Page 1

H

A

M

I

L

T

O

N

J

E

W

E

L

E

V O L U M E

R

2 .

S

2 0 1 4 .

RARE SPIRITS ON DISPLAY

WHEN ROCK WAS YOUNG

FROM THE RUNWAYS

JACK NICKLAUS IN PARADISE

PATEK PHILIPPE CELEBRATES 175 YEARS OF FINE WATCHMAKING


CONTENTS

H A M I LT O N J E W E L E R S PRINCETON, NJ 609-771-6010

Fall/Winter 2014-15

HAMILTONJEWELERS.COM CHAIRMAN MARTIN SIEGEL PRESIDENT HANK B. SIEGEL VICE PRESIDENT

FEATURES

DONNA J. BOUCHARD VICE PRESIDENT DAVID S. KASTER

4 Welcome Letter

GRAPHIC DESIGNER

6 Fashion: It Bags

CHRISTOPHER D. NAVARRO

8 The Story Behind Glass-U

P U B L I S H E D B Y T H E B J I FA S H I O N G R O U P PUBLISHER

10 Patek Philippe Celebrates 175 Years

STU NIFOUSSI

14 What’s New

28

EDITOR-IN-CHIEF KAREN ALBERG GROSSMAN

16 Pearls: Adding Panache C R E AT I V E D I R E C T O R

18 Red Carpet

HANS GSCHLIESSER MANAGING EDITOR

22 Wellness: Pure Bliss

JILLIAN LAROCHELLE

24 Pantone Fashion Color Report

PROJECT MANAGER LISA MONTEMORRA

26 Wheels: A Better Mousetrap

DESIGNERS CYNTHIA LUCERO

28 From the Runways 32 Bulgari Celebrates 130 Years

JEAN-NICOLE VENDITTI

54

PRODUCTION MANAGER PEG EADIE

36 The Big Day

PRESIDENT AND CEO BRITTON JONES

40 The Honeymoon

CHAIRMAN AND COO

44 Perfect Gems

MAC BRIGHTON

48 Designers: Charles Krypell

Prices are subject to change without notice and may vary

50 Golf: Jack Nicklaus in Paradise

Accent® is published by Business Journals, Inc, P.O. Box 5550, Norwalk, CT 06856, 203-853-6015 • Fax: 203-852-8175;

54 Interiors: Roberto Coin 58 Photography: I Remember When Rock Was Young

16

Advertising Office: 1384 Broadway, 11th Floor, NY, NY 10018, 212686-4412 • Fax: 212-686-6821; All Rights Reserved. The publishers accept no responsibilities for advertisers’ claims, unsolicited manuscripts, transparencies or other materials. No part of this magazine may be reproduced without written permission of the

60 Food: Eat Across America

publishers. Volume 12, Issue 2. Accent® is a trademark of Business Journals, Inc. registered in the U.S. Patent and

62 Spirits: Rarities on Display

Trademark office. Printed In The U.S.A.

RUNWAY IMAGE COURTESY OF ACCESSORIESDIRECTIONS.COM

depending on size, quality and availability. Copyright 2014.


( ) % 6  * 6 - ) 2 ( 7  8LI ÁVWX TSVXMSR SJ  LEW TVSZIR XS FI ER I\GMXMRKXMQIJSVSYVGSQTER]-R1E][ILEH XLILSRSVSJFIMRKREQIHEWE[MRRIVMRXLI 2014 American Business Awards, Company of the Year Retail Category. 8LI%QIVMGER &YWMRIWW%[EVHWEVIXLIREXMSR¸WTVIQMIV FYWMRIWW E[EVHW TVSKVEQ %PP SVKERM^E XMSRWSTIVEXMRKMRXLI97%EVIIPMKMFPI XSWYFQMXRSQMREXMSRW³TYFPMGERHTVMZEXI JSVTVSÁXERHRSRTVSÁXPEVKIERHWQEPP

;IEVIEP[E]WXVIQIRHSYWP]KVEXIJYPXSEGLMIZIWYGLQIERMRK JYPVIGSKRMXMSRW;I[SVOLEVHXSHIPMZIVSYXWXERHMRKWIVZMGI ERHWX]PIXSSYVGPMIRXWERHXLIWILSRSVWEVIE[SRHIVJYP MRHMGEXMSRXLEX[IEVIHSMRKWS2SX[ERXMRKXSVIWXSRSYV PEYVIPW [I GSRXMRYSYWP] WXVMZI XS MQTVSZI SYV WXVEXIKMIW XLEXVIWYPXMRETSWMXMZIMQTEGXSRSYVXIEQSYVGPMIRXW ERHSYVGSQQYRMX] %W EP[E]W [I VIGSKRM^I XLEX [I GSYPH RSXLEZIVIEGLIHWYGLQMPIWXSRIW[MXL SYXXLIWYTTSVXSJSYVZEPYIHGPMIRXW¬ WYGGIWWMZIKIRIVEXMSRWSJFVMHIWJEQMPMIW ERH GSQQYRMXMIW XLEX LEZI MRZMXIH YW XS GIPIFVEXI ER MQTSVXERX VSPI MR XLIMV GLIVMWLIHQIQSVMIW

1SVI XLER  RSQMREXMSRW JVSQ SVKERM^E XMSRWSJEPPWM^IWERHMRZMVXYEPP]IZIV]MRHYWXV][IVI WYFQMXXIHXLMW]IEVJSVGSRWMHIVEXMSRMRE[MHIVERKI SJGEXIKSVMIWMRGPYHMRK1SWX-RRSZEXMZI'SQTER] SJXLI=IEV1EREKIQIRX8IEQSJXLI=IEV&IWX 2I[4VSHYGXSV7IVZMGISJXLI=IEV'SVTSVEXI 7SGMEP6IWTSRWMFMPMX]4VSKVEQSJXLI=IEV ERH)\IGYXMZISJXLI=IEVEQSRKSXLIVW *MREPMWXW[IVIGLSWIRF]QSVIXLER FYWMRIWW TVSJIWWMSREPW REXMSR[MHI HYVMRK TVIPMQMREV] NYHKMRK MR %TVMP ERH 1E] ERH[I[IVIRSXMÁIHSJSYVE[EVHEX ERE[EVHWKEPEMR.YRIMR'LMGEKS

;IEVITPIEWIHXSTVIWIRXXLMWMWWYISJ ACCENT 1EKE^MRI [MXL XSTMGW XLEX [I LSTI ]SY [MPP JMRH IRXIVXEMRMRK ERH VIPIZERX XS ]SY -R EHHMXMSR XS XLI PEXIWX RI[W ERH XVIRH YTHEXIW JVSQ XLI [SVPH SJ JEWLMSR XLIVI EVI E [MHI ZEVMIX] SJ EVXMGPIW SR XSTMGW VERKMRK JVSQ XLI EVXW ERH GYPXYVI XSXVEZIP 4PIEWI IRNS] XLMW MWWYI SJ ACCENT [MXLSYVGSQTPMQIRXW;I[MWL]SY ERH ]SYVW E [SRHIVJYP JEPP ERH LSPMHE]WIEWSRERHPSSOJSV[EVHXS WIIMRK]SYWSSR

8SOIITXLII\GMXIQIRXKSMRKIEVP] XLMWWYQQIVTown & Country1EKE ^MRIERRSYRGIHXLEX,EQMPXSR.I[IP IVW[EWFIIRREQIHXSThe List: America’s Leading Independent Jewelers MR  JSVXLIWIGSRHGSRWIGYXMZI]IEV;IEVI TVSYHXSNSMRXLITVIWXMKMSYWKVSYTSJ Town & Country0IEHMRK-RHITIRHIRX .I[IPIVW XLI FIWX NI[IPV] ERH [EXGL VIXEMP WXSVIW MR %QIVMGE WIPIGXIH JSV XLIMV HMWXMRKYMWLIH WIVZMGI ERH ÁRI GSPPIGXMSRW

 Hank B. Siegel, President

PRINCETON PALM BEACH PALM BEACH GARDENS 1.800.5.HAMILTON HAMILTONJEWELERS.COM

4


1954

60 YEARS OF CONTINUOUS INSPIRATION IN THE PURSUIT OF TECHNICAL PERFECTION

Heritage Black Bay is the direct descendant of TUDOR’s technical success in Greenland on the wrists of Royal Navy sailors. 60 years later, the Black Bay is ready to stand as its own legend. TUDOR HERITAGE BLACK BAY® Self-winding mechanical movement, waterproof to 200 m, 41 mm steel case. Visit tudorwatch.com and explore more.

®


fashion

IT BAGS Fall ’14 handbag must-haves.

ELISE DIAMANTINI

Whether you’re looking for boho chic or tongue in cheek, this season’s trends range in style, silhouette and function. FESTIVAL FRINGE

Music festivals like Coachella have been a big source of fashion inspiration as of late. New York-based forecasting firm The Doneger Group has coined the trend “Frontier,” calling out festival-influenced saddlebags, pouches and anything with fringe. Fashion Snoops’ Laura Miller describes the trend as bohemian mixed with tribal influences. “We saw it on the runways from brands like Ralph Lauren, Tory Burch and Etro,” she adds.

SCHOOL GIRL

Backpacks are… well… back, and you don’t have to be a student to carry one. While silhouettes are smaller than your typical knapsack, it’s also not the mini backpack you remember from the ’90s. Backpacks can be found in various fabrications for wherever you want to carry them: try an active-influenced sling in a nylon fabric for a stylish way to hit the yoga studio, or high-fashion quilted leather for a more upscale look. And if you can’t commit, convertible backpacks (those that can be either worn on the back or converted into a satchel) are trending too.

BUCKET LIST

The drawstring bucket bag is reemerging for fall, making an important impact on the runways. “This is a nod to the ’70s trend, which is in full swing with a cleaned-up ‘mom’ look,” explains Jacqui Ma of trend-forecasting firm WGSN. Size doesn’t matter here either: go for a big “black hole” bucket or a smaller drawstring style.

SHOW US WHAT YA GOT “Transparent materials continue to be strong, as

PATTERN & PRINT

“The trend toward print and pattern on luxury bags has been led by Chanel. Painterly effects and hand-drawn styles add a new artist-casual feel to bags,” says Ma. Fashion Snoops’ Miller echoes this sentiment, noting that “billboard” bags featuring iconic graphics or even Fortune 500 company logos are trending on portfolio bags and totes.

