Page 1

Table of Contents Industrial . . . . . . . . . . . . . . . . . . . . . . . . . 1

Disinfectants & Deodorants . . . . . . . 7

Housekeeping . . . . . . . . . . . . . . . . . . .13

Hand Care . . . . . . . . . . . . . . . . . . . . . . .23

Lubricants . . . . . . . . . . . . . . . . . . . . . . .27

Automotive . . . . . . . . . . . . . . . . . . . . . .29

Coatings, Sealants, & Adhesives33

Seasonal & Supplies . . . . . . . . . . . . . .37

Can Liners . . . . . . . . . . . . . . . . . . . . . . .39

Paper Products . . . . . . . . . . . . . . . . . .41

Floor Care . . . . . . . . . . . . . . . . . . . . . . .47

Maintenance Tools & Supplies . . . .53

Accessories & Applicators . . . . . . . .57

Safety Products . . . . . . . . . . . . . . . . . .61

Razor Blades & Utility Knives . . . . .75

Equipment . . . . . . . . . . . . . . . . . . . . . .79

Tapes . . . . . . . . . . . . . . . . . . . . . . . . . . . .81

Index . . . . . . . . . . . . . . . . . . . . . . . . . . . .89

&RS\ULJKW‹


Freight ALL ITEMS IN THIS CATALOG ARE ACTUAL FREIGHT. Stocked items have selective availability. Any order that is not stocked at your designated distribution center will incur actual freight from the next closest distribution center. Non-stocked items incur actual freight from the source of manufacture and are designated with this logo: The following may incur higher freight premiums: • Bulk items greater than or equal to 5 gallons • Hazardous chemicals including, but not limited to flammables and corrosive materials • Products that ship via air Freight charges for chemicals can vary depending on packaging, weight, and hazard class. In addition, freight charges are based on distance traveled and on how much space the order takes up on a vehicle. Ordering more stocked products per pallet reduces the overall average freight cost. )RRG3ODQW8VH

(QYLURQPHQWDOO\3UHIHUUHG

&RS\ULJKW‹


Industrial

Industrial &2%5$

6,'(:,1'(5

(9$325$725&21'(16(5 &2,/ ),1&/($1(5

(9$325$725&21'(16(5 &2,/ ),1&/($1(5

(/(&75,&$/&/($1(5

&3&&,7586'(*5($6(5

(/(&75,&$/3$576&/($1(5

&,7586&/($1(5'(*5($6(5  '(2'25$17

 ²R]$HURVRO +LJKSUHVVXUHIRDPLQJFRLOFOHDQHU6HOI5LQVLQJRQ ZRUNLQJHYDSRUDWRUFRLOV(IIHFWLYHO\UHPRYHVJUHDVH RLOZDWHUGHSRVLWVGLUWGXVWOLQWDQGDOOW\SHVRIVRLOV :DWHUEDVHG 1RQ)ODPPDEOH

 ²R]$HURVRO 'LVWULEXWLRQIURP&DOLIRUQLD

 ²[$HURVROV 'LVWULEXWLRQIURP&DOLIRUQLD

+LJKSHUIRUPDQFHIDVWHYDSRUDWLQJQRQIODPPDEOH FOHDQHUIRUXVHRQHQHUJL]HGHOHFWULFDOHTXLSPHQW ([FHOOHQWUHSODFHPHQWIRUFKORULQDWHGDQG FKORURIOXRULQDWHGVROYHQWV'ULHVTXLFNO\DQGLVUHVLGXH IUHH4XLFNO\UHPRYHVJUHDVHJULPHZD[DQGRLO+LJK GLHOHFWULFVWUHQJWKDQGQRQIODPPDELOLW\PDNHVWKH GHJUHDVHUVDIHIRUXVHRQPRWRUVUHOD\VVZLWFKHV JHQHUDWRUVDQGFRQWUROSDQHOV1RWWREHXVHGIRU PRWRUL]HGYHKLFOHPDLQWHQDQFHRUDXWRPRWLYHSDUWV

&RS\ULJKW‹

 ²R]$HURVRO +LJKSUHVVXUHIRDPLQJFRLOFOHDQHU6HOI5LQVLQJRQ ZRUNLQJHYDSRUDWRUFRLOV(IIHFWLYHO\UHPRYHVJUHDVH RLOZDWHUGHSRVLWVGLUWGXVWOLQWDQGDOOW\SHVRIVRLOS+ :DWHUEDVHGDQGQRQIODPPDEOH6SUD\DQ\ZD\ YDOYH

 ²R]$HURVRO $OOQDWXUDOLQJUHGLHQWV&DQEHXVHGDVDGHRGRUDQW ZKHQXVHGLQFOHDQLQJGXPSVWHUVJDUEDJHFDQVZDVWH UHPRYDOWUXFNVHWF1RWR[LFIXPHVQRQDFLGQRQFDXVWLF DQGQRQFRUURVLYH&RQWDLQVQRFKORULQDWHGVROYHQWV RUSHWUROHXPGLVWLOODWHV3OHDVDQWFLWUXVVFHQW+HDY\ IOXVKLQJDFWLRQTXLFNO\GLVVROYHVDQGUHPRYHVJUHDVH JULPHDVSKDOWRLO WDU3DUWVFDQDLUGU\OHDYLQJQHJOLJLEOH UHVLGXHRUEHULQVHGFOHDQZLWKZDWHU'RQRWVSUD\LQWR RURQHOHFWULFDOHTXLSPHQW3UHWHVWRQSDLQWVDQGSODVWLFV 1RW)RU6DOH2U8VH,Q&$0,RU27&6WDWHV

1


Industrial 635$<211(875$)25&(Š+'

3$576'(*5($6(5

+($9<'87<)2$0,1*'(*5($6(5

²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

(IIHFWLYHO\UHPRYHVJUHDVHJULPHRLODQGRWKHU RLOEDVHGFRQWDPLQDQWVIURPDYDULHW\RIVXEVWUDWHV LQFOXGLQJDXWRPRWLYHDQGPHWDOOLFSDUWV&RQFHQWUDWHG IRUPXODWKDWPXVWEHGLOXWHG

 ²R]$HURVRO  ²[$HURVROV 'HJUHDVHUIRUHIIHFWLYHUHPRYDORIKHDY\VRLOV)RDP FOLQJVWRVXUIDFHV1RULQVLQJQHFHVVDU\MXVWVSUD\DQG ZLSHRII&RQWDLQVQRFDXVWLFVSKRVSKDWHVRUVLOLFDWHV

32:(57521 ,1'8675,$/&/($1(5 '(*5($6(5  ²$HURVRO 'LVWULEXWLRQIURP&DOLIRUQLD

 ²[$HURVROV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQ 'LVWULEXWLRQIURP&DOLIRUQLD

 ²[*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

,QGXVWULDOGHJUHDVHUIRUXVHZKHUHTXLFNFOHDQLQJIDVWHYDSRUDWLRQDQGQRUHVLGXHLVGHVLUHG(IIHFWLYHO\UHPRYHVRLOGLUWJUHDVHWDUDQG OXEULFDWLQJFRPSRXQGVIURPDOOW\SHVRIHTXLSPHQW([FHOOHQWIRUFOHDQLQJWRROVHOHFWULFPRWRUVHOHFWULFDOFRQWDFWVDQGFLUFXLWERDUGV 1RW )RU6DOH2U8VH,Q&DOLIRUQLD

62/9

5(92/87,21

3$576:$6+,1*&/($1(5

121%87</'(2'25,=(5 &/($1(5

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

5HDG\WRXVHSDUWVZDVKLQJFOHDQHUDQGGHJUHDVHUWKDWLV VDIHIRUXVHRQZLULQJLQVXODWLRQDQGZHOGLQJHTXLSPHQW 6ROYHQWFDQEHDSSOLHGLQDQRQDWRPL]LQJVSUD\PHWKRG LPPHUVLRQRUE\KDQGZLSLQJ5LQVLQJLVQRWUHTXLUHG

 ²*DOORQ  ²[*DOORQV  ²*DOORQV  ²*DOORQV 6XSHULRUQRQEXW\OIRUPXOD6RLOVXVSHQVLRQSURSHUWLHV 1RQIODPPDEOHQRVROYHQWV0L[HGE\KDQGRUDXWRPDWLF PHWHULQJV\VWHP$SSO\E\VSUD\LQJZLSLQJEUXVKLQJ GLSSLQJRUVRDNLQJ0D\EHXVHGLQKLJKSUHVVXUHVSUD\ HTXLSPHQWDQGDXWRPDWLFIORRUVFUXEEHUV)UDJUDQFH /HPRQ'LOXWLRQV.LWFKHQV*HQHUDO

)$67%$// &21&(175$7('$//385326(&/($1(5 '(*5($6(5  ²R]$HURVRO  ²[$HURVROV  ²4XDUW  ²*DOORQ  ²[*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD   ²*DOORQV  ²*DOORQV $OOSXUSRVHFOHDQHUIRUDQ\VSUD\DQGZLSHMREIURPOLJKWGXW\WRKHDY\JURVVVRLO5HPRYHVJUHDVHLQNFUD\RQSHQFLOOLSVWLFNJUHDV\ IRRGVRLOVVPRNHILOPZLWKQRH[FHVVVFUXEELQJQRULQVLQJDQGQRUHVLGXH&RPSDUHVWR=HSIRUPXOD

2

&RS\ULJKW‹


Industrial 683(5%$//

32:(5%$//

&21&(175$7('08/7,385326( ,1'8675,$/&/($1(5 '(*5($6(5

,1'8675,$/'(*5($6(5 &/($1(5

25$1*(

,6,&,75866:,3(

'(*5($6(5 '5$,123(1(5

 ²*DOORQ 'LVWULEXWLRQIURP1HYDGD

 ²[*DOORQV 'LVWULEXWLRQIURP1HYDGD

)DVWDFWLQJFOHDQHUGHJUHDVHUIRUUHPRYLQJJUHDVHRLOLQN IDWWDUDGKHVLYHDQGRWKHUVRLOV'RHVQRWFRQWDLQDQ\ KDUVKDFLGVDONDOLQHVSKRVSKDWHVEOHDFKRUDPPRQLD &LWUXVIUDJUDQFH

 ²*DOORQ  ²[*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV  ²*DOORQV (FRQRPLFDODONDOLQHFOHDQHUDQGGHJUHDVHUIRUPXODWHG WROLIWJUHDVHJULPHDQGGLUW([FHOOHQWIRUXVHRQIORRUV ZDOOVXQSDLQWHGPHWDOVXUIDFHVHQJLQHVPDFKLQHU\ WUXFNVFDUVZKLWHZDOOVKRRGVYHQWVJULOOVRYHQVIDQV SODVWLFDQGYLQ\OXSKROVWHU\

 ²4XDUW  ²[4XDUWV  ²*DOORQ  ²[*DOORQV  ²*DOORQV ²*DOORQV 1DWXUDOFLWUXVZDWHUEDVHGGHJUHDVHUGUDLQFOHDQHUDQG GHRGRUL]HULQFRQFHQWUDWH/RRVHQVJUHDVH JULPHIRU IDVWHDV\UHPRYDO1RQFRUURVLYHDQGQRQIODPPDEOH

25$1*( +($9<'87<'(*5($6(5 &/($1(5

 ²*DOORQ  ²[*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV  ²*DOORQV (FRQRPLFDOFRQFHQWUDWHGDONDOLQHFOHDQHUGHJUHDVHU VSHFLDOO\IRUPXODWHGIRUH[WUDKHDY\GXW\DSSOLFDWLRQV 32:(5%$//ZLOOTXLFNO\UHPRYHPDQ\JUHDV\DQG FDUERQEDVHGVRLOVWKDWRUGLQDU\FOHDQHUGHJUHDVHUV FDQQRWKDQGOH&RPSDUHVWR=HSIRUPXOD

)/2$7,1*/,)767$7,21 '(*5($6(56;

 ²4XDUW  ²[4XDUWV  ²*DOORQ  ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV  ²*DOORQV 1DWXUDOFLWUXVZDWHUEDVHGGHJUHDVHUDQGGHRGRUL]HU FRQFHQWUDWH7KLVPXOWLSXUSRVHFOHDQHUVWULSVJUHDVH DQGKHDY\RLOGHSRVLWVIURPYLUWXDOO\DQ\VXUIDFH6DIH RQPRVWVXUIDFHVDQGDQH[FHOOHQWVXEVWLWXWHIRUKDUVK VROYHQWV&RPSDUHVWR=HSIRUPXOD%LJ2UDQJH

 ²*DOORQ/6 'LVWULEXWLRQIURP&$

 ²[*DOORQV 'LVWULEXWLRQIURP&$

 ²*DOORQV 'LVWULEXWLRQIURP&$

 ²*DOORQ)/6'HJUHDVHU6; 'LVWIURP,/

 ²[*DOORQV 'LVWULEXWLRQIURP,/

 ²*DOORQV 'LVWULEXWLRQIURP,/

6WULSVDZD\KHDY\JUHDVHDFFXPXODWLRQVIURPZDOOVDQG SXPSV4XLFNO\GLVVROYHVJUHDVH7UHDWVDQGPDLQWDLQV JUHDVHWUDSVDQGOLIWVWDWLRQV

05*5((1

%,*

(19,5210(17$//<6$)( &/($1(5 '(*5($6(5

&21&(175$7(',1'8675,$/&/($1(5

 ²4XDUW  ²[4XDUWV  ²*DOORQ  ²[*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV  ²*DOORQV 9HUVDWLOHFOHDQHUGHJUHDVHUDQGGHRGRUL]HUIRU LQGXVWULDODQGLQVWLWXWLRQDOXVH1RQIODPPDEOHIRUPXOD FUHDWHVDVDIHSURGXFWIRUXVHLQPDQ\DUHDVRILQGXVWU\ 'RHVQRWGXOOVXUIDFHV(FRQRPLFDOIRUXVHRQDYDULHW\ RIFOHDQLQJFRQGLWLRQV'LOXWHZLWKPRUHZDWHUIRUOLJKW FRQGLWLRQVDQGXVHOHVVZDWHUIRUKHDYLHUVRLOV &RS\ULJKWÂ&#x2039;

 ²*DOORQ  ²[*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV ([WUDVWUHQJWKKHDY\GXW\LQGXVWULDOFOHDQHU/RZIRDPLQJ IRUPXODEOHDFKHVDVLWFOHDQVDQGOHDYHVEHKLQGDIUHVK FOHDQ&DQEHDSSOLHGE\EUXVKPRSRUVSUD\HU

3


Industrial ($6<*5((1

%5,*+7./((1

$//385326(&/($1(5

 ²*DOORQ  ²*DOORQV  ²*DOORQV 1RQFDXVWLFQRQFRUURVLYHDOOSXUSRVHFOHDQHUZLWKQR KDUVKDONDOLV6DIHIRUXVHRQJODVVSDLQWHGVXUIDFHV SRUFHODLQDOXPLQXPVWDLQOHVVVWHHOSODVWLFYLQ\ODQG PRVWRWKHUKDUGVXUIDFHV%XW\OIUHH1RIUDJUDQFH

 ²*DOORQ 'LVWULEXWLRQIURP&DOLIRUQLD

 ²[*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

%ULJKW.OHHQLVDFRQFHQWUDWHGV\QWKHWLFDOOSXUSRVH FOHDQHUWKDWPD\EHXVHGRQDQ\VXUIDFHQRWKDUPHGE\ ZDWHU8VHZLWKKRWRUFROGZDWHUDQGZLWKKDUGRUVRIW ZDWHU3HQHWUDWHVWKURXJKDOOJULPHDQGGLUW(PXOVLILHV JUHDVHDQGRLO/LIWVGLUWDZD\IURPDOOVXEVWUDWHV)RUXVH RQ)ORRUV$XWRPRELOHV:DOOVDQG3DLQWHG6XUIDFHV *ODVVDQG/DXQGU\

32:(53/86

&2&

&/($1(5

&21&(175$7('&/($1(5

 ²*DOORQ 'LVWULEXWLRQIURP&DOLIRUQLD

 ²[*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

%LRGHJUDGDEOHQRQIODPPDEOHFOHDQHUWKDWHPXOVLILHV DQGIORDWVDZD\GLUWJUHDVHRLOZD[LQNDQGFDUERQVWDLQV IURPZDOOIORRUVZRRGZRUNPHWDOIXUQLWXUHDQGPDFKLQHU\

 ²*DOORQ 'LVWULEXWLRQIURP&DOLIRUQLD

 ²[*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

6XSHUFRQFHQWUDWHGFOHDQHU4XLFNO\UHPRYHVJUHDVH RLOZD[FDUERQLQNVG\HFUHRVRWHPLOGHZDQGRWKHU VWXEERUQVRLOV6SHFLDOLQJUHGLHQWVOHDYHDSURWHFWLYHILOP RQFOHDQHGVXUIDFHVWRKHOSSUHYHQWFRUURVLRQ:DWHU VROXEOHWRTXLFNO\SHQHWUDWHORRVHQDQGVWULSJUHDVHGLUW DQGJULPHIURPPDFKLQHU\FRQFUHWHDQGPHWDOVXUIDFHV

%:

%8*-8,&(

%/2&.:+,7(1(5

+($9<'87<$48(2863$576&/($1,1*62/87,21

 ²*DOORQ 'LVWULEXWLRQIURP&DOLIRUQLD

 ²[*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

+HDY\GXW\OLTXLGFKORULQDWHGGHWHUJHQWWKDWLVGHVLJQHG WRFOHDQWRXJKVWDLQVDQGVRLOV+LJKO\FRQFHQWUDWHG ZKLWHQHUIRUFOHDQLQJFXWWLQJERDUGVEOHDFKLQJRXWIORRUV DQGZDOOV&RQWDLQVEOHDFK

 ²*DOORQV 'HVLJQHGIRUGLIILFXOWFOHDQLQJDSSOLFDWLRQVLQ ELRUHPHGLDWLRQSDUWVZDVKLQJV\VWHPVDWDQRSHUDWLQJ WHPSHUDWXUHƒ)ƒ)%OHQGHGOLTXLGIRUPXOD SURGXFHVDQRLOGLVSHUVDQWDQGGHJUHDVLQJIOXLG1RQ &RUURVLYH1RQ)ODPPDEOH1RQ&DXVWLF1RQ+D]DUGRXV

+'*5,0(%867(5'(*5($6(5

)/2:287

 ²*DOORQV 'LVWULEXWLRQIURP1HYDGD

$OOSXUSRVHFOHDQHU8VHVSHFLILFDOO\IRUFOHDQLQJ JUHDVHILOWHUVGXFWVUHIXVHFRQWDLQHUVRURWKHUURXJK JUHDVHRUZD[UHPRYDOMREV

*5$18/$5'5$,123(1(5

4

 ²OEV  ²OEV (IIHFWLYHO\ULGVOLQHVRIWUHHURRWVJUHDVHVIDWVZD[HV GHWHUJHQWVVROXEOHVROLGVDQGVHPLVROXEOHVROLGV.HHS OLQHVFOHDQVWRSVIRXOEDFNXSRGRUVDQGSUHYHQWIXWXUH FORJJLQJ$WWDFNVDOORUJDQLFZDVWHSUHVHQWLQWKHOLQH,V HDV\DQGVDIHWRXVHQRQIODPPDEOHDQGQRQH[SORVLYH &OHDQVVHZHUOLQHVFKHPLFDOO\DQGLQH[SHQVLYHO\

&RS\ULJKW‹


Industrial %,*3,1( 32:'(5('&21&5(7(&/($1(5

 ²OEV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²OEV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²OEV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²OEV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²OEV 3LQHVFHQWHGFRQFHQWUDWHGFOHDQHUPDGHWRKDQGOHWKHKHDYLHVWVRLO&RORU2UDQJH3OHDVDQWO\VFHQWHGDQGGXVWIUHH'LVVROYHVLQWR ZDWHUVROXWLRQFRPSOHWHO\DQGTXLFNO\

%,*3,1( :+,7(32:'(5('&21&5(7(&/($1(5  ²OEV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²OEV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²OEV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²OEV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²OEV 3LQHVFHQWHGFRQFHQWUDWHGFOHDQHUPDGHWRKDQGOHWKHKHDYLHVWVRLO&RORU:KLWH3OHDVDQWO\VFHQWHGDQGGXVWIUHH'LVVROYHVLQWRZDWHU VROXWLRQFRPSOHWHO\DQGTXLFNO\

35(0,80&5(7( &21&5(7(&/($1(5  ²OEV3UHP&RQFUHWH&OHDQHU  ²OEV3UHP&RQFUHWH&OHDQHU &RQFHQWUDWHGKHDY\GXW\DFLGFOHDQHUIRUPXODWHGWRFOHDQFRQFUHWHDQGFHPHQWGHSRVLWVIURPYDULRXVHTXLSPHQWLQFOXGLQJWUXFNV PDFKLQHU\WUDQVLWIRUPVVKRYHOVDQGPHWDOHTXLSPHQW

+':+,7( &21&5(7(&/($1(5  ²OEV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²OEV%ODVW2II  ²OEV%ODVW2II &RQFUHWHFOHDQHUWKDWTXLFNO\VRDNVGRZQLQWRJUHDVHRLODQGGLUW,WGLVVROYHVORRVHQVVXVSHQGVKDUGWRJHWLPEHGGHGPDWHULDOVDQG ULQVHVTXLFNO\DZD\&RQFUHWHGULHVWRDOLJKWHUFRORUDQGLVQRWVOLSSHU\

&RS\ULJKWÂ&#x2039;

5


Industrial 936;

&$867,&&/($1(5

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

+LJKFDXVWLFFOHDQHUIRUSRUWDEOHODYDWRU\FOHDQLQJ

 ²*DOORQV 'LVWULEXWLRQIURP1HYDGD

$OLTXLGDONDOLQHIRDPLQJJHQHUDOFOHDQHUGHVLJQHG SULQFLSDOO\IRUXVHLQPHDWSDFNLQJSRXOWU\SUHSDUDWLRQ DQGRWKHUIRRGSURFHVVLQJSODQWVZKHUHVRLODQGJUHDVH DUHIDFWRUV,WKDVLWVRZQEXLOWLQIRDPLQJDJHQWDQGFDQ EHXVHGLQDOOW\SHVRIKLJKSUHVVXUHHTXLSPHQW

&+/25)2$0

**

&+/25,1$7('&/($1(5

*5$)),7,5(029(5*(/

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP,OOLQRLV

 ²*DOORQV 'LVWULEXWLRQIURP,OOLQRLV

+LJKO\HIIHFWLYHLQUHPRYLQJKHDY\DFFXPXODWLRQVRI EDNHGRQJUHDVHDQGSURWHLQEDVHGVRLOVIURPVXUIDFHV )RUXVHLQIRDPHUVVWHDPFOHDQHUVRUSUHVVXUHZDVKHUV &KORULQDWHGIRUPXODLVH[FHOOHQWIRUFOHDQLQJVWDLQUHPRYDO DQGGHRGRUL]LQJ

 ²4XDUW 'LVWULEXWLRQIURP&DOLIRUQLD

 ²[4XDUWV 'LVWULEXWLRQIURP&DOLIRUQLD

*UDIILWLUHPRYHUGHVLJQHGWRUHPRYHSDLQWLQNDQGRWKHU W\SHVRIJUDIILWLIURPURDGVLJQVEXVHVELOOERDUGVHWF

*5$)),7,*21(

'25$'248,&.),;

9$1'$/,600$5.5(029(5

*5$)),7,5(029(5

²R]$HURVRO 6ROYHQWEDVHGJHO²FOLQJVWRYHUWLFDOVXUIDFHV5HPRYHV DOOW\SHVRIJUDIILWLPDUNLQJVZLWKRXWGDPDJLQJVXUIDFHV 1RWDSDLQWVWULSSHU²VDIHRQPRVWSDLQWHGVXUIDFHV )RUUHPRYDORILQNPDUNVURDGWDUFUD\RQSHQFLOVFXII PDUNV/HDYHVDSOHDVDQWIUDJUDQFH $SSOLFDWLRQVFRXQWHUWRSVEDWKURRPVWDOOVWLOHZDOOV URDGVLJQVVLGHZDONVELOOERDUGVEULGJHVEXVVHVWUXFNV EXLOGLQJVDQGPRUH:RQ¶WKDUPVWHHODOXPLQXPJODVV SRUFHODLQEUDVVFKURPHFRQFUHWHPDUEOHEULFNZRRG DQGPRVWHQDPHOHGVXUIDFHV

 ²R]%RWWOH (QJLQHHUHGWRFOHDQXSSUREOHPJUDIILWLRYHUVSUD\ JXQNDQGWDUZLWKRXWGDPDJLQJXQGHUO\LQJSDLQW (QYLURQPHQWDOO\VDIHDQGHDV\WRXVH&OHDUDQG ELRGHJUDGDEOHORZRGRUOLTXLG

7+(0$*,&,$1

(;35(66:,3(6

$,5,1)86('3/$67,&+$5' 685)$&(&/($1(5

*5$)),7,5(029(5

²/D\HU6SRQJH 7ZRVWULSVRI0HODPLQHVHSHUDWHGE\DGXUDEOH\HOORZ VWULS,QGXVWULDOVWUHQJWKFRQWDLQVQRFKHPLFDOVVLPSO\ XVHZDWHU0DGHRIDLULQIXVHGSODVWLF4XLFNO\UHPRYHV JUDIILWLSDLQWSHUPDQHQWPDUNHUVWDLQVVFXIIVOLSVWLFN LQNVRDSVFXPWDUFUD\RQJUHDVHDQGSHQFLO $SSOLFDWLRQV6FKRROVGD\FDUHVKRVSLWDOVDVVLVWHG OLYLQJFHQWHUVFDIHWHULDVRIILFHVDXWRPRWLYHLQGXVWU\

6

 ²3UH0RLVWHQHG7RZHOV´[´ %LRGHJUDGDEOHIRUPXODDQGVFUXEELQJDFWLRQTXLFNO\ DWWDFNVDOOIRUPVRIJUDIILWL'XDOWH[WXUHGWRZHOPLOG FOHDQLQJ VPRRWKVLGH GLIILFXOWVWDLQV DEUDVLYHVLGH  5HPRYHVPRVWSDLQWVDQGHQDPHOV3XUSOHWRZHOPLOG RGRUQRKDUVKFKHPLFDOVVDIHWRKDQGOH )RUXVHRQ$OXPLQXPVWDLQOHVVVWHHOVWHHOVPRRWK PHWDOVWLOHSRUFHODLQ)RUPLFDZRRGODPLQDWHVJODVV 3OH[LJODVDQGPDQ\SODVWLFV 1RWH,QLWLDOO\WHVWRQLQFRQVSLFXRXVDUHDWRPDNHVXUH SDLQWLVQRWUHPRYHGRUGXOOHGDORQJZLWKWKHJUDIILWL$OVR WKHVHZLSHVPD\DWWDFNFHUWDLQSODVWLFV &RS\ULJKWÂ&#x2039;


Disinfectants & Deodorants

Disinfectants & Deodorants =(671'',6,1)(&7$17 1(875$/',6,1)(&7$1708/7,385326(&/($1(5  ²*DOORQ  ²[*DOORQV  ²*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD ,OOLQRLV

$YDLODEOHLQWKHIROORZLQJVWDWHV&$19102.7;1'01,/0,,12+3$'LVLQIHFWDQW&OHDQHU0LOGHZVWDW)XQJLFLGH9LUXFLGH DQG'HRGRUDQW$SSOLFDWLRQV+RVSLWDOV1XUVLQJ+RPHV6FKRROV9HWHULQDU\$UHDV5HVWURRPV&DUSHW 8SKROVWHU\&RPPHUFLDO ,QVWLWXWLRQDODQG,QGXVWULDO8VH0HHWV26+$%ORRGERUQH3DWKRJHQ6WDQGDUGIRU+,9+%9DQG+&9(IIHFWLYHDJDLQVW3DUYRYLUXV &39  3RUFLQH3DUYRYLUXVDQG5DELHV:LOOQRWGXOOIORRUILQLVKHV(3$5HJLVWHUHG+RVSLWDO*UDGH4XDWHUQDU\'HWHUJHQW*HQHUDOGLOXWLRQR] )UDJUDQFH/HPRQ

3+(120(1$/

*(50$:$<

+263,7$/',6,1)(&7$176 '(2'25$176

08/7,385326(48$7 ',6,1)(&7$17 &/($1(5

 ²R]$HURVRO&RXQWU\*DUGHQ  ²[$HURVROV&RXQWU\*DUGHQ  ²R]$HURVRO5HJXODU  ²[$HURVROV5HJXODU  ²R]$HURVRO&LWUXV  ²[$HURVROV&LWUXV &OHDQV'LVLQIHFWV'HRGRUL]HV9LUXFLGDO)XQJLFLGDO 6WDSK\ORFLGDO%DFWHULFLGDO7XEHUFXORFLGDO 3+(12/,&',6,1)(&7$176DUHWKHRQO\W\SH RIGLVLQIHFWDQWVDSSURYHGE\WKH(3$WRFRPEDW 0\FREDFWHULXP7XEHUFXORVLV'HVWUR\VRGRUFDXVLQJ EDFWHULDRQHQYLURQPHQWDOVXUIDFHV &RS\ULJKWÂ&#x2039;

 ²R]$HURVRO  ²[$HURVROV )RDPLQJ'LVLQIHFWDQW&OHDQHU&OHDQV'LVLQIHFWV 'HRGRUL]HV3RZHUIXO*HUP&RQWURO)UHVK&LWUXV6FHQW 4XDWHUQDU\DPPRQLXPFKORULGHEDVHGDFWLYHLQJUHGLHQWV 'HVWUR\VRGRUFDXVLQJEDFWHULDRQHQYLURQPHQWDO VXUIDFHV.LOOV6WDSK6DOPRQHOOD3VHXGRPRQXV+HUSHV 6LPSOH[9LUXV7\SHVDQGDQG+,9± $,'9LUXV  (OLPLQDWHV ,QKLELWVWKH*URZWKRI0ROG)XQJXV 0LOGHZ/HDYHVVXUIDFHVFOHDQDQGIUHHRIRGRUV)RU XVHRQKDUGQRQSRURXVHQYLURQPHQWDOVXUIDFHV

7


Disinfectants & Deodorants (=:,3(6

4'

+$5'685)$&(',6,1)(&7$17

',6,1)(&7$17'(2'25$17 &/($1(5

 ²3UH0RLVWHQHG7RZHOV 1RQZRYHQGLVSRVDEOHFORWKFRQWDLQLQJDVWDEOHORZS+ GLVLQIHFWDQWDQGGHRGRUDQWIRUDQ\KDUGQRQSRURXVVXUIDFHV ZKHUHFRQWURORIFURVVFRQWDPLQDWLRQLVUHTXLUHGƒ& ƒ) 3VHXGRPRQDVDHUXJLQRVD6DOPRQHOODFKROHUDHVXLV (VFKHULFKLDFROL++HUSHVVLPSOH[YLUXV JHQLWDO KHUSHVYLUXV +,9 $,'6YLUXV  DWDQH[SRVXUHWLPH RIPLQ 7ULFKRSK\WRQPHQWDJURSK\WHV $WKOHWH¶VIRRW IXQJXV 0\FREDFWHULXPWXEHUFXORVLV0HWKLFLOOLQ5HVLVWDQW 6WDSK\ORFRFFXVDXUHXV 056$ 9DQFRP\FLQ5HVLVWDQW (QWHURFRFFXVIDHFDOLV 95( ,QIOXHQ]D$

 ²*DOORQ/HPRQ  ²[*DOORQV/HPRQ  ²*DOORQ0LQW  ²[*DOORQV0LQW  ²*DOORQ3LQH  ²[*DOORQV3LQH  ²*DOORQ)UHVK  ²[*DOORQV)UHVK 0XOWLSXUSRVH'LVLQIHFWDQW *HUPLFLGDOFOHDQV GHRGRUL]HVDQGGLVLQIHFWVLQRQHODERUVDYLQJVWHS.LOOV 6WDSK\ORFRFFXVDXUHXV0HWKLFLOOLQ5HVLVWDQW 056$  9LUXVHV  $GHQRYLUXV7\SH +HUSHVVLPSOH[7\SH +HUSHV  +,9 $,'6YLUXV  ,QIOXHQ]D$7H[DV ,QIOXHQ]D  5XEHOOD *HUPDQ0HDVOHV  9DFFLQLD 3R[9LUXV  )XQJL  $VSHUJLOOXVIODYXV$VSHUJLOOXVIXPLJDWXV$VSHUJLOOXV JODXFXVYDUWRQRSKLOXV&DQGLGDDOELFDQVDQG7ULFKRSK\WRQ PHQWDJURSK\WHV $WKOHWH¶V)RRW)XQJXV 

-$:6Š

8/75$&/($1%/($&+

',6,1)(&7$17&/($1(5 '(*5($6(5

$//385326(6$1,7,=,1*%/($&+

 ²IOR]&RQFHQWUDWH&DUWULGJH  ²[&DUWULGJHV  ²IOR]/DEHOHG%RWWOH  ²6WDUWHU3DFNSDFNRIFDUWULGJHV ODEHOHGERWWOHVSUD\HUKHDG  ²6SUD\HU+HDG 1HXWUDOS+QRULQVHFOHDQLQJDQGEURDGVSHFWUXP GLVLQIHFWDQW.LOOV95(056$+%9 +,9&OHDQV WRXJKVRLOVZLWKDSOHDVDQWIUHVKIUDJUDQFH

 ²*DOORQ 'LVWULEXWLRQIURP&$ 19

 ²[*DOORQV 'LVWULEXWLRQIURP&$ 19

'LVLQIHFWDQWIXQJLFLGHPLFURELFLGHPLFURELVWDWVDQLWL]HU YLUXFLGH

,6,8/75$%/($&+

7,06(1

 ²*DOORQV 'LVWULEXWLRQIURP1HYDGD

&RQFHQWUDWHGEOHDFKIRUZDUHZDVKFOHDQLQJDQG EULJKWHQLQJ

',6,1)(&7$176$1,7,=(5 '(2'25,=(5

75,)(&7$17',6,1)(&7$1732:'(5

48$75,16(

 ²OEV 'LVWULEXWLRQIURP1HYDGD

+LJKO\HIIHFWLYHEURXGVSHFWUXPGLVLQIHFWDQWXVHGWR SUHYHQWWKHVSUHDGRIYDULRXVGLVHDVHVLQYHWHULQDU\ KRVSLWDOVERDUGLQJIDFLOLWHVDQGVKHOWHUV

 ²*DOORQV 'LVWULEXWLRQIURP1HYDGD

 ²[*DOORQV 'LVWULEXWLRQIURP1HYDGD

)RUVSUD\VDQLWL]LQJRULPPHUVLRQVDQLWL]LQJRSHUDWLRQV 3HUIHFWLQIRRGSUHSDUDWLRQVHWWLQJV'HVLJQHGIRUXVH RQIORRUVZDOOVIRRGSURFHVVLQJHTXLSPHQWDQGDOOKDUG VXUIDFHV86'$'DSSURYHG

8

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

&RQFHQWUDWHGGLVLQIHFWDQWVDQLWL]HUDQGGHRGRUL]HU 6SHFLILFDOO\GHVLJQHGIRULQVWLWXWLRQDOXVHVVXFKDV KRVSLWDOVQXUVLQJ+RPHVDQGVFKRROV,GHDOIRU GLVLQIHFWLQJIORRUVZDOOVFRXQWHUWRSVEDWKLQJDUHDV ODYDWRULHVEHGIUDPHVWDEOHVFKDLUVJDUEDJHSDLOVDQG RWKHUKDUGQRQSRURXVVXUIDFHV

&RS\ULJKW‹


Disinfectants & Deodorants $,5(66(1&(

)3.,//=2'25

2'25&2817(5$&7$17

 ²*DOORQ&RXQWU\  ²[*DOORQV&RXQWU\  ²*DOORQ$SSOH  ²[*DOORQV$SSOH  ²*DOORQ&KHUU\  ²[*DOORQV&KHUU\  ²*DOORQV&KHUU\ 'LVWULEXWLRQIURP1HYDGD

0XOWLSXUSRXVZDWHUVROXEOHPDORGRUFRXQWHUDFWDQW FRQWDLQLQJDQDFWLYHRGRUGLJHVWLQJHQ]\PHWRUHPRYH SUREOHPRGRUV

 ²4XDUW&LQQDPRQ  ²[4XDUWV&LQQDPRQ  ²4XDUW/HPRQ  ²[4XDUWV/HPRQ (OLPLQDWHVRGRUVVXFKDVPLOGHZVPRNHYRPLWDQG XULQH1HXWUDOL]HVRGRUVDWWKHLUVRXUFHGRHVQRWPDVN WKHP5HPRYHVRGRUVIURPIORRUVFDUSHWVJDUEDJHFDQV FORVHWVWRLOHWVGLDSHUSDLOVFLJDUHWWHXUQVGLVSRVDOXQLWV FORVHWVNHQQHOVHWF$LU(VVHQFHLVFRQFHQWUDWHGIRU HFRQRPLFDOXVH

6(:(56:((7(1(5/(0216;

6(:(56:((7(1(5&+(55<

 ±*DOORQ  ±[*DOORQV  ±*DOORQV 'LVWULEXWLRQIURP,OOLQRLV

)RUPXODWHGWRFRQWUROREQR[LRXVRGRUVLQVHZDJHSODQWV ODJRRQVPDLQVDQGODWHUDOVJDUEDJHFRQWDLQHUVKDXOHUV DQGGXPSV

 ²*DOORQ  ²[*DOORQV

)5(6+67$57

)5(6+67$576;

 ²4XDUW  ²[4XDUWV )UHVKFXWERXTXHWIUDJUDQFHODVWVIRUKRXUV6WRSVRGRUV DWWKHLUVRXUFH,GHDOIRUPRSZDWHURUFDUSHWFOHDQLQJ VROXWLRQV

²*DOORQV 'LVWULEXWLRQIURP,OOLQRLV

JDOSDLO)RUPXODWHGWRFRQWUROREQR[LRXVRGRUVLQ VHZDJHSODQWVODJRRQVPDLQVDQGODWHUDOVJDUEDJH FRQWDLQHUVKDXOHUVDQGGXPSV

)5(6+&+(55,(6

,6,32/<&,75$=<0(

)RUPXODWHGWRFRQWUROREQR[LRXVRGRUVLQVHZDJHSODQWV ODJRRQVPDLQVDQGODWHUDOVJDUEDJH FRQWDLQHUVKDXOHUVDQGGXPSV

'(2'(5,=(5 '5$,10$,17$,1(5  ²*DOORQ  ²[*DOORQV :LOGFKHUU\IUDJUDQFHWKDWODVWVIRUKRXUV6WRSVRGRUVDW WKHLUVRXUFH,GHDOIRUUHVWURRPPRSZDWHUDQGFOHDQLQJ VROXWLRQV7HUPLQDWHVRGRUVRQFRQWDFW

&RS\ULJKWÂ&#x2039;

 ²4XDUW  ²[4XDUWV 4XLFNO\DQGQDWXUDOO\HOLPLQDWHVDYDULHW\RIVWXEERUQ RGRUVE\DQHQ]\PHGLJHVWLRQSURFHVVQHXWUDOL]LQJRGRUV DWWKHVRXUFH*RRGIRUXVHLQUHVWURRPVVHSWLFWDQNV JDUEDJHDUHDVJUHDVHWUDSVXULQDOVSRUWDEOHWRLOHWV$ IUHVKFLWUXVIUDJUDQFH

9


Disinfectants & Deodorants &+87(6 '80367(56

 ²*DOORQ  ²[*DOORQV  ²*DOORQV 4XLFNO\EUHDNVGRZQJUHDVHDQGRWKHURUJDQLFVRLOVZKLOHUHGXFLQJWKHQRWLFHDEOHVPHOORIJDUEDJH:RUNVRQZDONZD\VORDGLQJGRFNV DQGFRQFUHWHSDGVXQGHUQHDWKGXPSVWHUV&OHDQVHQWLUHGXPSVWHUDUHDLQOHVVWKDQPLQXWHV

'5<635$<$,5 )$%5,&'(2'25$176  ²R]$HURVRO%DE\3RZGHU  ²R]$HURVRO&OHDQ/LQHQ  ²R]$HURVRO0XOEHUU\  ²R]$HURVRO6SULQJ0LVW  ²R]$HURVRO/LQHQ  ²R]$HURVRO9DQLOOD  ²R]$HURVRO5HG+RW &LQQDPRQ   ²R]$HURVRO2FHDQ%UHH]H  ²R]$HURVRO0DQJR

 ²[$HURVROV%DE\3RZGHU  ²[$HURVROV&OHDQ/LQHQ  ²[$HURVROV0XOEHUU\  ²[$HURVROV6SULQJ0LVW  ²[$HURVROV/LQHQ  ²[$HURVROV9DQLOOD  ²[$HURVROV5HG+RW &LQQDPRQ   ²[$HURVROV2FHDQ%UHH]H  ²[$HURVROV0DQJR  ²3DFN$LU)UHVKHQHU$VVRUWPHQW&RQWDLQVRIHDFK0XOEHUU\6SULQJ 0LVW/LQHQ9DQLOOD5HG+RW &LQQDPRQ 2FHDQ%UHH]HDQG0DQJRIUDJUDQFH 'U\PLVWDHURVRORGRUFRXQWHUDFWDQWDLUIUHVKHQHU'HRGRUL]HV$,5RU)$%5,&83+2/67(5<&KHPLFDOO\QHXWUDOL]HVDQGUHPRYHV RGRUVWUDSSHGLQIDEULFDQGIRDPSDGGLQJ6SHFLDO9DOYH±VSUD\VXSULJKWRULQYHUWHG92&&RPSOLDQW 1RQIODPPDEOH1RQVWDLQLQJZKHQ XVHGDVGLUHFWHG'HVWUR\VIRXORGRUVFDXVHGE\VPRNHGHFD\XULQHIHFHVVROYHQWVJDVYRPLWFRRNLQJDQLPDOVDQGPRUH

