Page 1

VOLUME 1. 2014.


HAMILTON JEWELERS PRINCETON, NJ 609-771-6010 HAMILTONJEWELERS.COM CHAIRMAN MARTIN SIEGEL PRESIDENT HANK B. SIEGEL VICE PRESIDENT DONNA J. BOUCHARD VICE PRESIDENT DAVID S. KASTER GRAPHIC DESIGNER CHRISTOPHER D. NAVARRO

P U B L I S H E D B Y T H E B J I FA S H I O N G R O U P PUBLISHER STU NIFOUSSI

CONTENTS

EDITOR-IN-CHIEF KAREN ALBERG GROSSMAN CREATIVE DIRECTOR HANS GSCHLIESSER MANAGING EDITOR JILLIAN LAROCHELLE PROJECT MANAGER

FEATURES

LISA MONTEMORRA DESIGNERS

4 Welcome Letter

CYNTHIA LUCERO

6 Pantone Fashion Color Report

JEAN-NICOLE VENDITTI PRODUCTION MANAGER

WATCHES A C C E N T M A G A Z I N E S P E C I A L S E C T I O N S P R I N G / S U M M E R 2 01 4

12 Exhibits: Jewelry on Display 16 On the Hamilton Scene 20 Trends: Simply Modern

BRITTON JONES

MAC BRIGHTON

26 The Year in Review

30 From the Runways

PRESIDENT AND CEO

CHAIRMAN AND COO

24 Family Business of the Year Award

Prices are subject to change without notice and may vary depending on size, quality and availability. Copyright 2014.

GETTY 1 PASIEKA

28 Chatter: Ask the Designers

PEG EADIE

Accent® is published by Business Journals, Inc, P.O. Box 5550,

34 Some Like it Sculpted

WATCH SECTION

38 Red Carpet

48 Spotlight: Hot Watches

41 Happily Ever Afters

50 Watchmaking: Hooked on

Norwalk, CT 06856, 203-853-6015 • Fax: 203-852-8175; Advertising Office: 1384 Broadway, 11th Floor, NY, NY 10018, 212-686-4412 • Fax: 212-686-6821; All Rights Reserved. The

58 Perfect Gems

Classics

62 Fitness: Spin Cycle

54 Profile: Patek Philippe

64 Food: Brooklyn’s Fine Fare

56 Wheels: Need for Speed

publishers accept no responsibilities for advertisers’ claims, unsolicited manuscripts, transparencies or other materials. No part of this magazine may be reproduced without written permission of the publishers. Volume 12, Issue 1. Accent® is a trademark of Business Journals, Inc. registered in the U.S. Patent and Trademark office. Printed In The U.S.A.

2

ROBERTO COIN BANGLES FROM THE POIS MOI COLLECTION IN 18K ROSE, WHITE AND YELLOW GOLD

8 Collecting: Haute History


oys ter perpe tual e x plorer ii

rolex

oyster perpetual and explorer are trademarks.


Dear Friends,

The year was celebrated in earnest with a tremendous Watch Fair EXSYV4EPQ&IEGL+EVHIRWWXSVI[LIVI[ITVIWIRXIHSZIV stunning timepieces. New Jersey celebrated the holiday season with EQEKRMÁGIRXLSPMHE]TEVX]GSLSWXIHF]Town & Country Magazine. The year was one of great successes and many new wonderful client stories to be told. You’ll see inside this issue a feature on two Hamilton couples who began their married life (with our help) in 2013 – a celebration that is always such an honor for us to be a part of.

Just when we thought we couldn’t top the excitement surrounding the milestone of our company’s centennial in 2012, the year of 2013 proved to also be extraordinary. For the second consecutive year, we were particularly proud when [I[IVIRSXMÁIHXLEX[I[IVIÁREPMWXWJSVXLI2.*EQMP]&YWMRIWWSJ the Year Award. Managed by the Rothman Institute of Fairleigh (MGOMRWSR9RMZIVWMX]XLITVIWXMKMSYWE[EVHWIPIGXWXLIÁRIWXJEQMP] businesses in the state and recognizes them at an awards luncheon in October. The award acknowledges the importance of familyowned companies in our regions and in the economy at large, and was established to recognize multi-generational family businesses with practices and policies that result in a positive impact on business and the community. We were very honored to have been selected as the winning recipient company for 2013. Recognition such as this helps to reinforce our company’s commitment to carry forth my grandfather’s legacy and passion for exemplary client service and excellent value.

As always, we recognize that we could not have reached such milestones without the support of our valued clients… successive generations of brides, families and communities that have invited us to celebrate an important role in their cherished memories. We are pleased to present this issue of ACCENT Magazine, with XSTMGWXLEX[ILSTI]SY[MPPÁRH entertaining and relevant to you. In addition to the latest news and trend updates from the world of fashion, there are a wide variety of articles ranging from the arts and culture to travel. Please enjoy this issue of ACCENT with our compliments. We wish you and yours a wonderful spring and summer season and look forward to seeing you soon.

Hank B. Siegel, President

PRINCETON RED BANK PALM BEACH PALM BEACH GARDENS

92 Nassau Street, Princeton

SHOP ONLINE AT HAMILTONJEWELERS.COM

4


1954

60 YEARS OF CONTINUOUS INSPIRATION IN THE PURSUIT OF TECHNICAL PERFECTION

Heritage Black Bay is the direct descendant of Tudor’s technical success in Greenland on the wrists of Royal Navy sailors. 60 years later, the Black Bay is ready to stand as its own legend. TUDOR HERITAGE BLACK BAY® Self-winding mechanical movement, waterproof to 200 m, 41 mm steel case. Visit tudorwatch.com and explore more.

®


PL ACID B LU E C AY E N N E

VIOLET TULIP CELOSIA OR ANGE

H EM LOCK RADIANT ORCHID

PA LO M A DA Z ZLI N G B LU E

PURPLE HAZE

SAND COMFREY

FREESIA M A G E N TA P U R P L E

The Pantone Fashion Color Report is the foremost international authority on colors and trends for the upcoming fashion season. Created 50 years ago with the purpose of simplifying the decision-making and buying processes for fashion designers, industry leaders and enthusiasts, the report showcases the latest fashion trends and predictions—all in the name of style. As a new season of fashion made its debut during Fashion Week, so does a new palette of spring 2014 colors. With warmer days ahead, cooler colors prevail with tranquil Placid Blue and whimsical Violet Tulip, along with the much-loved neutral colors of Sand and Paloma. Take a cue from a beautiful spring sunset with colors like sultry Cayenne and tropical Celosia Orange. From light and airy green Hemlock to the combination of fuchsia and pink-toned Radiant Orchid, the possibilities are endless. From WIVMSYW JEWLMSRMWXEW XS XLSWI NYWX PSSOMRK XS YTHEXI XLIMV [EVHVSFIW NI[IPV] [MPP GSQTPIQIRX XLI XVIRH SJ VIJVIWLMRKP] VIÁRIH WX]PIW GSYTPIH [MXL XLI GPEWWMGW 8LIVI¸W E KIQWXSRI XS MRZMKSVEXI ER] SYXÁX ERH WIX XLI WXEKI JSV MRHMZMHYEP WX]PI ERH GLEVEGXIV

6


collecting

Haute HISTORY

Estate jewelry is a present that comes with a past. KARYN D. COLLINS

T

he term “estate jewelry” often conjures up visions of million-dollar baubles that once belonged to royalty, heiresses and Hollywood stars. But for many jewelers, a more typical estate jewelry story is like the one of a young woman who brought in her grandmother’s ring to Reis-Nichols Jewelers in Indianapolis. “The girl’s mother had put it in a drawer because she never wore it, and the girl brought it in to sell as scrap gold. Well, it was Bulgari—not an antique, but still a beautiful piece. So I made her an offer accordingly,” says Jon Bennett, Reis-Nichols’ lead estate buyer. Sounds like a nice surprise! In the fine jewelry industry, estate jewelry is

an umbrella term for any pre-owned jewelry from another era. The category includes antique jewelry, which by definition is nearly 100 years old or more. “I like to use the term ‘pre-loved’ when I describe estate jewelry,” says Holly A. Blenden, a gemologist with Hamilton Jewelers in New Jersey. “It doesn’t reflect any specific time period or even a special manufacturer. It doesn’t necessarily have to be from an actual estate sale or bequeathed in a will. It just means it’s a piece of jewelry that someone has loved.” How jewelers handle the estate segment of their business differs greatly from store to store. Some, for example, have a dedicated person or team that purchases items from

8


I like to use the term ‘pre-loved’ when I describe estate jewelry. It doesn’t necessarily have to be from an actual estate sale or left in a will. It just means it’s a piece of jewelry that someone has loved.” HOLLY A. BLENDEN GEMOLOGIST, HAMILTON JEWELERS

10

auctions, estate sales and antique jewelry dealers. Other stores feature, for the most part, items that customers have brought in for resale. How the items are featured and sold (including how large of a percentage estate jewelry accounts for in the overall product mix) also varies by store. The Diamond Cellar offers estate jewelry online as well as at one of its two Ohio stores, but the items at its Dublin location aren’t on display and are only brought out on request. Lux Bond & Green rotates its estate jewelry collection among its eight locations in Connecticut and Massachusetts. And at Lee Michaels Fine Jewelry, three of its six locations offer estate jewelry. The Baton Rouge, La. store actually has a separate room devoted entirely to estate and antique jewelry. “I think it gives the collection a certain sophistication. It’s a beautiful room,” says Katheryne C. Mauldin, manager of antique and estate jewelry. Tapper’s in Michigan has an especially unique policy: it will, as a matter of courtesy, accept any item brought in to them, reveals Leora Tapper, who handles estate jewelry purchasing for the retailer. “We’re proud to offer this service,” says Tapper. “We have a long history and have built a great [estate jewelry] business, so we won’t turn our customers away, no matter what the piece is.” y contrast, London Jewelers focuses exclusively on vintage Chanel jewelry that it purchases through a dealer. The inventory is spread among the company’s website and its five locations in the Hamptons and suburbs of New York City. Customers can order from London Jewelers’ website, or request that items be sent to a nearby store to be viewed in person. For stores that offer a mix of pieces purchased from dealers and brought in by customers, it can be tricky to find the right balance between what appeals to a jeweler’s eye and what will sell. “I look for jewelry that has a provenance and a story. My goal is to bring in pieces that I can potentially resell,” says Bennett at Reis-Nichols. “I also look for brand names with a heritage, since they give some value above and beyond the style of the item. “Customers often want jewelry that comes from a certain era: for some collectors it’s Art Deco, others the Edwardian period. And then you have people who just want to buy something unique, that’s of good value and maybe costs less than what they would pay for a brand-new version.” But sometimes a jeweler can only follow his instincts, taking a shot in the dark at what he thinks will appeal to customers. “I have a few pieces still in our case today and I can’t understand why they haven’t sold,” John Green of Lux Bond & Green confides. “One in particular we’ve had for seven years, but no one has bought it. I think it’s beautiful and I would probably buy it again,” he says. “Then there have been things I liked but didn’t think were as unique, and they were purchased right away. “What’s the saying? Beauty is in the eye of the beholder.” Perhaps that special treasure is waiting just for you.