6

TOP: DVF COURTESY OF ACCESSORIESDIRECTIONS.COM. LEFT TO RIGHT: STREET STYLE, ANYA HINDMARCH, ANTEPRIMA, ALL COURTESY OF WGSN GROUP

people like to expose the inner contents of their bags,” explains Ma. This style leaves nothing to the imagination, so make sure to put the items you might not want to show the world inside a cosmetic case!


A stylish twist on an entrepreneurial spirit.

Sunglasses can simply be thought of as commonplace accessories that shield your eyes from harmful sunlight. They can be fashionable, high tech, or somewhere in between, and most people own at least one pair. It wasn’t until January of 2013 that sunglasses also became a statement of collegiate pride. It was then that Glass-U launched with the modest mission of giving fans and students the opportunity to express themselves through the magic of custom sunglasses. 8


µ-X¸WRSXEPPEFSYXQSRI]¶*MRIWE]W µ-X¸WRSXEPPEFSYX[LEXGER[IHSFYXQSVI what can we create that makes others happy?” Taking his entrepreneurial spirit to new heights, Daniel Fine, now a senior at the University of Pennsylvania’s Wharton School, launched +PEWW9[MXLRSSYXWMHIÁRERGMEPFEGOMRK-R January 2013, Fine unveiled the sunglasses company from his dorm room and quickly VIEPM^IHLI[EWRSXWEXMWÁIHXSWMQTP]WIPP his wares to his fellow classmates. He set his sights on something much bigger. “What started as custom, if you will, progressed into what is actually licensed,” he says. “Putting those logos on, having them available for every Greek organization and every school and putting them at a price point that’s really affordable.”

Top 5 Young Entrepreneurs by Entrepreneurs Organization. He has received the “President’s Volunteer Service Award” twice — from Presidents George W. Bush and Barack Obama — and is a Fellow of XLI/EMVSW7SGMIX]VITVIWIRXMRKµXLIFIWXERHFVMKLXIWXSJXLIRI\X KIRIVEXMSRWSJIRXVITVIRIYVW¶-RLI[EWREQIHXLVSYKLER international selection, as one of 30 Global Teen Leaders by We Are Family Foundation. Fine is the founder and chairman of the Juvenile Diabetes Research Foundation’s (JDRF) Youth Board of Advisors and co-founder and former chairman of the LEAGUE 2EXMSREP =SYXL 'SQQMWWMSR RS[ +IRIVEXMSR 32 -R XLI WYQmer of 2014, he was selected as one of the World’s Top 30 StuHIRX)RXVITVIRIYVWERHVITVIWIRXIHXLI97MR1SWGS[JSVXLI G20 Young (Under 40) Entrepreneurs Summit, where he was the ]SYRKIWXSJKPSFEPHIPIKEXIW-RXLI%YKYWXMWWYISJPhiladelphia Magazine, titled “Best of Philly 2014,” at just 21 years old, Fine was named Philadelphia’s “Best Entrepreneur.”

Fine’s resume is impressive indeed. He is the founder and CEO of Team Brotherly Love and The Fine Companies, which includes Glass-U, medical app Dosed, and Boston-based XYXSVMRK ÁVQ 2I\8YXSVW *SPPS[MRK younger brother Jake’s diagnosis with Type-1 Diabetes in 2004, Daniel and Jake launched Team Brotherly Love. (IXIVQMRIH XS ÁKLX .YZIRMPI (MEFIXIW the organization has raised over $1.9 million, thanks to tremendous support from friends, family and the greater community. Committed to increasing public awareness of the disease and helping to find a cure, Fine embarked on the dedicated journey to build his enterprises into philanthropic conduits [MXL KSSH SPHJEWLMSRIH QS\MI ERH HIXIVQMREtion. A portion of all of Glass-U sales go towards supporting these causes.

By placing heavy emphasis on product quality and customer service (while still keeping the product affordable), Glass-U has FIIRGSRWMWXIRXP]VIWTIGXIHERHMWI\TERHMRKVETMHP]8[IRX]WM\ employees and interns work at the company’s Philadelphia headquarters, and Glass-U GURUs (brand ambassadors for the company) can now be found on 84 college campuses across the country, with more yet to come. “What we’re establishing and building is XLMWLMKL[E]MJ]SY[MPP?ERHA+PEWW9MWXLIÁVWXGEVXSKSHS[R that road,” Fine says when discussing the GURU network.

Though Glass-U is the cornerstone of Fine’s business enterprise, he has established multiple companies that range from one-onone mentorship/tutoring programs to tech and digital marketing under his umbrella corporation, The Fine 'SQTERMIW00'-RIEGLSJ these pursuits, Fine emphaWM^IWTLMPERXLVST]µ-X¸WRSX all about money,” Fine says. µ-X¸WRSXEPPEFSYX[LEXGER Glass-U makes fully-folding sunglasses and is licensed by we do, but more, what can hundreds of universities and nearly every fraternity and so- we create that makes others VSVMX]MRXLI97-XLEWFIIRJIEXYVIHEXIZIRXWVERKMRKJVSQ happy? What can we do 8LI 6SWI &S[P XS 0SPPETEPSS^E -R 1E]  +PEWW9 WXVYGO E along the process to make GSRXVEGX [MXL *-*% XS HMWXVMFYXI WYRKPEWWIW JSV XLI ;SVPH sure that we’re giving back? Cup in Brazil, the youngest such company to do so. Under the So now we have a campaign called Rock the Cause that we’re agreement, Glass-U manufactured customized sunglasses for launching shortly, which is partnerships across all types of noneach of the 32 teams par- TVSÁXW¶ ticipating in the World Cup. Fine believes that more companies should emphasize philanthroRecognized for his dedica- py at the beginning, rather than waiting until the business takes tion, Fine has been named SJJXSÁKYVISYXLS[XLI]GERFIEJSVGIJSVTSWMXMZIGLERKI one of TIME Magazine’s Top  -RXIVREXMSREP 0IEHIVW SJ 8SQSVVS[ 8313663; For more information on Glass-U or Daniel, 25) and one of the World’s visit them online at Glass-U.com or DanielFine.com

9


anniversaries

PASSING THE TIME

Patek Philippe celebrates 175 years at the pinnacle of fine watchmaking. LAURIE KAHLE

10

T

his year, Patek Philippe marks a milestone that few companies will ever achieve: its 175th anniversary. The revered Geneva watchmaker has operated without interruption since May 1, 1839, when it was founded by Antoine Norbert de Patek. He was joined by Adrien Philippe six years later. Today, it stands as the last familyowned independent watch manufacturer in Geneva under the auspices of the Stern family, which acquired the brand in 1932. Thierry Stern, who represents the fourth generation of Sterns at the helm, has some surprises in store to commemorate the occasion, though he will reveal nothing until the brand unveils its 175th Anniversary collection in Geneva this fall. Stern’s love of musical minute repeaters and decorative métiers d’art offers some clues to what’s in store. Expectations are high given that the 150th anniversary in 1989 saw the debut of the Calibre 89 pocket watch, hailed as the most complicated watch in the world with 33 complications. Stern recalls how the 150th anniversary collection, especially its minute repeater wristwatches, signaled a transformation for the brand. “Years later, I realized that anniversary marked a new beginning for complications,” he says. “Before that, such complications were normally for pocket watches. It was a celebration of a milestone, but it was also about a new movement and a new era.” Stern, 43, has brought a more youthful perspective to Patek’s hallowed halls since he took over as president from his father Philippe five years ago. While Patek Philippe has maintained its traditional core values, Stern has expanded the use of steel to broaden the brand’s appeal to a younger audience. Women have also benefited with a range of complicated timepieces—including a splitseconds chronograph, minute repeater and perpetual calendar—and striking jeweled novelties, such as this year’s diamond-set Gondolo Ref. 7042/100R-001 with an Akoya pearl bracelet. For men, the new steel version of the Ref. 5960/1A-001 Annual Calendar Chronograph makes a contemporary style statement with its white dial highlighted in black and red. And the Ref. 5990/1A001 Nautilus Travel Time Chronograph, powered by a new automatic movement, combines a chronograph with a practical dual time function. “From Patek Philippe, people expect beauty, quality, accuracy, but also some surprise,” says Stern. “In my mind, there will be two lines: one with useful complications you need every day, while the other is more complicated—minute repeaters, tourbillons, split-second chronographs—which you may not need, but you enjoy the quality of them. Those are really the pieces of art.”


GARDENS AN INSPIRED COLLECTION. CULTIVATED FOR YOU. CHANEL GUCCI RALPH LAUREN SALVATORE FERRAGAMO HAMILTON JEWELERS LOUIS VUITTON BURBERRY HUGO BOSS JIMMY CHOO ROBERT GRAHAM HENRI BENDEL H&M KATE SPADE BROOKS BROTHERS A|X ARMANI EXCHANGE TIFFANY & CO. APPLE DAVID YURMAN J. CREW LILLY PULITZER PANDORA MAYORS JEWELERS MICHAEL KORS WILLIAMS-SONOMA POTTERY BARN TOURNEAU THE ART OF SHAVING LULULEMON ATHLETICA ANTHROPOLOGIE MONTBLANC VINEYARD VINES TORY BURCH BOSTON PROPER J. MCLAUGHLIN SAKS FIFTH AVENUE NORDSTROM BLOOMINGDALE’S MACY’S 3101 PGA BOULEVARD, PALM BEACH GARDENS 561.775.7750 THEGARDENSMALL.COM


Our talented jewelry designers have applied their expertise to develop a repertoire of stunning jewelry essentials perfect for a modern style statement.

H A M ILTON’S PE R SONA L IZED COL L ECT ION Make It Personal. Gift outside the box with a truly unique and memorable piece of personalized jewelry. Customized bar necklaces in a variety of shapes and sizes to suit every style and taste. In 14k yellow gold or sterling silver. Priced from $125. Please allow four weeks for delivery.

14


I N T R O D U C I N G

T H E

MERCER COLLECTION A sophisticated and modern design that mixes classic pavĂŠ diamonds on a unique squared-edge shape.

Hamilton’s Mercer Collection comes in a variety of widths and carat weights. Available in 18k white, yellow or rose gold.