727$/5(/($6( 2'25&21752/  ²R]$HURVRO$SSOH  ²[$HURVRO$SSOH  ²R]$HURVRO/LQHQ  ²[$HURVRO/LQHQ  ²R]$HURVRO/HPRQ/LPH  ²[$HURVRO/HPRQ/LPH  ²R]$HURVRO2UDQJH  ²[$HURVRO2UDQJH  ²R]$HURVRO0RXQWDLQ$LU  ²[$HURVRO0RXQWDLQ$LU  ²R]$HURVRO)UHVK$LU  ²[$HURVRO)UHVK$LU 'U\PLVWRGRUFRXQWHUDFWDQWDLUIUHVKHQHU6DPHJUHDWIHDWXUHVDQGIUDJUDQFHVDVWKHODUJHUFDQVRIDLUIUHVKHQHUEXWLQDVPDOOHU R]IRJJHUFDQGHVLJQ7ZRZD\UHOHDVHYDOYHVFDQEHORFNHGLQWRRSHQSRVLWLRQIRUFRPSOHWHGLVFKDUJHLQDURRPRUYHKLFOHRUOLJKWO\ GHSUHVVHGIRUDVKRUWEXUVWRIVSUD\3OHDVDQWIUDJUDQFHQHXWUDOL]HVKXQGUHGVRIPDORGRUV(DFKFDQQHXWUDOL]HVDQGGHVWUR\VRGRUVLQXS WRFXIWRIVSDFH

0(7(5('0,67  ²R]&LQQDPRQ  ²R]9DQLOOD  ²R]0DQJR  ²R]/LQHQ  ²R])UHVK6FHQW ³7LPHGUHOHDVH´DLUIUHVKHQHUV&DOLIRUQLD92&FRPSOLDQWIUDJUDQFHVWRWDO)LWVVWDQGDUGPHWHUHGDHURVROGLVSHQVHUV1HXWUDOL]HV XQSOHDVDQWRGRUV&RQVWDQWO\GHRGRUL]HVIRUDSSUR[LPDWHO\GD\V)LQHGU\PLVWLVQRQVWDLQLQJ&RXQWHUDFWVRGRUVVXFKDVVPRNH WREDFFRIRRGDQLPDOVPLOGHZDQGPXFKPRUH$SSOLFDWLRQ5HVWURRPVKRVSLWDOVORFNHUURRPVVFKRROVEDVHPHQWVPHHWLQJURRPV NLWFKHQVUHVWDXUDQWVDQGPXFKPRUH

10

&RS\ULJKWÂ&#x2039;


Disinfectants & Deodorants $,520$          

²:KLWH'LVSHQVHU ²'D\$HURVRO&LWUXV ²[$HURVROV&LWUXV ²'D\$HURVRO0DQJR ²[$HURVROV0DQJR ²'D\$HURVRO/LQHQ ²[$HURVROV/LQHQ ²'D\$HURVRO%RXTXHW ²[$HURVROV%RXTXHW ²9DULHW\3DFN

9HFWDLU$LURPDIUDJUDQFHVRIIHUVW\OHDQGLPSDFWRSWLRQVWRPDWFKDOOSUHIHUHQFHV7KH$LURPD'LVSHQVHUDXWRPDWLFDOO\GHOLYHUVVPDOO EXUVWVRIIUDJUDQFHDWVSHFLILFLQWHUYDOVLQRUGHUWRNHHSRGRUVDWED\,WSURYLGHVIOH[LEOHDQGHDV\WRXVHSURJUDPPLQJRSWLRQVDQGFDQEH VHWWRPDWFK\RXUH[DFWORFDWLRQFRQGLWLRQV

9(&7$,59$,5         

²'D\&DUWULGJH*UHHQ ²[&DUWULGJHV*UHHQ ²'D\&DUWULGJH<HOORZ ²[&DUWULGJHV<HOORZ ²'D\&DUWULGJH%OXH ²[&DUWULGJHV%OXH ²'D\&DUWULGJH5HG ²[&DUWULGJHV5HG ²:KLWH'LVSHQVHU

7KH9$LURGRUFRQWUROV\VWHPSURYLGHVXSWRGD\VRIFRQWLQXRXVIUDJUDQFHLQDFRPSOHWHO\HQYLURQPHQWDOO\IULHQGO\PDQQHURSHUDWLQJ ZLWKRXWWKHXVHRIEDWWHULHVRUKDUPIXOSURSHOODQWV

&+$03,210(7(5(''(2'25,=(56 'LVWULEXWLRQIURP1HYDGD

 ²0XOEHUU\0HWHUHGR]  ²9DQLOOD0HWHUHGR]  ²2FHDQ0LVW0HWHUHGR]  ²0DQJR0HWHUHGR]  ²2UDQJH6XQ0HWHUHGR]  ²([RWLFJDUGQ0HWHUHGR]  ²2GRU1HXWU0HWHUHGR]  ²3LQD&RODGD0HWHUHGR]  ²$SSOH%VP0HWHUHGR]  ²0HWHUHG'LVSHQVHU  ²&LQQDPRQ0HWHUHGR] SDFNVDYDLODEOHZLWKDµ¶VXIIL[ &RQWDLQVDPDORGRUHOLPLQDWRUWKDWFRPSOHWHO\HOLPLQDWHVXQSOHDVDQWRGRUVDQGOHDYHVDFOHDQIUHVKVFHQWLQWKHDLU (OLPLQDWHVRGRUVLQDFXELFIRRWDUHDIRUXSWRGD\V

&+$03,21$,5)5(6+(1(56

&+$03,21)2$0 'LVWULEXWLRQIURP1HYDGD

 ²6SULQJ/LQHQR] 'LVWULEXWLRQIURP1HYDGD

 ²9DQLOOD%HDQR] 'LVWULEXWLRQIURP1HYDGD

 ²[6SULQJ/LQHQ  ²[9DQLOOD%HDQ &KDPSLRQGU\DLUIUHVKHQHUVFRQWDLQ2UGHQRQHŒDQ HIIHFWLYHGHRGRUL]LQJLQJUHGLHQWWKDWFRPSOHWHO\HOLPLQDWHV XQSOHDVDQWRGRUV7KHORQJODVWLQJIRUPXODLVHIIHFWLYH DJDLQVWVPRNHDQGFRRNLQJRGRUVGHRGRUL]LQJZLWKRXW IDLO

',6,1)(&7$17'(2'25$17

&RS\ULJKW‹

 ²$HURVRO  ²[$HURVROV 4XDWHUQDU\IRDPLQJGLVLQIHFWDQWFOHDQHU.LOOVRI JHUPVLQPLQXWHV5HPRYHVPROGDQGPLOGHZVWDLQV DQGHOLPLQDWHVRGRUV

11


Disinfectants & Deodorants $,5:25.6Š 'LVWULEXWLRQIURP1HYDGD

 ²)UXLW%DVNHW5HILOO  ²&LWUXV*URYH5HILOO  ²6XQEXUVW5HILOO  ²'LVSHQVHU%ODFN  ²'LVSHQVHU:KLWH 8VHVSDVVLYHJUDYLW\WRGLVSHQVHIUDJUDQFH/LTXLG IORZVIURPLQQHUFRUHWRVSHFLDOO\ERQGHGZLFN (QYLURQPHQWDOO\IULHQGO\UHF\FODEOHFRQWDLQHUXVHV QREDWWHURUSURSHOODQWV&RQWDLQV0HWD]HQHŠEUDQG 0ROHFXODURGRUQHXWUDOL]HU1RGULSSLQJVSLOOLQJRUOHDNLQJ

$,5:25.6Š%2:/&/,36  ²6XQEXUVW SHUER[

 ²&LWUXV*URYH SHUER[

 ²)UXLW%DVNHW SHUER[

/DVWVXSWRGD\V&RQWLQXRXVRGRUFRQWURO:LOOQWR GLVVROYHLQZDWHU92&FRPSOLDQW)LWVPRVWVWDQGDUG WRLOHWV&OLSVRQRXWVLGHRIERZO&RQWDLQHQ]\PHVWKDW FRQWLQXDOO\ZRUNWRHOLPLQDWHRGRUVDWWKHVRXUFH

$,5:25.6Š85,1$/6&5((1

85,1$/6&5((1%/2&.

 ²)UXLW%DVNHW SHUER[

 ²6XQEXUVW SHUER[

 ²&LWUXV*URYH SHUER[

7UXHGD\SHUIRUPDQFHZLWKFRQWLQXRXVRGRUFRQWURO )OH[LEOHWRILWDOOXULQDOV+HOSVHOLPLQDWHFORJJLQJ92& FRPSOLDQW&DQEHXVHGLQZHWRUGU\XULQDOV(DFK WUDQVOXVFHQWVFUHHQLVSDFNDJHGZLWKJORYHVIRUVDIHDQG VDQLWDU\UHPRYDODQGSODFHPHQW

 ²&KHUU\%[ 'LVWULEXWLRQ)URP19

 ²)UXLW%VNW%[ 'LVWULEXWLRQ)URP19

 ²6XQEXUVW%[ 'LVWULEXWLRQ)URP19

 ²&LWUXV*UY%[ 'LVWULEXWLRQ)URP19

&OHDQVDQGGHRGRUL]HV1RQVWDLQLQJQRQ WR[LFELRGHJUDGDEOHEORFNZLWKH[FOXVLYH SDWHQWHG1R6SODVKGHVLJQ1RWWREHXVHG LQXULQDOVZLWKVWDQGLQJZDWHU

85,1$/6&5((1

5,0&$*(

&+(55<)5$*5$1&(

&+(55<)5$*5$1&(%/8(

 ²3DFN %ORFNLVHQFORVHGLQZDWHUVROXEOHZUDS&OHDQV DQGGHRGRUL]HVXSWRGD\V1DWXUDORGRU FRXQWHUDFWDQW6WURQJVXGVLQJDFWLRQDVVXUHV VDQLWDWLRQ%XLOWLQKRRNIRUHDV\UHPRYDO

 ²3DFN /DVWVXSWRGD\VDQGHDFKIOXVKOHDYHVEOXHFRORU %XLOWLQIRDPLQJDFWLRQILWVRYHUWKHULPRIPRVWWRLOHWV

&5&'867(5Œ $(5262/'8675(029$/6<67(0  ²R]$HURVRO 1RQIODPPDEOHQRQUHVLGXDO3RZHUIXOKLJKSUHVVXUHGXVWHU5HPRYHVVXUIDFHFRQWDPLQDQWVZLWKRXWGDPDJLQJVHQVLWLYHFRPSRQHQWV DQGVXUIDFHILQLVKHV5HPRYHVGXVWGLUWDQGOLQW'ULHVLQVWDQWO\VDIHRQSODVWLFVó´H[WHQVLRQWXEHLQFOXGHG $SSOLFDWLRQVSODQWPDFKLQHU\FRPSXWHUVRIILFHHTXLSPHQWHOHFWURQLFVDXGLRYLGHRFRPPXQLFDWLRQDQGSKRWRJUDSK\HTXLSPHQW OLJKWLQJZRUNEHQFKHVFLUFXLWERDUGVEUHDNHUSDQHOVFRQQHFWRUVGUDIWLQJWDEOHVDQGPRUH

12

&RS\ULJKW‹


Housekeeping

Housekeeping 63$5./(

%5,//,$1&(

67$,1/(6667((/&/($1(5

67$,1/(6667((/&/($1(5 32/,6+

 ²R]$HURVRO &OHDQVEULJKWHQVDQGSROLVKHVVWDLQOHVVVWHHO(TXDOO\ HIIHFWLYHRQDOXPLQXPFKURPHIRUPLFDSRUFHODLQDQG FHUDPLFWLOH1RQDEUDVLYH&UHDWHVDSURWHFWLYHFRDWLQJ WKDWSUHVHUYHVKLJKOXVWHU5HVLVWVZDWHUDQGUXVW $SSOLFDWLRQV*UHDVHJULPHRLOVWDLQVILQJHUSULQWV VPXGJHVDQGRLO\UHVLGXHV

 ²R]$HURVRO  ²[$HURVROV &OHDQVSROLVKHVDQGSURWHFWVLQRQHHDV\RSHUDWLRQ 3OHDVDQWOHPRQIUDJUDQFH&DQEHHTXDOO\HIIHFWLYHIRU XVHRQIRUPLFDSRUFHODLQDQGFHUDPLFWLOH5HPRYHV VPXGJHVVRLODQGVWDLQVTXLFNO\6KLHOGWKDWUHVLVWVZDWHU PDUNVDQGUXVWLQJ+LJKOXVWHU1RQDEUDVLYH

-$:6Š

6811<675($./(66

*/$66 +$5'685)$&(&/($1(5

*/$66 685)$&(&/($1(5

 ²IOR]&RQFHQWUDWH&DUWULGJH  ²[&DUWULGJHV  ²IOR]/DEHOHG%RWWOH  ²6WDUWHU3DFNSDFNRIFDUWULGJHV ODEHOHGERWWOHVSUD\HUKHDG  ²6SUD\HU+HDG 6DIHRQDQWLJODUHZLQGRZFRYHULQJVJODVVSODVWLF FRPSXWHUVFUHHQVDQGDOOWKHUPRSODVWLFV4XLFNO\FOHDQV DQGVKLQHVVXUIDFHV5HPRYHVVRLOVZLWKRXWVWUHDNLQJ

&RS\ULJKW‹

 ²R]$HURVRO  ²4XDUW  ²[4XDUWV  ²*DOORQ  ²[*DOORQV  ²*DOORQV  ²*DOORQV  ²*DOORQV 'LVWIURP&DOLIRUQLD

5HDG\WRXVHJODVVDQGDOOSXUSRVHVSUD\6SHFLDOO\ IRUPXODWHGZLWKDEDODQFHGEOHQGRIFOHDQLQJ DJHQWVWRTXLFNO\UHPRYHGLUWILQJHUSULQWVVRRWRLO DQGJUHDVHIURPZLQGRZVPLUURUVOLJKWIL[WXUHV FRXQWHUVDQGRWKHUKDUGVXUIDFHV

13


Housekeeping 675($.)5(( */$66&/($1(5

 ²4XDUW  ²[4XDUWV (IIHFWLYHO\FOHDQVDQGSROLVKHVDOOJODVVDOOSODVWLFFRPSXWHUVFUHHQVWLOHFKURPHIRUPLFDHQDPHODQGRWKHUKDUGVXUIDFWV:LOOQRWKDUP SDLQWHGVXUIDFHVDURXQGJODVV3UHYHQWVKD]HGJODVVDQGHIIHFWLYHO\UHPRYHVEXJVSHFNV

*/$66&/($1(5

5('6.<(

&21&(175$7('$0021,$)5(( */$66&/($1(5

$//685)$&(

 ²*DOORQ  ²[*DOORQV &XWVWKURXJKGLUWJULPHDQGSROOXWLRQILOPWRFOHDQ VXUIDFHVTXLFNO\DQGHDVLO\1RSUHPDWXUHGU\LQJRU VWUHDNLQJ(FRQRPLFDODWR]SHUJDOORQ8VHWRFOHDQ ZLQGRZVPLUURUVZLQGVKLHOGVDQGJODVVIL[WXUHV)UHVK IORUDOIUDJUDQFH

 ²4XDUW  ²[4XDUWV )RUFOHDQLQJNLWFKHQVEDWKURRPVKRXVHKROGVXUIDFHV IORRUVDQGZDOOV/RQJODVWLQJIUHVKIUDJUDQFH

3$56(/<3/86

3,1(2./((1

$//385326(&/($1(5

$//385326(&/($1(5

 ²R]%RWWOH  ²[%RWWOHV &OHDQVGHJUHDVHVDQGGHRGRUL]HVZLWKWKHQDWXUDOSRZHU RI3DUVOH\1RULQVHQHXWUDOS+FOHDQHULVVDIHDQG HIIHFWLYHRQDQ\ZDWHUVDIHVXUIDFH([FHOOHQWLQHYHU\ DUHDRIDNLWFKHQDQGEDWKURRPLQFOXGLQJJUDQLWHDQG PDUEOHVXUIDFHV0DGHZLWKRQO\VXVWDLQDEOHSODQW EDVHGLQJUHGLHQWV'RHVQRWFRQWDLQG\HVRUV\QWKHWLF SHUIXPHVJUH\ZDWHUDQGVHSWLFVDIH

 ²*DOORQ  ²[*DOORQV  ²*DOORQV *HQHUDOSXUSRVHSLQHFOHDQHUDQGGHRGRUL]HUIRUKDUG VXUIDFHV,GHDOIRUEDWKURRPVNLWFKHQVDQGIORRUV

,6,32/<(/,0,1$725 ,167$17'(2'(5,=(5 '5$,1/,1(0$,17$,1(5  ²4XDUW  ²[4XDUWV  ²*DOORQ  ²[*DOORQV  ²*DOORQV  ²*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP,/

 ²*DOORQV 'LVWULEXWLRQIURP,/

 ²*DOORQV 'LVWULEXWLRQIURP&$

9HUVDWLOHQDWXUDOEOHQGRIV\QHUJLVWLFHQ]\PHVDQGEDFWHULDOFXOWXUHVZKLFKEUHDNVGRZQRUJDQLFPDWWHUDQGHOLPLQDWHVWKHVRXUFHRI PRVWRGRUV+DVD)UHVK1HXWUDOIUDJUDQFH

14

&RS\ULJKWÂ&#x2039;


Housekeeping .:,.67(3 121$&,'5(675220&/($1(5  ²4XDUW  ²[4XDUWV 'LVLQIHFWDQWFOHDQHUIXQJLFLGHPLOGHZVWDWYLUXFLGH GHRGRUL]HU6DQLWL]HUIRUNLWFKHQVEDWKURRPVDQGKRXVHKROGQRQIRRGFRQWDFW VXUIDFHV)RUXVHRQZDVKDEOHQRQSRURXVVXUIDFHV

1$0 &21&(175$7('/,0(5(029(5  ²4XDUW  ²[4XDUWV  ²*DOORQ  ²[*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP&$

 ²*DOORQV 9HUVDWLOHHFRQRPLFDOPLOGDFLGOLPHUHPRYHU6SHFLDOO\IRUPXODWHGWRUHPRYHXQVLJKWO\EXLOGXSRIPLQHUDOGHSRVLWVDQGOLPHVFDOH &OHDQVGHVFDOHVDQGGHRGRUL]HV

'(/,0(51)

/,0(62/9

/,0(5(029(5

+($9<'87</,0( 58675(029(5

 ²*DOORQ  ²[*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP&$

 ²*DOORQV 'LVWULEXWLRQIURP,/

5HPRYHVOLPHVFDOHUXVWR[LGDWLRQKDUGZDWHUVWDLQV VRDSVFXPGHWHUJHQWUHVLGXHFRIIHHVWDLQVDQG PLONVWRQH)RUXVHLQGLVKPDFKLQHVZDUHZDVKPDFKLQHV VWHULOL]HUVVWHDPFOHDQHUVDQGLFHPDFKLQHV6DIHRQ JODVVDOXPLQXPVWDLQOHVVVWHHOFRSSHUEUDVVFKURPH SRUFHODLQSODVWLFDQGFHUDPLFVXUIDFHV&RPSDUHVWR=HS 3ULPH

 ²*DOORQ  ²[*DOORQV )RUPXODWHGWRUHPRYHKHDY\GHSRVLWVRIOLPHFDOFLXP XULQDU\VDOWVLURQFRQFUHWHUXVWDQGRWKHUPLQHUDO GHSRVLWV&RQWDLQVK\GURFKORULFDFLGDQGDFRUURVLRQ LQKLELWRU

9$1,6+

0$67(5%2:/

0,/'(:&/($1(5

5(675220&/($1(5

 ²4XDUW  ²[4XDUWV 0LOGHZ6WDLQ5HPRYHU5HPRYHVVRDSVFXPILOPDQG VFXPIURPWLOHZKLOHZKLWHQLQJJURXWLQJ

&RS\ULJKWÂ&#x2039;

 ²4XDUW  ²[4XDUWV  ²*DOORQ  ²[*DOORQV 7KLFNHQHGFOLQJLQJSKRVSKRULFDFLGEDVHGFOHDQHU ZLWKDVWURQJFKHUU\IUDJUDQFH&OLQJVWRYHUWLFDOVXUIDFHV

15


Housekeeping 85,1$/%5,*+7(1(5

)80()5((

 ²4XDUW  ²[4XDUWV 'LVVROYHVXULQDU\VDOWVPLQHUDOVFDOHDQGUXVWGHSRVLWV .HHSVXULQDOVIUHHIORZLQJ

/,48,''5$,1&/($1(5

&+$5*(

727$/

'5$,123(1(5 '(*5($6(5

%,2(1=<0$7,&%$7+5220&/($1(5

 ²4XDUW  ²[4XDUWV 1RQ)XPLQJQRQDFLGOLTXLGGUDLQRSHQHU:RUNV LQVWDQWO\WRGLVVROYHJUHDVHKDLUYHJHWDEOHDQGRWKHU RUJDQLFPDWWHULQGUDLQV

 ²R]$HURVRO 1DWXUDOFLWUXVEDVHGSURGXFWGHVLJQHGWRFOHDUFORJJHG GUDLQOLQHV4XLFNO\SHQHWUDWHVWRWKHVRXUFHRIFORJDQG LPPHGLDWHO\GLVVROYHVJUHDVHRLOVDQGVRDSV&RQWDLQV QRFDXVWLFRUDFLGVDQGHPLWVQRKDUPIXOYDSRUV'RHV QRWFRQWDLQFKORULQDWHGVROYHQWVRUSHWUROHXPGLVWLOODWHV :LOOQRWKDUPVHSWLFV\VWHPV5HXVDEOH´DWWDFKPHQW WXEHSHUPLWVTXLFNSHQHWUDWLRQGLUHFWO\WRWKHVRXUFHRI DFORJ

 ²R]$HURVRO  ²[$HURVROV )UHVKFOHDQVFHQW2QHVLQJOHSURGXFWWRFOHDQDQG GHRGRUL]HDOOEDWKURRPVXUIDFHV5HJXODUXVHKHOSV NHHSVXUIDFHVFOHDQDQGGUDLQOLQHVDQGWUDSVIUHH IORZLQJDQGRGRUIUHH)RUPXODWHGZLWKDVSHFLDOEOHQG RIHQ]\PHSURGXFLQJEDFWHULDZKLFKVDIHO\GLJHVWV RUJDQLFVWDLQVDQGRGRUV6SUD\VLQDQXSULJKWRU LQYHUWHGSRVLWLRQ

,6,29(1%5,7(

-867

 ²*DOORQ  ²[*DOORQV &RQFHQWUDWHGRYHQFOHDQHUIRUXVHLQDWULJJHUVSUD\HU1R VFUXEELQJQHFHVVDU\%DNHGRQJUHDVHDQGIRRGUHVLGXH ZLOOGLVVROYHDZD\

,6,)2$0*(/29(1*5,//  ²*DOORQ  ²[*DOORQV

+LJKO\FRQFHQWUDWHGYHVFRXVDONDOLQHFOHDQHUGHVLJQHG IRUIDVWDQGHIILFLHQWUHPRYDORIFDUERQL]HGRLOHQFUXVWHG JUHDVHDQGEXUQHGRQIRRGSDUWLFOHVIURPRYHQV JULOOVDQGGHHSIU\HUVZLWKRXWWKHQHHGIRUVFRXULQJRU VFUXEELQJ

16

29(1*5,//&/($1(5

 ²4XDUW 'LVWULEXWLRQIURP,OOLQRLV

 ²[4XDUWV 'LVWULEXWLRQIURP,OOLQRLV

6WURQJDONDOLQHRYHQDQGJULOOFOHDQHUZLWKSRZHUIXO GHJUHDVLQJDGGLWLYHV*UHDWIRURYHQVUDQJHWRSVGHHS IDWIU\HUVJULGGOHVH[KDXVWKRRGVWDEOHVDQGRWKHU VXUIDFHV1RWIRUVDOHLQ&DOLIRUQLD

683(5.29(1&/($1(5  ²*DOORQ 'LVWULEXWLRQIURP&DOLIRUQLD

 ²[*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

5HPRYHVJUHDVHEDNHGRQIRRGDQGFDUERQ(DVLO\ SHQHWUDWHVDQGGLVVROYHVIRUTXLFNFOHDQLQJ8VHRQ RYHQVUDQJHVKRRGVILOWHUVIORRUVJULOOVDQGRWKHU NLWFKHQHTXLSPHQW

&RS\ULJKWÂ&#x2039;


Housekeeping ,6,($6<&/($1  ²*DOORQ 'LVWULEXWLRQIURP1HYDGD

 ²[*DOORQV 'LVWULEXWLRQIURP1HYDGD

 ²*DOORQV 'LVWULEXWLRQIURP1HYDGD

$EDODQFHGEOHQGRIDONDOLVEXIIHUVGHIRDPHUVXUIDFWDQWDQGLQKLELWRUV*LYHVPD[LPXPFOHDQLQJDQGFRUURVLRQSURWHFWLRQDJDLQVWWLQ VWDLQOHVVVWHHODQGDOXPLQXPLQFRPPHUFLDODXWRPDWLFGLVKZDVKHUV

'(/8;( ',6+:$6+/,48,'  ²*DOORQ  ²[*DOORQV +LJKO\FRQFHQWUDWHGOLTXLGGHWHUJHQW)RUKDQGZDVKLQJ GLVKHVJODVVHVVLOYHUSRWVDQGSDQV(QULFKHGZLWK WKHVNLQFRQGLWLRQHU*O\FHULQ +HOSVVNLQUHWDLQQDWXUDO PRLVWXUH &RQWDLQVWKHDQWLVHSWLFLQJUHGLHQW0LOGRQ KDQGV([FHOOHQWJUHDVHGLVVROYLQJSRZHU&XWVWKURXJK IRRGUHVLGXHRLOVDQGIDWV0D[LPXPVXGVVWDELOLW\ 1RKDUPIXODONDOLHVRUDEUDVLYHV)UDJUDQFH3OHDVDQW OHPRQ

,6,6327)5((

 ²*DOORQV 6SRW)UHHLVDVSHFLDOEOHQGRIORZIRDPLQJVXUIDFWDQWV DQGZHWWLQJDJHQWVGHVLJQHGWRDLGLQWKHGU\LQJDQG ULQVLQJRIGLVKHVJODVVHVVLOYHZDUHHWF,WULQVHVVWUHDN IUHHDQGOHDYHVJODVVHVDQGRWKHULWHPVVSRWOHVV

<(//2:',6+62$3

 ²*DOORQ  ²[*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP,OOLQRLV

0DQXDOSRW SDQGHWHUJHQWIRUGLVKHVJODVVZDUH VLOYHUZDUHSRWVDQGSDQV

/$81'5<'(7(5*(17/,48,' :)$%5,&62)7(1(5  ²*DOORQ  ²[*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

8QLTXHODXQGU\SURGXFWWKDWSURYLGHVH[FHOOHQWFOHDQLQJ SRZHUDVZHOODVDIXOOVWUHQJWKIDEULFVRIWHQHU5HPRYHV WRXJKGLUWDQGVWDLQV/HDYHVFORWKLQJVRIWDQGVWDWLFIUHH 8VHVóFXSIRUQRUPDOORDG)ORUDOVFHQWHGDQGZKLWHQV DQGEULJKWHQVLQKRWZDUPDQGFROGZDWHU

2&($1%/8(

18%/8

/,48,'/$81'5<'(7(5*(17

/$81'5<'(7(5*(1732:'(5

 ²*DOORQ  ²[*DOORQV  ²*DOORQV 'LVWULEXWLRQIURP,OOLQRLV

/LTXLG/DXQGU\'HWHUJHQW&RQFHQWUDWHGIRUPXODFOHDQV EULJKWHQVDQGIUHVKHQVOLQHQVXQLIRUPVDQGWRZHOVLQ RQHHDV\VWHS(IIHFWLYHIRUVWDLQUHPRYDO

 ²OE +LJKSRZHUHGJUHDVHUHOHDVLQJIRUPXOD(IIHFWLYHRQ WRXJKJUHDV\LQGXVWULDODQGLQVWLWXWLRQDOVWDLQV&RQWUROOHG VXGVIRUHDV\ULQVLQJ&RQWDLQVRSWLFDOEULJKWHQHUV /HPRQVFHQWHG

&RS\ULJKWÂ&#x2039;

17


Housekeeping %*

)5(=(,7

&$53(767$,1 63275(029(5

&+(:,1**805(029(5

 ²R]$HURVRO  ²[$HURVROV 3RZHUIXOFDUSHWVWDLQDQGVSRWUHPRYHUWKDWDWWDFNVWRXJK GLUWLQNJUHDVHRLOPXGXULQHYRPLWFRIIHHDQGWHD VWDLQV'HVWUR\VRGRUVDQGLVVDIHIRUXVHRQPRVWIDEULFV

 ²R]$HURVRO )UHH]HVJXPFDQGOHZD[DQGRWKHUVWLFN\VXEVWDQFHV 4XLFNO\UHPRYHVWDFNLQHVVIURPGHSRVLWIRUHDV\ UHPRYDO $SSOLFDWLRQVFDUSHWXSKROVWHU\IXUQLWXUHVLGHZDONV ZDOOVIORRUVVWDLUFDVHVFKDLUVWDEOHV:RQ¶WKDUPRU VWDLQPRVWIDEULFRUSDLQWHGVXUIDFHV6SUD\GHSRVLWIRU VHFRQGVWKHQVFUDSHRIIGHSRVLW

.12&.,7287 67$,15(029(5

 ²4XDUW  ²[4XDUWV *HQHUDOSXUSRVHVWDLQUHPRYHU+LJKO\HIIHFWLYHVSRWWHUGHVLJQHGWRORRVHQDQGUHPRYHEDOOSRLQWSHQLQNVWDLQVPDUNHUVJUHDVHWDU  PRUH

,121(&$53(7&/($1(5

(;75$&7$//&21&(175$7(

08/7,385326(&$53(7&/($1(5

&21&(175$7('&$53(7(;75$&7,21 &/($1(5

 ²*DOORQ  ²[*DOORQV 6SRWWHUSUHVSUD\ERQQHWFOHDQHUDQGH[WUDFWLRQFOHDQHU DOOLQRQH$VDVSRWWHULWUHPRYHVWRXJKVRLOVVXFKDVIRRG SHWVWDLQVDQGHYHQGLUW\PRWRURLO$VDSUHVSUD\ERQQHW RUH[WUDFWLRQFOHDQHULWEULQJVWKHVHWRXJKVRLOVDZD\IURP WKHFDUSHWILEHUVZLWKRXWOHDYLQJDUHVLGXHWKDWFDQDWWUDFW VRLOV

 ²*DOORQ  ²[*DOORQV 'HVLJQHGWREHXVHGLQDOOFDUSHWVWHDPFOHDQLQJXQLWV DQGRUVRLOH[WUDFWRUXQLWV

75$)),&/$1(&/($1(5

1(875$/,=(55,16(

&$53(7$1'/$81'5<35(75($70(17

1(875$/,=,1*5,16()25$/.$/,1( &$53(7&/($1(56

 ²*DOORQ  ²[*DOORQV $LGVLQWKHFOHDQLQJRIKHDY\WUDIILFDUHDV)RUXVHLQ HQWUDQFHZD\VZHDULQIURQWRIFKDLUVVRIDVKDOOZD\V RUDQ\KHDY\WUDIILFFDUSHWDUHD&DQEHDGGHGWRFDUSHW VKDPSRRVRUH[WUDFWLRQFOHDQHUVDVDERRVWHUIRUKHDY\ GXW\FOHDQLQJ

18

 ²*DOORQ  ²[*DOORQV 0LOGDFLGVROXWLRQIRUPXODWHGWRQRWRQO\QHXWUDOL]HDONDOLQH UHVLGXHEXWWRDFWLYDWHVKDPSRRUHVLGXHVRWKHULQVLQJ SURFHVVLVPRUHFRPSOHWH/HDYHVFDUSHWVVRIWDQGEULJKW 6DIHRQVWDLQUHVLVWDQWFDUSHWV&OHDUZLWKDPLOGVFHQW

&RS\ULJKWÂ&#x2039;


Housekeeping 3527(&&$53(73527(&725

'()2$0(5

&$53(783+2/67(5<67$,13527(&725

$17,)2$0,1*&21&(175$7(

6$/7$:$<

1(875$/3+

,&(0(/7$,'

)/225&/($1(5 :HVW&RDVW 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQ  ²[*DOORQV $QDQWLVRLODQGDQWLVWDWLFSURGXFWGHVLJQHGWRSURWHFW FDUSHWDQGXSKROVWHU\+HOSVWRNHHSFDUSHWDQG XSKROVWHU\FOHDQHURYHUWKHORQJWHUPDQGPDNHVSHULRGLF FOHDQLQJHDVLHU:KHQDSSOLHGDIWHUVKDPSRRLQJRU FOHDQLQJ3UR7HFJUHDWO\UHGXFHVVRLOLQJDQGWKHVKRFNLQJ HIIHFWRIVWDWLFEXLOGXS

 ²*DOORQ  ²[*DOORQV ,QGXVWULDOVWUHQJWKULQVLQJFRPSRXQGWKDWKDVEHHQ GHYHORSHGVSHFLILFDOO\WRFXWWKURXJKWKHGXOOLQJZKLWH FKDON\UHVLGXHOHIWE\LFHPHOWLQJFKHPLFDOV6DOWUHVLGXH LVFKHPLFDOO\GLVVROYHGZLWKRXWKDUPLQJVHQVLWLYHSDLQWHG RUILQLVKHGVXUIDFHV

)/225),1,6+675,33(5

 ²*DOORQ  ²[*DOORQV 8VHWRUHPRYHIORRUZD[HVDFU\OLFVW\UHQHSRO\PHUVFR SRO\PHUVROLJLPHUVPHWDOFURVVOLQNHGILQLVKHVDVZHOODV DFU\OLFDQGZDWHUEDVHGXUHWKDQHVHDOHUV

 ²*DOORQ  ²[*DOORQ (OLPLQDWHVIRDPLQUHFRYHU\WDQNVRIKRWDQGFROGZDWHU H[WUDFWRUVDXWRPDWLFVKDPSRRLQJHTXLSPHQWDQG IORRUVFUXEEHUV8VHWRVWRSIRDPZKLFKPD\FDXVH LQWHUIHUHQFHRUHTXLSPHQWVKXWGRZQ&RVWHIIHFWLYHDQG XVHUIULHQGO\

 ²*DOORQ  ²[*DOORQV 5HPRYHVRLODQGGLUW\HWGRHVQRWFRQWDLQEXLOGHUVDQG ZDWHUVRIWHQHUVZKLFKZKHQGU\ZLOOOHDYHDZKLWHUHVLGXH WKDWFDQGXOOKLJKJORVVIORRUVXUIDFHV$QHXWUDOS+ SURGXFWWKDWZLOOQRWKDUPPRGHUQIORRUZD[HV&OHDQV ZLWKRXWVWULSSLQJKLJKJORVVILQLVKHV&XWVWKHWLPHDQG ODERUFRVWVRIHYHU\GD\IORRUPDLQWHQDQFH

+($9<'87<675,33(5 &2175$&725*5$'()/225675,33(5  ²*DOORQ  ²[*DOORQV &RQWUDFWRUJUDGHIRUPXODWLRQVWULSVKDUGWRUHPRYH ILQLVKHVDQGVHDOV(OLPLQDWHVRUJUHDWO\UHGXFHVPDFKLQH VFUXEELQJ3RZHUIXOHQRXJKWRUHPRYHPXOWLSOHOD\HUV EXLOGXSRUKLJKO\EXUQLVKHGILQLVK/RZIRDPIRUHDV\ DSSOLFDWLRQZLWKDXWRPDWLFVFUXEEHUV'HVLJQHGWRVWULS HTXDOO\ZHOOLQFROGRUZDUPZDWHU

1$12+,*+62/,')/225),1,6+

+,*+*/266)/225),1,6+

5(92/87,21$5<)/225),1,6+

'LVWULEXWLRQIURP,OOLQRLV1RWIRUVDOHLQ&DOLIRUQLD

 ²*DOORQ ²[*DOORQV  ²*DOORQV 1DQR]LQFFURVVOLQNLQJSURYLGHVVXSHULRU/D\GRZQ JORVV*ORVVEXLOG'XUDELOLW\0DUNUHVLVWDQFH6RLO UHVLVWDQFH'U\DQGUHFRDWWLPHV$PPRQLDIUHHIRU GUDPDWLFDOO\UHGXFHGRGRU,GHDOIRUOLPLWHGPDLQWHQDQFH SURJUDPV\HWUHVSRQGVWRGDLO\EXUQLVKLQJLIGHVLUHG /RZHPLVVLRQVIRUPXODPHHWV&DOLIRUQLD¶VQHZ92& 5HJXODWLRQ)DVWGU\LQJWRPLQXWHVXQGHUQRUPDO FRQGLWLRQV6OLSUHVLVWDQW8/&ODVVLILHG

&RS\ULJKWÂ&#x2039;

 ²*DOORQ  ²[*DOORQV 7KLVXQLTXHUHVLQEOHQGPDLQWDLQVLWVVKLQHIRUORQJHU SHULRGVLQFUHDVLQJWKHLQWHUYDOEHWZHHQEXUQLVKLQJ UHVXOWLQJLQORZHUODERUFRVWVSHUVTXDUHIRRW%XLOWLQ SULPHUXQGHUFRDW6HDOVDVLWILQLVKHV/HYHOVSHUIHFWO\RQ DOOVXUIDFHV:LOOQRWGLVFRORU7UDQVSDUHQWSURWHFWLRQ

19


Housekeeping /2:0$,17(1$1&(),1,6+ 5('8&('0$,17(1$1&()/225),1,6+

6&58%1¶6+,1( */2665(6725(50$,17$,1(5

 ²*DOORQ  ²[*DOORQV  ²*DOORQV ([WUHPHO\GXUDEOHDQGPDUNUHVLVWDQWILQLVKIRUORZ PDLQWHQDQFHDSSOLFDWLRQV+LJKJORVVDFU\OLFSRO\PHUV VWD\FOHDQFOHDUDQGVKLQ\WRUHGXFHPDLQWHQDQFH1RQ \HOORZLQJORZPDLQWHQDQFHIRUPXODRIIHUVVXSHUEEODFN PDUNDQGVFXIIUHVLVWDQFH,GHDOIRUUHGXFHGEXUQLVKLQJ SURJUDPV RQFHSHUZHHN 8VHRQYLQ\OWLOHUXEEHU OLQROHXPWHUUD]]RDQGTXDUU\WLOHIORRUV([FHOOHQWVHDO SURSHUWLHV

 ²*DOORQ  ²[*DOORQV 4XLFNO\VDWXUDWHVWUHDWHGVXUIDFHVEXWHYDSRUDWHVVORZO\ 3UHYHQWVVFDWWHULQJ8VHDVDGXVWFORWKWUHDWPHQWIRU VPDOOMREV/HDYHVVXUIDFHVFRPSOHWHO\IUHHRIGXVWOLQW DQGKDLU5HVWRUHVZRRGVXUIDFHVDQGOHDYHVDOOVXUIDFHV VKLQLQJ)RUPXODWHGWREHXVHGLQKRPHVKRWHOVPRWHOV LQGXVWULDOSODQWVKRVSLWDOVRIILFHVZDUHKRXVHVDQG LQVWLWXWLRQV7UHDWVGXVWPRSVFORWKVDQGVRIWEULVWOHSXVK EURRPV

'86702375($70(17

&+$03,21%$6(%2$5'675,3

$(5262/

 ²$HURVRO 'LVWULEXWLRQIURP1HYDGD

 ²[$HURVROV 'LVWULEXWLRQIURP1HYDGD

 ²R]$HURVRO  ²[$HURVROV 5HPRYHVHPEHGGHGVRLODQGUHSDLUVVFXIIVVFUDWFKHV DQGGXOOVSRWVZKLOHHOLPLQDWLQJSRZGHULQJ(FRQRPLFDO RXQFHGLOXWLRQGHVLJQHGIRUXVHWKURXJKDXWR VFUXEEHUV(OLPLQDWHVUHVWRUHUEXLOGXS²FRQWDLQVQR ZD[RUSRO\PHUV:RUNVDVDGHHSVFUXEFOHDQHUSULRU WRUHFRDWLQJDWR]SHUJDOORQ8VHRQDOOUHVLOLHQWVWRQH DQGZRRGIORRUVWKDWDUHSURSHUO\ILQLVKHG3OHDVDQWFLWUXV IUDJUDQFH6OLS5HVLVWDQW²0HHWV$670'

&+$03,2167$,1/(6667((/&/($1(5  ²$HURVRO 'LVWULEXWLRQIURP1HYDGD

 ²[$HURVROV 'LVWULEXWLRQIURP1HYDGD

2LOEDVHGVWDLQOHVVVWHHOFOHDQHU5HPRYHVVPXGJHV VRLORLODQGJUHDVHVWDQVZLWKPLQLPDOUXEELQJ)RUPV DSURWHFWLYHVKLHOGDJDLQVWVWDLQVZDWHUPDUNVDQGUXVW ZLWKRXWOHDYLQJDJUHDV\ILOP

)RDPLQJJHOEDVHERDUGDQGIORRUVWULSSHUZLWKJRRGFOLQJ DQGSHQHWUDWLRQ5HPRYHVROGZD[DFU\OLFVDQGGLUW 6SHFLILFDOO\GHVLJQHGIRUXVHLQVFKRROPXQLFLSDODQG JRYHUQPHQWELGV

,6/$1')5(6++$,5%2'<  ²*DOORQ  ²[*DOORQV  ²*DOORQV

+DLUDQG%RG\6KDPSRRLVDQH[FOXVLFHIRPXODWKDWPD\ EHXVHGWRJHQWO\FOHDQKDLUDQGERG\ZLWKDULFKWKLFN OX[XULRXVO\VFHQWHGODWKHU

(&266(17,$/ 'LVWULEXWLRQIURP1HYDGD

 ²&DVH%RG\:DVK  ²&DVH%RG\/RWLRQ  ²&DVH)DFLDO6RDS  ²&DVH%DWK6RDS  ²&DVH&RQGLWLRQHU6KDPSRR $QDPHQLWLHVSURJUDPIRUWKDWLVELRGHJUDGDEOHLQFOXGLQJWKHSDFNDJLQJ

20

&RS\ULJKWÂ&#x2039;


Housekeeping &'3

&'3

*/$66 685)$&(&/($1(5

*5((1635$<&/($1(5

 ²/LWHUV  ²[/LWHUV $OOVXUIDFHKHDY\GXW\FOHDQHUUHPRYHWRXJKJUHDVH JULPHVPXGJHVDQGGLUWZLWKRXWOHDYLQJDUHVLGXHRU EXLOGXS*UHDWIRUPLUURUVJODVVFKURPHVWDLQOHVVVWHHO DQGDOOZDVKDEOHVXUIDFHVVXFKDVDSSOLDQFHVFRQWHUWRSV DQGUHVWURRPVXUIDFHV8VHZLWKZDOOPRXQW GLVSHQVHU