B


A place you’ll always remember. A day you’ll never forget. Your happily-ever-after starts here… at our splendid Palm Beach paradise. With a stunning lakeside pavilion, inventive cuisine and unrivaled service, PGA National Resort & Spa is the premier destination for luxury weddings. Call 1.888.893.2182 today and begin planning your unforgettable celebration at PGA National Resort & Spa.

undeniably

HOT

unexpectedly

COOL

Personal Wedding Planner | Customized Menus | Bridal Packages at the Spa | Exclusive Wedding & Honeymoon Packages 1.888.893.2182 | 400 Ave of the Champions | Palm Beach Gardens, FL 33418 | pgaresort.com/wedding | Jewelry provided by Hamilton Jewelers


exhibits

Jewelry

ON DISPLAY

Many leading arts institutions now regularly highlight fine and contemporary jewelry from the 19th and 20th centuries—and visitors have taken note.

F

or the past three years, the Boston Museum of Fine Arts has served up Jewels, Gems, and Treasures: Ancient to Modern (through June 1), drawn from the museum’s over 20,000-piece collection of jewelry. “Not only is this exhibit bringing a lot of visitors to the museum, but there’s now more respect for jewelry in the art world. It’s no longer considered something just for women [to wear],” says Yvonne Markowitz, the Rita J. Kaplan and Susan B. Kaplan Curator of Jewelry at the MFA. While Markowitz’s next exhibition will focus on the museum’s collection of ancient Nubian jewelry, come September, more 20thcentury jewelry will be on display at the MFA as part of an upcoming exhibition devoted to Hollywood fashion and glamour. New York’s Metropolitan Museum of Art, which has long been known for showing modern jewels, recently put together Jewels by JAR, the first large-scale exhibition of the exquisite work of Paris-based jeweler Joel Rosenthal. “If you look at Joel’s work, it’s like sculpture, it’s three-dimensional,” says associate curator Jane Adlin. “There’s no difference between someone like Joel and

Frank Stella or Anthony Caro. It’s just that Joel is working in gemstones.” The Met will soon be showing another exhibit curated by Adlin, International Contemporary Jewelry from The Donna Schneier Collection, from May 13 through August 31. It will feature more than 100 pieces from the 1960s onward, designed by 88 different artists from 17 countries. Another museum at the forefront of bringing contemporary jewelry to the masses is New York’s Museum of Arts and Design, which will feature Multiple Exposures: Jewelry and Photography from June 24, 2014 through January 18, 2015. This ambitious exhibit focuses in part on how art jewelry and technology can collide. “Art jewelry is often idea-driven, so an exhibition can lend itself to a theme or aesthetic,” says Ursula Ilse-Neuman, the museum’s curator of Above: Armband (bazuband). Indian, late 17th–early 18th century. Gold, enamel and emeralds. Left: Heraldic Maltese Cross Brooch, 1964. Cabochon green onyx, circular-cut-diamond and sapphire center surrounded by coral arms with circular-cut diamonds and gold. By David Webb, courtesy of private collector.

12

TOP: PHOTOGRAPH © MUSEUM OF FINE ARTS, BOSTON. BOTTOM: COURTESY OF NORTON MUSEUM OF ART.

BRIAN SCOTT LIPTON


GARDENS 150 STORES. 25 YEARS. 1 GREAT EXPERIENCE. CHANEL GUCCI RALPH LAUREN SALVATORE FERRAGAMO TIFFANY & CO. LOUIS VUITTON BURBERRY HUGO BOSS JIMMY CHOO ROBERT GRAHAM HENRI BENDEL H&M KATE SPADE BROOKS BROTHERS A|X ARMANI EXCHANGE HAMILTON JEWELERS APPLE DAVID YURMAN TRUE RELIGION BRAND JEANS J. CREW LILLY PULITZER PANDORA MAYORS JEWELERS MICHAEL KORS WILLIAMS-SONOMA POTTERY BARN TOURNEAU THE ART OF SHAVING LULULEMON ATHLETICA ANTHROPOLOGIE SWAROVSKI MONTBLANC VINEYARD VINES TORY BURCH SAKS FIFTH AVENUE NORDSTROM BLOOMINGDALE’S MACY’S THEGARDENSMALL.COM


1.

3.

5.

4.

jewelry. “That’s what makes it intriguing to our visitors. This kind of jewelry is not just about decorating the body or finding the right accessory for your green dress.” In other cases, leading jewelry makers are arranging for their most beautiful wares to be shown in museums. Some glorious vintage Tiffany pieces are part of the Museum of the City of New York’s Gilded New York exhibit (through November 2014), which can be found in the new Tiffany and Co. Foundation Gallery; Cartier recently organized an exhibition of its finest works for the Grand Palais in Paris; Van Cleef & Arpels put together A Quest for Beauty, which closed in February at California’s Bowers Museum of Art; and the Norton Museum of Art in West Palm Beach, Florida recently

showcased David Webb: Society’s Jeweler, featuring over 80 examples of the master craftsman’s work from the 1960s and 1970s. Clockwise from top left: 1. Emerald and diamond shell brooch. Seashell, Cabochon emeralds, diamonds. David Webb, courtesy of Primavera Gallery. 2. Tiffany & Co., perfume bottle, ca. 1895. Gold, diamonds, rock crystal, quartz, enamel. Tiffany & Co. Archives, A1999.57. 3. Ceremonial elephant brooch, 1964. Mabé pearl, carved rubies, circular-cut diamonds, carved and circular-cut emeralds, off-white enamel, platinum and gold. David Webb, courtesy of Hollis Reh & Shariff. 4. Marcus & Co. necklace, 1900. Gold, natural pearls, demantoid garnet, enamel. Courtesy of Siegelson, New York. 5. Marjorie Merriweather Post brooch. Possibly by Oscar Heyman & Bros. (American, founded in 1912). For Marcus & Co. (American, 1892–1941). American, late 1920s. Platinum, diamond and emerald.

The Aurora Butterfly of Peace Perhaps the most unusual jewelry exhibition of the moment is The Aurora Butterfly of Peace currently on view through June 1 at the Natural History Museum of Los Angeles County. Artist Harry Rodman and curator Alan Bronstein spent 12 years assembling the 240-piece collection of natural colored fancy diamonds from around the globe, one stone at a time, and shaping them into a butterfly. “The Aurora Butterfly of Peace is both an exquisite artistic creation and a valuable scientific collection,” says Dr. Eloïse Gaillou, NHM’s associate curator of the museum’s Gems and Mineral Collection. “A diamond’s flaws and impurities offer clues into the geological conditions that have dubbed diamonds ‘messengers of the deep earth.’ ”

14

1. IMAGE BY ILAN RUBIN COURTESY OF NORTON MUSEUM OF ART. 2. IMAGE COURTESY OF MOCNY. 3. IMAGE COURTESY OF NORTON MUSEUM OF ART. 4. IMAGE COURTESY OF MOCNY. 5. PHOTOGRAPH © MUSEUM OF FINE ARTS, BOSTON. WILLIAM FRANCIS WARDEN FUND, MARSHALL H. GOULD FUND, FRANK B. BEMIS FUND, MARY S. AND EDWARD JACKSON HOLMES FUND, JOHN H. AND ERNESTINE A. PAYNE FUND, OTIS NORCROSS FUND, HELEN AND ALICE COLBURN FUND, WILLIAM E. NICKERSON FUND, ARTHUR TRACY CABOT FUND, EDWIN E. JACK FUND, FREDERICK BROWN FUND, ELIZABETH MARIE PARAMINO FUND IN MEMORY OF JOHN F. PARAMINO, BOSTON SCULPTOR, MORRIS AND LOUISE ROSENTHAL FUND, HARRIET OTIS CRUFT FUND, H.E. BOLLES FUND, SETH K. SWEETSER FUND, HELEN B. SWEENEY FUND, ERNEST KAHN FUND, ARTHUR MASON KNAPP FUND, JOHN WHEELOCK ELLIOT AND JOHN MORSE ELLIOT FUND, SUSAN CORNELIA WARREN FUND, MARY L. SMITH FUND, SAMUEL PUTNAM AVERY FUND, ALICE M. BARTLETT FUND, BENJAMIN PIERCE CHENEY DONATION, FRANK M. AND MARY T.B. FLETCHER LITTLE. BOTTOM LEFT: IMAGE COURTESY OF NATURAL HISTORY MUSEUM OF LA COUNTY.

2.


Our talented jewelry designers have applied their expertise to develop a repertoire of stunning jewelry essentials perfect for a fresh spring look and beyond.

ALLURE COLLECTION

Combining the brilliance of diamonds with the vivid hues of gemstones, this collection was inspired by the classic crossover look of stacked layers of rings. The design was then interpreted in dazzling matching earrings, all set in 18K white gold with prong-set gemstones and diamond clusters. The result is a high-fashion I\TVIWWMSR[MXLXMQIPIWWPMRIWERHEĂ‚EVISJGSRXVEWX Rings and earrings available in yellow sapphire, blue sapphire, tsavorite, pink sapphire and black diamond. shop the collection online at hamiltonjewelers.com

16


LOVE KNOT COLLECTION For hundreds of years, the love knot has symbolized the interlocking of two souls that intertwine and are devoted to each other. This new collection was designed and inspired by this love and trust, to be cherished for a lifetime. Bracelets and earrings crafted in 18K rose, white, or yellow gold with diamonds, featuring this enduring motif for a timeless style.

shop the collection online at hamiltonjewelers.com

17


Alice & Olivia • M Missoni • Red Valentino • Gianvito Rossi • Flavio Castellani • Adrienne nne Landau • La Marque Collection • Jovan • IRO

• Jimmy Choo • Christian Louboutin • Charlotte Olympia • Saint Laurent • Giuseppe Zanotti • N i c h o l a s K

CoCo Parì Often praised for its top-notch customer service, CoCo Pari offers a highly edited collection of designer clothing, shoes and handbags. Treat yourself to the ultimate shopping experience.

OPEN SUNDAYS 12 – 6PM! RED BANK

17 Broad Street • Red Bank, NJ • 732-212-8111 • www.cocopari.com Mon.-Thurs. 10am-9pm • Fri. & Sat. 10am-10pm • Sun. Noon-6pm

DEAL 270 Norwood Avenue (Route # 71) • Deal, NJ • 732-517-1227

ARE YOU A FAN?