15


pearls

ADDING PANACHE This season’s wardrobe essential is a take on every season’s wardrobe essential: perfect pearls! KAREN ALBERG GROSSMAN

Next to sound judgment, diamonds and pearls are the rarest things in the world.” –Jean de la Bruyere

16

T

here are few creations of nature as beautiful, versatile, romantic, or transformative as genuine pearls. Coveted as far back as 51 BCE (the age of Cleopatra), even a simple strand of lustrous, well-matched pearls will add instant panache to everything you wear, from a T- shirt and jeans to a little black dress. Dressing with pearls does not require complicated how-to charts. Simply clasp on a single strand to enhance the elegance of everything in your wardrobe, or splurge on a longer length to be worn doubled or tripled for maximum impact. Akoya, fresh water, Black, White or Golden South Sea, Conch, Melo, Baroque, Keshi, Mabe, natural or cultured: the choices are vast, the rewards more so. Follow your heart and choose pearls that most closely reflect your spirit; talk to our highly trained associates and we’ll help you make the perfect selection. For holiday 2014, options include suspended settings that showcase the pearl from every angle, and pearls mixed with colored gemstones (mint tourmalines, star sapphires) or with fancy-cut diamonds. Another suggestion: once you own that perfect strand of luminous white or ivory pearls, why not test the magic and mystery of Black South Sea cultured pearls? In 1914, exactly a century ago, Mikimoto established its first Black cultured pearl farm on Okinawa Island. In celebration of this milestone anniversary, Mikimoto has launched a limited-edition multi-colored Black South Sea cultured pearl necklace and bracelet set with signature clasps. Consider too Mikimoto’s Black and White South Sea cultured pearl gradient lariat set in 18K white gold with pavé diamond clasp (pictured far left), the Baroque Black South Sea cultured pearl and pavé diamond ring (pictured left), or Black South Sea pearl and diamond Embrace earrings. Could there be a more meaningful holiday gift? Or as the poets put it: “Love makes everything beautiful, even tears become pearls if they flow in someone’s love.”


red carpet Halle Berry

SHADY LADY Halle sticks to a single hue for her dress, jewels and accessories. Even her stone-studded belt is lovely in lilac.

Joanne Froggatt

PASTEL PRINCESS

HORRAY

forHOLLYWOOD

BRUMANI

Downton Abbey’s favorite nice girl shows her sweet side in a tea-length mint dress, complemented by rose gold and rainbowcolored jewels.

PASQUALE BRUNI

DOVES BY DORON PALOMA

A look at what’s sparkling on the red carpet and beyond... JILLIAN LAROCHELLE

18

Sarah Silverman

STAR STUDDED Statement stud earrings are back in a big way. They’re chic enough for evening but work just as well off the red carpet.


W W W . H A M I L T O N J E W E L E R S . C O M

|

8 0 0 . 5 . H A M I L T O N


Sarah Hyland

OPPOSITES ATTRACT

RING GAME

It’s violet for Viola, but she warms up the coolcolored dress with ruby earrings and a firey red clutch.

Choose a splitshank ring like Sarah’s or stack them yourself for maximum impact. More is more!

SUTRA

BRUMANI

Viola Davis

Maria Menounos:

January Jones

CHIC SEPARATES

SOCIAL CLIMBER Worn with edgy ear climbers and a black diamond knuckle ring, this dress becomes more biker, less Betty.

JACK VARTANIAN

SUAZNNE KALAN, JORGE ADELER, JACK VARTANIAN

IMAGES COURTESY OF D’ORAZIO & ASSOCIATES

Most ladies go for a gown, but matching isn’t all it’s cracked up to be. Maria makes it work with a colorful cocktail ring and contrasting hoops.

20


REINVENT YOURSELF RENDEZ-VOUS NIGHT & DAY Discover the Jaeger-LeCoultre jewellery watch line at ladies.jaeger-lecoultre.com


wellness

Pure

BLISS

Tammy Fender wants to care for your skin—and for you. JILLIAN LAROCHELLE

W

hile studying for her college degree in psychology, Tammy Fender took a job behind a cosmetics counter and was astonished at the number of chemicals being used in even the most well respected skin care products. She began training as an esthetician and blending her own products, using natural herbs and essential oils, in her kitchen. The lovingly handmade treatments quickly gained a word-of-mouth following, and she began doing facials at several luxury spas within Florida. In 2002, she opened her own atelier and spa, Tammy Fender Holistic Skin Care, in West Palm Beach. Here, we interview the sweet and soulful Fender about her namesake skin care line and her philosophy for holistic living. Tell us about how Tammy Fender Holistic Skin Care came to be. I have been intuitively drawn toward a holistic lifestyle since childhood. I’ve always had a really strong desire for people to be happy and achieve wellbeing. Even when I was working behind a cosmetics counter I would think, “What are they buying? Does it work or do they just think it works?” So then I started researching ingredients. I decided to become an esthetician to learn more about the skin and find out how these ingredients were affecting it. I began over 25 years ago, long before organic and natural became the buzzwords in the industry.

22

My training has largely been in botany and aromatherapy. It’s not necessarily an area of study that you go to one school for, but I’ve taken many different courses in this country and abroad. I spent time in France doing informal training with a woman who had a spa there. I’ve spent time in New Zealand and Fiji working with the indigenous medicine men and women, learning how to heal the body and the mind through natural sources. Wherever my travels take me, I have a tendency to study the healing properties of the plant life there. My products were born from a desire to serve my clientele in the most healing and nurturing way. How do you explain the renewed focus on healthy lifestyles? People are once again practicing yoga, choosing organic foods, turning to holistic medicine… In our fast-changing world, we’re all craving what sustains us and brings us peace, joy and vitality. I love to say that were human beings and not human doings. Everyone is searching for a way to slow down and bring balance back to our lives. What treatment would you recommend to someone visiting your spa for the first time? Our holistic custom facial is the ultimate experience in beauty and healing.


We recommend it [in conjunction] with reflexology because when there’s someone at the crown chakra and someone at the base chakra at the same time, there’s an energy balancing that takes place. This is caring for the well-being of the skin and body at once. The oils and herbs that the client selects upon arrival are utilized within both treatments, so it’s completely tailored to each individual.

What’s the biggest skin care mistake you see people making today? It’s important to recognize that the skin is a living organ and that what you put on it permeates to the cellular level. You always want to use products that nourish. Avoid chemicals when possible and don’t fall into the trap of over-cleansing and over-exfoliating.

Tell us about the selection process and the power of aromatherapy. When someone comes into the spa, we offer them a collection of herbs and oils to sit with prior to going into the treatment room. All plants give off either masculine or feminine hormones, and each oil has different physical and psychological healing properties. The oils a person is drawn to might indicate that certain parts of the body need extra healing energy. On an emotional level, if someone is tired they’re probably going to choose a stimulating oil in order to bring life back into balance. It’s an excellent diagnostic tool.

What’s your makeup routine? Personally, I don’t wear any. I like to let the beauty of the skin shine through and live in that space of natural freedom. If you use makeup, use it minimally and only to enhance your best features. Allow your natural skin to glow. I think we can get away from thinking everything needs to be so perfect… healthy and natural is beautiful.

How do men’s skincare needs differ from women’s? My products can be used by both men and women, depending on each individual’s needs. Men’s skin in general is thicker, so it ages more slowly. But they have more irritation from shaving, and their skin tends to be oilier, so they usually need more deep cleaning and purifying. Women are more sensitive with thinner skin, so for them it’s all about nourishing and anti-aging. The best forms of anti-aging originate from natural ingredients: rose is the most powerful at cell renewal. Avocado butter permeates the skin to replace nutrients, which is healing and anti-aging. Are your products FDA approved? Yes, always. They go through all the clinical testing and trials, but they are 100 percent botanical. The products are also handmade. We use food-grade instead of cosmetic-grade ingredients, since the processing of cosmeticgrade ingredients (they are often heated and/or cut with a solvent) decreases their therapeutic value. In our products you’re getting the livingmost parts of the plant in the most natural form possible.

What kind of diet and exercise complements your skin care regimen? Eating things in their most natural state is going to give the highest nutritional value. I’m a big believer in juicing, because it gets those fresh nutrients and enzymes directly to the bloodstream. Obviously when you can do it locally and organically, it’s even better. Stretching and increasing circulation is very important too. I love Pilates, yoga and dance. Dancing creates a freeness. Your mind isn’t necessarily guided in a certain way. We’re always told what we should and shouldn’t do, but when you dance, you’re expressing freedom. What’s next for Tammy Fender? We’re working on so many different things at the moment: growing our retail division with The Breakers, continuing to be a pioneer in holistic skincare, keeping up with demand and figuring out how to expand into global markets. I’m excited to grow into a holistic lifestyle brand. Most of all, we want to continue caring for the person as a whole. I never thought of starting and growing a company; it all just happened from me living my passion. And the best part is getting to see how that passion has benefited others.

FENDER’S PHILOSOPHY “Yin and Yang are the foundations of holistic medicine. Sometimes we all feel a little out of balance, whether it’s because of emotional stress, overworking ourselves, or not nourishing ourselves. My opinion is that the mind and body intuitively urge us to create balance. When you’re eating junk food all the time, the body is going to start craving healthy food. If you’re constantly in front of a computer trying to keep up with your workload, you’re going to crave a yoga class. But to recognize these signals we need awareness. “We must remember that all cells need nutrients and oxygen to thrive. This is where plants are so phenomenal. Plant oils and herbs provide the life force. The skin is a living organism, and it’s amazing because it has the ability to regenerate and to repair itself. It’s also an eliminating organ: when things are out of balance in the body, they’ll start to be pushed out through the skin. “Holistic skin care is all about awareness and prevention. You should be intuitive about what your needs are—not what anyone tells you they are. We have different personalities and different genetic make-ups, so each person is different. Our minds and bodies will tell us what we need to know if we just listen. “We can live in health and peace, even if there is a lot of chaos around us. When we find that inner peace within, it radiates out. That’s what beauty is.”

23


For more than 20 years, Pantone, the global

authority on color, has sur veyed the designers of New York Fashion Week and beyond to bring you the season’s most important color trends. This report previews the most prominent hues in women’s fashion for fall 2014. Fashion designers are often fascinated with the beauty of the past and the spirit of the present—recreating it with color, fabric and style. This fall season is no exception as color was inspired by everything from books to artisan crafts, photography and architecture to exotic landscapes. The distinct color palette takes us on an adventure spanning 100 years—a season roused by various vantage points both past and present. First we have Sangria, an exotic red that evokes a sense of glamorous adventure and faraway destinations, which is then enhanced by Aurora Red, a more sophisticated shade that adds energy and glow. These creative crimsons are followed by two ends of the purple spectrum that fascinate the eye and inspire the imagination. Mauve Mist, a romantic and elegant purple shade, reminds us of the deco era and stimulates a sense of femininity and empowerment, [LMPI6EHMERX3VGLMHEGETXMZEXMRKERHÂI\MFPIWLEHIIRGLERXW the complete spectrum. Pair with Cypress, a majestic and powerful green; indicative of its name, this shade has a lofty presence and serves as a stunning favorite.

