little   gal   who   will   happily  welcome  you  home  each  and  every  day.  The   staff   says   I   make   them   laugh!   Take   me   home   and   youâ&#x20AC;&#x2122;ll  see!

Well,  hello   there.   Iâ&#x20AC;&#x2122;m   Graham.   Iâ&#x20AC;&#x2122;m   a   super   handsome  boy  who  longs  to  be  loved  and  snuggled.  I   was  abandoned  outside  for  a  long  time  before  I  found   my  way  to  the  shelter.  Iâ&#x20AC;&#x2122;ve  received  lots  of  TLC  since  I   came  here  and  Iâ&#x20AC;&#x2122;m  feeling  and  looking  wonderful.   Iâ&#x20AC;&#x2122;m  a  mellow  and  quiet  sort  of  guy  who  might  enjoy   the  company  of  another  feline  friend.  The  staff  thinks   Iâ&#x20AC;&#x2122;m  neat  and  just  such  a  sweet,  sweet  boy.   I   love   my   meals,   but   most   of   all,   Iâ&#x20AC;&#x2122;m   looking   to   be   petted   and   cuddled   with.   If   you   are   looking   for   a   handsome   companion   with   a   kind,   sweet   and   loving   personality,  come  meet  me  today!  I  will  melt  your  heart!  

%RDUGPDQ6WUHHW0LGGOHEXU\Â&#x2021;Â&#x2021;&DOORUFKHFNRXUZHEVLWH:HPD\KDYHDSHWIRU\RXZZZKRPHZDUGERXQGDQLPDOVRUJ Â


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  23

2013 Garden Game

presents: Doris Rotax of  Lincoln  has  a   long   standing   competition   in   our   Garden   Game   for   largest   potato   every   year.   She   and   Floyd   Hall,   also   of   Lincoln,   always   seem   to   compete   for   the  largest  spud.  This  year  she   brought   in   a   potato   that   was   8   inches   long   by   10   inches   around.   It   wasnâ&#x20AC;&#x2122;t   quite   large   enough  to  be  a  winner,  but  she   did  say  she  has  more  to  dig  up.

We still need entries for broccolli, carrot, cauliflower & turnip! Fran Putnam  is   another   returning   Garden   Game   player.   She   has   been   a   winner   in   our   rutabaga   category   before.   We   love   when   she   comes   to   visit   with   her   grandkids,   Cole and   Eliza.   This   year   Cole   started   kindergarten,   so   we   got   a   special   visit   from   Fran   and  Eliza.  The  rutabaga  they   brought   in   was   11.5   inches   DURXQG DQG LV WKH ÂżUVW RQH weâ&#x20AC;&#x2122;ve   gotten!   Fran   says   it   was   a   pretty   hard   year   for   vegetables   like   these.   In   the   past   her   rutabaga   entries   have  been  much  larger.

Floyd Hall,  who   competes   with   Doris   every   year   for   largest  potato,  has  taken  the   lead  for  the  category  for  2013.   Floyd  and  his  granddaughter,   Halle Forrest,   came   by   last   week   to   show   us   several   potatoes   that   they   grew   in   their  garden  in  Lincoln.  They   had   a   red   one   that   was   16   inches   around   by   11   inches   long.  The  largest  potato  was   15.5  inches  long  by  17  inches   around.   The   other   large   on   was  16  inches  around  by  13   inches  long.

Walter Phelps  came   in   last   week   to   show   us   the   largest   beet  we  have  ever  seen!  This   beet   takes   the   frontrunner   spot  for  the  category  at  24.5   inches   around!   Walter   grew   this   big   beet   in   his   garden   in   Orwell.   We   werenâ&#x20AC;&#x2122;t   sure   where   to   even   start   when   trying  to  cook  it.

Julie Lonergan  is   a   returning   player   in   our   Garden   Game.   She   brought   in   a   huge   pumpkin   that   was   59   inches   around   by   61.5   inches  around!  This  massive   pumpkin   had   the   frontrunner   spot,   but   late   last   week   someone   came   in   with   an   even   bigger   one!   Julie   told   us   she   didnâ&#x20AC;&#x2122;t   think   she   had   any   pumpkins   but   when   her   garden   started   to   die   back,   low   and   behold,   she   found   this   big   pumpkin   that   she   started  from  seed.  

Debra Bessette  visited   us   last   week   and   took   over   the   frontrunner   spot   for   pumpkins!  Julie  had  the  lead,   but   Debraâ&#x20AC;&#x2122;s   pumpkin   was   a   bit  larger  at  66  inches  around   by   62   inches   around!   The   picture   is   of   her   grandsons,   Xander and Xavier DeBlois   with   the   giant   pumpkin   in   her   garden   in   New   Haven.   She   said   she   had   a   ton   of   pumpkins   at   home   â&#x20AC;&#x201C;   lots   of   big  ones  like  these,  but  even   more  smaller  ones  as  well.

CATEGORIES & FRONTRUNNERS

Â&#x2021;%HHWV (circumference) :DOWHU3KHOSV2UZHOOÂľ Â&#x2021;%URFFROL(diameter) Â&#x2021;&DEEDJH(circumference) *HRUJH%LVFRH%ULGSRUWÂľ Â&#x2021;&DQWDORXSH(circumference) *HRUJH%LVFRH%ULGSRUWÂľ Â&#x2021;&DUURW(length x circumference) Â&#x2021;&DXOLĂ RZHU(diameter) Â&#x2021;&XFXPEHU (length x circumference) 5RJHU6FDUERURXJK/HLFHVWHUÂľ[Âľ

Â&#x2021;(JJSODQW(circumference x circumference) 3HWHU'HPRQJ&RUQZDOOÂľ[Âľ Â&#x2021;*UHHQ%HDQ(length) *DU\0LOOHU0LGGOHEXU\Âľ Â&#x2021;%HOO3HSSHU(circumference x circumference)  %RE$QGHUVRQ%ULGSRUWÂľ[Âľ Â&#x2021;2QLRQ(circumference) 'DQQ\*UDFH%ULVWROÂľ Â&#x2021;3RWDWR(length x circumference) )OR\G+DOO/LQFROQÂľ[Âľ

RULES OF THE GARDEN GAME Â&#x2021;(QWULHVPXVWEHKRPHJURZQLQWKHJUHDWHU$GGLVRQ&RXQW\DUHDÂ&#x2021;2QO\SURGXFHEURXJKWWRWKH $GGLVRQ,QGHSHQGHQWRIĂ&#x20AC;FHEHWZHHQDP SP0RQ)ULZLOOEHHOLJLEOHÂ&#x2021;7KHJDUGHQHURUDIULHQG RUIDPLO\PHPEHUVKRXOGEULQJLQWKHHQWU\Â&#x2021;:HHNO\IURQWUXQQHUVZLOOEHOLVWHGLQWKH´*DUGHQ*DPHÂľ FROXPQXQWLOVRPHRQHHOVHEXPSVWKHPRIIZLWKDODUJHUH[DPSOHRIWKDWSDUWLFXODUIUXLWRUYHJHWDEOH 7KH ODUJHVW HQWULHV DV RI 7KXUVGD\ QRRQ GHDGOLQH ZLOO EH WKH IURQW UXQQHUV OLVWHG LQ WKDW 0RQGD\¡V HGLWLRQ Â&#x2021;7KHUHZLOOEHRQHZLQQHUSHUFDWHJRU\Â&#x2021;:KDWWKH-XGJHVVD\JRHVÂ&#x2021;$WWKHVLJQRIWKHĂ&#x20AC;UVW IURVWĂ&#x20AC;QDOĂ&#x20AC;UVWSODFHZLQQHUVZLOOEHDQQRXQFHG

Â&#x2021;3XPSNLQ(circumference x circumference) 'HEUD%HVVHWWH1HZ+DYHQÂľ[Âľ Â&#x2021;5XWDEDJD(circumference) )UDQ3XWQDP:H\EULGJHÂľ Â&#x2021;6XPPHU6TXDVK(length x circumference) .DWKOHHQ+XEEDUG0LGGOHEXU\Âľ[Âľ Â&#x2021;6XQĂ RZHU(diameter) 5DYHQ3D\QH&RUQZDOOÂľ Â&#x2021;7RPDWR(circumference) +DQQDK'DYLGVRQ%UDQGRQÂľ Â&#x2021;7XUQLS(circumference) Â&#x2021;=XFFKLQL(length x circumference) *DU\0LOOHU0LGGOHEXU\Âľ[Âľ ADDISON COUNTY

INDEPENDENT

VERMONTâ&#x20AC;&#x2122;S TWICE-­WEEKLY NEWSPAPER 0LGGOHEXU\97Â&#x2021;  Â&#x2021;ZZZ$GGLVRQ,QGHSHQGHQWFRP


PAGE  24  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

Over 31 years of personalized, comfortable care in a high-tech dental office!

1FUFS+)PQQFS %%4t"EBN&'BTPMJ %.% #SJBO%$PMMJOT %%4 t.PTU*OTVSBODF8FMDPNFt&NFSHFODJFT8FMDPNF t/FX1BUJFOUT8FMDPNF 133&YDIBOHF4USFFU 4VJUFt.JEEMFCVSZ (802) 388-3553

www.middleburydentalvt.com

News Tip?Give  Us  A  Call,  388-­4944

Shoreland (Continued  from  Page  1 implemented   standards   that   would   the  committees  of  jurisdiction  (over   stateâ&#x20AC;&#x2122;s  812  lakes  and  ponds  that  are   include   vegetation   and   (buffers)   of   the  bill)  can  take  a  look  to  make  sure   greater  than  10  acres.  Together,  they   greater   than   50   feet,â&#x20AC;?   Webb   said.   the  proposed  regulations  are  perfor-­ encompass  more  than  230,000  acres   â&#x20AC;&#x153;Where  we  are  right  now  is  that  20   mance-­based. of  water  (not  including  Lake  Cham-­ percent   of   the   towns   have   actually   Sen.   Bob   Hartwell,   D-­Benning-­ plain,  which  is  313,600  acres)  lying   created  shoreland  protection  bylaws   ton,  added  that  the  rules,  when  draft-­ within   300,000   acres   of   wetlands,   or  any  kind  of  zoning  ordinance.â&#x20AC;? ed,   will   also   have   to   pass   muster   DFFRUGLQJWR$15RIÂżFLDOV The   ANR   will   be   charged   with   with   the   Legislative   Committee   on   Using  an  ANR-­produced  video  as   GUDIWLQJ UXOHV WR UHĂ&#x20AC;HFW WKH OHJLVOD-­ Administrative  Rules. part   of   their   presen-­ tive  intent  of  a  shore-­ â&#x20AC;&#x153;Youâ&#x20AC;&#x2122;ll   get   two   shots   at   rules   re-­ tation,   the   commis-­ lands  bill  that  is  ulti-­ view   on   this   case,   which   is   really   sion   explained   that   â&#x20AC;&#x153;If you can do your mately  passed  by  the   good,â&#x20AC;?  Hartwell  said. the   stateâ&#x20AC;&#x2122;s   strategy   activity and protect General   Assembly   Still,  it  was  clear  on  Thursday  that   to   keep   lakes   and   both the habitat and  signed  into  law. many   Addison   County   shoreland   ponds   clean   has   in-­ and the water qualH o u s e -­ p a s s e d   residents   are   nervous   about   what   cluded  working  with   H.526  calls  for: kind  of  law  the  Legislature  and  ANR   farmers  and  munici-­ ity of the lake, then Â&#x2021;7KH$15WRFUH-­ will  ultimately  produce.  Some  folks   pal   sewer   plants   to   youâ&#x20AC;&#x2122;re set; youâ&#x20AC;&#x2122;re ate   vegetation   man-­ at  Thursdayâ&#x20AC;&#x2122;s  meeting  were  frustrat-­ try   and   prevent   dis-­ good to go.â&#x20AC;? agement   standards   HGWKDWSXEOLFLQSXWZDVFRQÂżQHGWR charges   â&#x20AC;&#x201D;   particu-­ undeveloped   written  questions  they  could  submit   â&#x20AC;&#x201D; Rep. David Deen for   larly   phosphorous   shoreline   lots.   No   IURPWKHĂ&#x20AC;RRU:KLOHWKHVHTXHVWLRQV â&#x20AC;&#x201D;   from   entering   permit   would   be   re-­ will  become  part  of  the  record  as  the   waterways.  Markowitz  said  the  state   quired  for  undeveloped  lots  for  new   commission   does   its   work,   the   for-­ now  wants  to  bring  shoreland  prop-­ impervious   surface   or   clearing   in-­ mat   did   not   allow   people   to   make   erties   into   the   regulatory   fold,   spe-­ volving  less  than  500  square  feet. impassioned   comments   from   the   FLÂżFDOO\ DV LW UHODWHV WR PDLQWDLQLQJ Â&#x2021; ,Q FDVHV RI LPSURYHPHQWV WR Ă&#x20AC;RRU shoreline   vegetation   as   a   means   of   existing   homes   (which   would   be   Some  of  the  questions  expressed   preventing   erosion,   reducing   storm   grandfathered),  no  permit  would  be   RSSRVLWLRQ WR + DQG UHĂ&#x20AC;HFWHG water  runoff  and  providing  a  natural   required   for   undeveloped   lots   for   skepticism   about   the   ANRâ&#x20AC;&#x2122;s   abil-­ ÂżOWHU IRU UXQRII WKDW PDNHV LWV ZD\ new   impervious   surface   or   clearing   ity  to  come  up  with  sensible  rules   into  ponds  and  lakes. involving  less  than  500  square  feet. that  could  be  reasonably  enforced.   Markowitz  said  it  was  after  Tropi-­ Â&#x2021; ([LVWLQJ QRQFRQIRUPLQJ ORWV One  questioner  noted  the  state  had   cal   Storm   Irene   in   August   of   2011   would   be   developable   â&#x20AC;&#x153;provided   recently   built   two   cottages   within   that  she  became  particularly  focused   that   adequate   mitigation   measures   100   feet   of   the   Lake   Champlain   on  the  stateâ&#x20AC;&#x2122;s  shorelines  and  the  role   are  implemented.â&#x20AC;? shoreline  at  Button  Bay  State  Park.   they  play  in  keeping  lakes  and  ponds   Commission   members   have   been   Markowitz   acknowledged   the   clean.   She   recalled   seeing   post-­ particularly   receptive   to   the   current   gaffe. storm  photos  of  lakes. Maine  shoreland  law,  which  among   â&#x20AC;&#x153;This  has  led  to  an  audit  of  what   â&#x20AC;&#x153;In  places  where  there  was  natural   other  things: our  practices  are,â&#x20AC;?  Markowitz  said. vegetation,  there  was  a  little  damage   Â&#x2021;5HTXLUHVDIRRWZLGHEXIIHU And  there  is  clearly  some  division   and   the   water   was   a   little   murky,â&#x20AC;?   between   the   lake/pond   and   future   among   committee   members   about   she   said.   â&#x20AC;&#x153;But   where   there   wasnâ&#x20AC;&#x2122;t   construction  on  an  undeveloped  lot. shorelands  legislation. any  natural  vegetation,  it  was  brown.   Â&#x2021; &DOOV IRU QDWX-­ C o m m i s s i o n   You  could  see  the  runoff,  you  could   ral   vegetation   to   be   â&#x20AC;&#x153;From day one, member   Thomas   see  the  erosion  and  people  lost  prop-­ maintained   within   Terenzini,  a  Republi-­ Iâ&#x20AC;&#x2122;ve said that this erty.â&#x20AC;? 100   feet   of   the   wa-­ can   House   represen-­ Markowitz   said   Vermont   is   the   terâ&#x20AC;&#x2122;s   edge   in   cases   is nothing but a tative   from   Rutland,   only   Northeastern   state   without   where   someone   power grab by the was  candid  in  his  op-­ standards   for   shoreland   develop-­ wants   to   redevelop   ANR in the state of position  to  a  legisla-­ ment.   She   and   other   commission   an   existing   home.   Vermont.â&#x20AC;? tive  effort  to  regulate   members   cited   New   Hampshire   The   law   allows   a   â&#x20AC;&#x201D; Rep. Thomas shoreland   develop-­ and   Maine   as   states   with   effective   30-­percent   increase   Terenzini ment. shoreland  protection  laws.  They  ar-­ in  structures  without   â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m  the  only  per-­ gued  that  shoreland  property  owners   a   permit   and   allows   son   on   the   commis-­ in   those   two   states   have   seen   their   structure   replacement   within   the   sion  whoâ&#x20AC;&#x2122;s  against  this  bill,â&#x20AC;?  Teren-­ property   values   increase   as   a   result   same  footprint. zini   said.   â&#x20AC;&#x153;From   day   one,   Iâ&#x20AC;&#x2122;ve   said   of  the  regulations  that  are  in  place. Â&#x2021;0DQGDWHVDYDULDQFHLIVHWEDFNV that  this  is  nothing  but  a  power  grab   â&#x20AC;&#x153;We   are   seeking   to   have   a   bal-­ and   buffer   width   arenâ&#x20AC;&#x2122;t   possible   on   by  the  ANR  in  the  state  of  Vermont.   anced  approach,â&#x20AC;?  Markowitz  said.  â&#x20AC;&#x153;I   non-­conforming  lots. I  believe  that  if  you  own  a  camp  or   know  that  you  all,  who  are  lakeshore   $15RIÂżFLDOVDQWLFLSDWHKDYLQJWR a  house  on  the  lake  or  a  pond  in  the   owners,   have   reasonable   expecta-­ KLUHIRXURUÂżYHDGGLWLRQDOVWDIIHUVWR state   of   Vermont,   youâ&#x20AC;&#x2122;re   already   tions  to  use  your  property. process   shoreland   development   ap-­ paying  enormous  taxes.  I  just  think   â&#x20AC;&#x153;What  the  Legislature  has  done  is   plications.   Application   fees   would   the   state   of   Vermont   has   no   right   they  have  worked  to  craft  a  bill  that   be   expected   to   underwrite   the   cost   to  â&#x20AC;&#x201D;  as  long  as  youâ&#x20AC;&#x2122;re  not  a  major   creates   a   balance,   a   balance   thatâ&#x20AC;&#x2122;s   of  those  new  positions. polluter  â&#x20AC;&#x201D;  tell  you  what  to  do  with   designed  to  give  homeowners  maxi-­ Rep.   David   Deen,   D-­Putney,   is   your  own  property.â&#x20AC;? PXPĂ&#x20AC;H[LELOLW\ZKLOHVWLOOUHWDLQLQJ chairman   of   the   commission   and   He   added   he   hopes   Vermonters   the  protection  that  shoreline  vegeta-­ also  leader  of  the  House  Fish,  Wild-­ will  â&#x20AC;&#x153;rise  upâ&#x20AC;?  to  oppose  the  bill  and   tion  provides  for  water  quality,â&#x20AC;?  she   life   and   Water   Resources   Com-­ show   their   ultimate   displeasure   by   added. mittee.   He   anticipates   a   shoreland   voting  â&#x20AC;&#x153;some  of  these  people  out  of   Act   110   of   2009-­2010   offered   protection   law   that   will   be   â&#x20AC;&#x153;perfor-­ RIÂżFH´ KH VDLG JODQFLQJ GRZQ KLV towns   technical   assistance   and   mance-­based.â&#x20AC;? row  of  colleagues. grants  to  create  their  own  shoreline   â&#x20AC;&#x153;If   you   can   do   your   activity   and   Deen  said  such  a  rally  could  back-­ ordinances   or   bylaws,   according   protect  both  the  habitat  and  the  wa-­ ÂżUH to   commission   member   Rep.   Kate   ter   quality   of   the   lake,   then   youâ&#x20AC;&#x2122;re   â&#x20AC;&#x153;Some  of  you  might  want  to  vote   Webb,   D-­Shelburne.   There   are   173   set;Íž  youâ&#x20AC;&#x2122;re  good  to  go,â&#x20AC;?  he  said.  â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s   against   people   who   didnâ&#x20AC;&#x2122;t   vote   for   towns   in   Vermont   with   lakes   and   a   matter   of   performanceâ&#x20AC;Ś   We   are   this  bill,â&#x20AC;?  he  responded. ponds  that  are  larger  than  10  acres.   not  putting  anyone  out  of  their  home   Written   comments   must   be   sub-­ Thus   far,   42   of   those   towns   have   or  off  their  lake  lot.â&#x20AC;? mitted  to  the  commission  by  Oct.  15.   moved   forward   to   implement   local   Deen   noted   a   provision   in   H.526   The  commission  will  post  its  report   shoreland   protection   laws,   accord-­ that  requires  the  ANR  to  come  back   by  Jan.  14,  2014. ing  to  Webb. to   the   Legislature   before   it   begins   Reporter   John   Flowers   is   at   â&#x20AC;&#x153;Only   10   towns   have   actually   the   formal   rule-­making   process,   so   johnf@addisonindependent.com.