• Haute Hippe • Torn by Ronny Kobo • A.L.C. • Autumn Cashmere • Diane Von Furstenberg • J Brand • Brian A


“My boyfriend and I were at Coco Pari recently and a salesgirl named Ali was so attentive and gracious, clearly loves what she does. Ali made us feel welcome and was very helpful, fun energetic, and did magnificent job in showing us all the fabulous inventory of clothes and shoes. Although I wasn’t able to make a purchase this time, as my finances are pretty tight, she made me feel very welcomed and comfortable. She was even kind enough to give me 2 Coco Pari t-shirts – I love them! As soon as my financial situation changes I will be celebrating my new fortune at Coco Pari. Thanks for everything, Ali. They were very smart to hire someone like you. I will be back for the irresistible Saint Laurent black sandals I tried on!!!” – Sabrina Osso, Moonachie, NJ

Pierre Balmain • Class Roberto Cavalli • Theyskens Theory • Catherine Malandrino • Equipment • David Lerner • Opening Ceremony •

k w o o d • Chloé • Feel The Piece • Valentino • Hervé Léger • Alexander McQueen • Jitrois • RVN •Wolford •

ood • Victoria Beckham • Alexis • Skaist Taylor • L'Agence • Veda • Mandalay • Rachel Zoe • Stella McCartney


trends

A

s the warm-weather seasons begin, jewelry and fashion have both entered into a nouveau modern era. In two words: sleek and uncomplicated. Still glamorous? Definitely—but more panache with purity, if you will. When models strutted down the spring/summer runways wearing peek-a-boo sheers and cut-out mesh (and even see-through skirts) they looked sensual, but seldom overly sexy. “In fashion, there’s a distinct modernization going on, as designers are beginning to rethink luxury,” explains David Wolfe, creative director of international fabric, color and style forecasting agency The Doneger Group in New York City. “It’s super-simplicity—kind of no-fashion fashion. Yet there’s a lot of cutting-edge creativity. For example, clean-cut sharp angles—what I’m calling geometrickery!” What does this mean in terms of jewelry accessorizing? “It’s the minimalist ’90s back in fashion. But not the stark minimal ’90s, when everything was spare—as in no accessories and no jewelry,” explains Vicente Agor, president of the Contemporary Jewelry Design Group. “This time around, sleek apparel is the backdrop for jewelry. That’s key to what makes it now—completely 2014,” he says. “The clean lines of the clothes actually let the jewelry stand out. If you wear something exactly as it was styled in its original decade, then it’s a costume! So it’s very important to pair the new austere-shaded, streamlined clothes with jewelry. Otherwise, you’ll look out-of-date—very yesterday.”

“and jewelry looks very fresh when it’s large in scale.” Nonetheless, says Wolfe, “Because there are many important silhouettes going on simultaneously this season, sometimes dramatic designs are needed while, at other times, what you wear may call for smaller, slimmer items of jewelry worn together for an overall uber effect.”

FASHION’S METALLICS, JEWELRY’S METALS Still, whether the jewels you wear this spring and summer are singularly super-sized or merely appear large when layered, the precious metal itself is a key consideration. To some degree, all the high-gloss futuristic fabrics are a factor. “We’re currently experiencing a fascination with unnatural-looking textiles. Metallic is being worn year-round, not just during the holiday period,” Wolfe says. “All shades of metallic—blue, pink, green—a rich rainbow. But my favorites are the darker muted gold metallics; I call them golden glamour. They’re very complementary to the new jewelry we’re seeing in yellow, rose and darkened rhodium-plated gold, and these mix fabulously with white gold and sterling silver that’s oxidized to look gray or black.”

SIMPLY MODERN

COLORS . . . AND NON-COLORS

Speaking of black, like last year, it’s the non-color that’s still going strong. LIVING LARGE “Lots of sparkling white, too,” The first thing to remember when Wolfe reminds us. “Remember, wearing the season’s refined, white is now worn year-round. I unfussy clothes is to think big: especially like all the black-andLORRAINE DEPASQUE jewelry with impact is a megawhite clothes because it’s a color trend. And you can do that either combo that gives you a lot of by wearing large statement freedom with jewelry and other pieces or by layering several for a accessories. Beyond black and strong jewelry look. With luxury brands, top-trending categories include white, color runs the gamut, from bold and bright to darks to mellow yellow, knuckle rings and cocktail rings, power pendants and lengthy necklaces, neutral, and nude. And I love that very sophisticated combination of navy long dangle earrings—especially triple-stone drops—and slim bracelets and black, which many major fashion houses have given us. Although this worn in multiples—three minimum, but mostly five—stacked up the arm. Ivanka Trump Metropolis collection layering necklace in 18K yellow gold with diamonds “Geometric and sculptural pieces are very important now,” notes Agor,

Jewelry’s new sophisticated simplicity.

20


T H E O R I G I N ATO R O F C U LT U R E D P E A R L S . S I N C E 1 8 9 3 .


year, you’ll see all shades of blue—light, medium, and dark navy—straight into fall and through the winter. And more monochromatic schemes of mid-tone blues, too.”

F

ine jewelry has, in fact, led the way when it comes to blues, says lapidary artist and veteran gem dealer Bill Gangi, who sells high-quality colored stones to many leading names in luxury artisanal jewelry. “It’s the number-one gem color every year,” he says. But in the 2014 Spectrum Awards (the annual premier competition for colored gemstone jewelry design sponsored by the American Gem Trade Association), there were notably more indigo, azure and cobalt-colored jewelry entries than in the 2013 contest. Tanzanite, blue sapphire, lapis-lazuli and aquamarine were hard-to-miss standouts—way more popular than in the previous year. You definitely want your jeweler to show you some new designs that highlight any (or all!) of those blue beauties. Other in-vogue blues are iolite, black opal, blue moonstone, labradorite, turquoise, blue chalcedony, blue topaz and blue zircon. “A great color combination is blue with purple,” Wolfe recommends. “In fashion, purple’s been hot for the past four seasons.” Given that the Pantone Color Institute named Radiant Orchid as its 2014 Color of the Year, you can bet that purple passion will continue to heat up throughout the year. “It’s a modern and surprisingly versatile shade,” says Pantone’s executive DAVID WOLFE director, Leatrice Eiseman. (Take note: There’s that word THE DONEGER GROUP modern again!) Eiseman adds that Radiant Orchid is “a captivating, magical, enigmatic purple, inspiring confidence and emanating great joy, love and health. And it encourages expanded creativity and originality.” Looking at the breadth of imaginative new collections from goldsmiths inspired by a spectrum of violet, lavender and eggplant shaded stones—amethyst, alexandrite, sugilite, purple sapphire, kunzite, tourmaline, agate, quartz and lavender spinel—we can’t help but agree! On a final note, it’s hardly coincidental that the Pantone Color of the Year is named after a beautiful, delicate flower. Remember, we’re enjoying an uncluttered, easy-to understand style era right now, one that’s often characterized by natural influences as well as geometrics. Think about it: Both nature and geometry are minimalist at their core. Going forward, well beyond 2014, forecasters are predicting that organic-themed collections will continue to grow, as women (like us!) are captivated by the perfection of the imperfection of asymmetric gemstones. Raw diamonds, baroque pearls, sliced precious and semiprecious color. . . each gem is one-of-a-kind from nature—and completely sophisticated in its simplicity!

This year, you’ll see all shades of blue—light, medium and dark navy—straight into fall and through the winter.’’

From top: Ivanka Trump Patras collection blue sapphire ring in 18K white gold with white diamond surround Roberto Coin trio of single-row bracelets from the Poi Moi collection, in highpolished 18K rose, white and yellow gold Roberto Coin Haute Couture collection cluster ring in 18K white gold with iolite, blue sapphire and white diamonds Hamilton Jewelers Artisan collection rings, aqua chalcedony in sterling silver with yellow gold overlay, and blue chalcedony in sterling silver with white gold overlay

22


hermès. time reinvented.

arceau petite lune la montre hermès flies you to the moon by displaying its phases on your wrist. first or last quarter, new or full moon: governed by the regular tempo of a mechanical movement, your watch shows you the position of the earth’s satellite in relation to the sun. bathed in the soft glow of moonlight, hermès tells the tale of time.


HAMILTON JEWELERS WINS THE PRESTIGIOUS

FAMILY BUSINESS OF THE YEAR AWARD

P

art of the Silberman College of Business of Fairleigh Dickinson University since 1989, the mission of the Rothman -RWXMXYXIMWXSXIEGLERHWYTTSVXIRXVITVIRIYVWLMTERHMRRSZEXMSRMRXLIEGEHIQMGFYWMRIWWERHRSRTVSÁXGSQQYRMXMIW An outstanding entrepreneurship curriculum taught by an excellent faculty has helped put the academic program EQSRKXLIXSTMRXLIREXMSR-REHHMXMSRXLISVKERM^EXMSR¸WSYXVIEGLTVSKVEQWLIPTTISTPIWYGGIIHMRXLIMVRI[SV KVS[MRKZIRXYVIWEW[IPPEWMRXLIMVGSVTSVEXMSRWSVSVKERM^EXMSRW

)EGL]IEVXLI6SXLQER-RWXMXYXIGSSVHMREXIW[MXLSXLIVGSVTSVEXIWTSRWSVWJSVERERRYEPIZIRX[LMGLWIPIGXWXLIÁRIWXJEQMP] FYWMRIWWIWMRXLIWXEXIERHVIGSKRM^IWXLIQEXERE[EVHWPYRGLISR*MREPMWXWERH[MRRIVW[IVILSRSVIHEXXLIWXE[EVHW 'IVIQSR]SR3GXSFIVEXXLI'V]WXEP4PE^EMR0MZMRKWXSR2.

Above: Members from the Hamilton Jewelers team join the Siegel family at the award ceremony luncheon in October 2013.