MAUVE MIST

CYPRESS

RADIANT ORCHID

ALUMINUM

SANGRIA

MISTED YELLOW

AURORA RED

R O YA L B L U E

C O G NAC

B R I G H T C O B A LT

With its faintly green undertone, Bright Cobalt offers a subtle twist SR XLI GSRZIRXMSREP GSFEPX [LMGL YRMÁIW XLMW WIEWSR¸W FPYIW Likewise, Royal Blue, which is both haunting and distinguished, provides more complexity and excitement than the traditional navy, while still remaining versatile. Pair Bright Cobalt with Sangria and Cypress, or Royal Blue with Mauve Mist and Aluminum, a futuristic stainless steel shade that serves as a complex neutral. Similar to Sangria, Cognac’s name alone leads to enchanting daydreams. This cultured brown takes a conventional autumnal color to a luxurious realm, making the shade unexpectedly ideal for evening wear. Adding a ray of sunlight and warmth, optimistic Misted Yellow alludes to the promise of spring to come.

24


AMERICAN WATCHMAKING IS CRAFTING A COMEBACK IN THE CITY THAT ALWAYS DOES. THE RUNWELL CHRONO FEATURING AN ALLIGATOR LEATHER STRAP AND CREAM DIAL WITH TWO SUB EYES AND DATE INDICATOR DRIVEN BY THE DETROIT-BUILT ARGONITE 5021 MOVEMENT. EXCLUSIVELY AVAILABLE AT FINE WATCH AND JEWELRY STORES.


wheels

Tesla Model S

A BETTER MOUSETRAP

For Tesla Motors, reinventing the wheel doesn’t just involve a new car. ROBERT HAYNES-PETERSON

T

he past two decades have borne witness to fantastical leaps in technology we now consider invaluable: smartphones, GPS guidance systems, tablet computers. It’s also provided its fair share of clunkers: the Segway, non-iPod MP3 players, MySpace. One innovation that appeared to straddle the hot-or-not fence several times since its introduction almost a decade ago: Tesla Motors’ luxury electric vehicles (EVs). In recent months, however, much of the doubt about Tesla’s viability and even its historic importance seems to have been erased through a flurry of investments, new products and innovative sales and intellectual property rights management. Though founded by computer engineers Martin Eberhard and Marc Tarpenning in 2003, it was big thinker Elon Musk who got Tesla rolling. (He’s also a driving force behind much of the commercial space travel industry and a proposed Hyperloop high-speed magnetic rail in California.) The world got its first taste of the future with the Tesla Roadster in 2006. Musk argued that the nascent electronic car industry needn’t be restricted to boxy, utilitarian vehicles. He envisioned luxury roadsters and even high-performance racecars (the Tesla Roadster was the first EV to top 200 MPH, and was soon participating in eco-races in Australia). He made a point of investing personally in American manufacturing and dropping a significant amount of his and other people’s (including the U.S. DOE’s) money into manufacturing. Soon pundits speculated each $128,000 car rolling off the line actually cost millions more based on investments vs. actual production. Various delays, along with a 2009 Roadster recall and battery pack fires in the Model S in 2013, made it seem as if the Tesla might be another rich kid’s vanity toy destined to be tossed aside. (Remember the DeLorean?) Flash forward to 2014, and Musk’s vision is very nearly rock solid. The company posted profits in 2013. Buliding vertically, Tesla offers a growing range of cars. The full-sized, five-door Model S, with a remarkable 97 MPG

highway, expanded sales in the U.K. and Europe significantly during the first part of the year, while the falcon-winged, dual-motor, all-wheel drive Model X is expected to reach buyers by 2015. Just as importantly, the company opened its 100th charging station in Hamilton, New Jersey (also the 22nd state to approve Tesla’s unusual direct sales approach: you can scope the models on a showroom floor, but you must buy online). The most unusual Tesla Supercharger aspect of the Supercharger Station stations? Topping off your batteries doesn’t cost a cent. With enough stations, you can now theoretically cross the country for free. Even more mind-boggling to the traditional Carnegie-era capitalist: in a blog post dated June 12, 2014, Musk made waves by announcing that all of Tesla’s hard-earned (and expensive) patents would be released into the public domain. In an era when the concept of open-sourcing headbutts against the lucrative intellectual property universe (think patented human DNA), the announcement was a potentially world-changing one. “If we clear a path to the creation of compelling electronic vehicles,” Musk wrote, “but then lay intellectual property landmines behind us to inhibit others, we are acting in a manner contrary to that goal.” All of this adds up to a rosy future for Tesla, which claims to have more orders than they can possibly fill. Though he’s no longer associated with the company, Tarpenning is convinced of the significant role luxury EVs play. At a 2012 Silicon Valley Band of Angels lunch, he noted that in 10 years, “all the supercars will be electric or electric assisted.”

26


WELCOME TO OUR WORLD

A privileged partner of aviation since it first took flight, Breitling has established itself as the cult brand among pilots the world over. The new Chronomat Airborne, a special series of the Chronomat created 30 years ago for elite pilots, combines peerless sturdiness with all the performances of an authentic instrument for professionals. Onboard this model designed for the most extreme missions is Manufacture Breitling Caliber 01, a movement chronometer-certified by the COSC – the highest official benchmark in terms of reliability and precision. Welcome to the world of daring accomplishments. Welcome to the Breitling world.

CHRONOMAT AIRBORNE


D A R K

M A G I C

Hamilton Jewelers presents Paul Morelli

RUNWAY IMAGES COURTESY OF ACCESSORIESDIRECTIONS.COM

Made in America by renowned designer Paul Morelli. All crafted in 18k gold with brilliant diamonds and gemstones. A walk on the exotic side. Top row: Bee pendant with white and black diamonds. Dragony pendant with white diamonds. Buttery pendant with diamonds and semi-precious stones. Bottom: Black rhodium diamond bracelet with black, yellow and white diamonds. Diamond bracelet with white diamonds. Black rhodium diamond bracelet with white and black diamonds.

28


WINTER WHITES

Chantecler, from the island of Capri, and available exclusively at Hamilton. A frosty color palette to warm your days. All items from the Bon Bon Collection in 18k white gold. Necklace with freshwater pearls and pavé diamonds. Ring with white coral and pavé diamonds. Earrings with freshwater pearls and pavé diamonds. Bracelet with freshwater pearls and pavé diamonds.

29

RUNWAY IMAGES COURTESY OF ACCESSORIESDIRECTIONS.COM

Hamilton Jewelers presents Chantecler


COLOR CON T R A ST Haute hues make the cut.

RUNWAY IMAGES COURTESY OF ACCESSORIESDIRECTIONS.COM

Featuring bold and vibrant designs from the Hamilton Collections. Top: Hamilton’s Color Classics Collection. 18k white gold handmade gemstone and diamond drop earrings featuring blue tourmaline, green tourmaline and violet spinel. Bottom: Hamilton’s Lisette Color Collection. 18k white gold and diamond halo-setting gemstone rings featuring peridot, aquamarine and tanzanite.

30


A RT IST IC DETA I L S

RUNWAY IMAGES COURTESY OF DAVID HART

On the cuff and on the mark.

Hamilton handmade sterling silver cufflinks with whimsical designs and themes. Perfect for him to make his grade of style. Enameled cufflinks: Speedboat. Black and orange tiger. Royal blue golf bag. Baseball with red stitching. Pirate skull with red bandana and ruby eyes. Red and black race car. Trout. Sailboat. Priced from $350.

31


Celebrating 130 years, Bulgari began in 1884 EWEWQEPPJEQMP]NI[IPV]WLSTGVIEXMRKQEKRMÁGIRXTMIGIWERHLEW since grown into an iconic global luxury company. As an emblem SJ-XEPMERI\GIPPIRGI&YPKEVMNI[IPWEVIMQQIHMEXIP]VIGSKRM^EFPI JSVXLIMVTS[IVJYPSTYPIRGIVMGLGSPSVWHEVMRKGSQTSWMXMSRERH TVIGMWIGVEJXWQERWLMT*VSQLMWÁVWXNI[IPV]WLSTMR6SQI+VIIO WMPZIVWQMXL 7SXMVMS &YPKEVM TMSRIIVIH E PIZIP SJ WOMPP ERH ZMWMSR XLEXWIXXLIWXEKIJSVEYHEGMSYWHIWMKRWERHHMWXMRGXMZIWX]PIXLEX [SYPHFIGSQIORS[REWXLIµ-XEPMER7GLSSP¶SJNI[IPV]HIWMKR