 ²/LWHUV  ²[/LWHUV 7KLVSRZHUIXOVSUD\DQGZLSHFOHDQHUTXLFNO\FXWVWRXJK JUHDVHRLODQGJULPH*UHDWIRUFOHDQLQJFRXQWHUWRSV GLVSOD\VDSSOLDQFHV)RUPLFDIXUQLWXUHUHVWURRP VXUIDFHVSODVWLFPHWDODQGRWKHUKDUGVXUIDFHV'ULHVIDVW WRSUHYHQWVWUHDNLQJDQGUHVRLOLQJ8VHZLWKZDOO PRXQWGLVSHQVHU

&'3

&'3

'$,/<5(675220&/($1(5

5(6752206+2:(5&/($1(5

 ²/LWHUV  ²[/LWHUV 1RQDFLGIRUPXODLVVDIHIRUHYHU\GD\XVHRQDOOUHVWURRP VXUIDFHV5HPRYHVGLUWVRDSVFXPKDUGZDWHUGHSRVLWV DQGJUHDVH8VHZLWKZDOOPRXQWGLVSHQVHU

 ²/LWHUV  ²[/LWHUV 5HPRYHVPLQHUDOGHSRVLWVVRDSVFXPERG\RLOVXULF DFLGVDOWVDQGKHDY\VRLOV3HUIHFWIRUFOHDQLQJVKRZHU DQGUHVWURRPZDOOVWRLOHWVXULQDOVIORRUVDQGIL[WXUHV8VH ZLWKZDOOPRXQWGLVSHQVHU

&'3

&'3

32732855,2'25&2817(5

1(875$/)/225&/($1(5

 ²/LWHUV  ²[/LWHUV &RQWDLQVHVVHQWLDORLOVRGRUFRXQWHUDFWDQWVDQG SHQHWUDWLQJDJHQWVWRHOLPLQDWHVPRNHRGRUVIRUKRXUV 6SHFLDOPDORGRUFRXQWHUDFWDQWVVXUURXQGXQZDQWHG VPRNHPROHFXOHVFKDQJHVWKHLUVWUXFWXUHDQGUHSODFHV WKHPZLWKWKHFOHDQVFHQWRIFKHUU\8VHZLWK ZDOOPRXQWGLVSHQVHU

 ²/LWHUV  ²[/LWHUV 1RQIODPPDEOHQRQFRUURVLYHDQGSKRVSKDWHIUHH 'HVLJQHGIRUGDLO\FOHDQLQJRIILQLVKHGIORRUVZDOOV IXUQLWXUHFRXQWHUWRSVHWF3UHYHQWVUHGHSRVLWLRQ8VHZLWK ZDOOPRXQWGLVSHQVHU

&'3

&'3

$8726&58%%(5)/225

1(875$/*(50,&,'$/&/($1(5

 ²/LWHUV  ²[/LWHUV 5HPRYHVHPEHGGHGVRLODQGUHSDLUVVFXIIVVFUDWFKHV DQGGXOOVSRWVZKLOHHOLPLQDWLQJSRZGHULQJ(OLPLQDWHV UHVWRUHUEXLOGXS8VHRQDOOUHVLOLHQWVWRQHDQGZRRG IORRUVWKDWDUHSURSHUO\ILQLVKHG8VHZLWKZDOO PRXQWGLVSHQVHU

 ²/LWHUV  ²[/LWHUV 1HWXUDOS+GLVLQIHFWDQWZLOOQRWKDUPILQLVKHGIORRUV :LOOQRWOHDYHDILOPRUGXOOIORRUVOLNHKLJKHUDONDOLQH GLVLQIHFWDQWV,GHDOIRULQVWLWXWLRQDOHVWDEOLVKPHQWV VXFKDVKRVSLWDOVQXUVLQJKRPHVKRWHOVVFKRROVDQG XQLYHUVLWLHV8VHZLWKZDOOPRXQWGLVSHQVHU

&RS\ULJKWÂ&#x2039;

21


Housekeeping &'3

&'3

5(675220&/($1(5 ',6,1)(&7$17

*5((13(52;,'(&/($1(5

 ²/LWHUV  ²[/LWHUV 'LVLQIHFWVKDUGVXUIDFHV,GHDOIRULQVWLWXWLRQDO HVWDEOLVKPHQVWVVXFKDVKRVSLWDOVQXUVLQJKRPHVKRWHOV VFKRROVDQGXQLYHUVLWLHV&RQWUROVPROGDQGPLOGHZDQG GHRGRUL]HVJDUJDEHELQV8VHZLWKZDOOPRXQW GLVSHQVHU

 ²/LWHUV  ²[/LWHUV 3HUR[LGHFOHDQHUGHVLJQHGWRFOHDQJURXWIORRUVZDOOV FRXQWHUWRSVHTXLSPHQWDSSOLFDQFHVDQGRWKHUKDUG VXUIDFHV8VHWRGHVWDLQFDUSHWV&LWUXVIUDJUDQFH8VH ZLWKZDOOPRXQWGLVSHQVHU

&'3

&'3

602.(287'(2'25$17

)22'6(59,&(6$1,7,=(5

 ²/LWHUV  ²[/LWHUV &RQWDLQVHVVHQWLDORLOVRGRUFRXQWHUDFWDQWVDQG SHQHWUDWLQJDJHQWVWRHOLPLQDWHVPRNHRGRUVIRUKRXUV 6SHFLDOPDORGRUFRXQWHUDFWDQWVVXUURXQGXQZDQWHG VPRNHPROHFXOHVFKDQJHVWKHLUVWUXFWXUHDQGUHSODFHV WKHPZLWKWKHFOHDQVFHQWRIFKHUU\8VHZLWK ZDOOPRXQWGLVSHQVHU

 ²/LWHUV  ²[/LWHUV 3HUIHFWLQIRRGSUHSDUDWLRQVHWWLQJVVXFKDVVXSHUPDUNHWV GDLULHVVFKRROVKRVSLWDOVQXUVLQJKRPHVUHVWDXUDQWV DQGPHDQSRXOWU\KDQGOLQJRSHUDWLRQV'HVLJQHGIRUVSUD\ VDQLWL]LQJRULPPHUVLRQVDQLWL]LQJRSHUDWLRQVDQGIRUXVH RQIORRUVZDOOVHTXLSPHQWDQGKDUGVXUIDFHV8VHZLWK ZDOOPRXQWGLVSHQVHU

&'3

&'3

)22'6(59,&('(*5($6(5

&$53(7(1&$368/$725

 ²/LWHUV  ²[/LWHUV 4XLFNO\GLVVROYHVKHDY\JUHDVHIDWIRRGUHVLGXH DQGEORRGIURPZDOOVIORRUVFXWWLQJWDEOHVDQGIRRG SURFHVVLQJHTXLSPHQW)RUXVHLQPHDWURRPVGHOLVIRRG SURFHVVLQJSODQWVFRPPLVVDULHVDQGRWKHUIRRGKDQGOLQJ DUHDV8VHZLWKZDOOPRXQWGLVSHQVHU

 ²/LWHUV  ²[/LWHUV 8VHZLWKZDOOPRXQWGLVSHQVHU

&'3:$//02817',63(16(5

&'3%277/(:$//5$&.



22



&RS\ULJKWÂ&#x2039;


Hand Care

Hand Care 1$785$/728&+

+231¶&+(55<

+$1'&/($1(5

+$1'&/($1(5

 ²R]7XEH  ²3DFNRIR]7XEH  ²*DOORQ  ²[*DOORQV $OOQDWXUDOFLWUXVDQGVR\EHDQRLOVWKDWHIIHFWLYHUHPRYH JUHDVHRLOGLUWDQGKHDY\JULPHIURPKDQGVDQGVNLQ 'HVLJQHGZLWKDYHU\OLJKWDEUDVLYHWRGLJGHHSGRZQLQWR FUDFNVDQGFUHYLFHV\HWPLOGRQWKHVNLQ

 ²*DOORQ  ²[*DOORQV +DQGFOHDQHULVWKHXQDQLPRXVFKRLFHIRUPHFKDQLFV SULQWHUVSDLQWHUVIDFWRU\DQGLQGXVWULDOZRUNHUVUHSDLU DQGVHUYLFHSHUVRQQHO,WVHQKDQFHGFOHDQLQJSRZHU GLJVRXWWRXJKVRLOV7KHKHDY\GXW\GHWHUJHQWVFOHDQ WKRURXJKO\ZLWKRXWVROYHQWV)RULQGXVWULDODQGLQVWLWXWLRQDO XVHRQO\&RPSDUHVWR=HS&KHUU\%RPE

728*+-2%

728&+'2:1

+$1'&/($1(5

+$1'&/($1(5

 ²*DOORQ  ²[*DOORQV +HDY\GXW\LQGXVWULDOKDQGFOHDQHUZLWKVSHFLDOVFUXEELQJ SDUWLFOHVWRUHPRYHWKHKHDYLHVWJUHDVHDQGJULPH/HPRQ VFHQWHG&RPSDUHVWR=HS5HDFK

 ²*DOORQ  ²[*DOORQV 3UHPLXPKHDY\GXW\LQGXVWULDOKDQGFOHDQHU7RXJKRQ GLUWJHQWOHRQKDQGV&OHDQVVRIWHQVDQGFRQGLWLRQV &RQWDLQV3&0;DQWLVHSWLF

+20(581

&200(1'

+($9<'87<+$1'&/($1(5

*2/'$17,6(37,&+$1'&/($1(5

 ²*DOORQ  ²[*DOORQV +DQGFOHDQHUZLWKULFKODWKHUDQGWLQ\VFUXEEHUVWKDWGLJ GHHSDQGUHPRYHWRXJKVRLOVZLWKRXWLUULWDWLRQ

 ²*DOORQ  ²[*DOORQV *ROGYLVFRXVOLTXLGKDQGVRDSZLWKWKHDQWLEDFWHULDODJHQW 7ULFORVDQ)RUPXODWHGWRHIIHFWLYHO\UHPRYHVRLOVDQG LQKLELWEDFWHULD0LOGRQWKHKDQGV

&RS\ULJKWÂ&#x2039;

23


Hand Care '(/8;(() +$1'62$3  ²*DOORQ  ²3DFNRI*DOORQV 6DQLWL]LQJKDQGVRDSWKDWPHHWV86'$UHTXLUHPHQWVIRU XVHLQIHGHUDOO\LQVSHFWHGPHDWDQGSRXOWU\SURFHVVLQJ SODQWV7KLVKDQGVRDSLVUHFRPPHQGHGIRUXVHLQIRRG SURFHVVLQJSODQWVDQGUHVWDXUDQWVIRUSHUVRQQHOSULRUWR KDQGOLQJIRRGDQGRUSURFHVVLQJHTXLSPHQW

3,1.2)),&(+$1'62$3

 ²*DOORQ  ²[*DOORQV 5HDG\WRXVHOLTXLGKDQGFOHDQHU/HDYHVKDQGVFOHDQ VRIWDQGVPRRWK&UHDWHVDULFKODWKHUWRIORDWVRLOVDZD\ 3OHDVDQWIORUDOERXTXHWVFHQW&RQYHQLHQWSRXUJDOORQ

,6,+$1'62$3',63(16(56

:25;

 ²)*/LTXLG+DQG6RDS'LVSHQVHU )RUXVHZLWKIODWWRSJDOORQFRQWDLQHUV

+$1'&/($1(5

32:(5&/($1

)2$0$1$725

32:'(5+$1'62$3

,167$17+$1'6$1,7,=(5

 ²OE6KDNHU  ²OE +HDY\GXW\OHPRQSRZGHUHGKDQGFOHDQHU$OLJKWODWKHU DOORZV\RXWRVHHWKHGLUWJUHDVHDQGJULPHPHOWRII\RXU KDQGV

 ²R]%RWWOH  ²[%RWWOHVR]  ²PO%RWWOH  ²[%RWWOHVPO .LOOVRIWKHPRVWFRPPRQJHUPVEDFWHULDYLUXVHV \HDVWDQGPROGWKDWFDXVHLOOQHVV:RUNVLQDVOLWWOHDV VHFRQGV1RVRDSZDWHURUWRZHOVUHTXLUHG/HDYHVKDQGV FOHDQHUKHDOWKLHUDQGVRIWHUZLWKUHSHDWHGXVH&RQWDLQV QRDOFRKRORU7ULFORVDQ

 ²R]6KDNHU  ²OE6KDNHU ²OE&RQWDLQHU  ²:KLWH+RPH'LVSHQVHU (QYLURQPHQWDOO\FHUWL¿HGE\(FRORJRRI&DQDGDDQG *UHHQ6HDOLQWKH8QLWHG6WDWHV6LPSO\ZHWKDQGVDSSO\ :25;ŠSRZGHUVFUXEKDQGVDQGULQVH&RVWHIIHFWLYH 'RHVQRWFORJGUDLQVRUVHSDUDWH)RUPXODWHGWRPDWFKWKH S+RIVNLQOHDYLQJWKHQDWXUDORLOVLQWDFW'RHVQRWFRQWDLQ FKORULQDWHGVROYHQWVERUD[SXPLFHVDQGSKRVSKDWHVR]RQH GHSOHWLQJFRPSRXQGVRURWKHUVNLQVHQVLWL]LQJVROYHQWV

%$55,&$'( +$1'&5($0  ²R]$HURVRO $HURVROKDQGSURWHFWLRQFUHDP3URWHFWVIURPLUULWDQWVVXFKDVLQNVVDOWVDFLGVFRUURVLYHDONDOLVLQGXVWULDOJULPHJUHDVHVROYHQWV SDLQWUHVLQVWDUDQGPXFKPRUH0DNHVFOHDQXSWLPHIDVWHU&RQWDLQVODQROLQ:DVKHVRIIZLWKVRDSDQGZDWHU$SSOLFDWLRQVLQGXVWULDO SODQWVSULQWLQJSODQWVFKHPLFDOSODQWVZDUHKRXVHSHUVRQQHOFRQVWUXFWLRQZRUNHUVKHDY\PDFKLQHU\RSHUDWRUVDQGLQSODFHVLQZKLFK KHDY\RQKDQGRSHUDWLRQVWDNHSODFH

24

&RS\ULJKW‹


Hand Care '(%$(52%/8(62$3

'(%$(52526(62$3

)2$0,1*+$1'$1'%2'<6+$0322

/8;85,286)2$0,1*+$1'62$3

 ²/LWHU  ²[/LWHUV *HQHUDOSXUSRVHKDQGDQGERG\VKDPSRRZLWKVLON\ VPRRWKDIWHUIHHO*UHHQ6HDOŒ&HUWLILHG +LJKO\HFRQRPLFDODQGHIIHFWLYHUHTXLUHVQRZDWHUWR ODWKHU)RDPVLQVWDQWO\DQGULQVHVHDVLO\IURPWKHVNLQ OHDYLQJQRVRDS\UHVLGXH&RQWDLQVFRQGLWLRQHUVWR LPSURYHK\GUDWLRQDQGSUHYHQWGU\VNLQ&RORU%OXH 'LVSHQVHUV 

 ²/LWHU  ²[/LWHUV /X[XULRXVKDQGZDVKZLWKVLON\VPRRWKDIWHUIHHO*UHHQ 6HDOŒ&HUWLILHG+LJKO\HFRQRPLFDODQGHIIHFWLYHUHTXLUHV QRZDWHUWRODWKHU)RDPVLQVWDQWO\DQGULQVHVHDVLO\IURP WKHVNLQOHDYLQJQRVRDS\UHVLGXH&RQWDLQVFRQGLWLRQHUV WRLPSURYHK\GUDWLRQDQGSUHYHQWGU\VNLQ&RORU5HG 'LVSHQVHUV

'(%$(52*5((162$3

'(%$(52&/($16(62$3

$17,%$&7(5,$/)2$0,1*+$1'62$3

)2$0,1*6.,1&/($16(5

 ²/LWHU  ²[/LWHUV $QWLEDFWHULDOIRUPXODFRQWDLQLQJ7ULFORVDQDQGDGGHG PRLVWXUL]HUV(OLPLQDWHVRIJHUPVDQGEDFWHULD +LJKO\HFRQRPLFDODQGHIIHFWLYHUHTXLUHVQRZDWHUWR ODWKHU5LQVHVHDVLO\IURPWKHVNLQOHDYLQJQRVRDS\ UHVLGXH&RQWDLQVFRQGLWLRQHUVWRLPSURYHK\GUDWLRQDQG SUHYHQWGU\VNLQ &RORU*UHHQ 'LVSHQVHUV 

 ²/LWHU  ²[/LWHUV 6XSHULRUDQWLEDFWHULDOFOHDQVHUGHVLJQHGIRUKLJKHVW OHYHORIK\JLHQH%LRGHJUDGDEOH2QO\DVPDOODPRXQWLV UHTXLUHGIRUHIIHFWLYHFOHDQLQJ5LQVHVHDVLO\IURPWKHVNLQ OHDYLQJQRVRDS\UHVLGXH&RORUOHVVDQGIUDJUDQFHIUHH 'LVSHQVHUV 

'(%$(52,462$3

'(%,167$17)2$06$1,7,=(5

$17,%$&7(5,$/48$7)2$0,1* +$1'62$3

121$/&2+2/)2$0,1*,167$17 +$1'6$1,7,=(5

'(%8/75$*5((1*(/

'(%$48$5(66+$1'$1'%2'<62$3

$17,%$&7(5,$/*(/

+$1'$1'%2'<6+$0322

 ±/LWHU  ±[/LWHUV 3OHDVDQWO\VFHQWHGIRUPXODSURYLGLQJDQWLEDFWHULDODFWLRQ &RQWDLQV7ULFORVDQDQG&KORUR[\OHQROWRILJKWEDFWHULDO JURZWK5LQVHVHDVLO\IURPWKHVNLQOHDYLQJQRVRDS\ UHVLGXH$QRQLUULWDWLQJQRQDEUDVLYHPLOGJHOVRDS &RORU*UHHQ 'LVSHQVHUV 

 ±/LWHU  ±[/LWHUV /LJKWKDQGDQGERG\VKDPSRRZLWKDVLON\VPRRWKDIWHU IHHO$QDWXUDOELRGHJUDGDEOHVRDSZLWKDOLJKWIUDJUDQFH &RQWDLQVH[WUDHPROOLHQWVIRUVNLQFRQGLWLRQLQJ5LQVHV HDVLO\IURPWKHVNLQOHDYLQJQRVRDS\UHVLGXH &RORU%OXH 'LVSHQVHUV 

 ²/LWHU  ²[/LWHUV 4XDWIRUPXODSURYLGLQJWKHKLJKHVWOHYHORISURWHFWLRQIURP FURVVFRQWDPLQDWLRQ(UDWHGIRDPLQJKDQGVRDSIRU IRRGKDQGOLQJLQGXVWU\+LJKO\HFRQRPLFDODQGHIIHFWLYH ,QVWDQWIRDPLQJDQGTXLFNULQVLQJ2GRUOHVV&RORUOHVV ELRGHJUDGDEOHIRDPLQJKDQGVRDS 'LVSHQVHUV 

&RS\ULJKW‹

 ²/LWHU  ²[/LWHUV 2QHVWHSKDQGVDQLWL]HUWKDWLVDOFRKROIUHHDQGPLOGRQ WKHVNLQHIIHFWLYHDJDLQVWFRPPRQJHUPVDQG EDFWHULD%LRGHJUDGDEOHDQGKLJKO\HFRQRPLFDO)RDPV LQVWDQWO\QRZDWHUQHFHVVDU\&RQWDLQVFRQGLWLRQHUVWR LPSURYHK\GUDWLRQDQGSUHYHQWGU\VNLQ&RORU3XUSOH 'LVSHQVHUV 

25


Hand Care '(%3,1.62$3

'(%,167$17)2$01$

 ²/LWHU  ²[/LWHUV /X[XU\ORWLRQVRDSIRUDOOSXUSRVHXVH (QKDQFHGZLWK/DQROLQOHDYLQJVNLQUHIUHVKHGDQG FRQGLWLRQHG6LON\VPRRWKDIWHUIHHODQGDQDWXUDOIUHVK IUDJUDQFH5LQVHVHDVLO\IURPWKHVNLQOHDYLQJQRVRDS\ UHVLGXH &RORU3LQN 'LVSHQVHUV 

 ±/LWHU  ±[/LWHUV HIIHFWLYHDJDLQVWFRPPRQJHUPVDQGEDFWHULD %LRGHJUDGDEOHDQGKLJKO\HFRQRPLFDO)RDPVLQVWDQWO\QR ZDWHUQHFHVVDU\,GHDOIRUIRRGVHUYLFHDQGIRRGKDQGOLQJ HQYLURQPHQWV&RORUOHVV 'LVSHQVHUV 

'(%$17,%$&7(5,$/)2$0

'(%,167$17)2$0$/&2+2/

728&+)5(($17,%$&7(5,$/ )2$0:$6+

728&+)5(($/&2+2/)2$0 6$1,7,=(5

/8;85</27,2162$3

121$/&2+2/)2$0,1*+$1'6$1,7,=(5

 ²P/  ²3DFN HIIHFWLYHDJDLQVWFRPPRQJHUPVDQGEDFWHULD 8VHVVNLQFRQGLWLRQHUVWRLPSURYHK\GUDWLRQ3OHDVDQWO\ SHUIXPHGZLWKPLOGIUDJUDQFH6XLWDEOHIRUXVHLQJHQHUDO LQGXVWU\VFKRROVDQGRIILFHZDVKURRPDUHDV*UHHQ%OXH

 ²P/  ²3DFN 16)(UDWHGIRUKDQGVDQLWL]LQJHIIHFWLYH DJDLQVWFRPPRQJHUPVDQGEDFWHULD3HUIXPHIUHHDQG G\HIUHH,GHDOIRUIRRGPDQXIDFWXULQJIRRGVHUYLFHDQG KHDOWKFDUH&RORUOHVV

'(%$=85()2$07)

'(%&859('',63(16(5

728&+)5((0,/')2$062$3

 ²/LWHU:KLWH  ²/LWHU%ODFN +\JLHQLFHQFRXUDJHVFRUUHFWVNLQVDIHW\SUDFWLFH &RQYHQLHQWDQGHFRQRPLFDO*XDUDQWHHGIRUOLIH)LWV '(%+DQG6RDSV  

 ²P/  ²3DFN +LJKTXDOLW\TXLFNULQVLQJIRDP/HDYHVVNLQIHHOLQJVLON\ VPRRWKZLWKQRUHVLGXH)RUJHQHUDOXVHLQDQ\ZDVKURRP DUHD,GHDOIRUVFKRROVRIILFHVDQGSXEOLFIDFLOLWLHV%OXH

'(%)2$0,1*',63(16(5  ²/LWHU:KLWH  ²/LWHU%ODFN +\JLHQLFHQFRXUDJHVFRUUHFWVNLQVDIHW\SUDFWLFH&RQYHQLHQWDQGHFRQRPLFDO*XDUDQWHHGIRUOLIH)LWV'HE6%6+DQG6RDSV 

26

&RS\ULJKWÂ&#x2039;


Lubricants

Lubricants '5<*5$3+,7(/8%5,&$17

'5<5(/($6(7()/21Š

$1'3$57,1*&203281'

/8%5,&$17 5(/($6($*(17

 ²R]$HURVRO 8VHGIRUH[WUHPHOXEULFDWLRQUHTXLUHPHQWV6XSHU VOLSSHU\ZLWKORQJODVWLQJSURWHFWLYHILOP&OHDQGU\ QRQRLO\DQGQRQVWDLQLQJ&DQEHXVHGZKHUHSHWUROHXP SURGXFWVDUHDYRLGHG7HPSHUDWXUH5DQJHƒ)WR ƒ)

 ²R]$HURVRO  ²[$HURVROV +LJK7HFK7HIORQŠGU\OXEHDHURVRO0RUHVOLSSHU\WKDQ VLOLFRQHJUDSKLWHRURLO([FHOOHQWIRUUHGXFLQJORZ VSHHGIULFWLRQ)DVW'U\LQJ 1RQ6WDLQLQJ 2GRUOHVV 1RQRLO\JUHDVHOHVVFKHPLFDOO\LQHUW1RFKORULQDWHG VROYHQWV+HDWVWDEOHIURPƒ)WRƒ)1RQ &RQGXFWLYHZKHQGU\

+86.(<+96

635$<21+,*+3(5)250$1&(/8%(

2=78%(6

:(7/8%5,&$17:,7+37)(

 ²R]7XEH 'LVWULEXWLRQ)URP&DOLIRUQLD

1RQKDUGHQLQJDQGQRQFDUERQL]LQJVLOLFRQHOXEULFDQW ZLWKH[FHOOHQWGLHOHFWULFSURSHUWLHVSOXVERWKSK\VLFDODQG WKHUPDOVWDELOLW\+96LVLQVROXEOHLQZDWHUPHWKDQRO HWKDQROGLOXWHDFLGVDQGFDXVWLFVYHJHWDEOHDQGPLQHUDO RLOVJO\FROVDQGJO\FHULQH$16)86'$+5HJLVWHUG DSSURYDOSHUPLWVWKHXVHLQDSSOLFDWLRQVZKHUHWKHUH PD\EHLQFLGHQWDOIRRGFRQWDFWRUIRUXVHLQSRWDEOHZDWHU V\VWHPV

 ²R]$HURVRO  ²[$HURVROV 'LVSODFHVPRLVWXUHOXEULFDWHVDQGSURYLGHVDSURWHFWLYH ILOP'LVVROYHVUXVWJUHDVHDQGGLUW+HOSVJXDUGDJDLQVW KXPLGLW\DQGFRUURVLRQ7HPSHUDWXUHUDQJHž)WR ž)'LHOHFWULFVWUHQJWKYROWV+LJKIODVKSRLQW ž)

&RS\ULJKW‹

27


Lubricants 635$<217+(3527(&725Œ

&5&)22'*5$'(0$&+,1(2,/

$//385326(/8%5,&$17

 ²R]$HURVRO )RUXVHRQIRRGSURFHVVLQJHTXLSPHQW3HQHWUDWHVWR ORRVHQUXVWVFDOHGLUWDQGFRUURVLRQ+LJKIODVKSRLQW SURYLGHVVDIHW\IRUXVHU6LOLFRQHIUHHHDVLHUFOHDQXS DQGUHPRYDORIH[FHVVRLOƒ6SUD\$Q\:D\9DOYH &RORUOHVVRGRUOHVVQRQGU\LQJRLO\ZHWILOP

 ²R]$HURVRO  ²[$HURVROV 'LVSODFHVPRLVWXUHOXEULFDWHVDQGSURYLGHVDQGXOWUDWKLQ ILOPRISURWHFWLRQRQGHOLFDWHFRQWDFWVDQGFRQQHFWRUV 3HQHWUDWHVDQGSUHYHQWVUXVW&RQWDLQVQRVLOLFRQH6SUD\ $Q\:D\9DOYH:LGHWHPSHUDWXUHUDQJHž)WRž) 'LHOHFWULFVWUHQJWKYROWV )ODVKSRLQWž)

)*0,1(5$/2,/

67$/8%(Š)22'*5$'(

)22'6$)(

08/7,385326( + *5($6(

 ²*DOORQ  ²[*DOORQV /XEULFDQWUHOHDVHDJHQWDQGDQWLUXVWILOPIRUHTXLSPHQW DQGPDFKLQHSDUWV)RUXVHLQDUHDVZKLFKWKHUHLV H[SRVXUHRIWKHOXEULFDQWWRHGLEOHSURGXFWV1RQWR[LF RGRUOHVVDQGWDVWHOHVV$XWKRUL]HGE\WKH86'$IRUXVH LQIHGHUDOO\LQVSHFWHGPHDWDQGSRXOWU\SODQWV8VHV VOLGHVEHDULQJVSLVWRQVULQJVVHDOVDQGEHOWV

 ²R]&DQ 3UHPLXP)RRG*UDGH*UHDVH+LJK7HPS0XOWL3XUSRVH ([FHOOHQWDQWLZHDUSURSHUWLHV+LJKUHVLVWDQFHWRZDWHU DWWDFNKHDY\ORDGVDQGVKRFNORDGV5XVW R[LGDWLRQ DGGLWLYHVDVVXUHORQJOLIHOXEULFDWLRQ6PRRWKEXWWHU\ WH[WXUH $SSOLFDWLRQVKLJKWHPSHUDWXUHDSSOLFDWLRQVEDOO UROOHU EHDULQJVVOLGHEHDULQJVMRXUQDOEHDULQJV

&5&:+,7(/,7+,80*5($6(

67$/8%(Š67$3/(;

 ²R]$HURVRO 3URYLGHVVXSHULRUOXEULFDWLRQDQGGXUDELOLW\LQDQ\ZHDWKHU DQGPRVWWHPSHUDWXUHV9HUVDWLOHGHVLJQHGIRUOLJKW GXW\DSSOLFDWLRQVUHTXLULQJDORQJJUHDVHOLIH&RQWDLQV R[LGDWLRQLQKLELWRUVFRXQWHUVFRUURVLRQSURWHFWVZLWK DWRXJKKLJKYLVFRVLW\ILOP([FHOOHQWEUHDNLQOXEHIRU EHDULQJVQRQFRQGXFWLYH5HFRPPHQGHGDSSOLFDWLRQV KLQJHVODWFKHVRYHUKHDGGRRUWUDFNVRSHQJHDUVDQG FDEOHVFKDLQVVOLGHFRQYH\RUVJXLGHUDLOVFDPVSLVWRQV PDFKLQHVWRROVDQGHTXLSPHQW

(;75(0(35(6685(35(0,805('*5($6(

*($5/8%(()

$1&+25/8%(

23(1*($5/8%5,&$17

&877,1*)/8,'

²R]$HURVRO +LJKO\YLVFRXVVROLGILOPJHDUOXEH7KLFNEODFN WDFN\OXEULFDQWVWD\VRQJHDUV([FHOOHQWµVWUHWFKLQJ¶ FKDUDFWHULVWLFV±OXEULFDWHVDOOVXUIDFHV5HSHOVZDWHU± SURWHFWVDJDLQVWUXVW FRUURVLRQ+HDY\6HUYLFH7HPS 5DQJH WRƒ)5HGXFHVQRLVH SURWHFWVDJDLQVW H[WUHPHORDGV([WHQGVOLIHRIPDFKLQHU\±UHGXFHV GRZQWLPH PDLQWHQDQFH1RFKORULQDWHGRUIOXRULQDWHG VROYHQWV

 ²R]  ²R]  ²*DOORQ 6SHFLDOO\GHVLJQHGIRUSUREOHPPHWDOZRUNLQJMREV,WLV WKHEHVWSURGXFWDYDLODEOHIRUVWDLQOHVVKLJKFDUERQKLJK FKURPHFDVHLURQHWF&DQEHXVHGIRUGULOOLQJWDSSLQJ VDZLQJVSRWIDFLQJFRXQWHUERULQJPLOOLQJIO\FXWWLQJ VHDWIRUPLQJHQJUDYLQJEURDFKLQJGUDZLQJSLHUFLQJ SXQFKLQJKROHH[WUXGLQJDQGPDQ\PRUHDSSOLFDWLRQV $QFKRUOXEHPD\DOVRPHXVHGRQQRQIHUURXVPHWDOV VXFKDVEUDVVDQGDOXPLQXP

28

 ²R]&DQ 6XSHULRUPXOWLSXUSRVHFHUWLILHGOLWKLXPFRPSOH[EDVHG 1/*,JUHDVH&RQWDLQVH[WUHPHSUHVVXUHDQWLZHDU DQWLR[LGDWLRQDGGLWLYHV,GHDOIRUKLJKWHPSHUDWXUH  SHUIRUPDQFHDSSOLFDWLRQV $SSOLFDWLRQV0LQLQJPHWDOSURGXFWLRQPDFKLQLQJ SODVWLFPROGLQJSXPSVHOHFWULFPRWRUVEDOO UROOHU EHDULQJVNLOQVDVVHPEO\SODQWVGU\LQJRYHQVWUXFNV DXWRPRELOHVFRQVWUXFWLRQHTXLSPHQWZDWHUSXPSV

&RS\ULJKW‹


Automotive

Automotive ,6,),5(%$//

,6,),5(%$//3/86

758&. 75$,/(5:$6+

&21&(175$7('758&. 75$,/(5:$6+

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV  ²*DOORQV 6XSHUFRQFHQWUDWHGSUHPLXPPHGLXPWRKLJKIRDPLQJ FRQFHQWUDWHGWUXFNDQGWUDLOHUZDVKWKDWLVVSHFLDOO\ IRUPXODWHGWRUHPRYHEXJVURDGILOPDQGH[KDXVW GHSRVLWV([FHOOHQWIRUXVHRQPDVVWUDQVLWHTXLSPHQW WUDLOHUVWUXFNVDQGIOHHWV

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

+HDY\FRQFHQWUDWHGH[FHSWLRQDOPHGLXPWRKLJKIRDPLQJ OLTXLGWUXFNDQGWUDLOHUZDVKFRQFHQWUDWHWKDWLVVSHFLDOO\ GHVLJQHGIRUXVHWKURXJKKRWRUFROGKLJKSUHVVXUH ZDVKLQJHTXLSPHQW,GHDOIRUFOHDQLQJEXJVURDGILOPDQG H[KDXVWGHSRVLWVWKDWKDYHDFFXPXODWHGRQWUDFWRUWUDLOHU IOHHWYHKLFOH

./((1$:$<

$&,'758&.:$6+

',(6(/ 602.(:$6+

 ²*DOORQV 'LVWULEXWLRQIURP,OOLQRLV

 ²*DOORQV 'LVWULEXWLRQIURP,OOLQRLV

&OHDQVEULJKWHQVUHPRYHVR[LGDWLRQDQGFRUURVLRQIURP DOXPLQXP)RUXVHRQEXVHVDOXPLQXPWUDLOHUVDQGRWKHU W\SHVRIWUDQVSRUWDWLRQHTXLSPHQW

 ²*DOORQ 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

6XSHULRUGHWHUJHQF\WKDWLVVSHFLILFDOO\IRUPXODWHGWR SURYLGHHDV\UHPRYDORIGLHVHOVPRNHURDGILOPDQGRLO\ GLUWIURPWUDLOHUVWUDFWRUVEXVHVORFRPRWLYHVHWF,WLV DPEHULQFRORUDQGKDVDDONDOLQHRGRU.OHHQDZD\LV QRQVWUHDNLQJDQGKLJKO\FRQFHQWUDWHG,WKDVDQHIIHFWLYH GLOXWLRQUDWLRQRIXSWRSDUWVZDWHUWRRQHSDUWSURGXFW

&RS\ULJKWÂ&#x2039;

29


Automotive $//:$7(563275(029(5

$/80,1$7(

$&,'&/($1(5

$/80,180%5,*+7(1(5 .(0/,7( :$//&/($1(5

 ²*DOORQ 'LVWULEXWLRQIURP&$ 19

(DVLO\UHPRYHVZDWHUVSRWVOHIWEHKLQGIURPKDUGZDWHU IURPVSULQNOHUV\VWHPVRUQRWGU\LQJWKHFDUIDVWHQRXJK DIWHUZDVKLQJLW([FHOOHQWIRUXVHRQSDLQWDQGJODVV6DIH IRUDOOVXUIDFHVZKHQXVHGDVGLUHFWHG

 ²*DOORQ  ²[*DOORQV  ²*DOORQV 6XSHUFRQFHQWUDWHGOLTXLGDOXPLQXPDQGVWDLQOHVVVWHHO FOHDQHU%ULJKWHQVDQGFRQGLWLRQVVDWLQILQLVKHVRQRYHU WKHURDGWUXFNVDQGWUDLOHUV

$//)$//287

:$6+ :$;

/,48,'$&,'&/($1(5 'LVWULEXWLRQIURP&DOLIRUQLD

21(67(3&$5:$6+

 ²*DOORQ  ²[*DOORQV  ²*DOORQV $FLGLFFOHDQHUWKDWUHPRYHVIDOORXWDQGUXVWHGGHDGSDLQW TXLFNO\DQGHDVLO\

 ²*DOORQ 'LVWULEXWLRQIURP&$ 19

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP,OOLQRLV

 ²*DOORQV 'LVWULEXWLRQIURP,OOLQRLV

/LTXLGFRQFHQWUDWHIRURQHVWHSZDVKLQJDQGZD[LQJ 3URGXFHVULFKKLJKVXGVIRUH[WUDFOHDQLQJSRZHU /HDYHVDQDWWUDFWLYHSURWHFWLYHUHDOZD[FRDWLQJ:DWHU ³EHDGVXS´WRSUHYHQWZDWHUVSRWWLQJ3UHYHQWVR[LGDWLRQ

6+2:1Âś*2Â&#x152;:$6+1Âś:$;

6+2:1Âś*2Â&#x152;(;7(5,25'5(66,1*

(;7(5,25&$5:$6+$1':$;

9,1</ 58%%(5685)$&('5(66,1*

 

 

²4XDUW R]

²*DOORQ R]

â&#x20AC;˘ Dilute 30:1 for easy high performance high suds car wash â&#x20AC;˘ Leaves a high gloss shine â&#x20AC;˘ Non-caustic formula safe on paint even if allowed to dry on â&#x20AC;˘ Great for detail shops and premium hand washes â&#x20AC;˘ Great for automated car wash proportioner systems â&#x20AC;˘ Color: Pink â&#x20AC;˘ Fragrance: Fruity

²4XDUW R]

²*DOORQ R]

â&#x20AC;˘ Exterior tires and trim â&#x20AC;˘ Simply spray or wipe onto surface â&#x20AC;˘ Beautifies and protects exterior rubber and vinyl surfaces â&#x20AC;˘ Soaks in and slowly dries providing even coverage â&#x20AC;˘ Medium gloss non-greasy finish that does not attract dust â&#x20AC;˘ Color: Blue â&#x20AC;˘ Fragrance: Grape

6+2:1Âś*2Â&#x152;:+((/&/($1(5

6+2:1Âś*2Â&#x152;'(*5($6(5

/2:+$=$5':+((/&/($1(5*(/

$//385326('(*5($6(5

 

 

²4XDUW R]

²*DOORQ R]

â&#x20AC;˘ Heavy-duty formula will handle the toughest road grime and brake dust soils â&#x20AC;˘ Simple RTU spray and rinse formula â&#x20AC;˘ Scrubbing usually not required â&#x20AC;˘ Thickened formula will cling to vertical surfaces â&#x20AC;˘ Safer for surfaces and personnel â&#x20AC;˘ Color: Green â&#x20AC;˘ Fragrance: Fresh

30

²4XDUW R]

²*DOORQ R]

â&#x20AC;˘ Ready to use for heavy soils or dilute up to 8:1 â&#x20AC;˘ Great for engines, tires, wheels, or as a truck wash â&#x20AC;˘ Not for use on clear plastics, leather, freshly painted, or freshly dyed surfaces â&#x20AC;˘ Great for removing engine grease, road grime, or other heavy soils â&#x20AC;˘ Color: Purple â&#x20AC;˘ Fragrance: Clean

&RS\ULJKWÂ&#x2039;


Automotive 6+2:1Âś*2Â&#x152;/($7+(56($/$17

6+2:1Âś*2Â&#x152;,17(5,2575($70(17

35(0,80/($7+(5&21',7,21(5

,17(5,2558%%(59,1</$1'3/$67,&75($70(17

 

 

²4XDUW R]

²*DOORQ R]

²4XDUW R]

²*DOORQ R]

â&#x20AC;˘ Simply wipe on and let it dry â&#x20AC;˘ Replenishes natural oils restoring to like new appearance, feel, and smell â&#x20AC;˘ Restores dry cracked leather to almost new â&#x20AC;˘ Use for all of your leather conditioning needs â&#x20AC;˘ Re-live the new leather experience with residual leather fragrance â&#x20AC;˘ Color: White â&#x20AC;˘ Fragrance: Leather

â&#x20AC;˘ Simply spray and wipe â&#x20AC;˘ Beautifies and protects interior rubber and vinyl surfaces â&#x20AC;˘ Reactive polymers for long term protection â&#x20AC;˘ Dries to a light non-greasy shine that will not attract dust â&#x20AC;˘ Contains no soaps, glycerin, or other extenders â&#x20AC;˘ Color: White â&#x20AC;˘ Fragrance: Cherry

&200$1'

'(7$,/&/$<

$87232/,6+

 ²JU*UH\ )LQH

 ²JU3XUSOH 0HG

)LQHJUDGHFOD\LVIRUPXODWHGWRFRUUHFWVXUIDFH FRQWDPLQDWLRQZLWKRXWDQDJJUHVVLYHDSSURDFK'RHV QRWUHTXLUHKHDY\SUHVVXUHWRFRUUHFWVHULRXVVXUIDFH SUREOHPV,GHDOIRUQHZFDUSUHSDUDWLRQZKHQ JHQHUDOVXUIDFHVPRRWKLQJLVQHHGHG%HVWFKRLFH IRUUHPRYDORIUDLOKHDGGXVW0HGLXPJUDGHFOD\ LVPRUHDJJUHVVLYHDQGVXLWDEOHIRUPRUHVHULRXV VXUIDFHFRQWDPLQDQWVWKDQILQHJUDGHFOD\,GHDOIRU KLJKYROXPHUHFRQGLWLRQLQJSULRUWRVXUIDFHSROLVKLQJ DQGZD[LQJ%RG\VKRSIULHQGO\H[FHOOHQWIRUUHPRYDO RISULPHUDQGDLUERUQHSDLQWRYHUVSUD\

 ²R]$HURVRO $OOZHDWKHUDHURVROSROLVKIRUILQLVKHVDQGVXUIDFHVRI DXWRPRELOHWUXFNZDWHUFUDIWWUDLOHUVDLUFUDIWDSSOLDQFHV 59ÂśVJROIFDUWVDQGVWDLQOHVVVWHHOHTXLSPHQW/HDYHV GHHSOXVWURXVVKLQHWKDWZLOOQRWGDPDJHDQ\SDLQWILQLVK :LOOUHPRYHKHDY\SDLQWR[LGDWLRQ3URWHFWVZLWKFDUQDXED ZD[DQG'XSRQW7HIORQÂ&#x160;5HVWRUHVWROLNHQHZJORVV\ ILQLVK

&5&%(/7'5(66,1*

=/($7+(5&$5(

)22'*5$'(

 ²PO%RWWOH  ²[%RWWOHV 1DWXUDOFDUQDXEDZD[VLOLFRQHZD[DQGSRO\PHUFDUH FRPSRQHQWV(QVXUHJHQWOHFDUHRILQWHULRUFDUILWWLQJV PRWRUF\FOHOXJJDJHDQGDOOW\SHVRIILQLVKHGOHDWKHU (IIRUWOHVVO\UHPRYHVGLUWJUHDVHDQGRLO3HQHWUDWHV TXLFNO\DQGGHHSO\LQWRSRUHVRIWKHOHDWKHUDQGUHVWRUHV LW1RJUHDV\ILOP&DUHFRPSRQHQWVSURWHFWWKHOHDWKHU VXUIDFHIURPEHFRPLQJEULWWOHDQGUHVWRUHLWWRWKHRULJLQDO VRIWQHVV

²R]$HURVRO 7HPSRUDU\V\QWKHWLFWUHDWPHQWIRUZRUQEHOWV([WHQGV EHOWOLIHE\UHGXFLQJVOLSSDJHKDUGHQLQJJOD]LQJGLUW EXLOGXSDQGIULFWLRQ(OLPLQDWHVDQQR\LQJVTXHDNVDQG VTXHDOV)RUPXODWHGZLWKDWDFN\QRQGU\LQJZDWHU UHVLVWDQWSRO\PHU5HGXFHVEHOWWHQVLRQUHOLHYLQJVWUHVV RQPRWRUVVKDIWVDQGZKHHOVLPSURYLQJRSHUDWLQJ HIILFLHQFLHV)RRGJUDGHV\QWKHWLFOXEULFDQW2GRUOHVV OLJKWDPEHUZLOOQRWVWDLQILQLVKHGJRRGVWUDQVSRUWHGRQ FRQYH\RUV$SSOLFDWLRQVLQGXVWULDOPDFKLQHU\FRQYH\RU V\VWHPVSRUWDEOHPRWRUL]HGHTXLSPHQWDQGYHKLFOHEHOWV

7523+<9,1</'5(66,1*

6/,&.