24


H

amilton had the privilege to once again attend XLI 2I[ .IVWI] *EQily Business of the Year %[EVHW PYRGLISR XLMW ]IEVEGGSQTERMIHF]E[SRHIVJYPKVSYT representing members of the Hamilton 2.XIEQ;I[IVILSRSVIHXSLEZIFIIR ÁREPMWXWMREW[IPP2S[MRMXWWX ]IEVXLI*&3=E[EVHWEVIGSRHYGXIHMR GSRNYRGXMSR[MXLXLI6SXLQER-RWXMXYXI of Entrepreneurship at Farleigh Dickinson University, emceed by one of the ERGLSVWJSV2.2I[WERHZSXIHSRF]E team of distinguished panelists in the marketing, communications, business, IHYGEXMSRERHTYFPMWLMRKÁIPHW

Once again, Hamilton made it to the ÁREP VSYRH SJ NYHKMRK [LMGL XEOIW into account community commitment, longevity, excellence in marketing and branding, industry leadership, and bestSJFVIIH FYWMRIWW TVEGXMGIW ;I [IVI MRXIVZMI[IH F] WIZIVEP SJ XLI TERIPMWXW ERH WYFQMXXIH SYV µFMS¶ [MXL HIXEMPIH MRJSVQEXMSR EFSYX SYV GSQTER]¸W SZIVEPPGSVTSVEXIEGYQIRERHGSRHYGX

%X XLI PYRGLISR [I [IVI LSRSVIH XS FIREQIHXLI[MRRIVXLMW]IEVERHVIceived a beautiful crystal plaque and proclamation from Governor Christie GSRKVEXYPEXMRK YW SR SYV EGLMIZIQIRX We are proud of this prestigious honor XLEX VITVIWIRXW XLI LEVH [SVO SJ SYV XIEQ [LS IQFVEGIW SYV QMWWMSR ERH GSVIZEPYIWSREHEMP]FEWMW

8LIIZIRXMWEREWWIQFP]SJ2I[.IVWI]¸W ÁRIWXJEQMP]FYWMRIWWIWERHMXMWEP[E]W inspiring to learn about the many excellent closely held businesses in the state, ranging from specialty metal extruders

XLI GSQTER] XLEX TVSHYGIH XLI ÁVWX aluminum tennis racquets) to innovative retailers and service providers (a luxury TIX GEVI WTE [MXL LIEXIH TSSP I\IVGMWI pavilion, executive chef), to those doing GYXXMRKIHKIVIWIEVGLMRFMSXIGLRSPSK] -REPPXLIVI[IVISZIVRSQMRIIWXLMW ]IEVJSVXLIE[EVHW

Top right: Left to right: Lisette, Martin, Denise and Hank Siegel. Left middle: Hank Siegel. Bottom right: The Hamilton team.

25


2013

The Year in Review e concluded 2013 with some noteworthy events to showcase the latest and greatest MRÁRINI[IPV]ERHXMQITMIGIWXSSYVGPMIRXW ;I[IVITVSYHXSLSWXE1IIXXLI4VIWMHIRX IZIRX[MXL&VIMXPMRK¸W8LMIVV]4VMWWIVXMRSYV 4EPQ&IEGL+EVHIRWPSGEXMSR

JVSQXLI[SVPH¸WÁRIWXPY\YV]FVERHWMRGPYHMRK&VIMXPMRK'EVXMIV 'LERIP,IVQrW-;'4ERIVEMERHQSVI 8LIIZIRXEPWSQEVOIHXLIMRXVSHYGXMSRSJ8YHSV[EXGLIWXSXLI ,EQMPXSRJEQMP]7IZIVEPLYRHVIHKYIWXWIRNS]IHXLMWSRIHE] STTSVXYRMX]XSZMI[[EXGLQEOMRKEXMXWÁRIWX

8S[IPGSQIXLILSPMHE]WIEWSRMRXVYILMKLJEWLMSRERHWX]PISYV 4VMRGIXSRPSGEXMSRTEVXRIVIH[MXLRSRISXLIVXLERXLIJEFYPSYW QIHME MGSR Town & Country 8LI QEKE^MRI¸W JEWLMSR EYXLSVMX] WX]PIHMVIGXSV7XIPPIRI:SPERHIWEXXIRHIHXLIIZIRXXSKVIIX,EQMPXSR¸W KYIWXWERHTVIZMI[WSQISJXLIWIEWSR¸WMQTSVXERXRI[ÁRINI[IPV] TMIGIW +YIWXW [IVI XVIEXIH XS ER I\XVEZEKERX QIRY SJ KSYVQIX 8LI RI\X HE] WE[ XLI I\GMXIQIRX SJ SYV ERRYEP;EXGL *EMV EPWS JEVIJVSQ6EX¸W6IWXEYVERXMRGPYHMRKEVE[FEV[MXLS]WXIVWWYWLM MR 4EPQ &IEGL +EVHIRW 3ZIV  XMQITMIGIW [IVI WLS[GEWIH GEZMEVERHWTIGMEPX]GSGOXEMPW 8LI TVMZEXI GSGOXEMP VIGITXMSR [EW E KVIEX GLERGI JSV KYIWXW XS QIIXERHKVIIX1V4VMWWIVX[LS[EWXLIVIXSHMWGYWW&VIMXPMRK¸W XVIQIRHSYW[EXGLQEOMRKPIKEG]ERHTVSHYGXSJJIVMRKW8LI,SRHE 'PEWWMG XIEQ [EW EPWS VIGSKRM^IH JSV XLIMV [SVO XS WYTTSVX GLMPHVIR¸WLIEPXLGSRGIVRW

Above: As we always say, “start them young”. Mr. Prissert shows a young guest the joys of owning a Breitling timepiece. Opposite page: 1. Hank Siegel, guests and Mr. Prissert. 2. Guests enjoying the evening viewing the Breitling collection. 3. Hamilton’s Palm Beach Gardens storefront on Watch Fair event day. 4. Left to right: Hank Siegel, Martin Siegel and Ken Kennerly from Honda Classic. 5. From left to right: Matthew Talomie, Town & Country associate publisher, Stellene Volandes, Town & Country style director, Nessi Erkmenoglu, Town & Country executive jewelry & watch director, Hank and Lisette Siegel.

26


2

3

1

2

4

5

27

2


chatter

Ask the

DESIGNERS We asked some of our favorite designers: what’s next on your bucket list? Listen in and get to know the artists behind your most-loved jewelry.

IVANKA TRUMP

going to debut an exclusive limited-edition collection inspired by the horse. To me, the horse symbolizes par excellence of freedom and elegance. Actually, this is related with my second wish, to keep surprising myself and my collectors by keeping them young and glamorous.”

IPPOLITA

My next destination is Luang Prabang in Laos, one of the most mystical, magical and inspiring old villages in Asia. It will be the inspiration for my next collection.” GUY BEDARIDA OF JOHN HARDY

ROBERTO COIN

I have been compiling pieces of my writing, photographs and experiences for some time now. 2014 is the year it’s all going to come together inside one cover. I have a publisher so the rest is down to me. If anyone who knows me can remember anything that involves me between 1989 and 2000, please send in your stories. No junk mail or time wasters please.” STEPHEN WEBSTER

28

STEPHEN WEBSTER IMAGE COURTESY OF RANKIN. GUY BEDARIDA IMAGE COURTESY OF JOHN HARDY.

I love to travel, and one of my all-time favorite trips is to Chile. I’ve been several times, but next time I go I want to try glacier skiing in Portillo.”

Read Tolstoy in Russian and Proust in French. Roll around in caviar with Javier Bardem. Make my own scented candle with Cire Trudon. Walk the Great For sure on my bucket list Wall of China. Travel there is the bright future for my brand. I am a creator around the world with and a dreamer, and I wish my future grandchildren. to always keep being able to Learn to paint from foresee my clientele’s taste and mood. This year we are Eric Fischl.”


P OIS MOI COLLECTION


LOVELYLADY

2 1

4 1. 2. 3. 4. 5.

5

Mikimoto special-edition 18K white gold 18-inch necklace and matching 8mm stud earrings. Hamilton’s Classics Collection 18K yellow gold diamond hoop earrings. Hamilton’s Destiny Collection lattice design diamond tennis bracelet in platinum. Hamilton’s Select Collection diamond pendant and stud earrings set in 18K white gold. Hermès 18K rose gold watch with diamond bezel on chocolate strap.

30

RUNWAY IMAGES COURTESY OF ACCESSORIESDIRECTIONS.COM

3


NEARLYNUDE

1

2 3

4 5 RUNWAY IMAGES COURTESY OF ACCESSORIESDIRECTIONS.COM

6 1. 2. 3. 4. 5. 6.

31

Hamilton’s Trellis Collection 14K rose gold ring with diamonds. Hamilton’s Heritage Collection 18K rose gold earrings with diamonds. Hamilton’s Love Knot Collection 18K rose gold bangle with diamonds. Hamilton’s Lisette Collection 18K white gold earrings with morganite, white sapphires, and diamonds. Hamilton’s Classics Collection 18K rose gold diamond hoop earrings. Chantecler 18K pink gold ring with pink coral and pavé diamonds.


EVENTFULEVENING

2 1 3

5 1. 2. 3. 4. 5. 6.

6

Chantecler 18K white gold necklace with black onyx and diamonds. Hamilton’s Private Reserve Collection Asscher-cut diamond earrings in platinum. Hamilton’s Rare Gemstone Collection rare rubellite ring with diamonds set in 18K white gold. Hamilton’s Centennial Collection Deco-style diamond bracelet handcrafted in platinum. Hamilton’s Diamond Classics Collection 18K white gold teardrop diamond earrings. Hamilton’s Gemstone Collection 18K white gold and black rhodium earrings with blue agate, white sapphire and tanzanite with diamonds.

32

RUNWAY IMAGES COURTESY OF ACCESSORIESDIRECTIONS.COM

4


MASSAPPEAL

1

2

3

RUNWAY IMAGES COURTESY OF IMAGE.NET AND MERCEDES-BENZ FASHION WEEK

4

1. 2. 3. 4.

33

Tudor Heritage Chrono Blue steel case with blue, orange and gray fabric strap. Patek Philippe Calatrava 18K rose gold with brown alligator strap. MT-G, Metal Twisted G-Shock stainless steel analog watch. Panerai Radiomir polished steel case with black alligator strap.


MASSAPPEAL

1

2

3

RUNWAY IMAGES COURTESY OF IMAGE.NET AND MERCEDES-BENZ FASHION WEEK

4

Internationally renowned sculptor Seward Johnson honored with a retrospective exhibition at Grounds For Sculpture on view May 4, 2014 through September 21, 2014. Forever Marilyn at 25 feet in height, a monumental scale sculpture by Seward Johnson, will be a key attraction at the artist’s lifetime retrospective exhibition opening May 4 at Grounds For Sculpture in Hamilton, NJ. Forever Marilyn by Seward Johnson, ©1996, 2011 The Sculpture Foundation, Inc. Photo by Carl Deal III.

34 33

1. 2. 3. 4.

Tudor Heritage Chrono Blue steel case with blue, orange and gray fabric strap. Patek Philippe Calatrava 18K rose gold with brown alligator strap. MT-G, Metal Twisted G-Shock stainless steel analog watch. Panerai Radiomir polished steel case with black alligator strap.


