Issuu on Google+

ADDISON COUNTY INDEPENDENT

B Section

THURSDAY,  JANUARY  16,  2014

KARL LINDHOLM

SPORTS

t4DIPPM/FXT t-FHBM/PUJDFT

Panther   women   unplug   Chargers

Does  Kansas connect  to  Boston  – through  Cameroon? Editor’s  note:  Independent  sports   FROXPQLVW .DUO /LQGKROP LV ÂżOLQJ his   reports   this   year   from   Yaounde,   Cameroon,  West  Africa.   Are   the   Boston   Celtics   trying   to   lose  games  on  purpose? Well,  not  exactly.   It’s  clear  the  Celtics’  effort  on  the   Ă€RRULQJDPHVLVDGPLUDEOHEXWWKH team   is   not   com-­ petitive   with   the   best  in  the  league.   That’s   OK.   Los-­ ing   is   good,   some   say.   The   Celt-­ ics   thus   position   themselves   for   the   upcoming   draft   of   amateur   players   (and   international   players)  in  late  June,  a  draft  consid-­ ered  especially  rich  in  the  depth  and   quality  of  talent  this  year.   Some   argue   that   University   of   Kansas  freshman  Andrew  Wiggins  is   the   best   young   prospect   since   LeB-­ ron   James.   Kentucky’s   Julius   Ran-­ dle   and   Jabari   Parker   of   Duke,   also   freshmen,   are   believed   to   be   future   NBA  stars.   Another   freshman   from   Kansas,   however,  may  be  the  best  prospect  of   all   —   and   he   is   playing   in   only   his   third  year  of  organized  basketball! Joel   Embiid   (em-­BEED)   is   the   7-­foot,   250-­pound   son   of   Thomas   and   Christina   Embiid,   the   brother   of   Arthur   and   Muriel,   of   Yaounde,   Cameroon,   this   capital   city   of   1.7   PLOOLRQ LQ ZKLFK , ÂżQG P\VHOI WKLV year.   (PELLGLVKDUGO\DUHÂżQHGWDOHQWDW this  point  —  and  it’s  not  inconceiv-­ able   that   he   will   remain   at   Kansas   to   further   improve   his   game.   When   asked  his  plans,  he  smiles  and  replies   that   he   will   be   at   Kansas   “all   four   years,â€?  but  few  believe  that.  His  po-­ tential  seems  unlimited.    He  could  go   as  high  as  one  or  two  this  spring. Embiid   played   only   a   little   pick-­ up   basketball   growing   up   in   Cam-­ eroon  —  he  “dabbled,â€?  as  he  put  it.   His   sports   were   volleyball,   playing   RQ D WHDP IRU ÂżYH \HDUV DQG VRF-­ cer,  where  he  was  a  forward.    “I  was   good  for  headers,â€?  he  said.  “My  dad   wanted  me  to  be  a  professional  vol-­ leyball  player.â€? His   parents   were   athletes,   his   fa-­ ther   a   professional   team   handball   player,   who   also   played   volleyball   and  soccer,  and  his  mother  a  compet-­ (See  Lindholm,  Page  3B)

ALSO IN THIS SECTION:

Middlebury  back   at  full  strength By  ANDY  KIRKALDY MIDDLEBURY   —   A   Middle-­ bury   College   women’s   basketball   WHDPZLWKDOLQHXSÂżQDOO\ORRNLQJ more  like  what  the  Panthers  hoped   for   surged   to   open   Tues-­ “In the day’s   second   second half   on   the   way   to   a   65-­ half Colby58   victory   Sawyer over   visiting   didn’t lose Colby-­Saw-­ the game, yer. we won it The   game   ... Nothing marked   only   the   second   came game   this   particularly season   that   easy to last   season’s   us, but leading   re-­ we stayed bounder,   se-­ nior   forward   focused and Katie   Pett,   we hung and   second-­ in there, l e a d i n g   and we scorer   and   rebounded r e b o u n d e r,   the ball, Scarlett   Kirk,   had  taken  the   and that Ă€RRU WRJHWK-­ cures a lot er.   of things.â€? Pett   went   — Panther down   with   a   coach shoulder   in-­ Noreen Pecsok jury   on   Dec.    DQG PLVVHG ÂżYH JDPHV EHIRUH returning   for   12   minutes   in   the   Panthers’  70-­44  loss  vs.  undefeat-­ ed   NESCAC   rival   Tufts   on   Sun-­ day.   She   played   17   minutes   and   contributed   nine   boards   and   eight   points  on  Tuesday. .LUN PLVVHG WKH ÂżUVW VHPHVWHU PANTHER  SENIOR  SARAH  Marcus  scored  a  team-­high  15  points  to  help  Middlebury  beat  Colby-­Sawyer   while   helping   the   Panther   wom-­ 65-­58  Tuesday  night. (See  Hoops,  Page  2B) Independent  photo/Trent  Campbell

t$MBTTJĂŤFET t3FBM&TUBUF

Sports BRIEFS Tiger  girls’  hockey   rallies  past  Stowe   for  big  D-­II  win STOWE   —   The   Middlebury   Union   High   School   girls’   hockey   team   rallied   for   a   key   Division   II   road  win  on  Monday,  3-­2  at  Stowe. The   Tigers   trailed   the   Raiders,   2-­1,  in  the  third,  but  goals  by  Timi   Carone   and   Molly   Wetmore   gave   the  Tigers  the  victory.   CareyAnne   Howlett   notched   the   other   score,   and   goalie   Baily   Ryan   made   six   saves   for   MUHS,   which   improved  to  8-­3.  The  Raiders,  fourth   place  in  D-­II,  fell  to  5-­6  despite  54   saves  by  goalie  Danielle  Mayo. The   Tigers   as   of   Wednesday   morning   were   in   second   place   in   the  league  according  to  the  Vermont   Principals’   Association   quality   points   standings,   just   behind   Burr   &  Burton  (9-­1-­1)  and  just  ahead  of   1RUWK¿HOG  7KH7LJHUVœHDU-­ ly-­season  D-­I  wins  are  helping  them   in  the  standings.  

MUHS  boys  nip   host  Slaters  in   overtime,  54-­53 FAIR  HAVEN  —  The  Middlebury   Union  High  School  boys’  basketball   team  edged  host  Fair  Haven  in  over-­ time  on  Monday,  54-­53.   The  Slaters’  Alex  Fontaine  forced   OT   with   a   three-­pointer   to   beat   the   fourth-­quarter  buzzer,  but  the  Tigers   came   out   on   top   of   a   seesaw   over-­ time. )RQWDLQH ¿QLVKHG ZLWK D JDPH high   21,   and   Cameron   Hughes   chipped   in   with   14   for   Fair   Haven,   which  dropped  to  3-­4  heading  into  a   Friday  home  game  with  Vergennes. Oakley   Gordon   (16)   and   Bobby   Ritter  (14)  sparked  the  Tiger  offense.   08+6 KDV QRZ ZRQ IRXU RI ¿YH games  after  an  0-­2  start  to  climb  over   .500  at  4-­3.  The  Tigers  face  an  unde-­ feated  Burr  &  Burton  team  at  home   on  Saturday  at  12:30  p.m.

ScoreBOARD HIGH SCHOOL SPORTS Hockey 1/13  MUHS  Girls  vs.  Stowe    ...................  3-­2 Boys’ Basketball 1/13  MUHS  vs.  Fair  Haven    .......  54-­53  (OT) Girls’ Basketball 1/13  OV  vs.  Windsor    ..........................  61-­42 COLLEGE SPORTS Men’s Basketball 1/12  Midd.  vs.  Tufts    ...........................  80-­66 1/14  Midd.  vs.  Lyndon    .......................  81-­69 Women’s Basketball 1/12  Tufts  vs.  Midd.    ...........................  70-­44 1/14  Midd.  vs.  Colby-­Sawyer  ..............  65-­58

Schedule

HIGH SCHOOL SPORTS Hockey 1/22  MUHS  Girls  at  Woodstock    ....5:30  p.m. 1/22  MUHS  Boys  at  Harwood    ...........  6  p.m. 1/24  Brattleboro  at  MUHS  Girls    ...  4:45  p.m. 1/24  Burlington  at  MUHS  Boys    .........  7  p.m. Boys’ Basketball 1/16  OV  at  Twin  Valley    .....................  7  p.m. 1/17  VUHS  at  Fair  Haven    .................  7  p.m. 1/18  Burr&Burton  at  MUHS    .......  12:30  p.m. 1/18  OV  at  Mill  River    ....................  2:30  p.m. 1/21  Mt.  Abe  at  VUHS    ......................  7  p.m. 1/21  MUHS  at  Milton    .........................7  p.m. 1/21  Green  Mt.  at  OV    .......................  7  p.m. 1/24  OV  at  Leland  &  Gray    ................  7  p.m. 1/24  Missisquoi  at  Mt.  Abe    ................  7  p.m. 1/24  VUHS  at  Milton    .........................  7  p.m. 1/24  MUHS  at  St.  Albans    .............  7:30  p.m. Girls’ Basketball 1/16  Mt.  Anthony  at  OV    ....................  7  p.m. 1/17  Missisquoi  at  VUHS    .............  5:30  p.m. 0W0DQVÂżHOGDW0W$EH  ...........  7  p.m. 1/18  MUHS  at  Colchester    ............  1:45  p.m. 1/18  OV  at  Fair  Haven    .................  2:30  p.m. 1/20  Harwood  at  VUHS    ....................  7  p.m. 1/20  Brattleboro  at  OV    ......................  7  p.m. 1/20  Mt.  Abe  at  S.  Burlington    ............  7  p.m. 1/22  Mt.  Abe  at  Missisquoi    ................  7  p.m. 1/22  Milton  at  MUHS    ........................  7  p.m.

(See  Schedule,  Page  3B)

PANTHER   JUNIOR   CHARLOTTE   Dewey   swings   into   a   shot   during   Tuesday’s  match  against  Amherst.  Dewey  won  and  helped  the  women   to  an  8-­1  victory.

Middlebury  squash   teams  win  in  new  digs PANTHER  FRESHMAN  WYATT  French  waits  for  the  ball  to  bounce  off  the  back  wall  during  the  Panthers’   match  against  Amherst  Tuesday.  The  Middlebury  men  won,  8-­1. Independent  photos/Trent  Campbell

MIDDLEBURY   —   The   Middle-­ bury   College   men’s   and   women’s   squash   teams   both   boosted   their   re-­ cords   on   Tuesday   with   victories   at   home. The   Middlebury   men’s   squash   team   improved   to   5-­3   on   the   year   with  an  8-­1  win  over  No.  22  Amherst  

LQWKH3DQWKHUVœ¿QDOKRPHPDWFKRI the  season.   The   19th-­ranked   Panthers   swept   matches   2-­9   with   six   of   the   wins   coming  in  three  games.  Andrew  Ca-­ dienhead,  Will  Moore,  Wyatt  French,   Harrison   Croll   and   Ben   Krant   were   (See  Squash  courts,  Page  4B)


PAGE  2B  —  Addison  Independent,  Thursday,  January  16,  2014

Panther track competes well +$129(5 1+ ² 2Q 6XQGD\ DWWKH'DUWPRXWK5HOD\V0LGGOHEXU\ &ROOHJH ZRPHQ¶V LQGRRU WUDFN DQG ¿HOG FDSWDLQ /DXUD 6WURP ZRQ WKH KLJKMXPSZLWKWKH1&$$'LYLVLRQ,,, WRSKHLJKWWKXVIDUWKLVZLQWHUWRKHOS OHDGKHUWHDPWRDVL[WKSODFH¿QLVK  SRLQWV RXWRIWHDPV 7KHPHQ¶VWHDPDOVRFRPSHWHGDQG SODFHG QLQWK VL[ SRLQWV  RXW RI  VTXDGV 'XULQJ WKH ZRPHQ¶V KLJK MXPS 6WURPFRPSHWHGDJDLQVWRWKHUSDU WLFLSDQWV LQFOXGLQJ PDQ\ IURP 'LYL VLRQ,VFKRROVDQGOHDSWWRDKHLJKWRI ¶´ 7KDW FOHDUDQFH WLHG KHU ZLWK 'DUWPRXWK¶V .DLWOLQ :KLWHKRUQ EXW 6WURP ZRQ WKH HYHQW EDVHG RQ IHZHU PLVVHVDWWKHSDUWLFXODUKHLJKWDQGJDU QHUHGKHUWHDPSRLQWV $GGLWLRQDOO\ 3DQWKHU VRSKRPRUH $OH[DQGUD 0RUULV WXUQHG LQ WKH QD WLRQ¶V WKLUGIDVWHVW WLPH WKXV IDU LQ WKH PHWHU GDVK LQ  VKH JRW VHFRQG DQG HDUQHG HLJKW WHDP SRLQWV 'XULQJ WKH [PHWHU UHOD\ WKH TXDUWHW RI 0DGLVRQ *RRGVWHLQ 6DUD 6REROHZVNL (PPD 0F*XLUN DQG 3DLJH)HUQDQGH]UDFHGWRWKHOLQHIRU DQHLJKWKSODFH¿QLVKWLPHRI 2WKHU QRWDEOH SHUIRUPDQFHV IRU WKHZRPHQFDPHLQWKHORQJMXPSE\ 'D\ 5RELQV QLQWK ¶´  DQG &KHOVHD0RQWHOORRI2UZHOO WK   DQG LQ WKH WULSOH MXPS ZKHUH 0F*XLUNZDVWKZLWKDKRSVNLSDQG MXPSRI¶´DQG+DQQDK%ODFNEXUQ DQG(ULQ5HDWLHGIRUWK   ,QWKHPHQ¶VSROHYDXOW-DVRQ0F &DOOXPUHFRUGHGDIRXUWKSODFHVKRZ LQJE\FOHDULQJWKHEDUDW,Q WKHWULSOHMXPS-DPHV/\QFKUHFRUGHG DGLVWDQFHRIJRRGIRUWK 2Q WKH WUDFN $OH[ 1LFKROV WRRN VL[WK LQ WKH PHWHU GDVK LQ  DQG-DNH:RRG&RQRU6LPRQV%UDQ GRQ &XVKPDQ DQG 1LFKROV WRRN VHY HQWKLQWKH[UHOD\ 7KH 3DQWKHUV FRPSHWH DW 890 WKLVZHHNHQG

Hoops (Continued  from  Page  1B) en’s   soccer   team   reach   the   NCAA   'LYLVLRQ ,,, ¿QDO IRXU 6LQFH KHU UHWXUQ WKH 3DQWKHUV QRZ  KDYH JRQH  LQFOXGLQJ D )ULGD\ 1(6 &$&ZLQRYHUYLVLWLQJ%DWHV 2Q7XHVGD\KHUUHERXQGVKHOSHG WKH 3DQWKHUV GRPLQDWH &ROE\6DZ \HURQWKHERDUGV &RDFK1RUHHQ3HFVRN²ZKRDOVR UHWXUQVWKUHHRWKHUNH\URWDWLRQSOD\ HUVVHQLRUJXDUGV6DUDK0DUFXVDQG /DXUD/RZU\DQGMXQLRUIRUZDUG5D FKHO &UHZV IURP ODVW \HDU¶V  1(6&$&SOD\RIIWHDP²LVH[FLWHG WRKDYHDOOKDQGVRQGHFN ³.DWLH SUDFWLFHG D ELW ODVW ZHHN DQGLWZDVWKH¿UVWWLPHVKHDQG6FDU OHWWKDGEHHQRQWKHÀRRUWRJHWKHULQ D \HDU´ 3HFVRN VDLG ³,W¶V JUHDW WR KDYHWKHPEDFN7KH\¶UHJUHDWNLGV DQGWKH\VKDUHWKHEDOO´ ,Q7XHVGD\¶V¿UVWKDOIWKHYLVLWLQJ &KDUJHUV VWDUWHG TXLFNO\ H[SORLWLQJ WKHLQWHULRURI0LGGOHEXU\¶VPDQWR PDQ GHIHQVH IRU IRXU KRRSV LQVLGH WKUHH IURP .HOVH\ &DKLOO ZKR ¿Q LVKHGZLWKDJDPHKLJKSRLQWV LQ DQ RSHQLQJ  UXQ WKDW SURPSWHG 3HFVRNWRFDOOWLPHDW 3HFVRNVSHQWWKHUHVWRIWKHJDPH UHJXODUO\ VZLWFKLQJ IURP PDQ WR ]RQH GHIHQVHV D WDFWLF VKH VDLG WKH 3DQWKHUV ZLOO XVH DOO VHDVRQ 7KH &KDUJHUV VWDUWHG JRLQJ DZD\ IURP WKHLU SURGXFWLYH LQVLGH DWWDFN DQG WULHG PRUH RIWHQ WR VKRRW RYHU WKH 3DQWKHUV D WDFWLF WKDW UHVXOWHG LQ D IRU SHUIRUPDQFH IURP WKUHH SRLQW UDQJH 7KH 3DQWKHUV DOVR GLG D EHWWHU MRE RQ &DKLOO HVSHFLDOO\ LQ WKHVHFRQGKDOILQIRUFLQJKHUIXUWKHU IURPWKHEDVNHW ³:H¶UH PL[LQJ WKLQJV XS GHIHQ VLYHO\:H¶UHWU\LQJWRFRQIXVHSHR SOHGHIHQVLYHO\´3HFVRNVDLG $IWHU WKH WLPHRXW 0LGGOHEXU\ ULSSHG RII D  VSXUW LQ ZKLFK /RZU\SLFNHGXSWKUHHRIKHUIRXUDV VLVWVDQGIUHVKPDQIRUZDUG(OL]DEHWK .QR[VFRUHGIRXURIKHUQLQHSRLQWV

PANTHER   FRESHMAN   ELIZABETH   Knox   puts   up   two   of   her   nine   points  against  Colby-­Sawyer  Tuesday  night.  Middlebury  won  the  game,   65-­58. Independent  photos/Trent  Campbell

VKHDGGHGHLJKWERDUGVRYHUDOO.LUN FDSSHGLWZLWKDSXWEDFNDW 7KH &KDUJHUV UHWRRN WKH OHDG DW  RQ WZR EXFNHWV RQ WKH EUHDN

Bristol,  VT  Homeowner   Recommends  Bristol  Electronics

D VWHDO FRQYHUVLRQ WKH\ VFRUHG  SRLQWVDIWHU3DQWKHUPLVFXHVDZHDN VSRWIRUWKHKRPHWHDP DQGDWKUHH SRLQWHU %XW&UHZVZKRVFRUHGRIKHU SRLQWVLQWKH¿UVWKDOIUHVSRQGHG ZLWKDOHIWKDQGPRYHLQWKHSDLQWWR VSDUND3DQWKHUVXUJHLQZKLFK VKH DOVR VDQN WZR IUHH WKURZV %XFNHWVE\0DUFXVDQG.QR[PDGH LW  3DQWKHUV EXW .DWLH 0F &DUWK\¶V ORQJUDQJH EX]]HUEHDWHU JDYH&ROE\6DZ\HUDOHDGDW WKHEUHDN 0DUFXV VSDUNHG WKH 3DQWKHU VXUJHWRRSHQWKHVHFRQGKDOIZLWK RIKHUWHDPKLJKSRLQWVLQWKH ¿UVW²DWKUHHDVWHDOFRQYHU VLRQDOD\XSRQWKHEUHDNVHWXSE\ /RZU\WZRIUHHWKURZVDQGDGULYH

PANTHER   SENIOR   SCARLETT   Kirk   reaches   for   a   rebound   against   Colby-­Sawyer  Tuesday  night  in  Pepin  Gymnasium.

WRWKHKRRS $IWHU WKH &KDUJHUV¶ $VKOH\ )UX] ]HWWL VDQN D WKUHH DW  WR PDNH LW  &UHZV DQG MXQLRU IRUZDUG $OH[LV &RROLGJH FRPELQHG IRU WKH QH[W  3DQWKHU SRLQWV DV WKH OHDG JUHZWRDW 7KH 3DQWKHUV NHSW DWWDFNLQJ WKH EDVNHW DQG FRQVHFXWLYH GULYHV E\ 0DUFXV 3HWW DQG /RZU\ DQG WKHQ DMXPSHUDQGDIUHHWKURZE\.QR[ SXVKHG WKH OHDG WR   ZLWK WRJR &ROE\6DZ\HUFDPHWRZLWKLQ¿YH LQWKH¿QDOPLQXWHEXW3HWWZHQWVL[ IRUVL[IURPWKHOLQHLQWKH¿QDO WRLFHWKHZLQ ³.DWLH 3HWW FDPH EDFN DQG JRW WR

“Recently,  we  had  a  small  solar  array  installed  on  our  garage  by  Bristol  Electronics.   They  were  very  helpful  through  all  the  phases  of  the  installation  process.  It  took   us  quite  some  time  to  decide  that  solar  energy  was  the  way  to  go.  They  were  very   patient  with  us  as  we  asked  lots  of  questions!  Bristol  Electronics  always  responded   promptly  and  with  all  the  information  we  needed.  Once  we  made  the  decision  to   go  solar,    they  made  the  process  really  easy  and  helped  us  choose  an  array  that   ¿WERWKRXUHOHFWULFDQG¿QDQFLDOQHHGVZLWKWKHRSWLRQWRH[SDQGLQWKHIXWXUH7KH physical  installation  didn’t  even  take  an  entire  day  and  we  immediately  had  online   access  to  actually  see  our  solar  production!  I  couldn’t  ask  for  an  easier  process.   802 . 453 . 2500 And  we  know  that  our  local  installer  is  available  any  time  we  have  further  questions!   BristolElectronicsVT.com Thank  you,  Bristol  Electronics!                                                                                     Michelle  Lass  –  Bristol,  VT       FREE  SITE  EVALUATIONS                        

MIDDLEBURY  COLLEGE  SENIOR  Kristina  Conroy  sets  up  a  play  dur-­ ing  Tuesday’s  game  against  Colby-­Sawyer.

SOD\ VRPH UHDO PLQXWHV ZKLFK ZDV DZHVRPH´3HFVRNVDLG³:HPLVVHG KHUWHUULEO\OHDUQHGDORWZLWKRXWKHU DQGJRWEHWWHU«6RKRSHIXOO\QRZ ZH¶OOEHEHWWHUZLWKKHU´ 7KH3DQWKHUVVKRWSHUFHQWIURP WKHÀRRULQWKHVHFRQGKDOIDIWHUFRQ QHFWLQJ DW D  SHUFHQW FOLS LQ WKH ¿UVWDQGKHOGWKH&KDUJHUVWRSHU FHQWLQWKHVHFRQGKDOIDIWHUWKHLU SHUFHQW¿UVWKDOISHUIRUPDQFH ³,WROGWKHWHDPLQWKHVHFRQGKDOI &ROE\6DZ\HUGLGQ¶WORVHWKHJDPH ZH ZRQ LW´ 3HFVRN VDLG ³1RWKLQJ FDPHSDUWLFXODUO\HDV\WRXVEXWZH VWD\HGIRFXVHGDQGZHKXQJLQWKHUH DQGZHUHERXQGHGWKHEDOODQGWKDW FXUHVDORWRIWKLQJV´ WEEKEND  GAMES ,Q WKH 3DQWKHUV¶  ORVV RQ 6XQGD\ YV  7XIWV WKH JDPH ZDV WLHG DW  ODWH LQ WKH ¿UVW KDOIZKHQ3HFVRNVDLGWKH3DQWKHUV FRPPLWWHG D KDOIGR]HQ XQIRUFHG WXUQRYHUV WKDW OHG WR D GHFLVLYH -XPERUXQWRFORVHWKHKDOI .QR[ OHG 0LGGOHEXU\ ZLWK  SRLQWV WR JR DORQJ ZLWK VHYHQ UH ERXQGV ZKLOH .LUN UHFRUGHG  SRLQWVDQGUHERXQGVDQG/RZU\ DGGHGSRLQWV ,Q WKH 3DQWKHUV¶  ZLQ RYHU %DWHV  WKH3DQWKHUVWRRN D  OHDG DV 0DUFXV NQRFNHG GRZQWKUHHHDUO\WKUHHSRLQWHUVDQG OHG DW WKH KDOI  7KH\ PDLQ WDLQHGDGRXEOHGLJLWOHDGDIWHUWKH EUHDN DQG RXWUHERXQGHG WKH %RE FDWV .LUN KDG  SRLQWV DQG  UH ERXQGV DQG .QR[ UHFRUGHG  ERDUGV DQG  SRLQWV 0DUFXV ¿Q LVKHGZLWKSRLQWVDQG&RROLGJH DGGHGSRLQWVDQGHLJKWUHERXQGV (YHQ LQ WKH 7XIWV VHWEDFN WKH 3DQWKHUV KHOG D  HGJH RQ WKH ERDUGVZKLFK3HFVRNVDLGLVDNH\ SDUW RI WKH JDPH SODQ WR PDNH XS IRUZKDWVKHGHVFULEHGDVWKH3DQ WKHUV¶ ³OLPLWDWLRQV´ ² WKH\ KDYH QRW VKRW H[FHSWLRQDOO\ ZHOO  IURPWKHÀRRUWKXVIDUDQGWKH\DUH QRWWKHWDOOHVWWHDPLQWKHOHDJXH 5HERXQGLQJKDUGZRUNLQFKDQJ LQJGHIHQVLYHORRNVDQGFRQWLQXHG ZRUNWRLPSURYHWKHLURIIHQVLYHHI ¿FLHQF\ZLOOEHFULWLFDOLIWKH3DQ WKHUV DUH WR FRPSHWH ZLWK WKH EHVW WHDPVLQ1(6&$&3HFVRNVDLG ³:H¶UH WU\LQJ WR PDNH SHRSOH ZRUN GHIHQVLYHO\ « PDNH SHRSOH ZRUN RIIHQVLYHO\ DQG UHERXQG WKH EDOO´VKHVDLG

Men’s  hoop  wins  two  of  three 0,''/(%85< ² 7KH 0LGGOH EXU\&ROOHJHPHQ¶VEDVNHWEDOOWHDP ZRQ WZR RI WKUHH UHFHQW JDPHV WR LPSURYHWRVSOLWWLQJLWV¿UVWWZR 1(6&$& JDPHV DW KRPH WKLV SDVW ZHHNHQG EHIRUH FODLPLQJ D QRQ OHDJXHFRQWHVWRQ7XHVGD\ 2Q6XQGD\0LGGOHEXU\KHOG7XIWV   1(6&$&  ZLWKRXW D ¿HOG JRDOIRUWKHJDPH¶V¿QDOLQDQ ZLQ 7XIWV WRRN D  OHDG LQWR WKH EUHDN DIWHU D EDFNDQGIRUWK ¿UVW KDOI DQG WRRN D  OHDG ZLWK WRJRDIWHUDUXQ%XWWKH -XPERVSXWWKH3DQWKHUVLQWRWKHER QXV VLWXDWLRQ ZLWK  UHPDLQLQJ

LQWKHKDOIDQG0LGGOHEXU\FDSLWDO L]HGE\FRQQHFWLQJRQRIIUHH WKURZVWKHUHVWRIWKHZD\ %HQ)HUULVFRQYHUWHGDWKUHHSRLQW SOD\ ZLWK  UHPDLQLQJ HDUQLQJ 7XIWVLWV¿QDO¿HOGJRDORIWKHJDPH DQGSXWWLQJWKHPXS7KH3DQ WKHUGHIHQVHWKHQIRUFHGWKH-XPERV WRPLVVWKHLU¿QDOVKRWVDWWHPSWHG IURPWKHÀRRU $  UXQ IROORZLQJ WKH )HUULV EXFNHWJDYH0LGGOHEXU\DOHDG ZLWK  OHIW WR SOD\ 7KH -XPERV FDPH ZLWKLQ WKUHH RQ D SDLU RI IUHH WKURZVIURP)HUULVZLWKUHPDLQ LQJEXWWKH3DQWKHUVFORVHGWKHJDPH RQDQUXQ$ELJWKUHHIURP0DWW

'DOH\GRZQWKHVWUHWFKJDYH0LGGOH EXU\VRPHEUHDWKLQJURRP -RH\ .L]HO OHG ¿YH 3DQWKHUV LQ GRXEOH ¿JXUHV ZLWK  SRLQWV DQG D JDPHKLJKVL[DVVLVWV'DOH\+XQWHU 0HUU\PDQ DQG '\ODQ 6LQQLFNVRQ HDFK VFRUHG  SRLQWV DQG 0DWW 6W $PRXU DGGHG  -DFN 5REHUWV UH FRUGHG VHYHQ UHERXQGV DQG WKUHH EORFNV IRU WKH 3DQWKHUV ZKLOH -DNH %URZQGLVKHGRXW¿YHDVVLVWV 2Q )ULGD\ WKH 3DQWKHUV OHG IRU QHDUO\WKHLUHQWLUH1(6&$&RSHQHU DJDLQVW YLVLWLQJ %DWHV EXW D ODWH WKUHHSRLQWHU IURP ZHOO EHKLQG WKH DUF E\ *UDKDP 6DIIRUG OLIWHG WKH (See  Panthers,  Page  4B)


Addison  Independent,  Thursday,  January  16,  2014  â&#x20AC;&#x201D;  PAGE  3B

Indoor  track athletes  earn   WRS¿QLVKHV

Hunting  success THREE  GENERATIONS  OF  the  Stearns  family  of  Ferrisburgh  display  the  results  of  this  past  deer  hunting  season,  which  they  said  shows   KXQWLQJLQ9HUPRQWLVPDNLQJDFRPHEDFN6KRZQIURPOHIWLQDVKRWWDNHQGXULQJULĂ&#x20AC;HVHDVRQDUH5D\6WHDUQVDQGKLVZLIH/LQGD6WHDUQVKLV WKUHHVRQV5DQG\6FRWWDQG'DQQ\6WHDUQVDQGJUDQGVRQ=DFKDU\6WHDUQV 5DQG\DFWXDOO\OLYHVLQ$GGLVRQ =DFKDU\GRZQHGWKHKHDYLHVW EXFNDWSRXQGVDQG6FRWWÂśVSRLQWHUKDGWKHELJJHVWUDFN/LQGDQRWHGWKDWJUDQGGDXJKWHU1LFROH6WHDUQVRI$GGLVRQ QRWSLFWXUHGKHUH  bagged  a  doe  during  Youth  Hunting  Weekend.  Combined,  the  family  boasts  more  than  180  years  of  hunting  experience.