& 9 0 + % 6 -  ' ) 0 ) & 6 % 8 ) 7

=)%67 3*09<96=

-RWTMVIH F] XLI EVX ERH EVGLMXIGXYVI SJ %RGMIRX +VIIGI ERH 6SQI&YPKEVM[SYPHWSSRFIGSQIW]RSR]QSYW[MXLXLI)XIVREP 'MX] VIZSPYXMSRM^MRK NI[IPV] HIWMKR MR XLI TVSGIWW 8S QEVO XLMW WMKRMÁGERX ERRMZIVWEV] &YPKEVM GSQQMWWMSRIH VIRS[RIH %QIVMGEREVGLMXIGX4IXIV1EVMRSXSVIJYVFMWLMXWÂEKWLMTWXSVI MR 6SQI EX :ME HIM 'SRHSXXM  ERH [MPP EPWS JMRERGI XLI renovation of the Spanish Steps. &YPKEVMGETXYVIWXLITS[IVSJPYQMRSWMX]MR0:')%ERI[XMQI TMIGIJSV[SQIR%XVMFYXIXSXLIWYRHMEP0:')%[MRHWLMWXSV] [MXL QSHIVRMX] QIVKMRK JYRGXMSR [MXL HIWMKR% VSYRHIH GEWI ERH E WTIGXVYQ SJ WLEHIW ERH WX]PIW QEOI 0:')% PYQMRSYWP] JIQMRMRIERHGSQTPIXIP]YRQMWXEOEFPI 6SSXIH MR %RGMIRX 6SQER ERH +VIIO XVEHMXMSR 0:')% TE]W LSQEKIXS&YPKEVM¸WVMGLLMWXSV]F]FPIRHMRKluce, the Italian for µPMKLX¶[MXLluxMXWGSYRXIVTEVXMR0EXMR6SYRHIHEWELEPSSJ PMKLX 0:')%¸W KPIEQMRK GEWI IRGMVGPIW XLI TEWWEKI SJ XMQI% PYGIRXKIQWXSRIMWWIXMRXSXLIGVS[RSJIZIV]0:')%GVIEXMSR [LIVI[IEPWSÁRHERI\UYMWMXIHMEQSRHEWTEVOPMRKVIQMRHIVSJ XLI WTMVMXYEP FIEYX] SJ [SQER 0:')%¸W KPIEQMRK FERH XEOIW MRWTMVEXMSRJVSQERMGSRMG&ZPKEVMGSPPIGXMSR7IVTIRXM8LIWGEPIW SJ XLI FVEGIPIX GSMP MRXS ER EVGLMXIGXYVEP KISQIXV] SJ TSPMWLIH QIXEPW[MXLIEGLPMROSRXLIFERHQIPHMRKWIEQPIWWP] ;MXL E GSPPIGXMSR SJ  HMJJIVIRX WX]PIW 0:')% VERKIW JVSQ E GPEWWMGWXIIPZIVWMSRXSXLIPY\YV]SJTMROKSPHERHTEZqHMEQSRHW 8LMWHIRWIVERKISJRI[GVIEXMSRWTPE]MRKSREWMRKPIXLIQITE]W a strong tribute to the femininity that unites all women, but also HIRSXIW KVIEX VIWTIGX JSV XLI FSPHRIWW XLEX GLEVEGXIVM^IW IZIV] Bulgari woman.

32


Photo credits: David Steele and Marie Labbancz.

Book your next corporate event or holiday party at Rat’s Restaurant. Ground For Sculpture and Rat’s Catering offers a full complement of resources and services for a wide range of social, private, and corporate functions. So many events, from weddings and holiday parties to trade shows and lectures, have been inspired by the unique interplay of nature and art. Whether it’s an intimate wedding reception or an out-of-the-box corporate planning session overlooking the magical landscape of Rat’s Restaurant, only the inspired cuisine and the dedicated staff’s attention to detail rival the setting itself.

Located in the heart of central New Jersey, Rat’s Restaurant is open year round, Tues - Sat: 11:30am - 9pm, Sun 11am - 5:30pm and is closed Mondays. For directions and info, visit ratsrestaurant.com or call 609.584.7800.

Rat’s Restaurant is located at spectacular Grounds For Sculpture (609) 584-7800 | 16 Fairgrounds Road, Hamilton, NJ | www.ratsrestaurant.com


WEDDINGS

IMAGE LARA FERRONI, COURTESY OF AK CAKE DESIGN

A SPECIAL BRIDAL SECTION FROM ACCENT MAGAZINE


T H E B I G D AY

BY KRISTEN FINELLO

new twists on tradition WHEN IT COMES TO TYING THE KNOT, COUPLES AND EVENT DESIGNERS ARE CONSTANTLY LOOKING FOR WAYS TO PUT A UNIQUE SPIN ON TRADITIONAL ELEMENTS. FROM MUSEUM-WORTHY CAKES TO DRAMATIC DRESSES, STEAL THESE IDEAS TO MAKE YOUR BIG DAY A STANDOUT SUCCESS.

SENSATIONAL SEATS Not long ago, draping guest seats with fabric chair covers was a simple and popular way to add interest and elegance at a ceremony or reception. “Over time, though, everyone got tired of seeing so much fabric in a room and chair covers were replaced by the chiavari chair,” says Dallas-based celebrity wedding and event specialist Donnie Brown, author of Donnie Brown Weddings: From the Couture to the Cake. The chiavari, with its classic, elegant style, became the go-to for many couples and event designers. Now the chameleon chair—aptly named because it can be customized to complement virtually any wedding aesthetic—has become the seat of choice. “Chameleon chairs are the coolest chairs in the world,” says Brown, who has used them at many events. Made of steel, the basic chair comes in several styles and leg colors including black, gold and silver. Dress them up with seat cushions, chair covers and jackets (longer swaths of fabric) in dozens of fabric colors, from charcoal and platinum to eggplant and raspberry. For an even more dramatic look, choose chair covers or jackets with tulle, lace, metallic or ruffles. “Now you can completely customize your chairs to your event,” says Brown. “They are fabulous.”

DECADENT DÉCOR “Sparkle and glitz are really big right now,” explains Brown. One creative way to bring some bling to your event is to incorporate jewelry into the décor. Using brooches is especially chic. They can glam up cakes, escort cards, napkins (tie with a pretty ribbon and attach a brooch), menu cards and bridal bouquets. “One of the big things these days is using brooches on the cake,” says Brown. “I also

around each tier instead of piping.” Rhinestones can add a reflective element to guest tables too. “Instead of a fabric runner, arrange a wide band of rhinestones down the center of the table,” suggests Brown. Traditional linens are getting a high-style makeover with the addition of embellishments such as ruffles, stones and beads. Seasonally-hued stones in amber, black and brown are especially trendy for fall.

B R I D A L

36

S E C T I O N

COURTESY OF EDMONSON PHOTOGRAPHY

did a wedding where we decorated the cake by stringing rhinestone necklaces


P OIS MOI COLLECTION


ELEGANT AFFAIRS

THE FRESHEST FARE From cocktail hour to dinner, the focus is on fresh, tasty and elegant. “It’s about the quality of the food, not just having an abundance of it,” says Andrea Correale, president and founder of Elegant Affairs Caterers in New York. “People are eating less and looking for healthier items such as local, organic produce.” Farm-to-table is a huge trend and couples are displaying menu cards that list the sources of the food they’re serving. The long-popular antipasto table is out, says Correale. In its place she suggests a chef-manned burrata (creamy mozzarella) bar with a selection of pestos and a hanging bread display. Also popular are vegan sushi and dishes such as free-range organic chicken with kale or quinoa salad. For couples wanting to update the traditional Champagne toast, Correale serves flutes of Champagne Jello topped with a toast point and caviar. And whether it’s a rolling oyster bar, gueridon service (in which some dishes are partially prepared tableside on a food service trolley) or strolling waiters offering organic beet and taro root chips, interaction and old-time elegance are back big-time. In fact, even the venerable Viennese table has been replaced by butler-passed bites such as pie fries, cheesecake lollipops, and warm cookies with a shot of milk.

ONE-OF-A-KIND CONFECTIONS No longer just a sweet treat to finish off the meal, cakes are becoming an important design element at weddings. “Couples want a cake that reflects their individuality and harmonizes with the look and feel of their event,” says Allison Kelleher, owner of AK Cake Design in Portland, Oregon. “That could mean an elegant white cake with sugar flowers or a bold, brightly colored creation.” Today’s cakes are impressive works of art that feature elements such as mosaics, metallics and hand-painting. So-called “naked” cakes—tiers of cake and filling without an iced outer layer—are also popular with couples favoring a natural look. They can be served as one large cake or individual mini cakes. Also hot: unusual cake shapes such as spheres and taller-than-usual tiers. “Cake tiers have typically been four inches high but now we’re

taller,” says Kelleher. “When stacked all together they make for a lovely and graceful cake.”

B R I D A L

38

S E C T I O N

LARA FERRONI

seeing individual tiers that are five to six inches or


ISABELLE ARMSTRONG

DRESSES THAT IMPRESS Every bride wants a dress that wows, and the latest looks don’t disappoint. White is timeless but dresses in soft tones such as blush and peach are gaining popularity with fashion-forward brides looking for a new twist on tradition, says Tara Nattini, president of bridal design house Isabelle Armstrong. “The silhouette may be classic but the color makes it modern.” For another contemporary take, brides are opting for subtle yet striking ombre designs that gradually transition from white or ivory to a color such as pink or peach. Also on-trend: gowns that highlight the bride’s back. “The back is really the focal point when the bride is walking down the aisle, so we’re accentuating it with crystals and lace, says Nattini. “Plus, jewelers are doing dramatic necklaces that trail down the back and dresses with bare backs really show them off.” Finally, taking a cue from Duchess Katherine, and more recently, Kim Kardashian, brides are opting for sleeves to the elbow or wrist. “Once considered very traditional, sleeves are becoming more modern and trendy,” says Johanna Kraft, designer and production manager at Isabelle Armstrong. Her fall collection includes gowns with detachable sleeves that give brides two looks in one dress: classic long sleeves for the ceremony and a sexy, sleeveless reception style.

WE ARE FAMILY When it comes to choosing attendants, couples are ignoring outdated rules and following their hearts. For one thing, they no longer feel obligated to have an equal number of bridesmaids and groomsmen, so there’s no pressure to fill a spot or leave out someone you’d like to include. “I’m also seeing a lot more male/female role reversals,” says Brown. A bride, for example, might have her brother or a close male friend on “her side” rather than only asking sisters or female friends. Having parents or even grandparents in the bridal party is another new twist. For her March MICHAEL CASWELL PHOTOGRAPHY

2014 wedding, Cali Solorio of Austin, Texas asked her beloved grandmother and great aunt to serve as flower girls. The ladies joyfully tossed petals as they walked down the aisle. “We got so many compliments. People couldn’t stop talking about them,” says Solorio. “I loved having them in my wedding and I’m so glad we decided to do something untraditional that people will remember.”

B R I D A L

39

S E C T I O N


THE HONEYMOON

BY KELLY E. CARTER

LIFETIME ADVENTURES

HORSEBACK RIDE IN BOTSWANA

SURF IN THE MALDIVES

Add romance to action with a stay in an over-the-water bungalow at a luxurious resort in this tropical paradise in the Indian Ocean. Known for its spectacular whitesand beaches and shimmering turquoise waters, the Maldives are also where water-loving lovers can hang 10 together on some of the most perfect waves in the world. Surf breaks are endless but immediate access from resorts is limited. Charter a boat to reach the best breaks and escape the crowds that pack boat shuttles from hotels during the busy months. Surfing in the Maldives is available year round, but June to September are the prime months for honeymooners chasing the best swells. Avoid the masses in the Central Atoll and the more isolated South Atolls, but expect plenty of company in the Malé Atolls. TropicSurf can arrange luxury surfing experiences with five-star boats and resorts, expert guides and tailored trips such as a romantic dinner on a deserted island or a private seaplane to a secluded surf break (which would take a boat several hours to reach). Visit tropicsurf.net.