3R1E]+VSYRHW*SV7GYPTXYVI[MPPSTIRXLIPEVKIWXERHQSWXWMKRMÁGERXI\LMFMXMSRMRMXWLMWXSV] a presentation of work by its founder, Seward Johnson. The exhibit will feature more than 150 sculptures, including his much-acclaimed *SVIZIV1EVMP]R8LI%[EOIRMRK and 9RGSRHMXMSREP7YVVIRHIV Works will be sited in three indoor galleries as well as across the 42-acre park campus. Johnson, age 83, is an American sculptor and philanthropist who has dedicated his career to public art. His life-like bronze and QSRYQIRXEP ÁKYVIW EVI JEQMPMEV WMKLXW XLVSYKLSYX XLI 9RMXIH States, Europe and Asia. He is also the founder of the not-forTVSÁX+VSYRHW*SV7GYPTXYVI[LMGLSTIRIHMXWHSSVWXSXLITYFPMG in 1992 and includes works from such notable artists as Clement 1IEHQSVI%RXLSR]'EVS&IZIVP]4ITTIV+ISVKI7IKEPERH-WEEG Witkin. The park, located in Hamilton Township, New Jersey, welcomes nearly 160,000 visitors annually. Seward Johnson: The Retrospective [MPP WTER ÁZI HIGEHIW SJ Johnson’s exploration into what he refers to as “The Visceral Moment.” He describes this as the pivotal moment when viewers engage with a piece of artwork and transcend their own place in space and time to experience a heightened connection to their common humanity. Johnson’s best-known works are the lifelike sculptures from his Celebrating the Familiar series. These pieces draw attention to the smallest details of ordinary life: a nap on a park bench, a trip to the grocery store, the pleasure a child takes in an ice cream cone. 8LI]LEZIFIIRWLS[RMRXIVREXMSREPP]JVSQ-WXERFYPXS6SQIEW [IPPEWEGVSWWXLI9RMXIH7XEXIWµ-[ERXQ][SVOXSHMWETTIEVMRXS the landscape and then take a viewer by surprise,” Johnson said in a 2002 interview with The New York Times. “After he gets over the shock of being fooled, it becomes an emotional discovery. Then he owns the sculpture. People often revisit their favorites. They become like friends.” Also on view during Seward Johnson: The Retrospective are works from his Beyond the FrameWIVMIW%RLSQEKIXSXLI-QTVIWWMSRMWX painters, Beyond the Frame works transform well-known paintings such as Claude Monet’s Garden at Sainte-Addresse and Edouard Manet’s Le Dejeuner sur l’herbe into life-sized three-dimensional tableaux. These works, says Johnson, “allow an intimacy with the paintings that the paintings don’t allow themselves.” A third series, Icons Revisited, includes works inspired by familiar and time-tested images. His Unconditional Surrender captures the famous Times Square V-Day moment when a sailor kissed a nurse. This iconic sculpture, enlarged to 25 feet, has been invited XS8MQIW7UYEVI7ER(MIKS7EVEWSXEERH6SQI-XEP].SLRWSR¸W Forever Marilyn, a 26-foot-tall, stainless steel and aluminum Marilyn Monroe complete with white billowing skirt, has captured the attention of the The Wall Street Journal, The New York Times, Time Magazine, The Daily Show with Jon Stewart, The Today Show, Good Morning America, and others. Throughout the duration of Seward Johnson: The Retrospective, +VSYRHW*SV7GYPTXYVI[MPPSJJIVLERHWSREVXQEOMRK[SVOWLSTW MRWTMVIHF]XLILYQSVERHLYQERMWXMGMRWMKLXSJXLMWTVSPMÁGEVXMWX tours of the park and artwork, screenings of archival footage, an exclusive behind-the-scenes tour with Johnson himself, and more.

35

About Grounds For Sculpture +VSYRHW *SV 7GYPTXYVI +*7  PSGEXIH MR ,EQMPXSR 2I[ .IVWI]

QMH[E] FIX[IIR 4LMPEHIPTLME ERH 2I[ =SVO  MW E EGVI WGYPTXYVITEVOERHEVFSVIXYQJSYRHIHF]7I[EVH.SLRWSR-XW collection features more than 270 contemporary sculptures by renowned and emerging artists. Exhibitions change seasonally MRÁZIMRHSSVKEPPIVMIW;MXLVMGLIHYGEXMSREPSJJIVMRKWEVSFYWX schedule of performing arts, and fun family events, the park is open year-round. For more information, please visit groundsforsculpture.org


TO A LONG, HEALTHY AND PROSPEROUS LIFE IN JUPITER. ESPECIALLY THE HEALTHY PART.

1210 South Old Dixie Highway, Jupiter, Florida 33458


SAMIRA WILEY at Mercedes-Benz New York Fashion Week

MIKE COPOLA/GETTY IMAGES FOR MERCEDES-BENZ

CARLA GUGINO at the 65th Annual Primetime Emmy Awards

COURTESY OF NORMAN SILVERMAN

red carpet

REGINA HALL at the Hollywood premiere of The Best Man Holiday 38

COURTESY OF SAZINGG AND KUUMBA

JULIETTE BINOCHE at the Cartier: Le Style et l’Histoire exhibition in Paris

RINDOFF PETROFF-CASTEL

RED HOT!


BEN PRUCHNIE FOR PARAMOUNT PICTURES INTL

KATE WINSLET at the BFI London Film Festival Labor Day screening

COURTESY OF CHIMENTO

EMMA ROBERTS at the 2014 Vanity Fair Oscar Party

In this bold hue, there’s no chance of blending in.

EMMY ROSSUM at the BTJA 3rd Annual Critics’ Choice Awards 39

COURTESY OF NORMAN SILVERMAN

KELLY OSBOURNE at the 65th Annual Primetime Emmy Awards

COURTESY OF AMRAPALI

JILLIAN LAROCHELLE


Hamilton clients & their happily ever afters.

41


Julia & Greg

42

Photos by Todd Laffler; lafflerphotography.com


It’s your typical love story, really. Boy meets girl. Girl crushes boy in every workout they participate in as members of the same CrossFit gym. Boy falls head-over-heels for girl and after numerous failed attempts, his persistence pays off and LIMWÁREPP]EFPIXSGSRZMRGILIVXSKMZILMQEGLERGI8LEXGLERGI led to a walk in the park on a beautiful sunny afternoon, which was followed up with dinner and drinks later that week, and eventually GSRGPYHIH[MXLXLIMVÁVWXOMWW8SXLIMVHIPMKLXXLEXOMWW[EWSRI of many more to come. Knowing almost immediately that Julia was the woman he wanted to spend the rest of his life with, Gregory wasted very little time heading to Hamilton Jewelers to seek assistance in designing an engagement ring which, as he saw it, needed to be as perfect for Julia as she was for him. Not only was that goal met, but Hamilton Jewelers stepped up and actually played an integral role in the proposal itself! As guests of the Hamilton Jewelers’ Centennial Holiday Party MR (IGIQFIV SJ  NYWX E JI[ WLSVX QSRXLW EJXIV XLEX ZIV] ÁVWX FYXXIVÂMIWMRWXSQEGLMRHYGMRK[EPOMRXLITEVO[MXL.YPME+VIKSV]¸W plan to pop the question sprung into action. Shortly after the party began, they embarked on a romantic horse-drawn carriage ride in the crisp winter air beneath a blanket of stars. As the ride came to an end and Gregory took Julia’s hand to help her down from the carriage, he looked into her eyes and expressed, as best he could, how much he loved her. So, he asked... and she said “Yes!” Surrounded by friends and family, their wedding in Philadelphia the following fall was everything they hoped it would be and more. Love, laughter and ice cream... it was perfect! Darting across the Atlantic, they traveled to Spain for their honeymoon and had what can only be described as the trip of a lifetime. Eating more incredible food than they thought was humanly possible and driving Vespas along the GSEWX HIWTMXI FIMRK YREFPI XS VIEH ER] SJ XLIVSEH[E] XVEJÁG WMKRW  they left with countless cherished memories, two very full stomachs, and a bond that was strengthened with every new adventure they IQFEVOIHSR8LI]IZIRJSYRHE'VSWW*MXXLIVIXSZMWMXSRIQSVRMRK Needless to say, Julia once again crushed Gregory in the workout. Even halfway around the world, apparently some things never change.

43


Lindsey & Alex

44


A college friendship that evolved into a lifetime love… That’s the beginning of Alex and Lindsey. Having met while attending Babson College, located in Wellesley, Massachusetts, the pair began their journey in 2005. The couple were good friends and remained close for several years. Their romance started with a date in the spring of 2008, and the rest is a classic love story. Upon Lindsey’s graduation with a master’s degree from Suffolk University in Boston, Alex gifted her a weekend trip to New York City to see a Broadway show… something she had always dreamed of doing. The couple went to New York City, and enjoyed a beautiful dinner and show. When they returned to their hotel, Lindsey was shocked to see red rose petals on the bed, with Champagne, two glasses and a card. Alex got down on one knee and proposed. Lindsey had no inkling of Alex’s plans, but she said “Yes!” immediately.

Alex had been saying that he wanted a gold watch with a brown leather band for about a year, so Lindsey started to do some research, thinking that it would be a great wedding gift to her groom. During a trip to Palm Beach, she visited Hamilton and found the perfect Breguet watch for Alex. Shopping with her mom, Lindsey had no idea that her mother was busy doing her own reconnaissance work for Alex. She took photos of a stunning diamond necklace and sent them to Alex to suggest a wedding gift for Lindsey. He presented the beautiful gift to her for their wedding.

In 2008, while all of this was happening, Lindsey’s beloved grandmother passed away. She was a dear part of Lindsey’s life, and together with her two older sisters, Diane and Tanya, they HIGMHIH XS ÁRH E WTIGMEP TMIGI SJ NI[IPV] [MXL E FIUYIWX XLEX their grandmother had given to them. The ladies wanted a very meaningful piece so that they would always have the memory of their grandmother with them, and in turn, someday pass it down to their own children. They found a bracelet from Hamilton’s Heritage collection and it was everything they were looking for. With a vintage look and design, they all felt that its beauty and elegance was a perfect representation of their grandmother, and they purchased three of the bracelets.

The girls all wore the very special bracelets on Lindsey and Alex’s wedding day, as a way to commemorate their grandmother and celebrate her spirit. Lindsey hadn’t known the name of the collection that the bracelets were from, but after realizing that MX[EWXLI,IVMXEKIHIWMKRMXWIIQIHIZIRQSVIÁXXMRKXSTEWW along a legacy to their family by that name… and a beautiful family tradition was born.

45


Photo credits: David Steele and Marie Labbancz.

THE PATIO IS NOW OPEN...

YOUR OASIS AWAITS With stunning views, extraordinary country French cuisine and hand-crafted cocktails, Rat’s Restaurant at Grounds For Sculpture is the areas premiere dining destination. Join us for lunch, dinner, Sunday brunch and happy hour. Reservations recommended.

Located in the heart of central New Jersey, Rat’s Restaurant is open year round, Tues - Sat: 11:30am - 9pm, Sun 11am - 5:30pm and is closed Mondays. For directions and info, visit ratsrestaurant.com or call 609.584.7800.