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  25

Pie  contest  was  a  sweet  success

Community  (Continued  from  Page  1) PXFK DERXW WKHLU WRZQV WKH\ KDG E\ 'R\OHÂśV 9HUPRQW KLVWRU\ DQG towns. QHYHUNQRZQ JRYHUQPHQW FODVV DW -RKQVRQ 6WDWH The   night   will   be   the   world   pre-­ ³¾0\ WRZQ LV VR ERULQJÂś LV ZKDW DQG3HUHJULQH3URGXFWLRQV miere  of  â&#x20AC;&#x153;Life  In  Addison  County.â&#x20AC;?   VWXGHQWV VD\ DW WKH VWDUW´ )DUUHOO )DUUHOO VXJJHVWHG FRPELQLQJ KHU 7KHPLQXWHÂżOPZKLFKIHDWXUHV VDLG Âł7KHQ WKH\ OHDUQ %ULVWRO XVHG VWXGHQWVÂśSURMHFWVZLWKWKHVFUHHQLQJ LQWHUYLHZVZLWKUHVLGHQWVDFURVVWKH WR KDYH D PRYLH WKHDWHU D ERZOLQJ RIWKHÂżOPDQGWKHSODQQLQJIRUWKH FRXQW\ LV DERXW OLIH LQ 9HUPRQW LQ DOOH\ DQG D GDQFH KDOO DQG WKH\ÂśUH ÂżUVWHYHU$GGLVRQ &RXQW\ &RPPX-­ WKHVDQGV,WLVGHGLFDWHG DPD]HG´ QLW\6XPPLWEHJDQ WR *UHJ &ODUN D ORQJWLPH 0RXQW )DUUHOO UHFDOOHG D ,W ZDV D SHUIHFW $EH WHDFKHU ZKR UHSUHVHQWHG 9HU-­ student   telling   her   â&#x20AC;&#x153;I want students SDLULQJ 0LQD H[-­ JHQQHVLQWKH/HJLVODWXUHZKRZDV WKDWVKHKDGQHYHUVDW to have this insight SODLQHG NLOOHGLQDFDUDFFLGHQWWKLVSDVW1R-­ GRZQDQGWDONHGZLWK about history now. Âł:H UHDOL]HG ZH vember.   KHU JUDQGPRWKHU EH-­ Most of us donâ&#x20AC;&#x2122;t FRXOG FRPELQH WKH 7KH VHFRQG ÂżOP Âł+RZ 7R /LYH fore   interviewing   her   YLHZLQJ RI SURMHFWV 7R%H´ZDVSURGXFHGE\0RXQW IRUWKHSURMHFW$IWHU-­ get it until later in IURP \HDUV SDVW ZLWK 0DQVÂżHOG0HGLDDQGWHOOVWKHVWRU\ ZDUGVWKHVWXGHQWKDG life.â&#x20AC;? WKHODXQFKRIWKHÂżOPV â&#x20AC;&#x201D; teacher we  will  be  showing  in   RIWKH6WDPSHGHIRUWKH&XUHDQQXDO DQ HQWLUHO\ GLIIHUHQW IXQGUDLVHU LQ WKH FRQWH[W RI %ULVWRO XQGHUVWDQGLQJ DQG Kristen Farrell DQHYHQLQJWKDWZRXOG DVDVPDOOWRZQ DSSUHFLDWLRQ RI KHU DSSHDO WR DOO UHVLGHQWV 7KH &RPPXQLW\ 6XPPLW LV DQ JUDQGPRWKHU RI WKH FRXQW\´ 0LQD DPDOJDPDWLRQ RI VHYHUDO GLIIHUHQW Âł, ZDQW VWXGHQWV WR KDYH WKLV LQ-­ VDLGÂł,QWXUQRXUWKJUDGHUVZRXOG SURMHFWVLQWKHDUHRYHUWKHODVWIHZ VLJKW DERXW KLVWRU\ QRZ´ )DUUHOO EHDEOHWRJDWKHULGHDVDQGLQVSLUDWLRQ \HDUV VDLG Âł0RVW RI XV GRQÂśW JHW LW XQWLO IRUWKLV\HDUÂśVUHVHDUFKSURMHFWV´ Âł,WEHJDQZLWKDFRQYHUVDWLRQEH-­ ODWHULQOLIH´ )DUUHOO QRZ LQ KHU WK \HDU RI WZHHQ P\VHOI DQG .ULVWHQ )DUUHOO´ 6WXGHQWV XVH WKH LQIRUPDWLRQ WHDFKLQJ KRSHV WKDW FRPPXQLW\ VDLG /DXUD 0LQD WKH OLEUDU\ PHGLD WKH\ÂśYH JDWKHUHG DQG PDNH D VKRUW PHPEHUV ZLOO FRQQHFW ZLWK HDFK VSHFLDOLVWDW0RXQW$EH YLGHR $IWHU WKH SURMHFWV DUH FRP-­ RWKHU DW WKH VXPPLW 6KH UHFDOOHG Âł7KHURRWRIDOORIWKLVEHJDQZLWK SOHWH VWXGHQWV SUHVHQW WKHP WR WKH WKH VWXGHQW SURMHFWV IURP D IHZ WKH 9HUPRQW )RONOLIH FODVV \HDUVDJRZKHUHVHYHUDOFRPPXQLW\ &HQWHUÂśV FRXUVH RQ 0LQDIRURQHKDV PHPEHUVLQWHUYLHZHGVSRNHRI+XU-­ â&#x20AC;&#x153;â&#x20AC;&#x2DC;My town is so WHDFKLQJ ORFDO KLV-­ been  impressed. ULFDQH'RJZKLFKLQGDPDJHG boringâ&#x20AC;&#x2122; is what tory.â&#x20AC;?   Âł7KHFRQWHQWRIWKH PXFK RI 1HZ (QJODQG LQFOXGLQJ )DUUHOO DQG IHO-­ students say at SURMHFWV ZDV MXVW WRR 9HUPRQW'HVSLWHOLYLQJLQ$GGLVRQ ORZ 0RXQW $EH VR-­ the start. Then JRRG WR NHHS WR RXU-­ &RXQW\ IRU PRUH WKDQ D KDOIFHQWX-­ FLDO VWXGLHV WHDFKHUV they learn Bristol VHOYHV´0LQDVDLG U\ WKHVH SHRSOH GLG QRW PHHW XQWLO 6FRWW %HFNZLWK DQG used to have a ,Q  )DUUHOO WKH VWXGHQWVÂś KLVWRU\ SURMHFW XQLW-­ /DXUHQ 3DUUHQ WRRN DQG %LOO &RQQRU D HG WKHP ,Q DQRWKHU LQVWDQFH DQ WKH )RONOLIH &HQWHU movie theater, a IHOORZ 0RXQW $EH \HDUROG ZRPDQ UHFRJQL]HG DQ-­ FODVV WRJHWKHU ZKLFK bowling alley and WHDFKHU KHOG D Âł7HD RWKHU LQWHUYLHZ VXEMHFW ZLWK ZKRP LQVSLUHG WKH LGHD RI a dance hall, and DQG 7DON´ LQ WKH VKHKDGEHHQDÂżUVWJUDGHFODVVPDWH GRLQJ PRUH ORFDO KLV-­ theyâ&#x20AC;&#x2122;re amazed.â&#x20AC;? VFKRROOLEUDU\ZKHUH )DUUHOOVDLGVKHKRSHVFRQQHFWLRQV WRU\ SURMHFW VWXGHQWV students   presented   OLNH WKLV ZLOO KDSSHQ RQ D ODUJHU â&#x20AC;&#x201D; teacher 1RZ WKJUDGHUV WKHLU SURMHFWV WR WKH VFDOHDWWKHFRPPXQLW\VXPPLW6KH Kristen Farrell ZKR FRPH IURP WKH SXEOLF KDVLQYLWHGKLVWRULFDOVRFLHWLHVIURP ÂżYH WRZQV VHUYHG E\ Âł7KHUHVSRQVHZDV DFURVVWKHFRXQW\WRDWWHQG$IWHUWKH 0RXQW $EH %ULVWRO 1HZ +DYHQ H[FHOOHQW´0LQDVDLG VFUHHQLQJVDQGSUHVHQWDWLRQVJXHVWV 6WDUNVERUR 0RQNWRQ DQG /LQFROQ  6KH DQG )DUUHOO VRXJKW D ZD\ WR DUHLQYLWHGWRWKH0RXQW$EHOLEUDU\ PXVWFRPSOHWHDORFDOKLVWRU\SURMHFW EULQJ WKH SURMHFWV WR D ODUJHU DXGL-­ IRU UHIUHVKPHQWV DQG D GLVFXVVLRQ )RU WKH SURMHFW VWXGHQWV ORRN HQFH ZLWKWKHVXEMHFWVRIWKHÂżOPV WKURXJK KLVWRULFDO WH[WV DERXW WKHLU )DUUHOO KHDUG WKDW %LOO 'R\OH WKH :KHQDVNHGZK\WKLVSURMHFWZDV WRZQV 7KHQ WKH\ YLVLW WKHLU WRZQ -RKQVRQ6WDWH&ROOHJHSURIHVVRUDQG LPSRUWDQW IRU WKH VWXGHQWV )DUUHOO FOHUNÂśV RIÂżFH DQG ORFDO OLEUDULHV WR ORQJWLPH VWDWH VHQDWRU IURP :DVK-­ UHFDOOHG KRZ D IRUPHU VWXGHQW FRQ-­ JDWKHU LQIRUPDWLRQ DV ZHOO DV LQ-­ LQJWRQ &RXQW\ ZDV ORRNLQJ IRU D FOXGHGKHUSURMHFW WHUYLHZ FRPPXQLW\ PHPEHUV DERXW SODFH WR VFUHHQ D GRFXPHQWDU\ KH Âł,I ZH GRQÂśW UHPHPEHU WKH SDVW ZKDWWKHWRZQVZHUHOLNHLQWKHSDVW KDGZRUNHGRQFDOOHGÂł/LIH,Q$GGL-­ ZHÂśOO KDYH QR IXWXUH´ WKH VWXGHQW ,Q WKHLU UHVHDUFK VWXGHQWV GLVFRYHU VRQ&RXQW\´7KHÂżOPZDVSURGXFHG VDLG

Got Firewood? We Do!

VT  STATE   INSPECTION

Available for Prompt Delivery

Green or Dry (Kiln Processed)* Dried per USDA requirements for heat processing Approved Supplier VT Fuel Assistance Program *Dry Wood is heated in our Kilns at 200Âş until the average moisture is down to 20-25%

M O T O R V E H I C L E

VERMONT CTION S TA T E I N S P E I

10

month Expires the ove 2014 indicated ab

N S P E C T I O N

Simply  ask  for  an  auto  or home  rate  comparison  from  the   Carter Agency  and  receive  a   FHUWL¿FDWHIRUDIUHH97VWDWHFDU inspection  from  Heffernan Repair in  Bristol  (a  $35 VALUE)   No  purchase  necessary. Offer  expires  10/31/2013

THE CARTER AGENCY THE A. JOHNSON CO., LLC BRISTOL, VT 05443 802-453-4884 www.VermontLumber.com

2 South Street, Bristol, VT 05443 SIÂ&#x2021;FDUWHULQVXUDQFH#\DKRRFRP

7KH&DVH6WUHHW&RP-­ WUHPHQGRXVPXVLFDOWDOHQW PXQLW\&OXEZRXOGOLNHWR DQGWKHDZHVRPHSHRSOH H[SUHVVWKDQNVWRDOOWKRVH ZKRFDPHRXWWRELGDQG SHRSOHZKRKHOSHGPDNH WDVWHZLWKWKHLUGROODUV RXUGHVVHUWFRQWHVWDQGSLH of appreciation &RQJUDWXODWLRQVWR0DUL-­ DXFWLRQRQ6HSWDVXF-­ DQQH&DXOZKRZRQWKH FHVV DSSOHGHVVHUWFRQWHVW,W 6SHFLDOWKDQNVJRWRWKHPDQ\ ZDVDVXFFHVVIXOHYHQWDQGZHKDG ZRQGHUIXOSHRSOHZKRPDGHWKH DQDZHVRPHWLPH SLHVDQGSOXVGHVVHUWV+DSS\ Carol  Wood   9DOOH\2UFKDUGIRUWKHLUGRQDWLRQ CSCC  President =HSK\UIRUGRQDWLQJWKHLUWLPHDQG Middlebury

Notes

6QRZ%RZO 6HDVRQ3DVV  5DWHV IRU Order  your  pass  online  or  by  mail  â&#x20AC;&#x201C; form  at  www.middleburysnowbowl.com

Early Adult $410 Alumni 365 Student 300 Junior 240 Child and 70+ 105 Sr. Citizen 300

After Nov. $500 455 365 280 145 365

MID-­WEEK  PASS  $245   This  pass  is  valid  on  weekdays  from  the  beginning  of  the  season  until  3/1/14,   excluding  the  weeks  of  12/27/13-­  1/1/14  and  2/17/13-­  2/21/14.    From  3/1/14   to  the  end  of  the  season,  the  pass  is  valid  7  days  a  week.  On  any  weekend   day  or  holiday,  mid-­week  pass  holders  can  purchase  an  all  day  ticket  for  the   half  day  rate.

MIDD  STUDENT*  $175 FAC/STAFF HDFKRIWKH¿UVWWZR *  Valid  Midd  card  required  for  Middlebury  College  faculty/staff  passes   DQGPXVWEHEHQH¿WVHOLJLEOH A  CHILD  is  under  6  years  old.  A  JUNIOR  is  6  years  old  through  6th  grade.   A  STUDENT  is  7th  grade  through  college.  A  SENIOR CITIZEN  is  62-­69. Passes  will  be  sold  daily  Oct.  1-­31  in  the  Pro  Shop  at  the  Ralph  Myhre  Golf   Course  on  Route  30  South  from  Middlebury  from  8:00-­  5:00.  Forms  of  payment   accepted  are  cash,  check,  VISA  or  Mastercard.  Credit  card  purchases  can  be   made  by  calling  802-­443-­5125  or  online  at  www.middleburysnowbowl.com.  If   you  have  questions  concerning  this  sale  please  call  802-­443-­7669  or  email   snowbowl@middlebury.edu.


PAGE  26  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

SERVICES DIRECTORY Alexander Appliance Repair Inc. t!

â&#x20AC;&#x153;We  try  our  best  to  give  superior   quality  and  comfort. Our  team  cares  about  your   dental  health.â&#x20AC;?

r

us

v

Se r

ice

you

t n a c

GAS OR ELECTRIC

Washers Refrigerators Dishwashers Disposals

LOCKSMITH

DENTISTRY

APPLIANCE REPAIR

LOCK-­N-­GLASS CRAFTERS Â&#x2DC;1%-41&7%65 Â&#x2DC;'#&$1.65 Â&#x2DC;'8'45n01$5 Â&#x2DC;';'&#.+-'14 -';'&&+(('4'06.;

Thomas  A.  Coleman,  D.D.S.