B R I D A L

40

S E C T I O N

Safaris, one of travel’s ultimate thrills, are even more exciting from the saddle. They don’t get any better than in Botswana, where game is wide-ranging and plentiful. Home to all of the Big Five (lion, African elephant, Cape buffalo, leopard and rhinoceros), Botswana also boasts Africa’s largest concentration of elephants. Ride through the glittering Makgadikgadi Salt Pans and the expansive horizons of the Okavango Delta, where it’s possible to come across elephants, zebra, hippos and giraffes. Lovebirds who go during green season, the early part of the year and when the dry savannah turns verdant, have to put up with a little rain but benefit from the numerous birds drawn to the lush landscape. In the Kalahari they’ll have the opportunity to ride alongside the zebra, wildebeest and springbok migration, and should be able to enjoy a more personalized experience thanks to fewer crowds. Those who disdain pre-packaged tours can have Explore Africa design a highly-customized, private experience tailored to their budget, created for beginner to advanced riders, and offering accommodations ranging from luxury lodges to mobile camps, whether it be for one day or two weeks. Special honeymoon arrangements can be made as well as handcrafted, one-of-a-kind adventures. Visit exploreafrica.net.

IMAGES COURTESY OF UNCHARTED AFRICA

During sundowner, newlyweds can toast while gazing at a spectacular sunset.


PEACE OF MIND STARTS WITH PROOF OF QUALITY. Weight Carat 1.53

ColorE Grade Grade Clarity VS1

Grade CutExcellent

Laser Inscription Registry Number GIA 16354621 Natural Diamond Not Synthetic

For over 80 years, GIA has brought clarity and global standards to gem evaluation. A GIA report means expert, independent verification from the creator of the 4Cs and the world’s most widely recognized gem authority.

Look for GIA-graded diamonds and jewelers who offer them. www.4cs.gia.edu CARLSBAD ANTWERP BANGKOK DUBAI GABORONE HONG KONG JOHANNESBURG LONDON MOSCOW MUMBAI NEW YORK OSAKA RAMAT GAN SEOUL TAIPEI TOKYO


WHY DIAMOND KNOWLEDGE STARTS WITH THE 4CS Every diamond is unique—a precious expression of celebration and aspiration around the world. And yet all diamonds share certain features that allow us to compare and evaluate them. Recognizing the need for one standard to describe a diamond’s quality, GIA created the 4Cs: a universal language that diamond buyers everywhere can understand.

Here are some quick pointers to help you become better educated about each of the 4Cs.

Carat Weight 1.53

Color Grade E

Clarity Grade VS1

Cut Grade Excellent

CARAT WEIGHT

COLOR GRADE

CLARITY GRADE

CUT GRADE

Carat weight is the measurement of how much a diamond weighs. All else being equal, diamond price increases with carat weight, because larger diamonds are more rare and desirable.

Diamonds are valued by how closely they approach colorlessness – the less color, the higher their value. GIA’s D-to-Z Scale begins with D, representing colorless, and continues to Z, for diamonds that appear light yellow or brown.

Diamond clarity refers to the relative absence of inclusions and blemishes. The GIA Clarity Scale contains 11 grades, with most diamonds falling in the VS (very slightly included) or SI (slightly included) categories.

In evaluating cut for the standard round brilliant diamond, GIA takes into account seven components: brightness, fire, scintillation, weight ratio, girdle thickness, symmetry, and polish. It then assigns a cut grade ranging from Excellent to Poor.

LEARN MORE ABOUT THE 4CS AND HOW TO CHOOSE A DIAMOND ON GIA’S OFFICIAL

CHANNEL.


BACKROADS

TREK FROM CUSCO TO MACHU PICCHU Think of the fun newlyweds can have rubbing each other’s feet every evening after a lodge-to-lodge journey on foot from Cusco, once the capital of the Inca Empire, to Machu Picchu, a UNESCO World Heritage Site. Machu Picchu, rising nearly 8,000 feet above sea level in a tropical mountain forest, may be one of the most famous sites in the world and is visited by countless travelers annually, but there’s still a way for couples to have a distinct experience while visiting this 15th-century Inca creation. With a voyage arranged through Backroads, honeymooners can have porters and mules transport their luggage while they tackle the trail on foot during the day. At night, they’ll sip bubbly in the outdoor hot tub of a luxurious hotel. As a way to control the tourism impact on the area, Machu Picchu mandates that all visitors take its buses to the cultural site. But honeymooners in search of romance can grab one of the early buses to enjoy the first light of the day and slip away to a quiet corner away from the crowds to take it all in. The more adventurous in search of the most impressive view can hike Machu Picchu Mountain, using a special permit from Backroads. As if the trip isn’t mind-blowing enough, the company can help make this an even more extraordinary expedition. For an additional fee, they’ll provide Champagne that guests can sneak in to the ruins and arrange for a private dinner with the chef at Sol y Luna restaurant, room upgrades at lodges, and a private meeting with a shaman to read their cocoa leaves. Visit backroads.com.

KITE SKI THROUGH ANTARCTICA This frosty, remote continent gives thrill-seeking twosomes even more reason to snuggle. By itself, Antarctica sounds like a journey beyond the imagination of many. Toss in the exhilaration of kite-skiing and the stimulation of ice climbing and newlyweds will relish an adrenaline-pumping honeymoon on the Earth’s southernmost continent, where stunning scenery, dotted by icebergs at every turn, overwhelms. Whisk across pristine snow while kite-skiing—more like cross-country than downhill skiing—or ascend virgin peaks while ice-climbing untouched mountains. Those who book an adventure with White Desert, which doesn’t require guests to be athletes, only in normal physical condition, follow as professional polar explorers guide them to nirvana. White Desert offers standard programs that include climbing, kite-skiing and a visit to the Emperor Penguin colony to see the real life stars of March of the Penguins, but also designs bespoke excursions to meet clients’ wishes, such as a special kite-skiing trip using 4x4 for support while out in the field. When a couple wed last December at its camp, which fuses old-world luxury and high-tech performance, the bride wore a white dress—along with a parka. Visit white-desert.com.

B R I D A L

43

S E C T I O N


PERFECTGEMS

EXPLORE THE LITTLE LUXURIES THE WORLD HAS TO OFFER. DONALD CHARLES RICHARDSON

ESCAPE ARTISTS

There are many opulent hotels on the glamorous island of St. Barths. Then there’s the Taiwana. Set on Flamands Beach, Taiwana is the island’s most private retreat. Within moments of your arrival, the staff knows your name and room number and is quickly learning your preferences in wine and food. Both are superb at this resort (and if you wake up hungry in the middle of the night, you’ll find someone on duty in the restaurant to supply a snack or ice cream). The rooms are sleek and sumptuously supplied with Frette towels, robes and linens. There’s an excellent Neville hair salon and spa. But it’s the ambiance of an exclusive club that truly sets Taiwana apart and makes it one of St. Barth’s most stylish places to unwind.

RICHARD TERMINE

CAT HITS HIGH NOTE

Celebrated for producing works composed for intimate venues, New York’s Gotham Chamber Opera is now in its 12th season. Performances have included rarities from the Baroque era, such as Mozart’s Il sogno di Scipione and Purcell’s Dido and Aeneas, and contemporary operas including I Have No Stories to Tell You by Lembit Beecher and The Raven by Toshio Hosokawa. During the 2014/2015 season, the company will present a revival of a favorite, El gato con botas (Puss in Boots), by Xavier Montsalvatge, at New York’s El Museo del Barrio. The opera tells the children’s story of a miller who inherits a mangy cat with magical talents. The cat woos a princess for the miller and, after defeating an evil ogre through trickery, happily unites the miller and princess. They marry and provide a warm home for the cat (which is probably what the cat had in mind all along).

44


The Pastel Collection

F e at u r e d i n 18 k t g o l d w i t h M o rg a n i t e , P i n k S a p p h i r e s a n d D i a m o n d s


GATHERING THE GRAPES At the 56-acre Hestan Vineyards located at the base of Okell Hill on Napa Valley’s eastern slopes, individually farmed blocks are planted with all five Bordeaux varietals: Cabernet Sauvignon, Merlot, Petit Verdot, Cabernet Franc and Malbec. The grapes are co-harvested and cofermented to create Stephanie Proprietary Red Wine, a Bordeaux made from a layered blend of 46% Cabernet Sauvignon, 21% Petit Verdot, 16% Malbec, 12% Merlot and 5% Cabernet Franc. Limited to 900 cases, Stephanie is a complex wine with an intriguing nose of licorice, clove and sweet spice mingled with cedar, tobacco and black currant. And rich mocha notes unfold on the supple palate, lingering well into the long, elegant finish.

ROCK STAR

PHOTO BY NICOLA GNESI. ARTWORK © KAN YASUDA. COURTESY EYKYN MACLEAN

Sculptor Kan Yasuda’s critically acclaimed work is exhibited and installed at galleries and public spaces all over the world. The Boboli Gardens in Florence displayed the first abstract sculptures in this 500-year-old collection; a solo exhibition featured 18 large works at the Yorkshire Sculpture Park; and a 17-acre sculpture park is dedicated to him in Japan. Working in marble (his studio is in Pietrasanta in northern Italy, near the Carrara quarries), Yasuda’s creations are gentle, tranquil and contemplative, encouraging interaction with the viewer. At his recent American debut show at Eykyn Maclean Gallery, when asked how an individual should chose a sculpture, Yasada replied, “Touch it, and if it touches you back…”

UN CHÂTEAU AVEC DES ANIMAUX EXOTIQUES As you drive into the Château of Thoiry, about 30 miles west of Paris, don’t be surprised if a giraffe strolls past your car. Many animals, such as camels and zebras, roam freely. Others, like tigers, leopards and cheetahs, are kept in the château’s zoo. While touring this 16th-century, 370-acre estate, you’ll also discover a maze, several gardens, a restaurant, and possibly the current Count and Countess of La Panouse, who still live in the château (part of which is shown to the public by costumed guides). Because architect Philibert de l’Orme designed the château to be in perfect harmony with nature, the most spectacular time to visit is during the summer or winter solstice, when the center arch marks the exact position of the sun.