Otter  Valley  girls  prevail  at  Windsor

Lindholm (Continued  from  Page  1B) itive  volleyball  player.  In  November,   Thomas,   a   colonel   in   the   Cameroo-­ nian  army,  came  to  America  and  saw   his  son  play  in  a  basketball  game  for   WKHÂżUVWWLPH Embiidâ&#x20AC;&#x2122;s   story   exhibits   the   inter-­ national   reach   of   hoop.   In   the   sum-­ mer  of  2011,  Joel  attended  a  basket-­ ball   camp   in  Yaounde   organized   by   Richard   Mbah   a   Moute   (BAH-­a-­ MOU-­tay).  Mbah  a  Moute,  also  from   Yaounde,  was  a  star  at  UCLA  and  is   now   in   his   sixth   year   in   the   NBA,   playing   this   year   for   the   Minnesota   Timberwolves. At  Mbah  a  Mouteâ&#x20AC;&#x2122;s  camp,  Embiid   ZDV VHOHFWHG DV RQH RI WKH WRS ÂżYH players,   a   distinction   which   earned   him   a   trip   to   South   Africa   and   an-­ other  camp  organized  by  Basketball   Beyond  Borders.   His   play   there   led   to   the   decision   to   come   to   America   that   fall   to   at-­ tend  Montverde  Academy  in  Florida,   Mbah  a  Mouteâ&#x20AC;&#x2122;s  training  ground,  to   pursue   the   game   seriously   and   at-­ tend  school.  He  transferred  last  year   to   The   Rock   School,   a   secondary   school  in  Gainesville,  Fla.,  a  basket-­ ball  powerhouse. +HZDVVRFOXPV\LQKLVÂżUVWIRU-­ ays   on   the   court   that   his   teammates   at   Montverde   laughed   at   him.   His   coach,   Kevin   Boyle,   stopped   prac-­ tice   and   gathered   the   team   together   and   dispatched   Joel   to   get   water.   Boyle  told  the  team,  â&#x20AC;&#x153;Laugh  all  you   ZDQW%XWLQÂżYH\HDUV\RXZLOOEH asking   him   for   a   loan.  You   have   no   idea  how  good  he  is  going  to  be.â&#x20AC;?     When   Coach   Bill   Self   of   Kansas   came  The  Rock  School  on  a  recruit-­ ing  visit,  he  overlooked  Joelâ&#x20AC;&#x2122;s  inex-­ perience.  When  asked  his  opinion  of   his  potential,  Self  said,  â&#x20AC;&#x153;Are  you  kid-­ ding?  He  could  be  the  No.  1  pick  in   the  draft.    He  can  run.  Heâ&#x20AC;&#x2122;s  got  touch.   Heâ&#x20AC;&#x2122;s  unbelievable.  Heâ&#x20AC;&#x2122;ll  be  the  best   big  man  weâ&#x20AC;&#x2122;ve  ever  coached.â&#x20AC;?   1RZ KDOIZD\ WKURXJK KLV ÂżUVW year   at   Kansas,   Joel   is   developing   fast   at   the   highest   level   of   college   basketball,   playing   22   minutes   a   game,  averaging  11  points,  with  over   seven   rebounds   and   two   or   three   blocked  shots  a  game. As   sportswriter   Jason   King   ob-­ served,   â&#x20AC;&#x153;He   has   the   wingspan   of   a   pterodactyl   and   the   footwork   of   a   ballet  dancer.â&#x20AC;?  That  wingspan  is  7â&#x20AC;&#x2122;5â&#x20AC;?   with  his  arms  outstretched  wide,  and   IURP WKH WRS RI KLV ÂżQJHUWLSV XS-­ VWUHWFKHG WR WKH Ă&#x20AC;RRU KH PHDVXUHV 9â&#x20AC;&#x2122;6â&#x20AC;?.   King  wrote  in  a  recent  piece  in  the   on-­line  magazine  â&#x20AC;&#x153;Bleacher  Reportâ&#x20AC;?   that   Embiid   is   exhibiting   the   â&#x20AC;&#x153;foot-­ work  and  distance  runnerâ&#x20AC;&#x2122;s  stride  he   GHYHORSHG RQ WKH VRFFHU ÂżHOG WKH aggression   he   used   spiking   volley-­ EDOOVWKHGLVFLSOLQHDQGVHOĂ&#x20AC;HVVQHVV instilled  by  his  parents.â&#x20AC;? Coach   Self   calls   Embiid   a   â&#x20AC;&#x153;sponge,â&#x20AC;?   saying   â&#x20AC;&#x153;he   has   a   natural   feel,  natural  instincts.  Of  all  the  guys   on  our  team,  heâ&#x20AC;&#x2122;s  the  most  instinctive   basketball   guy   we   have.   We   never   have  to  tell  him  something  twice.â&#x20AC;? Like   so   many   in   Yaounde,   Em-­ biid   speaks   French,   English   and   his   native   Cameroonian   language.   His   basketball   hero   is   Hakeem   Olaju-­ won,  from  neighboring  Nigeria,  per-­ haps  the  most  nimble  big  man  in  the   history   of   the   sport.   Olajuwon   also   picked   up   the   game   late   in   his   ado-­ lescence  (15).  Embiid  watches  tapes   of   Olajuwon   religiously,   then   goes   out   and   duplicates   his   distinctive   post  moves. So,   stay   tuned.   Remember   the   name  â&#x20AC;&#x153;Joel  Embiid.â&#x20AC;?  Wouldnâ&#x20AC;&#x2122;t  it  be   fun  to  see  this  young  man  from  Cam-­ eroon  wearing  the  Celtic  green,  fol-­

lowing   in   the   footsteps   of   powerful   post   players   from   the   past,   Russell,   Cowens,  Parish,  and  Garnett.   Note   to   Jeff   Brown,   Middlebury   College  menâ&#x20AC;&#x2122;s  coach:  Trust  me,  Iâ&#x20AC;&#x2122;m   keeping  my  eye  out  here  in  Yaounde   for  a  7-­footer  for  you  too.  

WINDSOR   â&#x20AC;&#x201D;   The   Otter   Valley   Union   High   School   girlsâ&#x20AC;&#x2122;   basketball   team  used  balanced  scoring  to  win  at   Windsor  on  Monday  night,  61-­42.   Olivia  Bloomer  and  Brittany  Bush-­ ey   led   a   balanced   OV   attack   with   12   and  10  points,  respectively,  as  the  Ot-­ ters  improved  to  3-­4  with  the  win  over   the  5-­3  Jacks.  The  victory  was  the  third  

in  four  outings  for  the  Otters  after  an   0-­3  start  to  their  season.   Two   tough   matchups   loom   this   week:   Division   I   Mount   Anthony   is   scheduled  to  visit  Brandon  on  Thurs-­ day   at   7   p.m.,   and   OV   will   travel   to   face  D-­II  title  contender  Fair  Haven  on   Saturday  at  2:30  p.m.  The  Otters  also   host  Brattleboro  on  Monday  at  7  p.m.

BURLINGTON  â&#x20AC;&#x201D;  Five  Vergennes   Union   High   School   indoor   track   and   ÂżHOG DWKOHWHV VFRUHG SRLQWV DW D 6DW-­ urday   meet   hosted   by   the   University   of   Vermont   at   which   Division   I   and   II  athletes  competed  and  were  scored   together.   The   Commodore   boys   and   girls   HDFK ÂżQLVKHG WK RYHUDOO DPRQJ FURZGHG ÂżHOGV RI WHDPV ZLWK ', powers   South   Burlington   and   Essex   winning  the  boysâ&#x20AC;&#x2122;  and  girlsâ&#x20AC;&#x2122;  competi-­ tions,  respectively. Chris   Castillo   enjoyed   the   most   productive  day,  placing  in  two  events,   while   Alix   Kauffman,   Ally   Stearns,   Paige  Stolen  and  Matteo  Palmer  each   HDUQHGRQHWRSVL[ÂżQLVK Two  Mount  Abraham  runners,  Nata-­ lie  May  and  Chris  Carter,  just  missed   point-­scoring  results. The   complete   local   boysâ&#x20AC;&#x2122;   results   were: Â&#x2021; PHWHUV6HEE\&URZHOO9 7.34;Íž   17.   Castillo,   V,   7.44;Íž   23.   Chris   Leach,  V,  7.64. Â&#x2021;   &DVWLOOR 9   Crowell,   V,   41.24;Íž   17.   Carter,   M,   42.64;Íž  22.  Leach,  V,  44.44. Â&#x2021; &DUWHU0 Â&#x2021; 3DOPHU9 Â&#x2021; /RQJMXPS&DVWLOOR9 Â&#x2021; 7ULSOHMXPS&DVWLOOR9 Complete  local  girlsâ&#x20AC;&#x2122;  results  were: Â&#x2021;   .DXIIPDQ 9   Alyse  Beauchemin,  V,  9.44. Â&#x2021;   .DXIIPDQ 9   Stolen,  V,   51.64;Íž   37.   Beauchemin,  V,   56.44. Â&#x2021; 6WROHQ9 Â&#x2021; 0D\0 Â&#x2021; 6KRWSXW6WHDUQV9

Schedule (Continued  from  Page  1B) 0W0DQVÂżHOGDW08+6  .............  7  p.m. 98+6DW6%XUOLQJWRQ  ..............  6  p.m. 29DW+DUWIRUG  ..........................  7  p.m. 08+6DW98+6  ...................  5:30  p.m. Wrestling 1/17&18    ........... 2998+60W$EHDW(VVH[ 98+6DW08+6  ...................  6:30  p.m. %XUU %XUWRQDW29  ..................  6  p.m. 0W$QWKRQ\DW08+6  ..........  6:30  p.m. 2998+60W$EHDW&ROFK  ......  9  a.m. Indoor Track 98+6DW1RUZLFK  ......................  9  a.m. 98+6DW1RUZLFK  ......................  9  a.m. Nordic 29DW08+6  ......................  10:30  a.m. 29DW%XUU %XUWRQ  ...............  2:30  p.m. 08+6DW6%XUOLQJWRQ  ...........  10  a.m. Dance 7RXUQDPHQWDW08+6  ...............  7  p.m. Gymnastics 8DW08+6  ..........................  1  p.m. 0LOWRQDW08+6  ........................  6  p.m. COLLEGE SPORTS Menâ&#x20AC;&#x2122;s Basketball 0LGGDW:HVOH\DQ  .....................  8  p.m. 0LGGDW&RQQ  ..........................  4  p.m. 0LGGDW-RKQVRQ6WDWH  .............  7  p.m. 6W-RVHSKÂśVDW0LGG  ................  7  p.m. Womenâ&#x20AC;&#x2122;s Basketball 0LGGDW:HVOH\DQ  .....................  6  p.m. 0LGGDW&RQQ  ..........................  2  p.m. 0LGGDW1RUZLFK  .......................  7  p.m. Womenâ&#x20AC;&#x2122;s Hockey 0LGGDW$PKHUVW  .......................  7  p.m. 0LGGDW$PKHUVW  .......................  3  p.m. %RZGRLQDW0LGG  .......................7  p.m. %RZGRLQDW0LGG  ......................  3  p.m. Menâ&#x20AC;&#x2122;s Hockey 3ODWWVEXUJKDW0LGG  ..................  7  p.m. 0LGGDW1RUZLFK  .......................  7  p.m. 0LGGDW%RZGRLQ  ......................  7  p.m. 0LGGDW&ROE\  ...........................  3  p.m. Spectators   are   advised   to   consult   school   websites  for  the  latest  schedule  updates.  

Adult Education Classes Call to Register TODAY - 382-1012

HEALTH CAREERS ACADEMY Medical Billing Tue  &  Thu;  6-­9:45P;  Mar  4-­Jun  19;  120  Hrs;  $1,200   Learn  the  basics  of  the  United  States  Health  Care  Delivery  System  and   how  medical  insurance  is  utilized  to  reimburse  health  care  institutions   IURPSK\VLFLDQRI¿FHVWRPHGLFDOFOLQLFV,QIRUPDWLRQDOPHHWLQJ-DQ DW3RUJRWRKWWSSURJUDPVPNHGXRUJSDKFFPHGELOOIRUPRUH LQIRUPDWLRQ Medical Coding September 2014  KRXUV  3UHUHTXLVLWH 0HGLFDO %LOOLQJ RU DSSURYDO RI WKH LQVWUXFWRU 0HGLFDO FRGLQJ VSHFLDOLVWV DQDO\]H PHGLFDO UHFRUG GRFXPHQWDWLRQ WRDVVLJQGLDJQRVWLFDQGSURFHGXUHFRGHV7KH\SURYLGHLPSRUWDQW LQIRUPDWLRQWRKHOSGRFWRURI¿FHVFOLQLFVDQGRWKHUPHGLFDOIDFLOLWLHV GXULQJWKHUHLPEXUVHPHQWSURFHVVIRUDQ\PHGLFDOVHUYLFHVUHQGHUHG Licensed Nurse Assistant Program (LNA) This   course   will   prepare   the   student   to   apply   for   Licensed   Nurse   $VVLVWDQW /1$ OLFHQVXUHZLWKWKH6WDWH%RDUGRI1XUVLQJ7KHSURJUDP LVWDUJHWHGWRLQGLYLGXDOVZKRDUHLQWHUHVWHGLQDQHQWU\OHYHOSRVLWLRQ LQKHDOWKFDUHDQGLPPHGLDWHHPSOR\PHQW2I¿FLDOVLJQHGYHUL¿FDWLRQ RI LPPXQL]DWLRQVWLWHUV LV PDQGDWRU\ DQG PXVW EH SUHVHQWHG WR WKH LQVWUXFWRU $OO VWXGHQWV PXVW FRPSOHWH D SHUVRQDO LQWHUYLHZ DQG VFUHHQLQJH[DP7HVWLQJOLFHQVXUH XQLIRUPVDUHQRWLQFOXGHGLQWKH FRVW&ODVVEHJLQV0DUFKDQGHQGV0D\&DOO IRUVFKHGXOH

SKILLED BUTCHERS & MEAT CUTTERS ACADEMY $UH \RX LQWHUHVWHG LQ D FDUHHU DV D VNLOOHG EXWFKHU RU PHDW FXWWHU" 6WDUWKHUH&DOO  WR¿QGRXWZKHQWKHQH[WFODVVVHULHV EHJLQV&ODVVWXLWLRQGRHVQRWLQFOXGHWH[WDQGPDWHULDOV Offered  at  Green  Mountain  Career  &  Technical  Center: Food Safety & Sanitation -­ MPFS 1123 (HACCP) 0DU $SU3+UV Poultry Processing -­ MPFS 1214 3UHUHTXLVLWHV03)6RUHTXLYDOHQWRUFRQFXUUHQW HQUROOPHQWLQ03)65HTXLUHGIRU&HUWL¿FDWH $SULO 3 Offered  at  Vermont  Technical  Center: Food Safety & Sanitation -­ MPFS 1123 (HACCP) -XQ 3 Poultry Processing -­ MPFS 1214 3UHUHTXLVLWHV03)6RUHTXLYDOHQWRUFRQFXUUHQW HQUROOPHQWLQ03)65HTXLUHGIRU&HUWL¿FDWH -XQH 3 26+$ -XQH-XO\ 2QOLQH Meat Processing & Fabrication -­ MPFS 2122 (Wholesale Cuts)   3UHUHTXLVLWHV 03)6  03)6   03)6  5HTXLUHG IRU &HUWL¿FDWH -XQH      3 /RFDWLRQ LV7KH 5R\DO %XWFKHU Meat Processing & Merchandising -­ MPFS 2120 (Retail Cuts) 3UHUHTXLVLWH±03)6DQG03)65HTXLUHGIRU&HUWL¿FDWH -XO\ 3ORFDWLRQLV7KH5R\DO%XWFKHU Meat Industry Apprenticeship -­ MPFS 2204 3UHUHTXLVLWHV 03)6  03)6  03)6  DQG 03)6  This   course   is   a   2000   hour   paid   VT   Department   of   Labor   DSSUHQWLFHVKLS7KH VWXGHQW ZLOO EH SODFHG IXOOWLPH IRU RQH \HDU RU KDOIWLPHIRUWZR\HDUVZLWKRQHRIVHYHUDOLQGXVWU\SDUWQHUV Advanced Livestock Processing/Safety Analysis -­ MPFS 2264   3UHUHTXLVLWHV 03)6  03)6  03)6  DQG 03)6  &RQFXUUHQW HQUROOPHQW LQ 03)6  UHTXLUHG 5HTXLUHG IRU &HUWL¿FDWHLQGLYLGXDOL]HGVFKHGXOH-XO\ OSHA 10 5HTXLUHGIRU&HUWL¿FDWH6WXGHQWVPD\ WDNHWKHFRXUVHLQGHSHQGHQWO\ RQOLQHRUDUUDQJHIRUDVVLVWDQFH WKURXJK3$+&&

TRANSPORTATION ACADEMY OSHA & Highway Safety Awareness 7XH 7KX30DU '$QWRQH 12  Hrs;  $105 7KLV FODVV ZLOO FRYHU DW DQ DZDUHQHVV OHYHO 2FFXSDWLRQ 6DIHW\  +HDOWK $GPLQLVWUDWLRQ 26+$  VWDQGDUGV IRU FRQVWUXFWLRQ DQG KHDY\ HTXLSPHQW RSHUDWLRQV DQG UHOD\ )HGHUDO +LJKZD\ $GPLQLVWUDWLRQ )+:$ KLJKZD\ZRUN]RQHVDIHW\VWDQGDUGV3DUWLFLSDQWVZLOOOHDYH ZLWKDJHQHUDOVDIHW\NQRZOHGJHEDVHWKDWFDQEHXWLOL]HGIRUIXUWKHURQ WKHMREWUDLQLQJE\HPSOR\HUV7KLVLVDSUHUHTXLVLWHFRXUVHIRU+HDY\ (TXLSPHQW2SHUDWLRQDQG6DIHW\ Heavy Equipment Operation and Safety 3$XJ$7RZQVKHQGKUV /HDUQ WKH IXQGDPHQWDOV RI RSHUDWLQJ DQG PDLQWDLQLQJ EDFNKRHV EXOOGR]HUVH[FDYDWRUVDQGWUDFWRUVZKLOHSUDFWLFLQJVNLOOVVXFKDVWLOH GUDLQDJHLQVWDOODWLRQURDGEXLOGLQJDQGIRXQGDWLRQVLWHZRUN$OVROHDUQ DERXW FKDLQVDZ VDIHW\ PDLQWHQDQFH DQG VDIH RSHUDWLQJ WHFKQLTXHV $GGLWLRQDOO\ SDUWLFLSDQWV ZLOO JDLQ DQ XQGHUVWDQGLQJ RI EDVLF SODQH VXUYH\LQJDQG*36WHFKQRORJLHV6WHHOWRHERRWVDQG26+$DSSURYHG KDUGKDWDUHUHTXLUHG Commercial  Drivers  License  (CDL) $/LFHQVH%/LFHQVH $WR%8SJUDGH

³$´/LFHQVH³%´/LFHQVH ³83*5$'(´&ODVVURRP6DWXUGD\V$3 7KH6WDIIRUG'ULYHU7UDLQLQJ6FKRROLVRSHUDWHGWKURXJKWKH$GXOWDQG &RQWLQXLQJ (GXFDWLRQ SURJUDP DW 6WDIIRUG 7HFKQLFDO &HQWHU  7KLV SURJUDP WHDFKHV \RX PRUH WKDQ MXVW KRZ WR GULYH D VWUDLJKW WUXFN RU VHPL2XUSHUVRQDEOHDQGNQRZOHGJHDEOHWHDFKLQJVWDIIZLOOWHDFK\RX DOORIWKHVNLOOVQHHGHGWRFRPSHWHIRUDZHOOSD\LQJFDUHHULQWKHH[FLWLQJ ¿HOGRISURIHVVLRQDOWUXFNGULYLQJ:KHQ\RXFRPSOHWHWKHFODVVURRP DQGRYHUWKHURDGVWDWHDSSURYHGFXUULFXOXP\RXZLOOEHUHDG\WRWDFNOH WKHVWDWHUHTXLUHG&'/VNLOOVWHVWWRREWDLQ\RXUFODVV$RU%FRPPHUFLDO GULYHUV OLFHQVH  7KH FODVVURRP SUDFWLFH UDQJH DQG HTXLSPHQW DUH DOO ORFDWHG VHYHQ PLOHV IURP 6WDIIRUG 7HFKQLFDO &HQWHU RQ 5RXWH % LQ 1RUWK &ODUHQGRQ  3OHDVH FDOO    RU YLVLW RXU ZHEVLWH IRUDQRQOLQHDSSOLFDWLRQDWZZZVWDIIRUGGULYHUWUDLQLQJFRP3OHDVHEH DGYLVHGWKDW6WDIIRUG7HFKQLFDO&HQWHUFDQQRWJXDUDQWHHHPSOR\PHQW DIWHUVWXGHQWVFRPSOHWHWKLVWUDLQLQJSURJUDPQRUGRHVLWSURYLGHDFFHVV WRVFKRROEDVHGFDUHHUFRXQVHOLQJRUHPSOR\PHQWSODFHPHQWVHUYLFHV :KHQ DSSURSULDWH UHIHUUDOV DUH PDGH E\ 67& SURJUDP VWDII WR ORFDO HPSOR\HUVDQGJRYHUQPHQWDJHQFLHVWKDWFDQDVVLVWHOLJLEOHFDQGLGDWHV LQGHYHORSLQJDVWUDWHJ\IRUHPSOR\PHQW Shielded Metal Arc Welding I 0RQ3)HE$SU+UV $EHJLQQHUFRXUVHWRLQWURGXFHVWXGHQWVWRWKHDUWDQGVFLHQFHRIZHOGLQJ )RFXV LV GHYHORSLQJ KDQGVRQ SUR¿FLHQF\ 7KLV SURFHVV FRPPRQO\ NQRZQDV³VWLFNZHOGLQJ´LVWKHVWDQGDUGIRUDYDULHW\RILQGXVWULHVDQG DSSOLFDWLRQV+DQGVRQSUDFWLFHZLWKVXSHUYLVRULQVWUXFWLRQVRVWXGHQWV GHYHORSSURSHUWHFKQLTXH$OVRLQFOXGHVLQWURWR0,*7,*DQGFXWWLQJ

),1$1&,$/,1)250$7,21 7KH86+RXVHKDVSDVVHGWKH3RVW9HWHUDQV(GXFDWLRQDO$V-­ VLVWDQFH,PSURYHPHQWV$FWRI7KLVELOODOORZVYHWHUDQVWRXVH WKHLUEHQH¿WVDWHGXFDWLRQDOLQVWLWXWLRQVWKDWGRQRWDZDUGDVVRFLDWHRU KLJKHUGHJUHHVVXFKDV3$+&&7KLVLVDFKDQJHIURPWKHFXUUHQW 3RVW*,%LOOZKLFKGRHVQRWDOORZSDUWLFLSDQWVWRXVHIXQGVDWD QRQGHJUHHJUDQWLQJLQVWLWXWLRQ,QDGGLWLRQ3$+&&KDVQHHGEDVHG VFKRODUVKLSVDYDLODEOHDVZHOODV96$&QRQGHJUHHJUDQWV7KHVH IXQGVFDQEHDSSOLHGWRDOO3$+&&SURJUDPV3OHDVHFDOO IRUPRUHLQIR

             Register  using  one  of  the  following  ways: Â&#x2021;:$/.,1$0WR300RQGD\)ULGD\ Â&#x2021;)$;,1   Â&#x2021;%<0$,/253+21(   Â&#x2021;9,6$ 0&$&&(37(' <RXZLOOQRWEHFRQWDFWHGXQOHVVFODVVLVFDQFHOOHG&ODVVHVDUH ÂżOOHGRQDÂżUVWFRPHÂżUVWVHUYHGEDVLV

WINTER/SPRING 2014

Daytime Technical Programs $GXOWVZLWKRXWKLJKVFKRROGLSORPDV RUZLWKD*(' PD\DSSO\IRUIUHH WUDLQLQJLQGD\WLPHWHFKQLFDOSURJUDPV7XLWLRQLVFKDUJHGWRDGXOWVZLWK DKLJKVFKRROGLSORPDDQGQRQ9HUPRQWUHVLGHQWV&DOO   IRUPRUHLQIRUPDWLRQRUWRDSSO\6SULQJVHPHVWHUVWDUWV-DQ

INFORMATION TECHNOLOGY ACADEMY &UHDWLYH3RWHQWLDO8VLQJ0LFURVRIW2IĂ&#x20AC;FH :HG3)HE):DOVK+UV 7KLV LQWURGXFWRU\ FODVV ZLOO XQORFN WKH SRWHQWLDO RI :RUG ([FHO DQG 3RZHU3RLQWE\OHDUQLQJWRQDYLJDWHWKHÂłULEERQEDU´WRSHUIRUPPDQ\ WDVNV)HE:RUG)HE([FHO)HE3RZHU3RLQW Word 1 â&#x20AC;&#x201C; 2010 7XH 7KX3-DQ):DOVK+UV ZLWKWH[W 7KHIROORZLQJWRSLFVZLOOEHFRYHUHGH[SORUHWKH:RUGZLQGRZFUHDWH VDYHGRFXPHQWVSULQWPRYHFRS\IRUPDWDQGHGLWWH[W Word 2 â&#x20AC;&#x201C; 2010 7XH 7KX3-DQ):DOVK+UV ZLWKWH[WZLWKRXWWH[W 7KHIROORZLQJWRSLFVZLOOEHFRYHUHGFUHDWHPRGLI\WDEOHVXVHKHDGHUV IRRWHUV PDUJLQV SDJH EUHDNV$XWR&RUUHFW ÂżQGUHSODFH DQG DGG JUDSKLFVFOLSDUW<RXZLOOKDYHWLPHWRUHLQIRUFHVNLOOVOHDUQHGLQ:RUG Word 3 â&#x20AC;&#x201C; 2010 7XH 7KX3)HE):DOVK+UV ZLWKWH[W 7KH IROORZLQJ WRSLFV ZLOO EH FRYHUHG VW\OHV RXWOLQHV VHFWLRQV DQG FROXPQVIRUPDWWLQJWDEOHVDQGSULQWLQJHQYHORSHVODEHOV<RXZLOOKDYH WLPHWRUHLQIRUFHVNLOOVOHDUQHGLQ:RUGDQG Word 4 â&#x20AC;&#x201C; 2010 7XH 7KX3)HE):DOVK+UV ZLWKWH[WZLWKRXWWH[W 7KHIROORZLQJWRSLFVZLOOEHFRYHUHGWHPSODWHVEXLOGLQJEORFNVJUDSKLFV PDQDJLQJGRFXPHQWUHYLVLRQVDQGZHEIHDWXUHV<RXZLOOKDYHWLPHWR UHLQIRUFHVNLOOVOHDUQHGLQ:RUG Excel 1 â&#x20AC;&#x201C; 2010 7XH 7KX30DU):DOVK+UV ZLWKWH[W 7KHIROORZLQJWRSLFVZLOOEHFRYHUHGH[SORUHWKH([FHOZLQGRZQDYLJDWHD ZRUNVKHHWVDYHDQGXSGDWHZRUNERRNVPRYHDQGFRS\GDWDIRUPXODV LQVHUWGHOHWHUDQJHVURZVDQGFROXPQVDQGXVHIXQFWLRQV Excel 2 â&#x20AC;&#x201C; 2010 7XH 7KX30DU):DOVK+UV ZLWKWH[WZLWKRXWWH[W 7KHIROORZLQJWRSLFVZLOOEHFRYHUHGWH[WURZVFROXPQVDQGQXPEHUV SULQWGRFXPHQWVXVHFKDUWEDVLFVPDQDJHODUJHZRUNERRNVDQGIRUPDW ZLWKJUDSKLFV<RXZLOOKDYHWLPHWRUHLQIRUFHVNLOOVOHDUQHGLQ([FHO Excel 3 â&#x20AC;&#x201C; 2010 7XH 7KX3$SU):DOVK+UV ZLWKWH[W 7KHIROORZLQJWRSLFVZLOOEHFRYHUHGKRZWRQDYLJDWHPXOWLSOHZRUNVKHHWV ZRUNERRNVDGYDQFHGIRUPDWWLQJRXWOLQLQJDQGZRUNLQJZLWKWDEOHV<RX ZLOOKDYHWLPHWRUHLQIRUFHVNLOOVOHDUQHGLQ([FHODQG Excel 4 â&#x20AC;&#x201C; 2010 7XH 7KX3$SU):DOVK+UV ZLWKWH[WZLWKRXWWH[W1RFODVV0D\ 7KHIROORZLQJWRSLFVZLOOEHFRYHUHGZHEDQGVKDULQJIHDWXUHVDGYDQFHG FKDUWLQJGRFXPHQWLQJDQGDXGLWLQJWHPSODWHVDQGVHWWLQJVDQGSLYRWLQJ WDEOHVFKDUWV<RXZLOOKDYHWLPHWRUHLQIRUFHVNLOOVOHDUQHGLQ([FHO PowerPoint 7XH 7KX30D\):DOVK+UVZLWKWH[W :KHQ\RXÂżQLVKWKLVFODVV\RXZLOOEHRQ\RXUZD\WRFUHDWHHIIHFWLYH SURIHVVLRQDOSUHVHQWDWLRQVIRUKRPHEXVLQHVVRUHGXFDWLRQDOXVH &RPSXWHU&RPSHWHQF\&HUWLÂżFDWH &RPSOHWHDOOOHYHOVRI([FHO:RUGDQG3RZHU3RLQWDQGHDUQD&HUWLÂżFDWHRI,QLWLDO Computer  Mastery  authorized  by  the  Adult    Technical  Education  Association  of   9HUPRQW3UHUHTXLVLWH,QIRUPDWLRQ3URFHVVLQJFRXUVHRUSURYHQFRPSHWHQF\

7R R O V  I R U  D  E H W W H U  W R P R U U R Z

www.hannafordcareercenter.org

Online  Learning  Courses  Begin  At  $99!