 ²4XDUW 'LVWULEXWLRQIURP&$ 19

 ²[4XDUWV 'LVWULEXWLRQIURP&$ 19

5HDG\WRXVHYLQ\OGUHVVLQJWKDWSURWHFWVEHDXWLILHVDQG UHVWRUHV

7,5(02817,1*/8%5,&$17

&RS\ULJKWÂ&#x2039;

 ²*DOORQ 'LVWULEXWLRQIURP&$ 19

 ²*DOORQV 'LVWULEXWLRQIURP&$ 19

:DWHUEDVHGOXEULFDQWIRUTXLFNPRXQWLQJDQGGLVPRXQWLQJ RIWLUHV9LVFRXVZLOOQRWMXVWUXQRIIZLWKRXWGRLQJWKHMRE

31


Automotive $&)/86+ $,5&21',7,21(5&/($1(5  ²*DOORQ 'LVWULEXWLRQIURP&$ 19

 ²[*DOORQ 'LVWULEXWLRQIURP&$ 19

)DVWHYDSRUDWLQJDLUFRQGLWLRQHUFOHDQHUGHVLJQHGWRSXUJHDQGFOHDQDLUFRQGLWLRQLQJOLQHV5HPRYHVRLOJUHDVHDQGJULPH/HDYHQR UHVLGXHDQGFRQWDLQVQRFKORULQDWHGVROYHQWV

%5$.( 3$576&/($1(5  ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP&DOLIRUQLD

 ²*DOORQV 'LVWULEXWLRQIURP2KLR

 ²*DOORQV 'LVWULEXWLRQIURP2KLR

 ²*DOORQV 'LVWULEXWLRQIURP2KLR

)RUPXODWHGWRUHPRYHGXVWRLOJUHDVHEUDNHIOXLGDQGRWKHUVRLOVIURPEUDNHXQLWV&DQEHXVHGRQDQ\W\SHRIEUDNHHTXLSPHQW (YDSRUDWHVTXLFNO\DQGOHDYHVQRUHVLGXH1RQHHGWRGLVDVVHPEOHEUDNHXQLWV&RQWDLQVQRKH[DQHRUFKORULQDWHGVROYHQWV

6/,3127 %(/7'5(66,1*  ²R]$HURVRO &OHDUUHVLQVSUD\IRUUHGXFLQJEHOWVOLSSDJH,QFUHDVHVJULSSRZHUSHUIRUPDQFHHFRQRP\$OVRFOHDQVDQGLPSURYHVEHOWOLIH:LOOQRW JOD]HJXPRUDWWUDFWGLUW $SSOLFDWLRQVPRVWW\SHVRISRZHUEHOWVURXQGIODW 9EHOWVIDEULFOHDWKHUUXEEHUFDQYDVLQGRRUVRURXWGRRUVZHWFRQGLWLRQVEHOWVIRXQGRQPHDWSURFHVVLQJHTXLSPHQW VOLFHUVJULQGHUV VHDOHUV FRQYH\RUEHOWVIDUPDQGLQGXVWULDOHTXLSPHQWDXWRPRWLYHEHOWVSRZHUWRROV RWKHUEHOWGULYHQHTXLSPHQW

3(50$7(;Š)250$6($//($.5(3$,5  ²R]$HURVRO ‡)RUPVGXUDEOHUXEEHUEDUULHU6WRSVH[WHULRUHQJLQHOHDNVLQPLQXWHVZLWKRXWSDUWUHPRYDO(OLPLQDWHVWKHQHHGIRUOLTXLGDGGLWLYH VHDOHUV'ULHVWRDFOHDUUXEEHUFRDWLQJ5HVLVWVFRPPRQVKRSIOXLGV6HDOVDQGSURWHFWV(QJLQHUHWXUQHGWRVHUYLFHLQPLQXWHV ‡$SSOLFDWLRQV(QJLQHDQGWUDQVPLVVLRQOHDNVFRROLQJV\VWHPVURRIVSOXPELQJPDVRQU\ZRRGSODVWLFVJODVV39&

32

&RS\ULJKW‹


Coatings, Sealants, & Adhesives

Coatings, Sealants, & Adhesives $&2867,&$/7,/(5(6725(5

$&2867,&$/7,/(5(6725(5

 ²R]$HURVRO  ²([WUD$FWXDWRUIRU9HUWLFDO6SUD\LQJ :KLWHFRORUFRYHUVVWDLQVDQGGLVFRORUDWLRQVRQDFRXVWLFDO FHLOLQJWLOHV5HVWRUHVWLOHVWROLNHQHZFRQGLWLRQ (OLPLQDWHVWLOHUHSODFHPHQW121)/$00$%/(:+(1 '5<

2/':+,7(

:+,7(287

3/$67,',3Š

67$,1.,//(5

635$<08/7,385326(58%%(5&2$7,1*

 ²R]$HURVRO 2ULJLQDO:DWHU%DVH3RO\HVWHU3ULPHU6XUIDFHVHDOHU 6SHFLDOO\IRUPXODWHGSULPHUVHDOHUWKDWEORFNVRXWDQG VHDOVVWDLQVPDGHE\VPRNHZDWHUILUHOLSVWLFNLQN FUD\RQJUHDVHRURWKHUVLPLODUKRXVHKROGSURGXFWV)RU XVHRQERWKLQWHULRU H[WHULRUVXUIDFHV

 ²5HGR]$HURVRO  ²<HOORZR]$HURVRO  ²%ODFNR]$HURVRO  ²:KLWHR]$HURVRO  ²&OHDUR]$HURVRO )OH[LEOHV\QWKHWLFUXEEHUFRDWLQJZKLFKH[KLELWVH[FHOOHQW PRLVWXUHDFLGDONDOLQHDQGDEUDVLRQUHVLVWDQFH:RQ¶W FUDFNFKLSRUEHFRPHEULWWOHGHDGHQVVRXQG,QVXODWHV DJDLQVWHOHFWULFDOVKRFNYLEUDWLRQDQGKHDW5HVLVW ZHDWKHUFKHPLFDOVLPSDFWDQGDEUDVLRQ

&RS\ULJKW‹

 ²R]$HURVRO &RYHUVVWDLQVDQGGLVFRORUDWLRQRQDFRXVWLFDOFHLOLQJWLOHV 'RHVQRWDIIHFWDFRXVWLFDOSURSHUWLHVRUILUHUDWLQJRIWKH WLOHV([FHOOHQWIRUERWKVPRRWKDQGURXJKWLOHV:LOOQRW FDXVHZDUSRUVDJ&RPSOLHVZLWKILUHDQGEXLOGLQJFRGHV (OLPLQDWHVWLOHUHSODFHPHQW)RUXVHE\2IILFHEXLOGLQJ PDLQWHQDQFHFUHZVFRQVWUXFWLRQFRPSDQLHVUHPRGHOHUV EXLOGLQJVXSHULQWHQGHQWVPXQLFLSDOLWLHVUHVWDXUDQWV VFKRROVKRVSLWDOVQXUVLQJKRPHVKRWHOVPRWHOVUHWDLO VWRUHV

33


Coatings, Sealants, & Adhesives *22'*5,3

'()(16(()

6/,35(6,67$177(;785(' (32;<&2$7,1*6

0(7$/3$5763527(&725

 ²&OHDUR]$HURVRO  ²%ODFNR]$HURVRO $QWL6NLG(SR[\&RDWLQJ$HURVRO3URYLGHVRQHSDUW 528*+*5,3685)$&($GKHUHVWRPRVWKDUG ,17(5,25RU(;7(5,25VXUIDFHV&RQWDLQVV\QWKHWLF JULWZLWKQRVKDUSHGJHV

 ²R]$HURVRO $QWLFRUURVLRQZDWHUSURRIFRDWLQJIRUPHWDOSDUWV7KLQ IORZDEOHFRDWLQJWUDQVSDUHQWDPEHUILOP3URWHFWVSDUWV DJDLQVWUXVW FRUURVLRQ)LOPLVKDUGEXWIOH[LEOHDQG ZHOGDEOH6HWVXSKDUGLQKRXUV'LUWDQGGXVWFDQEH ZLSHGRIIZLWKRXWDIIHFWLQJILOP5HPRYDEOHZLWKNHURVHQH RUPLQHUDOVSLULWV3DUWVFDQEHSDLQWHGDIWHUUHPRYDORI ILOP/RQJWHUPLQGRRURURXWGRRUVWRUDJHDQGSURWHFWLRQ ([FHOOHQWIRUSURWHFWLQJSDUWVZKLOHLQWUDQVLWSURWHFWV DJDLQVWVDOWVSUD\

48,.=,1& &2/'*$/9$1,=(&2$7,1*  ²R]$HURVRO +HDY\GXW\]LQFSURWHFWLYHFRDWLQJ6XSHULRUSURWHFWLRQRILURQ VWHHOLQFRUURVLYHFRQGLWLRQV+LJKVROLGVIRUPXOD±=LQF'ULHVWR DIOH[LEOH]LQFFRDWLQJWKDWEHQGVZLWKRXWFKLSSLQJ3URPRWHVWUXHJDOYDQLFDFWLRQZKHQVXUIDFHLVVFUDWFKHGEURNHQRUGLVVLSDWHGLQWKH SUHVHQFHRIPRLVWXUH5HVLVWVPRLVWXUHVDOWVDQGDFLGV8VHDVDSULPHURUDILQDOSURWHFWLYHFRDWLQJ&RPSDUDEOHWRKRWGLSJDOYDQL]H ZKHQDSSOLHGDWDPLOWKLFNQHVV

.5</21*$/9$1,=,1*35,0(5 352)(66,21$/*5$<35,0(5

 ²R]$HURVRO  ²[$HURVROV .U\ORQ&RQWUDFWRUVL]HFDQ(DV\RQDQGRII3LQFK1¶3XOOŒFDS5HVWRUHVWKHEULJKWORRNRIKRWGLSSHGJDOYDQL]HGVXUIDFHV6WRSV UXVWDQGFRUURVLRQRQDQ\LURQRUVWHHOVXUIDFH=LQFIRUPXODIRUORQJODVWLQJSURWHFWLRQ $SSOLFDWLRQV:HOGWKUXSULPLQJRVPHWLFUHSDLURQZHOGVKDQGUDLOVULPVKLJKZD\JXDUGUDLOVPHWDOFKDLQOLQNHGIHQFHVSLSHV79 WRZHUVKHDY\HTXLSPHQWDQGFRUUXJDWHGPHWDOEXLOGLQJV

+$1',)2$0Š

6(<02855$3,'6($/

32/<85(7+$1()2$06($/$17

58%%(5,=('6($/$17

 ²R]6WUDZ7RS  ²R]*XQ6HDODQW 0XOWLSOHSXUSRVHRQHFRPSRQHQWSRO\XUHWKDQHIRDP $GKHUHVWRDOPRVWDOOEXLOGLQJPDWHULDOV&XUHGIRDPLV UHVLVWDQWWRWHPSHUDWXUHVUDQJLQJEHWZHHQƒ)WR ƒ) ƒ&WRƒ& :DWHUUHVLVWDQW8VHJXQ VHDODQWZLWKDSSOLFDWLRQJXQ

 ²R]$HURVRO )DVWGU\LQJUHVLVWUXVWURDGVDOWVDONDOL DFLGV$OORZV PD[LPXPEXLOGXSZLWKRXWVDJJLQJ&DQEHWRSFRDWHG DIWHUFXULQJZLWKRXWEOHHGWKURXJK5HVLVWVWHPSHUDWXUH H[WUHPHV'HDGHQVVRXQG92&FRPSOLDQW $SSOLFDWLRQVURRIDUHDVVN\OLJKWVIODVKLQJVDLUYHQWV JXWWHUVVKLQJOHVDQWHQQDLQVWDOODWLRQVVPDOOFUDFNVKROHV LQGULYHZD\VWUHHVKUXESUXQLQJOHDNVLQSDLOV ZDVWH UHFHSWDFOHV YHKLFOHXQGHUFRDWLQJ

34

&RS\ULJKW‹


Coatings, Sealants, & Adhesives 2$7(<$//385326(/($.'(7(&725

6855281'

 ²R] %OXH/LTXLG/HDN'HWHFWRULQFOXGHVVSHFLDOGDXEHULQFDS 'HWHFWVOHDNVLQVHFRQGVRQDOOW\SHVRIHTXLSPHQW 6SHFLDOVORZHYDSRUDWLQJIRUPXODWLRQSURYLGHVORQJHU EXEEOLQJDFWLRQDQGLQFUHDVHGLQVSHFWLRQWLPH)RU8VH 2QWXELQJYDOYHVF\OLQGHUVSUHVVXUHWDQNVRUDQ\ V\VWHPXQGHUDLUJDVRUR[\JHQSUHVVXUH(IIHFWLYH 7HPSHUDWXUH5DQJHƒWRƒ)

&2/'3,3(,168/$7,21635$<

 ²R] $HURVROLQVXODWRUHQFDVHVFROGZDWHUSLSHVZLWKD ZKLWHFRDWLQJ3UHYHQWVVOLSDQGIDOOKD]DUGVLQWKH ZRUNSODFHGXHWRZHWIORRUV(DV\WRVDQGRIIRUUHPRYH IRUPDLQWHQDQFHUHSDLUV8VHLQDLUFRQGLWLRQLQJ PDLQWHQDQFHDLUFUDIWPDLQWHQDQFHLQGXVWULDORSHUDWLRQV IRRGEHYHUDJHDQGFRVPHWLFPDQXIDFWXULQJUHIULJHUDWLRQ WUXFNVFROGVWRUDJHORFNHUVVKLSSLQJRSHUDWLRQVNLWFKHQV DQGLQGRRULFHULQNV3URGXFWLVQRWUHFRPPHQGHGIRUKRW ZDWHUDSSOLFDWLRQV

)$6767((/ 67((/5(,1)25&('(32;<67,&.  ²R]´/RQJ['LD7XEH 5HSDLUVIHUURXVDQGDOXPLQXPPHWDOV$SSOLFDWLRQVUHSDLUVPHWDOWRROVHTXLSPHQWSLSHVGXFWVKRXVLQJVDSSOLDQFHVHQJLQHSDUWVJDVWDQNVVWULSSHG WKUHDGVDXWRERGLHVXVHWRDQFKRUPDFKLQHVIRUPQXWVDQGEROWVDQGPDQ\RWKHUPHWDOUHSDLUV16)DSSURYHG6DIHIRUSRWDEOHZDWHU&KHPLFDO 5HVLVWDQFH7RK\GURFDUERQVNHWRQHVDOFRKROVHVWHUVKDORFDUERQVDTXHRXVVDOWVROXWLRQVGLOXWHDFLGVDQGEDVHVJDVROLQH

$48$0(1' :$7(5 0$5,1((32;<67,&.  ²R]´/RQJ['LD7XEH 5HSDLUVSRROPDULQHDQGZDWHUW\SHVXEVWUDWHV:RUNVRQXQGHUZDWHUDQGRQGDPSRUZHWVXUIDFHV3OXJVVORZOHDNV1RQ\HOORZLQJFXUHVWR ILEHUJODVVZKLWH3DWFKHVGLQJVVFUDWFKHVFXWVJRXJHVDQGKROHV$SSOLFDWLRQVUHSDLUVILEHUJODVV39&PHWDOZRRGFRQFUHWHFHUDPLFVJODVVSODVWLFV ERDWVHTXLSPHQWSLSHVZDWHUWDQNVVSDVKRWWXEVSRROVHWF&KHPLFDO5HVLVWDQFH7RK\GURFDUERQVNHWRQHVDOFRKROVHVWHUVKDORFDUERQVDTXHRXVVDOW VROXWLRQVGLOXWHDFLGVDQGEDVHVJDVROLQH

48,.&233(5 &233(55(,1)25&('(32;<67,&.  ²R]´/RQJ['LD7XEH ³3OXPEHULQD7XEH´,GHDOIRUSLSHUHSDLU5HSDLUVFRSSHUEUDVVEURQ]HDQGRWKHUQRQIHUURXVPHWDOV%RQGVWRGDPSVORZOHDNLQJVXUIDFHV)L[SOXPELQJ OHDNVLQPLQXWHV5HVWRUHVHUYLFHWRKRWZDWHUSLSHVLQMXVWKRXU$SSOLFDWLRQVUHSDLUVSLSHVHOERZVMRLQWVVOHHYHVWUDSVGUDLQVGRPHVWLFKRWZDWHU SLSHVSLQKROHOHDNVIUHH]HEUHDNVHWF7RXJKGXUDEOHUHSDLUV+DQG.QHDGDEOH0ROGV/LNH&OD\6HWV6WHHO+DUG&DQEHGULOOHGWDSSHGPDFKLQHGJURXQG ILOHGVFUHZHGVDZHGVDQGHGDQGSDLQWHG16)DSSURYHG6DIHIRUSRWDEOHZDWHU&KHPLFDO5HVLVWDQFH7RK\GURFDUERQVNHWRQHVDOFRKROVHVWHUV KDORFDUERQVDTXHRXVVDOWVROXWLRQVGLOXWHDFLGVDQGEDVHVJDVROLQH

48,.:22' :22'5(3$,5(32;<67,&.  ²R]´/RQJ['LD7XEH )LOOVQDLOKROHVVWULSSHGVFUHZKROHVVFUDWFKHVJRXJHVFUDFNVGU\URWDQGNQRWKROHV6DPHGHQVLW\DVZRRG&DQEHVDQGHGVDZHGSDLQWHGVWDLQHG WDSSHGPDFKLQHG,QWHULRURUH[WHULRUDSSOLFDWLRQVRQDQ\ZRRG$SSOLFDWLRQVUHSDLUVRQIXUQLWXUHPROGLQJIUDPHVUDLOLQJIHQFHVZRRGFDUYLQJVIORRULQJ UHPROGLQJRUUHVKDSLQJRIZRRGVNQREVDQGKDQGOHVHWF7RXJKGXUDEOHUHSDLUV+DQG.QHDGDEOH0ROGV/LNH&OD\6HWV6WHHO+DUG&DQEHGULOOHGWDSSHG PDFKLQHGJURXQGILOHGVFUHZHGVDZHGVDQGHGDQGSDLQWHG&KHPLFDO5HVLVWDQFH7RK\GURFDUERQVNHWRQHVDOFRKROVHVWHUVKDORFDUERQVDTXHRXVVDOW VROXWLRQVGLOXWHDFLGVDQGEDVHVJDVROLQH &RS\ULJKW‹

35


Coatings, Sealants, & Adhesives 48,.3/$67,. 3/$67,&5(3$,5(32;<67,&.  ²R]´/RQJ['LD7XEH 5HSDLUVPRVWULJLGRUVHPLIOH[LEOHSODVWLFV6HDOVOHDNVLQSODVWLFSLSHV5HVWRUHVVHUYLFHWREURNHQ39&SLSHVLQKRXUV$SSOLFDWLRQVDXWRPRWLYHSODVWLF WULPDQGSDUWVSODVWLFVVXFKDV39&$%6&39&SODVWLFKRXVLQJVWRROVHTXLSPHQWSODVWLFRXWGRRUIXUQLWXUH7RXJKGXUDEOHUHSDLUV+DQG.QHDGDEOH0ROGV /LNH&OD\6HWV6WHHO+DUG&DQEHGULOOHGWDSSHGPDFKLQHGJURXQGILOHGVFUHZHGVDZHGVDQGHGDQGSDLQWHG&KHPLFDO5HVLVWDQFH7RK\GURFDUERQV NHWRQHVDOFRKROVHVWHUVKDORFDUERQVDTXHRXVVDOWVROXWLRQVGLOXWHDFLGVDQGEDVHVJDVROLQH

/2&7,7( )$67%21',1*/$5*(*$3),//$'+(6,9(  ²R]$GKHVLYH  ²3DFNRI0L[HU7LSV +LJKVROLGV0RUHSLJPHQWVDQGUHVLQV/HVVVROYHQWV%HWWHU FRYHUDJH/RZ92&IRUPXODV

3$,170$5.(56 $57/,1(Š;)

 ²)HOWLS3DLQW0DUNHU:KLWH  ²[%OXH  ²[:KLWH  ²)HOWLS3DLQW0DUNHU*UHHQ  ²)HOWLS3DLQW0DUNHU<HOORZ  ²[*UHHQ  ²[<HOORZ  ²)HOWLS3DLQW0DUNHU2UDQJH  ²)HOWLS3DLQW0DUNHU%ODFN  ²[2UDQJH  ²[%ODFN  ²)HOWLS3DLQW0DUNHU6LOYHU  ²)HOWLS3DLQW0DUNHU5HG  ²[6LOYHU  ²[5HG  ²)HOWLS3DLQW0DUNHU*ROG  ²)HOWLS3DLQW0DUNHU%OXH  ²[*ROG )HOWLSSDLQWSHQVIRUSHUPDQHQWPDUNLQJOHWWHULQJFRGLQJDQGQXPEHULQJRIERWKLQWHULRUDQGH[WHULRUVXUIDFHV)DVWGU\LQJKLJKJORVVHQDPHOSDLQW(DV\7R 8VH²FRQYHQLHQWWRFDUU\LQ\RXUSRFNHW0DUNVDOPRVWDQ\WKLQJPHWDOSODVWLFSULQWHGFLUFXLWERDUGVJODVVZRRGSDSHUOHDWKHUWH[WLOHVHWF:ULWHVRQ DQ\VXUIDFHSRURXVRUQRQSRURXVURXJKRUVPRRWKZHWRLO\RUGU\:RQ¶WFKLSSHHOIDGHRUUXERII6WDQGDUGPDUNLQJDSSUR[LPDWHO\´ZLGHOLQH&RORU FRGHGFDSV

3(50$7(;Š3(50$32;< 7:23$57(32;<6<5,1*(6  ²*HQHUDO3XUSRVH  ²([WUD6WUHQJWK&U\VWDO&OHDU  ²0XOWL0HWDO  ²0XOWL0HWDO  ²3ODVWLF:HOG (DV\WRXVHPXOWLSXUSRVHWZRSDUWDGKHVLYHVLQIOR]GXDOV\ULQJHVRUWZRR]VTXHH]HWXEHV5HVLVWDQWWRIXHOVVROYHQWVDQG PRVWRWKHUOLTXLGV*HQHUDO3XUSRVH8VHGWRERQGRUUHSDLUFHUDPLFFKURPHIDEULFILEHUJODVVJODVVKDUGSODVWLFPHWDODQGUXEEHU ([WUD6WUHQJWK&U\VWDO&OHDU8VHGWRERQGRUUHSDLUFHUDPLFFRQFUHWHIDEULFJODVVPHWDOUXEEHU0XOWL0HWDO8VHGWRERQGRUUHSDLU DOXPLQXPEUDVVFKURPHFRSSHULURQVWDLQOHVVVWHHODQGVWHHO3ODVWLF:HOG8VHGWRERQGRUUHSDLU$%6DFU\OLFILEHUJODVVJODVV39& VWHHOVW\UHQHYLQ\ODQGZRRG

36

&RS\ULJKW‹


Seasonal & Supplies

Seasonal & Supplies (=:,3(6 (;35(66:,3(6,16(&75(3(//$17  ²3UH0RLVWHQHG7RZHOV 5HSHOVPRVTXLWRHVELWLQJIOLHVFKLJJHUVWLFNVGHHUIOLHVVWDEOHIOLHVEODFNIOLHVJQDWVIOHDVDQGRWKHUELWLQJGLVHDVHFDUU\LQJLQVHFWV 1HDWDQGVDIHDOWHUQDWLYHWRPHVV\ORWLRQV $SSOLFDWLRQV6NLQDQGFORWKLQJRIFRQVWUXFWLRQDQGPXQLFLSDOZRUNHUVKLNHUVMRJJHUVDWKOHWHVILVKHUPHQJDUGHQHUVJROIHUV ODQGVFDSHUVIDUPHUVERDWHUVDQGDQ\RQHZKRZRUNVRUSOD\VRXWGRRUV

0,67<'8$/&,'(3 %52$'63(&7580,16(&7,&,'(  ²R]$HURVRO  ²[$HURVROV :DWHU%DVHG)RUPXOD.LOOV2Q&RQWDFW3URWHFWV)RU8SWR0RQWKV)RU5HVLGHQWLDO&RPPHUFLDO$JULFXOWXUDO8VH1R8QSOHDVDQW 2GRU1RQ6WDLQLQJ.LOOV$QWV ,QFOXGLQJ&DUSHQWHU$QWV %HHV%HHWOHV ,QFOXGLQJ&DUSHW)ORXU*UDLQDQG*URXQG%HHWOHV &HQWLSHGHV &ORYHU0LWHV&RFNURDFKHV&ULFNHWV ,QFOXGLQJ0ROH&ULFNHWV (DUZLJV)LUHEUDWV)OHDV0LOOLSHGHV0RWKV3LOOEXJV6FRUSLRQV6LOYHUILVK 6RZEXJV6SLGHUV7LFNV:DVSV%HG%XJVDQGPDQ\RWKHUSHVWV

&RS\ULJKWÂ&#x2039;

37


Seasonal & Supplies 7+(+285Œ

&6 96

,16(&75(3(//(17

52$&+ $17635$<

 ²R]3XPS6SUD\ &RQWDLQVDFWLYH'LHWK\OPWROXDPLGH '((7  3URIHVVLRQDOVWUHQJWKIRUPXOD2QHDSSOLFDWLRQZLOOSURWHFW IRUXSWRKRXUV:RQ¶WVZHDWRXW5HSHOVPRVTXLWRHV WLFNVFKLJJHUVEODFNIOLHVGHHUIOLHVKRUVHIOLHVVWDEOH IOLHVIOHDVJQDWVEHHV LIQRWVZDUPLQJ 7KHPRVW HIIHFWLYHLQVHFWUHSHOOHQWDYDLODEOHWRSURWHFWDJDLQVW PRVTXLWRHVFDUU\LQJWKH:HVW1LOH9LUXV

 ²R]$HURVRO&KHUU\  ²[$HURVROV&KHUU\  ²R]$HURVRO9DQLOOD  ²[$HURVROV9DQLOOD &UDFNDQGFUHYLFHVSUD\)RU,1'225RU287'225 XVH6ROYHQWEDVHGVSUD\IRUXOWUDIDVWNQRFNGRZQ TXLFN NLOO6ROYHQWLQVWDQWO\SHQHWUDWHVH[RVNHOHWRQV:RUNV RQ&217$&7DQG5(6,'8$//<IRUWRZHHNV 3RZHUIXOVWUHDPVSUD\.LOOVURDFKHVDQWVVLOYHUILVK VSLGHUVVFRUSLRQVZDWHUEXJVFULFNHWVFDUSHWEHHWOHV MXQHEXJVIO\LQJPRWKVIOLHVPRVTXLWRHVJQDWVZDVSV HDUZLJVDQGPDQ\RWKHUSHVWV

'220 :(('.,//(5635$<  ²R]$HURVRO 1RQVHOHFWLYHV\VWHPLFKHUELFLGH5DSLGNLOOLQJRIPRVWZHHGVDQGXQZDQWHGYHJHWDWLRQ (DV\WR8VH7XUQFDQXSVLGHGRZQDQGVSUD\GLUHFWO\RQWRZHHG&RQWDLQVDVRLOVWHULODQWWKDQFDQFRQWUROZHHGVXSWRDSSUR[LPDWHO\ \HDU%HVWWRXVHLQODWHVSULQJZKHQPRVWZHHGVKDYHDSSHDUHG(3$UHJLVWHUHG $SSOLFDWLRQV-RKQVRQJUDVVFUDEJUDVVIR[WDLOEDUQ\DUGJUDVVODPEVTXDUWHUEURRPVHGJHGDQGHOLRQDQGPDQ\RWKHUZHHGV

'(,&( )5267 ,&(5(029(5  ²R]$HURVRO 4XLFNO\PHOWVIURVW LFH+HOSVSUHYHQWLFHDQGIURVWIRUPDWLRQRQZLQGRZV ZLQGVKLHOGVZKHQVSUD\HGDIHZKRXUVLQDGYDQFHRID IUHH]H&OHDUDOFRKRO JO\FROEDVHGVSUD\ (DV\7R8VH%UXVKDZD\ORRVHVQRZDQGLFH6FRUHWKHLFHZLWKHGJHRIDNH\RULFHVFUDSHU6SUD\VFRUHGDUHDDQGWKHHQWLUHVXUIDFH $SSOLFDWLRQVZLQGVKLHOGVKHDGOLJKWVGRRUORFNVWLUHVZLQGRZVVWHSVVLGHZDONVHTXLSPHQW

+($7:25.6:$50(56  ²+DQG3RNFHW *ORYH:DUPHU  ²3DLU%R[+DQG:DUPHU  ²$GKHVLYH7RH:DUPHU $LU$FWLYDWHG+DQG3RFNHW *ORYH:DUPHUV1RVSHFLDOGLVSRVDOUHTXLUHG

38

&RS\ULJKW‹


Can Liners

Can Liners 3DUW1R

6L]H

&RORU

7KLFNQHVV

4XDQWLW\



;

1DWXUDO

0,&





;

1DWXUDO

0,&





;

1DWXUDO

0,&





;

1DWXUDO

0,&





;

1DWXUDO

0,&





;

1DWXUDO

0,&



&RS\ULJKWÂ&#x2039;

+,*+'(16,7<&$1/,1(56 â&#x20AC;˘ Excellent economical choice for heavy, wet trash and soft refuse as long as there are no sharp or irregular shaped objects. â&#x20AC;˘ Great for offices, restrooms, waiting areas and restaurants. â&#x20AC;˘ SOLD BY CASE

39


Can Liners 3DUW1R

6L]H

&RORU

7KLFNQHVV

4XDQWLW\



;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/





;

*UHHQ

0,/



/2:'(16,7<&$1/,1(56 â&#x20AC;˘ Superior strength, puncture and tear resistance â&#x20AC;˘ Stretchable - Great for trash with sharp, irregular edges such as bolts, glass, sticks, utensils etc. â&#x20AC;˘ Contains recycled content â&#x20AC;˘ SOLD BY CASE

+86.((75$6+&$1  ²*DO*UD\ â&#x20AC;˘ Molded from engineered resins with seamless construction â&#x20AC;˘ Nestable for easy stacking â&#x20AC;˘ Can also be used as a food bin â&#x20AC;˘ 100% recycled

40

&RS\ULJKWÂ&#x2039;


Paper Products & Wipers

Paper Products & Wipers 35(6(59(Â&#x160;+$5':281'72:(/6 7KHVHEXON\WKLUVW\WRZHOVDUHVRIWVWURQJDQGDEVRUEHQW\HWFRPSHWLWLYHO\SULFHG'HVLJQHGWRILWLQWRDZLGHUDQJHRI GLVSHQVHUVHFRQRP\KDUGZRXQGHYHU\GD\WRZHOVKHOS\RXNHHSFRVWVXQGHUFRQWURO/RZSHUXQLWFRVWVPDNHVWKHVHWRZHOV WKHDIIRUGDEOHFKRLFHIRUKLJKWUDIILFDUHDVVXFKDVZDVKURRPVLQJRYHUQPHQWDQGSXEOLFIDFLOLWLHVRIILFHEXLOGLQJVIRRGVHUYLFH IDFLOLWLHVDQGORGJLQJ  â&#x20AC;˘ Roll Width: 7.9â&#x20AC;? â&#x20AC;˘ Core Size: 2â&#x20AC;? â&#x20AC;˘ 800 feet per roll, 6 rolls per case â&#x20AC;˘ Green Seal Certified â&#x20AC;˘ Mechanical Hands-Free Dispenser: 865.07.8861 â&#x20AC;˘ Electronic Hands-Free Dispenser: 865.07.2245\ â&#x20AC;˘ Sold by case

 â&#x20AC;˘ Roll Width: 10â&#x20AC;? â&#x20AC;˘ Core Size: 1.75â&#x20AC;? â&#x20AC;˘ 800 feet per roll, 6 rolls per case â&#x20AC;˘ Green Seal Certified â&#x20AC;˘ Designed to fit 10â&#x20AC;? major brand electronic hands-free dispensers â&#x20AC;˘ Dispenser: 865.07.1080 â&#x20AC;˘ Sold by case

 â&#x20AC;˘ Star-Cut Core Design â&#x20AC;˘ Roll Width: 8â&#x20AC;? â&#x20AC;˘ Core Size: 2â&#x20AC;? â&#x20AC;˘ 600 feet per roll. 6 rolls per case â&#x20AC;˘ Fits Baywest Dispenser Numbers: 67500, 80000, 86000, 86500, 89400, 89500 â&#x20AC;˘ Sold by case

 â&#x20AC;˘ Perforated Household Roll Towel â&#x20AC;˘ Highly absorbent & durable â&#x20AC;&#x201C; ideal for tough jobs â&#x20AC;˘ 2 ply construction â&#x20AC;˘ 11â&#x20AC;? x 9â&#x20AC;? sheets â&#x20AC;˘ 85 sheets per roll, 30 rolls per case â&#x20AC;˘ Green Seal Certified â&#x20AC;˘ Sold by case

 â&#x20AC;˘ Mechanical Hands-Free Dispenser â&#x20AC;˘ For standard 8â&#x20AC;? wide hardwound roll towels â&#x20AC;˘ Attractive design is perfect for most any application â&#x20AC;˘ No batteries to replace â&#x20AC;˘ Controls usage

&RS\ULJKWÂ&#x2039;

 â&#x20AC;˘ Electronic Hands-Free Dispenser with Motion Sensor â&#x20AC;˘ For standard 8â&#x20AC;? wide hardwound roll towels â&#x20AC;˘ Attractive design will compliment any restroom dĂŠcor â&#x20AC;˘ Towels are dispensed automatically when hands are placed below dispenser â&#x20AC;˘ Low battery indicator

 â&#x20AC;˘ 10â&#x20AC;? Electronic Hands-Free Dispenser â&#x20AC;˘ For dispensing 10â&#x20AC;? wide roll towels â&#x20AC;˘ Stylish, attractive design â&#x20AC;˘ Extra long battery life â&#x20AC;˘ Mechanical back-up feature

41


Paper Products & Wipers &(17(538//72:(/6 &HQWHUSXOOV\VWHPVDUHWKHPRVWHIILFLHQWHFRQRPLFDOKDQGVIUHHGU\LQJPHWKRGDYDLODEOH,GHDOIRUUHVWURRPVNLWFKHQV IRRGSUHSDUDWLRQDUHDVDQGRWKHUKLJKWUDIILFORFDWLRQVZKHUHVDQLWDWLRQLVLPSRUWDQW<RXXVHRQO\WKHWRZHO\RXWRXFK HOLPLQDWLQJFURVVFRQWDPLQDWLRQ(DFKUROOLVSHUIRUDWHGWRGHOLYHURQO\RQHFOHDQGU\JHUPIUHHVKHHWDWDWLPHWRFRQWURO XVDJHDQGUHGXFHZDVWH*UHHQ6HDO&HUWLILHG  â&#x20AC;˘ 2 Ply â&#x20AC;˘ Roll Diameter: 8.3â&#x20AC;? â&#x20AC;˘ Roll Width: 7.6â&#x20AC;? â&#x20AC;˘ Core Size: 2.36â&#x20AC;? â&#x20AC;˘ 600 feet per roll â&#x20AC;˘ 6 rolls per case â&#x20AC;˘ Dispenser â&#x20AC;&#x201C; 865.07.6622 â&#x20AC;˘ Sold by case

 â&#x20AC;˘ 1 Ply â&#x20AC;˘ Roll Diameter: 8.4â&#x20AC;? â&#x20AC;˘ Roll Width: 7.6â&#x20AC;? â&#x20AC;˘ Core Size: 2.36â&#x20AC;? â&#x20AC;˘ 1000 feet per roll â&#x20AC;˘ 5 rolls per case â&#x20AC;˘ Dispenser â&#x20AC;&#x201C; 865.07.6622 â&#x20AC;˘ Sold by case

 â&#x20AC;˘ 2 Ply Mini -Roll â&#x20AC;˘ Roll Diameter: 5.8â&#x20AC;? â&#x20AC;˘ Roll Width: 8.3â&#x20AC;? â&#x20AC;˘ 264 feet per roll â&#x20AC;˘ 12 rolls per case â&#x20AC;˘ Dispenser â&#x20AC;&#x201C; 865.07.2644 â&#x20AC;˘ Sold by case

&(17(538//',63(16(56  â&#x20AC;˘ Standard Centerpull Dispenser â&#x20AC;˘ Transparent smoke cover â&#x20AC;˘ Unique mounting system with removable mounting plate â&#x20AC;˘ No moving parts â&#x20AC;&#x201C; simplest, most cost effective, handsfree towel dispenser available â&#x20AC;˘ Watertight â&#x20AC;&#x201C; can be used in moist environments or where washdowns are required

 â&#x20AC;˘ Mini Centerpull Dispenser â&#x20AC;˘ Transparent smoke cover â&#x20AC;˘ Perfect for high-traffic limited space areas â&#x20AC;˘ Unique mounting system with removable mounting plate â&#x20AC;˘ Size: 7â&#x20AC;?D x 14â&#x20AC;?H x 8â&#x20AC;?W

)($7+(562)7%$7+52207,668( )HDWKHU6RIWLVDXQLYHUVDOVRIWDEVRUEHQWHFRQRPLFDOSO\WLVVXHWKDWGHOLYHUVTXDOLW\YDOXHDQGSHUIRUPDQFH(OHJDQWO\ HPERVVHGHQKDQFHVEXONDQGVRIWQHVV(DFKUROOLVRYHUDOOZUDSSHGHQVXULQJVDQLWDU\SURWHFWLRQ(DV\VWDUWWDLOVHDO SUHYHQWVZDVWH6SHFLDOWLJKWO\ZRXQGUROOVIRUVRXUFHUHGXFWLRQDQGVSDFHVDYLQJVEHQHILWV5DSLGEUHDNXSFDSDELOLWLHVDUH LGHDOIRUDOOSOXPELQJV\VWHPV%LRGHJUDGDEOHDQGVDIHIRUXVHLQVHSWLFV\VWHPVERDWV59VDQGPRWRUKRPHV 0DGHIURPUHF\FOHGILEHUVDQHQYLURQPHQWDOEHQHILWDQGDSRVLWLYHLPDJHEXLOGHU  â&#x20AC;˘ Tissue Size: 4.5â&#x20AC;? W x 3.6â&#x20AC;? L â&#x20AC;˘ Safe for sewer and septic systems â&#x20AC;˘ 500 sheets per roll â&#x20AC;˘ 96 rolls per case â&#x20AC;˘ Twin Roll Dispenser â&#x20AC;&#x201C; 865.07.2500 â&#x20AC;˘ Sold by case

 â&#x20AC;˘ Standard Twin Roll Dispenser â&#x20AC;˘ Holds 2 rolls of standard bath tissue up to 5.3â&#x20AC;? diameter and 4.5â&#x20AC;? width â&#x20AC;˘ Translucent cover to monitor tissue supply â&#x20AC;˘ Rolls selector eliminates stub roll waste â&#x20AC;˘ Reserve roll is enclosed for maximum hygiene

3257$52//%$7+52207,668( 3RUWD5ROOEDWKWLVVXHLVSURGXFHGZLWKDô´FRUHDQGXQLTXH´SHUIRUDWLRQ7KHVPDOOFRUHDFFRPPRGDWHVPRUHIRRWDJH RQDUROOUHGXFLQJWKHFKDQFHRIUXQRXWV  â&#x20AC;˘ 2-Ply construction â&#x20AC;˘ žâ&#x20AC;? core; 6â&#x20AC;? diameter â&#x20AC;˘ 470 feet per roll â&#x20AC;˘ For use with dispenser 865.07.3200 â&#x20AC;˘ Sold by the case

42

 â&#x20AC;˘ Porta-Roll dispenser â&#x20AC;˘ Holds two 6â&#x20AC;? diameter rolls â&#x20AC;˘ Uses 865.07.470 bathroom tissue

&RS\ULJKWÂ&#x2039;


Paper Products & Wipers -80%252//%$7+52207,668( -XPER5ROO%DWKURRP7LVVXH -57WLVVXH LVDQDIIRUGDEOHFKRLFHIRUKLJKWUDIILFDUHDVVXFKDVZDVKURRPVLQKRWHOV RIILFHEXLOGLQJVSXEOLFIDFLOLWLHVVFKRROVIRRGVHUYLFHDQGKHDOWKFDUHIDFLOLWLHV(DFKMXPERVL]HGUROOGHOLYHUVDQ HFRQRPLFDOIHHWRIWLVVXHZKLFKPHDQVUHGXFHGPDLQWHQDQFHWLPHDQGJUHDWHUFXVWRPHUVDWLVIDFWLRQE\GHFUHDVLQJ WKHFKDQFHVRIUXQRXWGXULQJSHDNWLPHV  â&#x20AC;˘ Two ply construction for the softest feel â&#x20AC;˘ Industry standard 9â&#x20AC;? diameter roll â&#x20AC;˘ 1000 feet per roll â&#x20AC;˘ 12 rolls per case â&#x20AC;˘ JRT Single Roll Dispenser â&#x20AC;&#x201C; 865.07.4200 â&#x20AC;˘ JRT Twin Roll Dispenser â&#x20AC;&#x201C; 865.07.3253 â&#x20AC;˘ Sold by case