46


EMPIRE COLLECTION Diamonds 路 Prasiolite 路 Tourmaline


D E S I G N E R S P O T L I G H T:

Charles Krypell, a brand synonymous with luxury, craftsmanship and exclusivity, invites you to peek inside the heritage of a familyowned and operated, world-renowned jewelry design company. Recognizable for award-winning styles and trendsetting designs, XLI 'LEVPIW /V]TIPP 'SQTER] LEW GSRXMRYIH XS MRÂYIRGI XLI world market since 1976.

‘Jewelry designer’ is not the only title Charles Krypell bears; he MWEPWSEVIQEVOEFPIFYWMRIWWQER,MWTLMPSWSTL]SRXLIXSTMGSJ FYWMRIWW MR ÁRI NI[IPV] MW EW JSPPS[W µ7TIGMEPX] HIWMKRIVW LEZI a strong involvement in design and maintenance towards their business. Today, a designer must not only be hands-on and innovative, but must be able to conceptualize the product, take it to market and provide strong distribution. If you are able to A native New Yorker, Krypell realized his calling as a designer of stand out as a specialty designer in today’s ever-changing market, jewelry while attending Pratt Institute in Brooklyn, New York. it is what we call sustainability, maintenance, listening to your core During this transformation period, Krypell was fortunate to ap- GYWXSQIVERHXLIVIEWSR]SY[MPPYPXMQEXIP]WLMRI¶ prentice with and work alongside master carver-turned-sculptor Toshio Odate. Trained as a sculptor, Krypell enjoyed working in Charles Krypell’s current success has come from an underthree-dimensional media, including clay, wood, brass and stone. standing that style and design needs to evolve over time. Thus in  /V]TIPP¸W PEXIWX GSPPIGXMSR 7XIVPMRK 7MPZIV [EW MRXVSHYGIH Constantly pushing the boundaries of design, Krypell utilizes his into mainstream America. Well styled, fresh and casually elegant, sculptor’s eye, ample artistic talent and keen insight into human this collection attracts the most discerning collectors. Krypell

“Constantly pushing the boundaries of design, Charles utilizes his sculptor’s eye, ample artistic talent, and keen insight into human nature to fashion one of the world’s premier jewelry lines. 0SSOMRKEXLMWNI[IPV]MXMWGPIEVXLEXSRIEVXMWXMGGVEJXÂS[WWIEQPIWWP]MRXSXLISXLIV¶ nature to fashion one of the world’s premier jewelry lines. Looking at his exquisite, perfectly balanced jewelry, it is clear XLEX SRI EVXMWXMG GVEJX ÂS[W WIEQPIWWP] into the other.

explains, “I wanted to create a balance of the whole woman, not just SJLIVNI[IPV]1]7XIVPMRKGSPPIGXMSRMW[IEVEFPIEVXXLEXLETTIRWXS FIGEPPIHNI[IPV]¶

Charles Krypell is forever challenging himself to pursue the pinnacle of beauty and promises to relentlessly add to what is Krypell designs jewelry meant to be enalready one of the most distinctive collections in the world, year joyed from multiple approaches, just after year. As Krypell describes, “Many have said and will continue PMOIETMIGISJÁRIP]XYRIHWGYPTXYVI,I to say, ‘Charles, you are only as good as your next collection.’ Well, wants his clients to enjoy the piece of jewelry designed from every my new collections will mix and match, layer and stack, and single angle. Thus, his introduction to national advertising needed balance off my previous collections in a perfectly paired manner. XSVIÂIGXLMWGSVIZMWMSRMRHMQIRWMSREPMX] My design style is passionately evolving as my collectors’ standards continually rise. Experience what you will consider your treasures µ%[SQERRIIHWXSFIERMRHMZMHYEP¶WXEXIW/V]TIPPµ7LIRIIHWXS SJXLIJYXYVI)RNS]¶ JYPP]I\TIVMIRGIXLIHMQIRWMSREP[SVPHMRJVSRXSJLIV¶

48


golf

JACK NICKLAUS IN PARADISE Redefining the Los Cabos resort experience. EDWARD KIERSH

O

n the tip of Mexico’s Baja Peninsula, high above sheer, windswept cliffs offering stunning panoramas of the Pacific Ocean, the legendary “Golden Bear” has collaborated with Mother Nature to design a breathtaking—and provocative—$40 million, eight-years-in-themaking golf course that promises to redefine the Los Cabos resort experience. Opening this October, Jack Nicklaus’ challenging 7,224-yard, par-72 Quivira Golf Club, featuring three holes that “literally hang over the ocean,” will be the centerpiece of two luxury resorts and three high-end real estate communities. It will also be “unlike any other course in Los Cabos,” according to Nicklaus, who has designed five other courses in the area, since even high-handicap golfers can savor the jaw-dropping views

provided by the unique mountain-ocean-desert ecosystem. “Many people will think it is the most spectacular golf course [in the world], while some will struggle with it,” says Nicklaus, the “Golfer of the Century” with 120 professional PGA tour victories and 18 major championship wins. And now, he’s the designer of 380 courses worldwide. “Yet this property was far too unique to try to create a resort course that would be suited just for high-handicappers. It was a course where you had to take advantage of all the spectacular [topographic] situations, and whether they were too difficult or not, you had to employ them. This is a terrain that offers more elevation changes and oceanfront exposure than any other course in Los Cabos. If you look at golf as a fun experience and want to play in an exciting place, you will love Quivira.” (continued)

50


A place you’ll always remember. A day you’ll never forget. Your happily-ever-after starts here… at our splendid Palm Beach paradise. With a stunning lakeside pavilion, inventive cuisine and unrivaled service, PGA National Resort & Spa is the premier destination for luxury weddings. Call 1.888.893.2182 today and begin planning your unforgettable celebration at PGA National Resort & Spa.

undeniably

HOT

unexpectedly

COOL

Personal Wedding Planner | Customized Menus | Bridal Packages at the Spa | Exclusive Wedding & Honeymoon Packages 1.888.893.2182 | 400 Ave of the Champions | Palm Beach Gardens, FL 33418 | pgaresort.com/wedding | Jewelry provided by Hamilton Jewelers


Indicative of that excitement, several holes that rise more than 350 feet above sea level afford views of frolicking whales and crashing waves. Yet perhaps most exhilarating is the dramatic three-quarter-mile drive to the fifth hole, which crosses arroyo-spanning bridges and traces a switchback route up the side of a mountain. An awe-inspiring climb already dubbed “the greatest drive in golf,” this marvelous ascent is more than 200 feet above sea level, and once ending at the tee at the short par-4 fifth hole, an exclamation point awaits golfers: amazing vistas of assorted wildlife, far-flung boats and white beaches far below. The par-3 sixth, its concave clifftop green carved from the base of a massive dune, is equally dramatic. The layout then weaves through the dunes, returns to the cliffs at the dazzling par-3 13th hole, proceeds inland through the desert toward distant mountain peaks, and drops sharply from a set of elevated tees at numbers 16 and 17, a pair of thrilling par 4s. Quivira’s par-4 18th hole, stretching to 469 yards, is a classic links-style creation that plays to an infinity-edge green overlooking the sea. In the wind, Quivira could prove bedeviling, for as even Nicklaus admits, “I am eager to play it—on a nice calm day.” If the course proves too challenging, golfers can take solace in the other luxuries that abound at Quivira. Each of the two Pueblo Bonito Resorts & Spas offers lavish accommodations; luxury estates and residences dot this exclusive, 1,850-acre community. And the thatched-roof clubhouse, besides featuring fine dining, is the ideal place to conclude any golf adventure. It’s a welcome oasis, a place to bask in refreshments and to celebrate this Land’s End escape with three miles of pristine creamy beaches.

52


Apply today for Hamilton Jewelers

Preferred Cardholder Program ~ No annual fee ~ ~ 7MQTPIMRWXSVISVSRPMRIGVIHMXETTPMGEXMSRTVSGIWW~ ~ -RZMXEXMSRWXSSYVQSWXI\GPYWMZITVMZEXIVIGITXMSRWERHWTIGMEPIZIRXW~ ~ 7TIGMEPÁRERGMRKEZEMPEFPI~

-RUYMVIXSHE]ERHÁRHSYXLS[,EQMPXSR.I[IPIVWGERTVSZMHI]SY [MXLIRLERGIHTYVGLEWMRKTS[IVERHÂI\MFPIÁRERGISTXMSRW :MWMXER]PSGEXMSRSVSRPMRIEXhamiltonjewelers.comJSVERMRWXERXETTPMGEXMSR


interiors

Prominently displayed near a stairwell in Coin’s home is a sculpture by French artist Arman. “I had the precious chance to meet him and immediately loved his philosophy,” the designer explains.

B

BLANK CANVAS

orn in Venice, Roberto Coin began his career in the hotel industry and spent the early part of his adult life studying management in Switzerland. At the age of 32, Coin set out on a new path to become a jewelry designer and felt the change of career called for a change of scenery. “Vicenza became important when I joined the world of jewelry,” he explains. “I chose this city as it is and was a point of reference for gold manufacturing.” The 10,000-sq.-ft. home Coin eventually purchased in 2000 was originally built in 1960 and in need of some serious renovations. With help from Venetian architect Enrico Novello, Coin designed much of the space himself and now spends about six months of the year there with his wife, Pilar, and their youngest son, Kevin. The family spends the rest of the time traveling or at their other home in nearby Venice. Located in the hills just outside Vicenza city center, the neutral

Roberto Coin’s minimalist décor serves as a backdrop for creativity. JILLIAN LAROCHELLE 54


H A M I L T O N

J E W E L E R S

SERVICE AWARD PROGRAMS

SPORTS TOURNAMENTS AND GOLF TROPHIES

SALES AND ACHIEVEMENT AWARDS

MILESTONE AND PRESENTATION GIFTS

For assistance, please contact Donna Latham at 609.524.6497, or email dlatham@hamiltonjewelers.com


A custom picture window frames “a natural painting of Vicenza.”

structure is modern yet timeless, much like Coin’s extensive jewelry collection. The home’s minimalist décor is almost entirely devoid of color, serving as a blank backdrop for inspiring Coin’s creative visions. “I wanted to recreate a kind of luxury hotel lounge, full of light,” he reveals. “We managed to create a unique mix of different styles while keeping the atmosphere light and simple. For example, we mixed modern furniture with pieces from the 7th century and Art Deco style with creations from Pierre Fernandez Arman, known as ‘the violins sculptor.’” In the home’s sitting room, an expansive window hints at the gorgeous view beyond. “The house is full of important paintings and with that window I wanted to create a natural painting of Vicenza,” says Coin. “It is very relaxing watching outside

from that window… and you can also dream of being anywhere in the world. Moreover, from there I can see the opposite hill, where my son’s house is.” Despite the sitting room’s prime view, Coin reveals that his favorite room is in fact “my relax room; it is my own studio where I can smoke, read, watch TV and dream. My favorite item in the home is a special statue made by Wallace Chan, which he explained to me was the perfect statue representing my personality. It has many different heads and the biggest one is a child.” Like the hidden ruby inside each of his designs (meant to bring luck, health and happiness to the wearer), there is more to Roberto Coin—and his home— than first meets the eye.