ZZZHGJRFRPKDQQDIRUG

 


PAGE  4B  â&#x20AC;&#x201D;  Addison  Independent,  Thursday,  January  16,  2014

Womenâ&#x20AC;&#x2122;s  hockey  earns  win,  tie MIDDLETOWN,   Conn.   â&#x20AC;&#x201D;   The   Middlebury  College  womenâ&#x20AC;&#x2122;s  hock-­ ey   team   picked   up   a   win   and   a   tie   at  NESCAC  foe  Wesleyan  this  past   ZHHNHQG KHDGLQJ LQWR D ÂżUVWSODFH showdown   this   weekend   at   Am-­ herst.   The   9-­1-­1   Panthers   and   the   8-­2-­ 2   Jeffs   are   tied   at   the   top   of   the   league  table  with  5-­0-­1  records,  and   Middlebury   will   visit   Amherst   for   a   two-­game   series   on   Friday   night   and  Saturday  afternoon. This   past   Saturday,   the   Panthers,   who   are   ranked   No.   2   in   NCAA   Division  III,  defeated  Wesleyan  (3-­ 6-­3,   1-­3-­2   NESCAC),   4-­1,   as   Em-­ ily  Fluke  picked  up  a  goal  and  two   assists.   0LGGOHEXU\VFRUHGÂżUVWZLWKWZR Cardinals  in  the  penalty  box  at  5:18   RI WKH ÂżUVW SHULRG$ SRLQW VKRW E\ Carly   Watson   went   wide   and   car-­

omed   to   Fluke,   who   set   up   Pam   Schulman  in  the  slot.   Middlebury  made  it  2-­0  with  an-­ other  power-­play  goal  at  3:46  of  the   second   period,   when   Sara   Ugalde   took   a   Fluke   pass   from   behind   the   let  on  the  left  for  a  quick  shot.  Less   than   three   minutes   later,   Middle-­ bury   got   its   only   even-­strength   goal   of   the   weekend   when   Hannah   Bielawski   carried   the   puck   up   the   right   side   and   hit   Kelly   Sherman   with  a  centering  pass  for  Shermanâ&#x20AC;&#x2122;s   ÂżUVWFDUHHUJRDO Wesleyan   got   on   the   board   at   14:01   of   the   middle   stanza,   and   Fluke   put   the   puck   into   an   empty   net   with   22   seconds   left   in   the   third.   Cardinal   goalie   Corinne   Ri-­ vard   made   26   saves,   and   Middle-­ buryâ&#x20AC;&#x2122;s  Annabelle  Jones  stopped  22   shots. On   Friday,   the   two   teams   skated  

to  a  2-­2  tie  in  a  series  that  favors  the   Panthers  all-­time,  47-­0-­4.   Wesleyan   tied   the   game   at   2-­2   with   34   seconds   left   in   regulation,   DQG 5LYDUG PDGH ÂżYH RI KHU  saves   in   overtime   to   preserve   the   deadlock.   Middlebury   scored   the   gameâ&#x20AC;&#x2122;s   ÂżUVW WZR JRDOV DV ERWK 8JDOGH DQG Fluke  scored,  both  on  power  plays.   Ugalde   tallied   hers   at   10:02   of   the   ÂżUVWSHULRGDVVKHZKLVWOHGLQDZULV-­ ter   from   left   circle   off   a   pass   from   freshman   Carly   Watson.   Flukeâ&#x20AC;&#x2122;s   goal  came  at  3:59  of  the  second  pe-­ riod,   when   she   smacked   home   the   rebound  of  a  shot  by  senior  Jennifer   Krakower.   Wesleyan   got   on   the   board   at   16:57   of   the   second   before   com-­ pleting   their   comeback   late   in   the   third.   Jones   made   22   saves   for   the   Panthers.

Middlebury  men  split  NESCAC  games MIDDLEBURY   â&#x20AC;&#x201D;   The   Middle-­ bury   College   menâ&#x20AC;&#x2122;s   hockey   team   split  a  pair  of  home  NESCAC  games   this  past  weekend  to  move  to  6-­4-­2,   4-­3-­1   in   the   league.   That   record   is   good   for   a   fourth-­place   tie   in   NES-­ CAC  with  two  other  teams. The  Panthers  face  two  tough  non-­ league  games  this  weekend,  hosting   Plattsburgh   on   Friday   and   visiting   Norwich  on  Saturday.   On  this  past  Saturday,  senior  goal-­ tender   Nick   BonDurant   made   25   VDYHV WR SRVW KLV ÂżUVW VKXWRXW WKLV season   and   second   of   his   career   to   lead   the   Panthers   to   a   5-­0   blanking   of  Wesleyan  (7-­4-­1,  2-­4-­0).   The   Panthers   took   the   lead   at   RIWKHÂżUVWZKHQ%HQ:LJJLQV VFRUHGKLVÂżUVWJRDORIWKHZLQWHU+H skated   into   the   middle   of   the   Wes-­ OH\DQ GHIHQVH DQG EHQHÂżWWHG IURP nice  passes  by  Matt  Silcoff  and  Zach   Haggerty  after  Haggerty  won  a  battle   for  the  puck.

Middlebury  added  two  power  play   goals  in  the  second  period.  At  4:35,   Louis  Belisle  scored  his  eighth  goal   of   the   season.   Nearly   10   minutes   later,   Silcoff   tipped   in   a   shot   from   Connor  Frick. At   1:38   of   the   third,   Silcoff   con-­ verted   after   a   pair   of   one-­touch   passes  from  Mike  Longo  and  Robbie   Donahoe.  Seconds  later,  BonDurant   kept   his   shutout   intact   as   he   slid   to   his   right   and   made   a   glove   save   on   a  breakaway  attempt  by  Wesleyanâ&#x20AC;&#x2122;s   James  Albrecht. Longo   capped   off   the   scoring   for   the  Panthers  at  the  15:39  mark  on  the   power  play  when  he  redirected  a  shot   by  Haggerty  after  Brendan  McGov-­ ern  won  a  battle  for  the  puck  along   the  boards. 0LGGOHEXU\ÂżQLVKHGZLWKD advantage   in   shots.   Dawson   Sprig-­ ings  made  33  saves  for  Wesleyan. On  Friday,  Trinity  (9-­3,  4-­2  NES-­ &$& WRRNDÂżUVWSHULRGOHDGRQ

the   way   to   a   6-­3   victory   over   Mid-­ dlebury.   7KH %DQWDPV DOVR VFRUHG ÂżUVW LQ the  second  before  Middlebury  got  on   the  board  8:46  into  the  period  when   Silcoff   picked   up   a   loose   puck   and   scored   from   the   slot.   But   the   Ban-­ tams  responded  with  two  goals  in  the   next  1:30  to  make  it  6-­1.   Middlebury  made  it  6-­2  with  1:27   OHIWWRJRLQWKHSHULRGZLWKDÂżYHRQ three   power   play   goal.   Belisle   and   Brendan  McGovern  passed  the  puck   back  and  forth  before  Belisle  scored   from  the  right  side.  Longo  scored  the   only   goal   of   the   third   session,   con-­ verting  on  a  rebound  after  Derek  Pi-­ mentelâ&#x20AC;&#x2122;s  shot  was  saved. 7KH3DQWKHUVÂżQLVKHGZLWKD shots   advantage,   with   Bantam   Ben-­ jamin   Coulthard   making   38   saves.   'UHZ0LFKDOV HLJKWVDYHVLQWKHÂżUVW period)  and  BonDurant  (10  saves  in   the  second  and  third  periods)  saw  ac-­ tion  for  the  Panthers.

Groups  sponsor  substance  awareness  poster  contest VERGENNES   â&#x20AC;&#x201D;   The   Vergennes   Knights   of   Columbus   and   the   Ver-­ gennes   Community   Action   Group   are   sponsoring   a   Substance   Abuse   Awareness   Poster   Contest   for   chil-­ dren  from  ages  8  to  14.  The  goal  of   this   educational   art   contest   is   to   al-­ low  young  people  the  opportunity  to   develop  their  own  solutions  to  chal-­ lenges  they  may  face. Black-­and-­white  or  colored  11-­by-­ 17-­inch  posters  will  be  judged  for  two   age   classes:   8-­11   and   12-­14.   Posters  

and  application  forms  need  to  be  sub-­ mitted   by   Feb.   3   to   the   Vergennes   3ROLFH'HSDUWPHQW2I¿FH$IWHUMXGJ-­ ing,  posters  will  be  displayed  on  a  ro-­ tation  at  the  local  schools. First-­place   winners   in   each   class   will   receive   a   $50   check   from   the   Vergennes   Knights   of   Columbus   Council  3664.  Second-­place  winners   in  the  8-­11  age  group  will  receive  a   JLIW FHUWL¿FDWH IRU SL]]D DW /XLJLœV Second-­place   in   age   group   12-­14   will  receive  gift  cards  for  six  6-­inch  

subs   from   Subway   in   Vergennes.   Winners  will  be  entered  in  the  state   competition   and   state   winners   will   compete  in  the  International  Knights   Contest. Applications  and  information  may   be   acquired   at   Ferrisburgh   Central,   Vergennes   Union   Elementary,   Ad-­ dison  Central  and  Champlain  Valley   Christian  schools.  Contact  Vergennes   Chief  of  Police  George  Merkel  (877-­ 1154)   or   Bill   Scott   (881-­8836)   for   more  information.

Please join the Porter Auxiliary Board for

An Evening for Porter Friday, January 24 , 2014 5:30 â&#x20AC;&#x201C; 8:30 PM Two Brothers Tavern Lounge & Stage th

.BJO4USFFUr.JEEMFCVSZ 75

Much More Than This One Road YJODIFTJODMVEFTBIBOEDSBGUFEXBMOVUGSBNF7BMVFEBU 

5IJTCFBVUJGVMPSJHJOBMQBJOUJOHXBTDSFBUFECZMPDBMBSUJTU "OOF$BEZ  XIPEPOBUFEUIJTQJFDFGPSUIFSBĂ°FUPTVQQPSUUIFXPSLPG1PSUFS.FEJDBM$FOUFS 5IFQBJOUJOHDBOCFWJFXFEBU&EHFXBUFS(BMMFSZm0OF.JMM4USFFU .JEEMFCVSZ 75 Raffle tickets are $10 $BMM 388.4738 PSHPPOMJOFBUwww.portermedical.orgBOEDMJDLUIF iEPOBUFOPXuCVUUPOPOUIFIPNFQBHF .BTUFS$BSEBOE7JTBBDDFQUFEFJUIFSCZQIPOFPSPOUIFXFCTJUF [ You do not have to purchase tickets to this event or be present at the event to win the raffle.]

1JBOP#BSGFBUVSJOH'SFE#BSOFTr"QQFUJ[FSTBOE#FWFSBHFTGSPNMPDBMQVSWFZPST QFSQFSTPO JODMVEFTPOFESJOLWPVDIFS

Many thanks to our sponsors:

For more information, please call Laurie Borden at 388.4738

MIDDLEBURY  COLLEGE  SOPHOMORE  Harrison  Croll  leans  down  to  connect  with  a  backhand  during  the   Panthersâ&#x20AC;&#x2122;  match  against  Amherst  Tuesday  afternoon. Independent  photo/Trent  Campbell

Squash  courts (Continued  from  Page  1B) all   victorious   by   a   score   of   3-­0   in   slots  3-­7.  Andrew  Jung  earned  a  3-­1   victory   in   the   second   spot,   while   Reed  Palmer  won  by  the  same  score   at  No.  8. Middlebury   No.   1   Parker   Hurst   fell   to   Amherstâ&#x20AC;&#x2122;s   Noah   Browne   in   three  games. The   Panther   womenâ&#x20AC;&#x2122;s   squash   WHDP ZRQ LWV ÂżIWK VWUDLJKW PDWFK WR

improve   to   5-­1   on   the   season   with   an   8-­1   victory   over   18th-­ranked   Amherst.   This   was   the   Middlebury   ZRPHQœV ¿QDO KRPH FRQWHVW RI WKH season,  as  well. Middlebury,  ranked  17  in  Division   II,   swept   matches   1-­8,   earning   3-­0   victories  in  each  match-­up.  Amanda   Chen  lost  just  eight  points  in  her  3-­0   victory  at  No.  7,  while  Abby  Jenkins   surrendered   just   a   dozen   points   in  

her  3-­0  win  at  No.  1.  The  other  Pan-­ ther  winners  were  Charlotte  Dewey,   Annie  Wymard,  Tiffany  Hau,  Saskia   Pownall-­Gray,  Zoe  Carey  and  Katie   Dewey.   Amherst   No.   9   Lena   Rice   defeated   Middlebury   freshman   Au-­ drey  Ellen. The   Middlebury   womenâ&#x20AC;&#x2122;s   and   menâ&#x20AC;&#x2122;s   squash   teams   both   return   to   action   on   Saturday   and   Sunday   at   Williams  and  Drexel.

Panthers (Continued  from  Page  2B) Bobcats  to  a  64-­61  victory.   The  Panthers  took  a  36-­25  lead  into   the  locker  room  as  Sinnickson  scored    ÂżUVWKDOI SRLQWV LQFOXGLQJ  LQ D 16-­2   run   that   wiped   out   Batesâ&#x20AC;&#x2122;   early   11-­10  lead.   Middlebury  held  an  eight-­point  lead,   42-­34,  with  13:21  left.  Bates  answered   with   a   6-­0   run   and   pulled   to   within   two   (42-­40)   on   a   lay-­up   from   Luke   Matarazzo   with   10:18   on   the   clock.   The  Panthers  pulled  away  again  with   a  9-­0  run  ended  by  two  charity  tosses   from  Sinnickson  at  6:49  and  led  51-­40.   Bates   fought   its   way   back   and   took   LWVÂżUVWOHDGRIWKHJDPHZLWK 3:55  remaining  on  a  tip-­in  by  Malcolm   Delpeche. With   2:35   left,   Middleburyâ&#x20AC;&#x2122;s   Kizel   was  fouled  and  stepped  to  the  line  hit-­ WLQJ WKH ÂżUVW DQG W\LQJ WKH JDPH  56.  He  missed  his  second  attempt,  but   grabbed  his  own  miss  and  hit  a  three  to   make   it   59-­56.   On   the   ensuing   Bates   possession,  Adam   Philpott   responded   with  a  three  of  his  own  and  knotted  the   contest,  59-­59.  Matarazzo  tallied  a  lay-­ up  for  Bates  and  St.  Amour  sank  two   IUHH WKURZV WR VHW XS 6DIIRUGÂśV ÂżQDO shot  with  11.4  seconds  left. Sinnickson   led   all   scorers   with   23   points,   while   Kizel   and   Merryman   added   12   and   11,   respectively.  Addi-­ tionally,   Kizel   corralled   a   team-­best   seven   rebounds.   For   Bates,   Safford   paced  three  in  double  digits  with  18. On   Tuesday,   Middlebury   won,   81-­ 69,   at   Lyndon   State   (3-­10).  The   Pan-­ thers   scored   24   points   on   19   Hornet   turnovers  and  took  a  17-­6  advantage  at   RIWKHÂżUVWKDOIRQWKHZD\WRD 46-­26  halftime  lead.   Lyndon  rallied  to  within  67-­60  with   4:33  to  go  with  a  10-­0  run,  but  a  Mer-­ ryman   three-­pointer   halted   the   surge   and  the  Panthers  controlled  the  rest  of   the  way.   St.  Amour  led  four  Panthers  in  dou-­ EOHÂżJXUHVZLWKIROORZHGE\0HU-­ rymanâ&#x20AC;&#x2122;s   15   points   and   seven   boards,   Sinnickson  with  13  points,  and  James   Jensen  with  10.  Roberts  recorded  eight   boards  and  three  blocks,  while  Brown   VFRUHG VL[ SLFNHG XS ÂżYH VWHDOV DQG dished  out  four  assists.


Addison  Independent,  Thursday,  January  16,  2014  â&#x20AC;&#x201D;  PAGE  5B

ADDISON COUNTY

Vt.  Farm  Show  returns  Jan.  28

Agricultural News

ESSEX  JUNCTION  â&#x20AC;&#x201D;  The  annual   Vermont   Farm   Show   returns   to   the   Champlain   Valley   Fair   Grounds   in   Essex   Junction   for   another   exciting   year.   Scheduled   as   always   for   the   last   Tuesday   through   Thursday   in   January,  this  yearâ&#x20AC;&#x2122;s  dates  are  January   28-­30. The   move   from   Barre   to   Essex   Junction   took   place   three   years   ago   and  has  afforded  the  show  the  oppor-­ tunity  to  offer  more  exhibits,  activities   and   meetings,   and   lots   of   free   park-­ ing.  For  agriculture  professionals,  it  is   an  opportunity  to  meet  with  vendors,   preview  products  and  machinery  and   network   with   the   farm   community.   For   consumers,   itâ&#x20AC;&#x2122;s   a   great   venue   to  

learn  about  technological  advances  in   DJULFXOWXUHWKDWEHQHÂżWDOOVL]HVDQG all  kinds  of  farms. And  of  course  there  will  be  some   great   animals   on   display.   This   year,   attendees   can   enjoy   miniature   donkeys  as  well  as  a  Morgan  horse,   sheep,  llamas  and  birds. The  show  is  once  again  partnering   with   the   Vermont   FoodBank   â&#x20AC;&#x201D;   so   even  though  admission  to  the  Farm   Show  is  free,  all  those  attending  are   asked   to   donate   a   canned   or   boxed   good  to  the  greeters  as  they  walk  in   the  front  door  of  the  Miller  Building.   The   response   was   wonderful   last   year,   and   show   organizers   say   they   KRSH WR FRQWLQXH ÂżOOLQJ WKH VKHOYHV

at  the  FoodBank. This   year,   Consumer   Night   will   be   held   Wednesday,   Jan.   29,   from   4-­7  p.m.  Food  enthusiasts  will  enjoy   the   Buy   Local   Market,   which   will   showcase   foods   and   products   from   Vermont  farms.  The  â&#x20AC;&#x153;Capital  Cook-­ off,â&#x20AC;?  an  Iron  Chef-­type  competition   featuring   the   Vermont   House   of   Representatives,  Senate,  and  Agency   of   Agriculture,   Food   and   Markets,   will  also  occur  this  year.  Teams  will   have   90   minutes   to   create   a   dish   using   Vermont   products   bought   at   the  Buy  Local  Market.   For   more   information,   including   a   list  of  scheduled  2014  exhibitors,  visit   www.vtfarmshow.com.

ED  BIELLO  STANDS  on  Panton  land  that  will  remain  as  open  farmland  after  he  and  his  wife,  Beverly,  sold   development  rights  to  the  Vermont  Land  Trust  in  order  to  lower  the  price  for  a  nearby  dairy  farm  that  then   purchased  the  property.

Panton acreage retained as farmland PANTON  â&#x20AC;&#x201D;  Ed  and  Beverly  Biello   were   not   considering   conservation   when   they   bought   a   home   and   land   in   Panton   in   2000.  Their   property   had   scenic   views   of   Lake   Champlain   with   good  access  from  Adams  Ferry  Road  so   they  looked  into  selling  house  lots.   The  fate  of  the  land  changed  after  the   Biellos  were  approached  by  the  Allens,   neighboring   farmers   who   were   inter-­ ested  in  buying  all  the  land  to  support   their   dairy   farm.   To   make   such   prime   land  affordable  for  farming,  the  Biellos   sold   a   conservation   easement   on   104   acres  to  the  Vermont  Land  Trust  before   selling  the  land  to  the  Allens. â&#x20AC;&#x153;Working   with   the   Vermont   Land   Trust  was  a  great  outcome  for  Beverly   and  me,â&#x20AC;?  said  Ed  Biello.  â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re  pleased   the  land  is  conserved  and  it  allows  the   Allens  to  buy  it  at  an  affordable  price.   Theyâ&#x20AC;&#x2122;re   young,   ambitious   farmers   and   we  know  theyâ&#x20AC;&#x2122;ll  make  good  use  of  the   land.â&#x20AC;? The   Allens   are   also   pleased   with   the  outcome.  Joe  and  Becky  Allen  and  

Joeâ&#x20AC;&#x2122;s   mother,   Claudia,   own   Allendale   farm,   a   modern   dairy   with   750   head.   Joe  and  Becky  are  the  eighth  generation   to  run  the  farm,  which  has  been  in  the   family  since  1791.  Now,  they  have  the   additional  cropland  they  need  to  support   their  herd. â&#x20AC;&#x153;This   is   a   wonderful   opportunity   to   strengthen   our   family   farm,â&#x20AC;?   said   Becky  Allen,  a  large-­animal  vet.  â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re   familiar   with   conservation   restrictions   because   Claudia   conserved   two   other   farms   in   Panton   and   Ferrisburgh.   We   intend   to   continue   the   long   history   of   good   land   stewardship   and   weâ&#x20AC;&#x2122;re   glad   this   good   farmland   wonâ&#x20AC;&#x2122;t   be   developed.â&#x20AC;? The   property   has   good   agricultural   soil   with   large   meadows   that   are   easy   to  farm  and  well  drained.  The  land  has   been  used  for  hay  and  corn.  In  addition   to   protecting   the   productive   farmland   from   development,   the   easement   also   places  logging  restrictions  on  20  acres   of  uncommon  clayplain  forest. â&#x20AC;&#x153;The  sale  of  conservation  easements  

has  been  critical  to  keeping  scenic,  open   land   available   to   farmers,â&#x20AC;?   explained   Al  Karnatz  of  the  Vermont  Land  Trust.   â&#x20AC;&#x153;Once  you  develop  farmland,  itâ&#x20AC;&#x2122;s  very   unlikely   it   will   ever   become   farmland   again.  We  at  the  Vermont  Land  Trust  are   grateful  that  the  Biellos  and  the  Allens   decided  to  work  together  to  protect  this   productive  land  for  future  generations.â&#x20AC;? The   conservation   easement   is   held   by   Vermont   Land   Trust,   the   Vermont   Housing  and  Conservation  Board,  and   the   Vermont   Agency   of   Agriculture,   Food   and   Markets.   The   purchase   of   the  conservation  easement  was  funded   by  both  state  and  federal  sources.  The   Vermont   Housing   and   Conservation   Board   grant   contribution   is   matched   by   the   federal   Farm   and   Ranch   Lands   Protection   Program   managed   by   the   USDA   Natural   Resources   Conservation  Service. Editorâ&#x20AC;&#x2122;s   note:   This   story   was   provided   by   Nadine   Berrini   of   the   Vermont  Land  Trust.

VUHS  receives  Farm  to  School  grant MONTPELIER   â&#x20AC;&#x201D;   Vergennes   Union  High  School  will  be  among  the   schools  and  school  districts  receiving   Farm  to  School  grants  this  week. The   Vermont   Agency   of   Agriculture,   in   partnership   with   the   Vermont   Farm   to   School   Network,   will   be   awarding   the   2014   Farm   to   School  grants  at  a  special  ceremony  on   Thursday,  Jan.  16,  at  the  State  House   cafeteria  in  Montpelier.  This  year  six   schools   and   two   supervisory   unions   (SU)  will  be  awarded  grants.  VUHS   â&#x20AC;&#x201D;   along   with   Newbury   Elementary   School,  Walden  School  and  Barnard   Academy  â&#x20AC;&#x201D;  will  receive  $5,000  plan-­ ning   grants.   Receiving   implementa-­ tion   grants   of   up   to   $20,000   will   be   the   Orleans   Southwest   Supervisory   Union,   Charlotte   Central   School,  

Middletown   Springs   Elementary   School   and   the   Chittenden   Central   Supervisory  Union. Implementation   grant   recipients   will  receive  up  to  $20,000  to  initiate   a   Farm   to   School   program   in   2014.   Planning  grant  recipients  will  receive   $5,000   to   develop   a   plan   for   imple-­ menting   a   Farm   to   School   program   in  the  future.  Recipients  are  selected   based   on   a   competitive   application   process. â&#x20AC;&#x153;The  Farm  to  School  grant  program   enriches   our   communities   by   link-­ ing   local   producers   with   schools.   It   enables   schools   to   serve   students   nutritious,   wholesome   foods   and   creates   new   opportunities   for   local   farmers,â&#x20AC;?   according   to   Chuck   Ross,   secretary   of   the   Vermont  Agency   of  

Agriculture,  Food,  and  Markets.  â&#x20AC;&#x153;We   are   proud   to   facilitate   this   program,   which   provides   hands-­on   local   food   and   farm   education   to   students   in   their   cafeterias,   classrooms   and   communities.â&#x20AC;? At   Thursdayâ&#x20AC;&#x2122;s   event,   the   2013   grant  recipients  will  be  on  hand  with   displays   demonstrating   how   the   grant  program  impacted  their  school.   Organizations   that   focus   on   Farm   to  School  and  farm  and  food  educa-­ tion   will   also   be   displaying   their   programs. The  Farm  to  School  grant  program   is  in  its  eighth  year  and  is  the  result   of  collaboration  between  the  Agency   of  Agriculture,  Agency  of  Education,   Vermont   Farm   to   School   Network,   and  Department  of  Health.

Morning  light THE  MORNING  SUN  tries  to  burn  through  a  darkly  overcast  sky  and  a  small  snow  squall  in  Weybridge   last  week.

Nominations  sought  for   2014  sustainable  farms VERMONT   â&#x20AC;&#x201D;   Vermontâ&#x20AC;&#x2122;s   Sustainable   Agriculture   Council   is   seeking   nominations   for   the   2014   award.   The   council   will   recognize   efforts   to   promote   the   vitality   of   Vermontâ&#x20AC;&#x2122;s  food  system  with  practices   that  are  environmentally,  socially  and   economically  sustainable. Anyone  may  nominate  an  individ-­ ual   farm,   or   the   innovative   practices   of  a  team  that  includes  a  farm. In  the  nomination,  please  indicate: Â&#x2021; :KRLVWKHIDUP LQFOXGLQJQDPH of   farmer(s),   name   of   farm,   and   its   location)?  Who  are  team  members,  if   relevant? Â&#x2021; :KDWGRHVWKHIDUPSURGXFH" Â&#x2021; :KDWSUDFWLFHVVWDQGRXWDVHVSH-­ FLDOO\ EHQHÂżFLDO IRU 9HUPRQW ODQG communities  and  farm  economy? Â&#x2021; :KDWDUHWKHHFRQRPLFHQYLURQ-­ PHQWDO DQGRU VRFLDO EHQHÂżWV RI WKH farmâ&#x20AC;&#x2122;s/teamâ&#x20AC;&#x2122;s  activities? Â&#x2021; :KHWKHURUQRWZHKDYHSHUPLV-­ sion   to   post   the   information   submit-­ ted  in  your  nomination  (your  answer   ZLOOQRWLQĂ&#x20AC;XHQFHRXUGHFLVLRQ  Criteria   used   to   evaluate   each   nomination  will  include  the  extent  to   which  it  demonstrates: Â&#x2021; (QKDQFHG HFRQRPLF YLDELOLW\ RI Vermont  farms. Â&#x2021; &RPPXQLW\HQJDJHPHQW Â&#x2021; (QYLURQPHQWDOEHQHÂżWV Â&#x2021; $VRFLDOMXVWLFHHPSKDVLV Â&#x2021; 6WURQJFROODERUDWLRQ Self-­nominations   are   acceptable.   Nominations   should   be   no   longer   than  500  words.  Nominations  are  due   by  5  p.m.  EST  on  Friday,  Jan.  17.  