Rat’s Restaurant is located at the spectacular Grounds For Sculpture (609) 584-7800 | 16 Fairgounds Road, Hamilton, NJ | www.ratsrestaurant.com


WATCHES GETTY 1 PASIEKA

A C C E NT M A G A Z I N E S P E C I A L S E C T I O N S P R I N G / S U M M E R 2 014


SPOTLIGHT by Roberta Naas

HOT WATCHES Today’s finest watchmakers are pulling out all the stops when it comes to timepiece design. Key men’s looks for the season include stealth black chronographs to time his workouts.

DAVID YURMAN Classic GMT World Time Iconic American designer David Yurman continues to create top-of-the-line Swiss-made watches. Among his more coveted pieces is the very functional yet refined Classic GMT World Time watch. Created in a 43.5 mm stainless steel case with integrated signature cable design, the watch houses a topquality Swiss automatic ETA Movement with 42 hours of power reserve. It offers hour, minute and seconds timing, as well as a dual time-zone function. The sapphire crystal and caseback both feature two-sided anti-reflective coating for easy readability, and to allow for viewing of the movement. An inner rotating bezel on the watch indicates top world cities, and there is a printed 24-hour GMT track for use in finding time in different zones. The watch is water resistant to 100 feet.

PANERAI PAM515 Radiomir 1940 3 Days Oro Rosso Those who love the iconic brand will be thrilled with the Officine Panerai PAM515 Radiomir 1940 3 Days Oro Rosso. The bold 47 mm, 18-karat rose gold case houses the 162-part hand-wound mechanical Panerai P. 3000 caliber—created entirely in house by Panerai. The 21-jeweled movement features an Incabloc anti-shock device for all your rugged sports, and offers three days of power reserve via two barrels. The Radiomir 1940 3 Days Oro Rosso recalls the brand’s rich history with the navy, and its brown dial and luminous numerals and markers are vintage inspired. The sapphire crystal is extra thick and features an anti-reflective coating. The caseback is a sapphire crystal as well, for viewing the superb movement. While classically alluring, the elegant watch is also water resistant to 50 meters.

48


REINVENT YOURSELF RENDEZ-VOUS NIGHT & DAY Discover the Jaeger-LeCoultre jewellery watch line at ladies.jaeger-lecoultre.com


WATCHMAKING by Jack Forster

HOOKED ON CLASSICS

Heritage-themed watchmaking in the 21st century.

I

n 1969, the first quartz watch (the Seiko Astron, which cost as much as a car at the time) was introduced, and by the mid-1970s mechanical watches seemed to be on their way out. But today they’re back in a big way, and some of the most popular styles recall the most classic designs from the past. Watchmaking has been around for nearly 500 years, and for the last century, wristwatches have dominated personal timekeeping. But they didn’t really take off until after the first World War, when their widespread use by officers as a more practical alternative to the pocket watch made them respectable for men to wear. (Before then, they were called “wristlet” watches and were worn almost exclusively by women.) A fine mechanical wristwatch—a tiny, high-precision machine—was considered a masterpiece of miniaturization, and as the wristwatch evolved

technically, especially during the 1950s and ’60s, certain classic forms evolved too. One of the most important was the extra-thin dress watch. Extra-thin watches couldn’t be made by just anybody; they required high precision and care to assemble thanks to the unforgiving tolerances, so a thin, gold dress watch was considered a de rigeur accessory. The development of better waterproofing techniques led to the evolution of sports watches that could be worn by divers, and specialist watches (particularly chronographs), which combined the functions of a watch and stopwatch, began to be made for pilots, motorsports enthusiasts, and were even worn into space by both American and Soviet astronauts. Extra-thin watches seemed a dying breed, even during the renaissance of mechanical watchmaking. As recently as 10 years ago, men’s taste ran strongly

50

IMAGE COURTESY OF JAEGER-LECOULTRE

Jaeger-LeCoultre master engraver Dominique Vuez


Mediterranean Sea. “Gamma� men in training. The diver emerging from the water is wearing a Panerai compass on his wrist.

history a n d heroes. luminor marina 8 days (ref. 510) available in steel and red gold


WATCHMAKING in favor of large, aggressively styled watches, but in the last five years watch lovers have rediscovered the pleasures of the classic dress watch. The evolution of thin watches goes back a long way, to the 18th century, when some of the first thin pocket watches were made by Pierre de Beaumarchais (who also wrote the Figaro plays, one of which was turned into the opera The Barber of Seville, by Rossini). Making a true extra-thin watch that still keeps time well is a huge challenge. Everything from the mainspring to the case itself has to be built differently, in order to maintain the ability to keep precise time in a space that may be half the thickness, or less, of an ordinary dress watch. For this reason, true extra-thin watches tend to be made by companies that have been in the business for a while—long enough to build up the necessary expertise. For real connoisseurs, they’re desirable not just for the technical skill it takes to make them, or their incredible elegance (they’re still the only really correct watch for formal events, James Bond’s Rolex-with-tux notwithstanding), but also for the heritage of the companies that make them.

One of the least-known but most interesting pieces of pilot’s watch history is from an even more unlikely source: Cartier. Cartier’s most famous watch is, of course, the Tank (first sold in 1918 and in production ever since, speaking of classic dress watches), but it’s not often realized that the Santos was originally designed as a pilot’s watch, for the great aviation pioneer Alberto SantosDumont. Santos-Dumont, one of the first to successfully build and fly a heavierthan-air craft, was a friend to Louis Cartier. When he complained that a pocket watch wasn’t exactly practical for flying, Louis Cartier made a wristwatch for him, which Santos-Dumont wore while flying as early Panerai Radiomir as 1906. Though the watch has been made in a huge Composite Black Seal 3 Days Automatic variety of styles, the basic design’s still the same. It’s fascinating to note that in addition to being one of the Cartier Santos, original and current most successful watch models of all time, the Santos was also the first pilot’s watch. Omega Speedmaster Moonwatch Professional Diver’s watches are loved and worn by many who

What’s old is new again. Classic watch styles endure the test of time. Think Vacheron Constantin, Jaeger-LeCoultre, Breguet, Piaget, and of course, Patek Philippe. intage-style chronographs are, for many, a reminder of some of the most important events in motorsports, with names like Daytona and Carrera representing both iconic competitions and the watches favored by drivers and enthusiasts. Although vintage-style dress chronographs are popular, the lion’s share of attention these days goes to sports chronographs, including models by companies like Rolex, Tudor and TAG Heuer which either revive favorite designs from the past, or which have actually never gone out of production (the Rolex Daytona is a case in point). For their part, pilot’s watches have remained one of the most enduringly appealing of all watch types. In the explosion of interest in civil aviation postWWII, some of today’s most memorable designs were first created, including Breitling’s Navitimer and the Rolex GMT Master (first made for Pan Am aircrews). Ironically, one of the most popular aviator’s watches of all time—the Omega Speedmaster Professional—was first designed for motorsports enthusiasts (its tachymetric bezel is designed to calculate average speed over a measured mile). But it became immortalized in watchmaking history as the timepiece worn by all Apollo crews, and it’s still flight-qualified by NASA today.

V

never dive, though plenty of amateur and professional divers still use them, as a back-up to modern wrist-worn dive computers. They’re popular for both their rugged good looks and inherent durability. Not just any watch can be called a “diver’s watch”; there is actually an international standard which specifies, among other things, a 200-meter minimum water-resistance, shock resistance, and anti-magnetic resistance, as well as a certain minimum visibility in the dark, and a mandatory rotating timing bezel. Thanks to the rich history of the development of undersea exploration—and undersea warfare—in the 20th century, there are a wealth of choices, including the Rolex Submariner (in production continuously since it was introduced in 1954, and one of the most enduring designs of all time). As with the Santos, some of the earliest diver’s watches may be a surprise. Those who don’t know Panerai might dismiss their Radiomir and Luminor designs as mere exercises in style, but in fact they’re designs that originated in the 1950s (Luminor) and the 1930s (Radiomir), representing some of the first true diver’s watches ever made. Whether you’re looking for a watch that’s rich in history, or just a greatlooking timepiece that recalls the post-World War II Golden Age of mechanical watchmaking, there’s never been a better time to be a watch lover.

52


METAL TWISTED G-SHOCK

MTGS1000BD-1A Stainless Steel

TRIPLE G RESIST VIBRATION RESISTANCE SHOCK RESISTANCE CENTRIFUGAL FORCE RESISTANCE metal twisted g-shock A fusion of resin and metal encompassed in a case that has our trademark shock resistance with extraordinary elegance results in the perfect combination of our technologies and impeccable craftsmanship.

Š2014 CASIO AMERICA, INC.


PROFILE by Adam Gebhardt

GENEVA’S CROWN JEWEL To acquire a Patek Philippe is to become the custodian of an artistic and scientific tradition.

P

atek Philippe is Geneva’s oldest independent family-owned watch manufacturer, founded in 1839. Faithful to the most noble artisanal techniques, its watchmakers and craftsmen perpetuate the timehonored traditions that distinguish the fine art of watchmaking. The company’s independence from corporate ownership enables the brand to go its own way and control its own destiny while pursuing a longterm vision. It also benefits from total creative freedom, developing and manufacturing its movements in house according to its own quality criteria, and producing only watches that reflect its quest for the exceptional. The timepieces outlive passing fashions without ever losing their appeal or relevance. Patek Philippe has established its own understated, timeless style: a harmonious combination of personality and discretion, elegance and an aristocratic touch. The style has inspired models with simple, strong, refined lines. Now, as always, subtle modifications enable the watches to

evolve while retaining all their characteristic charm. Representing tradition at its most dynamic, Patek Philippe constantly pushes the boundaries of watchmaking through its innovations. It has confirmed its pioneering role in the industry by filing more than 80 patents, including 20 of major importance to the history of horology. Patek Philippe has always conceived its watches as exclusive creations. More than 200 models are in regular production, each in small series of between 10 and several hundred, and fitted with a vast array of in-house movements. From design to mechanism, they earn their special place in the hearts of enthusiasts the world over. The rigorous standards applied to every step of the development process and in the long months of crafting and finishing make each Patek Philippe a precious, unique creation coveted by the connoisseur. A Patek Philippe commands a high price and will fully retain or even increase in value. Many of the models achieve cult status and regularly fetch Patek Philippe Twenty-4 record-setting sums at auction. Their stainless steel ladies watch with solid reputation amongst collectors— 36 diamonds, blue sunburst and the great sentimental value that a dial and diamond hour markers Patek Philippe usually acquires in the eyes of its owner—make each one a treasured asset. To acquire a Patek Philippe is to become the custodian of an artistic and scientific tradition that has been handed down with care and will continue to inspire remarkable creations. It is your entry into the world where each generation is dedicated to perpetuating a unique heritage. To acquire a Patek Philippe is also to welcome into your own family a possession designed to last for successive generations, signifying the start of your own tradition.