Dryers Ranges Microwaves Air Conditioners

$FMMt0GmDF

Jack Alexander

#SJHHT)JMMr#SJTUPM 75

Ayrshire  Professional  Building 5  Carver  Street   Brandon,  VT  05733

Dennis Cassidy 388-­7633

(802)  247-­3336

63 Maple Street, Middlebury in the Marble Works

www.drtomcoleman.com

www.middleburysafeandlock.com

ELECTRICIAN

BOARDING

LUMBER

Dog Obedience & Agility

â&#x2DC;&#x2026; Rough Lumber

â&#x2DC;&#x2026; Bark Mulch

Hartland  Heffernan     802-­349-­0211

Native  Vermonter

wiremonkeyelectric.com Middlebury,  VT  05753

Residential  &  Commercial Service  &  Installation 9RLFH 'DWD&DEOLQJÂ&#x2021;3KRWRYROWDLFV

Oliver,  Peg  Cobb  and  Ethan

Hand-in-Paw Training & Boarding Kennel

Licensed  /  Insured

5RXWH&RUQZDOOÂ&#x2021;

CHIMNEY SERVICE www.centralvermontchimneysweeping.com

Early Bird Special:

Chimney sweeping and level 1 inspection $135 for the Ă&#x20AC;UVWĂ XHHDFKDGGLWLRQDOĂ XH²QRZXQWLO2FWst &DOOQRZWRVFKHGXOH\RXUFKLPQH\VZHHSLQJ

â&#x2DC;&#x2026;Dimension Lumber

802-388-7828 â&#x2DC;&#x2026; End of S. Munger St. â&#x2DC;&#x2026; Middlebury

EQUIPMENT RENTALS

MASONRY

40  TYPES  OF  RENTAL  EQUIPMENT  TO  CHOOSE  FROM

F��� D�� S���� M������

Â&#x2021;PDWHULDOIRUNOLIWV Â&#x2021;H[FDYDWRUV Â&#x2021;EXOOGR]HUV Â&#x2021;PLQLH[FDYDWRUV Â&#x2021;VNLGVWHHUV

Â&#x2021;0DQOLIWVXSWRÂś Â&#x2021;PDQEDVNHWZFUDQH XSWR

Jď?Ąď?­ď?Šď?Ľ Mď?Ąď?łď?Ľď?Śď?Šď?Ľď?Źď?¤

Â&#x2021;FRQFUHWHFRPSDFWRUV Â&#x2021;EDFNKRHV

C�������� �� ��� D�� S���� W������ A���������� �� G���� B������

Chimney,  Pellet,  Woodstove,  &    Dryer  Vent  Cleaning 9LGHR,QVSHFWLRQÂ&#x2021;6WDLQOHVV6WHHO5HOLQLQJÂ&#x2021;5HSDLUV &ODVV$&KLPQH\VÂ&#x2021;&DSVÂ&#x2021;7KHUPRFUHWHÂ&#x2021;6PRNHWLWH :DWHU6HDOLQJÂ&#x2021;3UHVVXUH:DVKLQJÂ&#x2021;)LUHZRRG

(802)558-­4336

DENTISTRY

I N S U R E D

â&#x2DC;&#x2026; Open most nights & weekends

802-233-4670

www.brownswelding.com 275 South 116, Bristol, Vermont 05443  Â&#x2021;&HOO  

HORSE WORKSHOPS

jmasefield@gmavt.net

MOTORCYCLE REPAIR Tom Bohler

802-342-2061

+21'$Â&#x2021;<$0$+$Â&#x2021;68=8.,Â&#x2021;.$:$6$.,

Engine  &  Crank  Rebuilding Head  &  Cylinder  Mods

Wiseco  Dealer Brandon,  VT


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  27

Vermont  bald  eagles,  other  endangered  birds  successful  in  2013

VERMONT  â&#x20AC;&#x201D;   Bald   eagles   in   the   state   had   a   very   good   nesting   season   in  2013,  according  to  a  report  from  Vt.   Fish   &   Wildlife   Dept.   and   Audubon   Vermont.   From   16   known   nests,   Vermontâ&#x20AC;&#x2122;s   bald   eagles   produced   26   offspring  that  survived  to  leave  the  nest.   This  is  an  increase  from  2012,  when  24   Ă&#x20AC;HGJOLQJVZHUHSURGXFHG â&#x20AC;&#x153;Not  all  bald  eagle  nests  are  success-­ ful   every   year,â&#x20AC;?   said   John   Buck,   migratory   bird   biologist   for   the   Fish   &  Wildlife  Department.  â&#x20AC;&#x153;Late  winters,  

food  shortages,   or   even   the   nest   tree   falling   down   can   cause   a   nest   to   fail.   Despite  the  potential  for  these  natural   setbacks,   Vermont   still   experienced   a   QHWLQFUHDVHLQHDJOHVĂ&#x20AC;HGJHGWKLV\HDU which  is  very  encouraging.â&#x20AC;? Buck   urged  Vermonters   to   appreci-­ ate  eagle  nests  from  a  distance.  â&#x20AC;&#x153;Bald   eagles  at  nest  sites  are  very  susceptible   to   disturbance,   so   giving   eagles   their   space  while  theyâ&#x20AC;&#x2122;re  nesting  is  the  one   of  the  best  ways  Vermonters  can  help   these   birds   during   nesting   season.â&#x20AC;?  

Bald  eagles   are   no   longer   a   federally   endangered   species,   but   they   are   still   listed   under   Vermontâ&#x20AC;&#x2122;s   Endangered   Species  Act.   Other   bird   species   monitored   by   the   department   and   its   Vermont   part-­ ners   fared   well   this   nesting   season.   Common  loons  and  peregrine  falcons,   which  were  removed  from  state  endan-­ gered   species   lists   following   years   of   stable   populations,   both   posted   high   numbers  of  offspring. Two   endangered   bird   species,   the  

black  tern  and  common  tern,  also  had   successful  nesting  years.  â&#x20AC;&#x153;Black  terns   QHVW RQ JUDVV\ PXG Ă&#x20AC;DWV XVLQJ ORJV PDWV DQG RWKHU Ă&#x20AC;RDWLQJ SODWIRUPV WR stay   above   water   level,â&#x20AC;?   said   Buck.   â&#x20AC;&#x153;This   allowed   them   to   cope   with   the   challenge   of   a   sustained   rise   in   Lake   Champlain   water   levels   during   May   and  June.â&#x20AC;? Common  terns  experienced  a  record   nesting   year   with   260   nests   docu-­ mented  from  only  two  known  nesting   sites  on  Lake  Champlain.

â&#x20AC;&#x153;The  return   of   these   amazing   bird   species  to  Vermont  is  one  of  the  stateâ&#x20AC;&#x2122;s   great   conservation   success   stories,â&#x20AC;?   said  Buck.  â&#x20AC;&#x153;These  species  have  contin-­ ued  to  thrive  thanks  to  the  efforts  of  our   conservation   partners   and   the   citizens   of  Vermont.â&#x20AC;? Residents   can   help   researchers   in   their  effort  to  conserve  birds  by  donat-­ ing   to   the   nongame   wildlife   fund   on   line  29  of  their  tax  return  or  at  www. YWÂżVKDQGZLOGOLIHFRP,   or   by   purchas-­ ing  a  conservation  license  plate.

SERVICES DIRECTORY Storage  Units  Available!

Soak  Up  The  Sun! Donâ&#x20AC;&#x2122;t  spend  your  hard-­earned  money   making  the  hot  water  or  electricity  that   you  use  todayâ&#x20AC;&#x201C; SOLAR  IS  MORE  AFFORDABLE  THAN  EVER! Weâ&#x20AC;&#x2122;ve  been  here  for  you  for  41  years  â&#x20AC;&#x201C;   Let  us  help  you  with  your  solar  projects  today.  

STORAGE

SEPTIC

RENEWABLE ENERGY

Boat,  Car  &  R.V.  Storage Septic  Tank  &  Cesspool  Pumping Septic  Tank  &  System  Inspections New  Septic  Systems  Installed Septic  System  Repairs   Drain  &  Pipe  Cleaning Full  Excavation  Service

Climate  Control   Coming  Soon!  

U-­Haul Box  Dealer

NEW  HAVEN SELF  STORAGE

Now  owned  by  Mikeâ&#x20AC;&#x2122;s  Auto  &  Towing 2877  ETHAN  ALLEN  HWY.  (RT.7) 1(:+$9(197Â&#x2021;  

Go  Green  with  us. Call  for  a  FREE  on-­site  evaluation

RENT-A-SPOUSE

SIDING

STORAGE

VINYL  SIDING &  ROOFING We  also  do SDLQWLQJ

Al  LeMay :LQGRZVÂ&#x2021;'RRUV 5HSDLUV 3UHVVXUH:DVKLQJ ,QVXUHGa1R-RE7RR6PDOO

Â&#x2021;518-­499-­0281

STAMPS

WEDDING

Self   Inking  &  Hand  Stamps

Stop in to the Addison Independent office in the Marble Works to view a wonderful selection of

ROOFING

roofing Michael Doran

MADE TO ORDER

As  seen  at  Addison  County  Field  Days!

Â&#x2021;6WDQGLQJVHDP Â&#x2021;$VSKDOWVKLQJOHV Â&#x2021;6ODWH )UHHHVWLPDWHVÂ&#x2021;)XOO\,QVXUHG

Phone (802) 537-3555

Â

                            Available  at  the                                Addison  Independent in  the  Marble  Works,  Middlebury

388-4944

Wedding Invitations for Your Special Day!

388-4944

    For  more  info  call      


PAGE  28  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

Addison Independent

CLASSIFIEDS Notice

Cards  of  Thanks

THE  FAMILY  OF  MAURICE   J.   PAQUETTE  would   like   to   thank  everyone  for  your  acts   of  kindness  and  condolences,   the  cards,  food,  prayers  and   masses.  A  special  thanks  for   DOG   TEAM   CATERING.   ICU   at   Porter   Hospital.   The   Seating   300,   plus   bar   avail-­ MICU  at  FAHC,  also  to  Father   able.  Now  available,  Middle-­ Yvon,  Ladies  of  St.  Ann  and   bury  VFW.  Full  menus  avail-­ Knight   of   Colombus.   Millie,   able.  802-­388-­4831,  dogteam-­ Marie,  Richard,  Michael,  Gary,   Donna  and  families. catering.net. CVAA   TAI-­CHI   FOR   SE-­ NIORS.  Free  8  weeks.  Begins   Tuesday   9/24,   1pm,   Middle-­ bury  Fitness.  For  information   802-­388-­2651.

PARTY  RENTALS;   China,   flatware,   glassware,   lin-­ Public  Meetings ens.   Delivery   available.   802-­388-­4831. AL-­ANON:   FOR   FAMILIES   and  friends  affected  by  some-­ oneâ&#x20AC;&#x2122;s   drinking.   Members   Cards  of  Thanks share   experience,   strength   and   hope   to   solve   common   THANK   YOU   HOLY   Spirit   problems.   Newcomers   wel-­ and  St.  Jude  for  prayers  an-­ come.   Confidential.   St.   Ste-­ swered.  V.B. phenâ&#x20AC;&#x2122;s  Church  (use  front  side   door  and  go  to  second  floor)   THANK  YOU  LORD  and  St.   in  Middlebury,  Sunday  nights   Jude   for   prayers   answered.   7:15-­8:15pm. AL.

Services

Services

Public  Meetings

Public  Meetings

ALATEEN:  FOR   YOUNG   PEOPLE   whoâ&#x20AC;&#x2122;ve   been   af-­ fected   by   someoneâ&#x20AC;&#x2122;s   drink-­ ing.   Members   share   experi-­ ence,  strength,  hope  to  solve   common   problems.   Meets   Wednesdays   7:15-­8:15pm   downstairs   in   Turning   Point   Center   of   Addison   County   in   Middlebury   Marbleworks.   (Al-­Anon   meets   at   same   time  nearby  at  St.  Stephens   Church. ALCOHOLICS  ANONYMOUS   MIDDLEBURY   MEETINGS   SATURDAY:   Discussion   Meeting  9:00-­10:00  AM  at  the   Middlebury  United  Methodist   Church.   Discussion   Meeting   10:00-­11:00   AM.   Womenâ&#x20AC;&#x2122;s   Meeting  Noon-­1:00  PM.  Be-­ ginners   Meeting   6:30-­7:30   PM.   These   three   meetings   are  held  at  the  Turning  Point   Center   in   the   Marbleworks,   Middlebury. ALCOHOLICS  ANONYMOUS   MIDDLEBURY   MEETINGS   FRIDAY:  Discussion  Meeting   Noon-­1:00   PM   at   the   Turn-­ ing  Point  in  the  Marbleworks,   Middlebury.

Services

ALCOHOLICS  ANONYMOUS   MIDDLEBURY   MEETINGS   THURSDAY:  Big  Book  Meet-­ ing   Noon-­1:00   PM   at   the   Turning   Point   Center   in   the   Marbleworks,   Middlebury.   Speaker   Meeting   7:30-­8:30   PM  at  St.  Stephenâ&#x20AC;&#x2122;s  Church,   Main  St.(On  the  Green). ALCOHOLICS  ANONYMOUS   MIDDLEBURY   MEETINGS   WEDNESDAY:   Big   Book   Meeting   7:15-­8:15   AM   is   held  at  the  Middlebury  United   Methodist  Church  on  N.  Pleas-­ ant  Street.  Discussion  Meet-­ ing  Noon-­1:00  PM.  Womenâ&#x20AC;&#x2122;s   Meeting  5:30-­6:30  PM.  Both   held   at   The   Turning   Point   Center   in   the   Marbleworks,   Middlebury.

Public  Meetings

Public  Meetings

ALCOHOLICS  ANONYMOUS   MIDDLEBURY   MEETINGS   MONDAY:   As   Bill   Sees   It   Meeting   Noon-­1:00   PM.   Big   Book  Meeting  7:30-­8:30  PM.   Both  held  at  the  Turning  Point   Center   in   the   Marbleworks,   Middlebury. ALCOHOLICS  ANONYMOUS   MIDDLEBURY   MEETINGS   SUNDAY:   12   Step   Meeting   9:00-­10:00   AM   held   at   the   Middlebury  United  Methodist   Church  on  N.  Pleasant  Street.   Discussion  Meeting  1:00-­2:00   PM  held  at  the  Turning  Point   Center   in   the   Marbleworks,   Middlebury.

ALCOHOLICS  ANONYMOUS   NEW   HAVEN   MEETINGS:   Monday,   Big   Book   Meeting   ALCOHOLICS  ANONYMOUS   7:30-­8:30  PM  at  the  Congre-­ MIDDLEBURY   MEETINGS   gational  Church,  New  Haven   TUESDAY:   11th   Step   Meet-­ Village  Green. ing  Noon-­1:00  PM.  ALTEEN   Group.  Both  held  at  Turning   ALCOHOLICS  ANONYMOUS   Point,   228   Maple   Street.   12   RIPTON   MEETINGS:   Mon-­ Step  Meeting  Noon-­1:00  PM.   day,   As   Bill   Sees   It   Meet-­ 12   Step   Meeting   7:30-­8:30   ing  7:15-­8:15  AM.  Thursday,   PM.  Both  held  at  the  Turning   Grapevine  Meeting  6:00-­7:00   Point   Center   in   the   Marble-­ PM.  Both  held  at  Ripton  Fire-­ house,  Dugway  Rd. works,  Middlebury.

Services

Services

ALCOHOLICS  ANONYMOUS   BRANDON   MEETINGS:   Monday,  Discussion  Meeting   7:30-­8:30   PM.   Wednesday,   12   Step   Meeting   7:00-­8:00   PM.  Friday,  12  Step  Meeting   7:00-­8:00  PM.  All  held  at  the   St.  Thomas  Episcopal  Church,   RT  7  South. ALCOHOLICS  ANONYMOUS   BRISTOL  MEETINGS:  Sun-­ day,   Discussion   Meeting   4:00-­5:00   PM.   Wednesday,   12   Step   Meeting   7:00-­8:00   PM.  Friday,  Big  Book  Meeting,   6:00-­7:00  PM.  All  held  at  the   Federated  Church,  Church  St. ALCOHOLICS  ANONYMOUS   VERGENNES   MEETINGS:   Sunday,   12   Step   Meeting   7:00-­8:00   PM.   Friday,   Dis-­ cussion   Meeting   8:00-­9:00   PM.   Both   held   at   St.   Paulâ&#x20AC;&#x2122;s   Church,   Park   St.   Tuesday,   Discussion  Meeting  7:00-­8:00   PM,   at   the   Congregational   Church,  Water  St.

Services

WomenSafe Volunteer Training

WomenSafe will be holding a series of trainings over the next several weeks for af\ana\mYdkafl]j]kl]\afngdmfl]]jaf_^gjl`]fgf%hjgĂ&#x161;ll`Ylak[geeall]\lg]f\af_ \ge]kla[Yf\k]pmYdnagd]f[]&Ngdmfl]]jkemklYll]f\YddljYafaf_k]kkagfko`a[` Z]_afK]hl]eZ]j)1l`Yf\oaddZ]`]d\afEa\\d]Zmjq&L`]qYj]k]]caf_ngdmfl]]jk for the following positions/areas:  @gldaf]Ogjc]jk 9\eafakljYlan]9kkaklYf[]  =\m[YlagfYf\9oYj]f]kk Kh][aYd=n]flkNgdmfl]]jk  ;gmjl9\ng[Y[q F]okd]ll]j=\algj  ;`ad\[Yj]Hjgna\]jk Kmh]jnak]\NakalYlagfEgfalgjk

Last  Spring,   Bob   Rathbun,   of   Shoreham,   came   in   every   week   to   read   with   Lucas   Farrell,   as   an   EverybodyWins!   mentor   at   the   Shoreham  Elementary  School.    â&#x20AC;&#x2DC;Uncle   Bobâ&#x20AC;&#x2122;,  who  has  volunteered  throughout   the  years  at  the  Platt  Memorial  Library   and   as   childrenâ&#x20AC;&#x2122;s   tennis   instructor,   explained:    â&#x20AC;&#x153;I  just  love  the  kids!â&#x20AC;?    EW!   coordinators   appreciate   Bobâ&#x20AC;&#x2122;s   ability   to   connect   with   the   students   he   has   mentored:     â&#x20AC;&#x153;Bob   has   a   great   attitude   and   has   developed   many   meaningful   relationships  in  the  school  community.â&#x20AC;?     Thank  you  for  volunteering,  Bob.

Hd]Yk] [Ydd +00%1)0( ^gj Yf Yhhda[Ylagf hY[c]l$ gj ]eYad af^g8oge]fkY^]&f]l L`Yfcqgm& Go to www.unitedwayaddisoncounty.org/VolunteerDonate and click on VOLUNTEER NOW!

RATES

CLASSIFIED ORDER FORM Â&#x2021; Â&#x201E;SHUZRUGÂ&#x2021;PLQLPXPSHUDG Â&#x2021; LQWHUQHWOLVWLQJIRUXSWRLVVXHVÂ&#x2021;PLQLPXPLQVHUWLRQV &DVKLQRQRXUIRUUDWHV3D\IRULVVXHVJHWWKLVVXHIUHH([DPSOH$ZRUGDGLVMXVW $QDGSODFHGIRUFRQVHFXWLYHLVVXHV 0RQGD\V 7KXUVGD\V LVUXQWKWLPHIUHH&RVWLV IRULVVXHVSOXVLQWHUQHWFKDUJH 6SHFLDOIRUUDWHVQRWYDOLGIRUWKHIROORZLQJFDW HJRULHV+HOS:DQWHG6HUYLFHV2SSRUWXQLWLHV5HDO(VWDWH:RRGKHDW$WWQ)DUPHUV )RU5HQW 

Name: Address: Phone:

D E A D L I N E S Thurs. noon for Mon. paper Mon. 5 p.m. for Thurs. paper

CATEGORIES

Work Wanted Public Meetings** For Sale Help Wanted For Rent Want to Rent Real Estate Real Estate Wanted Vacation Rentals

Notices Card of Thanks Personals Services Free** Lost & Found** Garage Sales Lawn & Garden Opportunities

Spotlight with large



$2

Wood Heat Animals Att. Farmers Motorcycles Cars Trucks SUVs Snowmobiles Boats Wanted

** No charge for these ads

Public  Meetings

ALCOHOLICS  ANONYMOUS   NORTH   FERRISBURGH   MEETINGS:   Sunday,   Daily   Reflections  Meeting  6:00-­7:00   PM,  at  the  United  Methodist   Church,  Old  Hollow  Rd. BRAIN   INJURY   SUPPORT   GROUP:   Survivors,   family   members  and  care  givers  are   invited  to  share  their  experi-­ ence   in   a   safe,   secure   and   confidential   environment.   Meets   monthly   on   the   sec-­ ond   Tuesday   from   6:00pm   to   8:00pm   at   the   Hannaford   Career   Center,   Room   208   (second   floor,   an   elevator   is   available)  in  Middlebury.  For   more  information,  contact  Lisa   Bernardin  802-­388-­2720. NA   MEETINGS   MIDDLE-­ BURY:   Mondays,   6pm,   held   at   the   Turning   Point   Center   located  in  the  Marbleworks. NA   MEETINGS   MIDDLE-­ BURY:  Fridays,  7:30pm,  held   at   the   Turning   Point   Center   located  in  the  Marble  Works. OVEREATERS   ANONY-­ MOUS:   SATURDAYS   at   Lawrence   Memorial   Library,   1:00pm.  40  North  Street,  Bris-­ tol.  For  info  call:  802-­453-­2368   or  802-­388-­7081. OVEREATERS   ANONY-­ MOUS:  TUESDAYS  at  Turn-­ ing   Point   Center   (upstairs   meeting   room),   6:00-­7:00   Marble   Works,   Middlebury.   For   info   call:   802-­352-­4525   or  802-­388-­7081.