The   selection   committee   is   comprised   of   representatives   from   the   Sustainable   Agriculture   Council   and   others.   The   council   advises   the   Legislature;͞   the   University   of   Vermont;͞   and   the   Vermont   Agency   of  Agriculture,  Food  and  Markets  on   sustainable  agriculture  issues. Submit  nominations  to: Sustainable   Agriculture   Council   Award,   c/o   UVM   Center   for   6XVWDLQDEOH$JULFXOWXUH0DQV¿HOG Ave.,   Burlington,   VT   05401   or   via   email  to  cheryl.herrick@uvm.edu. Past   recipients   of   the   Sustainable   Farm   of   the   Year   award   include:   NVRH   &   Harvest   Hill   Farm,   Post   Oil   Solutions,   Does   Leap   )DUP %DNHUV¿HOG 6KHOEXUQH Vineyards,   Shelburne;͞   Shelburne   Orchards,   Shelburne;͞   Harlow   Farm,   Westminster;͞   Intervale   Community   Farm,   Burlington;͞   Butterworks   )DUP :HVW¿HOG /LODF 5LGJH )DUP West   Brattleboro;͞   Adams   Farm,   Wilmington;͞   Golden   Russet   Farm,   Shoreham;͞   Blue   Spruce   Farm,   Bridport,   Someday   Farm   in   East   Dorset,   La   Platte   River   Angus,   Shelburne;͞   and   Choiniere   Family   Farm,  Highgate. Established   in   1994,   the   UVM   Center   for   Sustainable   Agriculture   provides   timely   information   to   Vermont  communities  and  the  UVM   campus.  The  center  cultivates  partner-­ ships,   supports   innovative   research   and   practices,   and   informs   policy   to   advance   sustainable   food   and   farm-­ ing   systems.   For   more   information,  

Independent  photo/Trent  Campbell

HARDWOODS & SOFTWOODS Kiln Dried Lumber Mill Direct

Repairs Remodeling New Construction Jobs of Any Size Pine, Maple, Oak, Cherry, Ash...

Over 100 years Superior Quality/ Great Prices

Paneling Flooring Siding Trim Furniture & Cabinets

,OCAL s 3USTAINABLE s 2ENEWABLE &DVK 9ROXPH'LVFRXQWVÂ&#x2021;*UHDW6SHFLDOVÂ&#x2021;)ULHQGO\6HUYLFH 7KH$-RKQVRQ&R//&Â&#x2021;6RXWK5GÂ&#x2021;%ULVWRO97 Â&#x2021;ZZZ9HUPRQW/XPEHUFRP

Over 31 years of personalized, comfortable care in a high-tech dental office!

1FUFS+)PQQFS %%4t"EBN&'BTPMJ %.% #SJBO%$PMMJOT %%4 t.PTU*OTVSBODF8FMDPNFt&NFSHFODJFT8FMDPNF t/FX1BUJFOUT8FMDPNF 133&YDIBOHF4USFFU 4VJUFt.JEEMFCVSZ (802) 388-3553

www.middleburydentalvt.com Check  out  the  Real  Estate  section  every   Mon.  &  Thurs.  in  the

Addison  Independent


PAGE  6B  â&#x20AC;&#x201D;  Addison  Independent,  Thursday,  January  16,  2014

Addison Independent

CLASSIFIEDS Notice

Public  Meetings

DOG   TEAM   CATERING.   Seating  up  to  300,  plus  bar   available,  Middlebury  VFW.   Full  menus.  802-­388-­4831,   dogteamcatering.net  .

ALCOHOLICS   ANONY-­ M O U S   M I D D L E B U RY   MEETINGS  WEDNESDAY:   Big  Book  Meeting  7:15-­8:15   AM  is  held  at  the  Middlebury   PARTY   RENTALS;   CHI-­ United  Methodist  Church  on   NA,   flatware,   glassware,   N.  Pleasant  Street.  Discus-­ linens.   Delivery   available.   sion  Meeting  Noon-­1:00  PM.   Womenâ&#x20AC;&#x2122;s  Meeting  5:30-­6:30   802-­388-­4831. PM.  Both  held  at  The  Turn-­ ing  Point  Center  in  the  Mar-­ Cards  of  Thanks bleworks,  Middlebury.

Public  Meetings

Public  Meetings

ALCOHOLICS   ANONY-­ MOUS   BRISTOL   MEET-­ INGS:   Sunday,   Discussion   Meeting   4:00-­5:00   PM.   Wednesday,  12  Step  Meet-­ ing   7:00-­8:00   PM.   Friday,   Big  Book  Meeting,  6:00-­7:00   PM.  All  held  at  the  Federated   Church,  Church  St.

YOUNG   ADULT   ALL-­RE-­ COVERY   Group   Meeting.   The  Turning  Point  Center  is   starting  a  new  group  meet-­ ing  for  young  adults  (15-­25   years   old)   struggling   with   addiction   disorders.   It   will   be   a   great   place   to   meet   with  your  peers  who  are  in   recovery.  Our  first  meeting  is   on  January  14  at  4:00  p.m.   at  The  Turning  Point  Center.   Bring   a   friend   in   recovery   and   start   your   New   Year   out  right.

ALCOHOLICS   ANONY-­ M O U S   V E R G E N N E S   MEETINGS:   Sunday,   12   Step  Meeting  7:00-­8:00  PM.   Friday,  Discussion  Meeting   8:00-­9:00   PM.   Both   held   at   St.   Paulâ&#x20AC;&#x2122;s   Church,   Park   St.   Tuesday,   Discussion   Services Meeting   7:00-­8:00   PM,   at   the  Congregational  Church,   CHAIN  SAW  CHAINS  sharp-­ Water  St. ened.  Call  802-­759-­2095.

ALCOHOLICS   ANONY-­ THANKS   HOLY   SPIRIT   M O U S   M I D D L E B U RY   and   St.   Jude   for   prayers   MEETINGS  TUESDAY:  11th   answered.  Ma. Step   Meeting   Noon-­1:00   PM.  ALTEEN   Group.   Both   at   Turning   Point,   228   Public  Meetings held   Maple  Street.  12  Step  Meet-­ AL-­ANON:   FOR   FAMI-­ ing  Noon-­1:00  PM.  12  Step   LIES   and   friends   affected   Meeting  7:30-­8:30  PM.  Both   MAKING  RECOVERY  EAS-­ by   someoneâ&#x20AC;&#x2122;s   drinking.   held   at   The   Turning   Point   IER  (MRE).  Starting  January   Members   share   experi-­ Center  in  The  Marbleworks,   15,   5:30  â&#x20AC;&#x201D;  7:00   PM   at   The   ence,  strength  and  hope  to   Middlebury. Turning   Point   Center.   This   solve   common   problems.   ALCOHOLICS   ANONY-­ will   be   a   facilitated   group   N e w c o m e r s   w e l c o m e .   M O U S   M I D D L E B U RY   meeting  for  those  struggling   Confidential.   St.   Stephenâ&#x20AC;&#x2122;s   M E E T I N G S   M O N D AY:   with   the   decision   to   attend   Church  (use  front  side  door   As   Bill   Sees   It   Meeting   12-­step  programs.  It  will  be   and   go   to   second   floor)   in   Noon-­1:00   PM.   Big   Book   limited  to  explaining  and  dis-­ Middlebury,   Sunday   nights   Meeting  7:30-­8:30  PM.  Both   cussing   our   feelings   about   7:15-­8:15pm. held   at   The   Turning   Point   the  12-­step  programs  to  cre-­ ALATEEN:   FOR   YOUNG   Center  in  T  he  Marbleworks,   ate  a  better  understanding  of   how  they  can  help  a  person   PEOPLE   whoâ&#x20AC;&#x2122;ve   been   af-­ Middlebury. fected  by  someoneâ&#x20AC;&#x2122;s  drink-­ ALCOHOLICS   ANONY-­ in  recovery  on  his  /  her  lifeâ&#x20AC;&#x2122;s   ing.  Members  share  experi-­ M O U S   M I D D L E B U RY   journey.  A  certificate  will  be   ence,  strength,  hope  to  solve   MEETINGS   SUNDAY:   12   issued  at  the  end  of  all  the   common   problems.   Meets   Step   Meeting   9:00-­10:00   sessions.   Please   bring   a   Wednesdays   7:15-­8:15pm   AM  held  at  the  Middlebury   friend   in   recovery   who   is   downstairs  in  Turning  Point   United  Methodist  Church  on   also  contemplating  12-­step   Center   of  Addison   County   N.  Pleasant  Street.  Discus-­ programs. in  Middlebury  Marbleworks.   sion  Meeting  1:00-­2:00  PM   THE   HELENBACH   CAN-­ (Al-­Anon   meets   at   same   held   at   The   Turning   Point   CER   Support   Group   is   an   time  nearby  at  St.  Stephens   Center  in  The  Marbleworks,   independent  group  of  people   Church). who  are  dealing  with,  have   Middlebury. ALCOHOLICS   ANONY-­ ALCOHOLICS   ANONY-­ dealt   with,   and   who   know   M O U S   M I D D L E B U RY   MOUS  NEW  HAVEN  MEET-­ people  with  cancer.  We  meet   M E E T I N G S   S AT U R -­ INGS:   Monday,   Big   Book   on  an  irregularly  regular  ba-­ DAY:   Discussion   Meeting   Meeting  7:30-­8:30  PM  at  the   sis   (if   there   is   a   need,   we   9:00-­10:00  AM   at   the   Mid-­ Congregational  Church,  New   meet!)  at  the  Mary  Johnson   Child   Care   Center   on   Wa-­ dlebury   United   Methodist   Haven  Village  Green. ter  St.  in  Middlebury.  Good   Church.  Discussion  Meeting   10:00-­11:00  AM.   Womenâ&#x20AC;&#x2122;s   ALCOHOLICS   ANONY-­ home-­made   treats   are   al-­ Meeting  Noon-­1:00  PM.  Be-­ MOUS   RIPTON   MEET-­ ways  available  and  all  meet-­ ginnersâ&#x20AC;&#x2122;  Meeting   6:30-­7:30   INGS:   Monday,   As   Bill   ings   are   free.   Our   theme   PM.  These  three  meetings   Sees   It   Meeting   7:15-­8:15   song  has  been  Bill  Witherâ&#x20AC;&#x2122;s   are  held  at  The  Turning  Point   AM.   Thursday,   Grapevine   â&#x20AC;&#x153;Lean   on   Me,   when   youâ&#x20AC;&#x2122;re   Center  in  The  Marbleworks,   Meeting  6:00-­7:00  PM.  Both   not  strong,  Iâ&#x20AC;&#x2122;ll  be  your  friend,   held   at   Ripton   Firehouse,   Iâ&#x20AC;&#x2122;ll   help   you   carry   on..for   it   Middlebury. wonâ&#x20AC;&#x2122;t  be  long,  â&#x20AC;&#x2DC;til  Iâ&#x20AC;&#x2122;m  gonna   Dugway  Rd. ALCOHOLICS   ANONY-­ need,  somebody  to  lean  on.â&#x20AC;?   M O U S   M I D D L E B U RY   ALCOHOLICS   ANONY-­ Come  be  a  leaner,  be  a  sup-­ MEETINGS   FRIDAY:   Dis-­ MOUS   BRANDON   MEET-­ porter,  be  part  of  something   cussion  Meeting  Noon-­1:00   INGS:  Monday,  Discussion   that  gives  strength  by  shar-­ PM  at  The  Turning  Point  in   Meeting   7:30-­8:30   PM.   ing  love.  Call  802-­388-­6107   The   Marbleworks,   Middle-­ Wednesday,  12  Step  Meet-­ with  questions. ing  7:00-­8:00  PM.  Friday,  12   bury. Step  Meeting  7:00-­8:00  PM.   NA   MEETINGS   MIDDLE-­ ALCOHOLICS   ANONY-­ All   held   at   the   St.  Thomas   BURY:  Mondays,  6pm,  held   M O U S   M I D D L E B U RY   Episcopal   Church,   RT   7   at  The  Turning  Point  Center   MEETINGS   THURSDAY:   South. located  in  The  Marbleworks. Big  Book  Meeting  Noon-­1:00   PM   at   the   Turning   Point   ALCOHOLICS   ANONY-­ NA   MEETINGS   MIDDLE-­ Center  in  the  Marbleworks,   M O U S   N O R T H   F E R -­ BURY:   Fridays,   7:30pm,   Middlebury.  Speaker  Meet-­ RISBURGH   MEETINGS:   held   at   the   Turning   Point   ing  7:30-­8:30  PM  at  St.  Ste-­ Sunday,   Daily   Reflections   Center  located  in  the  Marble   phenâ&#x20AC;&#x2122;s  Church,  Main  St.(On   Meeting  6:00-­7:00  PM,  at  the   Works. United   Methodist   Church,   Old  Hollow  Rd.

the  Green).

Services

The Volunteer Center, a collaboration of RSVP and the United Way of Addison County, posts dozens of volunteer opportunities on the Web. Go to www. unitedwayaddisoncounty .org/VolunteerDonate and click on VOLUNTEER NOW!

Services

Services

CONSTRUCTION:   ADDI-­ TIONS,   RENOVATIONS,   new   construction,   drywall,   carpentry,  painting,  flooring,   roofing,   pressure   washing,   driveway  sealing.  All  aspects   of  construction,  also  property   maintenance.  Steven  Fifield   802-­989-­0009. FOR  EXPERT  TREE  SER-­ VICE,   call   Henry   at   Carr   Tree   &   Timber   LLC.   Tree   removal,  trimming,  chipping   &  more.  ISA  Certified  Arbor-­ ist  NE-­6944A.  Fully  insured.   Please   visit   our   website   at   www.carrtree.com   or   call   today  for  your  free  estimate:   802-­558-­5244.

Services

Free



S M A L L   C A R P E N T RY   JOBS,   property   mainte-­ nance   and   repairs.   Brush   trimming,   hedge   trimming,   light  trucking.  Geneâ&#x20AC;&#x2122;s  Prop-­ erty  Management,  Leicester,   VT.  Fully  insured.  Call  for  a   free  estimate,  802-­349-­6579.



FREE  HOUSE  CATS!  Many   to  choose  from.  Spayed  and   neutered.  Good  homes  only.   Call   802-­388-­1410.   1683   Dog  Team  Rd.,  New  Haven.

Lost/Found US   LOCK   KEY   found   January  6  on  Court  Street,   Middlebury;  near  crosswalk   by   Dunkin   Donuts  /  Cham-­ plain  Farms.  Call  to  identify.   802-­388-­4944.

LAMP REPAIR

skilled, reasonably priced

Homestead Candle & Wreath Shop 3U4P .JEEMFCVSZt ÉŠVST 'SJ4BUPSCZBQQU

FREE   BAGPIPE   AND   DRUMMING   lessons   for   anyone   14   or   older   who   is   looking   to   join   a   marching   bagpipe  and  drum  band.  For   more  information  call  Beth  at   343-­4738.

Help  Wanted

             ANTICIPATED  OPENING Patricia  A.  Hannaford  Regional   Technical  School  District,  Middlebury,  VT POSITION: 1.0  F.T.E.  Automotive/Forestry  &Natural  Resources  Teaching  Assistant RESPONSIBILITIES: Provide  teaching  assistance  to  the  Automotive  (a.m.)  and  Forestry  (p.m.) Instructors REQUIREMENTS: â&#x153;&#x201C; Associates  Degree  or  60  credits  beyond  a  high  school  diploma. â&#x153;&#x201C; Experience  in  forestry,  automotive,  or  heavy  equipment  preferred. â&#x153;&#x201C; Experience  or  training  working  w/high  school  age  students  preferred. PROBABLE  START  DATE:      January  22,  2014

ALARM   INSTALLER:   SE-­ CURITY,   fire,   IP   camera   systems.   Basic   home   con-­ struction   knowledge,   com-­ puter   literate,   dependable   transportation.  Must  undergo   strict   security   background   check.  Random  drug  testing.   Must   be   dependable   and   willing  to  learn.  Paid  vaca-­ tion,   sick   time   and   holiday   pay.  Send  resume:  Alarms,   P.O.   Box   734,   Middlebury,   VT  05753.

Interested  parties  should  send  a  letter  of  interest,  resume,  transcripts   and  letters  of  reference  to:       D.  Lynn  Coale,  Superintendent       Hannaford  Career  Center       51  Charles  Avenue       Middlebury,  VT    05753                                                  E.O.E.

HAS   YOUR   BUILDING   shifted   or   settled?   Contact   Woodford   Brothers   Inc.   for   straightening,   leveling,   foundation  and  wood  frame   repairs  at  1-­800-­OLD-­BARN.   www.woodfordbros.com  . HOME   MAINTENANCE.   Tree  removal  to  clean  outs.   Livestock  care.  Anything  you   need   an   extra   hand   with.   References.  802-­989-­5803.

Karrie Beebe -at- Maplefields Middlebury -orFax: P.O. Box 797 802-388-2955 Middlebury, VT 05753

IN-­HOME   CHILDCARE   available  â&#x20AC;&#x201D;  Shoreham,   VT.   Great   references,   flexible.   hours,   over   8   yearsâ&#x20AC;&#x2122;   pro-­ fessional   experience,   lots   of   space   for   inside  /  outside   activities.  Call  897-­5118  for   further  information  or  to  set   up  a  time  to  see  the  space.

Addison  Independent &ODVVL¿HGVDUH available  on  our   website.

INTERIOR  PAINTING.  Ex-­ cellent  quality,  20  yearsâ&#x20AC;&#x2122;  ex-­ perience.  Best  prices.  Refer-­ ences.  802-­989-­5803,  Paul.

www.addisonindependent.com

METICULOUS   RESIDEN-­ TIAL   CLEANING   Servic-­ es.   12   yearsâ&#x20AC;&#x2122;   experience.   Fully   insured.   Call   Leigh.   802-­282-­1903.

Digital Media Sales:

PRIVATE   CARE   GIVING   Services.   20   yearsâ&#x20AC;&#x2122;   expe-­ rience.   References.   Call   Leigh.  802-­282-­1903.

Services

Services

Services

Reading Mentors Mary Hogan Elementary School in Middlebury is seeking Everybody Wins! Reading Mentors to help its students foster a love of reading and increase l`][`ad\j]fkhjgkh][lk^gjkm[[]kk&=OE]flgjk meet with their students one hour per week on Lm]k\YqkgjO]\f]k\YqkYldmf[`lae]&L`]qhjg% egl] j]Y\af_ ^gj hd]Ykmj]$ `]dh Zmad\ l`] [`ad\k k]d^%[gfĂ&#x161;\]f[]Yf\k]d^%]kl]]e$Yf\k]jn]YkY[Yj% af_jgd]eg\]d&:Y[c_jgmf\[`][ckYf\^mddljYaf% af_Yj]hjgna\]\&Hd]Yk][Ydd+00%/(,,^gjegj] af^gjeYlagf&Gmjngdmfl]]jkDGN=l`akhjg_jYe

Help  Wanted

SALARY:    Based  upon  education  and  experience.

Help  Wanted

Free

Help  Wanted

Help  Wanted

Caleigh  Bushey,  of  Middlebury,  

was   one   of   the   many   wonderful   Patri-­ cia   Hannaford   Career   Center   students   who   volunteered   during   the   United   Wayâ&#x20AC;&#x2122;s   Days   of   Caring.     Caleigh   spent   the   day   at   the   Addison   County   Parent   Child   Center   working   in   the   kitchen,   making   lunch   and   doing   dishes.     Ca-­ leigh  said  that  the  part  she  most  enjoyed   about   volunteering   at   the   Parent   Child   Center  was  â&#x20AC;&#x153;knowing  that  I  was  helping   the  kids  by  making  a  nutritious  lunch.â&#x20AC;?     Thank  you,  Caleigh!

Build  your  portfolio  in  digital  media  by  working   with  local  businesses  to  make  digital  sales productive  and  effective.   We  are  seeking  an   energetic  and  creative   sales  professional  in  the   Rutland-­Manchester  area   with  territories  stretching   into  Middlebury,  Stratton   and  Bennington.   Year-­round  position,   vehicle  allowance,   at  least  one  year  of   sales  experience,   references  required.   Apply  via  email  to   angelo@addisonindependent.com.

L o c a l age n c ie s c a n p o s t t h e i r v o l u n te e r ne e d s w i t h Th e Vo l u n te e r C e n te r by c a l l i ng RSV P at 388-7044.

Addison Independent

CLASSIFIED ORDER FORM

Cash in on our 4-for-3 rates! Pay for 3 issues, get 4th issue free! Plus: Take advantage of our 10% Repeat Discounts! Example: A 20-word ad is just $5.00; less 10% for each issue thereafter. An ad placed for consecutive issues (Mondays & Thursdays) is run 4th time free! Cost is $14.00 for 4 issues plus $1.00 internet charge. UĂ&#x160;-ÂŤiVÂ&#x2C6;>Â?Ă&#x160;{Ă&#x160;vÂ&#x153;Ă&#x20AC;Ă&#x160;Ă&#x17D;Ă&#x160;Ă&#x20AC;>Ă&#x152;iĂ&#x192;Ă&#x160;Â&#x2DC;Â&#x153;Ă&#x152;Ă&#x160;Ă&#x203A;>Â?Â&#x2C6;`Ă&#x160;vÂ&#x153;Ă&#x20AC;Ă&#x160;Ă&#x152;Â&#x2026;iĂ&#x160;vÂ&#x153;Â?Â?Â&#x153;Ă&#x153;Â&#x2C6;Â&#x2DC;}Ă&#x160;V>Ă&#x152;i}Â&#x153;Ă&#x20AC;Â&#x2C6;iĂ&#x192;\Ă&#x160;-iĂ&#x20AC;Ă&#x203A;Â&#x2C6;ViĂ&#x192;]

Opportunities, Real Estate, Wood heat, Attn. Farmers, For Rent & Help Wanted Notices Work Wanted Att. Farmers Card of Thanks Help Wanted Motorcycles Address: Personals For Sale Cars Phone: Services Public Meetings** Trucks Free** DEADLINES: Thurs. noon for Mon. paper For Rent SUVs Mon. 5 p.m. for Thurs. paper Lost â&#x20AC;&#x2122;N Found** Want to Rent Snowmobiles Garage Sales Wood Heat Boats UĂ&#x160;Ă&#x201C;xZĂ&#x160;ÂŤiĂ&#x20AC;Ă&#x160;Ă&#x153;Â&#x153;Ă&#x20AC;`Ă&#x160;UĂ&#x160;Â&#x201C;Â&#x2C6;Â&#x2DC;Â&#x2C6;Â&#x201C;Ă&#x2022;Â&#x201C;Ă&#x160;fĂ&#x201C;°xäĂ&#x160;ÂŤiĂ&#x20AC;Ă&#x160;>`Ă&#x160; Lawn & Garden Real Estate Wanted UĂ&#x160;fÂŁĂ&#x160;Â&#x2C6;Â&#x2DC;Ă&#x152;iĂ&#x20AC;Â&#x2DC;iĂ&#x152;Ă&#x160;Â?Â&#x2C6;Ă&#x192;Ă&#x152;Â&#x2C6;Â&#x2DC;}Ă&#x160;vÂ&#x153;Ă&#x20AC;Ă&#x160;Ă&#x2022;ÂŤĂ&#x160;Ă&#x152;Â&#x153;Ă&#x160;{Ă&#x160;Â&#x2C6;Ă&#x192;Ă&#x192;Ă&#x2022;iĂ&#x192;Ă&#x160;UĂ&#x160;Â&#x201C;Â&#x2C6;Â&#x2DC;Â&#x2C6;Â&#x201C;Ă&#x2022;Â&#x201C;Ă&#x160;Ă&#x201C;Ă&#x160;Â&#x2C6;Â&#x2DC;Ă&#x192;iĂ&#x20AC;Ă&#x152;Â&#x2C6;Â&#x153;Â&#x2DC;Ă&#x192;Ă&#x160; Opportunities Animals Real Estate Wanted

ADDISON INDEPENDENT 58 Maple Street, Middlebury, VT 05753 802-388-4944 Ă&#x153;Ă&#x153;Ă&#x153;°>``Â&#x2C6;Ă&#x192;Â&#x153;Â&#x2DC;Â&#x2C6;Â&#x2DC;`iÂŤiÂ&#x2DC;`iÂ&#x2DC;Ă&#x152;°VÂ&#x153;Â&#x201C;Ă&#x160;UĂ&#x160;Ă&#x160;email: classifieds@addisonindependent.com

PLEASE PRINT YOUR AD...

RATES

Name:

UĂ&#x160;£ä¯Ă&#x160;`Â&#x2C6;Ă&#x192;VÂ&#x153;Ă&#x2022;Â&#x2DC;Ă&#x152;Ă&#x160;>vĂ&#x152;iĂ&#x20AC;Ă&#x160;wĂ&#x20AC;Ă&#x192;Ă&#x152;Ă&#x160;Ă&#x20AC;Ă&#x2022;Â&#x2DC;Ă&#x160;Â&#x153;Â&#x2DC;Ă&#x160;VÂ&#x153;Â&#x2DC;Ă&#x192;iVĂ&#x2022;Ă&#x152;Â&#x2C6;Ă&#x203A;iĂ&#x160;>`Ă&#x192;

Spotlight with large

$2 ** nothesechargeads for

Vacation Rentals

The Independent assumes no financial responsibility for errors in ads, but will rerun classified ad in which the error occurred. No refunds will be possible. Advertiser will please notify us of any errors which may occur after first publication.

Number of words: Cost: # of runs: Spotlight Charge: Internet Listing: TOTAL:

$2.00


 Addison  Independent,  Thursday,  January  16,  2014  â&#x20AC;&#x201C;  PAGE  7B

DIRECTORY

Business Service

Â&#x2021;DFFRXQWDQWV Â&#x2021;DSSOLDQFHUHSDLU Â&#x2021;DXWRJODVV Â&#x2021;DXWRUHSDLU Â&#x2021;EXVLQHVVFDUGV Â&#x2021;FDUSHQWU\FRQWUDFWRUV Â&#x2021;FRPSXWHUV

Â&#x2021;FRQVWUXFWLRQ Ă&#x20AC;QDQFLQJ Â&#x2021;GHQWLVWU\ Â&#x2021;HOHFWULFLDQ Â&#x2021;HTXLSPHQWUHQWDOV Â&#x2021;Ă RRUFDUH Â&#x2021;KDQG\PDQ

Â&#x2021;KHDOWKFDUH Â&#x2021;KHDWLQJDF Â&#x2021;LQYLWDWLRQV Â&#x2021;LQVXODWLRQ Â&#x2021;OXPEHU Â&#x2021;PDVRQU\

Handyman

Construction Financing

453-­5611

SMALL  JOBS

Offering    a  complete  service  package  for  businesses:

Bookkeeping,  Payroll  &  Tax  Preparation! FREE  ONE  HOUR  CONSULTATION

HANDYMAN  SERVICES~AND~MUCH  MORE

Mike  Dever    Expert  Painter          Honest                Dependable

For  New  Business  Startup

,QLWLDOVWDUWLQJIHHLQFOXGHVÂżOLQJRIDOOQHFHVVDU\SDSHUZRUNWR IRUP\RXUEXVLQHVVSDUWQHUVKLSRUFRUSRUDWLRQ

0DLQ6W6XLWH9HUJHQQHVÂ&#x2021; thomasbusinessagency@comcast.net

Rene Many -­ CTPA, Inc.

Heating/AC

Tax  Preparation  &  Accounting

Corporate  Partnerships,  Small  Businesses   &  Personal  Returns

Call 758-­2000 Today!

Ductwork Design Â&#x2021; Sealing Fabrication Â&#x2021; Installation Insulation Â&#x2021; Replacement Plasma Art Â&#x2021; Torches Welding Â&#x2021; Plasma Table H.R.V. / E.R.V. Installation Ductwork Video Camera

Dentistry â&#x20AC;&#x153;We  try  our  best  to  give  superior   quality  and  comfort. Our  team  cares  about  your   dental  health.â&#x20AC;?

MARK TRUDEAU GENERAL CARPENTRY HOME IMPROVEMENTS LOCAL CONTRACTOR

Cell: 802-989-5231 Office: 802-453-2007

J]eg\]daf_9\\alagfk HYaflaf_JggĂ&#x161;f_

CHECK US OUT ONLINE AT WWW.ADDISONINDEPENDENT.COM

WINNER  of  â&#x20AC;&#x153;Best  Local  Contractorâ&#x20AC;?  for THREE  CONSECUTIVE  YEARS    by   READERS  CHOICE  AWARDS!

802.388.0860

Thomas  A.  Coleman,  D.D.S.

WINDOW  &  SIDING  CO.,  INC :LQGRZVÂ&#x2021;9LQ\OVLGLQJÂ&#x2021;*DUDJHV 5RRIVÂ&#x2021;$GGLWLRQVÂ&#x2021;'HFNV

Specializing in Ductwork for Heating, Ventilating & Air Conditioning Systems Commercial/Residential . Owner Operated . Fully Insured . Neat & Clean

Ayrshire  Professional  Building &DUYHU6WUHHWÂ&#x2021;%UDQGRQ97

Invitations

(802)  247-­3336 www.drtomcoleman.com

Stop in to the Addison Independent office in the Marble Works to order your custom

Invitations

Electrician

for any occasion!