Patek Philippe

Patek Philippe Annual Calendar Annual Calendar watch featuring watch featuring date, day and date, day and month,month, moonmoon phase and phase and power reserve power reserve indicator, indicator $44,400

T IVO _.indd P0 44

54


SEREIN 16 DIAMOND SEREIN 16 DIAMOND TWO-TONE


WHEELS by David A. Rose

Taking a cue from its parent company, Tudor enters the world of motor sports sponsorship.

NEED FOR SPEED

Tudor Grantour Chrono Fly-Back

56

RACING IMAGE BY STEPHAN COOPER

A

nyone who knows anything about motor sports will know and Grand-Am Rolex Sports Car Series and the American Le Mans Series. The appreciate the contribution Rolex has made over the years. Rolex is two had been competing for fans, sponsors, teams and drivers since 1999, but the official timepiece at the Sebring International Raceway and the as a single series they have now created one of the most exciting sports car Mobil 1 Twelve Hours of Sebring, official timepiece at The 24 Hours of Le races in the world. Mans, and title sponsor of the annual Rolex 24 at Daytona. And in 2013, the “For years Tudor has been inspired by motor sports,” says brand brand made history when it became the global partner and official timepiece manager Russell Kelly. “This new partnership allows us to elevate our of Formula 1, the pinnacle of motor sports. commitment to sports car racing. This is the perfect alignment between Rolex also made headlines last year for another reason: the partners dedicated to performance and precision.” announcement that it would re-launch its storied Tudor brand in the U.S., International sports car racing brings together some of the most and promote it as the title partner for the new Tudor United SportsCar sophisticated machinery in existence with the best drivers in the world. Championship. Hans Wilsdorf, Rolex’s founder, Unlike other motor sports races, which run for a registered the name “The Tudor” in 1926 to honor specific number of miles or laps, sports car series are 2014 TUDOR the Tudor period in England. He established run for three, six, 12 and 24 hours. Each car must UNITED SPORTSCAR Montres Tudor SA in 1946 with the idea of offering utilize a minimum of two drivers for the shorter CHAMPIONSHIP the quality of Rolex timepieces at a lower price. races, and can use up to five drivers per car for 24UPCOMING RACE SCHEDULE Today, though Tudor is part of the Rolex Group, it is hour events. They race in all weather conditions and May 4 Mazda Raceway Laguna Seca operated separately and continues to uphold its the pace remains intense throughout the entire May 31 Detroit Belle Isle philosophy of affordable luxury. To celebrate its event. With the merger of the two series for 2014, June 7 Kansas Speedway colorful history, Tudor has introduced the Heritage there is no doubt that the Tudor United SportsCar June 29 Watkins Glen International Collection, featuring updated versions of iconic Championship will present race fans in North July 13 Canadian Tire Motorsports Park pieces like the Tudor Heritage Chrono and the America with the most exciting racing they’ve ever July 25 Indianapolis Motor Speedway Tudor Heritage Advisor. seen, while allowing watch lovers to become August 10 Road America The Tudor United SportsCar Championship was reacquainted with the luxury, quality and August 24 Virginia International Raceway formed by the merging of two rival U.S. events: the sophistication of the Tudor brand.


PATRAS

COLLECTION 18K Yellow Gold ‡ African Ruby ‡ Diamonds


PERFECTGEMS

EXPLORE THE LITTLE LUXURIES THE WORLD HAS TO OFFER. DONALD CHARLES RICHARDSON

LÉGENDAIRE NICE

From its venerable position on the Promenade des Anglais, the very grand Hotel Negresco in Nice, France has epitomized Côte d’Azur style for over 100 years. Collected behind the lofty facade is 400 years of French culture and art including works from the reign of Louis XIII and avantgarde sculptures (Picasso and Dali often stayed here). After viewing the hotel’s treasures, guests can watch the chic passing Riviera scene while sipping rosé in the outdoor lounge. The sommelier will take interested oenophiles off to one of the nearby vineyards for a tour and tastings. And dinner at Le Chantecler, the two Michelin-starred restaurant with a wine cellar containing 15,000 bottles, is a full evening’s experience. Of course, for those who come to Nice for the sea, the hotel has its own private beach.

MICHAEL RUDDIN

DISCOVERING NEW WINES FOR SUMMER

When dining at Vetro Restaurant & Lounge in Howard Beach, New York, guests can enter through the front door or dock their yachts at the marina. The menu includes classic Italian food and over 400 wines. According to Vetro’s sommelier, PJ Connolly, “Summer wines should be refreshing and you need to find a crisp, clean acidity.” The 2012 DAOU Vineyards Grenache Blanc Paso Robles from California is a grenache blanc with citrus and melon aromas and bright acidity. Nice for a barbeque. The 2012 Tenuta Guado al Tasso “Scalabrone” Rosato di Bolgheri, an Italian rosé, is blended from cabernet sauvignon, merlot and syrah. Fresh with a crisp finish, serve with fruit and light salads. The 2010 Pago De Los Capellanes Crianza, Ribera del Duero from Spain is 100 percent tempranillo and goes well with grilled meats and salsa verde. And from France comes the 2010 Domaine Faiveley Mercurey 1er Cru “Clos Des Myglands.” This pinot noir from the Côte Chalonnaise in Burgundy is a versatile wine: excellent with game meats or cheese, or by itself on a warm sunny day.

58


A HORSE OF COURSE

Just 40 miles from Washington D.C. in Middleburg, Va., the Salamander Resort & Spa is set on 340 acres in the foothills of the Blue Ridge Mountains. It features luxurious suites, spa, cooking studio and wine bar, but it’s the great outdoors that beckons most visitors. In the Culinary Garden the chef teaches secrets of organic farming, and guests can pick herbs and produce for a cooking class or dine under the garden trellis. There are hiking and biking paths, tennis courts and croquet. Naturally, since the resort is surrounded by Virginia’s famed riding country, horses are a mane attraction (the resort has nine horses and two ponies, or you can bring your own). The Equestrian Program at Salamander includes a practice ring, instructional classes, and riding trails through woods and fields.

WRAPPING UP THE SEASON

ROBERT GODWIN

Before beginning her career as a couturiere, Jackie Rogers was a model for Coco Chanel and learned much of her craft, style and technique from the legendary designer. She’s created clothes for some of the most famous women in the world, including Julianne Moore, Condaleeza Rice, Roberta Flack, Nicole Kidman, Gwyneth Paltrow, Salma Hayek and Courtney Love. For this spring and summer Rogers suggests a wrap-tie blouse, which she makes to order in 100 different colors (she particularly likes it in shocking pink). “A tie blouse can go over anything and make everything look new and fresh again,” she explains. (And think of the jewelry options!)

STRAVINSKY IN SANTA FE

Every summer The Santa Fe Opera in New Mexico presents repertory and contemporary performances on a high mesa overlooking two mountain ranges, a setting unmatched anywhere in the world. This summer, the program includes Carmen, Fidelio, the American premiere of Dr. Sun Yat-Sen, and a special salute to one of the early supporters of this unique company. In 1957 Igor Stravinsky was invited for the first season. Intrigued by the innovative organization, the celebrated composer returned several times to direct and conduct his own operas. In 2014, Santa Fe pays tribute to Stravinsky with a performance of Le Rossignol, marking the 100th anniversary of the opera’s premiere in Paris. The nightingale doesn’t only sing in Berkeley Square.

60


Hamilton Jewelers Business Gifts Division offers a full range of products to help companies and organizations commemorate important moments. In a competitive business environment, we understand the importance of communicating the right message to clients, employees, peers and communities. Hamilton is here to assist.

FOR ASSISTANCE, PLEASE CONTACT DONNA LATHAM AT 609.524.6497, OR EMAIL DLATHAM@HAMILTONJEWELERS.COM


fitness

SpinCYCLE

Indoor cycling has become the latest craze. ELISE DIAMANTINI Soul Cycle Locations: 25 with 15 openings planned this year, including its first international location At Soul Cycle riders can expect a “cardio dance party.” As instructor Marvin Foster explains, “Soul Cycle is a full-body workout that requires core strength, rhythm and coordination of the upper and lower body. Each class consists of interval jumps out of the saddle, quick-fire sprints, massive hills, upper body push-ups in and out of the saddle, and a

GETTY 1 / ISAAC KOVAL

five- to 10-minute weights section while cycling. At

S

ay goodbye to those tired spinning classes from the ’90s. Indoor cycling has gotten a major makeover, and new methods that incorporate strength training with spin are popping up all over the U.S. Most rides are 45 to 60 minutes long: total body workouts that leave riders dripping with sweat. In a typical class, you can burn anywhere from 500 to 1,000 calories (depending on variables like body type, how hard you push yourself, etc.). And you know it’s a good workout when celebrities like Kelly Ripa, Lady Gaga and Jake Gyllenhaal are all spinning to stay in shape. Another reason people love indoor cycling is the mind/body connection many studios offer. Classes are led by high-energy instructors who inspire and motivate riders to push their limits. At Soul Cycle, phrases like Aspire to Inspire, Change Your Body, and Take Your Journey are printed in big, bold letters on studio walls to motivate students during their rides. Instructors draw parallels between struggling in the class and the life struggles we all face, giving people the inspiration and strength to tackle anything that comes their way—on and off the bike. Instructor Marvin Foster explains that Soul Cycle offers more than just a workout. “Every class begins with a spiritual journey, eventually

building into a full-blown cardio dance party. At Soul Cycle, it’s about support, community and strength. I like to think of teaching as an exchange. We are both in the room, on our bikes, and we exchange the experience back and forth.” Flywheel’s Jaimie Bailey says of her teaching method: “Most of the things I say while coaching riders through a long sprint or heavy climb are things that have gotten me through thick situations. There is nothing better than having one of my riders share a Flywheel success story with me. Each class is not only challenging and fun, but inspiring. Flywheel loyalists come back for more not only because they love it, but because it works.” Music plays an important role in classes too. Riders are often encouraged to pedal to the beat, so speed can change dramatically based on a song’s tempo. Cyc touts a “unique playlist that includes unreleased songs and remixes,” while Soul Cycle hosts special themed rides, like a class that only plays Beyoncé or one that features songs from the TV show Glee. Whatever philosophy you follow, indoor cycling is a low-impact, high intensity cardio workout that helps you burn calories, build muscle, clear your mind and have fun!

62

Soul Cycle we work hard and party hard on the bike.”