Buy it! Sell it! Find it! Check the Classifieds twice a week in the Addison Independent.

ADDISON INDEPENDENT P.O. Box 31, Middlebury, VT 05753 802-388-4944

email: classifieds@addisonindependent.com

PLEASE PRINT YOUR AD HERE

The Independent assumes QR Ă&#x20AC;QDQFLDO UHVSRQVLELOLW\ IRU HUURUV LQ DGV EXW ZLOO UHUXQ FODVVLĂ&#x20AC;HG DG LQ ZKLFK WKH HUURU RFFXUUHG 1R UHIXQGV ZLOO EH SRVVLEOH $GYHUWLVHU ZLOO SOHDVH QRWLI\ XV RI DQ\ HUURUV ZKLFK PD\ RFFXU DIWHU Ă&#x20AC;UVW SXEOLFDWLRQ

1XPEHURIZRUGV &RVW RIUXQV 6SRWOLJKW&KDUJH ,QWHUQHW/LVWLQJ 727$/




Addison Independent,  Monday,  September  23,  2013  —  PAGE  29

Addison Independent

CLASSIFIEDS

Public Meetings THE  HELENBACH  CANCER   Support  Group  is  an  indepen-­ dent   group   of   people   who   are   dealing   with,   have   dealt   with,   and   who   know   people   with  cancer.  We  meet  on  an   irregularly   regular   basis   (if   there  is  a  need,  we  meet!)  at   the  Mary  Johnson  Child  Care   Center  on  Water  St.  in  Middle-­ bury.  Good  home-­made  treats   are   always   available   and   all   meetings  are  free.  Our  theme   song   has   been   Bill   Wither’s   “Lean  on  Me,  when  you’re  not   strong,   I’ll   be   your   friend,   I’ll   help  you  carry  on..for  it  won’t   be  long,  ‘til  I’m  gonna  need,   somebody  to  lean  on.”  Come   be  a  leaner,  be  a  supporter,  be   part  of   something   that   gives   strength  by  sharing  love.  Call   802-­388-­6107  with  questions.

Services

Services

Free



DEVELOPMENTAL HOME   PROVIDER  for  live-­in  client  or   respite  care.  36  years  experi-­ ence.  State  background  check   completed.  State  Agency  and   past  client  family  references   provided.   Call   Doreen   at   802-­247-­4409. METICULOUS   RESIDEN-­ TIAL   CLEANING   Servic-­ es.   12   years   experience.   Fully   insured.   Call   Leigh.   802-­282-­1903. PERSONAL   CAREGIVER  /   ASSISTANT   I   specialize   in   care  for  Alzheimer’s  patients.   I   can   help   with   a   variety   of   tasks:  large  /  small  animal  care,   light  office  work,  grocery  shop-­ ping,  errands,  nanny  care.  Ex-­ cellent  references.  Call  Kathy   802-­349-­7779.



FREE HOUSE  CATS!  Many   to  choose  from.  Spayed  and   Neutered.  Good  homes  only.   Call  802-­388-­1410.  1683  Dog   Team  Rd.,  New  Haven. FREE   MANURE   AVAIL-­ ABLE   from   locally   raised   rabbits.   Please   call   Mo   at   802-­349-­8040.

Opportunities SAWMILL SCHOOL  OF  ART   is  accepting  late  autumn  stu-­ dents.  Sliding  scale  intuition,   working   scholarships   avail-­ able.   Applications   can   be   sent  to  5012  Mountain  Road,   Bristol,  VT  05443.  Some  ap-­ plications  may  be  done  over   the  phone  802-­453-­6975.

PRIVATE CARE   GIVING   C&I   DRYWALL.   Hanging,   Services.   20   years   experi-­ taping   and   skim   coat   plas-­ ence.  References.  Call  Leigh.   tering.   Also   tile.   Call   Joe   802-­282-­1903. 802-­234-­5545. SNOW  PLOWING  AND  sand-­ CHAIN  SAW  CHAINS  sharp-­ ing   services.   802-­352-­1034,   ened.  Call  802-­759-­2095. 802-­349-­5457.

Help Wanted

Help Wanted

It’s GARAGE SALE Season...Let us get the word out for you!

Work Wanted

Help Wanted



COMMUNITY SUPPORT   P R O F E S S I O N A L :   H e l p   people   with   developmental   disabilities   become   more   independent,   learn   new   life   and   social   skills   and   enjoy   community  involvement,  in  ac-­ cordance  with  support  plans.   The  job  required  compassion,   patience,  creativity,  flexibility,   good  judgment  and  an  ability   to  think  on  your  feet.  Experi-­ ence   with   personal   care   or   behavioral  support  would  be  a   plus.  Good  driving  record  and   GED  required.  Two  benefited   positions  at  $11.80  /  hour.  Com-­ prehensive   benefit   package   with  onsite  gym  membership.   Respond   to   CSAC   HR,   89   Main   Street,   Middlebury   VT   05753.   802-­388-­6751,   ext.   425,  or  visit  www.csac-­vt.org  .

DYNAMIC NANNY   AVAIL-­ ABLE   Mornings   and   over   nights,   weekends   consid-­ ered.   20   years   experience,   all   ages,   stellar   references.   802-­349-­5053,  Toria. RETIRED   DAD   SEEKING   part   time   work  /  o dd   jobs.   Have   dependable   car   and   pickup  truck.  Will  also  do  any   type   of   deliveries,   errands,   etc.   Call   with   your   needs,   802-­453-­4235.

Help Wanted BANKRUPTCY:  CALL  to  find   out   if   bankruptcy   can   help   you.   Kathleen   Walls,   Esq.   802-­388-­1156. B R E A K FA S T   S E R V E R   WANTED  Saturdays  and  Sun-­ days.  Call  Michelle  at  the  Swift   House  Inn.  802-­388-­9925.

DELIVERY PERSON  NEED-­ ED.  Clean  driving  record  re-­ quired.  Must  pass  background   check.  Apply  in  person,  Sears   of  Middlebury.  383  Exchange   Street.

Our

&ODVVLÀHG$GV:RUN Call 388-4944 to place one! Help Wanted

Garage Sales

Garage Sales

7 CLASSIFIED ORDER FORM

$

Deadlines: Thursday Noon for Monday papers Monday 5pm for Thursday papers YOUR AD INFORMATION

TOWN: DATES & TIMES:

Help Wanted

Help Wanted

Medical Equipment  Technician The   Medicine   Chest,   a   provider   of   home   medical  equipment  rentals,  sales  and  service   has   a   full   time   opening   for   a   Medical   Equip-­ ment  Technician.    The  right  candidate  will  be   a   professional,   energetic   individual   willing   to   learn  all  aspects  of  our  business,  from  in-­store   customer   service   to   deliveries   and   set   up   of   equipment.   Position   includes   rotating   on   call   hours;;  point  of  sale,  computer  knowledge  and   mechanical  aptitude  all  helpful;;  willing  to  train   the  right  person.  Must  be  able  to  lift  65  lbs. Apply  in  person  at  99  Maple  St.,  Middlebury,   in  the  historic  Marble  Works  District,  or  fax   resume  to  388-­4146.

BET-CHA TRANSIT, INC. IMMEDIATE OPENINGS

Bet-cha Transit, Inc. has immediate openings for route & activity drivers in Addison & Rutland Counties. We fully train you and pay all your licensing costs. Eliminate childcare costs and collect unemployment over the summer months and holidays. For more information call Don or Lori at 388-7800

MIDDLEBURY UNION HIGH SCHOOL Coaching Positions MUHS has vacancies for Varsity and Junior Varsity Girls’ Basketball Coaches. The applicant must have a strong knowledge of basketball coaching principles with previous coaching experience preferred. Must possess strong organizational skills and the ability to communicate and relate to student athletes. Apply by sending a letter of interest and resume to: Sean Farrell, Activities Director Middlebury Union High School 73 Charles Avenue Middlebury, VT 05753 E.O.E 4SWMXMSRSTIRYRXMP½PPIH

STREET ADDRESS: COLLEGE STREET CHILDREN’S CENTER EARLY CHILDHOOD EDUCATOR

DESCRIPTION: (Up to 10 words)

YOUR CONTACT INFORMATION NAME: PHONE: Mail in your classified ad with payment to : PO Box 31, Middlebury VT 05753 OR

Stop in and drop it off to Kelly, Vicki or Laurie at our 58 Maple St. location in the Marble Works, Middlebury

MAILING ADDRESS:

$7(ad w/out kit) x___#of runs* For just $3 more, $10 (ad plus kit) x___#of runs pick up an all-inclusive (*Kit comes FREE with 3 runs or more!) GARAGE SALE KIT with Additional words x # of runs everything you need for x 25¢ a successful sale. Total Payment Enclosed $

The College Street Children’s Center is looking for a nurturing, creative, enthusiastic infant/ toddler teacher to join our team of childcare professionals. The position is guaranteed 20 hours a week, with more hours available, and begins as soon as possible. Person must have flexibility to work varied hours. Also looking for substitute teachers. Infant/Toddler experience and a BA, CDA or Associates degree in Early Childhood Education or related field is preferred. Send resume and 3 letters of reference by Ocotber 4th to: Jenne Morton College Street Children’s Center $PMMFHF4USFFUt.JEEMFCVSZ 75

802-388-2401 E-mail: cscc1@sover.net


PAGE  30  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

Addison Independent

Help  Wanted

CLASSIFIEDS

Help  Wanted

Help  Wanted

Help  Wanted

Resident Centered, Locally Governed

EastView is continuing to grow and we are adding more members to our team! Servers: Part-time and Full-time Positions Available

Our dining room team provides residents with a fine dining experience and full table service in a dynamic retirement community. With a manageable schedule and superb kitchen facilities, we offer a work environment that is hard to find in the hospitality industry. These positions will be primarily during the evenings. Applicants must be willing to work weekends and some holidays.

Residential Care Assistant: Part-time and Full-time Positions Available

The Residential Care Assistant participates as a key member of the health care team implementing care delivery systems in a manner that maintains a nurturing environment, supporting the health and independence of the residents. The Residential Care Assistant uses primary care assignments to provide resident-centered care to support the residentâ&#x20AC;&#x2122;s activities of daily living. Residential Care Assistants use their care-giving skills to ensure the physical and cognitive wellbeing of residents, as well as their emotional and social wellbeing. In addition, they provide support and information to families/others where appropriate. For more information about EastView at Middlebury, go to: www.eastviewmiddlebury.com Interested candidates please email greatplacetowork@eastviewmiddlebury.com or send cover letter and resume to: : EastView at Middlebury | 100 Eastview Terrace Middlebury, VT EOE

Let Us Help You Get That Job Done!

Help  Wanted

H O M E W A R D  B O U N D   ANIMAL   Welfare   Center   in   Middlebury   has   PT   and   FT   positions   available   in   the   shelter.   Positions   include   cleaning   kennels,   walking   dogs,   feeding   animals,   facility   housekeeping   and   customer   service.   Duties   may  be  expanded  to  clerical   a n d   a d o p t i o n s .   A n i m a l   care   experience   preferred   and   AM   hours   required   including   some   weekends.   Applications  available  at  www. homewardboundanimals.org   or  email  resume  to  jennifer@ homewardboundanimals.org  .

SHEA  MOTOR   COMPANY   has   immediate   opening   for   full  time,  flat  rate,  automotive   â&#x20AC;&#x153;Aâ&#x20AC;?  technician.  ASE  and  GM   Certification   a   must.   Valid   driverâ&#x20AC;&#x2122;s   license,   basic   tools   and   inspection   license   re-­ quired.  Top  pay  for  qualified  in-­ dividual  with  ability  to  perform   thorough  and  quality  repairs.   Applicant   must   be   customer   service  oriented  and  a  team   player.  Full  benefits  package   include:  Health,  Life  &  Disabil-­ ity  Insurance,  Uniforms,  Paid   Holidays  and  Vacation.  Please   reply  by  email  to  mark@shea-­ motorco.com  or  regular  mail   Attn:   Mark   Stacey,   General   JOB  OPENINGS  FOR:  Event   Manager,   Shea   Motor   Com-­ Security   Division,   Uniform   pany,  PO  Box  747,  Middlebury   Security  Division.  Part  Time.   VT  05753. All  shifts  available  throughout   the   state   of   VT.   Must   be   18   ROUSE   TIRE   SALES   is   years  of  age  and  have  a  high   currently   gearing   up   for   the   school   diploma   /   GED.   We   season   and   is   looking   to   fill   will   train   you   for   an   exciting   several  positions  immediately:   new  career  in  security.  Must   Tire   technician,   Warehouse   be   able   to   work   with   public   personnel,  Auto  /  lt.  truck  me-­ in   a   positive   friendly   manor.   chanic,   Service   truck   driver,   Apply   online:   www.gmcsvt. Alignment   technician.  Appli-­ com  /  employment/  . cants   must   have   previous   experience,   have   the   ability   to  work  in  a  fast  paced  envi-­ ronment  and  be  dependable,   MR.  MIKEâ&#x20AC;&#x2122;S  COMMERCIAL   self-­motivated,   have   a   valid   Cleaning   Service   has   open-­ driverâ&#x20AC;&#x2122;s   license   and   be   will-­ ings   for   relief   positions;   part   ing  to  work  at  least  45  hours   to  full  time.  Must  be  flexible,   per   week.   Applications   can   reliable,   and   able   to   pass   be   filled   out   at   our   Route   7   background  check.  Self  mo-­ South   location   (Middlebury).   tivated,  able  to  work  indepen-­ No  phone  calls  please.  Rouse   dently.  Email  resume  to:  info@ Tire   Sales,   Inc.   is   an   equal   mrmikescleaningservicevt. opportunity  employer. com.  Application   also   avail-­ NEEDED:   PART   TIME   eve-­ able   online   www.mrmikes-­ ning   and   night   position   for   cleaningservicevt.com.   No   a   loving   and   kind   person   to   phone  calls  please. care   for   seniors   in   a   home   atmosphere.   Holistically   we   incorporate  organic  nutrition,   integrative   medicine   and   a   wide  variety  of  fun  activities.   LNA  or  equivalent  is  desired.   If  you  are  a  team  player  and   reliable  please  send  your  re-­ sume  to  info@livingwellvt.org  .



Help  Wanted

Help  Wanted

Help  Wanted

Help  Wanted

OVERNIGHT  AWAKE  SHEL-­ TER  STAFF:  Overnight  awake   shelter   staff   for   a   seasonal   cold  weather  community  shel-­ ter  in  Middlebury  VT.  The  shel-­ ter  opens  November  15-­March   31,  2014  on  the  coldest  nights   of   the   year,   determined   by   state   criteria.   Shelter   hours   are   8:00pm-­8:00am,   Mon-­ day-­Sunday.   Overnight   staff   will  commit  to  over  nights  on   an  on  call  basis.  Position  pays   $10.00  per  hour  when  shelter   is  in  operation;  stipend  for  the   nights  the  shelter  is  not  open.   Send   resume   and   letter   of   interest   to:   HOPE,   Warming   Shelter,  PO  Box  165  Middle-­ bury,  VT  05753.

TOWN  OF  SHOREHAM,  tem-­ porary  vacancy,  Town  Clerk.   This  is  a  24  hour  per  week  po-­ sition  for  the  period  beginning   about  October  21,  2013  and   ending   March   5,   2014.   The   successful  candidate  must  be   a  Shoreham  voter  and  should   be  eligible  to  run  for  the  office   of  Town  Clerk  for  the  term  be-­ ginning  March  5,  2014.  Please   submit  a  resume  and  letter  of   interest  not  later  than  October   8,  2013  to:  Town  of  Shoreham,   297  Main  St.,  Shoreham,  VT   05770.   For   information   call   the  Town  Office  at  897-­5841.   Selectboard   of   the   Town   of   Shoreham.

SHARED  LIVING  PROVIDER   for   a   48   year   old   man   who   enjoys   simple   things   in   life.   This  gentleman  with  a  mild  de-­ velopmental  disability  enjoys   fishing,  going   out  for  coffee,   working   in   the   yard,   visiting   with   others   and   doing   some   traveling.   This   home   needs   to   be   alcohol-­free   and   have   no  children.  You  will  receive   a   generous   tax-­free   stipend   of   $25,000   plus   room   and   board   of   $7800,   as   well   as   respite   budget.   Please   call   Kim   McCarty   at   Community   Associates   for   more   details.   802-­388-­4021.

For  Sale 1â&#x20AC;?  CHERRY  LUMBER,  5â&#x20AC;?-­10â&#x20AC;?   wide,   $.80  /  board   foot.   1â&#x20AC;?+2â&#x20AC;?   curly  maple,  $2.50  /  board  foot.   Wood   splitter   with   9hp   gas   motor  $650.  802-­352-­4460. ANTIQUE   GAS   PUMP   and   Coke   machine;   plus   other   gas   station   items.   Call   af-­ ter   5pm,   or   leave   message,   802-­388-­1427. CLEAN,   USED   RESTAU-­ RANT   equipment.   Call   for   information,  802-­388-­4831.

DEFIANT  WOOD  STOVE  in   SOMEONE   TO   INSULATE   good   condition.   $150.   Call   part  of  basement.  453-­4597. Barb  802-­758-­2238. EVERGREEN   27â&#x20AC;&#x2122;   TRAVEL   TRAILER.   Queen   bed,   full   bath,   kitchen,   dinette,   one   slide  out.  All  composite  con-­ struction,   extremely   light-­ weight.   Very   high   quality   throughout.  Only  used  3  times,   pristine   condition.   $22,750.   Call  Bud,  802-­989-­8511. MAXIM   OUTDOOR   WOOD   PELLET  Furnace  by  Central   Boiler.  Heat  your  entire  home   and   hot   water.   Boivin   Farm   Supply  802-­236-­2389.