 â&#x20AC;˘ Single Jr. Jumbo Roll Dispenser â&#x20AC;˘ Perfect for high traffic areas where space is limited â&#x20AC;˘ Holds one 9â&#x20AC;? diameter rolls with 3.3â&#x20AC;? cores â&#x20AC;˘ Virtually indestructible

 â&#x20AC;˘ Twin Jr. Jumbo Roll Dispenser â&#x20AC;˘ Perfect for high traffic areas â&#x20AC;˘ Holds two 9â&#x20AC;? diameter rolls with 3.3â&#x20AC;? cores â&#x20AC;˘ Access control slide eliminates stub roll waste

921'5(+/()2/'('72:(/6 <RXGRQÂśWKDYHWRFKRRVHEHWZHHQUHF\FOHGSDSHUDQGVXSHULRUSHUIRUPDQFH7KHVHVRIWDEVRUEHQWWRZHOVKDYHDGU\LQJVWUHQJWKWKDWUHGXFHVFRQVXPSWLRQ 3DFNDJHGIRUHDV\KDQGOLQJDQGVWRUDJHWKHVHSUHPLXPWRZHOVSURYLGHVRIWQHVVDQGDEVRUEHQF\\RXUFXVWRPHUVZLOODSSUHFLDWH,GHDOIRURIILFHEXLOGLQJV KRWHOVUHVWDXUDQWVFROOHJHRUXQLYHUVLWLHV  &IROG â&#x20AC;˘ Towels combine a quality look & feel with economy and practicality â&#x20AC;˘ Sheet Size: 10-1/8â&#x20AC;? x 13â&#x20AC;? â&#x20AC;˘ 150 Towels per pack â&#x20AC;˘ 16 packs per case â&#x20AC;˘ Made from 100% recycled fiber â&#x20AC;˘ Dispenser: 865.07.175 â&#x20AC;˘ Sold by case

 â&#x20AC;˘ C-Fold/Multifold Combination Dispenser â&#x20AC;˘ Transparent smoke cover â&#x20AC;˘ Holds 300 C-fold or 500 Multifold towels at one time â&#x20AC;˘ Size: 5â&#x20AC;?D x 11.25â&#x20AC;?W x 15.25â&#x20AC;?H

./((1='5&:,3(56

 0XOWLIROG â&#x20AC;˘ Each full size towel is dispensed individually assuring superior hygiene & continuous dispensing â&#x20AC;˘ Sheet Size: 9-1/4â&#x20AC;? x 9-1/2â&#x20AC;? â&#x20AC;˘ 250 Towels per pack â&#x20AC;˘ 16 Packs per case â&#x20AC;˘ Green Seal Certified â&#x20AC;˘ Dispenser: 865.07.175 â&#x20AC;˘ Sold by case

921'5(+/()$&,$/7,668(

7KHVHVRIWZKLWHWLVVXHVDUHGHVLJQHGIRUXVHDORQHRULQDFRXQWHUWRS GLVSHQVHU%HFDXVHWKHVHWLVVXHVHDVLO\SXOORXWRQHDWDWLPHIHZHUDUH XVHG  â&#x20AC;˘ 2 Ply â&#x20AC;˘ Sheet Size: 8.5â&#x20AC;? x 7.5â&#x20AC;? â&#x20AC;˘ 100 Sheets per box â&#x20AC;˘ 30 boxes per case â&#x20AC;˘ Sold by case

'5& 'RXEOH5H&UHSH :LSHUVDUHWKHPRVWSRSXODUJHQHUDOSXUSRVHZLSHUVXVHGWRGD\7KH\KDYHD VRIWRXWHUOD\HUZLWKDKLJKO\DEVRUEHQWLQQHUOD\HUWKDWHDVLO\DEVRUEVDYDULHW\RIOLTXLGVLQFOXGLQJVROYHQWV RLODQGRWKHUOXEULFDQWVZLWKRXWEUHDNLQJGRZQ'5&ZLSHUVDUHVRIWHQRXJKWREHXVHGRQIDFHDQG KDQGVDQGGXUDEOHHQRXJKWRKDQGOHPRVWVROYHQWV&DQEHXVHGLQDQDVVRUWPHQWRI$SSOLFDWLRQV LQFOXGLQJ&DU'HDOHUVKLSV2LO /XEH6KRSV6HUYLFH6WDWLRQV0DLQWHQDQFH)DFLOLWLHV )RRGVHYLFH0DQXIDFWXULQJ8WLOLWLHVDQG3URGXFWLRQHQYLURQPHQWV â&#x20AC;˘ Professional Quality â&#x20AC;˘ Highly Absorbent â&#x20AC;˘ Perfect All-Purpose Wiper â&#x20AC;˘ Cleans Grease, Oil, Water & Solvents with One Wipe â&#x20AC;˘ Wipes Dry, No Smearing or Streaking

683(5:,3(56727(%2;

6(/(&7Â&#x152;:,3(632383%2;

 ²7RWH%R[  ²&DVHRI7RWHV â&#x20AC;˘ Wiper Size: 9â&#x20AC;? x 12â&#x20AC;? â&#x20AC;˘ Color: White â&#x20AC;˘ Box Qty: 225 Wipes â&#x20AC;˘ Sold by Tote Box

 ²3RS8S%R[  ²&DVHRI3RS8S%R[HV â&#x20AC;˘ Wiper Size: 9â&#x20AC;? x 16.5â&#x20AC;? â&#x20AC;˘ Color: White â&#x20AC;˘ Box Qty: 113 Wipes â&#x20AC;˘ Case Qty: 8 Boxes â&#x20AC;˘ Sold by Box

7+(&+$03Â&#x160;&(17(538//52//  ²5ROOVSHU&DVH  ²5ROOVSHU&DVH  ².OHHQ]&HQWHU3XOO'LVSHQVHU â&#x20AC;˘ Wiper Size: 9â&#x20AC;? x 12â&#x20AC;? â&#x20AC;˘ Color: White â&#x20AC;˘ Roll Qty: 300 Wipes â&#x20AC;˘ Case Qty: 2 Rolls â&#x20AC;˘ Sold by Case

&RS\ULJKWÂ&#x2039;

43


Paper Products & Wipers 725.6+230$;:,3(56 • • • •

Highly absorbent - excellent wipe-dry capabilities Strong enough to power through oil, grease & solvents - versatile enough for everyday, general cleanup & spills Thick, low linting cloth-like construction - excellent replacement for cloth rags Durability & high performance characteristics make these a perfect choice for a wide variety of uses

725.6+230$;32383%2;

725.6+230$;&(17(5)(('%2;

• Size: 9.5” x 16.5” • Color: White • Box Qty: 100 Wipers • Case Qty: 8 Boxes • Dispenser: 865.05.4050

• ShopMax Size: 9” x 13” • Color: White • Box Qty: 200 Wipers • Case Qty: 4 Boxes

725.6+230$;52//

725.6+230$;&(17(5)(('

• Size: 9” x 13” • Color: Blue • Roll Qty: 56 Wipers • Case Qty: 30 Rolls

• Bucket Dispenser • Size: 10” x 13” • Color: White • Bucket Qty: 200 Wipes • Case Qty: 2 Buckets • Refill: 865.02.2501

725.6+230$;&(17(5)(('5(),//

725.6+230$;&(17(5)(('

• Bucket Dispenser Refill • Size: 10” x 13” • Color: White • Roll Qty: 200 Wipes • Case Qty: 2 Rolls

• Bucket Dispenser • Size: 10” x 13” • Color: Blue • Bucket Qty: 200 Wipes • Case Qty: 2 Buckets • Refill: 865.02.2601

725.6+230$;&(17(5)(('5(),//

725.&(17(5)(('-80%252//

865.02.2000 ²6KRS0D[3RS8S%R[

865.02.2200 ²6KRS0D[5ROO

865.02.2501 ²6KRS0D[&HQWHUIHHG'U\:LSH5HILOO

865.02.2601 ²6KRS0D[&HQWHUIHHG'U\:LSH5HILOO

• Bucket Dispenser Refill • Size: 10” x 13” • Color: Blue • Roll Qty: 200 Wipes • Case Qty: 2 Rolls

44

865.02.2100 ²6KRS0D[&HQWHUIHHG%R[

865.02.2500 ²6KRS0D[&HQWHUIHHG'U\:LSH

865.02.2600 ²6KRS0D[&HQWHUIHHG'U\:LSH

865.02.2700 ²Centerfeed - Jumbo Roll

• Size: 9.8” x 13.25” • Color: Blue • Roll Qty: 800 Wipes • Dispenser - 865.05.5050

&RS\ULJKW‹


Paper Products & Wipers 725.$'9$1&('32383%2;

725.$'9$1&('&(17(5)(('52//

865.01.1000 ²3RS8S%R[

865.01.1100 ²&HQWHUIHHG5ROO

â&#x20AC;˘ Size: 9.5â&#x20AC;? x 16.5â&#x20AC;? â&#x20AC;˘ Color: White â&#x20AC;˘ Box Qty: 100 Wipers â&#x20AC;˘ Case Qty: 8 Boxes â&#x20AC;˘ Dispenser - 865.05.4050 â&#x20AC;˘ Highly absorbent - excellent wipe-dry capabilities â&#x20AC;˘ Soft, cloth-like feel â&#x20AC;˘ Strong & durable, wonâ&#x20AC;&#x2122;t tear easily

â&#x20AC;˘ Size: 9.5â&#x20AC;? x 16.5â&#x20AC;? â&#x20AC;˘ Color: White â&#x20AC;˘ Roll Qty: 300 Wipers â&#x20AC;˘ Case Qty: 2 Rolls â&#x20AC;˘ Dispenser - 865.05.4000 â&#x20AC;˘ Highly absorbent - excellent wipe-dry capabilities â&#x20AC;˘ Soft, cloth-like feel â&#x20AC;˘ Strong & durable, wonâ&#x20AC;&#x2122;t tear easily

725.35(0,8032383%2;

725.',63(16(56

865.03.3000 ²3RS8S%R[

 â&#x20AC;˘ Centerfeed Dispenser â&#x20AC;˘ 13â&#x20AC;?H x 10â&#x20AC;?W x 11â&#x20AC;?D

â&#x20AC;˘ Size: 8.5â&#x20AC;? x 16.5â&#x20AC;? â&#x20AC;˘ Color: White â&#x20AC;˘ Box Qty: 80 Wipers â&#x20AC;˘ Case Qty: 5 Boxes â&#x20AC;˘ Dispenser - 865.05.4050 â&#x20AC;˘ Premium cloth wipers are perfect choice for cleaning surfaces, tools & other heavy-duty maintenance â&#x20AC;˘ High absorbency makes cleaning oil, grime and solvents quick & easy â&#x20AC;˘ Low lint design makes them perfect for most jobs

 â&#x20AC;˘ Floor Stand Dispenser

35272:(/Â&#x160;+($9<'87<

3URIHVVLRQDO4XDOLW\+HDY\'XW\6SXQODFH6KRS7RZHOV

.OHHQ]6SXQODFH7RZHOVDUHQRQZRYHQZRRGSXOSSRO\HVWHUIDEULFHQJLQHHUHGIRUFORWKOLNHSHUIRUPDQFH PXOWLSOHUHXVH 3HUIHFWIRUWKHPRVWGHPDQGLQJZLSLQJMREVUHTXLULQJSUHFLVLRQFOHDQLQJZLWKRXWEUHDNLQJGRZQRUIDOOLQJDSDUW6XSHUEZHW VWUHQJWKZLSHGU\SHUIRUPDQFHYLUWXDOO\OLQWIUHHDQGVROYHQWUHVLVWDQW)RUXVHLQ0DQXIDFWXULQJ$XWRPRWLYHVKRSV%RG\VKRSV &DU'HDOHUVKLSV0DFKLQHVKRSV(QJLQH5HEXLOGHUV'HWDLOHUV+LJKWHFK(QJLQHHULQJ8WLOLWLHV,QGXVWULDO3ODQWV)RRG6HUYLFH DQGPRUH â&#x20AC;˘ Top of the Line Rag & Shop Towel Replacement â&#x20AC;˘ Super Strong â&#x20AC;˘ Solvent Resistant â&#x20AC;&#x201C; wonâ&#x20AC;&#x2122;t breakdown in most aggressive solvents â&#x20AC;˘ Highly Absorbent â&#x20AC;˘ Virtually Lint Free  ²7RWH%R[ â&#x20AC;˘ Towel Size: 10.5â&#x20AC;? x 15â&#x20AC;? â&#x20AC;˘ Color: White â&#x20AC;˘ Tote Box Qty: 200 Wipes â&#x20AC;˘ Sold by Tote Box

 ²6LQJOH5ROO â&#x20AC;˘ Towel Size: 12â&#x20AC;? x 12â&#x20AC;? â&#x20AC;˘ Color: White â&#x20AC;˘ Roll Qty: 500 Wipes â&#x20AC;˘ Sold by Roll

683(535(3Â&#x152;72:(/

3URIHVVLRQDO4XDOLW\+LJK3HUIRUPDQFH6SXQODFH7RZHO2QHRIWKHEHVWSUHSSLQJWRZHOVIRUWKH,QGXVWULDO$XWRPRWLYHLQGXVWU\ â&#x20AC;˘ Rated for use by Commercial & Professional Painters, Bright workers & Body Shops as a Prep Wipe â&#x20AC;˘ Ultra Strong Wet or Dry â&#x20AC;˘ Ideal For Many other Industries â&#x20AC;˘ Virtually Lint-Free â&#x20AC;˘ Solvent-Resistant â&#x20AC;˘ Absorbs Large Amounts of Water, Grease, and Oil â&#x20AC;˘ Will not scratch surfaces and are Tear-Resistant

683(535(3Â&#x152;72:(/727(%2;

683(535(3Â&#x152;72:(/-80%252//

 ²7RWH%R[ â&#x20AC;˘ Wiper Size: 9â&#x20AC;? x 15â&#x20AC;? â&#x20AC;˘ Color: Blue â&#x20AC;˘ Tote Box Qty: 200 Wipes â&#x20AC;˘ Sold by Tote Box

 ²6LQJOH5ROO  ².OHHQ])ORRU6WDQG'LVSHQVHU â&#x20AC;˘ Wiper Size: 12â&#x20AC;? x 12â&#x20AC;? â&#x20AC;˘ Color: Blue â&#x20AC;˘ Roll Qty: 1,000 Wipes â&#x20AC;˘ Sold by Roll

&RS\ULJKWÂ&#x2039;

45


Paper Products & Wipers 683(55$*Â&#x152;81,9(56$/

352&(//Â&#x152;81,9(56$/

683(55$*Â&#x152;81,9(56$/

352&(//Â&#x152;81,9(56$//,*+7 '87<727(%2;

3URIHVVLRQDO4XDOLW\+LJK3HUIRUPDQFH6SXQODFH7RZHOV â&#x20AC;˘ High Performance Prepping Towel with Value Pricing â&#x20AC;˘ Highly Absorbent â&#x20AC;˘ Solvent-Resistant â&#x20AC;˘ Virtually Lint-Free â&#x20AC;˘ Waterborne Compatible  ²7RWH%R[ â&#x20AC;˘ Great for Autobody Shops, Paint Booths & many other general uses â&#x20AC;˘ Wiper Size: 13â&#x20AC;? x 16â&#x20AC;? â&#x20AC;˘ Box Qty: 300 Wipers â&#x20AC;˘ Color: White â&#x20AC;˘ Sold by Box

683(55$*Â&#x152;81,9(56$/-80%252//

+LJK4XDOLW\(FRQRPLFDO$OO3XUSRVH7RZHO â&#x20AC;˘ Perfect for Light-Duty Tasks â&#x20AC;˘ Great Rag & Shop Towel Replacement â&#x20AC;˘ Strong & Absorbent â&#x20AC;˘ Waterborne Compatible

 ²7RWH%R[ â&#x20AC;˘ Wiper Size: 9â&#x20AC;? x 15â&#x20AC;? â&#x20AC;˘ Color: White â&#x20AC;˘ Box Qty: 320 Wipes â&#x20AC;˘ Sold by Box

&2/25('76+,5772:(/6

 ²6LQJOH5ROO  ².OHHQ])ORRU6WDQG'LVSHQVHU â&#x20AC;˘ Wiper Size: 12â&#x20AC;? x 12â&#x20AC;? â&#x20AC;˘ Color: White â&#x20AC;˘ Roll Qty: 1,100 Wipes â&#x20AC;˘ Sold by Roll

 ²OEV â&#x20AC;˘ Made from color knits and T-shirt type material â&#x20AC;˘ Soft and absorbent material â&#x20AC;˘ Great polishing and wiping cloth

72,/(76($7&29(56

6+2372:(/6

 ²3DFN â&#x20AC;˘ Half-fold â&#x20AC;˘ 14.5â&#x20AC;? x 17.25â&#x20AC;? â&#x20AC;˘ 250 seat covers per package

'HVFULSWLRQ

6L]H

3DFNDJLQJ

3DUW1R

6KRS7RZHO 5HG

´[´

7RZHOVEXQGOH



7HUU\7RZHO :KLWH ´[´

WRZHOVEXQGOH



&RWWRQ5DJV :KLWH

%R[ â&#x20AC;˘ Multi-use â&#x20AC;˘ Washable â&#x20AC;˘ 100% cotton; pre-washed â&#x20AC;˘ Shop towel (Red), Terry towel (White) â&#x20AC;˘ Sold by the bundle

+($9<:(,*+7:,3(56 &RORU %OXH

:LSHUV%R[ 3DUW1R  

â&#x20AC;˘ Made for the toughest clean-ups â&#x20AC;˘ Extra Strong â&#x20AC;˘ Pop up box - wiper size: 9.5â&#x20AC;? x 16.5â&#x20AC;?



0,&52),%(572:(/6 &RORU <HOORZ

6L]H

3DUW1R

[ 

*UHHQ

[ 

%OXH

[ 

:KLWH

[ 

â&#x20AC;˘ Removes smudges, grease & oils with ease â&#x20AC;˘ Safe for all surfaces - including clear coat â&#x20AC;˘ Picks up dust & microparticles like a magnet â&#x20AC;˘ Machine washable without bleach or softeners â&#x20AC;˘ 16â&#x20AC;? x 16â&#x20AC;? â&#x20AC;˘ Sold 12 per bag

46

&RS\ULJKWÂ&#x2039;


Floor Care

Floor Care &27721$1'5$<21023+($'6

)/2253$&Â&#x160;%/(1'/223023

 ²R]FRWWRQ  ²R]FRWWRQ  ²R]UD\RQ  ²R]UD\RQ â&#x20AC;˘ Made of 4 ply highly absorbent, long wearing yarns â&#x20AC;˘ Mops are sewed 2 times â&#x20AC;˘ Band is 1-1/4â&#x20AC;? wide â&#x20AC;˘ Cotton = better absorbency â&#x20AC;˘ Rayon = better durability

 ²:KLWH0HG  ²:KLWH/DUJH  ²%OXH0HGLXP  ²%OXH/DUJH â&#x20AC;˘ Highly absorbent and durable blended 4-ply yarn â&#x20AC;˘ Looped-end construction provides greater floor coverage

/223('(1''5<023

&27721&+$1*(50236<5

 ²´  ²´  ²´

 ²/%OXH  ²/*UHHQ â&#x20AC;˘ Patented spin open design to reveal underside of mop â&#x20AC;˘ Color: Blue â&#x20AC;˘ Use with handle 691.850

â&#x20AC;˘ 2-ply loop-end cotton yarn construction prevents fraying and raveling â&#x20AC;˘ Slip-on slot pocket; easiest and fastest method to secure dust mop to frame â&#x20AC;˘ Fits standard 5â&#x20AC;? dust mop frames

&RS\ULJKWÂ&#x2039;

47


Floor Care 023+$1'/(

48,&.&+$1*('5<023+$1'/(

 â&#x20AC;˘ Zinc-plated steel construction securely fastened to a No. 1 grade 1-1/8â&#x20AC;? diameter handle â&#x20AC;˘ Quick-change type â&#x20AC;˘ 7â&#x20AC;? head for 20 to 32 oz. mop heads

 ²´ â&#x20AC;˘ Zinc-plated steel construction securely fastened to a No. 1 grade 1-1/8â&#x20AC;? diameter handle â&#x20AC;˘ Quick-change type â&#x20AC;˘ 7â&#x20AC;? head for 20 to 32 oz. mop heads

48,&.&+$1*(0(7$/+($' 023+$1'/(

)/2256:((3

 ²´ â&#x20AC;˘ Quck change metal head â&#x20AC;˘ Easy loading â&#x20AC;˘ Fits mop heads #20 and up

 â&#x20AC;˘ For wet or dry sweeping rough or semi-smooth concrete, wood, asphalt, etc. â&#x20AC;˘ Black plastic 3â&#x20AC;&#x201C;1/8â&#x20AC;? bristles â&#x20AC;˘ 24â&#x20AC;? wide clear lacquered hardwood block â&#x20AC;˘ Comes with 5 ft. hardwood lacquered handle

*$5$*(%586+

)/2256:((3 &2$56(

 â&#x20AC;˘ For wet or dry heavy-duty sweeping of concrete, sidewalks, garage and factory floors â&#x20AC;˘ 24â&#x20AC;? wide lacquered hardwood block â&#x20AC;˘ Palmyra fill, 4â&#x20AC;? trim â&#x20AC;˘ Use with hardwood handle #691.1516 or plastic coated metal handle #691.1518 â&#x20AC;˘ Handle sold separately

 â&#x20AC;˘ For wet or dry sweeping of rough concrete or asphalt floors. â&#x20AC;˘ Will not soften when exposed to water, oils, or greases â&#x20AC;˘ Coarse brown plastic 3â&#x20AC;&#x201C;1/8â&#x20AC;? bristles â&#x20AC;˘ 24â&#x20AC;? wide clear lacquered hardwood block â&#x20AC;˘ Comes with 5 ft. hardwood lacquered handle

728*+6:((3 0(',80

)/2256:((3

 â&#x20AC;˘ For semi-smooth tile, concrete and blacktop â&#x20AC;˘ Yellow synthetic 3â&#x20AC;? trim bristles â&#x20AC;˘ 18â&#x20AC;? wide snythetic block will not split, crack or warp â&#x20AC;˘ Comes with 5â&#x20AC;&#x2122; handle

 â&#x20AC;˘ For sweeping smooth, highly polished floors, varnished woods and smooth concrete. â&#x20AC;˘ Will sweep very fine dust and grit. â&#x20AC;˘ Silver flagged-tip plastic 3 inch long bristles â&#x20AC;˘ 24â&#x20AC;? wide clear lacquered hardwood block â&#x20AC;˘ Comes with 5 ft. hardwood lacquered handle

5(3/$&(0(17 +$1'/(

3/$67,&&2$7(' 0(7$/+$1'/(

 â&#x20AC;˘ Made of hardwood with a clear lacquered finnish â&#x20AC;˘ One end rounded and the other with crimped-on metal threads to fit standard floor sweeps â&#x20AC;˘ 15/16â&#x20AC;? diameter, 5 foot long

 â&#x20AC;˘ Reinforced, heavy-duty metal handle â&#x20AC;˘ Yellow plastic coating with hang tab â&#x20AC;˘ 15/16â&#x20AC;? diameter, 5 foot length

48

0(',80

),1(

&RS\ULJKWÂ&#x2039;


Floor Care ),%(5*/$66+$1'/( ´:+,7(

$/80,1806:,9(/*5,3 +$1'/(´6<5

 â&#x20AC;˘ Fiberglass construction â&#x20AC;˘ Threaded tip â&#x20AC;˘ 1â&#x20AC;? Diameter, 60â&#x20AC;? long â&#x20AC;˘ White *approved for food industry

 â&#x20AC;˘ Heavy Duty aluminum handle â&#x20AC;˘ Use with SYR interchange mops, brushes, squeeges

&87(1' &277211%023

5(3/$&(0(17 +$1'/(7+5($'

 ²:KLWH  ²:KLWH â&#x20AC;˘ 4 Ply Cotton â&#x20AC;˘ Narrow Band â&#x20AC;˘ Use with Quick change handle

 â&#x20AC;˘ Made of heavy duty fiberglass for any 15/16â&#x20AC;? diameter handle

/,*+7'87<

02'(5$7('87<

 â&#x20AC;˘ Made of best quality broom corn and fibre â&#x20AC;˘ Sewed 4 times â&#x20AC;˘ Handle has a clear lacquered finish

 â&#x20AC;˘ Made of best quality broom corn and fibre â&#x20AC;˘ Sewed 5 times â&#x20AC;˘ Broom cap has velvet trim â&#x20AC;˘ Handle has a black lacquered finish

+($9<'87<

:+,6.%5220

 â&#x20AC;˘ Made of best quality broom corn and fibre â&#x20AC;˘ Sewed 4 times and reinforced with wire band â&#x20AC;˘ Made on a heavy-duty handle

 â&#x20AC;˘ Made of selected fine broom corn â&#x20AC;˘ 11 inch wide sweep

+$1'/(%5$&(

'5<023)5$0(

 â&#x20AC;˘ Heavy Duty handle brace made of aluminum bar stock â&#x20AC;˘ Fits all the above brooms â&#x20AC;˘ Comes with all screws and wing nuts â&#x20AC;˘ Broom sold separately &RS\ULJKWÂ&#x2039;

 ²;  ²;  ²; â&#x20AC;˘ 5â&#x20AC;? frames are constructed of 1/4â&#x20AC;? steel rods; resist rusting â&#x20AC;˘ Janitorial grade â&#x20AC;˘ Perfect for gyms, halls, and large floors

49


Floor Care *5287%586+6<5

6:,9(/'(&.%586+6<5

´)/2256&5$3(56<5

´)/225648((*((6<5

 ²%ON%OXH â&#x20AC;˘ Tough polypropylene bristles â&#x20AC;˘ Angled Bristles for cleaning grout between tiles and floor edges â&#x20AC;˘ Use with hadle 691.850



â&#x20AC;˘ 8â&#x20AC;? metal floor scraper with blade â&#x20AC;˘ Use with handle 691.850

&20%20-%8&.(7(:5,1*(5  ²%OXH â&#x20AC;˘ Polypropylene bucket and wringer basket â&#x20AC;˘ Ergonomic design taller for less bending â&#x20AC;˘ Casters are non marking

 ²%OXH â&#x20AC;˘ Tough polypropylene bristles â&#x20AC;˘ For use on hard floors â&#x20AC;˘ Great for baseboards â&#x20AC;˘ Use with handle 691.850

 ² â&#x20AC;˘ 22â&#x20AC;? Black Moss Floor Squeegee â&#x20AC;˘ Use with handle 691.850

72</2%%<3/$67,&%5220

 ²%ODFN â&#x20AC;˘ Long-lasting poly bristles ensure effective sweeping action

612:%5220  â&#x20AC;˘ Industrial Grade polyethylene foam molded head endures the harshest conditions and hundreds of vehicle clearings. â&#x20AC;˘ Approved for use on Class A finishes and received the highest rating possible from an independent testing lab for nonabrasiveness, freeze resistance and durability â&#x20AC;˘ 5-3/4â&#x20AC;? x 17â&#x20AC;? head weighs only 8 ounces â&#x20AC;˘ 48â&#x20AC;? Vinyl coated metal handle â&#x20AC;˘ Used by Auto Dealers, Municipal Agencies, Utility Company Fleets, Park â&#x20AC;&#x2DC;nâ&#x20AC;&#x2122; Fly lots, Valet Services

50

&RS\ULJKWÂ&#x2039;


Floor Care ´)2$0)/225648((*((6

648((*((7$3(5+$1'/(6

 ²5HGIDWDQGRLOUHVLVWDQW  ²%ODFNVWDQGDUG â&#x20AC;˘ Uses 5 ft. wooden handle - 15/16â&#x20AC;? diameter w/ tapered end â&#x20AC;˘ Soft and durable foam blade â&#x20AC;˘ Heavy duty metal frame â&#x20AC;˘ For Use On: Uneven, grouted and smooth surface floors â&#x20AC;˘ For Use In: Shop areas, supermarkets, warehouses, kitchens and much more

 ´GLDPHWHUIRRWOHQJWK  ¹´GLDPHWHUIRRWOHQJWK

)/225$1''5,9(:$<648((*((6

'8673$16

/2%%<'8673$1

0,&52),%(5'8673$'

 ²6WUDLJKW6TXHHJHH´  ²&XUYHG6TXHHJHH´ â&#x20AC;˘ 2â&#x20AC;? wide x 1/2â&#x20AC;? thick high grade neoprene squeegee strip attached with plated screws â&#x20AC;˘ Aluminum frame with taper handle socket â&#x20AC;˘ Use with taper handle below (order separately)

 â&#x20AC;˘ 12â&#x20AC;? Plastic lobby pan w/metal handle â&#x20AC;˘ Pivoting bucket locks open for hands-free disposal â&#x20AC;˘ Designed for use on both hard or soft floor surfaces

648((*((.,7

 ²´UHGIRDPZKDQGOH  ²´EODFNIRDPZKDQGOH ¹´GLDPHWHUIRRWOHQJWK

 ²LQFKHGJH  ²LQFKHGJH â&#x20AC;˘ 20 gauge metal dust pans â&#x20AC;˘ Black enamel finish â&#x20AC;˘ Corrugated ribs for added strength

 ²%OXH´  ²%OXH´ â&#x20AC;˘ Microfiber removes dust from all surface types â&#x20AC;˘ Ideal for cleaning large areas, such as hallways

0,&52),%(5:(70233$'

0,&52),%(53$'+2/'(5

 ²%OXH´  ²%OXH´ â&#x20AC;˘ Dries quicker, cleans more thoroughly than a standard mop â&#x20AC;˘ Looped end microfiber reduces drag â&#x20AC;˘ Can also be used for finish application

 ²´  ²´ â&#x20AC;˘ Aluminum frame â&#x20AC;˘ Hook and loop attachment for wet or dry pads â&#x20AC;˘ Fits extension handle 691.50100

$/80,180(;7(16,21+$1'/(  â&#x20AC;˘ Extends from 32â&#x20AC;? to 72â&#x20AC;? â&#x20AC;˘ Lightweight â&#x20AC;˘ Use with pad holders 691.50018 and 691.50024

&RS\ULJKWÂ&#x2039;

51


Floor Care %/$&.87,/,7<3$' '(7$,/3$')25675,33,1*  â&#x20AC;˘ Ideal for stripping floor finish in hard-to-reach places. â&#x20AC;˘ Easily reached into corners and under fixtures. â&#x20AC;˘ 4â&#x20AC;? X 10â&#x20AC;? â&#x20AC;˘ Fits Swivel Pad Holder - 691.36538

6:,9(/3$'+2/'(5 '(7$,/3$'+2/'(5  â&#x20AC;˘ Ideal cleaning tool for reaching hard to get at places like baseboards, stairs, under fixtures and furniture. â&#x20AC;˘ Hundreds of tiny hooks on the base of these holders secure the utility pad firmly in place. â&#x20AC;˘ The pad simply peels away from the holder for reversing or replacing. â&#x20AC;˘ Use with Black Utility Pad â&#x20AC;&#x201C; 691.541040

+($9<'87<%/$&.)/2253$' +($9<'87<675,33,1*3$' ²´&DVHRI ²´&DVHRI ²´&DVHRI ²´&DVHRI â&#x20AC;˘ Extra aggressive pad. â&#x20AC;˘ Excellent for removal of burnished floor finishes. â&#x20AC;˘ For use with machines up to 350 RPM

5(')/2253$' 6&58%%,1*3$' ²´&DVHRI ²´&DVHRI ²´&DVHRI ²´&DVHRI â&#x20AC;˘ For light cleaning and buffing. â&#x20AC;˘ Removes light scuff marks and dirt while producing a high gloss shine. â&#x20AC;˘ For use with machines up to 800 RPM

:+,7()/2253$' 32/,6+,1*%851,6+,1*3$' ²´&DVHRI ²´&DVHRI â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

Extra fine pad for polishing clean dry floors. Use to buff soft finishes and low traffic areas. Ideal for marble floors. Machine Speed: Up to 3000 RPM

52

&RS\ULJKWÂ&#x2039;


Maintenance Tools & Supplies

Maintenance Tools & Supplies 3$576&/($1,1*%586+  â&#x20AC;˘ Nylon Bristles â&#x20AC;˘ Natural Lacquered Handle â&#x20AC;˘ 11â&#x20AC;&#x2122;â&#x20AC;&#x2122; Overall Length

&+,3$1'2,/%586+ 3DUW1R

6L]H

      

      

â&#x20AC;˘ White Bristles â&#x20AC;˘ Smooth sanded handle with tin ferrule â&#x20AC;˘ 7-1/2â&#x20AC;&#x2122;â&#x20AC;&#x2122; Overall Length

6+2(+$1'/(6&5$7&+%586+  â&#x20AC;˘ Stainless steel bristles â&#x20AC;˘ Hardwood handle â&#x20AC;˘ Overall length 10â&#x20AC;? â&#x20AC;˘ Length of trim 1-1/8â&#x20AC;?

&RS\ULJKWÂ&#x2039;

6+2(+$1'/(6&5$7&+%586+ 690.8400

â&#x20AC;˘ Carbon steel bristles â&#x20AC;˘ Hardwood handle â&#x20AC;˘ Overall length 10â&#x20AC;?

53


Maintenance Tools & Supplies +($9<'87<0,//'867(5

SHOE HANDLE SCRATCH BRUSH

 â&#x20AC;˘ With brown plastic fill 1-3/4â&#x20AC;? trim length â&#x20AC;˘ Clear lacquered hardwood block â&#x20AC;˘ Popular in machine shops for clearing metal chips from drill presses, lathes, etc. â&#x20AC;˘ Overall Length: 13â&#x20AC;?

 â&#x20AC;˘ Stainless steel bristles â&#x20AC;˘ Hardwood Handle â&#x20AC;˘ Overall Length 10â&#x20AC;? â&#x20AC;˘ Length of trim 3/4â&#x20AC;?

&859('+$1'/(6&5$7&+%586+

:22'(1+$1'/(³7227+%586+´ 6&5$7&+%586+

 â&#x20AC;˘ Carbon Steel Bristles â&#x20AC;˘ Hardwood Handle â&#x20AC;˘ Overall Length 14â&#x20AC;?

3/$67,&+$1'/(³7227+%586+´ 6&5$7&+%586+(6  ²6WDLQOHVV6WHHO%ULVWOHV  ²%UDVV%ULVWOHV  ²1\ORQ%ULVWOHV

 â&#x20AC;˘ Stainless Steel Bristles

35(0,80:22'+$1'/(),77,1* %586+(6 3DUW1R

6L]H

 ´  ´  ´  ´  ´ â&#x20AC;˘ 4â&#x20AC;? solid birch wood handle â&#x20AC;˘ Single spiral 2-ply tempered carbon steel bristles â&#x20AC;˘ Bristles contain 20% more material than standard fitting brushes

+$1'/(6&58%%586+

+$1'$1'1$,/%586+

 â&#x20AC;˘ Crimped white polypropylene bristles â&#x20AC;˘ One piece plastic block and handle â&#x20AC;˘ Raised handle design â&#x20AC;˘ Block size: 6-1/2â&#x20AC;?L x 2-1/4â&#x20AC;?W â&#x20AC;˘ Length of Bristles: 1-1/8â&#x20AC;?

 â&#x20AC;˘ Smooth hardwood block â&#x20AC;˘ Natural tampico bristles â&#x20AC;˘ Block size: 4-3/4â&#x20AC;?L x 1-1/2â&#x20AC;?W â&#x20AC;˘ Length of Bristles: 5/8â&#x20AC;?

$&,'%586+(6

'(/8;(72,/(7%2:/023

 ²´  ²´

 â&#x20AC;˘ Full 1.oz, 5-3/4â&#x20AC;? mop head for greater absorbency â&#x20AC;˘ Acid-resistant polypropylene strands â&#x20AC;˘ 12â&#x20AC;? strong l-beam plastic handle, polypropylene â&#x20AC;˘ White mop head with blue handle

54

&RS\ULJKWÂ&#x2039;


Maintenance Tools & Supplies 6&58%%(56

.85/<.$7(6&58%%(5

 ²/LJKW'XW\;  ²0HGLXP'XW\;  ²([WUD+HDY\'XW\; â&#x20AC;˘ Light Duty: an extra soft pad for delicate surfaces, Ideal for porcelain sinks, tubs and toilet bowls. Also works well for cleaning rubber, vinyl, ceraminc tile, dishes, stainless steel, metal furniture and fixtures. Color: White â&#x20AC;˘ Medium Duty: For general duty cleaning. Ideal for daily cleaning of pots, pans, utensils and kitchen equipment. Color: Green â&#x20AC;˘ Extra Heavy Duty: For extra aggressive cleaning. Excellent for removing built-up grease and burned-on foods form pots, pans, ovens & broilers. Also ideal for removing rust corrosion. Color: Green

 6WDLQOHVV6WHHO â&#x20AC;˘ The ideal cleaning solution for tough chores â&#x20AC;˘ Rust free, Splinter free

81,9(56$/$%625%(1762&.6

81,9(56$/$%625%(173$'6

 ²6LQJOH6RFN  ²6RFN&DVH â&#x20AC;˘ Use for water and oil based fluids â&#x20AC;˘ 3â&#x20AC;? x 4â&#x20AC;&#x2122; â&#x20AC;˘ Color: Gray

3DUW1R

7\SH

6L]H

     

/LJKW 0HGLXP +HDY\ &DVHRI/LJKW &DVHRI0HGLXP &DVHRI+HDY\

[ [ [ [ [ [

â&#x20AC;˘ Use for water and oil based fluids â&#x20AC;˘ Point Bonded for strength â&#x20AC;˘ Perforated so you use only what you need â&#x20AC;˘ Color: Gray

2,/%$6('$%625%(173$'6 3DUW1R

7\SH

6L]H

   

2LO3DG +HDY\3DG &DVHRI2LO &DVHRI+HDY\

[ [ [ [

â&#x20AC;˘ Use for petroleum based fluids only â&#x20AC;˘ Point bonded for strength â&#x20AC;˘ Color: White

'580723$%625%(173$' 3DUW1R

7\SH

4W\

 $OO)OXLG'UXP7RS3DG 6LQJOH  $OO)OXLG'UXP7RS3DG &DVHRI  2LO2QO\'UXP7RS3DG 6LQJOH  2LO2QO\'UXP7RS3DG &DVHRI â&#x20AC;˘ Cut to fit the top of any 55 gallon drum

81,9(56$/$%625%(1752//

2,/%$6('$%625%(1752//6

 6LQJOH5ROO  5ROO3DFN â&#x20AC;˘ Use with water and oil based fluids â&#x20AC;˘ 32â&#x20AC;? x 150â&#x20AC;? Perforated Roll â&#x20AC;˘ Color: Gray

 ´[´5ROO â&#x20AC;˘ Use for Petrolem based fluids only â&#x20AC;˘ Color: White

&RS\ULJKWÂ&#x2039;

55


Maintenance Tools & Supplies 052%8&.(763,//.,7

%$77(5<$&,'63,//.,7

 â&#x20AC;˘ Self-contained kit packed in reusable 5 gallons pail â&#x20AC;˘ Absorbs all types of fluids â&#x20AC;˘ Kit Contains: (10) universal perforated pads (16â&#x20AC;? x 20â&#x20AC;?)   XQLYHUVDOVRFNV ´[´

  GLVSRVDEOHEDJZLWKWLH

 â&#x20AC;˘ (2) Quarts Kolor-SafeÂŽ liquid acid neutralizer â&#x20AC;˘ (1) PR Nitrile Gloves â&#x20AC;˘ (1) Poly Apron â&#x20AC;˘ (1) Scoop w/Detachable scraper â&#x20AC;˘ (10) 12â&#x20AC;? x 12â&#x20AC;? Hazmat Pads â&#x20AC;˘ (1) oz. Aqua lockitÂŽ Polymer â&#x20AC;˘ (1) PR Splash Goggles â&#x20AC;˘ (1) Trigger Sprayer â&#x20AC;˘ (1) Disposal Bag & twist tie 3ODFHLQVWUDWHJLFORFDWLRQVIRUTXLFNUHVSRQVHWROHDNLQJRUVSLOOHGEDWWHU\DFLG

3257$%/(*$//2163,//.,7

&203$&71(875$/,=(563,//.,7

 â&#x20AC;˘ Absorbs all types of non-aggressive liquid leaks & spills â&#x20AC;˘ Absorbs up to 4 Gallons â&#x20AC;˘ Contains: (4) 3â&#x20AC;? x 4â&#x20AC;? Socks   ´[´3UHPLXP3DG   3DLU1LWULOH*ORYHV   3DLU6SODVK*RJJOHV   *DOORQ3ODVWLF%XFNHW:6QDSRQ/LG

 â&#x20AC;˘ (1qt) Liquid Acid Neutralizer â&#x20AC;˘ (1) 2# Auqa lockit shaker bottle â&#x20AC;˘ (1pr) Splash Goggles â&#x20AC;˘ (2) Trigger Sprayer â&#x20AC;˘ (1qt) Liquid Base Neutralizer â&#x20AC;˘ (1pr) Nitrile Gloves â&#x20AC;˘ (1) Wisk-on Pan â&#x20AC;˘ (1) Disposal Bag & twist tie ,QFOXGHVHYHU\WKLQJQHHGHGLQRUGHUWRKDQGOHDVPDOOVSLOOLQYROYLQJDFLGVRUEDVHV

48,./((1Â&#x160;$%625%(17  *DOORQ-XJ  *DOORQ-XJ[  OE%DJ â&#x20AC;˘ QuikleenÂŽ is an inert, inorganic, non-biodegradable blend of minerals. It works by means of known as â&#x20AC;&#x153;silica encapsulationâ&#x20AC;?. The absorbed liquid actually becomes part of the silica molecule. â&#x20AC;˘ All natural, non-toxic, non-flammable, non-biodegradable, non-leaching, reusable â&#x20AC;˘ Landfill acceptable and EPA certified â&#x20AC;˘ 1.5 lbs of QuikleenÂŽ will absorb an entire quart of motor oil vs 15 lbs of clay. â&#x20AC;˘ Absorbs oils, fuels, grease, solvents, acids (except hydrofluoric), paint, coolants, bodily fluids, sewage

48,./((1Â&#x160;5(&<&/(.,7  'HVLJQHGVSHFLILFDOO\WRHQVXUHWKHPRVW HFRQRPLFDOXVHRI4XLNOHHQÂ&#x160;DEVRUEHQW%\ VLIWLQJDQGUHXVLQJWKHFOHDQDEVRUEHQW\RX FDQVDYHPRQH\RQSURGXFWDQGGLVSRVDOFRVWV Contents:

â&#x20AC;˘ (1) Plastic Dust Pan â&#x20AC;&#x201C; 865.3272 â&#x20AC;˘ (1) Screen Sifter â&#x20AC;&#x201C; 865.3273 â&#x20AC;˘ (1) Wheeled Trash Can â&#x20AC;&#x201C; 865.3274 â&#x20AC;˘ (1) 24â&#x20AC;? Coarse Floor Broom â&#x20AC;&#x201C; 691.2224

56

(1(5*,=(5Â&#x160;,1'8675,$/%$77(5,(6 6L]H $$ $$$ $$$$ &

3DUW1R    

6L]H ' 9 1

3DUW1R   

â&#x20AC;˘ High performance Alkaline Batteries â&#x20AC;˘ Shelf life: up to 5 years on Industrial Alkaline batteries â&#x20AC;˘ Ultra low Mercury content â&#x20AC;˘ Sold by the battery

&RS\ULJKWÂ&#x2039;


Accessories and Applicators

Accessories and Applicators 75,**(5635$<(56 3DUW1R

7\SH

&RORU

6L]H

      

6WDQGDUG %LJ%ODVWHU &KHPLFDO5HVLVWDQW  9DOXH *HQHUDO3XUSRVH 6WDQGDUG )RDP

%OXH :KLWH 5HG :KLWH *UD\ :KLWH :KLWH %OXH *UHHQ :KLWH :KLWH

ó´ ó´ ó´ ó´ ó´ ó´ ó´

1RWH1RWIRUXVHZLWKEUDNH FDUEFOHDQHUV

• High Quality Trigger Sprayers for all types of applications • Ergonomic Designs – extra long trigger for unsurpassed comfort • For Use With: 24 oz.* & 32 oz. bottles

• * It is normal for the 9 ¼” dip tube to fit tightly inside the shorter • 24 oz. bottle with some curvature of the dip tube required. • All nozzles adjust from fine mist to jet stream

7(&+1,&$/'$7$ • Standard Trigger – 1.3 ml per stroke; 30-40% greater output than regular triggers; works well with most common janitorial chemicals including D-limonene products • Big Blaster Trigger – 3.5 ml per stroke; highest output in the industry; 3-4 times greater output than standard trigger sprayers; “comfort grip” cushioned trigger minimizes user fatigue; designed for most heavy duty applications including: auto detailing, pest control, janitorial, and industrial • Chemical-Resistant Trigger - 1.3 ml per stroke; 30-40% greater output than regular triggers; superior chemical resistance; nozzle o-ring and piston cup are made of chemical-resistant viton; holds up against harsh chemicals and solvents; works with chemicals that cause other standard trigger sprayers to fail. Not suitable for brake and carb cleaners.