MIDDLEBURY, VERMONT

CLOVER STATE

Buy  Local!      802.989.0396

RESIDENTIAL WIRING & TROUBLE SHOOTING TERRY BLAIR LICENSED & INSURED

      For more information call 388-4944

388-6869

Insulation

Waste Management â&#x20AC;&#x201C; Roll-off container service Desabrais Means Glass & Affordable Service

s 7INDSHIELD 2EPAIR s )NSULATED 'LASS s 0LATE 'LASS s 7INDOW 'LASS s 0LEXIGLASS s 3AFETY 'LASS s -IRRORS s !UTO 'LASS s 3TORM 7INDOWS s 3CREEN 2EPAIRS s #USTOM 3HOWER $OOR %NCLOSURES 6INYL 2EPLACEMENT WINDOWS AND #OMPLETE )NSTALLATION

Fast, friendly, reliable service & competitive rates.

802-­877-­2102  Toll  Free:  888-­433-­0962

Equipment Rentals

mlbrunet@gmavt.net

www.cloverstate.com

Insurance Approved discounts

40  TYPES  OF  RENTAL  EQUIPMENT  TO  CHOOSE  FROM

Â&#x2021;PDWHULDOIRUNOLIWV Â&#x2021;H[FDYDWRUV Â&#x2021;EXOOGR]HUV Â&#x2021;PLQLH[FDYDWRUV Â&#x2021;VNLGVWHHUV

0LGGOHEXU\97Â&#x2021;

Automotive

Â&#x2021;0DQOLIWVXSWRÂś Â&#x2021;PDQEDVNHWZFUDQH XSWR

Â&#x2021;FRQFUHWHFRPSDFWRUV Â&#x2021;EDFNKRHV

'HQVH3DFN&HOOXORVHÂ&#x2021;%ORZQ,Q,QVXODWLRQ &RPSOHWH$LU6HDOLQJ

Â&#x2021;0DXULFH3ORXIIH 4XDNHU9LOODJH5RDG:H\EULGJH97

Over  30  yrs.  experience

Field  Automotive  Inc. &RPSOHWH$XWR6HUYLFHÂ&#x2021;'RPHVWLF )RUHLJQ5HSDLUV

Preventive  Maintenance %UDNHVÂ&#x2021;7XQHXSVÂ&#x2021;([KDXVWV 7RZLQJÂ&#x2021;$OLJQPHQWV $LU&RQGLWLRQLQJÂ&#x2021;6WDWH,QVSHFWLRQV

www.brownswelding.com 275 South 116, Bristol, Vermont 05443  Â&#x2021;&HOO  

62  Meigs  Rd.,  Vergennes

877-­9222

Floor Care

Business Cards ards C s s e n i s u B rder Made to O

Labels & Letterhead too!

Order your  Custom  Business  Cards  here at   the  Addison  Independent. Call  Vicki  at  388-­4944  or   VWRSE\RXURI¿FHLQWKH0DUEOH:RUNV EHWZHHQDP SP0RQGD\)ULGD\

Need Computer Help?

CALL MIKE FORTE

MOBILE COMPUTER SERVICE & SALES

388-2137

THE PC MEDIC OF VERMONT

GET YOUR COMPUTER RUNNING LIKE NEW AGAIN ! Â&#x2021;)DVW5HOLDEOH5HSDLUV Â&#x2021;+DUGZDUH 6RIWZDUH,QVWDOODWLRQV 8SJUDGHV Â&#x2021;6S\ZDUH5HPRYDO 9LUXV3URWHFWLRQ Â&#x2021;6HFXUH:LUHOHVV1HWZRUN6HWXS Â&#x2021;&RPSXWHU3XUFKDVLQJ$VVLVWDQFH Â&#x2021;$IIRUGDEOH5DWHVDW<RXU&RQYHQLHQFH

3DXO&ODXGRQÂ&#x2021; pcmedic@gmavt.net

Quaker Village CARPENTRY Siding,  Windows,  Garages,  Decks  &  Porches New  Construction,  Renovations  and  Repairs

Maurice Plouffe

802-545-2251 1736 Quaker Village Road Weybridge, VT 05753

CSI: Computer Specialists Inc. Your LOCAL PC Specialist Â&#x2DC;1/276'4#.'5n'48+%' Â&#x2DC;75+0'55#0&'5+&'06+#. Â&#x2DC;'6914-+0) Â&#x2DC;'9'&7%'&#6'5

388-­1444

www.computersvt.com Rte 7 So., Middlebury (across from A&W)

Independent

Announcements

ALLENâ&#x20AC;&#x2122;S FLOOR & CARPET CARE 877-9285

Wedding The Invitations Addison

=H9;]jlaĂ&#x161;]\ Renovator

More than just a newspaper!

Stationary

PROFESSIONAL SERVICEÂ&#x2021;SERVING OUR CUSTOMERS SINCE 1992 RESIDENTIAL & COMMERCIAL RESTORE & REFINISH ALL WOOD FLOORS CLEANING OF CARPETS AND UPHOLSTERY TILE & OTHER FLOORS

Lumber

FREE ESTIMATESÂ&#x2021;)ULLY INSURED

6cYgZĂ&#x2030;h;addgGZĂ&#x2019;c^h]^c\ - An Established Vermont Business with Over 25 Years of Experience -

Specializing in Hardwood & Softwood Floors Commercial Oil and Waterborne Finishes Quailty Workmanship - Competitive Pricing 54 Daigneault Hill Road Orwell,Vermont 05760

802-948-2004

Â&#x201E; Rough Lumber Native   Vermonter

Â&#x201E; Pine Siding

Â&#x201E; Open most nights & weekends

Â&#x201E;Long Beams

802-388-7828 Â&#x201E; End of S. Munger St.Ă&#x160;Â&#x201E; Middlebury

Masonry F��� D�� S���� M������

Jď?Ąď?­ď?Šď?Ľ Mď?Ąď?łď?Ľď?Śď?Šď?Ľď?Źď?¤

C�������� �� ��� D�� S���� W������ A���������� �� G���� B������

802-233-4670 jmasefield@gmavt.net


PAGE8B  â&#x20AC;&#x201D;  Addison  Independent,  Thursday,  January  16,  2014

&

DIRECTORY

Business Service Masonry

DAVID PETERS MASONRY & CONSTRUCTION, LTD. Stone...everlasting...a balance of logic, strength and scale... a framework for natureâ&#x20AC;&#x2122;s enduring beauty.

Stone & Brick Masonry

Â&#x2021;+HDWLQJ6\VWHPV Â&#x2021;3OXPELQJ6XSSOLHV Â&#x2021;3URIHVVLRQDO,QVWDOODWLRQ

NDON'S DUPlumbing & Heating

Â&#x2021;%DWKURRP'HVLJQ Â&#x2021;:DWHU7UHDWPHQW Â&#x2021;*UHDW$GYLFH

5W$2UZHOO  Â&#x2021; 

5RRĂ&#x20AC;QJ

$VSKDOW6ODWH 6WDQGLQJ6HDP5RRĂ&#x20AC;QJ 5RRI 5HSDLU

802 349 9795 HOME: 802 352 4749 WWW.VERMONTHOMEANDHEARTH.COM HEARTHANDSTONE@MYFAIRPOINT.NET

roofi ng Michael Doran

As  seen  at  Addison  County  Field  Days!

Â&#x2021;SOXPELQJ KHDWLQJ Â&#x2021;SURSHUW\ PDQDJHPHQW Â&#x2021;UHQHZDEOHHQHUJ\ Â&#x2021;URRĂ&#x20AC;QJ Â&#x2021;VHSWLF Â&#x2021;VHSWLF ZDWHU

Installation  &  Service 125  Monkton  Road Bristol,  VT  05443 802-­453-­2325

Fuel 185  Exchange  Street Middlebury,  VT  05753 802-­388-­4975

AIRPORT AUTO 6HOI6WRUDJHÂ&#x2021;/RZ5DWHV

$OVRDJRRGVHOHFWLRQRIXVHGYHKLFOHV 44 School House Hill Road, E. Middlebury

Â&#x2021;

)UHHHVWLPDWHVÂ&#x2021;)XOO\,QVXUHG

Phone (802) 537-3555

Bruce  A.  Maheuâ&#x20AC;&#x2122;s

Owned  and  operated  by: Bill  Heffernan,   Jim  &  David  Whitcomb

  MASONRY

STORAGE 4 Sizes ~ Self-locking units Hardscrabble Rd., Bristol

Serving  all  your  plumbing  and  heating  needs.

Septic

Monthly prices

6â&#x20AC;&#x2122;x12â&#x20AC;&#x2122; $30 t8â&#x20AC;&#x2122;x12â&#x20AC;&#x2122; $45 10â&#x20AC;&#x2122;x12â&#x20AC;&#x2122; $55 t12â&#x20AC;&#x2122;x21â&#x20AC;&#x2122; $75

NEW  &  REPAIR 5HVLGHQWLDOÂ&#x2021;/DNH&DPSV 'XQPRUH

Brick  â&#x20AC;&#x201C;  Block  â&#x20AC;&#x201C;  Stone   &KLPQH\V)LUHSODFHV2XWVLGH%DUEHFXHV 6WHSV3DWLRV6WRQH:DOOV

Â&#x2021;

TANK  &  CESSPOOL  PUMPING ELECTRONIC  TANK  LOCATING TANK  &  LEACH  FIELD  INSPECTIONS CAMERA  INSPECTIONS NEW  SYSTEMS  INSTALLED ALL  SEPTIC  SYSTEM  REPAIRS DRAIN  &  PIPE  CLEANING

27 Years Experience Honest & Fair Pricing Free Estimates Fully Insured

 

Â&#x2021;VLGLQJ Â&#x2021;VWRUDJH Â&#x2021;VXUYH\LQJ Â&#x2021;WD[VHUYLFHV Â&#x2021;YHWHULQDU\VHUYLFHV Â&#x2021;ZHOGLQJVXSSOLHV

Â&#x2021;6WDQGLQJVHDP Â&#x2021;$VSKDOWVKLQJOHV Â&#x2021;6ODWH

)LUHSODFHVÂ&#x2021;+HDUWKVÂ&#x2021;&KLPQH\V &KLPQH\&OHDQLQJ ,QVSHFLWRQ 5HSDLU 5HSRLQWLQJÂ&#x2021;3DWLRV :DOOVÂ&#x2021;&XOWXUHG6WRQHÂ&#x2021;6WHSV

CELL:

Â&#x2021;PDVRQU\ Â&#x2021;PHGLFDOVXSSOLHV Â&#x2021;PXVLFOHVVRQV Â&#x2021;RGGMREV Â&#x2021;SDLQWLQJ Â&#x2021;SDYLQJFRQWUDFWRUV Â&#x2021;SKRWRJUDSK\

                                                 Call  Bruce Salisbury,  VT        802-­352-­6050  

VISIT US ON FACEBOOK

Full   Excavation Service

CREDIT CARDS ACCEPTED

www.livingstonfarmlandscape.com

SHORT  SURVEYING,  INC.

Middlebury,  VT

Serving Addison County Since 1991

Timothy L. Short, L.S. Rodney Orvis, L.S.

Medical Supplies

Septic & Water FOR SEPTIC TANK PUMPING & DRAIN CLEANING SERVICE, Rely on the professionals. PORTABLE RESTROOMS

Medical Equipment and Oxygen SALES & RENTAL Knowledgable Staff

Personalized Service

Fax: 388-4146 Marble Works, Middlebury, VT

388-9801

Property Management RENTALS WANTED

Music Lessons Banjo,  Fiddle,  Guitar,  Mandolin, Bass  &  Accordian  Lessons in  the  Middlebury  area

One  solution  may  be  renting.   We  have  a  waiting  list  of   SUHTXDOL¿HGWHQDQWVORRNLQJIRU long  and  short  term  rentals.   Contact  Ray  Fortier  to  discuss  your  options  

Chris  Prickitt

Rental  management  provided.   802ray@gmail.com www.middleburyvthousesforsale.com

802-­377-­8202 &ROGZHOO%DQNHU%LOO%HFN5HDO(VWDWH

Painting

HESCOCK PAINTING Free Estimates References Fully Insured

Spruce up for the holiday season! A friendly, professional, and affordable family business.

462-3737 or 989-9107 Kim or Jonathan Hescock hescock@shoreham.net

DO DUN N'S Plumbing & Heating

Rt. 22A, Orwell 948-2082 Â&#x2021; 388-2705

Septic & Water

Jason Barnard Consulting, LLC Septic & Water System Designs State and Local Permitting Environmental Site Assessments Underground Storage Tank Removal Assessments Call 802-453-2597 or email jbsitetech@hotmail.com

Renewable Energy

LAROSE SURVEYS, P.C. Ronald L. LaRose, L.S. â&#x20AC;˘ Kevin R. LaRose, L.S.

Land Surveying/Septic Design â&#x20AC;&#x153;We will take you through the permitting process!â&#x20AC;?

25 West St. â&#x20AC;˘ PO Box 388 Bristol, VT 05443 Telephone: 802-453-3818 Fax: 802- 329-2138

larosesurveys@gmail.com

Tax Services K8OGI<G8I8K@FE %UXFH0%HUJPDQ&73$&HUWLÂżHG7D[3URIHVVLRQDO$GYLVRU

THOMAS TAX SERVICES, INC. thomasbusinessagency@comcast.net

&OLSRUPHQWLRQWKLVDG

95 Basic Return 69 Package Includes:

*$

Â&#x2021;)HGHUDO97OOO Â&#x2021;)UHH(OHFWURQLF)LOLQJIRU7D[5HIXQGV)DVW Â&#x2021;3UHSIHHVFDQEHGHGXFWHGIURPUHIXQG

Vergennes

0DLQ6W6XLWH

877-­2684

Soak  Up  The  Sun! Donâ&#x20AC;&#x2122;t  spend  your  hard-­earned  money   making  the  hot  water  or  electricity  that   you  use  todayâ&#x20AC;&#x201C; SOLAR  IS  MORE  AFFORDABLE  THAN  EVER! Weâ&#x20AC;&#x2122;ve  been  here  for  you  for  41  years  â&#x20AC;&#x201C;   Let  us  help  you  with  your  solar  projects  today.  

Celebrating 28 Years

(QYLURQPHQWDO&RQVXOWDQWV²&HUWLILHG6LWH7HFKQLFLDQV Steve Revell CPG-­CST Â&#x2021;:DWHU6XSSO\/RFDWLRQ'HYHORSPHQWDQG3HUPLWWLQJ Â&#x2021;2Q6LWH:DVWHZDWHU'HVLJQÂ&#x2021;6LQJOH 0XOWLSOH/RW6XEGLYLVLRQ Â&#x2021;3URSHUW\'HYHORSPHQW 3HUPLWWLQJ Â&#x2021;6WDWHDQG/RFDO3HUPLWWLQJ Â&#x2021;8QGHUJURXQG6WRUDJH7DQN5HPRYDO $VVHVVPHQW Toll-­Free:  800-­477-­4384

802-­453-­4384

Photography

)D[Â&#x2021;(PDLOMUHYHOO#ODJYWFRP 5HYHOO'ULYHÂ&#x2021;/LQFROQ97 Go  Green  with  us  â&#x20AC;&#x201C; Call  for  a  FREE  on-­site  evaluation

Cphotography apture those

www.lagvt.com

Burlington

9HVW+DYHQ'U

864-­0838

Veterinary Services Washington St. Ext. Middlebury

www.middleburyah.com

388-2691 Thomas L. Munschauer, D.V.M. Scott Sutor, D.V.M. Tracy A. Winters, V.M.D. Mark C. Doran, V.M.D.

Welding Supplies

special times

with images from award-winning

DAVID PETERS

photographer

MASONRY & CONSTRUCTION, LTD.

ROOFING

]ifdXnXi[$n`ee`e^g_fkf^iXg_\i

Trent Campbell.

Standing Seam, Asphalt & Slate Roofing & Roof Repair trent campbell

989-8369

63OHDVDQW6W0LGGOHEXU\97 388-­3511 ssi@sover.net

Property  hasnâ&#x20AC;&#x2122;t  sold?  Going  on  sabbatical?

Private,  group  &  ensemble  work, plus  instrument  rentals

207-­924-­4121              chrisprickitt@gmail.com

3URSHUW\/LQH6XUYH\VÂ&#x2021;7RSRJUDSKLFDO6XUYH\V )(0$(OHYDWLRQ&HUWLILFDWHV

photography

CELL: (802) 349-9795 HOME: (802) 352-4749 WWW.VERMONTHOMEANDHEARTH.COM HEARTHANDSTONE@MYFAIRPOINT.NET


 Addison  Independent,  Thursday,  January  16,  2014  â&#x20AC;&#x201D;  PAGE  9B

Addison Independent

CLASSIFIEDS Help  Wanted

Help  Wanted

VOTED  ONE  OF  THE  BEST PLACES  TO  WORK  IN VERMONT  FOR  4  YEARS! Four time winner of the Best Places to Work in VT award, Country Home Products, is a worldwide seller of outdoor power equipment and home of DRÂŽ and Power Equipment Plus. Weâ&#x20AC;&#x2122;re looking for Seasonal Sales Specialists to join the call center team in Vergennes, VT. 4XDOLĂ&#x20AC;HGFDQGLGDWHVZLOOKDYHDWOHDVWPRQWKV of sales experience, good computer skills, VWURQJYHUEDOFRPPXQLFDWLRQVNLOOVDQGDQ DELOLW\WRJDWKHULQIRUPDWLRQDQGPDNHGHFLVLRQVEDVHGRQWKHFULWHULDRIWKHGHSDUWPHQW ,I\RXHQMR\ZRUNLQJZLWKSHRSOHORYHDFKDOOHQJHDQGIULHQGO\FRPSHWLWLRQZH¡GOLNHWR KHDUIURP\RX 3OHDVHDSSO\ZLWKDFRYHUOHWWHUDQGUHVXPHDW KWWSVKRPHHHDVHDGSFRP UHFUXLW"LG 

VOTED  ONE  OF  THE  BEST PLACES  TO  WORK  IN VERMONT  FOR  4  YEARS! Country Home Products, home of DR Power Equipment and Power Equipment Plus, is looking for Seasonal Customer Service Technical Specialists to join our busy inbound call center in Vergennes! Do you tinker on small engines or outdoor power equipment? Are you generally mechanically inclined? Do you have a professional telephone manner, basic computer skill, and enjoy talking with the public? Do you want to work for a 4 time winner of the Best Places to Work in VT Award? If so, we want to hear from you! Seasonal Customer Service Technical Specialists handle a high volume of inbound customer calls and help resolve technical inquiries relating to our products, while earning $11.00 per hour plus paid incentive programs.

VOTED  ONE  OF  THE  BEST PLACES  TO  WORK  IN VERMONT  FOR  4  YEARS! Country Home Products, home of DR Power Equipment and Power Equipment Plus, is looking for Seasonal Customer Service Specialists to join our busy inbound call center in Vergennes! Do you have solid computer & problem solving skills and enjoy working in a fast-paced environment? Do you want to work for a 4 time winner of the Best Places to Work in VT Award? If so, CHP wants to hear from you! Seasonal Customer Service Specialists handle a high volume of inbound customer calls and resolve all customer inquiries relating to our products, billing, shipping and procedures, while earning $11.00 per hour plus paid incentive programs. The successful candidate will possess the ability to work closely with other departments while prioritizing and organizing daily follow-ups to ensure timely resolution for our customers. Please apply with a cover letter and resume at: https://home.eease.adp.com/ recruit/?id=7385351

WĹ&#x161;Ĺ˝Ä&#x17E;ĹśĹ?Ç&#x2020;&Ä&#x17E;Ä&#x17E;Ä&#x161;Ć?Î&#x2DC;EĆľĆ&#x161;Ć&#x152;Ĺ?Ć&#x;ŽŜÍ&#x2022;/ĹśÄ?Í&#x2DC;,  a  growing   New  Haven-­â&#x20AC;?based  custom  dairy  feed  manu-­â&#x20AC;? facturer,   is   looking   for   the   ideal   individuals   Ć&#x161;ŽĎůůĆ&#x161;Ĺ&#x161;Ä&#x17E;Ä¨Ĺ˝ĹŻĹŻĹ˝Ç Ĺ?ĹśĹ?Ć&#x2030;Ĺ˝Ć?Ĺ?Ć&#x;ŽŜĆ?Í&#x2014; DĹ?ĹŻĹŻ WĆ&#x152;Ĺ˝Ä&#x161;ĆľÄ?Ć&#x;ŽŜ ^Ć&#x2030;Ä&#x17E;Ä?Ĺ?Ä&#x201A;ĹŻĹ?Ć?Ć&#x161; Í´   your   Ä&#x161;ĆľĆ&#x;Ä&#x17E;Ć? Ç Ĺ˝ĆľĹŻÄ&#x161; Ĺ?ĹśÄ?ĹŻĆľÄ&#x161;Ä&#x17E; &Ä&#x17E;Ä&#x17E;Ä&#x161; WĆ&#x152;Ĺ˝Ä&#x161;ĆľÄ?Ć&#x;ŽŜ Ä&#x201A;ĹśÄ&#x161; ĹľÄ&#x201A;Ĺ?ĹśĆ&#x161;Ä&#x201A;Ĺ?ĹśĹ?ĹśĹ? Ä&#x201A; Ć?Ä&#x201A;ĨÄ&#x17E; Ä&#x201A;ĹśÄ&#x161; Ä&#x17E;ĸÄ?Ĺ?Ä&#x17E;ĹśĆ&#x161; Ç Ĺ˝Ć&#x152;ĹŹ Ä&#x17E;ĹśÇ&#x20AC;Ĺ?-­â&#x20AC;? ronment  for  our  feed  mill.     zŽƾĆ&#x152;Ĺ&#x161;ŽƾĆ&#x152;Ć?Ç Ĺ˝ĆľĹŻÄ&#x161;Ä&#x17E;ĹśÄ?ŽžĆ&#x2030;Ä&#x201A;Ć?Ć?Ä&#x161;Ä&#x201A;Ç&#x2021;Ć?Í&#x2022;ĹśĹ?Ĺ?Ĺ&#x161;Ć&#x161;Ć? as   well   as   some   weekend   hours.   Are   you   Ä&#x201A;Ä?ĹŻÄ&#x17E;Ć&#x161;ŽůĹ?Ĺ&#x152;ϹϏĆ&#x2030;ŽƾŜÄ&#x161;Ć?Í?tĹ˝Ć&#x152;ĹŹĹ?ĹśÄ&#x161;Ä&#x17E;Ć&#x2030;Ä&#x17E;ĹśÄ&#x161;Ä&#x17E;ĹśĆ&#x161;ĹŻÇ&#x2021;Í&#x2022; Ĺ?ĹśĆ&#x161;Ä&#x17E;ĹśĆ?Ĺ?Ç&#x20AC;Ä&#x17E;ĹŻÇ&#x2021;Ä&#x201A;ĹśÄ&#x161;Ć&#x152;Ä&#x17E;ĹŻĹ?Ä&#x201A;Ä?ĹŻÇ&#x2021;Í?/ĨÇ&#x2021;ŽƾÇ Ĺ˝ĆľĹŻÄ&#x161;ĹŻĹ?ĹŹÄ&#x17E;Ä&#x201A; Ä?Ä&#x201A;Ć&#x152;Ä&#x17E;Ä&#x17E;Ć&#x152; Ĺ?Ĺś Ĺ?Ć&#x152;Ĺ?Ä?ĆľĆ?Ĺ?ĹśÄ&#x17E;Ć?Ć?Í&#x2022; Ć&#x161;Ĺ&#x161;Ĺ?Ć? Ĺ?Ć? Ä&#x201A; Ĺ?ŽŽÄ&#x161; Ć&#x2030;ĹŻÄ&#x201A;Ä?Ä&#x17E; Ć&#x161;Ĺ˝ Ć?Ć&#x161;Ä&#x201A;Ć&#x152;Ć&#x161;Í&#x2DC; ŽžĆ&#x2030;Ä&#x17E;Ć&#x;Ć&#x;Ç&#x20AC;Ä&#x17E; Ç Ä&#x201A;Ĺ?Ä&#x17E;Ć? Ä&#x201A;ĹśÄ&#x161; Ĺ?Ä&#x17E;ĹśÄ&#x17E;Ć&#x152;ŽƾĆ? Ä?Ä&#x17E;ĹśÄ&#x17E;ÄŽĆ&#x161;Ć?Ć&#x2030;ĹŻÄ&#x201A;ĹśÄ&#x201A;Ć&#x152;Ä&#x17E;ŽčÄ&#x17E;Ć&#x152;Ä&#x17E;Ä&#x161;Í&#x2DC; ZÄ&#x17E;ĹŻĹ?Ä&#x17E;ĨĆ&#x152;Ĺ?Ç&#x20AC;Ä&#x17E;Ć&#x152;Í´Ç&#x2021;ŽƾĆ&#x152;Ä&#x161;ĆľĆ&#x;Ä&#x17E;Ć?Ç Ĺ˝ĆľĹŻÄ&#x161;Ĺ?ĹśÄ?ĹŻĆľÄ&#x161;Ä&#x17E;   delivering  feed  to  customers  as  well  as  back   hauling   ingredients.     Your   hours   would   en-­â&#x20AC;? Ä?ŽžĆ&#x2030;Ä&#x201A;Ć?Ć?Ä&#x161;Ä&#x201A;Ç&#x2021;Ć?Í&#x2022;ĹśĹ?Ĺ?Ĺ&#x161;Ć&#x161;Ć?Ä&#x201A;Ć?Ç Ä&#x17E;ĹŻĹŻÄ&#x201A;Ć?Ć?ŽžÄ&#x17E;Ç Ä&#x17E;Ä&#x17E;ĹŹ-­â&#x20AC;? Ä&#x17E;ĹśÄ&#x161; Ĺ&#x161;ŽƾĆ&#x152;Ć?Í&#x2DC; Ć&#x152;Ä&#x17E; Ç&#x2021;Žƾ Ä&#x201A;Ä?ĹŻÄ&#x17E; Ć&#x161;Ĺ˝ ĹŻĹ?Ĺ&#x152; ϹϏ Ć&#x2030;ŽƾŜÄ&#x161;Ć?Í? tĹ˝Ć&#x152;ĹŹĹ?ĹśÄ&#x161;Ä&#x17E;Ć&#x2030;Ä&#x17E;ĹśÄ&#x161;Ä&#x17E;ĹśĆ&#x161;ĹŻÇ&#x2021;Í&#x2022;Ĺ?ĹśĆ&#x161;Ä&#x17E;ĹśĆ?Ĺ?Ç&#x20AC;Ä&#x17E;ĹŻÇ&#x2021;Ä&#x201A;ĹśÄ&#x161;Ć&#x152;Ä&#x17E;ĹŻĹ?Ä&#x201A;Ä?ĹŻÇ&#x2021;Í? WĹŻÄ&#x17E;Ä&#x201A;Ć?Ä&#x17E;Ä&#x201A;Ć&#x2030;Ć&#x2030;ĹŻÇ&#x2021;Ĺ?ĹśĆ&#x2030;Ä&#x17E;Ć&#x152;Ć?ŽŜÄ&#x201A;Ć&#x161;WĹ&#x161;Ĺ˝Ä&#x17E;ĹśĹ?Ç&#x2020;&Ä&#x17E;Ä&#x17E;Ä&#x161;Ć?Ä&#x201A;ĹśÄ&#x161;   EĆľĆ&#x161;Ć&#x152;Ĺ?Ć&#x;ŽŜÍ&#x2022;ϹϰϴώĆ&#x161;Ĺ&#x161;Ä&#x201A;ŜůůÄ&#x17E;Ĺś,Ĺ?Ĺ?Ĺ&#x161;Ç Ä&#x201A;Ç&#x2021;ÍžZŽƾĆ&#x161;Ä&#x17E; ϳͿĹ?ĹśEÄ&#x17E;Ç ,Ä&#x201A;Ç&#x20AC;Ä&#x17E;ĹśÄ?Ä&#x17E;Ć&#x161;Ç Ä&#x17E;Ä&#x17E;ĹśĆ&#x161;Ĺ&#x161;Ä&#x17E;Ĺ&#x161;ŽƾĆ&#x152;Ć?ŽĨĎ´Ä&#x201A;Í&#x2DC;ĹľÍ&#x2DC; Ä&#x201A;ĹśÄ&#x161;Ď°Ć&#x2030;Í&#x2DC;ĹľÍ&#x2DC;&Ĺ?ĹśÄ&#x161;ŽƾĆ&#x161;žŽĆ&#x152;Ä&#x17E;Ĺ?ŜĨŽĆ&#x152;ĹľÄ&#x201A;Ć&#x;ŽŜÄ&#x201A;Ä?ŽƾĆ&#x161; WĹ&#x161;Ĺ˝Ä&#x17E;ĹśĹ?Ç&#x2020;&Ä&#x17E;Ä&#x17E;Ä&#x161;Ć?Ä&#x201A;Ć&#x161;Ç Ç Ç Í&#x2DC;Ć&#x2030;Ĺ&#x161;Ĺ˝Ä&#x17E;ĹśĹ?Ç&#x2020;ĨÄ&#x17E;Ä&#x17E;Ä&#x161;Ć?Í&#x2DC;ĹśÄ&#x17E;Ć&#x161;

Help  Wanted

Help  Wanted

BANKRUPTCY:   CALL   to   find   out   if   bankruptcy   can   help   you.   Kathleen   Walls,   Esq.  802-­388-­1156.