Help  Wanted

Help  Wanted

&XUUHQW-RE2SHQLQJV -RE&RUSVLVD\HDUURXQGUHVLGHQWLDOFDUHHUWHFKQLFDOWUDLQLQJDQGeducation SURJUDP IRU \RXWK DJHV  WKURXJK   6WXGHQWV DWWHQG DFDGHPLF DQG WUDGH FODVVHV GXULQJ WKH GD\ DQG SDUWLFLSDWH LQ YDULRXV DFWLYLWLHV LQ WKH HYHQLQJV DQG ZHHNHQGV-RLQRXUWHDPWRKHOSVXSSRUWWKHVH\RXQJSHRSOHLQGHYHORSLQJWKHLU VRFLDOVNLOOV$SSO\IRUDOOSRVLWLRQVRQOLQHDWZZZDOXWLLTFRP

Human Resources Manager (Full Time) &RQGXFWVUHFUXLWPHQWDFWVDV((22IÂżFHUDGPLQLVWHUVVDODU\SURJUDPFRRUGLQDWHVWUDLQLQJSURJUDPVDQGWKHSHUIRUPDQFH HYDOXDWLRQSURJUDP5HTXLUHPHQWV%DFKHORUÂśV'HJUHHLQKXPDQUHVRXUFHVRUUHODWHGÂżHOG6XSHUYLVRUH[SHULHQFHDSOXV Â Licensed Practical Nurse (Full Time) 3URYLGHVTXDOLW\QXUVLQJVHUYLFHVWRVWXGHQWVHYDOXDWHVDQGWUHDWVVWXGHQWVZLWKLQVFRSHRIOLFHQVXUH$VVLVWVLQPHGLFDO H[DPVWDNHVODERUDWRU\VDPSOHVDGPLQLVWHUVÂżUVWDLGDQGRWKHUWUHDWPHQWDVGLUHFWHGSURYLGHVUHTXLUHGLPPXQL]DWLRQVWR VWXGHQWVDQGGLVSHQVHVPHGLFLQHDVQHHGHG5HTXLUHPHQWV+LJK6FKRRO'LSORPDRU*('JUDGXDWLRQIURPDQDFFUHGLWHG VFKRRORIQXUVLQJFXUUHQW97/31OLFHQVHDQGRQH\HDURIQXUVLQJH[SHULHQFHSUHIHUUHG 6HFXULW\2IĂ&#x20AC;FHU )XOOWLPHDQG2Q&DOO

6XSSRUWVWXGHQWVLQGHYHORSLQJDKHDOWK\UHODWLRQVKLSWRRXUOHDUQLQJFXOWXUH3URWHFWVDQGHQVXUHVWKHZHOIDUHDQGVDIHW\ RIVWXGHQWVVWDIIIDFLOLWLHVJURXQGVDQGHTXLSPHQWLQFOXGLQJSK\VLFDOFKHFNVDQGLQVSHFWLRQVLQYHVWLJDWLRQVEHKDYLRU FRQWURODQGSRWHQWLDOVHDUFKDQGVHL]XUHDFWLYLWLHV$VVLVWVLQVWXGHQWWUDQVSRUWDVQHHGHG5HTXLUHPHQWV+LJK6FKRRO 'LSORPD*('ZLWKRQH\HDURIVHFXULW\RUODZHQIRUFHPHQWVHUYLFH9DOLGGULYHUÂśVOLFHQVH0XVWEHDEOHWRZRUNnd  and  3rd   VKLIWVLQFOXGLQJZHHNHQGV Wellness Supervisor â&#x20AC;&#x201C; RN (Full Time ) 3URYLGHVDVVHVVPHQWWULDJHDQGWUHDWPHQWWRVWXGHQWV2YHUVHHVFOLQLFDORSHUDWLRQVDQGQXUVLQJVWDII3URYLGHV:HOOQHVV &HQWHU RULHQWDWLRQ WR QHZ VWXGHQWV DQG DVVLVWV WKH +HDOWK 6HUYLFHV $GPLQLVWUDWRU ZLWK D YDULHW\ RI FOLQLFDO SURFHVVHV LQFOXGLQJSURYLGLQJPDQGDWRU\VWDIIWUDLQLQJ5HTXLUHPHQWV'HJUHHIURPDFFUHGLWHG3UDFWLFDO1XUVH3URJUDPRQH\HDU UHODWHGH[SHULHQFHFXUUHQW9HUPRQW51OLFHQVHZLWK%/6&35FHUWLÂżFDWLRQDQGDYDOLGVWDWHGULYHUÂśVOLFHQVH6XSHUYLVRU\ H[SHULHQFHSUHIHUUHG


Addison Independent,  Monday,  September  23,  2013  —  PAGE  31

Addison Independent

For Rent

CLASSIFIEDS

NEW HAVEN;  EXCELLENT   1   bedroom   apartment   with   MIDDLEBURY  PENTHOUSE   appliances,   heat,   trash   re-­ APARTMENT:  Charming  one   moval   included.   $800  /  m o.   bedroom,   1   1/2   bath   apart-­ plus  security.  Pets  negotiable.   ment   in   convenient   village   802-­453-­2184. location.  Interesting  floor  plan,   OFFICE  SPACE  FOR  RENT.   excellent   parking.   Includes   Located  above  the  Bristol  Bak-­ heat,  trash  removal,  recycling.   ery.  Renovated  475sq.ft.  office   Dogs  and  cats  permitted  with   space  on  the  second  floor  of   owner’s   O.K.   No   smoking   16  Main  Street  in  Bristol.  The   please.  Security  deposit  and   office  has  large  windows  fac-­ references   required.   $1000.   ing   south   onto   Main   St.   and   Contact  Bill  at  802-­388-­3562,   a   high   ceiling.   The   layout   is   or   Coleen   at   802-­343-­7240.   open   with   two   built-­in   work   colbeck@sover.net  . stations  and  a  storage  closet.  



For Sale

For Rent

For Rent

RAINY SUMMER   BARREL   SALE  —  THE  BARREL  MAN:   55   gallon   Plastic   and   Metal   barrels.  Several  types:  55  gal-­ lon  rain  barrels  with  faucets,   Food   grade   with   removable   locking   covers,   plastic   food   grade   with   spin-­on   covers   (pickle  barrels).  Also,  275  gal-­ lon   food   grade   totes   $125   each.   Delivery   available.   802-­453-­4235.

2 BEDROOM,   FIRST   floor   apartment   with   office   in   Middlebury,  85  Court  Street.   Full  basement,  W/D  hook-­up,   off-­street  parking.  Lawn,  snow   plowing   and   appliances   in-­ cluded.   $1000  /  mo.   No   pets   or   smoking.   Credit,   refer-­ ences   and   lease   required.   802-­352-­6678.

BRISTOL; QUAKER  COUN-­ TRY   home   (circa   1850),   twenty  acres.  References  re-­ quired.   No   alcohol.   Deposit   required.   $1395  /  mo.   Please   call  864-­630-­6905.

2-­3 BEDROOM,  900  SQ.  FT.   apartment   for   rent.   $1000   per  month.  Does  not  include   utilities.  Large  yard,  nice  deck,   close   to   village   and   down-­ hill  from  Mt.  Abraham  Union   High   School.   Dishwasher,   tons  of  storage,  hookups  for   washer  and  dryer  and  a  bonus   room.   This   unit   is   one   half   of   a   duplex.   Rent   includes:   Dumpsters  (Recycle  &  Trash),   lawn  care  and  snow  removal.   Absolutely  no  pets,  no  smok-­ ing.   900   sq.   ft.   storage   in-­ cluded.   Lease,   references,   deposit  and  credit  application   required.  802-­233-­2592.

FARM HOUSE   FOR   RENT:   Large  kitchen,  4  bedrooms,  2   car  garage.  $1300  /  month  plus   utilities.  References  required.   Pets  considered.  Ferrisburgh   /  802-­877-­9923.

MIDDLEBURY: 2  BEDROOM   apartment  with  laundry  room.   Heat,  trash,  water  and  snow   plowing  included.  Ready  Sept.   15.  No  smoking,  no  pets.  $950   /  month  plus  deposit.  Call  Mike   at  802-­349-­0025  after  4pm.

FERRISBURGH 4   BED-­ ROOM   2   bath   house.  Avail-­ able   Sept.   1-­   June   1,   2014.   $1500  /  month   plus   utilities.   First  and  security.  Credit  and   reference   check   required.   Karla  802-­377-­7445.

MIDDLEBURY; 1  BEDROOM   studio   apartment,   close   to   downtown.   Heat,   electricity   included.  References,  security   deposit   required.   $725  /  mo.   Call  802-­759-­2169.



ROUND BALE   HAY,   $20.   loaded.   Also   dry   firewood,   you   pick   up.   $200  /  c ord.   802-­247-­6061.

Vacation Rentals

ADDISON: LAKE   CHAM-­ PLAIN   waterfront   camp.   Beautiful  view,  gorgeous  sun-­ sets,   private   beach,   dock,   rowboat  and  canoe  included.   $600.  weekly,  or  call  for  week-­ 4   BEDROOM   LOG   home,   ends.  802-­349-­4212. Monkton.  1-­1/2  baths.  $1200   /  mo.   plus   utilities.  Available   October  15.  802-­453-­4206. For  Rent

CORNWALL EFFICIENCY   APARTMENT  clean  and  quiet.   $650  includes  all.  989-­8124.

MIDDLEBURY 1  BEDROOM   apartment,   near   Marble   Works.   $630  /  mo.   plus   utili-­ ties.  802-­388-­6892. MIDDLEBURY  1  BEDROOM   apartment.  Third  floor.  Center   of  town.  $1000  /  mo.  includes   electric,  water,  heat,  washer,   dryer,  parking.  802-­349-­8544.

AUTO STORAGE;  MONTH-­ LY,  seasonal  and  yearly  heat-­ MIDDLEBURY   COMMER-­ ed  storage.  Reasonable  rates.   CIALLY  ZONED  House  with   maximum   exposure   and   1  BEDROOM  APARTMENT   802-­877-­3207. access   to   Rt.   7   and   Foote   in  Salisbury  near  Lake  Dun-­ more.  Super  energy  efficient.   BRANDON,  NOW  RENTING   Street.  Great  way  to  build  your   Bedroom  and  full  bath  on  sec-­ 1   &   2   BR   affordable   apart-­ cliental.   Spacious   parking.   ond  floor.  Eat-­in  kitchen  with   ments  at  Park  Village.  Rents   Handicap  accessible.  Please   stove,  refrigerator;  and  living   starting   at   $691  /  mo.   Some   call  Darcy  at  802-­388-­9599. room   on   first   floor.   Private   utilities  included.  Great  loca-­ MIDDLEBURY   ONE   BED-­ basement   with   washer   and   tion,  beautiful  setting,  30  min.   ROOM  apartment.  First  floor   to   Rutland,   5   min.   to   down-­ dryer  included.  $800  /  mo.  plus   apartment  with  shared  deck,   utilities.   Yard   maintenance   town   Brandon,   easy   access   $750   month   plus   utilities.   to   R oute   7 .   P ets   a llowed   w ith   and   snow   plowing   included.   Beautiful  wood  floors.  Secu-­ deposit.   C all   C hantel   f or   m ore   Security,  references  required.   rity  deposit,  credit  application   Non-­smoking  property.  Abso-­ info  802-­247-­0165. required.  No  pets,  no  smoking.   lutely  no  pets.  802-­352-­6678. BRANDON:  $600.  AFFORD-­ 1457   Route   7   South.   See   1800  SQ  FT.  3  BEDROOMS:   ABLE  2  bedroom,  first  floor,   Craigslist  ad  for  photos.  Call   Walking   distance   to   Mt.Abe   trash,   snow,   parking,   pets   802-­349-­7432. High  School  and  village!  5  Star   welcome.  203-­253-­4389. Energy   rated   Town   house.   BRIDPORT;   LARGE   1   bed-­ For  Rent Laundry  Room,  Office,  Family   room,   second   floor   apart-­ Room.   Hardwood   Floors   in   ment.   References   and   de-­ Living  Room  &  for  2  cars.  No   posit   required.   $650  /  m o.   smoking,  no  pets.  Lease,  Ref-­ 802-­758-­2436. erences,  Deposit  and  Credit   Application   are   required!   BRISTOL   2   BEDROOM   1   $1275  /  month.   Does   not   in-­ Bath   efficient   gas   heat   and   clude   heat   or   utilities.   Rent   new  windows.  Excellent  con-­ includes:   Trash   &   Recycling   dition.   Water   and   sewer   in-­ removal,   Plowing   and   Lawn   cluded.  No  pets  or  smoking.   $850  /  month.  802-­635-­9716. care.  802-­233-­2592.



2 BEDROOM  HOUSE,  com-­ pletely  furnished  for  9  month   winter   rental   on   Lake   Dun-­ more.   Very   energy   efficient,   washer   and   dryer,   85’   of   frontage,   no   pets,   no   smok-­ ing.   $1000  /  mo.   plus   utilities.   802-­352-­6678. 2   B E D R O O M   R U S T I C   HOUSE  in  Salisbury  with  ac-­ cess   to   Lake   Dunmore.   For   winter   rental   and   possibly   longer.  Nice,  level  yard,  fire-­ place,  stove,  refrigerator  and   some  porch.  $800  /  month  plus   utilities.   No   smoking.   Pets   negotiable.  802-­352-­6678.

BRISTOL 2  BEDROOM  apart-­ ment.   $740  /  month   includes   heat,  snow  removal  and  lawn   care.   No   smoking  /  pets.   Off   street  parking.  Near  downtown   stores.  Call  802-­777-­2800. BRISTOL   2   BEDROOM   house.   Upgraded   kitchen.   Just  remodeled.  Large  3-­room   bathroom,   nice   porch   and   views,   private   yard,   washer   /  dryer.   Extra   storage.   2-­car   carport,   snow   removal   and   wifi   included.  Available   Nov.   1.   $950  /  m o.   Security   and   reference.  No  pets  /  smoking.   802-­453-­4838  leave  message. BRISTOL  2BR  APARTMENT   Heat,  hot  water,  snow  remov-­ al,  lawn  care  included.  Base-­ ment  and  garage.  Appliances.   Available  now.  453-­2566.

For Rent

This office  shares  the  hallway   and   bathroom   with   2   other   upstairs  offices.  Rent  is  $575   /  mo.  and  includes  heat,  elec-­ tric  and  A/C.  Available  Oct  1.   Please   call   Chris   or   Barb   at   453-­2756  to  inquire.

PANTON HOUSE   SHARE:   3   Bedroom,   1   bath,   shared   kitchen  and  common  space,   big  yard.  Convenient  to  Ver-­ gennes.  Transportation  neces-­ sary.  Looking  for  $400  /  month   and  shared  house  and  garden   MONKTON  POND  2  Bedroom   work.   References   required.   2   bath.   $1375  /  month   plus   802-­475-­2112. utilities.  First,  last  and  security.   Credit   check   and   reference   RIPTON   2   BEDROOM,   first   check  required.  Avail.  Nov.  1.   floor  apartment.  $475  /  mo.  plus   utilities.  No  pets.  No  smoking.   Karla  802-­377-­7445. Call  802-­382-­8567. MONKTON   POND   2   Bed-­ room,   1   bath.   $1275  /  month   RIPTON   TWO   BEDROOM   plus   utilities.   First,   last,   se-­ apartment.   $550  /  month   plus   curity.  References  and  credit   utilities.  No  pets.  No  smoking.   check  required.  Available  Oct.   Call  802-­382-­8567. 1.  Karla  802-­377-­7445. NEW   HAVEN   1   bedroom   apartment,   950sq.ft.   Energy   efficient,  low  heat  cost.  Sce-­ nic.   Quiet.   5   miles   to   center   Middlebury.   Washer  /  d ryer   hook-­up.   Cat   allowed.   $850   /  mo.  plus  first  month  and  se-­ curity.  802-­989-­6408.

For Rent

Att. Farmers

TWO BEDROOM   APART-­ MENT   available   for   occu-­ pancy.   Modern   apartment,   carpet  /  tile,  w/d  hookups  plus   onsite  laundry.  Ample  parking   and   storage.   Includes   trash,   snow   removal,   professional   management   and   24   hour   maintenance.   Efficient   gas   heat  /  hot  water.  In  quiet  Mid-­ dlebury  neighborhood.  $695  /   mo.  plus  utilities.  References   required.   Please   call   Diane   at   802-­472-­5016   for   more   information.   Equal   Housing   Opportunity.

BABY PIGS  FOR  SALE!  $40   EACH.  Call  802-­247-­6810.

STANDING CORN  and  balage   for  sale.  759-­2135. WANTED:   TO   PURCHASE   from   owner,   open   land,   20+   acres.  802-­558-­6092. WHITNEY’S  CUSTOM  FARM   WORK.  Pond  agitating,  liquid   manure  hauling,  mouldboard   plowing.   462-­2755,   John   Whitney

S A L I S B U R Y S T U D I O   APARTMENT,   upstairs,   fur-­ nished,  includes  utilities,  Dish   TV,  $750  /  mo.  802-­352-­9094.

Boats BOSTON WHALER  17’  90hp   Johnson,   trailer   and   acces-­ sories.   $5500.   OBO,   call   for   more   information.   Can   see   on  Craig’s  list.  802-­453-­4235.

STORAGE SHED.   20’X50’,   $200  /  month.  Contact  Marcel   Page  802-­623-­8311.



For Rent

FIREWOOD: CUT,   SPLIT,   delivered.  Call  802-­388-­7300.

Call the  Addison  Independent  at  (802)  388-­4944. Talk  to  our  sales  professionals.

1996 CHEVROLET  CAPRICE   Classic,   southern   car.   Good   shape   and   running   condi-­ tion.  $2000.  or  best  offer.  Call   802-­759-­2110.

Trucks



Particularly on  sites  like  Craigslist.

Let us  help  you  sift  through  the  complexities  of  the  Fair   Housing  Law.  Stay  legal.  Stay  on  the  right  side  of  the   nation’s  Fair  Housing  Law.  

Cars

FIREWOOD; CUT,   SPLIT   and  delivered.  Green  or  sea-­ soned.   Call   Tom   Shepard,   1998   FORD   RANGER   XLT,   802-­453-­4285. super  cab,  white.  4x4,  4  liter   FIREWOOD;  CUT,  SPLIT  and   V-­6.  Automatic  transmission,   delivered.  Call  for  information.   102,500   miles.   Inspected.   $2995.   Call   802-­758-­2377   247-­9782. for  information. MOUNTAIN   ROAD   FIRE-­ WOOD.  Green  and  dry  avail-­ able.  Oak,  ash,  maple,  beech.   Wanted Order  now  and  save  for  next   season.   Cut,   split   and   deliv-­ USED  OIL  WANTED:  Mikes   ered.  Call  802-­759-­2095. Auto  1  and  2,  small  amounts,   drop   off   with   us.   50   gallons   +   we   will   pick   up   locally.   802-­388-­4138. Real  Estate

It’s against  the  law   to  discriminate  when   advertising  housing   related  activities. And  it’s  easier  to  break  the  law  than  you  might   think.  You  can’t  say  “no  children”  or  “adults  only.”   There  is  lots  you  can’t  say.  The  federal  government   is  watching  for  such  discrimination.

HAY FOR   SALE:   Small   square   bales.   First   cut   and   mulch.   Delivery   avail-­ a b l e .   C a l l   f o r   p r i c i n g .   802-­453-­4481,  802-­349-­9281,   or  802-­989-­1004.

NEW HOLLAND   T1530-­   250TL   Loader,   200   hours.   TWO   BEDROOM   CONDO,   Winco   PTO   Generator.   Call   Middlebury   East.   One   bath,   802-­247-­6735. full   kitchen,   W/D.   Screened   porch.  Large  walk-­out  base-­ SAWDUST;   STORED   AND   ment  and  workshop.  One  car   undercover.   Large   tandem   garage.  $1350  /  mo.  Call  Bud   silage  truck  $627,  delivered.   Large  single  axle  dump  $259,   802-­989-­8511. delivered.   Single   axle   dump   $1  92,  delivered.  Pick  up  and   loading  also  available.  Phone   order  and  credit  cards  accept-­ ed.   802-­453-­2226.   Bagged   shavings  in  stock.  $5.50  per   bag.