&RS\ULJKW‹

57


Accessories and Applicators 3/$67,&635$<%277/(6 3DUW1R

&RORU

6L]H

 :KLWH WUDQVOXFHQW  IOR]  :KLWH WUDQVOXFHQW  IOR]  +DQG+ROG IOR]  +DQG+ROG IOR]

â&#x20AC;˘ High Quality Plastic Spray Bottles â&#x20AC;˘ Heavy-Duty, High-Density Polyethylene â&#x20AC;˘ Work well with most chemicals and solvents â&#x20AC;˘ Molded oz/ml & dilution scale â&#x20AC;˘ For Use With: 9 Âźâ&#x20AC;? trigger sprayers

3/$67,&)811(/6

3/$67,&635$<%277/(6 :,7+75,**(56 3DUW1R

'HVFULSWLRQ

     

IOR]6SUD\%RWWOHZLWK6WDQGDUG7ULJJHU IOR]6SUD\%RWWOHZLWK%ODVWHU7ULJJHU IOR]6SUD\%RWWOHZLWK&KHPLFDO7ULJJHU IOR]6SUD\%RWWOHZLWK6WDQGDUG7ULJJHU IOR]6SUD\%RWWOHZLWK%ODVWHU7ULJJHU IOR]6SUD\%RWWOHZLWK&KHPLFDO7ULJJHU

87,/,7<)811(/:,7+6&5((1

&DSDFLW\

7RWDO +HLJKW

'LDPHWHU

7LS 2'

3DUW1R

R] R]

´ ´

´ ´

´ ´

 

â&#x20AC;˘ Durable oil and gasoline resistant plastic â&#x20AC;˘ Safe for all petroleum products

 â&#x20AC;˘ All purpose fluid dispenser â&#x20AC;˘ Ideal for transmission fluid â&#x20AC;˘ 1 quart capacity â&#x20AC;˘ Heavy duty galvanized steel construction â&#x20AC;˘ Includes screen and 12â&#x20AC;? flexible extension â&#x20AC;˘ 5-3/4â&#x20AC;? funnel diameter, 17-1/2â&#x20AC;? overall length

0($685,1*&832=

0,&52),%(5&+(1,//(6321*(

 â&#x20AC;˘ Made of translucent polypropylene â&#x20AC;˘ Embossed graduations, ounce and millimeter scales â&#x20AC;˘ Dimensions: 2.5â&#x20AC;? D x 5â&#x20AC;? W x 3â&#x20AC;? H

 â&#x20AC;˘ Scratch-free microfiber chenille is super soft for â&#x20AC;˘ washing & detailing â&#x20AC;˘ Gently cleans auto, truck, rv & marine surfaces â&#x20AC;˘ Size: 9â&#x20AC;? x 5â&#x20AC;? x 3â&#x20AC;?

6381*2/'Â&#x160;&$5:$6+3$'

*2/'18**(7Â&#x160;352)(66,21$/&$5:$6+3$'

 â&#x20AC;˘ 9â&#x20AC;? x 9â&#x20AC;? â&#x20AC;˘ Made from heavy-duty synthetic fibers â&#x20AC;˘ No cuff, all ends closed

 â&#x20AC;˘ 9â&#x20AC;? x 9â&#x20AC;? â&#x20AC;˘ Made from downy soft Lorene Fibers for Superior â&#x20AC;˘ water absorbtion & retention â&#x20AC;˘ No cuff, all ends closed

58

&RS\ULJKWÂ&#x2039;


Accessories and Applicators :$6+ 6&58%&20%26321*(  â&#x20AC;˘ Heavy-Duty. 2 sponges in 1 â&#x20AC;˘ Super soft microfiber front cleans painted surfaces & metal â&#x20AC;˘ Durable scrubbing back cleans auto grills & bumpers â&#x20AC;˘ Size: 9â&#x20AC;? x 4-3/4â&#x20AC;? x 2

(&2120<%8*6321*(

685(6&58%Â&#x152;6321*(

 â&#x20AC;˘ When wet, it cleans dirt & grime from windshields, chrome & white walls â&#x20AC;˘ Poly sponge encased in nylon mesh. â&#x20AC;˘ 7-1/4â&#x20AC;? x 4-1/4â&#x20AC;? x 1â&#x20AC;?

 â&#x20AC;˘ Specially designed â&#x20AC;&#x153;honey combâ&#x20AC;? material will carry an abundance of soap & water â&#x20AC;˘ Safely scrub away stubborn bugs, bird droppings & other contaminants without harming clear coat finish â&#x20AC;˘ 3â&#x20AC;? x 5â&#x20AC;? x 2-1/2â&#x20AC;?

7,5('5(66,1*$33/,&$725

&217285('7,5('5(66,1*$33/,&$725

 â&#x20AC;˘ Used for applying tire protectants & dressings â&#x20AC;˘ Poly foam sponge with slits on the side for easy grip â&#x20AC;˘ 3-1/2â&#x20AC;? Dia. x 2â&#x20AC;? Thick â&#x20AC;˘ Sold in 2-Pack

 â&#x20AC;˘ Contour design conforms to tires â&#x20AC;˘ Non-absorbing foam reduces product waste â&#x20AC;˘ Spreads dressing evenly and eliminates runs & drips â&#x20AC;˘ Washable & reusable â&#x20AC;˘ Excellent for low profile tires

:$; 32/,6+$33/,&$725

*(18,1(:$7(5635,7(Â&#x160;'5<,1*&/27+

 ²:D[ 3ROLVK$SSOLFDWRU´  ²:D[ 3ROLVK$SSOLFDWRU´

 â&#x20AC;˘ Exclusive proven PVA material that gently cleans & dries fine finished surfaces â&#x20AC;˘ Water SpriteÂŽ actually lifts off residual dirt & grime away from the surface, leaving it clean & dry â&#x20AC;˘ It is not affected by mildew, bacteria or common household chemicals â&#x20AC;˘ Size: 23-1/4â&#x20AC;? x 34â&#x20AC;?

â&#x20AC;˘ Poly sponge encased in terry material for applying wax & polish to cars, trucks, furniture & woodwork

&RS\ULJKWÂ&#x2039;

59


Accessories and Applicators 758&.:$6+%586+(6

)2817$,1%586++$1'/(

 ²´ORQJ´EULVWOHOHQJWK%ODFN ZKLWH3RO\VW\UHQHEULVWOHV  ²´ORQJ´EULVWOHOHQJWK*UHHQ1\ORQEULVWOHV â&#x20AC;˘ Professional quality brushes for trucks, trailers & large vehicles

 â&#x20AC;˘ Tubular steel with baked enamel finish â&#x20AC;˘ Standard threads on the brush end with a water hose connector on the other end â&#x20AC;˘ 7/8â&#x20AC;? diameter X 5 feet length

)2817$,1%586+(6

+($9<'87<)(1'(5:+((/6&58%%586+(6

   

â&#x20AC;˘ Professional quality fountain brushes for cars, trucks, vans & rvâ&#x20AC;&#x2122;s â&#x20AC;˘ Polystyrene bristles â&#x20AC;˘ *Bi-Level uses Nylone bristles

 ²´+DQGOH  ²´+DQGOH â&#x20AC;˘ Crimped, stiff Blue Polyropylene bristles provide extra scubbing action â&#x20AC;˘ Bristles are highly resistant to acids, heat, chemicals & solvents

)(1'(5:$6+%586+(6

%2'<%586+(6

 ²´+DQGOH  ²´+DQGOH â&#x20AC;˘ White Tampico Bristles â&#x20AC;˘ 2â&#x20AC;? bristles set in hardwood block

 ²´+DQGOH  ²´+DQGOH â&#x20AC;˘ Flagged-tip bristles provide for gentle washing of any surface â&#x20AC;˘ Green Polystyrene bristles are resistant to acids & detergents

:+,7(6,'(:$//%586+

+($9<'87<,17(5,25 83+2/67(5<%586+

 ²´ORQJ â&#x20AC;˘ Brass wire bristles â&#x20AC;˘ Foam plastic block will not crack when left in tire cleaning solution

 ²´/RQJ â&#x20AC;˘ Extreme flare is convenient for scrubbing hard-to-reach areas â&#x20AC;˘ Crimped, cream polypropylene fibers set in a foam block

:,5(:+((/632.(%586+(6

9(17 '$6+%586+

 ²/DUJH´ORQJEUXVKPDGHZLWKQDWXUDOWDPSLFREULVWOHV  ²6PDOO´ORQJEUXVKPDGHZLWKFUHDPSRO\SURS\OHQHEULVWOHV â&#x20AC;˘ Perfect for removing built-up dirt between spokes

 ²´/RQJ â&#x20AC;˘ Perfect for quick removal of dust & debris from hard-toclean seams in automobile dashboards, around vents, radios & speakers â&#x20AC;˘ Soft natural boar bristles

60

²´Z´EULVWOHVJUHHQ ²´Z´EULVWOHVEOXH ²´Z%LOHYHO´EULVWOHVJUHHQ ²´Z´EULVWOHVZKLWH

&RS\ULJKWÂ&#x2039;


Safety Products

Safety Products */29(:25.6Â&#x152;+($9<'87</$7(; ',6326$%/(*/29(6 6L]H

3DUW1R

;;/DUJH ;/DUJH /DUJH 0HGLXP

   

&DVHRI %R[HV    

â&#x20AC;˘ Powder-free +AMMEX â&#x20AC;˘ Industrial grade â&#x20AC;˘ Extra thick (8 mil) for superior protection The Right Protection, Right Now! Now

â&#x20AC;˘ Textured for superior wet or dry grip â&#x20AC;˘ Packed 100 gloves per box â&#x20AC;˘ Color: Natural â&#x20AC;˘ Thickness: 8 mil

*/29(:25.6Â&#x152;1,75,/(',6326$%/( */29(632:'(5)5(( 6L]H

3DUW1R

;;/DUJH ;/DUJH /DUJH 0HGLXP 6PDOO

    

&DVHRI %R[HV     

â&#x20AC;˘ Latex-free Available in powdered or powder-free +AMMEX â&#x20AC;˘â&#x20AC;˘ Color: â&#x20AC;˘ Industrial grade Blue â&#x20AC;˘ Textured for a non-slip grip â&#x20AC;˘ Thickness: 5mil Palm - 6mil â&#x20AC;˘ Packed 100 gloves per box Fingertip The Right Protection, Right Now! Now

&RS\ULJKWÂ&#x2039;

*/29(3/86Â&#x152;%/$&.1,75,/(',63263$%/( */29(632:'(5)5(( 6L]H

3DUW1R

;;/DUJH ;/DUJH /DUJH 0HGLXP

   

&DVHRI %R[HV    

â&#x20AC;˘ Latex-free +AMMEXâ&#x20AC;˘ Packed 100 gloves per box â&#x20AC;˘ Industrial grade â&#x20AC;˘ Color: Black â&#x20AC;˘ Textured for a non-slip grip â&#x20AC;˘ Thickness: 5 mil Palm - 6mil â&#x20AC;˘ Powder-free Fingertip The Right Protection, Right Now! Now

*/29(:25.6Â&#x152;1,75,/(',6326$%/( */29(6/,*+7/<32:'(5(' 6L]H

3DUW1R

;;/DUJH ;/DUJH /DUJH 0HGLXP 6PDOO

    

&DVHRI %R[HV     

â&#x20AC;˘ Latex-free Available in powdered or powder-free +AMMEX â&#x20AC;˘â&#x20AC;˘ Color: â&#x20AC;˘ Industrial grade Blue â&#x20AC;˘ Textured for a non-slip grip â&#x20AC;˘ Thickness: 5mil Palm - 6mil â&#x20AC;˘ Packed 100 gloves per box Fingertip The Right Protection, Right Now! Now

61


Safety Products */29(3/86Â&#x152;+($9<'87<1,75,/( ',6326$%/(*/29(632:'(5)5(( 6L]H

3DUW1R

;/DUJH /DUJH 0HGLXP

  

&DVHRI %R[HV   

â&#x20AC;˘ Extra thick (8 mil) and Extra Long (12â&#x20AC;?) â&#x20AC;˘ Color: Blue â&#x20AC;˘ Textured for a better grip â&#x20AC;˘ Thickness: 8mil â&#x20AC;˘ Packed 50 gloves per box â&#x20AC;˘ Exam grade

+AMMEX The Right Protection, Right Now! Now

;75(0(;Â&#x152;1,75,/(',6326$%/(*/29(6 6L]H

3DUW1R

;/DUJH /DUJH 0HGLXP 6PDOO

   

&DVHRI %R[HV    

â&#x20AC;˘ Sets the new standard utilizing thinwall technology for exceptional dexterity â&#x20AC;˘ Powder and latex free

â&#x20AC;˘ Packed 100 gloves per box â&#x20AC;˘ Color: Blue â&#x20AC;˘ Thickness: 3mil (excellent strength)

*/29(3/86Â&#x152;/$7(;',6326$%/(*/29(6 +AMMEX 32:'(5)5(( The Right Protection, Right Now! Now

(;75(0(Â&#x152;1,75,/(',6326$%/(*/29(6 32:'(5)5(( 6L]H

3DUW1R

;/DUJH /DUJH 0HGLXP 6PDOO

   

&DVHRI %R[HV    

/,*+7/<32:'(5(' 6L]H

3DUW1R

;/DUJH /DUJH 0HGLXP

  

&DVHRI %R[HV   

â&#x20AC;˘ Latex-Free +AMMEX â&#x20AC;˘ Economy industrial grade â&#x20AC;˘ Great dexterity â&#x20AC;˘ Packed 100 gloves per box The Right Protection, Right Now! Now

â&#x20AC;˘ Available in powdered or powder-free â&#x20AC;˘ Color: Blue â&#x20AC;˘ Thickness: 4 mil Palm - 5mil Fingertip

6L]H

3DUW1R

;/DUJH /DUJH 0HGLXP 6PDOO

   

&DVHRI %R[HV    

/,*+7/<32:'(5(' 6L]H

3DUW1R

;/DUJH /DUJH 0HGLXP 6PDOO

   

â&#x20AC;˘ Textured for excellent grip â&#x20AC;˘ Medical grade â&#x20AC;˘ Packed 100 gloves per box

&DVHRI %R[HV    

â&#x20AC;˘ Available in powdered or powder-free â&#x20AC;˘ Color: Natural â&#x20AC;˘ Thickness: 5 mil

;75(0(;'1,75,/(',6326$%/(*/29(6 32:'(5)5((

7+,&.67(5Â&#x152;/$7(;',6326$%/(*/29(6 6L]H

3DUW1R

;;/DUJH ;/DUJH /DUJH 0HGLXP

   

&DVHRI %R[HV    

â&#x20AC;˘ Heavy-duty latex construction â&#x20AC;˘ Maximum strength/tear resistant â&#x20AC;˘ Lightly powdered â&#x20AC;˘ Textured grip â&#x20AC;˘ 50 gloves per box â&#x20AC;˘ Color: Blue â&#x20AC;˘ Thickness: 14 mil

6L]H

3DUW1R

6PDOO 0HGLXP /DUJH ;/DUJH ;;/DUJH

    

â&#x20AC;˘ Textured â&#x20AC;˘ Latex-Free â&#x20AC;˘ Packed 200 gloves per box

â&#x20AC;˘ Color: Blue â&#x20AC;˘ Complyâ&#x20AC;&#x2122;s with FDA 21CFR, 170-199

1,75,/(',6326$%/(*/29(6 32:'(5)5(( 6L]H

3DUW1R

;/DUJH /DUJH 0HGLXP 6PDOO

   

1,75,/(*/29(6

/$7(;*/29(6

32:'(5)5((

32:'(5)5((

6L]H

3DUW1R

6L]H

3DUW1R

;/DUJH /DUJH 0HGLXP 6PDOO

   

/DUJH 0HGLXP 6PDOO

  

62

&DVHRI %R[HV     

&DVHRI %R[HV    

&RS\ULJKWÂ&#x2039;


Safety Products 5$9(11,75,/(*/29(6

1,75,/(',6326$%/(*/29(6 /,*+7/<32:'(5('

6L]H

3DUW1R

6PDOO 0HGLXP /DUJH ;/DUJH ;;/DUJH

    

â&#x20AC;˘ 6 Mil Nitrile â&#x20AC;˘ Powder Free â&#x20AC;˘ Superior puncture & abrasion resistance

â&#x20AC;˘ Beaded cuff with textured grip â&#x20AC;˘ Ambidextrous â&#x20AC;˘ Packed 100 gloves per box

9,1</',6326$%/(*/29(6

6L]H

3DUW1R

;/DUJH /DUJH 0HGLXP

  

&DVHRI %R[HV   

â&#x20AC;˘ Available in powdered or powder-free â&#x20AC;˘ Resistant to chemicals & solvents â&#x20AC;˘ Non-medical / ambidextrous â&#x20AC;˘ Thickness: 5mil â&#x20AC;˘ Packed 100 per dispenser box

',6326$%/(*/29(',63(16(5 

6L]H

3DUW1R

/DUJH 0HGLXP

 

&DVHRI %R[HV  

â&#x20AC;˘ Lightly powdered â&#x20AC;˘ Packed 100 per dispenser box

â&#x20AC;˘ Wall-mountable (comes with hardware) â&#x20AC;˘ White, powder-coated wire dispenser â&#x20AC;˘ Holds one box of disposable gloves

â&#x20AC;˘ Industrial grade â&#x20AC;˘ Color: Clear/transparent

352)/(;+,*5,3*/29(6

0(&+$1,&66$)(7<*/29(%/$&.

6L]H

3DUW1R

6L]H

3DUW1R

0HGLXP /DUJH ;/DUJH

  

0HGLXP /DUJH ;/DUJH

  

â&#x20AC;˘ Textured silicone palm and fingers â&#x20AC;˘ Padded breathable spandex back â&#x20AC;˘ Micro-injected closure â&#x20AC;˘ Woven elastic cuff â&#x20AC;˘ Neoprene knuckle pad â&#x20AC;˘ Terry cloth thumb brow wipe

â&#x20AC;˘ Machine washable â&#x20AC;˘ Outstanding protection against knuckle injury â&#x20AC;˘ Padded palms perfect for use with pneumatic tools â&#x20AC;˘ Unparalleled comfort

0(&+$1,&6*/29(%/$&.

352+$1'/,1**/29(*5(<

6L]H

3DUW1R

6L]H

3DUW1R

0HGLXP /DUJH ;/DUJH

  

0HGLXP /DUJH ;/DUJH

  

â&#x20AC;˘ Excellent dexterity and flexibility â&#x20AC;˘ Machine washable â&#x20AC;˘ Outstanding gripper power â&#x20AC;˘ Spandex top for great flexibility and ease of movement

â&#x20AC;˘ Machine washable â&#x20AC;˘ Greatly reduces skin abrasions and cuts â&#x20AC;˘ Silicone strips on fingertips and palm for secure grip

*(1(5$/87,/,7<3/86*/29(6

0;Âś66/,321*/29(<(//2:

6L]H

3DUW1R

6L]H

3DUW1R

6PDOO 0HGLXP /DUJH ;/DUJH

   

0HGLXP /DUJH ;/DUJH

  

â&#x20AC;˘ Extensive asphalt reinforcement â&#x20AC;˘ Full finger reinforcement â&#x20AC;˘ Durable nylon fourchettes â&#x20AC;˘ Internal knuckle protection â&#x20AC;˘ Supportive FlexMeshâ&#x201E;˘ Cuff â&#x20AC;˘ Sold by the pair &RS\ULJKWÂ&#x2039;

â&#x20AC;˘ Machine washable â&#x20AC;˘ Excellent dexterity and flexibility â&#x20AC;˘ Outstanding gripper power

63


Safety Products :$7(53522):,17(5*/29( 6L]H

1$785$/&27721&$19$6*/29(6 2QH3DLU 

3DUW1R

/DUJH



;/DUJH



â&#x20AC;˘ Waterproof, windproof, breathable membrane â&#x20AC;˘ Insulating micro fleece liner and durable outer shell â&#x20AC;˘ Internal knuckle protection â&#x20AC;˘ Supportive FlexMeshâ&#x201E;˘ Cuff with gusset â&#x20AC;˘ Sold by the pair

*5((11,75,/(*/29(6 6L]H

2QH3DLU

/DUJH ;/DUJH

 

&DVHRI 3DLUV  

â&#x20AC;˘ Off-white color â&#x20AC;˘ Large size â&#x20AC;˘ Knit wrist

35(0,80/($7+(5'5,9(5*/29( 6L]H

3DUW1R

0HGLXP /DUJH ;/DUJH

  

â&#x20AC;˘ Nitrile provides extensive chemical resistance â&#x20AC;˘ Abrasive, cut and puncture resistant â&#x20AC;˘ Green Nitrile â&#x20AC;˘ Embossed wet/dry grip â&#x20AC;˘ 13â&#x20AC;? length, 15 mil thick

â&#x20AC;˘ Top grain pigskin â&#x20AC;˘ Straight thumb â&#x20AC;˘ General purpose protection â&#x20AC;˘ Strong & comfortable leather â&#x20AC;˘ Excellent protection for grinding, cutting and dismantling

*5((139&*/29(6

&27721-(56(<*/29(6

2QH3DLU 

2QH3DLU 

â&#x20AC;˘ 12â&#x20AC;? Gauntlet

â&#x20AC;˘ Cotton Jersie provides light duty comfortable hand protection â&#x20AC;˘ Brown color hides the dirt and extends the wear â&#x20AC;˘ Menâ&#x20AC;&#x2122;s size

%52:1-(56(<*/29(6

%/8(1,75,/(&87 6(:1

6L]H

7\SH

2QH3DLU

0HGLXP /DUJH /DUJH

8QOLQHG 8QOLQHG /LQHG

  

&DVHRI 3DLUV   

â&#x20AC;˘ Available lined or unlined â&#x20AC;˘ Unlined gloves have a knit wrist â&#x20AC;˘ Lined gloves are slip-on style

&27721675,1**/29(6 6L]H

3DUW1R

6PDOO /DUJH

 

â&#x20AC;˘ with Grip Dots â&#x20AC;˘ Cotton/polyester blend â&#x20AC;˘ Dotted on both sides â&#x20AC;˘ Regular weight

64

6L]H ;/DUJH

3DUW1R 

â&#x20AC;˘ Slip-on style â&#x20AC;˘ Excellent abrasion resistance â&#x20AC;˘ Superior dry grip and dexterity â&#x20AC;˘ Sold by the pair

+270,//*/29(6 2QH3DLU 

â&#x20AC;˘ 24oz. heavy-duty cotton construction â&#x20AC;˘ Double layer â&#x20AC;˘ Knit wrist with knuckle strap for added protection â&#x20AC;˘ Protects to 300°F â&#x20AC;˘ Sold by the pair

&RS\ULJKWÂ&#x2039;


Safety Products 675,1*.1,7*/29(6 6L]H

3DUW1R

0HGLXP /DUJH

 

â&#x20AC;˘ Cotton/Polyester blend â&#x20AC;˘ Seamless and reversable design â&#x20AC;˘ Can also be used as a glove liner for added warmth

1,75,/(3$/06$)(7<*/29(6 2QH3DLU 

â&#x20AC;˘ Heavy Duty â&#x20AC;˘ Blue nitrile palm coated â&#x20AC;˘ Jersey lined â&#x20AC;˘ Knit wrist â&#x20AC;˘ Menâ&#x20AC;&#x2122;s size

6L]H /DUJH

3DFN 

â&#x20AC;˘ Slip-on style â&#x20AC;˘ Excellent abrasion resistance â&#x20AC;˘ Superior dry grip and dexterity â&#x20AC;˘ Sold by the pair

/($7+(53$/0:25.*/29(6 6L]H

2QH3DLU

/DUJH ;/DUJH

 

&DVHRI 3DLUV  

â&#x20AC;˘ Heavy Duty â&#x20AC;˘ Rubberized safety cuff â&#x20AC;˘ Full feature deluxe work glove â&#x20AC;˘ Wing thumb â&#x20AC;˘ Large size

1,75,/(&2$7*/29(6:&8)) 6L]H /DUJH

675,1*.1,7*/29(6%/($&+(':+,7(

3DFN 

/($7+(53$/0:25.*/29(6 2QH3DLU

&DVHRI3DLUV





â&#x20AC;˘ Standard Duty â&#x20AC;˘ Denim cuff â&#x20AC;˘ Washable â&#x20AC;˘ Reinforced patch palm â&#x20AC;˘ Wing thumb â&#x20AC;˘ Large size

1</216+(//1,75,/(&2$7('3$/0

.(9/$5Â&#x160;6+(//1,75,/(&2$7('3$/0

6L]H

3DUW1R

6L]H

3DUW1R

0HGLXP /DUJH ;/DUJH

  

0HGLXP /DUJH ;/DUJH

  

â&#x20AC;˘ Durable Nitrile Coating Provides excellent abrasive resistance and offers protection against oils and greases â&#x20AC;˘ Stretch nylon shell feels like your working with your bare hands â&#x20AC;˘ Form fitting and flexible â&#x20AC;˘ Machine Washable

â&#x20AC;˘ Nitrile coating provides excellent abrasive resistance and offers protection against oil and greases â&#x20AC;˘ Kevlar fiber is five times stronger than steel and offers exceptional cut resistance â&#x20AC;˘ Machine Washable

1</216+(//32/<85(7+$1(&2$7('3$/0

%$0%226+(///$7(;&2$7('3$/0

6L]H

3DUW1R

6L]H

3DUW1R

0HGLXP /DUJH ;/DUJH

  

0HGLXP /DUJH ;/DUJH

  

â&#x20AC;˘ Polyurethane Palm coating provides unmatched grip and dexterity â&#x20AC;˘ Stretch nylon shell feels like you are working with your bare hands - keeps hands cool â&#x20AC;˘ Machine Washable

&RS\ULJKWÂ&#x2039;

â&#x20AC;˘ Textured latex coating provides great grip and tough abrasion and puncture resistance â&#x20AC;˘ Bamboo fabric is up to 4 times more absorbant than cotton â&#x20AC;˘ Will not hold odor or grow fungus, even if left in moist conditions â&#x20AC;˘ Machine washable (Lay flat to dry) â&#x20AC;˘ Great for general material handling, tools, gardening, and yard work

65


Safety Products /,1(0$1Âś6*/29(.,7

*/29(*5$%%(5

 .LWLQFOXGHV â&#x20AC;˘ 14â&#x20AC;?L insulating red/black rubber glove â&#x20AC;˘ Goatskin leather protector glove â&#x20AC;˘ 12â&#x20AC;? protective storage bag â&#x20AC;˘ Compliance: â&#x20AC;˘ Meets or exceeds ASTM D120 Standard â&#x20AC;˘ Meets International Standard 903, IEC-1988

  â&#x20AC;˘ Keep gloves where you want â&#x20AC;&#x2DC;em when you want â&#x20AC;&#x2DC;em â&#x20AC;˘ Easy to us, comfortable feel â&#x20AC;˘ Clips to clothing, belts, tool belts and D-Rings â&#x20AC;˘ Breakaway feature â&#x20AC;˘ Dialectric / Non-conductive material

:,//621Â&#x160;'8670$6. 3DFNDJLQJ

3DUW1R

6ROG,QGLYLGXDOO\ 0DVNV%R[

 

â&#x20AC;˘ Lightweight and disposable â&#x20AC;˘ For relief from nuisance level dusts & mists (non-oil) â&#x20AC;˘ Not NIOSH-Approved

03$57,&8/$7(5(63,5$7251 3DUW1R

0 3DUW1R

5HVSLUDWRU 3HU%R[







â&#x20AC;˘ NIOSH 42CFR84 approved â&#x20AC;˘ 3M recommended for grinding, sanding, and buffing â&#x20AC;˘ 3M Cool Flowâ&#x201E;˘ exhalation valve improves comfort â&#x20AC;˘ â&#x20AC;&#x153;Mâ&#x20AC;? nose clip adjusts to many face shapes â&#x20AC;˘ NIOSH certified as 95% efficient in removing solid and liquid particles (excluding those containing oils)

0$872027,9(5(63,5$7251 3DUW1R

0 3DUW1R

5HVSLUDWRU 3HU%R[







â&#x20AC;˘ Lightweight, disposable and easy to breath through â&#x20AC;˘ Does not restrict vision â&#x20AC;˘ NIOSH-Approved

13$57,&8/$7(5(63,5$725 3DUW1R

3DFNDJLQJ



3DFN

â&#x20AC;˘ Inner foam provides a custom seal â&#x20AC;˘ Dual head strap for optimum fit â&#x20AC;˘ NIOSH-Approved TC-8A-3888

+$5'+$76 3DUW1R

&RORU

   

:KLWH <HOORZ %OXH +L9L]*UHHQ

â&#x20AC;˘ 6-point ratchet nylon suspension â&#x20AC;˘ Light weight polyethylene â&#x20AC;˘ Adjustable head cradle â&#x20AC;˘ Soft brow band â&#x20AC;˘ Meets ANSI 289.1-2003 Standard Type 1, Class G & E

%803+$76 3DUW1R

&RORU

 

%XPSFDSZKLWHZSLQORFN %XPSFDS\HOORZZSLQORFN

â&#x20AC;˘ Ideal for use in areas with low head clearance â&#x20AC;˘ Sewn in sweat band â&#x20AC;˘ Close fitting â&#x20AC;˘ Great air circulation â&#x20AC;˘ 4-Point adjustable pinlock suspension system

66

0($6,&$5(3$,17635$<5(63,5$725 $66(0%/< 'HVFULSWLRQ

0 3DUW1R

3DUW1R

0HGLXP5HVSLUDWRU$VVHPEO\   /DUJH5HVSLUDWRU$VVHPEO\

 

3)LOWHU SHU%R[ 

 

â&#x20AC;˘ Maintenance free â&#x20AC;˘ Recommended for spray painting lacquer, enamel, and pesticides â&#x20AC;˘ NIOSH 42CFR84 approved $VVHPEO\LQFOXGHVRUJDQLFYDSRUUHVSLUDWRU HD 3ILOWHU HD DQGILOWHU UHWDLQHU HD

+$5'+$7 3DUW1R

&RORU



<HOORZ

â&#x20AC;˘ 6-point nylon suspension â&#x20AC;˘ Quick-Slide sizing adjusts suspension from head sizes 6-12 - 8 â&#x20AC;˘ Molded from high density polyethylene for maxium protection â&#x20AC;˘ Meets ANSI Z89.1-2003 standard type 1, class C, E & G requirements â&#x20AC;˘ Made in the U.S.A.

)8//%5,0+$5'+$7 3DUW1R

&RORU



:KLWH

â&#x20AC;˘ Flex-gearÂŽ Ratchet Suspension â&#x20AC;˘ Features cushion pillows where ratchet housing rests for added comfort â&#x20AC;˘ Adjusts by turning knob at the rear â&#x20AC;˘ Manufactured in an ISO 9002 registered facility â&#x20AC;˘ Complies with ANSI Z89.1-2009 standards Type I, Class E & G standards â&#x20AC;˘ 4-point ratchet suspension

&RS\ULJKWÂ&#x2039;


Safety Products )$&(6+,(/'6

67$1'$5'

 ²&OHDU (FRQRP\ ´[´[´7KLFN

 ²&OHDU &XUYHGPROGHGOHQV ´[´[´7KLFN

'(/8;(  ²&OHDU  ²7LQW $VSKHULFDO/HQV ´[´[7KLFN

+($'*($5 )$&(6+,(/'127,1&/8'('

 ²&OHDU â&#x20AC;¢ Non-slip ratchet adjustment â&#x20AC;¢ Pin lock adjustment for top band suspension â&#x20AC;¢ Double cam visor lock â&#x20AC;¢ Padded sweat band 1RWIRUXVHZLWK'HOX[$VSKHULFDOOHQVHVXVH 

'(/8;(+($'*($55$7&+(7$66(0%/< 

($53/8*6²',6326$%/()2$0

($53/8*67$7,21  â&#x20AC;¢ Material: Foam â&#x20AC;¢ NPR (max): 33 â&#x20AC;¢ Usage: Single Use â&#x20AC;¢ 100% PVC-Free â&#x20AC;¢ 250 pair â&#x20AC;¢ Independently tested to ANSI S3.19-1974 â&#x20AC;¢ Includes mounting bracket and hardware â&#x20AC;¢ Made in the U.S.A.

%$1'('($53/8*6  â&#x20AC;¢ Light weight and durable band â&#x20AC;¢ Super soft, washable plugs â&#x20AC;¢ NRR: 23

3DUW1R

4  W\%R[

'  HVFULSWLRQ

 

SDLU SDLU

8QFRUGHG &RUGHG

â&#x20AC;¢ Extremely soft foam plug â&#x20AC;¢ Tapered shape offers most comfortable fit for ear canal â&#x20AC;¢ Nylon Dielectric cord â&#x20AC;¢ NRR: 32 â&#x20AC;¢ Sold by the box

6,/(1&(5($508))6  â&#x20AC;¢ Adjustable, padded headband â&#x20AC;¢ Soft, foam-padded earcups â&#x20AC;¢ NRR: 26

5(86$%/(&25'('($53/8*6

($508))6

 â&#x20AC;¢ Super soft, washable plug â&#x20AC;¢ Nylon cord â&#x20AC;¢ Flip top cas â&#x20AC;¢ NRR: 28

 â&#x20AC;¢ Adjustable, padded headband â&#x20AC;¢ Soft, foam-padded earcups â&#x20AC;¢ NRR: 25 â&#x20AC;¢ Yellow â&#x20AC;¢ Made in the U.S.A.

&RS\ULJKWÂ&#x2039;

67


Safety Products 5(':+,7( %/8(6$)(7<*/$66(6 3DUW1R  

/HQV &OHDU/HQV 6PRNH/HQV

â&#x20AC;˘ Adjustable length and ratchet temple â&#x20AC;˘ Frame color â&#x20AC;&#x201D; red, white and blue

5$'$7$&6$)(7<*/$66(6 3DUW1R  

/HQV &OHDU/HQV 6PRNH/HQV

â&#x20AC;˘ Rubber tipped temples â&#x20AC;˘ Polycarbonate lens â&#x20AC;˘ Lightweight frame

&2%$/76$)(7<*/$66(6 3DUW1R   

/HQV &OHDU/HQV 6PRNH/HQV 3RODUL]HG/HQV

â&#x20AC;˘ Lightweight Frame â&#x20AC;˘ Wraparound design

0,5$*(6$)(7<*/$66(6 3DUW1R  

/HQV &OHDU/HQV 6PRNH/HQV

â&#x20AC;˘ Dual wraparound optically correct polycarbonate lens â&#x20AC;˘ Sleek lightweight design

5(9(/$7,216$)(7<*/$66(6 3DUW1R    

/HQV &OHDU/HQV 6PRNH/HQV $PEHU/HQV 3RODUL]HG/HQV

â&#x20AC;˘ Impact resistant polycarbonate lens â&#x20AC;˘ Adjustable temples fit most face sizes â&#x20AC;˘ Non-slip rubber nose pad

5$'²$32&$/<36(6$)(7<*/$66(6 3DUW1R  

0,5$*(576$)(7<*/$66(6 3DUW1R  

/HQV &OHDU/HQV 6PRNH/HQV

â&#x20AC;˘ Dual wraparound optically correct polycarbonate lens â&#x20AC;˘ Sleek lightweight design â&#x20AC;˘ Rubber tipped temples

/HQV &OHDU/HQV 6PRNH/HQV

â&#x20AC;˘ Soft rubber temples and nose piece â&#x20AC;˘ Scratch resistant lens â&#x20AC;˘ Includes neck cord

,//86,216$)(7<*/$66(6 6+$5.6$)(7<*/$66(6 3DUW1R  

/HQV &OHDU/HQV 6PRNH/HQV

3DUW1R  

/HQV &OHDU/HQV 6PRNH/HQV

â&#x20AC;˘ Flexible temple tips â&#x20AC;˘ Extended brow gaurd â&#x20AC;˘ Soft rubber nosepiece â&#x20AC;˘ Wraparound single polycarbonate lens

â&#x20AC;˘ One piece lens design â&#x20AC;˘ Adjustable temples â&#x20AC;˘ Frame color - blue

&+,()9,6,725*/$66(6 3DUW1R  

/HQV &OHDU/HQV 6PRNH/HQV

â&#x20AC;˘ Integrally molded brow guard â&#x20AC;˘ Reinforced sideshields â&#x20AC;˘ Can be worn over prescription glasses

68

5$'²6(48$/6$)(7<*/$66(6 3DUW1R  

/HQV &OHDU/HQV 6PRNH/HQV

â&#x20AC;˘ Soft rubber nosepiece and temples â&#x20AC;˘ Polycarbonate lens â&#x20AC;˘ Lightweight design

&RS\ULJKWÂ&#x2039;


Safety Products &+($7(566$)(7<*/$66(6 3DUW1R       

/HQV&RORU &OHDU &OHDU &OHDU &OHDU &OHDU 6PRNH 6PRNH

â&#x20AC;˘ Combining protective safety glasses with reading glasses â&#x20AC;˘ Cushioned non-slip rubber temple pads â&#x20AC;˘ Vented rubber nosepiece â&#x20AC;˘ Magnification diopter molded into the lens

$/7,78'(6$)(7<*/$66(6 3DUW1R   

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

)UDPH/HQV %ODFN&OHDU %ODFN6PRNH 7RUWRLVH&RIIHH

Sleek lightweight frame Impact resistant polycarbonate lens Soft rubber temples and nose piece Meets ANSI Z87.1+ Anti-fog lens coating

89(;;&Â&#x160;6$)(7<*/$66(6 3DUW1R 

/HQV &OHDU

â&#x20AC;˘ Made in the U.S.A. â&#x20AC;˘ Passes ANSI Z87+ and Z94.3 standards

3(5)25$7('*2**/(6

52&.6$)(7<*/$66(6 3DUW1R    

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

)UDPH/HQV %ODFN&OHDU %ODFN6PRNH :KLWH&OHDU :KLWH6PRNH

Sleek, lightweight design with wraparound temples Impact resistant polycarbonate lens Adjustable rubber nosepiece Meets ANSI Z87.1+ Anti-fog lens coating

5(0,1*72176$)(7<*/$66(6 3DUW1R  

/HQV &OHDU 6PRNH

â&#x20AC;˘ 4-position temple length adjustment â&#x20AC;˘ 5- position lens angle adjustment â&#x20AC;˘ Soft rubber nosepiece

7285*8$5',,,6$)(7<*/$66(6 :',63(16(5 3DUW1R 

/HQV &OHDU

â&#x20AC;˘ Dispenser contains 20 pair of Tour-Guard III Safety Glasses â&#x20AC;˘ ANSI Z87.1-2003 High Impact Compliant â&#x20AC;˘ Made in the U.S.A.

&+(0,&$/*2**/(6

 &OHDUDQWLIRJOHQV â&#x20AC;˘ Perforated sideshields â&#x20AC;˘ Elastic strap â&#x20AC;˘ Fits over most prescription glasses

 &OHDUDQWLIRJOHQV â&#x20AC;˘ Indirect vents provides protection against chemical splashes â&#x20AC;˘ NeoPrene strap â&#x20AC;˘ Fits over most prescription glasses

$17,63/$6+)2**2**/(

6$)(7<1(&.&25'6

 â&#x20AC;˘ Tough Duralite Polcarbonate Lens â&#x20AC;˘ Anti-Fog Resistant Coating â&#x20AC;˘ Large Lens Opening Fits Over Prescription & Saftey Glasses â&#x20AC;˘ Wide Nasal Flare Fits Over Most Half-Mask Respirators â&#x20AC;˘ Meets ANSI Z87.1 and Z94.3 Standards â&#x20AC;˘ Made in the U.S.A.