More of Coin’s extensive art collection is on display in the formal dining room.

Roberto Coin’s 10,000-sq.-ft. home in Vicenza, Italy.

56


Introducing Deluxe Concierge Suites at Jupiter Medical Center.

Get Well and Pampered At The Same Time. It’s the perfect combination – Jupiter Medical Center’s world-class clinical care delivered with all the amenities of a fine hotel. Our Deluxe Suites are beautifully furnished and offer quality Concierge Services to enhance your hospital experience so you can focus solely on your recovery. Each newly renovated suite includes two rooms with overnight guest accommodations, well-appointed features, custom amenities, and a concierge service team member as a single point of contact. What a great way to get well – and pampered. To learn more call Mindy Levine, Manager, Concierge Services, at (561) 263-5742.

1210 South Old Dixie Highway, Jupiter, Florida 33458 (561) 263-5728 • jmcfoundation.org


photography

I REMEMBER WHEN ROCK WAS YOUNG... Inside the glitter with famed photographer Tom O’Neal. DAVID A. ROSE

I

COURTESY OF CASEY O’NEAL

f you remember when music was purchased at record stores, you’ll of course remember the striking album covers that housed those black vinyl discs. Responsible for much of that album art: photographer Tom O’Neal, best known today for his

Crosby, Stills, Nash & Young Deja Vu album cover, 1969

A young Tom O’Neal, 1972

Joni Mitchell Leaning, now part of the Smithsonian permanent collection, 1969

Jim Morrison rehearsing for Smothers Brothers Show in Los Angeles, 1968

58

work with Rolex, shooting photos for their motorsports and yachting competitions. Among the rock stars he photographed: Jimi Hendrix, The Mamas and The Papas, The Doors, Crosby, Stills, Nash & Young, Janis Joplin, The Rolling Stones and Joni Mitchell. “It was quite a while ago but I have pretty vivid memories of working with some of the most iconic rock stars at the beginning of their careers. Of all those I worked with, I’m most proud of the Crosby, Stills, Nash & Young Déjà Vu album cover. It took months, and if you ask them, they’ll say it’s also their favorite... “I did nine album covers for Steppenwolf; their leader John Kay still has my original images from the Born to Be Wild album. That song is said to be the very first heavy metal song, and the most commercially successful song in the history of rock and roll. “I once spent two days with The Doors while they were rehearsing: during breaks, Jim Morrison always sat by himself, reading or writing in this little 5”x7” black book. Mick Jagger was also different from his public persona: I once met him at his home in London to talk about an album cover and found him to be very professional, a proper English gentleman. Jim Croce was the most humble person I ever worked and Joni Mitchell the most fascinating: fragile but with immense power. (My portrait of her is now on permanent display at the Smithsonian National Portrait Gallery.) “Often when I’d meet with a band leader to talk about a cover, they’d be so stoned that you couldn’t understand a word they said. Or else they weren’t stoned, but you still couldn’t understand them...”


ABSOLUTE TOUGHNESS UNIVERSAL ACCURACY

GPS HYBRID WAVE CEPTOR

Carbon Fiber Insert Band

GRAVITYMASTER is equipped both to receive time-calibration signals by radio wave from any of the six transmission stations worldwide for use in precision time correction and to receive transmissions of position and time data from GPS satellites.

LED Light (Super Illuminator)

Fine Resin Frame Solar Powered


Eat Across America

James Beard-approved events and eateries are now more accessible than ever. SHIRA LEVINE

W

hen it comes to America’s pioneering chefs, most are familiar with Julia Child. Yet it was another great gastronome that first taught America how to cook on TV and penned cookbooks for aspiring foodies to obsess over. James Beard—the “Dean of American cookery” according to a 1954 New York Times piece—influenced the way Americans eat today, championing local markets and products long before it became de rigeur, opening a culinary school in his home, and nurturing many of our most well known chefs and cookbook authors. The James Beard Foundation is headquartered in the West Village home where he lived during the last 15 years of his life. But today Beard’s legacy has spread even further, with the foundation’s stamp of approval appearing on eateries and events all across the U.S. Successfully determining a city’s tastiest epicurean experience can be a tricky dish, especially for new visitors. But “you can’t go wrong with a meal from James Beard award winners and nominees,” promises Susan Ungaro, who has served as the foundation’s president since 2006. “These are the best-of-the-best. “We are the country’s best-kept secret, but we don’t want to be!” says Ungaro. “The James Beard Foundation Awards are the Oscars of the culinary world, but we’re open to the public! People don’t realize all of our events are accessible, and that they don’t only happen New York.” In fact, the 2015 James Beard Awards will be held in Chicago, America’s “Tastiest City” long celebrated for its contribution to molecular gastronomy. The move marks the first time in a 24-year run that the annual fete will leave the Big Apple. Ungaro’s goal is to bring as many James Beard events outside New York City as there are within it. These currently include nationwide Friends of Beard events, where chefs create something special on location at their Beard-approved restaurants, rather than making a pilgrimage to “perform”

at the flagship. There’s also Taste America, the annual celebrity chef tour that visits 10 cities over five weekends from September 12 to October 25. “We showcase the talent of one city with a guest chef from another city,” says Ungaro. “These pairings are one-of-a-kind events for diners who want to try something completely unique. The linked chefs have never cooked together before, so they get try something new too.” All this is not to detract from the delectable dining experiences dished out at the James Beard House, which essentially operates as a restaurant with different chefs and menus 200 days of the year. Enjoying a meal here is a full sensory experience that will make you feel like an utter insider. Guests get to walk through the bustling kitchen where “America’s first celebrity chef” once demonstrated how to roast chicken and hand-make pastas with Tom Brokaw and Bryant Gumbel on the Today Show. You can mill around the quaint backyard garden as you nosh on curious canapés, then head upstairs for the guest chef-of-the-night’s much-anticipated multi-course dining experience. Dinners often sell out and can be priced at up to $250 per person. But if you can’t make it in person, you’re in luck: “We just installed a Livestream kitchen camera so anyone can watch what the chefs are creating in the James Beard kitchen every night.” says Ungaro. “In fact, you can see more of the action than our seated guests!” (Chefs are graciously given the choice between a sound-on or sound-off camera, although so far only one chef has opted to mute.) Ungaro credits America’s passion for reality food TV (and good fundraising) with much of the success of the foundation’s programming. “We’ve raised awareness about the joy of cooking and the art of cooking.”

60

JULIA CHILD DESCRIBED COOKING IN THE JAMES BEARD KITCHEN AS “LIKE A SINGER BEING INVITED TO SING AT CARNEGIE HALL.”

IMAGES BY KEN GOODMAN

food


spirits

Rarities

ON DISPLAY

Bars serve up vintage whisky, rum, tequila and more. ROBERT HAYNES-PETERSON

Rarities, a new bar in the recently renovated New York Palace Hotel, specializes in vintage and hard-to-find spirits, wines and liqueurs. enthusiastic customer) and much more, all available to drink, at a price. “When I began collecting, it was incredibly inexpensive,” he says as he shows off pictures of an 1860 rye and a 1905 bottle of Bacardi rum. “Now a bottle I bought 15 years ago for $500 sells for $5,000.” Such is the appeal of fine and rare spirits today. At New York City’s Pouring Ribbons, hipsters order a 1951 green chartreuse liqueur ($110 per ounce), while stylish financial types and celebrities sip “Reserve” cocktails made with rare spirits at the recently expanded NoMad Hotel Bar. And San Francisco’s Hard Water has placed the emphasis on its American whiskey collection, including those classified as “Allocated and Out of Production,” all served by the ounce Seeking to replicate the vintage experience at home? Edgar Harden, of the Old Spirits Company in London, is an excellent source for a seemingly endless supply of spirits and liqueurs dating from the early 1900s through the 1970s. Or consider picking up an 1863 single-harvest tawny port from Taylor Fladgate. Repackaged in a handsome decanter and box, a limited number of bottles recently went on sale for about $4,000.

62

COURTESY OF THE NEW YORK PALACE HOTEL

I

t’s not so unusual to find a high-end bar or restaurant pouring a 50year-old Scotch whisky or cognac. But in the past few years, an increasing number of spots are collecting and offering pours of very old gins, bourbons, chartreuse and anything else that sat around unopened for decades, even centuries. “The concept is that we are very much focused on giving something unique to the Palace guest,” says Karim Lakhani of the new Rarities bar hidden inside the New York Palace Hotel. The space—once the Helmsley Palace and originally the Villard Mansion—is now home to an elegant Belle Epoque-influenced, 25-seat lounge specializing in the rare, unusual and very old. Though the menu varies, one recent standout was a Hannisville rye whiskey, distilled in 1912 and stashed in a huge demijohn bottle during Prohibition. Individual two-ounce pours of the earthy, lightly oxidized rye ran for $175. Other recent gems included a Taylor Fladgate Scion port from 1855 and a Frapin cognac dated 1888. The trend of specializing in vintage spirits beyond cognac may have originated with Salvatore “The Maestro” Calabrese, head bartender at the new Salvatore’s Bar in London. The collection he’s amassed is mind boggling: Orange Curacao from the 1860s, Fernet from the 1960s, a 1788 Clos de Griffier Vieux Cognac (accidentally shattered two years ago by an


OYSTER PERPETUAL GMT-MASTER II

rolex

oyster perpetual and gmt-master ii are trademarks.


© D.YURMAN 2014


HAMILTON JEWELERS ACCENT THE MAGAZINE OF LIFE’S CELEBRATIONS

FALL/WINTER 2014

Hamilton Jewelers  
Hamilton Jewelers