STORAGE SPACES,  11’X28’.   Wood  Heat Large   overhead   doors,   ex-­ NEW   HAVEN   3   bedroom   tra   high   ceilings.   Will   ac-­ mobile  home.  $925  /  mo.  plus   commodate   large   campers,   deposit.  802-­453-­3870. boats   or   lots   of   stuff.   Call   802-­388-­8394. FIREWOOD   FOR   SALE:   Mixed   hardwoods,   cut   and   split.   Green   and   dry   avail-­ able.  Lathrop  Forest  Products.   802-­453-­3606.

For Rent

HAY FOR  SALE:  First  cut  $3   /  square  bale.  First  cut  round   bales  $30.  Mike  Quinn,  end  of   South  Munger  Street,  Middle-­ bury.  802-­388-­7828.

LEICESTER, 6.8   ACRES,   $59,000.   Very   nice   building   C site  surveyed,  septic  design  in-­ . to collegeR For Rent cluded.   eady  to  build  on,  with   T se lo EN C TM d. furbishe OM APAR 1 BEDRO Middlebury, newly re 00. all  permits.  Owner  financing.   , 00 et 0-­ re 00 St . n at he Mai th, includes Call  Wayne  802-­257-­7076. ury $750/mon of Middleb ds (Pub lassified A

lished: 5/

5/11)

WESTERN UNI-­MOUNT   Snow   Plow   in   good   working   condition.  802-­558-­5244.

WOODLAND OWNERS:  Buy-­ ing   any   type   standing   wood   and  /  or  property.  Highest  price   rth . T, no 00 EN ile 00 m TM t. 000-­ rubbish, 1 OM APAR plus deposi 1 BEDRO udes heat, electric, $595/month M I D D L E B U RY;   I N D U S -­ paid.  Land  clearing.  Courteous   cl ly, upstairs, in Available immediate professional.  518-­593-­8752. e TRIAL   d referenc Available   2   on Route 7. anPARK.   s. Deposit LE home ilitieacres,   BI ut O M us pl M O o. lease   or   build   to   suit.   2 BEDRO Private lot. $650/m . 802-­558-­6092.s required. in Salisbury 0-­0000. ce required. 00 t. Referen ONDO HOUSE/C arage and basemen 00. G OM TOWN 2 BEDRO mons, Vergennes. heat. No pets. 000-­00 d om Country C excluding utilities an washer, $1,000/mo. mpletely et, satellite, co , N ER D peed intern e. Very energy MO , i-­s M H O e. O R us ne 2 BED ore ho frontag Lake Dunm drilled well, 85’ lake 29, 2009 through Ju 802-­352-­6678. furnished st h, us utilities. ened porc arting Augu dryer, scre 10 month rental; st tiable. $1,000/mo. pl r go efficient. Fo -­smoking. Pets ne Non 26, 2010.


PAGE  32  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

NEW

 RUN  EVENT  SERIES

September 29th at Branbury State Park Choose between: 5km, 10km or ½  marathon %HDXWLIXOVHWWLQJ)XQIDLUVDIH DǺRUGDEOH

3URFHHGVEHQHĂŽWORFDO\RXWKVSRUWVWHDPV

www.vermontsun.com

802-â&#x20AC;?388-â&#x20AC;?6888

Buy it! Sell it! Find it!

&KHFNWKH&ODVVL¿HGVWZLFHDZHHN in  the  Addison  Independent.

September 28th On the Green in Bristol 10am - 4pm

Come and explore the 70+ Vendors, Handcrafters, Demonstrations &

Farmersâ&#x20AC;&#x2122; Market

Music

Ways for everyone to participate... Kidsâ&#x20AC;&#x2122;  Games   Pie  Eating  Contest,   Apple  Pie  Contest,   Chicken  Wing  Contest,   Biggest  Zucchini  Contest,   Pony  Rides,  Food  &  More!

10-­10:30~  Mark  Lavoie 10:30-­Noon~  LC  Jazz 12:15-­1:15~  Harvest  Fest  Band   1:30-­2:30~  Simply  Acoustic 2:45-­3:45~  Bible  Camp  Sleep   Over

5K Road Race

'RZQWRZQ+DUYHVW6FDYHQJHU+XQW5DČ?H Gift basket of downtown goodies and JLIWFHUWLĂ&#x20AC;FDWHVIRUWKHSUL]H Brought to you by: Bristol Recreation Department and the Addison County Chamber of Commerce. For information visit: bristolharvestfest.com or bristolrec.org or call 453-­5885 or 388-­7951x1

JOHN  AND  ANN  Hanson  of  Bridport  are  the  co-­chairs  of  the  2013  United  Way  of  Addison  County  fundrais-­ LQJFDPSDLJQ7KHRUJDQL]DWLRQKDVVHWDJRDOWRUDLVHWREHQH¿WORFDOQRQSUR¿WV

United  Way (Continued  from  Page  1) $725,000   goal   with   a   lot   of   hard   work,   some   newly   recruited   vol-­ unteers  and  a  renewed  effort  to  ex-­ plain   UWACâ&#x20AC;&#x2122;s   mission   and   track   record  to  prospective  donors. Leading   the   way,   with   United   Way   staff,   will   be   2013   campaign   co-­chairpersons   John   and   Ann   Hanson   of   Bridport.   The   Hansons   have  lived  in  the  area  for  25  years   DQG KDYH VHHQ ÂżUVWKDQG WKH VHU-­ vices   â&#x20AC;&#x201D;   ranging   from   fuel   assis-­ tance  to  affordable  housing  â&#x20AC;&#x201D;  that   8:$&VSRQVRUHG QRQSURÂżWV KDYH been   delivering   to   their   fellow   county  residents  for  many  years. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ve   watched   our   children   and   our   lives   intertwine   with   United   Way   agencies   all   the   way   through,   from   childcare   to   pro-­ grams  offered  through  the  schools   and  now  at  this  stage  of  our  lives,   where   we   have   friends   who   have   used  Elderly  Services  and  hospice   care,  so  it    has  been  kind  of  a  life-­ time  of  appreciation  for  the  things   United   Way   offers,â&#x20AC;?   Ann   Craig   Hanson,   dean   of   student   affairs   emeritus   with   Middlebury   Col-­ lege,   said   on   Thursday.   â&#x20AC;&#x153;We   want   to   help   out,   because   it   has   had   an   important  impact  on  us.â&#x20AC;? John   Hanson   is   former   director   of  admissions  at  the  college.  So  he   DQG KLV ZLIH KDYH DOVR VHHQ ÂżUVW hand   how   UWAC   agencies   have   helped   members   of   the   college   community. â&#x20AC;&#x153;Having   resided   in   Middlebury,   Cornwall   and   Bridport,   weâ&#x20AC;&#x2122;ve   also   seen   the   inter-­relationships,â&#x20AC;?   John     Hanson   said,   noting   United   Way  services  transcend  town  lines.   â&#x20AC;&#x153;Supporting  (UWAC)  seems  to  be   a  comprehensive  way  of    address-­ ing  what  weâ&#x20AC;&#x2122;ve  appreciated  in  our   own  lives.â&#x20AC;? The  Hansons  will  be  the  face  of   a   2013   campaign   that   organizers   promised   will   be   well   explained   and  that  will  seek  to  involve  what  

Independent  photo/Trent  Campbell

it  hopes  will  be  the  next  generation   DWHV WKH QRQSURÂżWV LW IXQGV DQG of  volunteers  and  clients. that   UWAC   is   also   involved   in   Âł,Q WKH QRQSURÂżW ZRUOG WKLV LV education  and  advocacy. really   a   big   concern,â&#x20AC;?   said   Kate   8QLWHG :D\ RIÂżFLDOV DOVR ZDQW McGowan,   executive   director   of   citizens   to   become   more   aware   of   the  United  Way  of  Addison  Coun-­ the   ancillary   services   it   provides   ty.   â&#x20AC;&#x153;When   we   look   at   our   donor   WRORFDOQRQSURÂżWVDQGEXVLQHVVHV demographics,   itâ&#x20AC;&#x2122;s   really   clear   7KRVH VHUYLFHV LQFOXGH ÂżQDQFLDO that  some  folks  are  moving  out  of   counseling   and   free   tax   prepa-­ the   community,   aging   out   of   giv-­ ration.   These   services   can   help   ing;Íž   theyâ&#x20AC;&#x2122;re   retiring,   so   income   people   with   limited   means   to   bet-­ changes.   Part   of   the   ter  budget  for  them-­ discussion   in   the   selves   and   therefore   QRQSURÂżW FRPPXQL-­ â&#x20AC;&#x153;When we look at not   need   as   much   ty   is,   â&#x20AC;&#x2DC;Whoâ&#x20AC;&#x2122;s   going   our donor demoassistance  from  non-­ to   replace   the   lead-­ graphics, itâ&#x20AC;&#x2122;s really SURÂżWV ers?  Whoâ&#x20AC;&#x2122;s   going   to   clear that some McGowan   and   replace   aging   board   folks are moving Luke   hope   to   see   members?   And   UWAC   increase   out of the comwhoâ&#x20AC;&#x2122;s   going   to   re-­ its   donor   rolls   in   place  aging  donors?â&#x20AC;&#x2122;   munity, aging out all   categories.   The   So   itâ&#x20AC;&#x2122;s   important   to   of giving; theyâ&#x20AC;&#x2122;re organization   cur-­ think   strategically   retiring, so income rently  counts  around   about   how   we   en-­ changes â&#x20AC;Ś Whoâ&#x20AC;&#x2122;s 2,000   total   donors   gage   folks   who   are   going to replace the who   contribute   busy,   but   who   are   through   paycheck   committed   to   their   leaders?â&#x20AC;? deductions,   small   â&#x20AC;&#x201D; Kate McGowan ÂżQDQFLDO FRQWULEX-­ communities   in   this   kind  of  way.â&#x20AC;? tions   and   larger   To   that   end,   outlays   (in   excess   UWAC   enters   the   2013   campaign   of   $1,250)   as   part   of   the   â&#x20AC;&#x153;Robert   having   dissolved   a   co-­directorâ&#x20AC;&#x2122;s   Frostâ&#x20AC;?   category   of   giving.   People   position   but   having   hired   a   devel-­ can  also  donate  stock  gifts.  Those   opment   and   marketing   director   â&#x20AC;&#x201D;   who  want  to  learn  more  about  their   Nancy   Luke.   Luke   has   been   put-­ giving  options  can  call  the  United   ting   together   publications,   videos   Way  at  388-­7189,  or  log  on  to  unit-­ and  other  publicity  materials  to  en-­ edwayaddisoncounty.org. able  county  residents  to  rediscover   2IÂżFLDOV DOVR ZDQW SHRSOH WR what  UWAC  is  all  about.  This  need   realize   they   can   help   throughout   was  underscored  in  a  recent  online   the   year,   and   not   just   during   the   survey   conducted   by   the   United   Days   of   Caring.   As   an   example,   Way.  The  survey  featured  12  multi-­ McGowan   cited   the   â&#x20AC;&#x153;Everybody   ple-­choice  questions  about  UWAC,   Winsâ&#x20AC;?   literacy   campaign   through   measuring   awareness   of   United   which   adults   periodically   go   into   Way  work  and  the  perceived  value   local  schools  to  read  to  young  stu-­ of  that  work.  A  large  percentage  of   dents. the  209  respondents  were  aware  of   â&#x20AC;&#x153;We   are   trying   to   show   people   UWAC  and  its  grant  making  func-­ how   they   can   make   a   difference   tion,   but   relatively   few   knew   that   every  day,â&#x20AC;?  McGowan  said. UWAC  priorities  are  chosen  based   Reporter   John   Flowers   is   at   on  a  community  dialogue,  that  the   johnf@addisonindependent.com.   organization   monitors   and   evalu-­


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  33

Public Notices Index Addison  County  Fair  and  Field   Days  (1) Addison  County  Superior   Court  (4) Bristol  (1) Middlebury  and  Weybridge  (1) To publish a legal notice in the Addison Independent, please email information to legals@addisonindependent.com or fax it to (802) 388-3100.

TOWN OF ORWELL HEARING â&#x20AC;&#x201C; DEVELOPMENT REVIEW BOARD

The  Orwell  Development  Review  Board   will  meet  Wednesday,  October  16  at  7:30   SPDWWKH7RZQ&OHUNÂśV2IÂżFHWRFRQGXFW WKHIROORZLQJEXVLQHVV  (UOH &KLS  7DXEH  %ODFN 6QDNH /DQH2UZHOO)LQDO3ODW+HDULQJIRU6XE-­ GLYLVLRQ3HUPLW Information  pertaining  to  these  matters   PD\EHYLHZHG077KDQG  DQG )U  DQG  DWWKH7RZQ&OHUNÂśV2IÂżFH David  King,  Chair  â&#x20AC;&#x201C;  Orwell  DRB 

Monkton  (1) Orwell  (1) Panton  (1) Ripton  (1) Salisbury  (1) Starksboro  (1)

MIDDLEBURY AND WEYBRIDGE JOINT PUBLIC MEETING

Local  Concerns  Meeting  -­  Pulp  Mill   Bridge  Area  Sidewalk  Scoping  Study October  8,  2013  â&#x20AC;&#x201C;  5:30  pm   0LGGOHEXU\7RZQ2IÂżFHV The   Towns   of   Middlebury   and   Weybridge   are   collaborating   on   a   planning  and  feasibility  study  for  sidewalk   connections   and   pedestrian   system   improvements   along   Seymour   Street   DQG3XOS0LOO%ULGJH5RDG7KHÂżUVWVWHS in   the   planning   process   is   co-­hosting   a   Local  Concerns  Meeting.  The  purpose  of   the  meeting  is  to  present  the  project  goals   and  provide  the  opportunity  for  the  public   to   express   support   or   concerns.   Please   contact   Kathleen   Ramsay,   Middlebury   Town   Manager,   (802)   388-­8100   ex201,   kramsay@townofmiddlebury.org   if   you   have  any  questions.    

TOWN OF MONKTON NOTICE OF PUBLIC HEARING ON THE PROPOSED TOWN PLAN

The  Monkton  Planning  Commission  will  hold  a  Public  Hearing  at  8:00  PM  on  Tuesday     October   15, 2013   at   the   Monkton   Central   School,   to   take   public   testimony   on   the   proposed  Town  Plan  for  the  Town  of  Monkton.   Statement of Purpose The  purpose  of  a  town  plan  is  to  provide  a  vision  for  orderly  development  with  in  the   town.      It  is  essentially  a  â&#x20AC;&#x153;picture  in  timeâ&#x20AC;?  that  uses  existing  conditions  to  guide  zoning   DQGGHYHORSPHQWGHFLVLRQVIRUWKHQH[WÂżYH\HDUSHULRG Our  new  town  plan  is  a  complete  revision  of  the  plan  adopted  in  2007.      At  a  minimum   each  section  has  been  reformatted  to  ensure  that  the  entire  document  speaks  with  a   single  voice  and  offers  information  in  the  same  way,  while  other  sections  have  received   a   more   complete   revision.     Unlike   earlier   editions   of   the   town   plan,   where   the   goals   ZHUHSUHVHQWHGLQDVLQJOHVHFWLRQ\RXZLOOÂżQGERWKJRDOVDQGDFWLRQSODQVZLWKLQWKH element  they  apply  to.       The  proposed  Town  Plan  affects  all  the  land  within  the  Town  of  Monkton. 7KH3ODQQLQJ&RPPLVVLRQEHOLHYHVWKHIROORZLQJDUHWKHVLJQLÂżFDQWFKDQJHVRIIHUHG by  the  plan: 1.    Within  the  Economy  section,  we  have  examined  the  advances  in  agriculture  and   WKHH[SDQGHGGHÂżQLWLRQRIDJULFXOWXUH$OWKRXJKWKHUHFRQWLQXHVWREHDGHFUHDVHLQWKH number  of  family  dairy  farms,  there  is  a  growth  in  small  non-­dairy  farm  operations.    The   SODQUHFRJQL]HVWKHVHQRQWUDGLWLRQDOGLYHUVLÂżHGRSHUDWLRQV:HKDYHDOVRORRNHGDWWKH diversity  of  small  business  in  town  and  believe  that  the  town  can  only  grow  stronger  by   providing  the  support  and  encouragement  these  businessesâ&#x20AC;&#x2122;  need  to  grow.       2.   Within   the   Transportation   section,   the   Plan   addresses   the   increasing   need   to   develop  transportation  systems  that  encourage  ride  sharing  and  decreases  the  number   of  trips  made  by  single  driver  vehicles.    The  plan  encourages  the  town  to  engage  in   conversations  with  Addison  County  Transit  Resources  (ACTR)  to  design  and  promote   a  bus  route  that  will  allow  town    residents  to  access  public  transportation  at  reasonable   hours  and  in  ways  that  will  make  taking  the  bus  a  desirable  alternative  to  driving.   The  plan  also  encourages  the  development  of  a  designated  park  and  ride  location,   DQGUHFRPPHQGVWKDWGXULQJWKHQH[WÂżYH\HDUSODQQLQJSHULRGWKHWRZQZRUNZLWKRWKHU WRZQVZLWKLQRXUUHJLRQWRGHYHORSDFRRUGLQDWHGSODQWKDWZLOOPRYHWUDIÂżFRIIRXUWRZQ roads  and  back  onto  the  appropriate  state  or  federal  highways.   3.      Within  the  Energy  Section  we  shifted  the  discussion  of  energy  infrastructure  to  the   Utilities  and  Facilities  Section  while  the  new  Energy  section  focuses  on  energy  usage,   conservation  and  renewable  energy.  We  have  also  added  a  discussion  on  commercial   wind  energy.   4.   Within   the   Land   Use   Section,   we   have   deleted   the   formula   for   determining   the   â&#x20AC;&#x153;no  buildâ&#x20AC;?  zone  from  the  previous  plan  while  still  protecting  our  ridgelines  and  scenic   YLHZV7KHIRUPXODRIIHUHGZDVKDUGWRXQGHUVWDQGDQGGLIÂżFXOWWRFDOFXODWH$IRUPXOD of  this  nature  should  be  part  of  zoning  and  subdivision  regulations  instead  of  a  planning   document.    We  have  also  created  two  land  use  areas;Íž  the  village  residential  planning   UHJLRQDQGWKHUXUDOUHVLGHQWLDOSODQQLQJUHJLRQ:HKDYHDOVRPRUHFOHDUO\GHÂżQHGWKH conserved  areas  of  town.     While   the   Plan   sets   forth   the   community   goals   and   objectives,   the   policies   and   other  means  of  achieving  those  ends  are  set  forth  in  the  town  zoning  and  subdivision   regulations.    A  town  plan  should  not  be  a  proscriptive  document.    This  version  of  the   Monkton  Town  Plan  adheres  to  this  principal.   Copies  of  the  Draft  Town  Plan  may  be  obtained  at  or  the  full  document  may  be  viewed   DWWKH7RZQ2IÂżFHV0RQNWRQ5LGJH0RQNWRQGXULQJUHJXODUEXVLQHVVKRXUVDQG on  the  town  web  site  www.monktonvt.com. The  Planning  Commission  will  meet  at  the  conclusion  of  the  public  hearing  to  discuss   the  testimony  presented.     Thea  Gaudette,  Clerk  â&#x20AC;&#x201C;  Monkton  Planning  Commission 9/23,  10/7