&RS\ULJKWÂ&#x2039;

&RORU 5HG %ODFN

3DUW1R  

â&#x20AC;˘ Provides convenient access to safety eyeware â&#x20AC;˘ Universal cords fit all safett glasses

69


Safety Products /(16&/($1,1*72:(/(77(6  â&#x20AC;˘ Handy pocket size pre-moistened towelettes â&#x20AC;˘ 100 towelettes per box â&#x20AC;˘ Box serves as dispenser

(<(:$6+67$7,216 3DUW1R  

'HVFULSWLRQ (\H:DVK6WDWLRQ5HILOOR] 'XDO(\H:DVK6WDWLRQ5HILOOR]

â&#x20AC;˘ Wall mountable â&#x20AC;˘ For use wherever immediate eye and body flushing may be needed â&#x20AC;˘ Once bottle is opened, discard and replace with refill

/$5*(/(16&/($1,1*67$7,21

60$///(16&/($1,1*67$7,21

 â&#x20AC;˘ 1603 spray cleaning solution â&#x20AC;˘ 1200 tissues

 â&#x20AC;˘ 802 spray cleaning solution â&#x20AC;˘ 600 tissues

3,(&(5$,168,7

.1((/,1*3$'

6L]H /DUJH ;/DUJH ;;/DUJH ;;;/DUJH

3DUW1R    

6L]H

3  DUW1R

[



â&#x20AC;˘ Lightweight foam rubber â&#x20AC;˘ Comfortable and easy to use

â&#x20AC;˘ 3 Piece rain suit includes bib overall suspender and jacket with detachable hood â&#x20AC;˘ .35mm PVC/Polyester â&#x20AC;˘ Corduroy Collar â&#x20AC;˘ Color: Yellow

'(/8;(.1((3$'

1,752)2$0Â&#x152;$//7(55$,1.1((3$'6

 â&#x20AC;˘ Plastic cap over tough nylon fabric soft foam rubber core â&#x20AC;˘ Water and abrasive resistant â&#x20AC;˘ Velcro closures â&#x20AC;˘ Easy to use

 0RGHO  0RGHO â&#x20AC;˘ Durable all terrain cap â&#x20AC;˘ Extremely comfortable to wear â&#x20AC;˘ Model 507 is a compact style that offers complete protection â&#x20AC;˘ Model 707 offers ultimate protection â&#x20AC;˘ Double strap for comfort and flexibility â&#x20AC;˘ Sold by the pair

352)/(;67$1'$5'%$&.6833257

352)/(;(&2120<%$&.6833257

6L]H

3DUW1R

6L]H

3DUW1R

0HGLXP /DUJH ;/DUJH ;;/DUJH

   

0HGLXP /DUJH ;/DUJH ;;/DUJH

   

â&#x20AC;˘ Patented non-conductive Sticky FingerÂŽ stays â&#x20AC;˘ Adjustable detachable suspenders â&#x20AC;˘ Patented Power Panel ÂŽ postitioners â&#x20AC;˘ Durable spandex body material â&#x20AC;˘ Strechable bias binding with zig-zag stitching

70

â&#x20AC;˘ Economical spandex back â&#x20AC;˘ Adjustable detachable suspenders â&#x20AC;˘ Non-conductive polyproplene stays â&#x20AC;˘ Strechable bias binding with zig-zag stitching â&#x20AC;˘ Rubber track webbing &RS\ULJKWÂ&#x2039;


Safety Products )$//7(&+/$1<$5'6 3DUW1R  

)$//7(&++$51(66

'HVFULSWLRQ 6HOI5HWUDFWLQJ/DQ\DUG

 6KRFN$EVRUELQJ/DQ\DUG

3DUW1R  

'HVFULSWLRQ )XOO%RG\+DUQHVV8QLILWZSDG )XOO%RG\+DUQHVV8QLILW'

â&#x20AC;˘ FallTech also has a variety of positioning and restraint lanyards designed to prevent you from falling from your work position, giving you the ability to work hands free with complete security. All of our lanyards are designed to meet or exceed applicable OSHA and ANSI standards.

â&#x20AC;˘ All of our harnesses are proudly made by hand right here in the USA, and are truly a cut above. We start with the highest quality polyester and aramid webbings and finish them off with our own proprietary hardware and accessory parts. Even our most basic harness webbing exceeds OSHA and ANSI requirements for tensile strength by more than 1,300 lbs

)$//7(&+)$//.,7

)$//7(&+5(675$,17%(/76

3DUW1R 

'HVFULSWLRQ (QG8VHU)DOO.LWV

â&#x20AC;˘ All FallTech Combination Sets meet or exceed OSHA and ANSI standards

'HVFULSWLRQ 5HVWUDLQW%HOWZSDG/* 5HVWUDLQW%HOWZSDG0('

â&#x20AC;˘ All FallTech Belts and Pads meet or exceed OSHA and ANSI standards.

)$//7(&+&$5$%,1((56 3DUW1R 

3DUW1R  

)$//7(&+$1&+25Âś6

'HVFULSWLRQ &DUDELQHU0HGLXP´

â&#x20AC;˘ FallTech offers a range of double locking snap hooks and carabiners to be used as connecting elements for a variety of applications for fall arrest. Specifically designed to prevent roll-out or accidental opening, all FallTech connectors are thoroughly tested and conform to OSHA and ANSI standards.

3DUW1R

'HVFULSWLRQ

 

 3DVV7KUX$QFKRU6OLQJ 5HXVDEOH5RRI$QFKRU

â&#x20AC;˘ All FallTech anchors and connectors meet or exceed OSHA and ANSI standards.

81,7,=('),567$,'.,76

.,7&217(176$1'5(),///,67 3DUW1R

'HVFULSWLRQ

4W\ SHU%R[

         

´[´$GKHVLYH)DEULF%DQGDJH ´[´$GKHVLYH3ODVWLF%DQGDJH VTLQ$EVRUEHQW*DX]H&RPSUHVV ´&RPSUHVV%DQGDJH2II&HQWHU ´[´[´7ULDQJXODU6OLQJ%DQGDJH ´[´*DX]H'UHVVLQJ3DG $QWLVHSWLF&OHDQVLQJ:LSHV VWLQJIUHH

3RYLGRQH,RGLQH,QIHFWLRQ&RQWURO:LSH %XUQ5HOLHI3DFN ´[´,QVWDQW&ROG&RPSUHVV 6WHULOH(\H3DGVR](\H:DVK ´[\G$GKHVLYH7DSH ´[\GV$GKHVLYH7DSH ([DP4XDOLW\*ORYHV

         

  

&RS\ULJKWÂ&#x2039;

&RQWHQWV &RQWHQWV SHU.LW SHU.LW   %R[ %R[ %R[ %R[ %R[ %R[ %R[

VHW  SDLU

%R[ %R[HV %R[ %R[ %R[ %R[ %R[ %R[ %R[ %R[ %R[

%R[ %R[

%R[ %R[





8QLW.LW

8QLW.LW

â&#x20AC;˘ Designed for the workplace â&#x20AC;˘ Kits are compliant with ANSI regulations and exceed OSHA requirements â&#x20AC;˘ Contents are easily refillable â&#x20AC;˘ Plastic case is portable or wall mountable

71


Safety Products 0(',&$7,216),567$,' 3DUW1R                        

'HVFULSWLRQ ,EXSURIHQ ([WUD6WUHQJWK1RQ$VSLULQ $VSLULQ $QWDFLG ([WUD6WUHQJWK3DLQ5HOLHYHU 6LQXV1DVDO'HFRQJHVWDQW &KHUU\&RXJK'URSV $QWLELRWLF2LQWPHQW +\GURFRUWLVRQH&UHDP $OFRKRO3UHS3DG 3RYLGRQH,RGLQH:LSH %ORRG&ORWWLQJVSUD\ 6XQVFUHHQ7RZHOHWWH $PPRQLD,QKDODQW ,QVHFW6WLQJ:LSH ´3ODVWLF7ZHH]HU ´6FLVVRUV $QJOHG%ODGH  6SOLQWHU2XW ´&RWWRQ7LSSHG6ZDE 6WHULOH  ´´)DEULF%DQGDJH ´[´)DEULF%DQGDJHV ´[´:RYHQ%DQGDJH .QXFNOH%DQGDJH )LQJHUWLS%DQGDJH

4W\3HU%R[ WDEOHWV WDEOHWV WDEOHWV WDEOHWV WDEOHWV SNSNV GURSV SDFNHWV SDFNHWV 3DGV :LSHV R]&DQ 7RZHOHWWH ,QKDODQWV :LSHV 7ZHH]HU 6FLVVRU 3NV 3N3NV%R[ %DQGDJHV %DQGDJHV %DQGDJHV %DQGDJHV %DQGDJHV

â&#x20AC;¢ Boxes are top perforated and dispenser capable â&#x20AC;¢ Full disclosure is listed on boxes as well as tablet packages â&#x20AC;¢ Contents are listed in English and Spanish

),567$,'.,76

 SHUVRQNLW   SHUVRQNLW

3(5621.,7&217(176/,67 'HVFULSWLRQ %DQGDJH$VVRUWPHQW 3ODVWLF%DQGDJH *DX]H3DG´[´ )LQJHUWLS%DQGDJH .QXFNOH%DQGDJH $GKHVLYH7DSH´[\GV $PPRQLD,QKDODQW´[´ )LUVW$LG$VVRUWPHQW &OHDQVLQJ7RZHOHWWH %XUQ&UHDPJUDP ,QVHFW6WLQJ:LSH &ROG3DFN )RUFHSV3ODVWLF´ 6FLVVRUV´ 1LWULOH*ORYH3DLU 7UDXPD3DG´[´ 7ULDQJXODU%DQGDJH´ )LUVW$LG)DFW6KHHW

3(5621.,7&217(176/,67

3LHFHV 8QLWV 3HU8QLW 

 

      

  

  

'HVFULSWLRQ %DQGDJH$VVRUWPHQW 3ODVWLF%DQGDJH´[´ *DX]H3DG´[´ *DX]H3DG´[´ (\H3DG )LQJHUWLS%DQGDJH .QXFNOH%DQGDJH $GKHVLYH7DSH´[\GV $PPRQLD,QKDODQW´[´ )LUVW$LG$VVRUWPHQW &OHDQVLQJ7RZHOHWWH %XUQ&UHDPJUDP ,QVHFW6WLQJ:LSH $VSLULQ7DEOHWVSNJ &ROG3DFN (\H:DVKPO )RUFHSV3ODVWLF´ 1LWULOH*ORYH3DLU 7UDXPD3DG´[´ 7ULDQJXODU%DQGDJH´ )LUVW$LG)DFW6KHHW

3LHFHV 8QLWV 3HU8QLW 

  

       

     

SHUVRQNLW

  

SHUVRQNLW

â&#x20AC;¢ For treating most minor emergencies â&#x20AC;¢ Both kits meet type I (stationary) and II (portable) specifications for indoor use â&#x20AC;¢ May be mounted on wall with two screws (screws not included)

6+(/)),567$,'67$7,21

 3DUW1R

'HVFULSWLRQ

4W\SHU%R[

                     

´[´3ODVWLF%DQGDJH ´[´)DEULF%DQGDJH .QXFNOH )LQJHUWLS%DQGDJHV /DUJH7ULDQJXODU6OLQJ%DQGDJH 6XSHU6WRS%DQGDJH ´[¶&RKHVLYH(ODVWLF%DQGDJH &RQIRUPLQJ*DX]H%DQGDJH5ROO ´[´ ´[´*DX]H'UHVVLQJ3DG $OFRKRO3UHS3DGV 7ULSOH$QWLELRWLF2LQWPHQW3DFNV %XUQ6SUD\R] $QWLVHSWLF6SUD\R] (\H:DVKR]2QH7LPH8VH ´[´7RQJXH'HSUHVVRUV &KHUU\&RXJK'URSV $QWDFLG7DEOHWV $VSLULQ7DEOHWV ([WUD6WUHQJWK3DLQ5HOLHYHU &XW)LUVW$LG7DSH´[\GV ´6FLVVRUV1LFNHO3ODWHG ´7ZHH]HUV3ODVWLF ([DP4XDOLW\*ORYHV

  RIHDFK     RIHDFK              3DLU

72

&RQWHQWV 3HU.LW %R[ %R[ %R[ %R[ 3NJ 3NJ %R[ %R[ %R[ %R[ &DQ &DQ %RWWOH 3NJ %R[ %R[ %R[ %R[ %R[HV 3NJ 3NJ %R[

â&#x20AC;¢ 941 piece industrial first aid station â&#x20AC;¢ Serves up to 100 people â&#x20AC;¢ Exceeds OSHA requirements

&RS\ULJKWÂ&#x2039;


Safety Products 6+(/)),567$,'67$7,21



3DUW1R                                          

'HVFULSWLRQ ´[´3ODVWLF%DQGDJH ´[´)DEULF%DQGDJH .QXFNOH)DEULF%DQGDJH )LQJHUWLS)DEULF%DQGDJH /DUJH)LQJHUWLS)DEULF (OERZ.QHH3ODVWLF%DQGDJH /DUJH7ULDQJXODU6OLQJ%DQGDJH ´[¶&RKHVLYH(ODVWLF%DQGDJH &RQIRUPLQJ*DX]H%DQGDJH5ROO 6XSHU6WRS%DQGDJH 6SUD\2Q%DQGDJHR] 1RQ6WLFN3DGZ$GKHVLYH(GJH ´[´*DX]H'UHVVLQJ3DG ´[´ ´[´*DX]H'UHVVLQJ3DG ´[´*DX]H'UHVVLQJ3DG VTLQ$EVRUEHQW*DX]H&RPSUHVV 0HGLXP%XWWHUIO\%DQGDJH $OFRKRO3UHS3DGV $QWLVHSWLF&OHDQVLQJ:LSHV 7ULSOH$QWLELRWLF2LQWPHQW3DFNV +\GURFRUWLVRQH&UHDP3DFNHWV 3URYLGRQH,RGLQH:LSHV $PPRQLD,QKDODQWV %XUQ5HOLHI3DFNV %XUQ6SUD\R] $QWLVHSWLF6SUD\R] (\H:DVKR]2QH7LPH8VH (\H:DVKR]2QH7LPH8VH (\H'URSVR] (\H3DG7DSH 5HVFXH%UHDWKHU&353DFN ´&RWWRQ7LSSHG$SSOLFDWRUV ´[´,QVWDQW&ROG&RPSUHVV ´[´,QVWDQW&ROG&RPSUHVV $VSLULQ7DEOHWV ([WUD6WUHQJWK3DLQ5HOLHYHU 1RQ$VSLULQ7DEOHWV $QWDFLG7DEOHWV &XW)LUVW$LG7DSH´[´\GV ´'HOX[H6FLVVRUV6WDLQOHVV6WHHO ´'HOX[H7ZHH]HU6WDLQOHVV6WHHO ([DP4XDOLW\*ORYHV

4W\SHU%R[              RIHDFK                6HW            3DLU

&RQWHQWV3HU.LW %R[ %R[ %R[ %R[ %R[ %R[ %R[ %R[ %R[HV 3NJ &DQ %R[ %R[ %R[ %R[ %R[HV %R[ %R[ %R[ %R[ %R[ %R[ %R[ %R[ &DQ &DQ %RWWOH %RWWOH %RWWOH %R[ %R[ 3NJ %R[ %R[ %R[ %R[ %R[ %R[ %R[ 3NJ 3NJ %R[

â&#x20AC;¢ 1719 piece first aid station â&#x20AC;¢ Serves up to 200+ people â&#x20AC;¢ Exceeds OSHA requirments

%/22'%251(3$7+2*(1%2',/<)/8,'63,//.,7



.,7&217(176 4W\             

'HVFULSWLRQ 3ODVWLFFDVH´[´[´ 'LVSRVDEOHJRZQZIXOOVOHHYHV 'LVSRVDEOHVKRHFRYHUV (\HVKLHOGZHDUORRSPDVN ([DPTXDOLW\YLQ\OJORYHVSDLU 5HG=IOXLGVROLGLILHUJUDP %LRKD]DUG6FRRSZLWKVFUDSHU ´[´%LRKD]DUG%DJVJDOFDSDFLW\ &OHDUEDJVZWZLVWWLHV 'LVSRVDEOHFOHDQXSWRZHOV $QWLVHSWLFFOHDQVLQJZLSHV VWLQJIUHH

´[´*HUPLFLGDO NLOOVJHUPV ZLSHFRYHUVVTIW %RGLO\)OXLG3LFN8S*XLGH

./((1*8$5'$&29(5$//6 6L]H

&DVH&RXQW

3DUW1R

/ ;/ ;;/ ;;;/ ;;;;/

    

    

â&#x20AC;¢ Designed to provide personal protection during biohazard clean-up â&#x20AC;¢ Kit meets federal OSHA recommendations â&#x20AC;¢ Reusable plastic case can be easily carried or mounted on a wall

7<9(.&29(5$//6

3DUW1R Z+RRG

6L]H

3DUW1R

&DVHRI 3DUW1R

 

;;/ ;;;/

 

 

â&#x20AC;¢ DuPont Tyvek Material

â&#x20AC;¢ Breathable, microporus film laminate material â&#x20AC;¢ Passes NFPA 99 for antistatic materials â&#x20AC;¢ Meets ANSI/ ISEA 101-1996 sizing standards

&RS\ULJKWÂ&#x2039;

73


Safety Products 32/<3523</(1(&29(5$//6 6L]H

3DUW1R

&DVHRI 3DUW1R

/DUJH ;/DUJH

 

 

&DVH 4W\ /DUJH  ;/DUJH  ;;/DUJH  ;;;/DUJH  6L]H

â&#x20AC;˘ Lightweight, comfortable coverall provides protection from paint overspray, sanding dust, pesticides, grease, dirt, and grime â&#x20AC;˘ Features a full zipper front, elastic wrists and pant cuffs â&#x20AC;˘ Sold individually or by the case

The Right Protection, Right Now!

&RORU

3DUW1R 3DFN

3DUW1R &DVH

:KLWH





â&#x20AC;˘ 100% spun bond polypropylene â&#x20AC;˘ Skid-free sole sleeves â&#x20AC;˘ One size fits most

6$)(7<9(67(&2120<&/$66 6L]H /DUJH ;/DUJH ;;/DUJH ;;;/DUJH

3DUW1R    

3DUW1R    

&DVH 3DUW1R    

â&#x20AC;˘ Tear and puncture resistant â&#x20AC;˘ Snap Front, 2 pockets

+AMMEX

6+2(&29(56

7<9(.7<3(/$%&2$76

3.3DUW1R    

â&#x20AC;˘ Closure: Hook & Loop â&#x20AC;˘ 2â&#x20AC;? Silver tape reflective material, 1 Horizontal stripe â&#x20AC;˘ Color: Hi-viz green â&#x20AC;˘ Material: 100% polyestermesh â&#x20AC;˘ Meet requirenebts of ansi/Isea 107-2004

6:($7%$1'6  EDJRI

â&#x20AC;˘ Deluxe full size (8-5/8â&#x20AC;? long) â&#x20AC;˘ Individually wrapped in plastic sleeves â&#x20AC;˘ Color: blue

6$)(7<&21(6 6L]H ´ ´ ´

3DUW1R   

â&#x20AC;˘ Brillant Red-Orange with UV inhibitor â&#x20AC;˘ 100% PVC Injected Molded cone â&#x20AC;˘ Environmentally Friendly-100% Recyclable

6$)(7<9(6767$1'$5'&/$66

67$.()/$*6

6L]H &RORU 0HGLXP +L9L]*UHHQ /DUJH +L9L]*UHHQ ;/DUJH +L9L]*UHHQ ;;/DUJH +L9L]*UHHQ ;;;/DUJH +L9L]*UHHQ 0HGLXP +L9L]2UDQJH /DUJH +L9L]2UDQJH ;/DUJH +L9L]2UDQJH ;;/DUJH +L9L]2UDQJH ;;;/DUJH +L9L]2UDQJH

6WHP /HQJWK &RORU ´[´  <HOORZ ´[´  %OXH ´[´  2UDQJH ´[´  5HG

3DUW1R 3.3DUW1R                    

)ODJ6L]H

3DUW1R

3. 3DUW1R

     

â&#x20AC;˘ For marking gas, water, or electric lines on construction sites â&#x20AC;˘ Each flag is glued to its metal stem and will not slip or slide

â&#x20AC;˘ Closure: Zipper â&#x20AC;˘ 2â&#x20AC;? Silver tape reflective material, 2 Horizontal stripe â&#x20AC;˘ Material: 100% polyestermesh â&#x20AC;˘ Pockets: 2 each upper outside, 2 ea lower inside â&#x20AC;˘ Meet requirements of ansi/Isea 107-2004

6$)(7<9(67(&2120<&/$66 6L]H 600(' /*;/* ;/;/ ;/;/ 600(' /*;/* ;/;/ ;/;/

&RORU +L9L]*UHHQ +L9L]*UHHQ +L9L]*UHHQ +L9L]*UHHQ +L9LV2UDQJH +L9LV2UDQJH +L9LV2UDQJH +L9LV2UDQJH

3DUW1R        

+($7:25.6:$50(56 'HVFULSWLRQ

3URGXFW &RGH

3DUW1R

+:



+:



+:



+DQG3RFNHW  *ORYH:DUPHU 3DLU%R[ +DQG:DUPHU $GKHVLYH7RH:DUPHU

â&#x20AC;˘ Air activated warmers

â&#x20AC;˘ Excellent low cost Class 3 vest â&#x20AC;˘ 100% light weight cool polyester for comfort â&#x20AC;˘ Velcro front closure â&#x20AC;˘ Two chest pockets

74

&RS\ULJKWÂ&#x2039;


Razor Blades and Utility Knives

Razor Blades and Utility Knives

67$1'$5'

67$1'$5' +($9<'87<

  ²SFEXONSDFN • Regular duty single edge (.009 gauge) • Aluminum backing • Individually wrapped for rust prevention • Ideal for cutting, scraping and trimming • Fits standard razor blade tools • 100 per tray

 • Heavy duty single edge (.012 gauge) • Aluminum backing • Similar quality as #9, but heavier gauge • Ideal for cutting, scraping and trimming • Fits standard razor blade tools • 100 per tray

(&2120<

(&2120< +($9<'87<

 • Single edge razor blade (.09 gauge) • Steel Backing • Fits standard razor blade tools • Sold 100 blades per box

 • Single edge razor blade (.012 gauge) • Steel Backing • Fits standard razor blade tools • Sold 100 blades per box

&RS\ULJKW‹

75


Razor Blades and Utility Knives 3/$67,&%/$'(

:,1'6+,(/'6&5$3(5

 • Plastic scraper blade • Safely removes stickers from plastic, coated windshields • Ideal for cutting, scraping and trimming • Will not cut or scratch work surfaces • Fits standard razor blade tools

 • Folds and locks closed for safe storage and carrying • 1-1/2” wide by 5” long, unfolds to 8” overall length • Blades lock open in 3 different positions • Comes with one razor blade

5$=25%/$'(6&5$3(5

'(/7$+($9<'87<*/$666&5$3(5

 • Stainless Steel Hand Scraper • Positive Brass Retention Slide • Comes With a Package of 5 single edge blades • Overall length 3-3/4” • Made in USA

 • Bio-engineered shape for better grip and precise control • Longer handle keeps hands farther away from blade • Blade is held at 5° offset angle for improved scraping • Extra firm blade clamp holds blade under scraping pressure • Comes with one blade

(;75$+($9<'87<5$7&+(7/2&.&877(5

(;75$+($9<'87<5(3/$&(0(17%/$'(

 • Cushion grip • Chemical resistant

 • 7 cutting edges per blade • Package of 5

+($9<'87<$872/2&.87,/,7<.1,)(

8/75$0$;61$32))%/$'(

 • Anti-slip cushion-grip handle • Built-in metal for prying paint cans and more

 • 18mm double honed blade for extreme sharpness • 8 cutting edges per blade • Package of 5

5$7&+(7/2&.87,/,7<.1,)(

&86+,21*5,35$7&+(7/2&.87,/,7<.1,)(

 • Contoured durable handle

  ²5HSODFHPHQWEODGH • Ratchet-wheel blade lock

76

&RS\ULJKW‹


Razor Blades and Utility Knives 08/7,385326(87,/,7<.1,)(

61$32))%/$'(

 â&#x20AC;˘ For light duty cutting jobs â&#x20AC;˘ Slide lock and pocket clip

 â&#x20AC;˘ 9mm carbon tool steel â&#x20AC;˘ 13 cutting edges per blade â&#x20AC;˘ Package of 10

08/7,%/$'($872/2$'87,/,7<.1,)(

8/75$0$;61$32))%/$'(

 â&#x20AC;˘ Automatic blade load-holds 5 blades

 â&#x20AC;˘ 9mm double honed for extreme sharpness â&#x20AC;˘ Package of 10

67$,1/(6667((/61$32))%/$'(

67$,1/(6667((/6/,'(/2&.87,/,7<.1,)(

 â&#x20AC;˘ 13 cutting edges per blade â&#x20AC;˘ Package of 10

 â&#x20AC;˘ For moist environment where rust is a concern

67$,1/(6667((/$872/2&.87,/,7<.1,)(

61$32))%/$'(.1,)( 00

  ²5HSODFHPHQWEODGH

  ²5HSODFHPHQWEODGHV SN

â&#x20AC;˘ Automatic blade lock

â&#x20AC;˘ Cut cardboard, foil, paper, wallcovering, etc. â&#x20AC;˘ 13 Sharp points per blade â&#x20AC;˘ Retractable blade with AUTO-LOCK â&#x20AC;˘ Stainless steel blade track â&#x20AC;˘ Built-in blade breaker â&#x20AC;˘ 3 Blades included (2 Blades stored in handle)

61$32))%/$'(.1,)( 00

87,/,7<.1,)(

  ²5HSODFHPHQWEODGHV SN

 â&#x20AC;˘ Ergonomic Shape, 6â&#x20AC;? overall length â&#x20AC;˘ Handle is painted safety orange â&#x20AC;˘ Industrial Quality, Retractable Blade With 3 position Zinc Retractor â&#x20AC;˘ Safety Nose overlaps top & bottom for blade security â&#x20AC;˘ Store extra blades in handle (comes with one blade) â&#x20AC;˘ Made in USA â&#x20AC;˘ Use utility blade 690.992 as replacement

â&#x20AC;˘ Cut carpeting, drywall, wallcovering, cardboard, etc. â&#x20AC;˘ 8 sharp points per blade â&#x20AC;˘ Retractable blade with one-piece positive lock â&#x20AC;˘ Stainless steel blade track â&#x20AC;˘ Built-in blade breaker â&#x20AC;˘ 3 blades included (2 blades store in handle) &RS\ULJKWÂ&#x2039;

77


Razor Blades and Utility Knives 87,/,7<%/$'(6

 ²+HDY\GXW\XWLOLW\EODGH JDXJH

 ²Dispenser unit with 100 H.D. Blades â&#x20AC;˘ Fits most utility knives including StanleyÂŽ, Red DevilÂŽ, and FullerÂŽ â&#x20AC;˘ Ideal for cutting drywall, fiberglass, wood, plastic, cardboard, etc. â&#x20AC;˘ Use with 690.102 tool

/(12;*2/'87,/,7<.1,)(3$&.

/(12;*2/'%,0(7$/87,/,7<.1,)(%/$'(6

 â&#x20AC;˘ Retractable utility knife with 3 Lenox Gold Utility Knife Blades â&#x20AC;˘ Extremely durable stainless steel nose resists wear â&#x20AC;˘ Quick release allows operator to change blades without opening handle â&#x20AC;˘ Able to store up to 5 blades in the handle

 ²%ODGHV3HU3DFN  ²%ODGHV3HU3DFN â&#x20AC;˘ Patented bi-metal construction â&#x20AC;˘ Gold coated edge is double the harness of ordinary utility blades â&#x20AC;˘ Shatter-resistant and virtually unbreakable â&#x20AC;˘ Up to 5X the life of standard carbon steel blades â&#x20AC;˘ 4 notch design extends blade further for deeper cutting

%/$'(%$1.

5(75$&7$%/(87,/,7<%/$'(*/$666&5$3(5

 ²:LWK:DOO%UDFNHW  ²:LWKRXW:DOO%UDFNHW â&#x20AC;˘ Bright, yellow plastic, one-time-use blade container (9 1/2â&#x20AC;? H x 3 1/2â&#x20AC;? W x 2 1/2 D) â&#x20AC;˘ Get used blades out of the workplace, off the floor, out of trash containers and all potentially hazardous locations â&#x20AC;˘ Holds approximately 1000 utility style blades â&#x20AC;˘ Comes with two plastic ties for quick and easy mounting to post angle iron (#690.951) â&#x20AC;˘ Also available with reusable metal wall bracket (#690.950) â&#x20AC;˘ When plastic unit is full dispose of in any approved receptacle

  ²5HSODFHPHQWEODGHV SN

â&#x20AC;˘ Use to remove paint and stickers from glass, mirrors or windshields â&#x20AC;˘ Rugged polystyrene construction â&#x20AC;˘ Retractable blade with positive lock â&#x20AC;˘ Built in scraping guide produces clean edges while leaving paint in contact with glass for proper seal â&#x20AC;˘ 1 blade included

%/$'(',6326$%/(&217$,1(5  â&#x20AC;˘ Includes wire holder â&#x20AC;˘ For utility-Knife blades and single-edged razor blade

78

&RS\ULJKWÂ&#x2039;


Equipment

Equipment 7251$'2&.352 ´835,*+79$&880:$77$&+0(176

TEXAS OR MISSOURI

  ²5HSODFHPHQW&OHDQ%UHH]HEDJVIRU7RUQDGR&.3523DFN • Ergonomic handle allows for multiple hand positioning • Standard onboard tools that make detail cleaning a breeze • True three-stage HEPA filtration • CRI SOA Silver approval, meeting LEED standards • Sound level that is less than 70 dB(A) • No-tool brush and belt replacement • Telescopic wand that has up to 30% longer reach than the competition • Standard Clean Breeze filter bag reduces dust emissions over 60% over paper bag • Uses replacement Clean Breeze bags 697.4011

7251$'2&9 ´835,*+7&200(5&,$/9$&880

TEXAS OR MISSOURI

  ²5HSODFHPHQW&OHDQ%UHH]HEDJVIRU7RUQDGR&93DFN • Built to Last with a rugged polypropylene base with non-marking injection molded rubber bumper • Rugged front cover seals to contain fine particulates and dust. If the filters are not properly in place, the front cover will not close. • Rugged polypropylene base with Standard onboard tools that make detail cleaning a breeze • True three-stage HEPA filtration • CRI SOA Silver approval, meeting LEED standards • Quiet operation with a sound level of 66 dB(A) • No-tool brush and belt replacement • Standard Clean Breeze filter bag reduces dust emissions over 60% over paper bag • Uses replacement Clean Breeze bags 697.4013

&RS\ULJKW‹

79


Equipment 7251$'2:,1'6+($5

7251$'206(5,(6)/2250$&+,1(

%/2:(5'5<(5

530)/2256&58%%(5



TEXAS OR MISSOURI

• Space saver stackable design takes up less room in storage • Easy transport with molded-in handle • Reinforced motor lugs to prevent damage in transport • A three-speed switch permits airflow selection of 1600, 2000 and 2500 CFM • Build-in three angle adjustment for drying or general air circulation • Rotomolded high density polyethylene housing for rugged durability

 ²´ TEXAS OR  ²´ MISSOURI • Offering 175 rpm scrubbing power • Quick-grip pad holders come standard • Cam-lever provides variable height adjustment • Ergonomic Start Guard and handle for safety and added strength • Cushioned handle grips to minimize operator fatigue • Optional shampoo tank with variable-rate solution control for scrubbing or carpet cleaning • Can be fitted with pads and disc brushes for multiple tasks • Quick-grip pad holder for more efficient change and disposal of disc pads

7251$'20,1,0$5$7+21

7251$'26:(7'5<9$&880

6(/)&217$,1('&$53(7(;75$&725

&200(5&,$/7$1.9$&880





TEXAS OR MISSOURI

TEXAS OR MISSOURI

• High-performance 2-stage, 1.6 hp vacuum motor • 4.25 solution tank with large fill area • 4 gallon recovery tank, perfect for cleaning small areas • 112 cfm and 107” of water lift • Protective filter screen removes debris and eliminates clogs • Clear recovery hose provides visibility ofsolution as it is recovered from carpet • Comfort grip and adjustable handle that folds down for easy transport in any vehicle.

• 18 guage Stainless Steel body • Powerful 1.61 hp motor • Sound insulated vacuum head unit • 114 cfm and 90” waterlift • Durable polyethylene dolly with push handle • Two stage dust-free filtration process • 360-degree hose rotation • Built in wheels • Standard attachments include a crush proof hose, two-piece wand, hard floor tool, squeegee attachment, dust brush and crevice tool

7251$'23

3$3(5&2//(&7,21%$*7251$'2&9

+,*+63(('(/(&75,&%851,6+(5 

TEXAS OR MISSOURI

• Heavy-duty 2000 RPM 1.5 hp motor with low start up and operating amp draw • Patented rotational molded housing absorbs vibration and minimizes torque for easy operation and control • Floating handle provides great maneuverability with no “flutter” or pull • Optimal head weight for maximized pad-to-floor contact, providing the • best shine possible • Low profile for easy maneuverability • Flex pad holder with lock-in retainer

80

²3DFN • Paper Collection Bags for Tornado CV30 Vacuum • 10 Bags per package • Provides high-quality filtration at an economical price

&RS\ULJKW‹


Tapes

Tapes 3/$67,',3Â&#x160;/,48,'(/(&75,&$/7$3(

%586+21(/(&75,&$/7$3(

 ²R]5HG  ²R]%ODFN â&#x20AC;˘ An air-dry, synthetic rubber coating with applicator brush in cap â&#x20AC;˘ Will not unravel like tape or crack, harden or peel â&#x20AC;˘ Exhibits excellent moisture, acid, alkaline, abrasion,and dielectric resistance. â&#x20AC;˘ Can be used to seal, insulate, protect, and color code connections â&#x20AC;˘ Remains flexible even under extreme conditions

 ²R] â&#x20AC;˘ Liquid Electrical Tape â&#x20AC;&#x201C; Brush-Top Can â&#x20AC;˘ Seals / Insulates / Repairs in 5 Minutes â&#x20AC;˘ Color: black â&#x20AC;˘ Dielectric / Stays Flexible / Moisture-Proofing â&#x20AC;˘ Excellent for odd-shaped and hard-to-reach connections â&#x20AC;˘ Stabilizes terminal connections / Stops loosening due to vibration â&#x20AC;˘ Easy-To-Use: Brush onto connection. Succeeding coats may be applied in 5-minute intervals if greater thickness is needed. Dries to touch in 5 minutes; fully cures in 24 hours.

6&27&+Â&#x160;683(5Â&#x152;9,1</(/(&75,&$/7$3(

6&27&+Â&#x160;9,1</(/(&75,&$/7$3()25 &2/25&2',1*

 ²´[Âś  ²´[Âś  ²´[Âś â&#x20AC;˘ The first and only 7-mil â&#x20AC;&#x153;one tape for all jobsâ&#x20AC;? â&#x20AC;˘ It wraps and holds in all weather and will continue to perform in sub-zero temperatures or in continuous temperature environment up to 220°F (105°C) â&#x20AC;˘ Conforms remarkably well â&#x20AC;˘ Resistant to oil, water, wear, chemicals and solvents â&#x20AC;˘ Voltage Range: up to 600v â&#x20AC;˘ Flame Retardant

6L]H

&RORU

[Âś [Âś [Âś [Âś [Âś [Âś [Âś [Âś [Âś

%OXH %URZQ *UD\ *UHHQ 2UDQJH 5HG 9LROHW :KLWH <HOORZ

0 3DUW1R         

3DUW1R

        

â&#x20AC;˘ Suited for all-weather conditions â&#x20AC;˘ Excellent electrical insulating

&RS\ULJKWÂ&#x2039;

81


Tapes 6&27&+Â&#x160;9,1</3/$67,&(/(&75,&$/7$3( 683(5

0Â&#x152;7(0)/(;Â&#x152;9,1</(/(&75,&$/7$3( 

0Â&#x152;58%%(563/,&,1*7$3(&

(/(&75,&$/7$3(

 ²´[Âś  ²´[Âś  ²´[Âś â&#x20AC;˘ Self-bonding ethylene propylene rubber (EPR) â&#x20AC;˘ Linerless, highly conformable â&#x20AC;˘ Weather resistant â&#x20AC;˘ Temperature rating: 90°C continuous operation   Â&#x192;&LQWHUPLWWHQW â&#x20AC;˘ Use for low and high voltage applications WKURXJKN9

 ²´[Âś  ²´[Âś â&#x20AC;˘ 7 Mil Thickness â&#x20AC;˘ Pressure Sensitive â&#x20AC;˘ Resistant to sun, water, oil, acids, alkalies and corrosive chemicals â&#x20AC;˘ UL Approved â&#x20AC;˘ Temperature rating: Max 176°F (80°C) â&#x20AC;˘ Uses: General splicing or as a protective outer jacket

$//:($7+(5,168/$7,1*7$3(

0Â&#x152;&/27+)5,&7,217$3(

 ²[Âś%ODFN â&#x20AC;˘ 7 Mil Thickness â&#x20AC;˘ Highly resistant to sun, water, oil, acid, alkalines, corrosive chemicals â&#x20AC;˘ UL Approved â&#x20AC;˘ Temperature rating: Max. 176° F (80° C)

 ²´[Âś â&#x20AC;˘ Used for sealing low voltage splices â&#x20AC;˘ Excellent abrasion resistance

&2/'6+5,1.7$3(

6(/))86,1*7$3(

 ²´[Âś%ODFN  ²´[Âś%ODFN  ²´[Âś:KLWH â&#x20AC;˘ Self-amalgamating ethylene propylene rubber (EPR) â&#x20AC;&#x153;weldsâ&#x20AC;? itself chemically and mechanically to form a watertight skin â&#x20AC;˘ Resists abrasion, impact, sunlight, ozone and most chemicals â&#x20AC;˘ Requires no heat or flame â&#x20AC;˘ Temperature Range: -40°C to 100°C and 130°C intermittently â&#x20AC;˘ Dielectric Strength: 36 KV/mm

 ²PLO*UD\  ²PLO%ODFN â&#x20AC;˘ 1â&#x20AC;? x 12 yd. roll â&#x20AC;˘ Silicone rubber tape provides an insulative barrier that is resistant to moisture, ozone and cozona â&#x20AC;˘ Temperature Range: -65°F to 500°F

:5$3Âľ16($/6(/))86,1*6,/,&21(7$3(

6&27&+Â&#x160;(/(&75,&$/02,6785(6($/$17 7$3(

 ²´[Âś â&#x20AC;˘ Suited for cold weather applications â&#x20AC;˘ Remains flexible

 ²%ODFN  ²5HG â&#x20AC;˘ 1â&#x20AC;? x 20â&#x20AC;&#x2122; roll â&#x20AC;˘ Self-adhering silicone tape has no adhesive and leaves no sticky residue â&#x20AC;˘ Fuses and cures to itself within 24 hours to form a permanent moisture tight seal â&#x20AC;˘ Excellent choice for high temperature applications â&#x20AC;˘ Thickness: .002â&#x20AC;? â&#x20AC;˘ Operating Temperature: -65°F to +500°F â&#x20AC;˘ Dielectric Strength: 400 volts per mil (vpm) â&#x20AC;˘ Tensile Strength: 700 PSI â&#x20AC;˘ Elongation: 300% â&#x20AC;˘ Meets MIL-I-46852C Type I and II

82

 ²[Âś â&#x20AC;˘ Flame retardant and weather resistant â&#x20AC;˘ Voltage Range: up to 600V â&#x20AC;˘ Temperature Range: up to 176°F

 ²´[Âś  ²´[´3DGV â&#x20AC;˘ Quick and easy method of moisture-proofing electrical connections â&#x20AC;˘ Protects against vibration, road grime and abrasion

&RS\ULJKWÂ&#x2039;


Tapes 6&27&+Â&#x160;*/$66&/27+7$3(  ²´[Âś:KLWH â&#x20AC;˘ 7 Mil Thickness â&#x20AC;˘ Pressure-sensitive rubber thermosetting adhesive â&#x20AC;˘ Excellent tensile (150 lb/in) and dielectric strength (3000 volts) â&#x20AC;˘ Temperature rating: 266°F (130°C)

3$,17(5Âś60$6.,1*7$3(  ²´:LGH[<DUGV  ²´:LGH[<DUGV  ²´:LGH[<DUGV  ²´:LGH[<DUGV â&#x20AC;˘ High heat range (275°F) allows for expansion under heat without lifting â&#x20AC;˘ Highly conformable; easily applied to curved surfaces â&#x20AC;˘ Strong adhesive bonding force to surfaces or to itself, yet strips cleanly and easily

6&27&+Â&#x160;3/$67,&7$3(²%/8(  ²´[\DUGV  ²´[\DUGV â&#x20AC;˘ Uniquely constructed vinyl backed tape offers outstanding paint line definition â&#x20AC;˘ Superior holding power â&#x20AC;˘ Packaged in individual poly bags

0Â&#x152;*(1(5$/385326(0$6.,1*7$3(  ²´[\DUGV  ²´[\DUGV  ²´[\DUGV â&#x20AC;˘ Utility grade paper masking tape â&#x20AC;˘ Use for non-critical masking, sealing, and holding applications â&#x20AC;˘ Not recommended for paint masking

&RS\ULJKWÂ&#x2039;

6&27&+Â&#x160;),5(5(7$5'$17(/(&75,&$5& 3522),1*7$3(

 ²´[ÂśUROO â&#x20AC;˘ Designed to protect all types of electric cables where exposed to potential failures of other high voltage cables or exposed to other high energy cables â&#x20AC;˘ Extremely conformable, easily wraps irregular shapes â&#x20AC;˘ Provides fault arc protection to adjacent wrapped cables and accessories â&#x20AC;˘ Self-extinguishing, will not propagate flame â&#x20AC;˘ Non-corrosive to metallic cable sheaths and compatible with synthetic cable jackets (i.e. semiconducting URD type, polyethylene, PVC, etc.) â&#x20AC;˘ Resistant to water, salt water, acids, sewage, and ultraviolet light â&#x20AC;˘ Thickness: 30 mils (.030â&#x20AC;?) â&#x20AC;˘ Color: Black

6&27&+Â&#x160;$872027,9(5(),1,6+0$6.,1* 7$3(  ²´[\DUGV  ²´[\DUGV  ²´[\DUGV  ²´[\DUGV â&#x20AC;˘ High performance tape designed to meet the needs of todayâ&#x20AC;&#x2122;s collision repair shops â&#x20AC;˘ Highly conformable, improved adhesive transfer resistance â&#x20AC;˘ Provides outstanding paint lines and a controlled, consistent unwind â&#x20AC;˘ Consistent performance under a variety of climactic conditions â&#x20AC;˘ Color: Green

6&27&+Â&#x160;/21*0$6.Â&#x152;0$6.,1*7$3(   ²´[\DUGV  ²´[\DUGV  ²´[\DUGV  ²´[\DUGV â&#x20AC;˘ Designed for short-term vehicle storage applications â&#x20AC;˘ Synthetic adhesive system provides UV stability and adhesive transfer resistance for up to seven days after application â&#x20AC;˘ Controlled crepe paper backing makes tape conformable and smooth for use when masking around damaged window, door and trunk openings â&#x20AC;˘ Color: Blue

0Â&#x152;'225$3(5785(5(),1,6+7$3( '$57

 ²PP ´ [\GV PHWHUV

â&#x20AC;˘ Soft edge foam masking tape â&#x20AC;˘ Designed to be used in masking door jams, hood or deck lid openings or other areas of a vehicle which need to be sealed during the painting operation â&#x20AC;˘ Provides a â&#x20AC;&#x153;soft edgeâ&#x20AC;? to prevent tape lines in the jam areas

83


Tapes :5(&.:5$3  ²´[Âś  ²´[Âś â&#x20AC;˘ Protects vehicle interior from rain, wind, snow, dirt, etc. â&#x20AC;˘ Adheres to any clean, dry surface â&#x20AC;&#x201C; glass, metal, plastic and interior surfaces & fabric â&#x20AC;˘ Can easily be peeled off without leaving any adhesive behind â&#x20AC;˘ Can also be used for vehicle & sign transport protection and over-spray protection on building/home & glass

685)$&(3527(&7,217$3(  ²´[\DUGV  ²&DVHRI

'85,1*$66(0%/< â&#x20AC;˘ Rework or cleaning can be avoided if interior surfaces are protected â&#x20AC;˘ Suitable for rough surfaces due to the high adhesive level â&#x20AC;˘ Standard polypropylene tape â&#x20AC;˘ Color: Ivory

075,00$6.,1*7$3(

$17,$%5$6,217$3(5('

 ²6WDUWHU.LW 6WDUWHU.LWFRQWDLQVUROORIHDFKVL]H7KH UHXVDEOH FDUWRQSURYLGHVFRQYHQLHQWVWRUDJHRIDOOUROOV â&#x20AC;˘ Hard band strip designed to actually lift up the molding from the vehicle, allowing paint to flow under molding â&#x20AC;˘ Saves time, labor and the cost of removing and installing new moldings â&#x20AC;˘ Works particularly well on flush mount windsheild and back glass moldings â&#x20AC;˘ Can be used on a variety of moldings found on todayâ&#x20AC;&#x2122;s domestic and imported vehicles â&#x20AC;˘ 2â&#x20AC;? x 10.94 yards

 ²´;\G â&#x20AC;˘ Protects against over-sanding and scratching of body panels during paint prep â&#x20AC;˘ Eliminates costly repaints â&#x20AC;˘ More durable than masking tape â&#x20AC;˘ Will not leave glue residue when removed

75,0/,)7,1*7$3(

/,)7,1*7$3(

 â&#x20AC;˘ A specially designed masking tape with a flexable, clear plastic edge used for masking around wind shields, tail lights and sunroofs â&#x20AC;˘ 10m long â&#x20AC;˘ 10mm wide clear plastic strip â&#x20AC;˘ Pertorated every 2 inches for easy tear off

84

6L]H PP[Âś PP[Âś PP[Âś PP[Âś PP[Âś PP[Âś

&RORU *UHHQ <HOORZ 2UDQJH %OXH &OHDU 5HG

3DUW1R

      â&#x20AC;˘ Used for easier masking and painting around window seals â&#x20AC;˘ Raises molding and allows paint to flow under it â&#x20AC;˘ Gives an outstanding professional finish, saves times, money & labor â&#x20AC;˘ Suitable for use in low bake ovens â&#x20AC;˘ A range of sizes available for a large variety of import & domestic vehicle applications

&RS\ULJKWÂ&#x2039;


Tapes 0Â&#x152;6$)(7<:$/.Â&#x152;

0Â&#x152;&2163,&8,7< 5()/(&7,9( 7$3(

 ²´[\DUGV  ²´[\DUGV  ²´[Âś â&#x20AC;˘ General Purpose slip-resistant material â&#x20AC;˘ Adhesive backed roll â&#x20AC;˘ Color: Black â&#x20AC;˘ For use on smooth, flat surfaces such as walkways, stairways, loading docks, etc.