FARMER  /  E QUIPMENT   OPERATOR:   Full   Moon   F a r m   ( w w w. f u l l m o o n -­ farminc.com)  is  looking  for   an  experienced  farmer  for   building  maintenance,  trac-­ tor  (operation,  maintenance   and   minor   repairs)   and   swine   herd   management.   This  is  a  year-­round  posi-­ tion.  598-­1986.  Hinesburg.

BOISE   CITGO   is   looking   for   a   part-­time   secretary  /   bookkeeper.  Computer  skills   Help  Wanted and  Quickbook  s  experience   a   plus.   Pay   depending   on   AUTOMOTIVE   TECHNI-­ experience.  Call  Boise  Citgo   CIAN   NEEDED.   Must   be   after  11am,  802-­758-­2361. able   to   diagnose   electrical   and   electronic   problems.   EXP.   REEFER   DRIVERS;   Prefer   ASE   master   tech,   Great   pay.   Freight   lanes   but   not   required.  Apply   in   f r o m   P r e s q u e   I s l e ,   person   or   send   resume   to   M E ,   B o s t o n -­ L e h i g h , Â�� Mikeâ&#x20AC;&#x2122;s   Auto,   19A   Elm   St,   PA   8 0 0 -­ 2 7 7 -­ 0 2 1 2   o r   driveforprime.com  . Middlebury,  VT.

BET-CHA TRANSIT, INC. IMMEDIATE OPENINGS

Bet-cha Transit, Inc. has immediate openings for route & activity drivers in Addison County. We fully train you and pay all your licensing costs. Eliminate childcare costs and collect unemployment over the summer months and holidays. For more information call Don or Vicki at 388-7800

MIDDLEBURY UNION HIGH SCHOOL Temporary Foreign Language (Spanish/French) Teacher Middlebury Union High School has a vacancy for a temporary 1.0 FTE Foreign Language Teacher (Spanish and French; however, 1 or other is acceptable) beginning April 17, 2014 through the remainder of the school year. Successful candidate must have an appropriate 9-12 Licensure. Apply by sending letter of interest, resume, three current reference letters, complete transcripts and evidence of licensure to: Dr. Peter Burrows, Superintendent Addison Central Supervisory Union 49 Charles Avenue Middlebury,VT 05753 Application Deadline: February 4, 2014 E.O.E.

BRIDPORT CENTRAL SCHOOL Anticipated Long-Term Substitute Bridport Central School is seeking a long-term PreK-K Teacher substitute for a maternity leave from April 28 through June 20, 2014. This position is supported by a classroom assistant and serves 18 students ranging in age from 3-6. Experience with Responsive Classroom, Mindfulness, and or Whole Brain Teaching is preferred. Apply by sending a letter of interest, resume, three current reference letters, complete transcripts and evidence of licensure to: Dr. Peter L. Burrows, Superintendent Addison Central Supervisory Union 49 Charles Avenue Middlebury,VT 05753 Application Deadline: January 31, 2014 E.O.E.

Phoenix   Feeds   and   Nutrition,   Inc.   based   in   New   Haven,   VT.   is   looking   IRU D TXDOLÂżHG LQGLYLGXDO WR MRLQ RXU customer   service   team.     Duties   in-­ clude,   but   are   not   limited   to,   taking   customer  orders  via  phone  and  email,   processing   orders   through   our   com-­ SXWHUV\VWHPIURPRUGHUWRLQYRLFHÂżO-­ ing  and  keeping  track  of  various  sales   and  inventory  spreadsheets.  This  is  a   full  time  position.  Our  ideal  candidate   will  have  a  strong  balance  of  both  cus-­ tomer   service   and   accounts   receiv-­ DEOH H[SHULHQFH Ă&#x20AC;XHQW NQRZOHGJH RI 0LFURVRIW 2IÂżFH  SURJUDPV LQFOXGLQJ ([FHODVZHOODVĂ&#x20AC;H[LELOLW\WREHFURVV WUDLQHG LQ RWKHU RIÂżFH GHSDUWPHQWV Microsoft     Dynamics   GP   experience   a  plus. Please  submit  resume  and  three  ref-­ erences  via  email  to: shannon@phoenixfeeds.net   or  by  mail  to:     Phoenix  Feeds  &  Nutrition,   Attention:    Shannon  Kayhart,   PO  Box  36,  New  Haven,  VT  05491.

Help  Wanted

For  Rent

For  Rent



2   BEDROOM   HOUSE,   completely   furnished   for   6   month   rental   on   Lake   Dunmore.  Dec.  21,  2013  to   June  21,  2014.  Very  energy   efficient,  washer  and  dryer,   85â&#x20AC;&#x2122;  of  frontage,  no  pets,  no   smoking.   $900  /  mo.   plus   utilities.  802-­352-­6678.

CORNWALL  EFFICIENCY   APARTMENT   clean   and   quiet.   $650   includes   all.   989-­8124.

RESIDENTIAL  PROGRAM   CLINICIAN,   RUTLAND.   Exciting  opportunity  to  pro-­ vide  clinical  oversight,  indi-­ vidual  &  group  therapy,  and   implementation   of   treat-­ ment  plans  in  an  innovative   residential   setting   serving   adolescent  males.  Full-­time   FIRE  &  ICE  RESTAURANT   offering  excellent  compen-­ is  looking  for  experienced   sation  and  benefits.  www. cooks,   servers   and   bus-­ howardcentercareers.org.   ers,  Apply  in  person  at  26   Job  ID  #1678.  Questions?   Seymour   Street,   Middle-­ 802-­488-­6950. bury,  VT.  To  be  considered   SUBSTITUTE  TEACHERS.   applicants   must   provide   Otter   Creek   Child   Center,   references. 150   Weybridge   Street   in   O P E N I N G S   F O R   PART-­TIME  housekeeper,   weekdays  and  weekends.   Looking   for   responsible   self-­motivated  and  meticu-­ lous   person,   stable   work   history.  Call  Strong  House   Inn,  877-­3337.



MR.   MIKEâ&#x20AC;&#x2122;S   COMMER-­ CIAL  Cleaning  Service  has   openings   for   relief   posi-­ tions;  part  to  full  time.  Must   be   flexible,   reliable,   and   able   to   pass   background   check.  Self  motivated,  able   to   work   independently.   Email   resume   to:   info@ mrmikescleaningservicevt. com.  Application  also  avail-­ able  online  www.mrmikes-­ cleaningservicevt.com.  No   phone  calls  please.



PART  TIME  CAREGIVER   for   13   year   old   disabled   boy,  Middlebury.  Applicants   must  have  child  care  expe-­ rience,  references,  incredi-­ ble  patience,  a  strong  back.   Flexible   hours.   Criminal   background   check.   Send   resume:   sstone7716@ gmail.com  .

2000  SQUARE  FEET  Pro-­ fessional   office   space   in   Middlebury,   multi-­room.   G r o u n d   l e v e l ,   p a r k -­ i n g ,   h a n d i c a p p e d -­ a c -­ cessible.   Available   now.   802-­558-­6092.

3  BEDROOM  HOUSE  one   mile  from  Bristol.  Pets  ne-­ gotiable.  Utilities  not  includ-­ Middlebury   is   looking   for   ed.   Credit   reference   and   enthusiastic,   flexible   and   damage   deposit.   $1,100  /   energetic  substitute  teach-­ month.  802-­363-­5619. ers   to   join   our   child   care   team.   This   is   a   part-­time   ADDISON   HOUSE   TO   on-­call  position,  with  varied   share.   Private   suite   con-­ hours  Monday-­Friday.  Must   sisting  of  1  bedroom,  small   enjoy   spending   time   with   living   room,   private   bath,   young  children  and  being  a   skylights,   laundry   room   team  player.  Please  e-­mail   with  washer  /  dryer,  includes   cover  letter,  resume  and  3   internet,   satellite   tv   and   written  letters  of  reference   all   utilities.   $550  /  month.   to  office@ottercreek.org  . References   and   deposit.   802-­759-­2133. SERVICE  COORDINATOR   for   the   Family   Services   BRANDON   2   BEDROOM   Program   at   Community   1.5  bath  with  new  kitchen,   Associates.   New   position   washer  /  d ryer   hookups.   to   develop,   coordinate,   Private  deck.  Tenant  pays   monitor  and  provide  direct   heat  and  electric.  $850  per   service   to   children   with   month.   Application   with   emotional,  behavioral  and   credit  check.  Call  Courtney   /  or  developmental  disabili-­ at  Lang  McLaughry  RE  at   ties.  Also  provide  important   802-­385-­1107. support   to   families,   work   B R A N D O N   S U N N Y   1   collaboratively  with  schools   bedroom   2nd   floor   pets   and   local  /  state   agencies.   welcome.   $475   month.   Must   have   solid   3+   years   203-­253-­4389 of   experience   supporting   children   and   families   with   BRANDON,   NOW   RENT-­ diverse   needs.   Seeking   a   ING  1  &  2  bedroom  afford-­ team  player  with  excellent   able   apartments   at   Park   communication  skills.  B.A.   Village.   Rents   starting   at   and  good  driving  record  re-­ $689  /  mo.   Some   utilities   quired.  Full-­time  with  com-­ included.   Great   location,   prehensive   benefit   pack-­ beautiful   setting,   30   min-­ age.  Respond  to  CSAC  HR,   utes  to  Rutland,  5  minutes   89  Main  Street,  Middlebury,   to   downtown   Brandon,   VT   05753,   802-­388-­6751,   easy   access   to   Route   7.   ext.   425,   or   visit   www. Call  Chantel  for  more  info   csac-­vt.org  . 802-­247-­0165.

PART-­TIME   ARTIST   AS-­ SISTANT   in   Middlebury.   Basic   computer   literacy   required.  Assistant  will  be   focused   on   applying   for   SHIFT   OPENINGS   FOR   shows,   returning   emails   compassionate  â&#x20AC;&#x153;Universal   and  organization  of  artwork.   Careâ&#x20AC;?   staff   in   our   loving   Call  Bob  802-­377-­2579. and   family-­oriented   resi-­ PARENT  SUPPORT  PRO-­ dential   care   home,   under   VIDER  /  FAMILY  LEADER.   new   management.   We   Are   you   the   parent   of   a   incorporate   holistic   ap-­ child   with   a   disability?   VT   proaches   through   organic   Federation  of  Families  for   nutrition,  integrative  medi-­ Childrenâ&#x20AC;&#x2122;s   Mental   Health   cine   and   a   wide   range   of   is   looking   for   a   parent,   community  activities.  LNA   who   has   experienced   the   or   equivalent   desired.   If   child-­serving   system,   to   you   are   a   reliable   team   provide   information,   sup-­ player   and   enjoy   working   port,  and  family  leadership   with  our  aging  community,   skills   to   Addison   County   please   send   your   resume   families.  This  is  a  part-­time   to   lori@livingwellvt.org   or   position,   20   hours   per   call  802-­453-­3946. week.  Requirements:  lead-­ THE  BURLINGTON  FREE   ership  &  advocacy,  listening   Press   is   looking   for   reli-­ /  communication,   meeting   able  early  morning  risers  to   facilitation,  disability  knowl-­ deliver  our  paper  to  home   edge  and  sensitivity.  To  ap-­ delivery  subscribers  in  the   ply  send  a  cover  letter  and   towns  of  Monkton,  N.  Fer-­ resume   with   three   refer-­ risburgh,   Middlebury   and   ences  to  Vermont  Federa-­ Cornwall.  Must  have  a  re-­ tion   of   Families,   P.O.   Box   liable   vehicle   and   proof   1577,  Williston,  VT  05495. of   a   valid   driverâ&#x20AC;&#x2122;s   license   PART-­TIME   POSITION   and  insurance.  Please  call   available   immediately.   316-­7194. Addison   County   Humane   Society   seeks   driver   for   weekly   animal   cremation   For  Sale deliveries.  1  day  per  week,   30  hours  per  month.  Must   MAXIM  OUTDOOR  WOOD   have  clean  driving  record,   Pellet  Furnace  by  Central   be  able  to  lift  50-­75  pounds.   Boiler.  Buy  now  and  save   Must   have   clean   driving   up   to   $300.   Boivin   Farm   record.  Stop  by  236  Board-­ Supply  802-­236-­2389. man   Street,   Middlebury.   SAWMILLS   FROM   ONLY   between   11-­12,   M-­F   for   $4,897.   Make   &   save   application  and  interview. money   with   your   own   PER   DIEM   NURSE   po-­ bandmill.   Cut   lumber   any   sition   available   immedi-­ dimension.  In  stock,  ready   ately:   seeking   per   diem   to   ship.   Free   info  /  D VD:   LPN   or   Medical   Assistant   www.NorwoodSawmills. to   join   our   fast   paced   com  1-­800-­578-­1363,  ext.   team.   Job   includes   room-­ 300N. ing   patients,   taking   vitals   SHED  6X8  STORAGE.  Ver-­ and   more   based   on   your   mont  Post  &  Beam  $2,562   skills.   Electronic   Medical   now  only  $999.  Free  ship-­ Record  experience  a  plus   ping   and   0%   rent   to   own   but  will  train  the  right  per-­ www.VTSheds.com,  quanti-­ son.   Middlebury   Family   ties  limited  866-­297-­3760. Health,   Attn:   Stacy   Ladd,   Practice  Administrator,   44   THE   BARREL   MAN:   55   Collins   Drive   Suite   201,   gallon   Plastic   and   Metal   Middlebury,  VT  05753,  Fax:   barrels.  Several  types:  55   388-­0441. gallon   rain   barrels   with   faucets,   Food   grade   with   removable  locking  covers,   plastic   food   grade   with   spin-­on   covers   (pickle   barrels).   Also,   275   gal-­ lon  food  grade  totes  $125   each.   55   gallon   sand  /  salt   barrels   with   PT   legs.   $50   each.   Delivery   available.   802-­453-­4235.



VERMONT   GUN   SHOW.   Jan.   18-­19   at   the   Knights   of   Columbus   Hall,   2   Be-­ rard   Dr.   South   Burlington   05403.  Info  802-­875-­4540   or   greenmtgunshowtrail. com  .

For  Rent 15,000  SQ.  FT.  MANUFAC-­ TURING  or  storage  by  the   month   or   by   the   quarter.   802-­388-­4831.

For  Rent

LAKE   DUNMORE:   Cozy   w i n t e r i z e d   2 -­ b e d r o o m   lakefront   cottage   avail-­ able   to   June,   shorter   pe-­ riods   (2-­night   minimum).   Fully-­equipped   kitchen,   bathroom   with   shower,   comfortable   furnishings,   WiFi,  satellite  TV,  plowing,   trash  collection,  recycling.   10   minutes   to   Middlebury   or  Brandon.  802-­352-­4236;   info@northcovecottages. com  . LEICESTER;  1  BEDROOM   apartment.  $675.  Heat  in-­ cluded.   References,   de-­ posit,  lease.  802-­349-­9733. MIDDLEBURY   4   BED-­ ROOM   HOUSE  â&#x20AC;&#x201D;  $1,400   /  mth   plus   utilities.   Great   Green   Mountain   view.   Please  no  smoking  or  pets.   388-­6363. MIDDLEBURY   OFFICE   SPACE   available,   with   handicap   ramp,   on   Court   Street.  Includes  heat,  elec-­ tric,   water,   sewer.   Park-­ ing  for  30  cars.  $1200  /  mo.   802-­388-­4831.

Wood  Heat



ADDISON  COUNTY  FIRE-­ WOOD.   Premium   hard-­ woods   cut  /  split  /  delivered.   Well   seasoned   $260  /  cord.   *Save   20%.   Reserve   fire-­ M I D D L E B U R Y,   F U R -­ wood  now  for  next  heating   NISHED   APARTMENT.   season,  with  no  up  front  ob-­ Large   living   room,   kitch-­ ligation.  Custom  sizes  avail-­ en,   bedroom,   bath.   $795   able.   For   honest,   reliable   /  mo.   All   utilities   included.   service  call  802-­238-­7748. 802-­388-­4251. FIREWOOD;   CUT,   SPLIT   NEW   HAVEN   EXCEL -­ and  delivered.  Green  or  sea-­ LENT   2   bedroom   apart-­ soned.   Call   Tom   Shepard,   ment,   newly   decorated   802-­453-­4285. with   all   appliances.   Heat   FIREWOOD;   CUT,   SPLIT   included.   $895   per   month   and   delivered.   Call   for   in-­ plus  security  deposit.  Pets   formation.  247-­9782. negotiable.  References  re-­ quired.  453-­2184. MIXED  HARDWOOD,  PAR-­ TIALLY  seasoned.  Cut,  split,   NEW   HAVEN:   Very   nice,   delivered.   $190  /  cord.  Also   sunny,   special   apartment.   trees   cut   and   removed.   Views,  deck,  garden  space.   Please   leave   message,   No  pets,  no  smoking.  Ref-­ 802-­282-­9110. erences,  lease.  $850  /  month   plus  utilities.  802-­236-­2040. MOUNTAIN   ROAD   FIRE-­ WOOD.   Green   and   dry   ORWELL   3   BEDROOM   available.   Oak,   ash,   ma-­ apartment.   $850  /  m onth   ple,  beech.  Order  now  and   +   utilities.   Credit   check   save  for  next  season.  Cut,   a n d   r e f e r e n c e s .   F i r s t   split   and   delivered.   Call   and   last   monthâ&#x20AC;&#x2122;s   rent.   802-­759-­2095. 802-­948-­2559.

BRANDON.   VERY   NICE,   sunny  1  bedroom,  second   floor   apartment   in   2-­fam-­ ily   house.   Great   location.   $650.   heat   included.   No   smoking,   no   pets.   Refer-­ PANTON;  GREAT  LOCA-­ ences,   lease,   deposit   re-­ TION,   Lake   Champlain   Real  Estate   quired.  802-­236-­1781. views.   Totally   renovated   Wanted BRIDPORT   VILLAGE;   house,   2   bedrooms,   2   ONE  bedroom  apartment,   baths,  new  kitchen,  fully  ap-­ WANTED:  TO  PURCHASE   4  rooms,  with  porch  /  lawn.   plianced,  garage  space.  No   from  owner,  open  land,  2  to   Washer  /  d ryer,   heat  /  h ot   pets,   no   smoking.   $1400  /   100  acres.  802-­558-­6092. water   included.   No   smok-­ mo.   plus   utilities.   Contact   ing,   no   pets.   References.   Nancy   Larrow   877-­6462,   Real  Estate $775  /  month   plus   security   Lang  McLaughry  Real  Es-­ deposit.  Only  living  unit  in   tate. C O U N T R Y   B A R N / 5   building.  For  more  informa-­ RIPTON   3-­BEDROOM,   ACRES:   $29,995.   Rustic   tion,  David  802-­758-­2546. 2   bath   house.   2-­zone   oil   â&#x20AC;&#x153;Country  Barn,â&#x20AC;?  well-­built  &   BRIDPORT;   LARGE   1   heat.   Acreage,   private.   sturdy.  On  5  wooded  acres,   bedroom,   second   floor   Applianced,  minimally  fur-­ meadows,   apple   orchard.   apartment.   $650  /  mo.   in-­ nished.  Fireplace,  log  inte-­ Frontage  on  State  Rte.  13,   cludes   electricity.   Refer-­ rior.  $1,100.  802-­318-­2118. mins   to   Salmon   River.  Ad-­ ences  and  deposit  required.   ROOM  TO  RENT  in  Bran-­ joins  NY  snowmobile  trails.   802-­758-­2436. d o n .   $ 1 2 0   p e r   w e e k .   Call  1-­800-­229-­7843  or  visit   www.landandcamps.com  . BRISTOL   1   BEDROOM   802-­417-­4075. centrally   located.   Park-­ SELF   STORAGE,   8â&#x20AC;&#x2122;X10â&#x20AC;&#x2122;   LEICESTER   6.8   ACRES,   i n g ,   l a r g e   b a c k   y a r d ,   units.   Your   lock   and   key,   $59,000.   Very   nice   build-­ h e a t   i n c l u d e d .   $ 8 0 0 .   $50  /  m onth.   Middlebury,   ing   site   surveyed,   septic   design   included.   Ready   to   802-­338-­2740. 802-­558-­6092. build   on,   with   all   permits.   BRISTOL  OFFICE  SPACE   S T O R A G E   S PA C E S ,   Owner  financing.  Call  Wayne   -­   located   in   the   Old   High   11â&#x20AC;&#x2122;X28â&#x20AC;&#x2122;.   Large   overhead   802-­257-­7076. School   building   by   the   doors,  extra  high  ceilings.   town  green,  310  s.f.,  high   Will   accommodate   large   MIDDLEBURY;   INDUS-­ c e i l i n g s ,   w a i n s c o t i n g ,   campers,   boats   or   lots   of   TRIAL   PARK.   Available   2   acres,  lease  or  build  to  suit.   hardwood   floors   just   re-­ stuff.  Call  802-­388-­8394. 802-­558-­6092. finished.  The  overall  com-­ plex   houses   non-­profits,   VERGENNES;   285   MAIN   alternative  health  practices,   Street,   available   now.   2   yoga  center  and  Bristol  Fit-­ bedroom   apartment.   Full   Att.  Farmers ness.  $385  /  month  includes   bath,   laundry   hookups,   heat   and   electric.   Lease   large   porch,   new   kitchen,   HAY  FOR  SALE:  First  cut  $3   required.   Available   now.   parking,   heat   and   hot   /  square  bale.  First  cut  round   water   included.   $890  /   bales  $30.  Mike  Quinn,  end   Call  453-­4065. month.   Also   277   Main   of   South   Munger   Street,   C L I M AT E   C O N T R O L   Street,  6-­room  apartment,   Middlebury.  802-­388-­7828. S TO R A G E   n o w   a v a i l -­ $1,100.  Call  only  8am-­8pm.   HAY   FOR   SALE:   First   able   in   New   Haven.   Call   802-­349-­8405. a n d   s e c o n d   c u t .   C a l l   802-­388-­4138. 802-­352-­4686. CORNWALL  3  BEDROOM   HAY   FOR   SALE:   Small   2-­year   old   home.   $1,500   square   bales.   First   cut   per  month.  802-­349-­9566. a n d   m u l c h .   D e l i v e r y   available.   Call   for   pric-­ i n g .   8 0 2 -­ 4 5 3 -­ 4 4 8 1 ,   8 0 2 -­ 3 4 9 -­ 9 2 8 1 ,   o r   802-­989-­1004.

For  Rent

For  Rent

Itâ&#x20AC;&#x2122;s  against  the  law   to  discriminate  when   advertising  housing   related  activities. Particularly  on  sites  like  Craigslist. And  itâ&#x20AC;&#x2122;s  easier  to  break  the  law  than  you  might   think.  You  canâ&#x20AC;&#x2122;t  say  â&#x20AC;&#x153;no  childrenâ&#x20AC;?  or  â&#x20AC;&#x153;adults  only.â&#x20AC;?   There  is  lots  you  canâ&#x20AC;&#x2122;t  say.  The  federal  government   is  watching  for  such  discrimination. Let  us  help  you  sift  through  the  complexities  of  the  Fair   Housing  Law.  Stay  legal.  Stay  on  the  right  side  of  the   nationâ&#x20AC;&#x2122;s  Fair  Housing  Law.   Call  the  Addison  Independent  at  (802)  388-­4944. Talk  to  our  sales  professionals.

NEW   HOLLAND   T1530-­   250TL   Loader,   200   hours.   Winco  PTO  Generator.  Call   802-­247-­6735. SAWDUST;  STORED  AND   undercover.   Large   tandem   silage  truck  $627,  delivered.   Large   single   axle   dump   $259,   delivered.   Single   axle  dump  $192,  delivered.   Pick   up   and   loading   also   available.   Phone   order   and  credit  cards  accepted.   802-­453-­2226.   Bagged   shavings   in   stock.   $5.50   per  bag. WA N T E D   N E W B O R N   ANGUS-­sired   bull   calves.   Please  call  453-­4144.

Cars 2007   HONDA   ODYSSEY   LX  van,  133k  miles.  Excel-­ lent   condition.   New   timing   belt.   Class   2   hitch.   $6995.   802-­989-­1185.


PAGE  10B  â&#x20AC;&#x201D;  Addison  Independent,  Thursday,  January  16,  2014

Accidents  on  icy  roads,  heroin  abuse,  burglaries  occupy  troopers ADDISON  COUNTY  â&#x20AC;&#x201D;  Slippery   road   conditions   in   the   county   late   last   week   contributed   to   a   number   RIWUDIÂżFFUDVKHV Vermont   State   Police   noted   that   Route   7   was   icing   as   it   was   snow-­ LQJRQ-DQDWDURXQGDP when   an  Acura   MDX   rear-­ended   a   Ford   box   truck   on   that   highway   in   )HUULVEXUJKQHDU5RXQG%DUQ5RDG Trooper   Dempsey   reported   that   $QGUHD .HULQ  RI 0RQNWRQ LQ the   Acura   was   following   William   Johnston,  45,  of  Bristol  in  the  truck   DW DSSUR[LPDWHO\  PSK ZKHQ Johnson  began  to  slow  for  the  traf-­ ÂżF LQ IURQW RI KLP DQG .HULQ ZDV unable   to   adequately   slow   down   when   her   vehicle   began   to   slide   RQ WKH LFH 7KH $FXUD VXVWDLQHG substantial  front-­end  damage  when   it  struck  the  rear  of  the  truck,  which   VXVWDLQHGPLQRUGDPDJH As  the  weather  turned  from  cold   to   warm   with   lots   of   rain   the   next   GD\ WURRSHUV RQ 6DWXUGD\ DW  DP UHVSRQGHG WR D RQHFDU DFFL-­ GHQW RQ 5RXWH  LQ $GGLVRQ Police  report  that  Irina  Brayant,  47,   ZDV GULYLQJ D  1LVVDQ &XEH

HDVWERXQG RQ 5RXWH  ZKHQ VKH lost  control  of  the  vehicle,  it  crossed   over   the   centerline,   went   off   the   road   and   rolled   onto   its   passenger   VLGH $GGLVRQ )LUH 'HSDUWPHQW responded   and   extracted   Brayant   IURPWKHYHKLFOHXQLQMXUHG 7KDW DIWHUQRRQ DW  SP when  the  road  was  still  wet  and  the   weather  was  described  as  rainy  and   IRJJ\ SROLFH UHSRUW WKDW \HDU old   James   Wells   of   Shoreham   was   GULYLQJ D  -HHS QRUWKERXQG on   Route   74   in   Cornwall   when   he   saw   another   vehicle   begin   to   pull   RXWLQWRKLVODQH$V:HOOVEHJDQWR swerve   to   avoid   colliding   with   the   second   vehicle,   he   lost   control   of   the  Jeep  and  went  off  the  road  into   DFRSVHRIVPDOOWUHHV$Q\HDU old  passenger  in  the  Jeep  was  taken   to   Porter   Hospital   to   be   treated   IRU PLQRU LQMXULHV 7KH YHKLFOH VXVWDLQHGVXEVWDQWLDOGDPDJH Also   on   Saturday,   state   police   responded   to   a   crash   in   Salisbury,   where   police   said   Carla   Brown,    RI &RUQLQJ 1< ZDV GULYLQJ D  +RQGD $FFRUG RQ /RZHU Plains   Road   near   Rice   Cemetery  

Public Notices Index Public  notices  for  the  following  can  be  found  in  this     ADDISON  INDEPENDENT  on  this  Page  10B.