72:12)%5,672/ 38%/,&+($5,1*127,&(

TOWN OF PANTON ADVERTISEMENT AND NOTICE OF TAX SALE  32 V.S.A. § 5253

The Bristol Board of Adjustment will hold a hearing on October 28, 2013 at the Town Offices located at 1 South Street beginning at 7:30 P.M. to consider the appeal of zoning permit #13-­55, Erle LaBounty (Parcel #20-­ 51-­71), requesting a variance to side yard set backs to build a storage shed. The Bristol Board of Adjustment will also consider the appeal of zoning permit #13-­ 47, Meghanâ&#x20AC;&#x2122;s Meadow View LLC (Parcel #20-­51-­1), requesting a conditional use permit to build two multi-­family structures. Copies of the complete zoning applications are available for review at the Bristol Town Office during regular business hours. 9/23

The  resident  and  nonresident  owners,  lien  holders  and  mortgagees  of  lands  in  the  Town   RI3DQWRQLQWKH&RXQW\RI$GGLVRQDUHKHUHE\QRWL¿HGWKDWWKHWD[HVDVVHVVHGE\VXFK town  for  the  years  2008  through  2012  remain,  either  in  whole  or  in  part,  unpaid  on  the   IROORZLQJGHVFULEHGODQGVLQVXFKWRZQWRZLW 3DUFHO%HLQJDOODQGWKHVDPHODQGVDQGSUHPLVHVFRQYH\HGWR(OUR\($XQFKPDQ DQG/DXULH$$XQFKPDQE\4XLW&ODLP'HHGRI*HRUJH$3DODQWLRVGDWHG6HSWHPEHU DQGUHFRUGHGLQWKH9ROXPHDW3DJHRIWKH3DQWRQ/DQG5HFRUGV6DLG SURSHUW\EHOLHYHGWREHORFDWHGDW3DQWRQ5RDG3DQWRQ9HUPRQW $QGVRPXFKRIVXFKODQGVZLOOEHVROGDWSXEOLFDXFWLRQDWWKH7RZQ+DOOLQ3DQWRQD SXEOLFSODFHLQVXFKWRZQRQ2FWREHUDWR¶FORFNLQWKHPRUQLQJDVVKDOOEH UHTXLVLWHWRGLVFKDUJHVXFKWD[HVZLWKFRVWVDQGIHHVXQOHVVSUHYLRXVO\SDLG 'DWHGDW3DQWRQ9HUPRQWWKLVrd  GD\RI6HSWHPEHU %DUEDUD)OHPLQJ&ROOHFWRURI'HOLQTXHQW7RZQ7D[HV 9/5    

TOWN OF SALISBURY PUBLIC HEARING NOTICE CORRECTION, CONTINUATION MEETING

67$7(2)9(50217 683(5,25&2857&,9,/',9,6,21 $GGLVRQ8QLW 'RFNHW1R$QFY

The  Salisbury   Development   Review   Board  will  hold  a  continuation  hearing   LQ WKH 7RZQ 2IÂżFH  6FKRROKRXVH Road)   at   approximately   7:00   PM   on   :HGQHVGD\ 6HSWHPEHU   to   continue   with   the   consideration   RI DSSOLFDWLRQV      7KH DSSOLFDWLRQV DUH from   the   Keewaydin   Foundation   and   IURP 6RQJDGHHZLQ ZKLFK LV DIÂżOLDWHG ZLWK WKH .HHZD\GLQ )RXQGDWLRQ )RU DSSOLFDWLRQ  WKHUH LV D SURSHUW\ DQG SDUFHO LGHQWLÂżFDWLRQ number  to  change,  which  should  read:  IURP WKH .HHZD\GLQ )RXQGDWLRQIRUWKHUHPRYDORID square   foot   lodgeâ&#x20AC;&#x201D;which   includes   lavatory  facilitiesâ&#x20AC;&#x201D;and  to  replace  this   VWUXFWXUH ZLWK D  VTXDUH IRRW ORGJH ZLWK SRUFK  DQG  VTXDUH IRRW IRUW UHVWURRP IDFLOLW\   $OVR WR UHVWRUH DSSUR[LPDWHO\  VTXDUH feet  of  green  space  in  the  Lake  Shore   'LVWULFW SXUVXDQW WR 6HFWLRQ  RI WKH 6DOLVEXU\ 8QLÂżHG 'HYHORSPHQW 5HJXODWLRQV  7KH SURSHUW\ LV ORFDWHG DW.HHZD\GLQ5RDG SDUFHO,'   Participation   in   a   hearing   is   a   prerequisite   to   an   interested   personâ&#x20AC;&#x2122;s   right   to   take   any   subsequent   appeal   IURPWKH'5%ÂśVGHFLVLRQ6HH96$ 6HFWLRQ E DQG D  $SSOLFDWLRQ PDWHULDOV DUH DYDLODEOH IRULQVSHFWLRQLQWKH7RZQ2IÂżFHGXULQJ UHJXODUEXVLQHVV Submitted  by  Jeffrey  Leno,  DRB  Clerk 

72:12)67$5.6%252 38%/,&+($5,1*127,&( '(9(/230(175(9,(:%2$5'

The Starksboro Development Review Board will hold a public hearing on the following application(s) beginning at 7:45PM on October 10, 2013 at the Starksboro Town Office. 1. Application # 2013DRB-­03-­V is request for variance from section 2.3 â&#x20AC;&#x153;required setbacksâ&#x20AC;? by Eric Denice pursuant to section 4.9. The applicant proposes to construct a 2nd floor addition to his non-­conforming single-­family home that predates the adoption of Starksboro Zoning. Parcel #F4339W is located at 390 Russell Young Road in the Low Density Residential and Commercial district. This application will be the second (2nd) scheduled item of business on that night. Application #2013DRB-­03-­V is available for review at the Town Office. Interested persons are invited to attend the hearings, or send a representative. Pursuant to 24 VSA § 4464(a)(1)(C) and 4471(a), participation in this local proceeding is a prerequisite to the right to take any subsequent appeal. 9/23 David Wetmore, Administrative Officer

PHH Mortgage Corporation, Plaintiff v. Thomas C. Record, Susan J. Record and Occupants residing at 216 Delong Road, Cornwall, Vermont, Defendants 127,&(2)6$/( By virtue and in execution of the Power of Sale contained in a certain mortgage given by Thomas C. Record and Susan J. Record to PHH Mortgage Services dated July 31, 2003 and recorded in Volume 57, Page 226 of the Land Records of the Town of Cornwall, of which mortgage the undersigned is the present holder, for breach of the conditions of said mortgage and for the purposes of foreclosing the same will be sold at Public Auction at 11:00 A.M. on October 2, 2003, at 216 Delong Road, Cornwall, Vermont all and singular the premises described in said mortgage: To Wit: Being all the same lands and premises conveyed to Thomas C. Record and Susan J. Record by virtue of a Warranty Deed from Dennis A. Packard and Joanne B. Packard dated July 31, 2003 and recorded August 1, 2003 in Volume 57, Page 224 of the Land Records of the Town of Cornwall. Terms of Sale: $10,000.00 to be paid in cash or cashierâ&#x20AC;&#x2122;s check by purchaser at the time of sale, with the balance due at closing. The sale is subject to taxes due and owing to the Town of Cornwall. The mortgagor is entitled to redeem the premises at any time prior to the sale by paying the full amount due under the mortgage, including the costs and expenses of the sale. Other terms to be announced at the sale or inquire at Lobe, Fortin & Rees, 30 Kimball Avenue, Ste. 306, South Burlington, VT 05403, (802) 660-­9000. This sale may be cancelled at any time prior to the scheduled sale date without prior notice. DATED at South Burlington, Vermont this 5th day of September, 2013. PHH Mortgage Corporation Joshua B. Lobe, Esq., Lobe, Fortin & Rees, PLC 9/9, 16, 23 30 Kimball Ave., Ste. 306 South Burlington, VT 05403

67$7(2)9(50217 683(5,25&2857&,9,/',9,6,21 $GGLVRQ8QLW'RFNHW1R$QFY EVERBANK Plaintiff, v. MICHAEL MCGURL; REBECCA J. MCGURL; Defendants. 127,&(2)6$/( By virtue and in execution of the Power of Sale contained in a certain mortgage given by Michael McGurl and Rebecca J. McGurl to Mortgage Electronic Registration Systems, Inc., as nominee for Greenpark Mortgage Corporation, dba GPMC dated April 22, 2009 and recorded in Book 74 at Page 96 of the City/Town of New Haven Land Records, of which mortgage the undersigned is the present holder by Assignment of Mortgage recorded on May 14, 2012 in Book 78 at Page 664, for breach of the conditions of said mortgage and for the purpose of foreclosing the same will be sold at Public Auction at 10:00 a.m. on October 18, 2013 at 6 Dog Team Road, New Haven, VT 05472 all and singular the premises described in said mortgage, To Wit: Being all and the same lands and premises conveyed to Michael P. McGurl and Rebecca J. McGurl by Warranty Deed of John Meshna dated May 30, 2007 of record at Book 70, Page 658 of the Town of New Haven Land Records. A parcel of land containing 2.0 acres, more or less, situated on the westerly side of Town Highway No. 36, in the Town of New Haven, and being shown and depicted on a plan of land entitled â&#x20AC;&#x153;Helen Norris, Town of New Haven, Addison Countyâ&#x20AC;? prepared by Eugene A. Orvis, dated August 20, 1996, and of record in Map Volume 3, page 4 of the New Haven Land Records. Plaintiff may adjourn this Public Auction one or more times for a total time not exceeding 30 days, without further court order, and without publication or service of a new notice of sale, by announcement of the new sale date to those present at each adjournment. Terms of Sale: $10,000.00 to be paid in cash or by certified check by the purchaser at the time of sale, with the balance due at closing. Proof of financing for the balance of the purchase to be provided at the time of sale. The sale is subject to taxes due and owing to the Town of New Haven. The Mortgagor is entitled to redeem the premises at any time prior to the sale by paying the full amount due under the mortgage, including the costs and expenses of the sale. Other terms to be announced at the sale. EverBank, Richard J. Volpe, Esq., Shechtman, Halperin, Savage, LLP, 1080 Main Street, Pawtucket, RI 02860, 877-­575-­1400, Attorney for Plaintiff 9-­16, 23, 30


PAGE  34  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

Brandon  community  promoter  Bette  Moffett  dead  at  89 By  LEE  J.  KAHRS BRANDON   â&#x20AC;&#x201D;   A   light   has   gone   out  in  Brandon.   Community  lover,  friend  and  local   treasure   Bette   Moffett   died   at   home   on  Sept.  11  at  the  age  of  89.   Bette  inhabited  the  idea  of  commu-­ nity   spirit.   Her   love   of   Brandon   and   its   residents   was   boundless,   as   evidenced   by   her   tireless   efforts   to   support,   enhance   and   promote   the   place  she  called  home  since  1968.   A  Service  of  Celebration  to  honor   her   life   with   music   and   memories   was   scheduled   held   at   the   Brandon   Inn  on  Sunday,  Sept.  22  at  3  p.m.   Married   to   â&#x20AC;&#x153;Lifeâ&#x20AC;?   magazine   editor  and  Vermont  State  Rep.  Hugh   Moffett,   Bette   traveled   the   world   with   her   husband   and   family   before   settling   in   Brandon.   Hugh   Moffett   died  in  1985  at  the  age  of  74.   +HZDVÂżUVWDQHZVSDSHUUHSRUWHU then   a   writer,   national   affairs   editor   and   assistant   managing   editor   at   â&#x20AC;&#x153;Life.â&#x20AC;?   His   accomplishments   included   interviews   with   Dr.   Albert   Schweitzer   in   Africa   and   Soviet   leader  Nikita  Khrushchev. Bette   Lou   Little   was   born   in   Kingsley,   Iowa.   After   earning   her   degree   from   the   University   of   Iowa   she   moved   to   Chicago.   In   1951,   she   met   and   married   Moffett,   started   a   family   and   moved   to   Port   Washington,   N.Y.,   on   Long   Island.   She  had  two  sons,  Mark  and  Joe,  and   two  stepchildren,  Molly  and  Tom.   Hugh   Moffett   was   then   made   bureau  chief  for  international  affairs   for  â&#x20AC;&#x153;Life,â&#x20AC;?  and  the  family  moved  to   3DULV IRU ÂżYH \HDUV 7KH\ DOVR WUDY-­ eled  to  Africa,  India,  the  then-­Soviet   Union,   the   near   and   far   East,   and   throughout   Europe.   When   the   time   came  to  return  to  the  States,  longtime   friend   Dottie   Kline   said   the   couple   wrote   to   every   capital   in   the   United   States. â&#x20AC;&#x153;They   asked,   â&#x20AC;&#x153;What   does   your  

THEN  NESHOBE  SCHOOL  Principal  John  Dilts  with  Bette  in  2008  after  she  was  given  the  Vermont  State   Board  of  Educationâ&#x20AC;&#x2122;s  Martha  H.  Oâ&#x20AC;&#x2122;Connor  Award. File  photo  by  Lee  Kahrs

state  have  to  offer  us?â&#x20AC;&#x2122;  Kline  recalled.   â&#x20AC;&#x153;And   they   liked   what   they   heard   from  Vermont,  so  they  moved  here.â&#x20AC;? HANDS-­ON,  CAN-­DO Betteâ&#x20AC;&#x2122;s   no-­nonsense   pragma-­ tism   and   can-­do   attitude,   combined   with   her   love   of   Brandon,   led   to   the   creation   or   enhancement   of   a   host   of   civic   endeavors.   Her   love   of   education,   children   and   music   informed   her   choices.   The   list   of   Brandon   institutions   that   began,   in   part   or   wholly   in   Betteâ&#x20AC;&#x2122;s   brain,   are   numerous,   impressive   and   varied.   They   included   the   Brandon   Town   Band,   Nifty   Thrifty   Thrift   Shop,   Aim   (Academic   Incentive   Money),   Neshobe  Nurturers  and  the  Brandon   Debate. Many   of   her   projects   revolved   around   education.   In   2002,   for   instance,   Bette   and   Neshobe   Elementary   School   Counselor   Laurie   Cox   inaugurated   a   mentor-­ ing   program   called   NOVA   that  

67$7(2)9(50217 683(5,25&2857&,9,/',9,6,21 $GGLVRQ8QLW 'RFNHW1R$QFY SunTrust Mortgage, Inc., Plaintiff v. Daniel E. Campagna and Occupants residing at 310 Post Office Hill Road, Granville, VT Defendants 127,&(2)6$/( By virtue and in execution of the Power of Sale contained in a certain mortgage given by Daniel E. Campagna to Mortgage Electronic Registration Systems, Inc., as nominee for SunTrust Mortgage, Inc. dated October 7, 2005 and recorded in Volume 36, Page 97, which mortgage was assigned from Mortgage Electronic Registration Systems, Inc., as nominee for SunTrust Mortgage, Inc. to SunTrust Mortgage, Inc. by an instrument dated July 10, 2011 and recorded on July 25, 2011 in Volume 40, Page 13 of the Land Records of the Town of Granville, of which mortgage the undersigned is the present holder, for breach of the conditions of said mortgage and for the purposes of foreclosing the same will be sold at Public Auction at 9:00 A.M. on October 2, 2013, at 310 Post Office Hill Road, Granville, Vermont all and singular the premises described in said mortgage: To Wit: Being all and the same lands and premises conveyed to Daniel E. Campagna by virtue of a Decree of Distribution from The Estate of Lionel J. Campagna dated August 18, 2000 and recorded September 13, 2000 in Volume 32, Page 72 of the Land Records of the Town of Granville. Terms of Sale: $10,000.00 to be paid in cash or cashierâ&#x20AC;&#x2122;s check by purchaser at the time of sale, with the balance due at closing. The sale is subject to taxes due and owing to the Town of Granville. The mortgagor is entitled to redeem the premises at any time prior to the sale by paying the full amount due under the mortgage, including the costs and expenses of the sale. Other terms to be announced at the sale or inquire at Lobe, Fortin & Rees, 30 Kimball Avenue, Ste. 306, South Burlington, VT 05403, (802) 660-­9000. This sale may be cancelled at any time prior to the scheduled sale date without prior notice. DATED at South Burlington, Vermont this 5th day of September, 2013. SunTrust Mortgage, Inc., Joshua B. Lobe, Esq., Lobe, Fortin & Rees, PLC 9/9, 16, 23 30 Kimball Ave., Ste. 306 South Burlington, VT 05403

involved  Otter   Valley   Union   High   School   students   mentoring   Neshobe   Elementary   students   twice   a   week.   The   program   grew   to   16   pairs   and   Gov.   James   Douglas   honored   the   founders   with   a   state   award   for   mentoring  during  the  project. Other   projects   included   the   Neshobe   Pre-­School   Program;͞   the   Neshobe   Family   Network,   where   children   play   in   a   structured   envi-­ ronment   while   parents   attended   parenting   classes;͞   Everybody   Wins!   teaching/mentoring  program;͞  Rotary   Readers   Program;͞   Neshobe   School   and   RNeSU   district   spelling   bee;͞   Rotary  Club  Dictionary  Program;͞  the   Harvest  Program  for  different  learn-­ ers;͞  and  the  Books  On  Tape  Program   for  blind  students. In   May   2011,   Bette   wrote   a   ¿UVWSHUVRQ FRPSLODWLRQ RI KHU

pet  projects   in   Brandon   for   The   Reporterâ&#x20AC;&#x2122;s   Brandon   250th   anni-­ versary   special   section.   Bette   was   FRQVLGHUHGVXFKDFHQWUDOÂżJXUHWRWKH town  that  she  got  her  own  page.  Here   is   how   she   described   her   need   for   community  involvement  in  Brandon: â&#x20AC;&#x153;Years   ago,   I   applied   and   was   accepted  in  the  Peace  Corps  to  spend   two  years  in  Niger,  Africa,  so  I  could   work   with   womenâ&#x20AC;&#x2122;s   talents   and   use   my   French.   I   was   deemed   too   great   D PHGLFDO ULVN DWULDO ÂżEULOODWLRQ  VR my  dream  was  dashed.  I  decided  that   I   would   apply   my   energy   to   â&#x20AC;&#x2DC;Peace   &RUSV%UDQGRQÂśDQGÂżQGPRUHZD\V to  support  my  adopted  hometown  in   every   way   I   could.   Education   and   mentoring  rated  high  on  my  list  ...  If   my  â&#x20AC;&#x2DC;Iâ&#x20AC;&#x2122;sâ&#x20AC;&#x2122;  seem  too  close  together  itâ&#x20AC;&#x2122;s   because  I  have  cared  so  much  about   maintaining   vitality   for   Brandon  

STATE OF VERMONT SUPERIOR COURT CIVIL DIVISION Addison County Unit Docket No. 142-­6-­12 Ancv