Cyc Locations: Madison, Wis.; Austin, Texas; New York, N.Y. Cyc activates the whole body the whole time, with moves inspired by more than 20 sports such as boxing, volleyball and swimming. Cyc Social, a proprietary social platform, allows riders to see where people within their network are sitting so they can book a bike nearby, and receive notifications when friends register for classes. Ride for Change is a part of Cyc’s tracking technology loaded onto every bike, and proceeds are donated to one of Cyc’s charity partners for every mile achieved.

Flywheel

Locations: Atlanta, Charlotte, Chicago, Dallas, LA, Miami, NYC, Philadelphia, Dubai Flywheel incorporates the TorqBoard, a proprietary technology which instructor Jaimie Bailey explains as a way to “digitally display and monitor every rider’s real-time performance data. Additionally, after class each rider can view their personal performance data (total power, miles, calories burned, etc.) on our Performance Page, enabling individual goal setting and performance tracking.”


L IVE L IFE B EAUTIFULLY


BRENT HERRIG

Saul Bolton's Atlantic Black Bass with Braised Fennel, Sweet Pea Puree and Saffron Chamomile Sauce

BRENT HERRIG

food

CHEF SAUL BOLTON Saul, The Vanderbilt, Red Gravy Saul just reopened in a very exciting new location: the architecturally majestic Brooklyn Museum. How did the site change come about? It was serendipitous. After 14 years at our Smith Street place and wanting to redo and rehab Saul, we saw this as a great opportunity to be part of an iconic institution. We were able to keep everybody from the old Saul and just continue on in the new location—in a bigger space. To have that kind of continuity in your kitchen and in the front of the house is a gift. Manhattan’s Union Square Greenmarket is a destination for chefs as well as residents and tourists. Which markets in Brooklyn should people check out? We go to Grand Army Plaza on Saturdays. It’s a badass farmer’s market. Cadman Plaza in Downtown Brooklyn is Tuesdays, Thursdays, Fridays and Saturdays. The Brooklyn Heights farmer’s market takes

FINE FARE

Discover a few Brooklyn chefs crafting delectable dishes in the borough no longer considered off-thebeaten-path. SHIRA LEVINE

care of the more specialty, esoteric stuff, like fresh lima beans and shishito peppers. The best fish purveyor in New York is also in Brooklyn. And we have great cheese purveyors here, like Saxelby in Red Hook. My favorite is Stinky in Cobble Hill. What do you make of all the attention Brooklyn has been getting? I’m really proud of where I live and I love to share it. I can cook foie gras in Brooklyn just as well as I can anywhere in Manhattan, and now people realize it. You’re the man behind Brooklyn Bangers, which has become quite a successful enterprise.

T

hose who plan their travels around the gastronomic demands of the stomach (or rather, the palate) should point their appetites toward the newly haute Brooklyn food scene. No longer the borough where your grandfather played stickball, post-industrial Brooklyn is ripe with multi-million dollar urban mansion conversions and shiny glass skyscrapers. Even the most exclusive Manhattanites now salivate at the locally sourced, sustainably farmed charm of the varied dining options. People from Sweden to Singapore are dropping the phrase très Brooklyn when describing things ultra cool, and they’re chomping at the bit to feast on Brooklyn’s fare. While the borough has long had its culinary attractions—The River Café, Peter Luger’s, Junior’s— a new wave of chefs has recently arrived to elevate the epicurean landscape. Like the influx of locals trading in Manhattan zip codes for new Brooklyn digs, chefs are seeking more space, cheaper rent, and a less frenetic lifestyle that allows them to tinker with recipes and cultivate their own culinary visions. From back-to-basics dishes at cozy-chic restaurants, to Michelin-starred, fancy fine dining rivaling the best in the world, Brooklyn’s nouveau cuisine is giving Gotham’s more than 10,000 restaurants a run for their money. The small-village vibe of neighborhoods like Park Slope, Boerum Hill and Carroll Gardens provides a welcoming atmosphere that’s utterly un-Manhattan, yet just across the river.

64

We wanted to do an American gastropub where we were making awesome sausages and charcuterie. It morphed into sausage-making equipment in the basement of The Vanderbilt. We started to sell them at the Brooklyn Flea, where some people wanted to buy them wholesale to serve at beer gardens and specialty stores. The Barclays Center approached us and we were like, “What the hell? Why not sell them at a basketball arena?” Next year we’ll be in Citi Field, MetLife Stadium and the Prudential Center, and we’ll be carried by [grocery delivery service] Fresh Direct. What are your favorite restaurants in Brooklyn? I love the tripe tacos at Tacos Matamoros in Sunset Park. I eat often at Al di La: great Italian in Park Slope. I also love Tanoreen’s Lebanese food in Bay Ridge.


The Precious Pastel Collection Rare, exceptional and captivating Featuring white, yellow and pink diamonds in extraordinary designs.


CHEF PAUL LIEBRANDT The Elm at King & Grove Hotel Williamsburg and be a part of the changes here. It’s certainly an area everyone is flocking to, so it’s exciting to be a part of that momentum. This isn’t the Williamsburg of a decade ago. But traditionally you haven’t followed trends. I’m not a trendy person. I always have my own voice. I was in kitchens since I was 15 and that’s how I was trained. You have to be true to yourself. I came here for the project, not to be a pioneer or whatever. That isn’t me. I want to reach

EVAN SUNG

the clientele I would have never reached with Corton. The Elm is sophisticated casual. It has elements of fine dining, but I don’t say it’s fine dining. This is in Williamsburg, but this project is not about being on trend.

CHEF ZAHRA TONGORRA Brucie

It was a big deal coming here from Manhattan. Your

Will you work with The Elm to bring another Michelin star

success there and your culinary background in London and

to Brooklyn?

Paris make you a bit different than other chefs that have

I’m not thinking about Michelin stars. I’m focused on giving

crossed the East River.

customers a different view of what I’ve been doing and

What does it mean to be a chef in

I think it was a natural progression. To be part of an

what they’ve already been getting in Brooklyn.

Brooklyn?

exciting, youthful and creative area is a risk, but it is one

Since you’re still exploring, what is your favorite place to

It is profoundly exciting. Being a chef and

that makes sense. For me, this is a nice project that is

eat in Brooklyn so far?

also the sole owner, your emotions span

approachable and fun. It’s exciting to be here in

I love Roberta’s in Bushwick.

the spectrum from exhaustion to elation, heart warmth to heartbreak. Now more than ever there is a lot of pressure to be

Lisa Giffen's Duck Breast with Chanterelles, Beets and Cherries

innovative and relevant amongst such amazing talent throughout the borough. Some days it feels surreal that anyone knows my name or eats at my restaurant, and other days I feel really on top of my game and like I really belong where I am. The word “trendy” is often used when describing Brooklyn cuisine. How do you feel about that? Honestly, I love seeing trends, but Brooklyn as a place to eat is not a trend. It’s awesome when a chef starts using an

CHEF LISA GIFFEN Maison Premiere

ingredient heavily and then it becomes a thing. I love seeing how it then spreads from hood to hood, and how they each

Tell us how your family heritage has

worked for mostly French chefs or chefs

blasted for not being a certain way.

influenced you as a chef.

who learned from French chefs, and

Could Brooklyn ultimately steal

make that “fad” ingredient their own by

I was born in Korea, but I was adopted

I love the discipline and dedication it

Manhattan’s culinary thunder?

using it differently. There’s a friendly

and grew up in Germany. My culinary

takes to learn this cuisine. Many of the

Manhattan will never fail to be what it

competitive spirit here in Brooklyn, and

heritage comes from my parents. My

techniques have been used for hundreds

is, this great Mecca of food, culture,

that’s what has driven the greatness of

dad is from the Midwest, and my mom

of years, which I find pretty amazing;

luxury and innovation. Brooklyn,

the Brooklyn food scene today.

is from northern California. They come

they withstand the test of time.

however, is the place to be all of that,

There is an obsession right now with

from agriculture backgrounds, so a

How would you describe Brooklyn’s

but on your own terms.

food scene to those who haven’t

What is one of your favorite Brooklyn

Brooklyn-born gourmet food items.

kitchen rich with vegetables and meats are part of my heritage. My

experienced it?

restaurants?

family loves food.

Brooklyn is like Manhattan’s rebellious

I enjoy St. Anselm in Williamsburg.

Maison Premiere is distinctly French,

sibling: raised the same, but doing it

They have such great affordable meats

and your past work under famed

their own way. Most of the chefs who

and some wonderful seasonal sides.

chefs like Alain Ducasse, Dan Barber

have settled into Brooklyn worked in

Why do you think there are so few

we are awfully lucky to have access to

and Ed Brown was also French

Manhattan for many years, so we all

notable women chefs?

natural foods and exciting foods on the

influenced. What is it about French

have a sense of what the highest

It’s not necessarily that there are

regular. Brooklyn is a community that

cuisine that inspires you?

standard is. In Brooklyn you retain

so few women chefs. It’s more, “Why

supports the ritual of food. I love moving

I’ve been classically French trained, so

those standards, but you can put your

are women chefs so unrecognized?”

back to the very basic idea of eating as

it’s something I know well. I have

own spin on it. In Brooklyn you aren’t

It’s 2014!

we were always intended to.

66

It’s very cool when you can sustain doing these specialty things. I like when people do one thing really well. I hear people saying how ridiculous kale is, but


PEACE OF MIND STARTS WITH PROOF OF QUALITY. Weight Carat 1.53

ColorE Grade Grade Clarity VS1

Grade CutExcellent

Laser Inscription Registry Number GIA 16354621 Natural Diamond Not Synthetic

For over 80 years, GIA has brought clarity and global standards to gem evaluation. A GIA report means expert, independent verification from the creator of the 4Cs and the world’s most widely recognized gem authority.

Look for GIA-graded diamonds and jewelers who offer them.

CARLSBAD ANTWERP BANGKOK DUBAI GABORONE HONG KONG JOHANNESBURG LONDON MOSCOW MUMBAI NEW YORK OSAKA RAMAT GAN SEOUL TAIPEI TOKYO


”WELCOME TO OUR WORLD”

Thom Richard is one of the few pilots in the world to possess the talent, experience and courage required to compete in the final of the famous Reno Air Races – the world’s fastest motorsport. Less than ten champions are capable of vying with each other at speeds of almost 500 mph, flying wing to wing at the risk of their lives, just a few feet off the ground. It is for these elite aviators that Breitling develops its chronographs: sturdy, functional and ultra high-performance instruments all equipped with movements chronometer-certified by the COSC – the highest official benchmark in terms of reliability and precision. Welcome to the Breitling world.

CHRONOMAT 44


© D.YURMAN 2014


HAMILTON JEWELERS ACCENT THE MAGAZINE OF LIFE’S CELEBRATIONS

SPRING/SUMMER 2014

Profile for Accent Magazine

Hamilton Jewelers  

The Magazine of Life's Celebrations

Hamilton Jewelers  

The Magazine of Life's Celebrations