Addison  County  Probate  Court  (2) Addison  County  (1) Ferrisburgh  (1) Middlebury  (1) Northlands  Job  Corps  Center  (1) Vergennes  (1) Vermont  Electric  Power  Company  (1) Vermont  Secretary  of  State  (1) PUBLIC NOTICE â&#x20AC;&#x201C; CITY OF VERGENNES

The  annual  City  Elections  will  be  held  on  Tuesday,  March  4,  2014.    Nominating  petitions   DUHDYDLODEOHDWWKH&LW\&OHUNÂśVRIÂżFHIRUWKHIROORZLQJSXEOLFRIÂżFHV Â&#x2021;7KUHH$OGHUPHQIRUUHVSHFWLYHWZR\HDUWHUPV Â&#x2021;2QH/LVWHUIRUDWKUHH\HDUWHUP Â&#x2021;2QH$XGLWRUIRUDWKUHH\HDUWHUP Â&#x2021;7ZR&RPPLVVLRQHUVWRWKH9HUJHQQHV3DQWRQ:DWHU'LVWULFW%RDUGRI 'LUHFWRUVIRUUHVSHFWLYHWKUHH\HDUWHUPV Â&#x2021;2QH*UDQG-XURUIRUDRQH\HDUWHUP Â&#x2021;2QH'LUHFWRUWRWKH9HUJHQQHV8QLRQ(OHPHQWDU\6FKRRO%RDUGRI'LUHFWRUV IRUDWKUHH\HDUWHUPDQG Â&#x2021;2QH'LUHFWRUWRWKH9HUJHQQHV8QLRQ+LJK6FKRRO%RDUGRI'LUHFWRUVIRUD WKUHH\HDUWHUP 7KHGHDGOLQHIRUÂżOLQJSHWLWLRQVIRUORFDOSXEOLFRIÂżFHVLJQHGE\RIWKHOHJDOYRWHUV LV0RQGD\-DQXDU\ VLJQDWXUHV

7KHGHDGOLQHIRUÂżOLQJSHWLWLRQVIRUDUWLFOHVWREHLQFOXGHGRQWKH&LW\:DUQLQJDQGEDOORW VLJQHGE\RIWKHOHJDOYRWHUVLV7KXUVGD\-DQXDU\ VLJQDWXUHV

5HVLGHQWV RI 9HUJHQQHV ZKR DUH QRW UHJLVWHUHG YRWHUV EXW ZLVK WR EH RQ WKH &LW\ÂśV FKHFNOLVWPXVWÂżOHDQDSSOLFDWLRQZLWKWKH&LW\&OHUNRQRUEHIRUH:HGQHVGD\)HEUXDU\ DWSP  -RDQ7'HYLQH9HUJHQQHV&LW\&OHUN

PUBLIC NOTICE â&#x20AC;&#x201C; HERBICIDE USE NOTIFICATION  

Vermont  utilities  maintain  electric  line  rights-­of-­way  with  several  methods,  including  the   selective  use  of  herbicides  on  trees  and  brush.  They  also  encourage  low-­growing  shrubs   and  trees  which  will  crowd  tall  growing  species  and,  thus,  minimize  the  use  of  herbicides.   The  application  of  herbicides  may  start  as  early  as  April  1.  Requests  to  utilities  for  notice   by  mail,  however,  must  be  made  by  February  15.   The  Public  Service  Board  requires  Vermont  utilities  to  carry  out  vegetation  management   WHFKQLTXHVZKLFKDOORZPDLQWHQDQFHRIHOHFWULFDOV\VWHPVLQDFRVWHIÂżFLHQWPDQQHU7KH types  of  herbicide  treatment  used  to  maintain  vegetation  on  utility  rights-­of-­way  include   the  following  applications:  stump,  injection,  basal,  soil  and  foliar.  These  are  the  commonly   used  methods;  your  local  utility  may  use  other  methods.  Landowners  have  the  option   of  requesting  a  utility  to  apply  herbicide  treatment  on  cut  stumps  only  or  that  a  utility   refrain  from  applying  herbicide.  In  the  latter  case,  the  landowner  has  to  pay  the  utility  an   administrative  fee.  Only  electric  utility  rights-­of-­way  which  have  tall-­growing  tree  species   with  the  potential  of  threatening  the  electric  utility  system  are  treated.   Utilities  advertise  by  radio  and  newspaper  prior  to  herbicide  applications  on  all  lines.   Utilities  typically  treat  rights  of  way  once  every  four  to  six  years,  depending  on  the  utilityâ&#x20AC;&#x2122;s   VSHFLÂżFYHJHWDWLRQPDQDJHPHQWF\FOH3OHDVHFKHFNZLWK\RXUXWLOLW\UHJDUGLQJWKH vegetation  management  cycle  of  a  particular  line. Some  utilities  identify  their  poles  with  metal  letter  and  numbers,  e.g.,  V.E.C.  (Vermont   (OHFWULF&RRSHUDWLYH RU9(/&2 9HUPRQW(OHFWULF3RZHU&RPSDQ\ 7KHVHPDUN-­ LQJVDUHQRWIRXQGRQHYHU\XWLOLW\SROH+RZHYHUE\FKHFNLQJRIVHYHUDOSROHVRQDOLQH \RXVKRXOGEHDEOHWRÂżQGDPDUNHGSROHDQGGHWHUPLQHZKLFKXWLOLW\RZQVLW Persons owning or occupying land within 1,000 feet of a utility right-­of-­way may request in writing that the utility notify them individually by mail anytime, but at least 30 days prior to treatment of the line with herbicides.  The  landowner  or  resi-­ dent  is  responsible  for  contacting  the  utility,  in  writing,  to  request  placement  on  the  mail-­ LQJOLVW7KHXWLOLW\VKRXOGEHSURYLGHGZLWKVXIÂżFLHQWLQIRUPDWLRQDVWRWKHH[DFWORFDWLRQ RIWKHUHVLGHQFHDQGODQG,WLVWKHGXW\RIHDFKODQGRZQHURUUHVLGHQWWRPDNHWKHXWLOLW\ aware  of  the  location  of  any  potentially  affected  water  supply,  and  any  environmentally   sensitive  areas  where  herbicide  application  ought  to  be  avoided.     &217$&7<285(/(&75,&87,/,7<:,7+48(67,21625 68%0,77+(&283213529,'(' If you have further questions or concerns contact: Agency  of   Agriculture Plant Industry Division, Agency of Agriculture Consumer Affairs & Public Information James  Leland Phil Benedict, Director Dept. of Public Service 116  State  St.,  Montpelier,  VT  05602 116 State St., Montpelier, VT 05602 112 State St., Montpelier, VT 05620 1-­802-­828-­2431 2332 1-­802-­828-­2431 1-­800-­622-­4496 or 1-­802-­828-­2811

LANDOWNER REQUEST TO BE ADDED TO HERBICIDE &28321)253(5621$/5(48(67 TREATMENT NOTIFICATION MAILING LIST Name Town/City of Affected Property Street Address Telephone # (Home) Town (Work) State Zip Code OK to use Work Number: Yes o No o Electric Account Number Best Time to Call Property of Concern: o Year Round Residence o Summer Residence o Commercial Property o Water Supply o Land o Other Line and Pole Identification: Utility Initials Numbers We need all of this information in order to determine if you qualify for personal notification. If information is unobtainable, please state why. Use an extra sheet of paper if you need more space.   5(785172<285/2&$/87,/,7< VELC008 VELCO14

when   the   Accord   left   the   roadway   DQGFROOLGHGZLWKDWUHH%URZQZDV transported   to   Porter   Hospital   to   EHWUHDWHGIRULQMXULHV7KHFDUZDV WRWDOHG 7URRSHU 6]DUHMNR UHSRUWHG that   this   collision   was   still   under   investigation   and   criminal   charges   DUHSHQGLQJ M e a n w h i l e ,   as   reported   in   Mondayâ&#x20AC;&#x2122;s   edition   of   the   I n d e p e n d e n t ,   state   police   said   they   suspected   that   a   Salisbury   man   who   died   at   his   home   in   an   untimely  manner  this  past  Thursday   had  been  using  heroin,  but  they  did   not  know  if  that  played  a  role  in  his   GHDWK Troopers   along   with   local   emer-­ gency   medical   services   were   GLVSDWFKHG RQ -DQ  DW DERXW  SP WR D UHSRUW RI DQ XQUHVSRQ-­ sive   male   discovered   in   a   single-­ room  rental  off  Route  7  near  Plains   5RDG LQ 6DOLVEXU\ $QGUHZ 5 +HQGHUVRQ  ZDV XQUHVSRQVLYH ZKHQGLVFRYHUHGE\DQHLJKERU+H

was   pronounced   dead   shortly   after   WKHDUULYDORIHPHUJHQF\SHUVRQQHO An  investigation  into  Hendersonâ&#x20AC;&#x2122;s   GHDWKLVXQGHUZD\ 6JW5REHUW3DWWHQQRWHGWKDW963 and   EMS   personnel   responded   to   another   person   in   medical   distress   at  a  different  home  along  Route  7  in   6DOLVEXU\MXVW minutes   before   responding   to   H e n d e r s o n â&#x20AC;&#x2122; s   GHDWK 7KHUH were   indicators   that   the   person   in   medical   distress  in  this  case  had  been  using   KHURLQ3DWWHQVDLG7KHSDWLHQWZDV transported  by  ambulance  to  Porter   +RVSLWDO LQ 0LGGOHEXU\ 1R GHDWK UHVXOWHGLQWKLVFDVH3DWWHQVDLG In   other   recent   activity,   state   SROLFH Â&#x2021; 2Q -DQ  DW DSSUR[LPDWHO\ SPVWRSSHGDYHKLFOHGULYHQ E\ -RQDK .OHLQIHOGW  RI %ULVWRO after   police   said   they   clocked   him   GRLQJ  PSK LQ D  PSK ]RQH RQ 5RXWH  LQ :DOWKDP 3ROLFH cited   Kleinfeldt   for   driving   with   a  

Vt. State

Police Log

criminally   suspended   license   and   LVVXHGKLPDVSHHGLQJWLFNHW Â&#x2021; 2Q -DQ  LVVXHG D UHSRUW XSGDWLQJ DQ HDUOLHU FDVH 7URRSHU Knapp   said   that   VSP   on   this   past   1RY  KDG UHFHLYHG D FDOO DERXW an   assault   that   occurred   on   Route    LQ *UDQYLOOH LQYROYLQJ (OZLQ 7ZLWFKHOO  RI *UDQYLOOH $IWHU speaking   with   both   parties,   paper-­ work   was   sent   to   the   Addison   &RXQW\6WDWHÂśV$WWRUQH\ÂśVRIÂżFHIRU SRVVLEOH FULPLQDO FKDUJHV .QDSS reported  last  week  that  prosecution   ZDVGHFOLQHG Â&#x2021; 2Q -DQ  VWRSSHG D PRWRU YHKLFOH GULYHQ E\ %ULDQ /DWWUHOO  RI %ULVWRO RQ 'HYLQR /DQH LQ Bristol   for   a   motor   vehicle   infrac-­ WLRQ3ROLFHFLWHG/DWWUHOOIRUGULYLQJ ZLWKDFULPLQDOO\VXVSHQGHGOLFHQVH Â&#x2021; 2Q-DQDWDPZHQWWR a  Monkton  residence  for  a  reported   assault   that   had   occurred   earlier   in   WKH HYHQLQJ 3ROLFH DUUHVWHG 7HUU\ %DUURZV  RI 0RQNWRQ FKDUJHG him   with   aggravated   domestic   assault   and   lodged   him   at   the   Marble  Valley  Correctional  Facility   IRUODFNRIEDLO

Â&#x2021; 2Q-DQDWSPUHFHLYHG a   call   about   a   car   that   was   off   the   URDGLQDUDYLQHRQ5RXWHQHDU 3OXQNWRQ5RDGLQ*UDQYLOOH'ULYHU 5LFKDUG *DERXU\  RI +DQFRFN told   police   that   he   was   driving   a    6XEDUX ,PSUH]D QRUWKERXQG RQ 5RXWH  ZKHQ KH KLW VRPH LFH DQG ORVW FRQWURO RI WKH YHKLFOH *DERXU\ZDVQRWLQMXUHGDFFRUGLQJ to  police,  but  the  vehicle  was  towed   GXHWRGDPDJH Â&#x2021; 2Q WKH HYHQLQJ RI -DQ  responded  to  a  report  of  an  assault   at   a   residence   on   Crown   Point   5RDGLQ%ULGSRUW,QYHVWLJDWLRQOHG SROLFHWRDUUHVW-DPHV7XUQHURI Bridport  and  cite  him  for  domestic   assault  and  interference  with  emer-­ JHQF\FRPPXQLFDWLRQ Â&#x2021; 2Q -DQ  ÂżHOGHG UHSRUWV RI burglaries   overnight   at   four   homes   in   Monkton   and   one   in   Charlotte,   ZKLFK SROLFH VXVSHFW ZHUH UHODWHG The   homes   were   on   Pond   Road,   Boro   Hill   Road,   Parks   Hurlburt   Road,   and   Old   Stage   Road   in   Monkton   and   on   Prindle   Road   in   &KDUORWWH 6HH IXOO VWRU\ LQ WKH $ 6HFWLRQRIWRGD\ÂśVHGLWLRQ

Police  arrest  three  men  in  separate  incidents %5,672/ ² 7KH %ULVWRO 3ROLFH Department   reported   three   recent   DUUHVWV 2Q -DQ  DW  SP SROLFH DUUHVWHG 7KRPDV -RKQ &ROHPDQ  of  Bristol  at  a  Basin  Street  residence   RQDZDUUDQWIRUHVFDSH7KH9HUPRQW Department  of  Corrections  had  issued   PROBATE  DIVISION DOCKET  NO.  15983 STATE  OF  VERMONT DISTRICT  OF  ADDISON,  SS. IN  RE  THE  ESTATE  OF JUDITH  HART NOTICE  TO  CREDITORS To  the  creditors  of  the  estate  of  Judith  Hart   late  of  Monkton,  Vermont. I   have   been   appointed   to   administer   this   estate.   All   creditors   having   claims   against   the  decedent  or  the  estate  must  present  their   claims   in   writing   within   four   (4)   months   of   WKH ¿UVW SXEOLFDWLRQ RI WKLV QRWLFH7KH FODLP must  be  presented  to  me  at  the  address  listed   below  with  a  copy  sent  to  the  court.  The  claim   may   be   barred   forever   if   it   is   not   presented   within  the  four  (4)  month  period. Dated:  Dec.  18,  2013 Marie  Hart 5474  Monkton  Road New  Haven,  VT  05472 (802)  349-­5659 mariesnaps@gmail.com Name  of  Publication:  Addison  Independent Publication  Date:  Jan.  16,  2014 Address  of  Probate  Court:  Addison  Probate   Court,   7   Mahady   Court,   Middlebury,   VT   05753 1/16

WKHZDUUDQWRQ'HF%ULVWROSROLFH lodged   Coleman   at   the   Chittenden   5HJLRQDO&RUUHFWLRQDO)DFLOLW\ Separately,  a  different  Bristol  man   RQ-DQIRXQGKLPVHOIXQGHUDUUHVW IRU WKH VHFRQG WLPH LQ WKUHH ZHHNV Bristol   police   cited   Samuel   /HZLV +HOOPXWK  LQWR FRXUW for   violating   a   relief  from  abuse   order   and   violat-­ ing  conditions  of  release  issued  by  a   judge   from   a   previous   arrest   on   the   VDPHFKDUJH

Bristol

Police Log

TOWN OF MIDDLEBURY NOTICE OF VACANCY

Pursuant  to  Title  24  VSA  961  (a)  No-­ tice  is  hereby  given  of  a  vacancy  on  the   Middlebury  Selectboard  effective  Jan  2,   2014.      Pursuant  to  Title  24  VSA  961(c)   and  Section  303  of  the  Middlebury  Town   Charter,   the   Middlebury   Selectboard   PXVWDSSRLQWDQHOLJLEOHSHUVRQWR¿OOWKH vacancy   until   the   next   annual   meeting   on   March   4,   2014.     Interested   eligible   voters   of   the   Town   of   Middlebury   who   wish   to   be   considered   for   appointment   by   the   Selectboard   for   the   period   end-­ ing  March  4,  2014  may  submit  a  letter  of   interest  to  the  Middlebury  Selectboard,   C/O  Kathleen  Ramsay,  Town  Manager,   94  Main  Street,  Middlebury,  VT  05753.

1/16

PUBLIC NOTICE FERRISBURGH RESIDENTS ANNUAL   TOWN   MEETING   ELECTIONS   WILL   BE   HELD   ON   MARCH   4,   2014   NOMINATING  PETITIONS  ARE  AVAILABLE  AT  THE  TOWN  CLERKâ&#x20AC;&#x2122;S  OFFICE  FOR  THE   FOLLOWING  PUBLIC  OFFICES: Moderator  for  Town  â&#x20AC;&#x201C;  1  year  term Town  School  Director  â&#x20AC;&#x201C;  2  year  term Moderator  for  Town  School    â&#x20AC;&#x201C;  1  year  term Town  School  Director  â&#x20AC;&#x201C;  3  year  term Town  Clerk  â&#x20AC;&#x201C;  3  year  term Union  High  School  Director  â&#x20AC;&#x201C;  3  year  term Town  Treasurer  â&#x20AC;&#x201C;  3  year  term First  Constable    â&#x20AC;&#x201C;  1  year  term Selectman  â&#x20AC;&#x201C;  2  year  term Delinquent  Tax  Collector  â&#x20AC;&#x201C;  1  year  term Selectman  â&#x20AC;&#x201C;  3  year  term Town  Agent  â&#x20AC;&#x201C;  1  year  term Lister  â&#x20AC;&#x201C;  3  year  term Town  Grand  Juror  â&#x20AC;&#x201C;  1  year  term Town  Auditor  â&#x20AC;&#x201C;  2  year  term Trustee  for  Rogers  &  Hazzard  Relief     Town  Auditor  â&#x20AC;&#x201C;  3  year  term          Society  â&#x20AC;&#x201C;  2  year  term 'HDGOLQHIRUÂżOLQJSHWLWLRQVIRU$UWLFOHVWREHLQFOXGHGRQWKH7RZQ0HHWLQJ'D\:DUQLQJ LV7KXUVGD\-DQXDU\UGDWSP 'HDGOLQHIRUÂżOLQJQRPLQDWLQJSHWLWLRQVIRUWRZQRIÂżFHVLV0RQGD\-DQXDU\ DW30 (OLJLEOHYRWHUVQRWRQWKH7RZQRI)HUULVEXUJK&KHFNOLVWPXVWÂżOHDQDSSOLFDWLRQWREH DGGHGWRWKHFKHFNOLVWRQRUEHIRUH:HGQHVGD\)HEUXDU\WKXSXQWLOSPWREH HOLJLEOHWRYRWHDWWKH$QQXDO7RZQ0HHWLQJHOHFWLRQVRQ0DUFK3ROOVDUHRSHQ IURPDPÂąSPDWWKH)HUULVEXUJK&HQWUDO6FKRRO   Chester  Hawkins   Ferrisburgh  Town  Clerk/Treasurer 1/16

ADDISON COUNTY WARNING

Pursuant  to  24  V.S.A.  Section  133(3)(a),  the  taxpayers  of  the  County  of  Addison  are   hereby  given  notice  that  the  annual  meeting  regarding  the  proposed  county  budget  for   2014-­2015  will  be  held  at  the  Judge  Frank  Mahady  Courthouse  in  Middlebury  on  Thurs-­ GD\-DQDWDP7KLVEXGJHWLVIRUÂżVFDO\HDU-XO\Âą-XQH More  information  and  extra  copies  of  the  budget  may  be  obtained  at  the  Addison  County   Superior  Court,  Frank  Mahady  Court  House,  Middlebury,  Vermont.  Tel.  802-­388-­7741 Francis  G.  Broughton,  Assistant  Judge Margaret  Gossens,  Assistant  Judge   REVENUE:   County  Tax     �� 0.0426%  2014-­2015   Passports   1RWDULHV ,QWHUHVW(DUQHG Wills  for  safekeeping   5HQW,QFRPHÂą-DLO%OGJ Miscellaneous   727$/,1&20(     Anticipated  Surplus       EXPENSES: Court:   Court  Personnel              Salaries   %HQHÂżWV Dues  &  Memberships   2IÂżFH([SHQVH 2IÂżFH(TXLSPHQW Insurance   7HOHSKRQH2SHUDWLRQV Law  Library   Professional  Services   Contracted  Services   Contingency        Subtotal  

2014-­2015   Proposed   $    194,231.00     $            2,000.00     $            3,500.00    $                  200.00        $        25,000.00   $    256,356.00        $          47,300.00    $              1,500.00     $              2,800.00    $                    250.00   $                7500.00   $              4,650.00         $                    500.00   $          70,550.00

Police  were  dispatched  to  a  North   Street   residence   on   the   afternoon   of   -DQ  UHVSRQGLQJ WR D UHSRUW WKDW Hellmuth   was   at   the   home   in   viola-­ WLRQ RI DQ DEXVH SUHYHQWLRQ RUGHU :KHQRI¿FHUVDUULYHG+HOOPXWKKDG already   left   the   VFHQHRQIRRW+H turned  himself  in   -DQ  DQG ZDV cited   to   appear   in  court  at  a  later   GDWH Hellmuth   was   initially   issued   the   UHOLHIIURPDEXVHRUGHU'HFDQG was  arrested  just  hours  later  on  suspi-­ cion   of   violating   that   order,   in   the   HDUO\KRXUVRI'HF%ULVWROSROLFH UHSRUW 2Q-DQDWDURXQGSPSROLFH DUUHVWHG-RVKXD0DUWHOORI%ULVWRO RQ VXVSLFLRQ RI UHWDLO WKHIW 3ROLFH responded   to   Rite   Aid   on   Prince   /DQH DIWHU UHFHLYLQJ D UHSRUW RI

EXPENSES   (continued)  

2014-­2015

NORTHLANDS JOB CORPS CENTER REQUEST FOR QUOTES

   The  Northlands  job  corps  Center  located   at   100   MacDonough   Dr.,   Vergennes,   VT     05491   requests   the   following   services/ vendors   to   submit   bids   on   the   following   services   for   the   Northlands   Job   Corps   Center.     NJCC   Contract   Base   year   (1)   contract   period   beginning   March   1,   2014   through   November   20,     2014.   Supplies   and/or   services  to  include: 1.      Student  EAP  Services 2.      Waste  Management 3.      Pest  Services 4.      Heating  Fuel 5.      Propane 6.      Boiler  Services 7.      Plumbing  Services 8.      Electrician  Services 9.      Commercial  Floor  Mat  Services 10.  Welding  Gasses  and  Supplies 11.  Janitorial  Cleaning  Products 12.  Other  janitorial  Supplies 13.  CafĂŠ  and  Culinary  Food 14.  Dairy 15.  Bread 16.  Culinary  Specialty  Foods 2IÂżFH6XSSOLHV 18.  Fire  Extinguisher  Services 19.  Payline  Security  Guard 20.  Academic  Uniforms 21.  Trade  Uniforms  and  boots 22.  CafĂŠ  Uniform  and  Trade  Supply  Rental   Services 23.  Wellness  Linen  Services     Bids   must   be   received   by   Date   January   QG DW  SP 6SHFLÂżFDWLRQ PD\ EH obtained   by   contacting   the   Purchasing   Agent,   Annette   Paquette   at   Northlands   Job   Corps   Center   Via   email:   annette. paquette@etrky.com  or  802-­877-­0149.    The  Northlands  Job  Corps  Center  reserves   the   right   to   accept   or   reject   any   and   all   bids.   Small   businesses   and   Minorities   are   encouraged  to  reply.   â&#x20AC;&#x153;THIS   IS   A   SUBCONTRACTING   OPPORTUNITYâ&#x20AC;?                                                                                          1-­6

VXVSLFLRXVDFWLYLW\7KHRIÂżFHUVSRNH with  Martell  outside  of  the  store,  and   Martell   turned   over   a   watch   battery   and   retrieved   the   empty   packaging   that  police  said  he  had  hidden  outside   WKHVWRUH 7KH RIÂżFHU FLWHG 0DUWHOO into  Addison  County  Superior  Court   WRDQVZHUWKHFKDUJHRIUHWDLOWKHIW Meanwhile,   the   police   depart-­ mentâ&#x20AC;&#x2122;s   Facebook   site   included   a   report   that   the   Bristol   Historical   Society   created   a   display   at   the   National   Bank   of   Middlebury   about   the   history   of   the   Bristol   Police   Department,   which   was   formed   in   0D\  ,Q WKH GLVSOD\ DUH VRPH SKRWRV RI RIÂżFHUV DQG IRUPHU FKLHIV RI SROLFH 7KLV GLVSOD\ ZDV FUHDWHG by   members   of   the   historical   soci-­ ety   using   information   obtained   by   RIÂżFHUV DQG %ULVWRO 3ROLFH$GYLVRU\ %RDUG PHPEHUV LQ  DORQJ ZLWK other   research   of   historical   society   PHPEHUV

ADDISON COUNTY

School Briefs Emily  Sundstrom  of  New  Haven,   a  student  at  Saint  Michaelâ&#x20AC;&#x2122;s  College,   LVVWXG\LQJDEURDGLQ$FFUD*KDQD IRUWKHVSULQJVHPHVWHU Hunter   Casey   of   Vergennes   was   named  to  the  presidentâ&#x20AC;&#x2122;s  list  at  Hudson   Valley   Community   College   for   the   IDOO  DFDGHPLF WHUP &DVH\ LV in   the   Heating/Air   Conditioning/ Refrigeration   Technical   Services   DFDGHPLFSURJUDPDWWKH7UR\1< FROOHJH PROBATE  DIVISION DOCKET  NO.  15997 STATE  OF  VERMONT DISTRICT  OF  ADDISON,  SS. IN  RE  THE  ESTATE  OF ROBERT  F.  BOISE NOTICE  TO  CREDITORS To   the   creditors   of   the   estate   of   Robert   F.   Boise  late  of  East  Middlebury,  Vermont. I   have   been   appointed   to   administer   this   estate.   All   creditors   having   claims   against   the  decedent  or  the  estate  must  present  their   claims   in   writing   within   four   (4)   months   of   WKH ÂżUVW SXEOLFDWLRQ RI WKLV QRWLFH 7KH FODLP must  be  presented  to  me  at  the  address  listed   below  with  a  copy  sent  to  the  court.  The  claim   may   be   barred   forever   if   it   is   not   presented   within  the  four  (4)  month  period. Dated:  Jan.  10,  2014 Roger  Boise 434  North  St. New  Haven,  VT  05472 (802)  453-­2682 rboise@gmavt.net Name  of  Publication:  Addison  Independent Publication  Date:  Jan.  16,  2013 Address  of  Probate  Court:  Addison  Probate   Court,  7  Mahady  Court,  Middlebury,  VT  05753 1/16

Proposed

Sheriffs  Department: Personnel:      Salaries   %HQH¿WV 2I¿FH([SHQVH Telephone   ,QVXUDQFH%RQGV Training   9,%5(69/(76   Audit  Fee   Radio        Subtotal  

$      74,984.00   $          1,800.00  $                500.00 $          5,500.00 $          1,500.00   $                750.00 $  124,081.00

Probate  Court: 6XSSOLHV(TXLSPHQW Dues   Contingency   Subtotal            

 $                375.00 $                250.00 $          1,375.00  

Jail  Building: 8WLOLWLHV %OGJ *URXQGV Custodial   ,QVXUDQFH Inspections   Capitol  Improvements   Subtotal  

  $            2,750.00  $            1,500.00 $        15,500.00 $        60,350.00

Total  Expense  

$      256,356.00

PROPOSED STATE RULES



By   law,   public   notice   of   proposed   rules   must   be   given   by   publication   in   newspapers   of  record.    The  purpose  of  these  notices  is  to  give  the  public  a  chance  to  respond  to  the   proposals.    The  public  notices  for  administrative  rules  are  now  also  available  online  at  http:// vermont-­archives.org/aparules/ovnotices.htm.    The  law  requires  an  agency  to  hold  a  public   hearing  on  a  proposed  rule,  if  requested  to  do  so  in  writing  by  25  persons  or  an  association   having  at  least  25  members. To  make  special  arrangements  for  individuals  with  disabilities  or  special  needs  please  call   or  write  the  contact  person  listed  below  as  soon  as  possible. To   obtain   further   information   concerning   any   schedule   hearing(s),   obtain   copies   of   proposed  rule(s)  or  submit  comments  regarding  proposed  rule(s),  please  call  or  write  the   contact  person  listed  below.  You  may  also  submit  comments  in  writing  to  the  Legislative   Committee  on  Administrative  Rules,  State  House,  Montpelier,  Vermont  05602  (828-­2231). +HDOWK%HQHĂ&#x20AC;WV(OLJLELOLW\DQG(QUROOPHQW²$PHQGPHQW Vermont  Proposed  Rule:  14PE01 AGENCY: Dept.  for  Children  and  Families  (DCF)     CONCISE SUMMARY: 7KHHPHUJHQF\UXOHDPHQGVWKHSUHYLRXVO\ÂżOHG+HDOWK%HQHÂżWV Eligibility  and  Enrollment  Amendment  One  in  order  to  incorporate  federal  rule  changes   WKDWZHUHPDGHWRRODWHE\WKHIHGHUDOJRYHUQPHQWWRLQFOXGHLQWKHSUHYLRXVO\ÂżOHGDQG adopted  amendment.  This  rule  implements  provision  of  the  Affordable  Care  Act  and   Vermont  Acts  No.  48  of  2011,  171  of  2012  and  79  of  2013. FOR FURTHER INFORMATION, CONTACT: Robin  Chapman,  Agency  of  Human  Services   Department  for  Children  and  Families,  Economic  Services  Division  103  South  Main  Street,   Waterbury  VT  05671-­1201  Tel:  802-­279-­3996  Fax:  802-­769-­2186  Email:  robin.chapman@ state.vt.us    URL:  http://dcf.vermont.gov/esd/rule FOR COPIES:  Afsar  Sultana,  Agency  of  Human  Services,  Department  for  Children  and   Families,  Economic  Services  Division  103  South  Main  Street,  Waterbury,  VT  05671-­1201   Tel:  802-­769-­6279  Fax:  802-­769-­2186  Email:  afsar.sultana@state.vt.us.   1/16


Addison  Independent,  Thursday,  January  16,  2014  â&#x20AC;&#x201D;  PAGE  11B