 NATIONAL  BANK  OF  MIDDLEBURY,  Plaintiff           v.             TAUSHA  L.  STALCUP,  RICHARD  D.  STALCUP,   PORTFOLIO  RECOVERY  ASSOC.,  LLC,  Defendants.     NOTICE OF SALE By  virtue  and  in  execution  of  the  Power  of  Sale  contained  in  a  certain  Mortgage  given   by  Tausha  L.  Stalcup  and  Richard  D.  Stalcup  dated  May  23,  2007,  recorded  at  Book  114,   Page  411  of  the  Town  of  Monkton  Land  Records,  of  which  Mortgage  the  undersigned  is   the  present  holder,  for  breach  of  the  conditions  of  said  Mortgage  and  for  the  purpose  of   foreclosing  the  same  will  be  sold  at  public  auction  at  2  p.m.  on  the  25th  day  of  October,   2013  at  29  Hardscrabble  Road,  Monkton,  Vermont,  all  in  singular  the  premises  described   in  said  Mortgage: To  Wit: Being   all   and   the   same   lands   and   premises   conveyed   to  Tausha   L.   Stalcup   and   Richard  D.  Stalcup  by  Quit  Claim  Deed  of  Tausha  Stalcup  dated  May  23,  2007,  and   recorded  in  Book  114  at  Page  504  of  the  Monkton  Land  Records;  and  by  Warranty   Deed   of   Addison   County   Community   Trust,   Inc.   to   Richard   Stalcup   and   Tausha   Stalcup  dated  May  23,  2007  and  recorded  in  Book  114,  Page  510  of  the  Monkton   Land   Records.     Said   property   being   a   parcel   of   land   located   at   29   Hardscrabble   Road,  Monkton,  Vermont.     7HUPV RI 6DOH  3XUFKDVHU DW WKH VDOH VKDOO SD\ FDVK RU FHUWLÂżHG IXQGV RU SURGXFH D commitment   letter   from   a   bank   or   mortgage   company   or   other   lender   licensed   to   do   EXVLQHVVLQWKH6WDWHRI9HUPRQW,QDQ\FDVHDFDVKGHSRVLWFHUWLÂżHGFKHFN or  bank  check,  or  other  â&#x20AC;&#x153;good  fundsâ&#x20AC;?  at  sale  shall  be  required,  with  the  balance  due  at   closing.    The  sale  is  subject  to  taxes  due  and  owing  to  the  Town  of  Monkton. The  mortgagor  is  entitled  to  redeem  the  premises  at  any  time  prior  to  the  sale  by  paying   the  full  amount  due  under  the  Mortgage,  including  the  cost  and  expenses  of  sale.     Other   terms   to   be   announced   at   the   sale   or   make   inquiries   to   Ebenezer   Punderson,   Esq.,   Deppman   &   Foley,   P.C.,   P.O.   Drawer   569,   7   Washington   Street,   Middlebury,   VT   05753,  802  388-­7933. DATED  AT  Middlebury,  Vermont  this  18th  day  of  September,  2013. NATIONAL  BANK  OF  MIDDLEBURY By:  Ebenezer  Punderson,  Esq.  Deppman  &  Foley,  P.C. P.O.  Drawer  569,  7  Washington  St.,  Middlebury,  VT  05753 (802)  388-­7933;  (802)  388-­9200  (fax)

9/23,  9/30,  10/7

these  past  42  years.â&#x20AC;?   Bette   also   served   on   the   Brandon   Free  Public  Library  Board  for  many   years.  She  also  served  on  the  board  of   the   Brandon   Town   School   and   then   13  years  on  the  Neshobe  Elementary   School   before   stepping   down   in   2008.   That   same   year,   Bette   received   the   Vermont   Board   of   Educationâ&#x20AC;&#x2122;s   Martha   H.   Oâ&#x20AC;&#x2122;Connor   Award.   The   annual   award,   the   boardâ&#x20AC;&#x2122;s   high-­ est,   goes   to   a   private   citizen   for   their   extraordinary   contributions   to   Vermontâ&#x20AC;&#x2122;s   school   children   and   their  education.  The  board  describes   the   award   recipient   as   someone   who   â&#x20AC;&#x153;celebrates   the   achievements   of   others,   does   not   claim   credit   for   WKHPVHOYHVUHPDLQVUHVROXWHLQGLIÂż-­ cult   times,   demonstrates   leadership,   grace,   and   humor,   and   who   always   makes  children  a  priority.â&#x20AC;? Reached   at   home   after   the   award   was   announced,   Moffett   illustrated   her  trademark  modesty. â&#x20AC;&#x153;(Sen.)   Patrick   and   Marcel   Leahy   just   called   to   congratulate   me,â&#x20AC;?   she   said.   â&#x20AC;&#x153;Donâ&#x20AC;&#x2122;t   they   have   anything   better  to  do?â&#x20AC;? As   for   her   own   accomplishments   being   recognized,   Moffett   said   she   is   not   special,   and   stayed   involved   despite  not  having  a  teaching  degree. (See  Moffett,  next  page)

$'',621&2817<)$,5  ),(/''$<6 38%/,&+($5,1*127,&(

All residents of Addison County are hereby given notice of the annual meeting of Addison County Fair & Field Days, Inc., to be held at 7:30 p.m. on Monday, October 7, 2013 at the Weybridge Congregational Church, in Weybridge, Vermont. $*(1'$ I. Welcome and Introduction of Board Members II. Review of 2013 Fair III. Financial Report IV. Audience Comments and Questions V. Election of Board Members and Officers VI. Refreshments will be served Cara N. Mullin, Business Manager 9/9

72:12)5,3721 38%/,&+($5,1*127,&(

The Planning Commission will hold a public hearing in the Town Office on Tuesday, October 8, 2013 at 8:00 p.m., to conduct a site plan review of an application (#13-­3) from Middlebury College for approval of the construction of a bridge across a tributary of the Middlebury River on its Rikert Nordic Ski Center property on Steam Mill Road (tax map ID# 11-­01-­07). The application is available for inspection at the Town Office. Interested parties who wish to appeal or to be heard at the hearing may do so in person, or may be represented by an agent or an attorney. Communications relating to the application may be filed in writing with the Commission either before or during the hearing. N.B.: Participation in the hearing is necessary to establish status as an â&#x20AC;&#x2DC;interested personâ&#x20AC;&#x2122; and the right to appeal decisions rendered in that hearing, according to the provisions of 24 V.S.A. 117 §§4465(b) and 4471(a). Participation consists of offering, through oral or written testimony, evidence or a statement of concern directly related to the subject of the hearing. Respectfully submitted, 9/23 Warren B. King, Chair


Addison  Independent,  Monday,  September  23,  2013  â&#x20AC;&#x201D;  PAGE  35

Auctions

Moffett (Continued  from  previous  page) decades,   most   often   with   Kline,   but   â&#x20AC;&#x153;I  am  just  blown  away,â&#x20AC;?  she  said.   her  performing  days  ended  after  she   â&#x20AC;&#x153;So  many  people  have  done  so  much.   KDGKHUÂżUVWVWURNHURXJKO\\HDUV I   wonder   what   people   are   thinking,   ago.   She   recovered   and   kept   her   but   I   am   very,   very   humbled   by   it   busy   schedule,   albeit   a   bit   slower.   all   because   I   donâ&#x20AC;&#x2122;t   have   my   stripes   Then   last   year,   Bette   underwent   in   education.   I   just   cancer   surgery   and   have   a   great,   great   suffered   another   love   for   children.   I   â&#x20AC;&#x153;I decided that I stroke   that   kept   hope   their   curiosity   her   at   Helen   Porter   would apply my never  dies.â&#x20AC;? Rehabilitation   in   CENTER  STAGE energy to â&#x20AC;&#x2DC;Peace Middlebury   for   Bette   also   had   a   Corps Brandonâ&#x20AC;&#x2122; months.   She   came   Ă&#x20AC;DUH IRU WKH VSRW-­ home   to   her   apart-­ DQGĂ&#x20AC;QGPRUH light  and  performed   ment   next   to   the   in  the  Marble  Valley   ways to support my Brandon   Free   Players   and   Night   adopted hometown Public   Library   last   Fires,   sang   in   innu-­ in every way I fall,   but   had   rarely   merable   choral   been  seen,  attended   p e r f o r m a n c e s ,   could.â&#x20AC;? to   by   a   live-­in   hosted   a   radio   â&#x20AC;&#x201D; Bette Moffett caregiver. show   on   WFAD,   Kline   said   she   and   organized   local   passed   away   on   open  mike  readings. Sept.  11  around  noon. As  a  volunteer  extraordinaire,  she   â&#x20AC;&#x153;She   took   everything   in   stride,â&#x20AC;?   received   the   Vermont   Alliance   for   Kline   said.   â&#x20AC;&#x153;I   have   always   said   that   Art  Education  Award,  the  Governorâ&#x20AC;&#x2122;s   Bette   was   Brandonâ&#x20AC;&#x2122;s   greatest   asset.   Outstanding   Community   Service   There  will  never  be  another  Bette.â&#x20AC;? Award,  and  the  Vermont  State  Alpha   A  TRIBUTE  IN  FILM Lambda   State   Outstanding   Service   About   four   years   ago,   Brandon   Award. UHVLGHQWDQGÂżOPPDNHU-RQ$QGHUVRQ In  2011,  she  wrote  the  memoir  of   began  making  a  documentary  called   her   childhood   titled,   â&#x20AC;&#x153;Roots,   Shoots   â&#x20AC;&#x153;The  Philosophers.â&#x20AC;?  In  October  2009,   &  Wings.â&#x20AC;? $QGHUVRQ ÂżOPHG %HWWH LQ KHU DSDUW-­ But   it   was   her   love   of   music   and   ment  and  around  Brandon  as  part  of  a   singing   that   led   to   some   of   Betteâ&#x20AC;&#x2122;s   sequence  in  the  documentary.  It  will   most  enduring  friendships,  including   that  of  Dottie  Kline,  who  has  taught   piano  to  hundreds  of  students  in  the   Brandon   area   since   moving   here   in   1978. Bette  and  Dottie  both  lived  on  Park   Street   when   the   Klines   moved   to   Brandon  in  1978.  Kline  said  they  hit   it  off  immediately  once  Bette  learned   that   Dottie   taught   piano   and   Dottie   learned   that   Bette   was   a   singer.   The   two   embarked   on   what   would   become  a  20-­year  road  show  of  local   musical   performance,   playing   inns   and   bookstores   for   tour   groups   and   parties. â&#x20AC;&#x153;Yeah,  we  really  packed  them  in,â&#x20AC;?   Kline   said.   â&#x20AC;&#x153;Accompaniment   is   the   love  of  my  life,  and  Bette  loved  to  be   front  and  center,  so  it  was  perfect.â&#x20AC;? They   deposited   any   money   they   made  in  what  they  called  the  â&#x20AC;&#x153;Pillar   48 Mountain Terrace to   Postâ&#x20AC;?   account,   â&#x20AC;&#x153;because   thatâ&#x20AC;&#x2122;s   Bristol, VT 05443 0(    s FAX 802-453-5898 where  we  played,â&#x20AC;?  Kline  said.  â&#x20AC;&#x153;here   Visit our websites at: to  there.â&#x20AC;?   www.wallacere.com Whenever  they  had  a  few  hundred   www.greenbuiltvermont.com dollars  saved,  the  two  friends  would   take  a  trip  into  New  York  City. SINGING  THROUGH   HEARTBREAK Despite  her  always  upbeat,  can-­do   demeanor,   Bette   had   her   share   of   Kelly Claire Tom tragedy,  none  greater  than  the  death   Please  call  Kelly,  Claire,  or  Tom of  her  teenage  son,  Joe,  in  1969. Kline  said  it  was  not  long  after  the   family  moved  here  from  France  and   Joe  was  a  senior  at  Otter  Valley.  He   was   playing   in   a   pick-­up   baseball   game   after   school   one   day   and   was   hit   in   the   heart   by   a   line   drive.   He   never  recovered. Kline  said  she  was  told  a  celebra-­ tion  of  Joe  Moffettâ&#x20AC;&#x2122;s  life  was  held  at   OV  shortly  after  his  death. â&#x20AC;&#x153;There   was   music   and   singing,â&#x20AC;?   she  said,  â&#x20AC;&#x153;and  there  was  Bette,  sing-­ ing  the  loudest.â&#x20AC;? Bette   continued   singing   for  

be  shown  at  the  memorial  celebration   for  Bette  on  Sunday.   Although   only   3:29   minutes   long,   Anderson   captured   Bette   in   her   environment,   and   in   just   a   few   short   sentences,   her   soulful   beliefs   on  live,  love  and  community.  In  the   HQGKHUZRUGVRQÂżOPKDYHEHFRPH a  touching  farewell  note  from  one  of   Brandonâ&#x20AC;&#x2122;s  most  beloved  citizens: â&#x20AC;&#x153;I  am  very  high  on  life,  so  my  list   for  my  days  here  is  long.  I  may  not   accomplish   everything   on   my   list,   but   it   is   such   a   vibrant   goal   for   me   to   live   each   day   to   the   fullest.   The   most  severe  test  I  had  was  the  death   of  our  son,  but  somehow  it  felt  right   to  reach  out  to  people  in  equal  pain   or   greater   pain,   and   bring   that   pain   into  your  life,  diffusing  that  severity,   reaching   out,   being   present,   always,   always  communicating. â&#x20AC;&#x153;Could   there   be   other   islands   like   ours,   enjoyed   by   so   many?   We   have   created   an   honest-­to-­goodness   community   here.   Like   all   relation-­ ships,   it   requires   constant   tending.   That  is  our  daily  task. â&#x20AC;&#x153;I  believe  love  is  poetry  that  plays   a   stealth   role.   It   sneaks   up   on   you.   Love   can   be   a   letter,   a   phone   call.   Itâ&#x20AC;&#x2122;s   a   great-­grandchild   singing   â&#x20AC;&#x2DC;Puff   the  Magic  Dragon.â&#x20AC;&#x2122;  Itâ&#x20AC;&#x2122;s  a  tap  on  the   shoulder,  a  hug.  I  have  felt  unworthy   of   the   love   shown   me.   I   feel   very   loved,  and  I  am  grateful.â&#x20AC;?

ANNUAL FALL DAIRY/FEEDER CONSIGNMENT SALE

12  NOON  â&#x20AC;&#x201C;  WEDNESDAY,  OCTOBER  9TH AT  ACCS  BARNS  â&#x20AC;&#x201C;  RT.  125  EAST  MIDDLEBURY,  VT   ACCEPTING CONSIGNMENTS NOW!! CASH IN ON YOUR OVERSTOCK 150  HEAD  EXPECTED/TOP  HOLSTEIN  ARTIFICIALLY  SIRED   FRESH  &  SPRINGING  â&#x20AC;&#x201C;  SHORTBRED  â&#x20AC;&#x201C;  READY-­TO-­BREED OPEN  HEIFERS  &  CALVES BEEF  &  FEEDER  FOLLOW  DAIRY  SALE Call  for  more  information   ACCS,  T.G.WISNOWSKI    802-­989-­1507 VT.  TOLL  FREE  800-­339-­COWS SALE  MANAGERâ&#x20AC;&#x201C;  T.G.  WISNOWSKI AUCTIONEERâ&#x20AC;&#x201C;  JOHN  NOP ADDISON  COUNTY  COMMISSION  SALES   WWW.ACCSCATTLE.COM

September 23 Puzzle Solutions 1

Real Estate Now is a great time to buy!

WALLACE REALTY

ADDISON COUNTY COMMISSION SALES, INC.

E

12

S

16

S

19

A

24

Y

P P L E

3

S

4

40

P

44

T

33

P E

R

13

E

A R L

D

S 34

L

59

E

64

V

69

E

72

L

E

V E

E

A R

E

L

S

A D

L F

65

E N

A

R

L Y

T 25

S

P

R

O

P

42

46

O C R

54

T

E

R 66

E

55

S T

61

I

A R

A G O E

S

L

11

T

H

E

E

G

A

Y

E

N

D

A M 37

I

D

38

39

O W

A

L

O N

E

K

E

T

D

E

D 56

L

70

T

E

O

31

43

N

10

A C

26

W

49

D

L

23

36

D

48

E

Y

A D D

45

9

A G R

22

35

I

P

18

T

S E

15

30

T

I

8

X

29

73

T

I

41

53 60

F T

S

E

O O M I

E

E

52

L

L

21

P

O

51

W A

V 28

7

17

E 20

6

O W E

14

A R

47 50

5

T

S

A

All real estate advertising in this newspaper is subject to the Federal Fair Housing Act of 1968 as amended which makes it illegal to advertise â&#x20AC;&#x153;any preference, limitation or discrimination based on race, color, religion, sex, handicap, familial status, national origin, sexual orientation, or persons receiv-­ ing public assistance, or an intention to make any such preference, limitation or discrimination.â&#x20AC;? This newspaper will not knowingly accept any advertisement for real estate which is in violation of the law. Our readers are hereby informed that all dwellings advertised in this newspaper are available on an equal opportunity basis. To complain of discrimina-­ tion, call HUD Toll-­free at 1-­800-­424-­8590. For the Washington, DC area please call HUD at 426-­3500.

A

27 32

EQUAL HOUSING OPPORTUNITY

2

D

62

G

57

A R

68

58

A D

63

E

67

E

E

E

R

M S

G R

E

E

K

A D

D

S

71

74

N

8

9

5

3

6

7

1

4

2

7 3

1 4

2 6

5 2

9 8

4 1

6 5

3 7

8 9

9

6

1

7

3

5

2

8

4

4 2

5 8

7 3

9 4

2 1

8 6

3 9

1 5

6 7

1

7

4

6

5

9

8

2

3

6 5

3 2

8 9

1 8

4 7

2 3

7 4

9 6

5 1


PAGE  36  â&#x20AC;&#x201D;  Addison  Independent,  Monday,  September  23,  2013

SEPTEMBER   SAVINGS! Summer Clearance! Super Deals! Stock Up Now! Miracle  GroŽ

Potting  Mix

Potting  Mix

HDFKRU

Â&#x2021;*UDVV6HHG

2 for

18

$

25%OFF*

Premium

  (except  fall  mixture)

899

$

99

2 Â cu.ft.

Â&#x2021;/DZQ)HUWLOL]HUV

  (except  fall  &  winter  fertilizers)

2 Â cu.ft.

Â&#x2021;6SUHDGHUV

50%OFF*

Miracle  GroŽ

Flower  &   Vegetable  Soil

799

$

OUTDOOR Â POTTERY

Premium Garden  Soil

499

$

2 Â cu.ft.

FXIW

Sale Ends 9/30/13               *Offer  valid  on  in-­stock  items  only  â&#x20AC;&#x201C;  while  supplies  last.

FALL  IS  COMING! Mums & Asters

HALLOWEEN

FALL BULBS

Houseplants

Select Summer & Clearance

SAVINGS

40% TO 50%

OFF

Middlebury Agway Coupon

20 OFF %

NEW  FALL  &  WINTER

CLOTHING Â PURCHASE

Offer  valid  on  in-­stock  items  only  â&#x20AC;&#x201C;  while  supplies  last. Not  valid  w/any  other  offer  or  on  items  already  on  clearance.   ([SLUHV

MIDDLEBURY AGWAY ([FKDQJH6W0LGGOHEXU\Â&#x2021;388-­4937 0RQGD\)ULGD\6DWXUGD\Â&#x2021;6XQGD\

YOUR YARD, GARDEN AND PET PLACEâ&#x201E;˘

OPEN

7 DAYS

Sept 23 2013  
Read more
Read more
Similar to
Popular now
Just for you