Convenience  store stop  ends  with  citation 9(5*(11(6 ² 9HUJHQQHV SR-­ lice  on  Jan.  8  cited  a  Huntington  man   for   refusal   to   submit   to   testing   for   GULYLQJ XQGHU WKH LQĂ&#x20AC;XHQFH RI DOFR-­ KRODQDFWLRQWDNHQDIWHUKHDOOHJHGO\ pulled  into  the  Champlain  Farms  con-­ venience   store   and   approached   two   PHPEHUVRIWKHGHSDUWPHQWDQGDVNHG them  to  help  him  pump  gas.   2QH RIÂżFHU WKH PDQ DSSURDFKHG at   the   Main   Street   business   was   the   GHSDUWPHQWÂśV SODLQFORWKHV GHWHFWLYH which   the   man   did   apparently   with-­ RXWQRWLFLQJDXQLIRUPHGRIÂżFHUZLWK the   detective.   Police   said   they   then   VPHOOHGDOFRKRORQ&KULVWRSKHU-RQHV RI+XQWLQJWRQDQGWKH\FLWHGKLP for   DUI-­refusal   and   also   drove   him   WRWKH$FWGHWR[LÂżFDWLRQIDFLOLW\LQ Burlington  to  sober  up. In  an  otherwise  mostly  quiet  period   EHWZHHQ-DQDQG9HUJHQQHVSR-­ OLFH GHDOW ZLWK WZR RWKHU '8, FDVHV both  on  Saturday. 3ROLFHWKDWQLJKWFLWHG-HIIUH\3LNH RI5LFKPRQGIRU'8,VHFRQGRI-­ IHQVH3ROLFHDOOHJHG3LNHIDLOHGURDG-­ side  sobriety  tests  after  they  stopped   KLPRQ6RXWK:DWHU6WUHHWIRUIDLOXUH to  signal  a  turn.   /DWHU WKDW QLJKW SROLFH FLWHG 5RG-­ QH\ 6WHDUQV -U RI &KDUORWWH  IRU '8, VHFRQG RIIHQVH UHIXVDO 7KH\ alleged   he   failed   roadside   sobriety   tests  after  police  stopped  his  car  at  the   junction  of  Route  7  and  New  Haven  

Vergennes Police Log

5RDGIRUHUUDWLFGULYLQJEXWWKHQUH-­ fused  blood-­alcohol  testing.   ,QRWKHUDFWLRQEHWZHHQ-DQDQG 9HUJHQQHVSROLFH Â&#x2021; 2Q-DQWRRNDUHSRUWRIDPL-­ nor  hit-­and-­run  accident  in  the  Shawâ&#x20AC;&#x2122;s   6XSHUPDUNHWSDUNLQJORW Â&#x2021; 2Q-DQUHFHLYHGWZRWLSVDERXW LOOHJDOGUXJDFWLYLW\LQWKH9HUJHQQHV and  Middlebury  areas.   Â&#x2021; 2Q -DQ  FDOPHG D GLVSXWH EH-­ tween   a   womanâ&#x20AC;&#x2122;s   husband   and   ex-­ ER\IULHQGLQD*UHHQ6WUHHWDSDUWPHQW police  are  still  sorting  out  allegations   RISXVKLQJDQGVKRYLQJWKH\VDLG Â&#x2021; 2Q-DQKHOSHGDFDURZQHUJHW LQWR D ORFNHG YHKLFOH RQ :HVW 0DLQ Street.   Â&#x2021; 2Q-DQFKHFNHGLQDWWKH6RXWK INTREPID  ROTARY  MEMBERS,  members  of  the  Middlebury  Union  High  School  football  team  and  Casella  workers  prepare  to  brave  the  ice   :DWHU6WUHHWKRPHRIDUHJXODUO\WUX-­ on  Saturday  morning,  Jan.  11,  for  the  annual  Merry  Mulch  Christmas  tree  pick-­up  around  Middlebury.  Monument  Farms  provided  the  truck. DQWFKLOGEXWIRXQGQRRQHKRPH3R-­ Photo  by  Max  Kraus OLFH FKHFNHG LQ ZLWK WKH 'HSDUWPHQW of   Children   of   Families   and   learned   that  the  DCF  was  already  investigat-­ ing  the  case.   Â&#x2021; 2Q -DQ  UHFHLYHG D FLWL]HQ FRPSODLQW RI D WUDFWRUWUDLOHU WUXFN Jan.   10.   Police   said   some   dogs   had   electronic   device   had   been   stolen   MIDDLEBURY   â&#x20AC;&#x201D;   Middlebury   WDLOJDWLQJH[FHVVLYHO\IRXQGWKHWUXFN been  left  outside  of  the  home.  Police   IURP D YHKLFOH SDUNHG DW -RKQ *UD-­ police   responded   to   a   report   of   an   DQGLVVXHGDWLFNHWWRLWVRSHUDWRU learned  a  family  member  was  caring   ham  Court  on  Jan.  12. out-­of-­control   man   at   Middlebury   for   the   dogs   while   the   owner   was   Â&#x2021; 5HVSRQGHG WR D GRPHVWLF GLV-­ Collegeâ&#x20AC;&#x2122;s  Mead  Chapel  on  Hepburn   away. pute  at  a  Juniper  Lane  residence  on   Road  on  Jan.  12.  Police  said  the  man   Have a news tip? Â&#x2021; :HUHLQIRUPHGRQ-DQRIWKH Jan.  12. â&#x20AC;&#x201D;   who   authorities   perceived   to   be   Call Mary Burchard recent   theft   of   a   Santa   Claus   card-­ Â&#x2021; $VVLVWHG D ORFDO PDQ ZKR RQ XQGHUWKHLQĂ&#x20AC;XHQFHRIVRPHNLQGRI at 352-4541 Jan.  12  reported  being  harassed  by  a   stimulant  drug  â&#x20AC;&#x201D;  ran  from  the  cha-­ ing   to   a   Case   Street   man   who   was   ERDUGFXWRXWIURP7ULDQJOH3DUN NEWS found  breathing  but  unresponsive  at   Â&#x2021; 5HVSRQGHG WR DQ DOOHJHG HP-­ female  acquaintance.  Police  warned   pel.   6$/,6%85< ² 7KH 6DOLVEXU\ ÂżQDOLVWV LQ WKH *HRJUDSK\ %HH$Y-­ Police  said  they  caught  him  at  the   his  home  on  Jan.  8.  Police  said  an  of-­ bezzlement   complaint   at   G.   Stone   the  woman  to  stop  calling  the  man. ODQGÂżOOLVFORVHGRQ:HGQHVGD\VXQ-­ HU\ $XVWLQ1HLO 'RPLQLF %HFN FROOHJHOLEUDU\DQGWKHQWRRNKLPWR ÂżFHU SURYLGHG ÂżUVW DLG DW WKH VFHQH Commercial  on  Foote  Street  on  Jan.   Â&#x2021; :DUQHG VRPH SHRSOH ZKR KDG til  some  time  in  the  spring.  Saturday   .DWLH %HUWKLDXPH %URRNH &ODUN Porter  Hospital  for  treatment. XQWLOWKHDPEXODQFHDUULYHGDQGWRRN 10.  Police  continue  to  investigate  the   EHHQ VOHHSLQJ ZLWKRXW SHUPLVVLRQ hours   remain   8   a.m.   to   1   p.m.   with   ,DQ (NURRV +XQWHU *DOH 6RSKLH in   a   vacant   apartment   on   North   ,QRWKHUDFWLRQODVWZHHN0LGGOH-­ the   patient   to   Porter   Hospital   for   matter. recycling  available. /DURFTXH 'DYLG 3HWHUV :\DWW 5X-­ bury  police: treatment   of   a   possible   drug   over-­ Â&#x2021; :DUQHGDPDQIRUYLRODWLQJWKH Pleasant  Street  on  Jan.  12. Petitions  for  articles  and  elections   bright   and   Thatcher   Trudeau.   They   townâ&#x20AC;&#x2122;s  ordinance  against  public  uri-­ Â&#x2021; :DUQHGVHYHUDOGUXQNHQSHRSOH Â&#x2021; ,QYHVWLJDWHG D FRPELQHG WRWDO dose. DUHGXHLQWKHWRZQRIÂżFHVRRQ$U-­ ZHUHGXHWRFRPSHWHLQWKHÂżQDOVRQ RIWKUHHWUXDQF\FRPSODLQWVÂżOHGE\ Â&#x2021; :DUQHG VRPH 6RXWK 9LOODJH nation  on  College  Street  on  Jan.  10. WRVWRSEORFNLQJWUDIÂżFRQ6H\PRXU WLFOHSHWLWLRQVDUHGXHRQ-DQE\ :HGQHVGD\-DQDQGWKDWZLQQHU Middlebury  Union  Middle  School  on   Green  residents  to  quiet  down  during   Â&#x2021; 5HFHLYHG D UHSRUW DERXW VRPH-­ Street  Extension  on  Jan.  12. SPDQGSHWLWLRQVIRUHOHFWHGRIÂżFHV ZLOOWDNHDWHVWWRTXDOLI\IRUWKHVWDWH Jan.  7  and  8. the  evening  of  Jan.  9. RQHXVLQJDVXVSLFLRXVLGHQWLÂżFDWLRQ Â&#x2021; :DUQHGDPDQIRUYLRODWLQJWKH are  due  on  Jan.  29  by  5  p.m.  To  ob-­ competition. Â&#x2021; $VVLVWHG UHVFXHRIÂżFLDOVLQ JHW-­ card   to   purchase   alcohol   at   a   Court   townâ&#x20AC;&#x2122;s   open   container   law   on   Sey-­ Â&#x2021; :HUHLQIRUPHGWKDWDFDUSDUNHG tain   a   petition   or   for   more   informa-­ The   Salisbury   Congregational   at  John  Graham  Court  had  been  van-­ WLQJDORFDOGUXQNHQZRPDQWR3RU-­ Street  store  on  Jan.  11. mour  Street  Extension  on  Jan.  12. WLRQFDOOWKHWRZQRIÂżFHDW Church  will  hold  a  rummage  sale  lat-­ dalized  on  Jan.  7. ter   Hospital   on   Jan.   9.   The   patient   Â&#x2021; $VVLVWHG9HUPRQW+LJKZD\'H-­ Â&#x2021; :DUQHG D PDQ IRU OLWWHULQJ RQ The   Friends   of   the   Salisbury   HUWKLVVSULQJDQGZRXOGOLNHSHRSOHWR Â&#x2021; $VVLVWHG9HUPRQW6WDWH3ROLFHLQ ZDV LQLWLDOO\ XQFRRSHUDWLYH DFFRUG-­ SDUWPHQW RIÂżFLDOV LQ FORVLQJ 5RXWH Pulp  Mill  Bridge  Road  on  Jan.  12. School   will   host   the   11th   annual   begin  to  save  good  items  for  the  sale.   responding   to   a   domestic   dispute   in   ing  to  police. DW6DQG+LOO%ULGJHZKLOHWKH\ Â&#x2021; :DUQHGDPDQIRUYLRODWLQJWKH &KLOL&KDOOHQJHRQ6DWXUGD\0DUFK $ OLWWOH FRUUHFWLRQ WR PDNH IURP :H\EULGJHRQ-DQ Â&#x2021; ,QYHVWLJDWHG DQ DQLPDO QHJOHFW salted  the  road  on  Jan.  11. WRZQÂśV RSHQ FRQWDLQHU ODZ RQ $G-­ DWSPDQGDUHHQFRXUDJLQJ ODVW ZHHNÂśV 6DOLVEXU\ 1HZV :H Â&#x2021; 5HFHLYHG D UHSRUW WKDW D 36 LURQGDFN9LHZRQ-DQ Â&#x2021; $VVLVWHGUHVFXHRIÂżFLDOVLQWHQG-­ complaint  at  a  Case  Street  home  on   DOO FRRNV WR VWDUW SHUIHFWLQJ WKHLU mentioned   that   sixth-­grader   Rielly   favorite   chili   recipe.   Catagories   are   :ULJKW4XHVQHO KDV UDLVHG  WUDGLWLRQDO ZLOG JDPH YHJHWDULDQ HDFK \HDU VLQFH NLQGHUJDUWHQ IRU PDGH E\ NLGV PDGH E\ DOXPQL DQG )OHWFKHU $OOHQ &KLOGUHQÂśV +RVSLWDO spiciest   (not   necessary   the   hottest).   DV D :2.2 &KDQJH %DQGLW $FWX-­ %85/,1*721 ² 7KH 9HUPRQW PXQLW\ *DUGHQ 1HWZRUN VWDII ZLOO *UDQWV$EXVLQHVVPD\RQO\DSSO\LQ SURYLGH PDWFKLQJ IXQGV RU LQNLQG $Q\RQH FDQ HQWHU WKH FRQWHVW VWX-­ DOO\ KLV JUDQGPRWKHUWHOOVXV WKDWLW 'HSDUWPHQW RI +HDOWK DQG 9HUPRQW KHOS ZRUNSODFH JDUGHQ JURXSV SODQ one  category. services  for  garden  development. GHQWVDOXPQLDQGFRPPXQLW\PHP-­ LV  WRWDO QRW HYHU\ \HDU 6WLOO &RPPXQLW\ *DUGHQ 1HWZRUN DQ-­ and  implement  their  garden  projects. Grant   winners   will   be   selected   For   more   program   details   and   a   bers.  More  information  will  be  avail-­ pretty  impressive. nounce   a   new   grant   program   for   $ ZRUNSODFH JDUGHQ FDQ KDYH based   on   readiness   to   develop   a   OLQN WR WKH RQOLQH DSSOLFDWLRQ JR WR able  later. 5LHOO\ LV DJDLQ DVNLQJ IRU \RXU small   businesses   that   will   provide   PDQ\EHQHÂżWVIRUDEXVLQHVVDQGLWV ZRUNSODFH JDUGHQ LQFOXGLQJ HP-­ ZZZYFJQRUJ*UHHQ7KXPEV$W-­ Congratulations   to   Josie   Rheau-­ KHOSMXVWVDYH\RXUORRVHFKDQJHIRU funding  and  technical  assistance  for   HPSOR\HHV LQFOXGLQJ IUHVK KHDOWK\ SOR\HH HQJDJHPHQW H[LVWHQFH RI D :RUN.  Call      for  more   PH ZKR KDV UHDG DOO  'RURWK\ the  next  two  months.  He  will  collect   QLQHZRUNSODFHIRRGJDUGHQVDWVLWHV ORFDO SURGXFH LQFUHDVHG HPSOR\-­ ZHOOQHVV FRRUGLQDWRU DQG DELOLW\ WR information. &DQÂżHOG )LVKHU ERRNV IRU FKLOGUHQ your  donations  and  turn  them  in  dur-­ statewide. HH HQJDJHPHQW FDPDUDGHULH DQG 7KHVH ERRNV DUH UHFRPPHQGHG IRU LQJWKH:2.2%LJ&KDQJH5RXQG 7KH*UHHQ7KXPEVDW:RUNJUDQWV healthy  behavior. VWXGHQWVLQJUDGHVWR Up.   For   more   information   call   Sa-­ DUH RSHQ WR DQ\ 9HUPRQW EXVLQHVV The   food   can   go   to   individual   MARKET  REPORT $OVR FRQJUDWXODWLRQV WR WKH  PDQWKD4XHVQHODW or   organization   with   fewer   than   50   HPSOR\HHV XVHG IRU VKDUHG PHDOV

Bring  out  your  trees

Out-­of-­control  man  taken  to  Porter  Hospital

Middlebury Police Log

Salisbury

Grants  available  for  workplace  food  gardens

Lincoln

Have a news tip? Call Kathy Mikkelsen at 453-4014 NEWS

I   hope   everyone   survived   all   that   rain  and  wind.  This  has  certainly  been   DVWUDQJHZLQWHUVRIDU+HUHÂśVVRPH-­ thing  to  lift  your  spirits. *HWRXW\RXUVNLVERDUGVDQGVZLP-­ VXLWV 7KH /LQFROQ /LEUDU\ LV UDIĂ&#x20AC;LQJ GRQDWHG VNL OLIW DQG ZDWHU SDUN GD\ SDVVHV IURP -D\ 3HDN 0DG 5LYHU *OHQ %ROWRQ 9DOOH\ DQG WKH 0LGGOH-­ bury  College  Snow  Bowl.  You  can  buy   DUDIĂ&#x20AC;HWLFNHWIRUDSDLURIVNLOLIW GD\SDVVHVRUDSHUVRQIDPLO\SDFN IRU-D\3HDN:DWHU3DUN(DFKUDIĂ&#x20AC;HLV OLPLWHGWRWLFNHWVVR\RXKDYHDRQH LQFKDQFHRIZLQQLQJWLFNHWVWKDWDUH YDOXHGDWRYHU7KHGUDZLQJZLOO EHKHOGRQ)HE5DIĂ&#x20AC;HWLFNHWVFDQEH purchased  at  the  library  or  at  the  lun-­ cheon   that   will   be   held   at   Burnham   Hall   on   Feb.   1   during   Hill   Country   +ROLGD\ZHHNHQG If   you   wish   to   submit   a   petition   to   get   something   on   the   ballot   for   town   PHHWLQJ WKH GHDGOLQH LV :HGQHVGD\ -DQ  DW  SP ,I \RX ZLVK WR UXQ IRU DQ RIÂżFH WKH GHDGOLQH IRU JHWWLQJ your  name  on  the  ballot  is  5  p.m.  on  

0RQGD\ -DQ <RX ZLOO DOVR QHHG to   submit   a   completed   consent   form.   %RWK PD\ EH SLFNHG XS DW WKH WRZQ RIÂżFHRUGRZQORDGHGIURPWKHWRZQÂśV ZHESDJH,IQRRQHLVLQWKHRIÂżFH\RX PD\GHSRVLWWKHSDSHUZRUNLQWKHVORW QH[WWRWKHRIÂżFHGRRU)RUPRUHLQIRU-­ PDWLRQ RU LI \RX QHHG WR SLFN XS WKH IRUPVIURPWKHWRZQRIÂżFHSOHDVHFDOO  The   annual   meeting   for   the   United   Church   of   Lincoln   will   be   held   on   6XQGD\ -DQ  DW %XUQKDP +DOO ,I \RXDUHDPHPEHURIWKHFKXUFKRULI you  attend  our  services  and  are  inter-­ HVWHG LQ DWWHQGLQJ IRU PRUH LQIRUPD-­ WLRQ SOHDVH FDOO WKH FKXUFK RIÂżFH DW 7KDQN\RX My   son   and   I   had   a   wild   ride   to   Rhode   Island   on   Saturday   so   I   could   attend   my   granddaughterâ&#x20AC;&#x2122;s   baby   shower  on    Sunday.  He  graciously  of-­ fered  to  be  my  driver  so  I  didnâ&#x20AC;&#x2122;t  have   WRGRVR:HKDGDQLFHWLPHYLVLWLQJ ZLWKIDPLO\DQGIULHQGVDQG\HV,ZLOO be   a   great-­grandmother   in   February.   0\KRZWKHWLPHGRHVĂ&#x20AC;\

employees.   Two   size   grants   will   be   DZDUGHG  DQG  E\ WKH Health   Department   and   program   SDUWQHUV 9HUPRQW &RPPXQLW\ *DU-­ GHQ 1HWZRUN *DUGHQHU¶V 6XSSO\ &RPSDQ\DQGJDUGHQH[SHUW&KDUOLH Nardozzi. Full   Food   Garden   Grants   pro-­ YLGHIRUPDWHULDOVDJLIW FHUWL¿FDWH WR *DUGHQHU¶V 6XSSO\ DQG  LQ WHFKQLFDO DVVLVWDQFH Container  Food   Garden  Grants  pro-­ YLGHIRUPDWHULDOVDJLIW FHUWL¿FDWH IURP *DUGHQHU¶V 6XSSO\ DQG  LQ WHFKQLFDO DVVLVWDQFH The  expert  technical  assistance  from   &KDUOLH1DUGR]]LDQG9HUPRQW&RP-­

Hancock

or   be   donated   a   local   food   shelf   or   VHUYLFHDJHQF\(DFKZRUNSODFHZLOO have   different   goals   for   the   garden.   The   technical   assistance   provided   through  the  grant  program  will  help   each   business   determine   the   type   and   size   of   garden   that   best   meets   LWV QHHGV DQG GHYHORS VWUDWHJLHV WR ensure  the  garden  will  be  successful   throughout  the  garden  season  and  for   years  to  come. The   application   deadline   is   Tues-­ GD\-DQ*UHHQ7KXPEVDW:RUN grant   winners   will   be   announced   Feb.  10.  Six  businesses  will  receive   Full   Food   Garden   Grants   and   three   will  receive  Container  Food  Garden  

Have a news tip? Call the Addison Independent at 388-4944. NEWS

+$1&2&. ² 7KH &RPPXQLW\ Church   will   be   holding   the   â&#x20AC;&#x153;Soup   )HVW´ RQ 6DWXUGD\ -DQ  IURP  SP 7KH PHDO IHDWXUHV VRXSV FKRZGHUV DQG VWHZV ZLWK UROOVRUEUHDGZLWKDFKRLFHRIVXQ-­ GDH IRU GHVVHUW 7KH FRVW LV  IRU DGXOWV DQG  IRU FKLOGUHQ  DQG younger.  

The   Community   Church   is   also   VHOOLQJ KLJKTXDOLW\  &DOHQ-­ GDUV&KULVWPDVFDUGVDQG5DGDSDU-­ LQJNQLYHV7KHVHZLOOEHVROGDWRXU dinners.  You  can  also  contact  Roger   &RPHV DW  LI \RX ZRXOG OLNH WR SXUFKDVH DQ\ RI WKHVH LWHPV IRU\RXUVHOIRUDVJLIWV&KHFNXVRXW RQ)DFHERRNDVZHOO

AUCTIONS Tom Broughton Auctioneer Â&#x2021;+RPHÂ&#x2021;Estates Â&#x2021;Commercial Â&#x2021;Consignments %ULGSRUW97Â&#x2021; tombroughtonauctions.com

ADDISON COUNTY COMMISSION SALES

57Â&#x2021;($670,''/(%85<97 6DOHVIRU-DQDQG-DQ Costs BEEF Lbs. per lb Dollars .%URZQ    %OXH6SUXFH   1RS%URV 6RQV    4XHQQHYLOOH%URV    'HHU9DOOH\)DUP  &RQDQWV5LYHUVLGH)DUP   /4XHQHO-U    Costs CALVES Lbs.per lb Dollars 0RQXPHQW)DUPV    %'DQ\RZ)DUP    .D\KDUW%URV    59DQGHUZH\    -+HVFRFN   

7RWDO%HHIÂ&#x2021;7RWDO&DOYHV :HYDOXHRXUIDLWKIXOFXVWRPHUV Sales at 3pm -­ Mon. & Thurs. )RUSLFNXSDQGWUXFNLQJ FDOO


LI N ST EW IN G !

PAGE  12B  â&#x20AC;&#x201D;  Addison  Independent,  Thursday,  January  16,  2014

MIDDLEBURY

Charm abounds in this vintage farmhouse with hardwood floors, solid wood doors, sleeping porch and fenced yard.  Walk or bike to schools or town. Hike the TAM just down the street. $235,000  MLS#4330885

BillBeck.com Middlebury â&#x20AC;&#x201C;  Prime  development  op-­ portunity  on  this  4.2  acre  parcel  with   330   feet   of   frontage   on   Otter   Creek.     Town  water  and  sewer  available,  High   Density   Residential   zone   suitable   for   17  residential  units.    Also  includes  a  4   bedroom,  2  bath  cape  style  home  with   attached  garage.    $695,000

SHOREHAM

Great Main Street exposure, plenty of parking for apartment occupants & office workers. Walking distance to school & town offices. Well maintained & well appointed, investment or owner occupied. Priced below recent appraisal & town assessment, this property is a great value. $239,000 MLS#4090749

BRANDON

This is a home with upgrades above and beyond the average home! Built in 2006 this 3 bedroom home has central air, central vac, security alarm, backup generator, insulated garage, closed cell insulation & 4 season porch off kitchen. All this and it is in immaculate condition! $290,000  MLS#4280354

BRIDPORT

A unique, contemporary home with incredible Adirondack Mountain views on 13.79 acres.  Three bedrooms, 4 baths and large screened in porch.  Fully insulated outbuilding, great for studio, workshop or just extra storage! $249,900  MLS#4252241

For recreation and investment,  this   cottage   has   it   all.     2   bedrooms   with   extensive   outdoor   living   on   Giardsâ&#x20AC;&#x2122;   Bay  on  Lake  Champlain.  Great  views   with  gorgeous  sunsets.  Use  when  you   want  to,  and  rent  to  pay  expenses,  as   the   current   owners   have.     Informa-­ tion  about  renting  will  be  available  to   buyer.   $178,000.

Bridport Mini Farm â&#x20AC;&#x201C; Imagine  your  own   private   domain   off   the   beaten   track   yet   just  15  minutes  from  Middlebury  and  only   minutes   from   Lake   Champlain   with   20   usable   level   acres.   Spacious   4   bedroom   Gambrel   Colonial   including   an   attached   In-­Law   apartment   and   many   recent   im-­ provements.    Currently  set  up  for  horses,   with  riding  rink,  fenced  in  pastures,  and  a   6   stall   40x80   barn   but   easily   adapted   to   other  animals.    Amenities  include  two  pro-­ SDQHVWRYHVVXQURRPWZRFDUJDUDJHZLWKÂżQLVKHGERQXVURRP0LGGOHEXU\PLGGOHDQG school.    All  this  for  an  affordable  price  of    $355,000

)RUPRUHGHWDLOVRQWKHVHDQGRWKHUĂ&#x20AC;QHKRPHV view the online photo album at www.BillBeck.com SUDBURY

Four-bedroom home surrounded by 75 +/- acres & views of mountains and farms. Built in early 1900â&#x20AC;&#x2122;s, renovated in 1988, 1st floor master bedroom & sitting room w/fireplace. Original maple flooring, doors & hardware. Handsome kitchen opens to a deck overlooking the â&#x20AC;&#x153;backâ&#x20AC;? meadow. Middlebury, Brandon, skiing and lakes all close by. $775,000 MLS#4316690

Bill Beck Real Estate 802-388-7983 REACH THE COUNTY, PLACE YOUR AD HERE. CALL 388-4944

Ingrid Punderson Jackson Real Estate 44 Main Street Middlebury, VT 05753 802-388-4242

Vermont: Greater Burlington, Fairlee, Londonderry, Lyndonville, Manchester, Middlebury, Norwich, Rutland, St. Albans, St. Johnsbury, Vergennes, Woodstock New Hampshire: Hanover, West Lebanon LEICESTER Live very economically paying a mortgage instead of rent! Updated electrical, newer windows, recent cosmetic work. Three season porch, easy commute north or south. $79,900 MLS 3106318

www.middvermontrealestate.com

HUBBARDTON Looking for a vacation get-a-way or year â&#x20AC;&#x2DC;round home with all the benefits of being brand new? Located on Lake Hortonia and surrounded by seasonal cottages. $134,750 MLS 4255294 BRIDPORT Cozy one level home with wrap around deck, spacious yard, deeded ROW to the lake, and mudroom entry. Open living area with woodstove. Move-in ready condition. $159,500 MLS 4258349

News Tip? Give  Us  A  Call,  388-­4944

MIDDLEBURY PRICED UNDER RECENT APPRAISAL! Sellers will contribute $4,000 toward buyerâ&#x20AC;&#x2122;s closing costs with an acceptable offer. Brand new roof on house & garage. Convenient one-level living. $199,500 MLS 4219857

EQUAL HOUSING OPPORTUNITY All   real   estate   advertising   in   this   newspaper  is  subject    to  the  Federal  Fair   Housing  Act  of  1968  as  amended  which   makes  it  illegal  to  advertise  â&#x20AC;&#x153;any  prefer-­ ence,  limitation  or  discrimination  based  on   race,  color,  religion,  sex,  handicap,  familial   status,  national  origin,  sexual  orientation,   or  persons  receiving  public  assistance,  or   an  intention  to  make  any  such  preference,   limitation  or  discrimination.â&#x20AC;? This   newspaper   will   not     knowingly   accept  any  advertisement  for  real  estate   which  is  in  violation  of  the  law.  Our  read-­ ers  are  hereby  informed  that  all  dwellings   advertised  in  this  newspaper  are  available   on  an  equal  opportunity  basis.    To  complain   of   discrimination,   call   HUD   Toll-­free   at   1-­800-­669-­9777.

FERRISBURGH Boat or kayak right from your own back yard! Sprawling Ranch-style home in Ferrisburgh with many upgraded features. Beautiful fireplace, rec room in finished basement. $349,000 MLS 4265534 FERRISBURGH Contemporary style home in pastoral setting with beautiful views. Lots of room for outside activities, or farm animals, plus garage and outbuildings. Easy commute north and south. $385,000 MLS 4330901

FEATURED AGENT

NOTICE FROM REALTORS

THE  ADDISON  COUNTY  BOARD   OF  REALTORS  wishes  to  inform  the   public  that      not    all  Brokers  of    real   estate  are  REALTORS...  Only  quali-­ ¿HG5HDOWRUVPD\XVHWKLVWHUP,W is  a  registered  trademark.  Realtors   must  abide  by  a  strict  code  of  eth-­ ics,  take  continuing  education  and   attend  local  monthly  meetings,  an-­ nual  state  conferences,  and  yearly   national  conferences,  hence  making   them  better  informed  on  all  aspects   of  real  estate.    Your   REALTOR   appreci-­ ates  your  business.

Courtney Houston â&#x20AC;&#x201C;REALTORÂŽ/Broker, CBR, ABR, GRI, CRS Courtney has 13 years of experience, is detail oriented and technologically savvy. 0Ä?DFt$FMM $PVSUOFZ)PVTUPO!MNTSFDPN

Lang McLaughry Middlebury

Middlebury Office 66 Court Street

Middlebury, Vermont 05753 802-388-1000 800-856-7585 802-388-7115 (fax)

Vergennes Office

268 Main Street Vergennes, Vermont 05491 802-877-3232 800-577-3232 802-877-2227 (fax)

www.LMSRE.com


Jan 16 2014 — B section