    

²´[IW5ROO´5HGDQG´:KLWH6WULSHV ²´[IW5ROO´5HGDQG´:KLWH6WULSHV ²´[´6WULS´5HGDQG´:KLWH6WULSHV ²´[IW5ROO:KLWH ²´[IW5ROO´5HGDQG:KLWH

â&#x20AC;˘ Designed to mark the side andrear perimeter of trucks and trailers for enhanced visibility and detection â&#x20AC;˘ In compliance with NHTSA ruling and DOT-C2 certification â&#x20AC;˘ Guaranteed to meet NHTSAâ&#x20AC;&#x2122;s minimum specifications for seven (7) years

5()/(;,7(Â&#x160;'27&2163,&8,7< 5()/(&7,9( 7$3(  ²´[Âś5ROO´:KLWH ´5HG6WULSHV  ²´[Âś5ROO´:KLWHDQG´5HG6WULSHV  ²´[Âś5ROO6ROLG:KLWH  ²´[´6WULS´:KLWHDQG´5HG6WULSHV  ²´[Âś5ROO6FKRRO%XV<HOORZ6ROLG<HOORZ  ²´[Âś5ROO6FKRRO%XV<HOORZ6ROLG<HOORZ â&#x20AC;˘ Enhanced daytime color - Exceeds all minimum requirements for school bus conspicuity tape â&#x20AC;˘ Impact resistant - maintains photometric performance after impact - maintains conspicuity after collision or years of wear. â&#x20AC;˘ Easy to apply - thin and flexible with 100% adhesion. Superior durability withstands high pressure washing and resists edge lift. â&#x20AC;˘ OEM preferred - can be riveted; no edge sealing required.

0Â&#x152;&21)250$%/(6$)(7<:$/.Â&#x152;

)/$**,1*7$3(

 ²´[Âś â&#x20AC;˘ Conformable slip-resistant material â&#x20AC;˘ Adhesive backed roll â&#x20AC;˘ Special aluminum backing conforms around corners and adheres to irregular surfaces â&#x20AC;˘ Color: Black â&#x20AC;˘ For use on steps and ladder rungs, heavy equipment, and vehicles

²´[Âś*OR2UDQJH â&#x20AC;˘ High tensile strength, resistant to breaking or tearing â&#x20AC;˘ Remains pliable, resist cracking even in the coldest weather â&#x20AC;˘ Used to identify boundries for surveying work, construction projects , recreational applications and for marking any other area.

$,6/(0$5.,1*7$3(

%$55,&$'(7$3(

&RORU <HOORZ <HOORZ%ODFN 5HG %OXH 2UDQJH <HOORZ%ODFN

6L]H ´[\DUGV ´[\DUGV ´[\DUGV ´[\DUGV ´[\DUGV ´[\DUGV

3DUW1R

      â&#x20AC;˘ Material: Polyvinyl Chloride (PVC) with synthetic rubber adhesive â&#x20AC;˘ Used for a wide range of color coding applications, lane marking and safety coding to meet OSHA requirements â&#x20AC;˘ Durable, puncture and tear resistant &RS\ULJKWÂ&#x2039;

 ²´[Âś&DXWLRQ  ²´[Âś&DXWLRQ  ²´[´&DXWLRQ'R1RW(QWHU â&#x20AC;˘ Black on Yellow â&#x20AC;˘ Poly barricade tape for warning at temporary safety hazards â&#x20AC;˘ Econmical, strong and disposable

85


Tapes +,*+75$&7,216$)(7<7$3(²$17,6/,3

3267,7Â&#x160;5(029$%/(/$%(/,1*7$3(

 ²´[œ%ODFN  ²´[œ%ODFN

 ²´[\DUGV â&#x20AC;˘ White, general purpose labeling tape that is easily removable â&#x20AC;˘ Use for shelf and bin marking and package identification â&#x20AC;˘ Works great for correction and cover-up work. â&#x20AC;˘ Use for work piece and body parts temporary identification

â&#x20AC;˘ Thin tough waterproof silicone carbide fabric, coated with mineral partcles â&#x20AC;˘ Adhesive backed â&#x20AC;˘ Application: Use on ramps, staies, cab steps, and in plants where oily conditions exist

0Â&#x152;6&27&+02817Â&#x152;'28%/(&2$7(' $&5</,&)2$07$3(

0Â&#x152;6&27&+02817Â&#x152;'28%/(&2$7(' $&5</,&)2$07$3(

   

 ²´[\DUGV%ODFN  ²´[\DUGV:KLWH â&#x20AC;˘ Intended for more demanding applications requiring a thicker tape â&#x20AC;˘ Resists stress with high conformability to compensate for part-to-body mismatch â&#x20AC;˘ OEM approved for attaching body side moldings, fascia nerf strips, bumper trim, door edge moldings, claddings, and a wide variety of other trim components â&#x20AC;˘ Good initial and cold temperature adhesion â&#x20AC;˘ Thickness: 1.8mm (.060â&#x20AC;?)

²´[\DUGV:KLWH ²´[\DUGV:KLWH ²´[\DUGV%ODFN ²´[\DUGV%ODFN

â&#x20AC;˘ OEM approved for attaching body side moldings, fascia nerf strips, bumper trim, wheel lip and door edge moldings, claddings, etc. â&#x20AC;˘ Resists stress â&#x20AC;˘ Good cold temperature adhesion â&#x20AC;˘ Thickness: 1.2mm (.045â&#x20AC;?)

0Â&#x152;6&27&+02817Â&#x152;1$0(3/$7(5(3$,5 '28%/(6,'('$77$&+0(177$3(  ²´ZLGH[IW 7$3(

 ²´[Âś\DUGV*UD\ â&#x20AC;˘ Automotive acrylic foam tape â&#x20AC;˘ Adheres emblems, nameplates, etc. to vehicle surfaces â&#x20AC;˘ Thinner foam allows for a flush mount to the vehicleâ&#x20AC;&#x2122;s surface â&#x20AC;˘ Thickness: 0.8mm (.030â&#x20AC;?) â&#x20AC;˘ Permanently adheres to OEM and aftermarket paint systems

 ²´ZLGH[IW  ²´ZLGH[IW  ²´ZLGH[IW  ²´ZLGH[IW 1RWH$OOWDSHVDUH´ PP WKLFN$OOWDSHV DUHEODFNZLWKEOXHEDFNLQJ+LJKVWUHQJWKDOO ZHDWKHUPRXQWLQJWDSHLVLGHDOIRUDZLGHYDULHW\ RIDXWRPRWLYHDSSOLFDWLRQV â&#x20AC;˘ OEM Approved â&#x20AC;˘ Polyurethane foam with acrylic adhesive â&#x20AC;˘ Super long life â&#x20AC;˘ Strong Adhesive Bond

0Â&#x152;'28%/(&2$7('32/<(7+</(1( )2$07$3(

0Â&#x152;'28%/(&2$7('85(7+$1()2$0 7$3(

 ²´[\DUGVPP ´

 ²´[\DUGVPP ´

â&#x20AC;˘ Conformable closed cell foam â&#x20AC;˘ High strength acrylic adhesive provides good initial tack & offers high ultimate adhesion to a wide variety a of surfaces â&#x20AC;˘ Color: White

 ²´[\DUGV´ â&#x20AC;˘ Ideal for a multitude of general purpose, indoor mounting and joining applications â&#x20AC;˘ Open-Cell, soft and conformable, high in strength â&#x20AC;˘ Functions well for extended periods at temperature of 104 C/ 200 F

$77$&+0(177$3(²&/($5

*$))(567$3(

 ²´[œ\DUGV PP[PP

 ²´[œ\DUGV PP[PP

 ²´[Âś\DUGV0LO â&#x20AC;˘ Used to attach paper barrier between door panel and structure of door â&#x20AC;˘ 11.0 mil thick â&#x20AC;˘ Matte black finish to match OEM tapes

â&#x20AC;˘ Double-sided acrylic adhesive on a polyester film for permanent mounting of trim and emblems â&#x20AC;˘ Adheres to plastics, metals and woods â&#x20AC;˘ Thickness: .008â&#x20AC;?

86

&RS\ULJKWÂ&#x2039;


Tapes $&5</,&75$16)(57$3(  ²´[Âś\DUGV  ²´[Âś\DUGV â&#x20AC;˘ 2 mil reinforced acrylic transfer tape â&#x20AC;˘ Ideal for permanent bonding of papers, plastics and films â&#x20AC;˘ Can also be used as a core start up tape â&#x20AC;˘ Conforms to FDA 21 CFR 175.105 â&#x20AC;&#x153;Adhesivesâ&#x20AC;?

'8&77$3( 6L]H ´[<DUGV ´[<DUGV ´[<DUGV ´[<DUGV ´[<DUGV ´[<DUGV ´[<DUGV ´[<DUGV ´[<DUGV

'HVFULSWLRQ %ODFN0LO %ODFN0LO %ODFN0LO :KLWH0LO 6LOYHU0LO 6LOYHU0LO 6LOYHU0LO <HOORZ0LO 5HG0LO

3DUW1R

        

â&#x20AC;˘ Polyethylene coated cloth â&#x20AC;˘ Strong, moisture proof barrier for packaging â&#x20AC;˘ Uses: general purpose applications including binding, holding, sealing and construction. â&#x20AC;˘ Use 11Mil for more demanding applications.

0Â&#x152;&/($5'8&77$3(

0Â&#x152;$/80,180)2,/7$3(

 ²´[\DUGV â&#x20AC;˘ Makes repairs less obvious â&#x20AC;˘ Will not fall apart in extreme tmperatures and harsh UV conditions â&#x20AC;˘ Lasts six times longer than other ordinary duct tapes

 ²´[´\DUGV â&#x20AC;˘ Dead soft aluminum foil backing with an acrylic adhesive â&#x20AC;˘ Aluminum backing acts as a heat shield, minimizing heat transfer â&#x20AC;˘ Superior conformability to adhere to irregular surfaces â&#x20AC;˘ Acrylic adhesive system developed for solvent resistance and clean removal â&#x20AC;˘ High adhesion and excellent aging resistance â&#x20AC;˘ Can be used for numerous masking and sealing applications

7+5($'6($/$177$3(

$,5&21',7,21,1*6($/$177$3(

 ²´[´  ²´[´  ²´[´  ²´[´ â&#x20AC;˘ Low density thread sealant tape with PTFE â&#x20AC;˘ Lubricates, protects and seals threads â&#x20AC;˘ Thread sealant tape makes it easier to assemble or disassemble threaded fittings, without the risk of system contamination

 ²´[´ â&#x20AC;˘ Dum Dum tape 1/8â&#x20AC;? thick â&#x20AC;˘ Black foam rubber â&#x20AC;˘ Insulates, prevents condensation, deadens sound

$/80,180)2,/7$3(

648($.5('8&7,217$3(

 ²´[´\DUGV â&#x20AC;˘ Dead soft aluminum foil backing is extremely conformable to irregular surfaces â&#x20AC;˘ Excellent adhesion and quick stick â&#x20AC;˘ Appropriate for a variety of insulation uses â&#x20AC;˘ Total Thickness: 5 mil â&#x20AC;˘ Foil Thickness: 2 mil

 ²´[\DUGV â&#x20AC;˘ An ultra-high molecular weight polyethylene film tape designed for the automotive industry â&#x20AC;˘ Controls squeaks and rattles due to vibration or wear of metal and plastic materials

)/((&(+$51(66 648($.7$3(

&$37$3(

²´[\G â&#x20AC;˘ Squeak and rattle reduction for interior panels and dash components. â&#x20AC;˘ Cable harness securing wrap for the passenger compartment of vehicles. â&#x20AC;˘ Rubber adhesive â&#x20AC;˘ PET fleece textile â&#x20AC;˘ Black

 ²´WKLFN[´ZLGHIRRWUROO  ²´WKLFN[´ZLGHIRRWUROO â&#x20AC;˘ Single faced closed cell neoprene sponge material â&#x20AC;˘ Designed to seal pickup truck camper caps â&#x20AC;˘ Dampens vibration, helps prevent creaks & squeaks

&RS\ULJKWÂ&#x2039;

87


Tapes $17,6(,=(7$3(32/<7(037$3(

0Â&#x152;7$57$1Â&#x152;3$&.$*,1*7$3(

 ²´[´&RSSHU  ²´[´1LFNHO â&#x20AC;˘ Unique lubricating products that assist in assembly and disassembly of threaded fasteners and connections â&#x20AC;˘ Provide the means to apply and control precise amount of lubrication while maintaining a clean, non-greasy assembly â&#x20AC;˘ Blended PTFE resin with Metal flake prevent the seizing and galling â&#x20AC;˘ Provides protection from corrosion and dirt â&#x20AC;˘ Poly-Temp Copper: Reduces required torque, applies easily, seals tightly, overcomes high temperature seizing. Protects against galvanic pitting; Temperature Range: -450° to 1800°F â&#x20AC;˘ Poly-Temp Nickel: Increased chemical resistance, extremely high temperature, and harsh environments. Made especially for stainless steel threads; Temperature Range: -450° to 2600°F

 ²´[\DUGV7DQ  ²&DVHRI7DQ  ²´[\DUGV&OHDU  ²&DVHRI&OHDU â&#x20AC;˘ Commercial grade film tape â&#x20AC;˘ Conforms to box surfaces â&#x20AC;˘ Ideal for most packaging applications

0Â&#x152;6&27&+Â&#x160;3$&.$*,1*7$3(  ²´[\DUGV&OHDU  ²&DVHRI&OHDU  ²3URPR3DFNUROOVRI ´[\DUGV &OHDUWDSHSOXVDIUHH+GLVSHQVHU  ²´[\DUGV7DQ  ²&DVHRI7DQ â&#x20AC;˘ Heavy-duty construction grade film â&#x20AC;˘ Provides a consistent uniform seal â&#x20AC;˘ Aggressive adhesive sticks instantly and holds tight

),/$0(173$&.$*,1*7$3(

3$&.$*,1*7$3(',63(16(56

 â&#x20AC;˘ 3/4â&#x20AC;? x 60 yard roll â&#x20AC;˘ Fiberglass reinforced strapping tape

 ²3LVWRO*ULS'LVSHQVHUIRU´3DFNDJLQJ7DSH  ²0+'LVSHQVHUIRU´3DFNDJLQJ7DSH  ²0+3LVWRO*ULS'LVSHQVHU IRU´3DFNDJLQJ7DSH

0Â&#x152;'8$//2&.Â&#x152;5(&/26$%/( )$67(1(56

0Â&#x152;+22.$1'/2235(&/26($%/( )$67(1(56

 ²UROOV´[\GV&OHDU  ²UROOV´[\GV%ODFN â&#x20AC;˘ Mini-pak dispenser with 2 rolls â&#x20AC;˘ When pressed together hundreds of mushroomshaped stems interlock with one another â&#x20AC;˘ An audible snap indicates the fastener is locked â&#x20AC;˘ Compared to hook and loop fasteners, you get improved tensile strength with five times more holding power

 ²VWULSV´[´%ODFN  ²UROOHD KRRN ORRS ´[\GV%ODFN â&#x20AC;˘ Mini-pak dispenser includes 1 roll of hook, and one roll of loop material â&#x20AC;˘ When hook and loop fasteners are pressed together, hundreds of tiny, stiff hooks mesh with a surface of pliable loops â&#x20AC;˘ Simply press together to fasten and pull apart to open â&#x20AC;˘ Prolonged exposure to water does reduce hook and loop closure strength, but full strength returns after drying

88

&RS\ULJKWÂ&#x2039;


Index 3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

690.01.101

76

690.8723

60

691.50024

51

697.7502

58

820.06455

86

823.19921

85

690.01.1011

76

690.8724

60

691.50100

51

697.7503

58

820.06500

83

823.41717

82

690.01.102

76

690.8725

60

691.50518

51

697.751

58

820.06502

83

823.41718

82

690.01.1021

76

690.8726

60

691.50524

51

697.7510

58

820.06504

83

823.41753

82

690.01.1021

76

690.8727

60

691.510110

55

697.7511

58

820.06506

83

823.42006

83

690.01.103

76

690.8728

60

691.510114

55

697.7512

58

820.12574

85

860.3201

6

690.01.104

76

690.8730

60

691.510125

55

697.7513

58

820.26334

83

860.3202

8

690.01.105

77

690.8731

60

691.541040

52

697.77240

76

820.26336

83

860.3210

37

690.01.1051

77

690.8732

60

691.554756

55

697.99158

22

820.26338

83

860.3212

6

690.01.106

77

690.8733

60

691.56018

51

697.99161

22

820.26340

83

860.7060

24

690.01.1061

77

690.9

75

691.56024

51

715.7520

56

820.4441.1

85

860.7060.1

24

690.01.1061

77

690.91

75

691.58892

54

715.7522

56

820.4441.2

85

860.70601

24

690.01.107

77

690.910

75

691.5904

48

715.7524

56

820.4492

86

860.70601.1

24

690.01.1071

77

690.911

75

691.6

51

715.7526

56

820.4496

86

860.71541

26

690.01.108

77

690.912

75

691.600

51

715.7527

56

820.5449

85

860.71542

26

690.102

77

690.919

76

691.601

60

715.7541

56

820.5549

85

860.71543

26

690.102.4

76

690.950

78

691.602

51

715.7590

56

820.55496

85

860.71544

26

690.1020

76

690.951

78

691.6200

50

791.162508.5

2

820.5649

85

860.71550

25

690.105

78

690.960

78

691.7.0

51

791.162508.55

2

820.67533

85

860.71550.1

25

690.1051

78

690.980

78

691.800

47

791.163500.5

15

820.67535

85

860.71551

25

690.106

77

690.981

78

691.801

47

791.168948.5

3

820.67537

85

860.71551.1

25

690.1061

77

690.985

78

691.820

50

791.176343.5

2

820.67635

85

860.71552

25

690.108

77

690.992

78

691.822

50

791.176343.55

2

820.71176

83

860.71552.1

25

690.1081

77

690.995

78

691.825

50

791.176598.5

14

820.71177

83

860.71553

25

690.8300

54

691.1516

48

691.828

50

791.176598.55

14

820.71180

83

860.71553.1

25

690.8301

54

691.1518

48

691.830

50

791.177211.5

3

820.98845

86

860.71554

25

690.8310

60

691.1519

49

691.850

49

791.177211.55

3

823.00072

81

860.71554.1

25

690.8405

53

691.1520

49

691.91

48

791.1772865.5

13

823.03451

87

860.71556

25

690.8406

54

691.1603

50

691.96124

49

791.1772865.55

13

823.0601

81

860.71556.1

25

690.8410

54

691.2015

48

691.96136

49

791.177315.100

5

823.0602

81

860.71559

25

690.8415

54

691.2018

48

691.96148

49

791.177356.5

3

823.0603

81

860.71559.1

25

690.8420

53

691.2024

48

691.96163

48

791.177356.55

3

823.06130

81

860.71561

26

690.8430

54

691.2224

48

691.96928

47

791.177375.100

5

823.06132

81

860.71561.1

26

690.8440

54

691.2230

49

691.96937

47

791.177384.5

29

823.06133

81

860.71562

25

690.8442

54

691.2231

49

691.96949

47

791.177384.55

29

823.06143

82

860.71562.1

25

690.8443

54

691.2232

49

691.99

49

791.177553.5

3

823.06147

82

860.71563

26

690.8444

54

691.228

49

697.0050

58

791.177553.55

3

823.06149

82

860.71563.1

26

690.8446

54

691.3029

60

697.0052

58

791.177561.5

3

823.06463

88

860.71566

26

690.8448

54

691.361410

51

697.0055

58

791.177561.55

3

823.06480

88

860.71566.1

26

690.8450

54

691.36538

52

697.4010

79

791.177877.5

3

823.06635

88

860.71567

26

690.8451

54

691.369418

47

697.4011

79

791.177877.55

3

823.06642

88

860.71567.1

26

690.8452

54

691.369424

47

697.4012

79

791.3.176598.5

14

823.06642.1

88

860.71568

26

690.8460

54

691.369448

47

697.4013

79

791.3.176598.55

14

823.06874

88

860.71568.1

26

690.8469

53

691.369454

47

697.40131

80

791.3.176676.5

15

823.06874.1

88

860.71599

20

690.8470

53

691.369824

49

697.4014

80

791.3.177520.5

30

823.06925

88

860.71599.1

20

690.8471

53

691.369832

49

697.4015

80

791.3.177520.55

30

823.06951

86

860.71599.55

20

690.8472

53

691.3724

48

697.4017

80

796.1001.30

32

823.06983

66

860.7201

24

690.8473

53

691.400513

52

697.4020

80

796.1001.5

32

823.07052

66

860.7202

24

690.8474

53

691.400516

52

697.4021

80

796.1001.55

32

823.07053

66

860.7203

24

690.8475

53

691.400517

52

697.4022

80

799.1470.100

5

823.07185

66

860.7205

24

690.8600

60

691.400520

52

697.68900

8

799.1470.50

5

823.07194

66

860.7755000

20

690.8610

60

691.401217

52

697.68900

13

799.1475.100

5

823.10271

81

860.7755003

20

690.8701

58

691.401220

52

697.68910

8

799.1475.50

5

823.10810

81

860.7755004

20

690.8702

58

691.404413

52

697.68913

13

820.05110

84

823.10828

81

860.7755015

20

690.8703

58

691.404416

52

697.720

88

820.06297

83

823.10836

81

860.7755030

20

690.8704

59

691.404417

52

697.740

57

820.06342

84

823.10844

81

860.800

24

690.8705

59

691.404420

52

697.7400

57

820.06356

87

823.10851

81

865.0199

63

690.8706

59

691.45195

58

697.7401

57

820.06380

86

823.10869

81

865.01991

12

690.8710

59

691.4655

51

697.7402

57

820.06381

86

823.10885

81

865.05.4000

45

690.8711

59

691.4660

51

697.741

57

820.06382

86

823.15074

83

865.05.5050

45

690.8715

59

691.4724

47

697.742

57

820.06383

86

823.1755

82

865.06.6000

43

690.8716

59

691.4732

47

697.7425

57

820.06385

86

823.19008

88

865.06.6000.1

43

690.8720

60

691.4824

47

697.750

58

820.06397

86

823.19220

85

865.06.6005

43

690.8721

60

691.4832

47

697.7500

58

820.06404

83

823.19223

85

865.06.6005.1

43

690.8722

60

691.50018

51

697.7501

58

820.06405

83

823.19282

85

865.06.6010

43

&RS\ULJKW‹

3DJH

89


Index 3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

865.06.6015

43

865.11.305

72

865.1101

72

865.1271

74

865.2.1061

68

865.3.1061

66

865.06.6030

45

865.11.305

72

865.1102

71

865.1271.1

74

865.2.1065

68

865.3.1062

66

865.06.6035

45

865.11.305

73

865.1103

71

865.1272

74

865.2.1066

68

865.3.1063

66

865.06.6040

45

865.11.306

72

865.1104

71

865.1272.1

74

865.2.1070

69

865.3.1065

67

865.06.6045

45

865.11.306

73

865.1105

71

865.1273

74

865.2.1071

69

865.3.1066

67

865.06.6050

46

865.11.308

73

865.1106

71

865.1273.1

74

865.2.1080

68

865.3.1068

67

865.06.6055

46

865.11.314

73

865.1106

73

865.1279

74

865.2.1081

68

865.3.1070

66

865.06.6060

46

865.11.315

72

865.1107

71

865.1279.1

74

865.2.1082

70

865.3.1150

66

865.06.6070

43

865.11.318

72

865.1108

71

865.1280

74

865.2.1083

70

865.3.7160.06

66

865.06.6075

45

865.11.318

73

865.1109

71

865.1280.1

74

865.2.1084

70

865.3.7160.07

66

865.06.6075

46

865.11.324

72

865.1110

71

865.1281

74

865.2.1088

70

865.3200

56

865.07.1076

42

865.11.325

72

865.1111

71

865.1281.1

74

865.2.1089

70

865.3200.1

56

865.07.1080

41

865.11.325

73

865.1112

71

865.1282

74

865.2.1090

68

865.3202

56

865.07.1209

43

865.11.326

72

865.1113

71

865.1282.1

74

865.2.1091

68

865.3210

56

865.07.175

43

865.11.340

73

865.1113

73

865.1283

74

865.2.1100

68

865.4.101

67

865.07.1860

41

865.11.341

72

865.1114

71

865.1283.1

74

865.2.1101

68

865.4.102

67

865.07.2245

41

865.11.341

73

865.1115

71

865.1290

74

865.2.1103

69

865.4.103

67

865.07.2500

42

865.11.400

72

865.1116

71

865.1291

74

865.2.1104

69

865.4.104

67

865.07.264

42

865.11.400

72

865.1125

85

865.1292

74

865.2.1105

69

865.4.1065

67

865.07.2644

42

865.11.401

72

865.1126

85

865.1293

74

865.2.1106

69

865.4.1066

67

865.07.3200

42

865.11.402

73

865.1127

85

865.1294

74

865.2.1107

69

865.4.200

67

865.07.3253

43

865.11.403

73

865.1128

85

865.1295

74

865.2.1108

69

865.4.202

67

865.07.4100

41

865.11.404

72

865.1129

85

865.1296

74

865.2.1109

69

865.4.203

67

865.07.4200

43

865.11.405

72

865.1130

85

865.1297

74

865.2.1110

69

865.5.1066

67

865.07.470

42

865.11.406

72

865.1135

85

865.1301

74

865.2.1111

69

865.50350

46

865.07.5022

42

865.11.408

73

865.1146

85

865.1302

74

865.2.23722

69

865.6384

46

865.07.524

43

865.11.500

72

865.1205

74

865.1302.1

74

865.2.3200

69

865.7100

70

865.07.548

43

865.11.501

72

865.1205.1

74

865.1303

74

865.2001

71

865.7500.12

74

865.07.600

42

865.11.501

73

865.1210

74

865.1303.1

74

865.2002

71

865.7500.18

74

865.07.6622

42

865.11.502

73

865.1210.1

74

865.1306

74

865.2003

71

865.7500.28

74

865.07.816

41

865.11.503

72

865.1211

74

865.138276

46

865.2004

71

865.77.0201

85

865.07.8575

43

865.11.504

72

865.1211.1

74

865.1720

38

865.2006

71

865.77.262

85

865.07.880

41

865.11.506

72

865.1214

73

865.1720

74

865.2007

71

865.81

70

865.07.8861

41

865.11.510

72

865.1214.1

73

865.1720.1

38

865.2008

71

865.816

59

865.1000

66

865.11.511

73

865.1215

73

865.1720.1

74

865.2009

71

865.82

70

865.1000.1

66

865.11.512

72

865.1215.1

73

865.1730

38

865.2012

71

865.83

70

865.104301

12

865.11.513

73

865.1221

73

865.1730

74

865.2013

71

865.84

70

865.104302

12

865.11.514

73

865.1222

73

865.1910

46

865.2096

46

865.8610.50

66

865.104310

12

865.11.515

72

865.1223

73

865.1990

46

865.2097

46

865.91

70

865.104311

12

865.11.516

73

865.1224

73

865.1991

46

865.2098

46

865.92

70

865.104312

12

865.11.518

73

865.1225

73

865.2.1003

68

865.2099

46

865.93

70

865.104315

12

865.11.520

72

865.1230

74

865.2.1005

68

865.2100

55

865.94

70

865.104315

12

865.11.520

73

865.1230.1

74

865.2.10051

68

865.2100.1

55

867.01.6301

63

865.104316

12

865.11.525

72

865.1231

74

865.2.10052

68

865.2101

55

867.01.6302

63

865.104316

12

865.11.525

73

865.1231.1

74

865.2.1006

68

865.2101.1

55

867.01.6303

63

865.104317

12

865.11.526

72

865.1232

74

865.2.10061

68

865.2103

55

867.02.11

64

865.104317

12

865.11.526

73

865.1232.1

74

865.2.1008

68

865.2103.1

55

867.02.6312

63

865.1053

68

865.11.528

72

865.1233

74

865.2.1010

68

865.2105

55

867.02.6313

63

865.1090

73

865.11.528

73

865.1233.1

74

865.2.1011

68

865.2105.1

55

867.02.6314

63

865.11.001

73

865.11.535

73

865.1242

73

865.2.1020

69

865.2108

55

867.02.6342

63

865.11.002

72

865.11.536

72

865.1243

73

865.2.1021

69

865.2108.1

55

867.02.6343

63

865.11.100

72

865.11.536

73

865.1255

70

865.2.1025

69

865.2109

55

867.02.6344

63

865.11.101

72

865.11.537

73

865.1256

70

865.2.1030

69

865.2109.1

55

867.02.6352

63

865.11.102

72

865.11.550

72

865.1260

74

865.2.1031

69

865.2110

55

867.02.6353

63

865.11.102

73

865.11.550

73

865.1260.1

74

865.2.1035

69

865.2110.1

55

867.02.6354

63

865.11.103

72

865.11.580

72

865.1262

74

865.2.1036

69

865.2125

56

867.02.6526

64

865.11.104

72

865.11.580

73

865.1262.1

74

865.2.10400

68

865.2130

56

867.02.6527

64

865.11.106

72

865.11.600

72

865.1264

74

865.2.10401

68

865.2140

56

867.02.6528

64

865.11.200

72

865.11.600

73

865.1264.1

74

865.2.10402

68

865.2143

56

867.02.6712

63

865.11.200

72

865.11.601

73

865.1266

74

865.2.10410

68

865.2201

55

867.02.6713

63

865.11.299

72

865.11.610

73

865.1266.1

74

865.2.10411

68

865.2201.1

55

867.02.6714

63

865.11.299

73

865.11.614

73

865.1269

74

865.2.1052

69

865.2202

55

867.102

65

865.11.300

72

865.11.700

73

865.1269.1

74

865.2.1054

69

865.2202.1

55

867.103

65

865.11.301

72

865.11.701

73

865.1270

74

865.2.1055

69

865.2205

55

867.104

65

865.11.301

73

865.1100

72

865.1270.1

74

865.2.1060

68

865.3.1060

66

867.105597

62

90

&RS\ULJKW‹


Index 3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

867.105598

62

867.2848.1

61

867.402

65

888.2603

87

890.2004

36

891.6611.1

10

867.105599

62

867.2849

62

867.403

65

888.2605

87

890.2004.1

36

891.6613

10

867.107544

62

867.2849.1

62

867.404

65

888.261

87

890.2005

36

891.6613.1

10

867.202

65

867.2850

62

867.412

64

888.265

87

890.2005.1

36

891.6616

10

867.203

65

867.2850.1

62

867.43

63

888.266

87

890.2006

36

891.6616.1

10

867.204

65

867.2851

62

867.430

63

888.3100

86

890.2006.1

36

891.6619

10

867.25

62

867.2851.1

62

867.44

63

888.3101

86

890.2007

36

891.6619.1

10

867.250

62

867.2852

62

867.440

63

888.3475

87

890.2007.1

36

891.6622

10

867.26

62

867.2852.1

62

867.5

65

888.36136

88

890.2008

36

891.6626

10

867.260

62

867.2855

62

867.50

65

888.36336

88

890.2008.1

36

891.6637

10

867.27

62

867.2855.1

62

867.60

65

888.40112

82

891.120201

20

891.6640

10

867.270

62

867.2856

62

867.602

65

888.42982

84

891.120201.1

20

891.6641

10

867.28

62

867.2856.1

62

867.6209

63

888.42982.1

84

891.120203

20

891.66431

11

867.280

62

867.2857

62

867.6210

63

888.4965

86

891.120203.1

20

891.66432

11

867.2800

62

867.2857.1

62

867.6211

63

888.49651

86

891.1681

33

891.66433

11

867.2800.1

62

867.2860

62

867.6212

63

888.4966

87

891.1682

33

891.66434

11

867.2801

62

867.2860.1

62

867.6231

64

888.4967

87

891.1683

33

891.66435

11

867.2801.1

62

867.2861

62

867.6232

64

888.497

87

891.1685

33

891.66436

11

867.2802

62

867.2861.1

62

867.650

64

888.498

87

891.1686

33

891.66437

11

867.2802.1

62

867.2862

62

867.66516

63

888.605262

82

891.3613

6

891.66438

11

867.2803

62

867.2862.1

62

867.66517

63

888.605263

82

891.380

31

891.66439

11

867.2803.1

62

867.2865

62

867.66518

63

888.605265

82

891.38103

30

891.66440

11

867.2805

62

867.2866

62

867.66519

63

888.60574

87

891.38104

30

891.66441

11

867.2805.1

62

867.2867

62

867.66520

63

888.60600

82

891.38105

31

891.668

13

867.2806

62

867.29

64

867.67

64

888.60601

82

891.38106

31

891.6681

13

867.2806.1

62

867.290

64

867.71

64

888.667

82

891.38107

30

891.6681.1

13

867.2807

62

867.3

64

867.7211

66

888.668

82

891.38108

30

891.66996

12

867.2807.1

62

867.30

64

867.8

64

888.69764

82

891.38109

30

891.66997

12

867.2808

62

867.301

64

867.85

65

888.700

88

891.38110

30

891.66998

12

867.2808.1

62

867.3011

64

867.87

65

888.715

88

891.38111

30

891.66999

12

867.2811

61

867.302

65

867.9

64

888.715.1

88

891.38112

30

891.67000

12

867.2811.1

61

867.303

65

867.901

65

888.720

88

891.38113

31

891.67001

11

867.2812

61

867.304

65

867.902

65

888.720.1

88

891.38114

31

891.67001.1

11

867.2812.1

61

867.31

62

867.905

65

888.750

87

891.3826

31

891.67002

11

867.2813

61

867.310

62

867.9502

70

888.9001

84

891.3826.1

31

891.67002.1

11

867.2813.1

61

867.32

62

867.9503

70

888.9002

84

891.3850

31

891.67003

11

867.2814

61

867.320

62

867.9504

70

888.9003

84

891.3851

31

891.67003.1

11

867.2814.1

61

867.33

62

867.9505

70

888.9004

84

891.6512

10

891.67004

11

867.2820

61

867.33.0

62

867.991

66

888.9005

84

891.6512.1

10

891.67004.1

11

867.2820.1

61

867.330

62

867.992

66

888.9007

84

891.6513

10

891.67005

11

867.2821

61

867.330.0

62

888.0001

86

888.9093

82

891.6513.1

10

891.67006

11

867.2821.1

61

867.34

63

888.0012

86

889.1008

32

891.6514

10

891.67007

11

867.2822

61

867.340

63

888.0014

86

889.1318

28

891.6514.1

10

891.67007.1

11

867.2822.1

61

867.3421

62

888.0034

86

889.1319

28

891.6515

10

891.67008

11

867.2823

61

867.3421.1

62

888.0078

86

889.1470

35

891.6515.1

10

891.67008.1

11

867.2823.1

61

867.3422

62

888.100

88

889.1471

35

891.6516

10

891.67009

11

867.2839

61

867.3422.1

62

888.1000

84

889.1472

35

891.6516.1

10

891.67009.1

11

867.2839.1

61

867.3423

62

888.1002

84

889.1473

35

891.6517

10

891.67010

11

867.2840

61

867.3423.1

62

888.101

88

889.1475

36

891.6517.1

10

891.67010.1

11

867.2840.1

61

867.3424

62

888.1034

83

889.4503

36

891.6521

11

891.67011

11

867.2841

61

867.3424.1

62

888.1100

83

889.4504

36

891.6521.1

11

891.682

7

867.2841.1

61

867.3425

62

888.1112

83

889.4580

35

891.6522

11

891.682.1

7

867.2842

61

867.3425.1

62

888.1200

83

889.50050

36

891.6522.1

11

891.6821

11

867.2842.1

61

867.3426

62

888.20112

82

889.50054

36

891.653

10

891.6821.1

11

867.2843

61

867.3426.1

62

888.205

87

889.50055

36

891.653.1

10

891.683

7

867.2843.1

61

867.3441

62

888.207

84

889.50056

36

891.654

10

891.683.1

7

867.2844

61

867.3441.1

62

888.208

86

889.50059

36

891.654.1

10

891.684

7

867.2844.1

61

867.3461

62

888.210

87

890.2000

36

891.6600

10

891.684.1

7

867.2845

61

867.3461.1

62

888.211

87

890.2000.1

36

891.6605

10

891.685

7

867.2845.1

61

867.3481

62

888.2113

87

890.2001

36

891.6605.1

10

891.685.1

7

867.2846

61

867.3481.1

62

888.230

87

890.2001.1

36

891.6606

10

891.6860

8

867.2846.1

61

867.35

63

888.260

87

890.2002

36

891.6606.1

10

891.6860.1

8

867.2847

61

867.350

63

888.2601

87

890.2002.1

36

891.6607

10

891.6861

8

867.2847.1

61

867.36

63

888.26011

87

890.2003

36

891.6607.1

10

891.6861.1

8

867.2848

61

867.360

63

888.2602

87

890.2003.1

36

891.6611

10

891.6862

8

&RS\ULJKW‹

91


Index 3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

3DUW1R

3DJH

891.6862.1

8

991.101694

24

991.108811

15

991.120206

18

991.120694

14

991.51503

3

891.6863

8

991.101694 .1

24

991.108811.1

15

991.120206

19

991.120694.1

14

991.51505

3

891.6863.1

8

991.101753

24

991.108812

16

991.120206.1

18

991.120901

16

991.51507

3

891.6882

20

991.101757

31

991.108812.1

16

991.120206.1

19

991.120901.1

16

991.51507.1

3

891.6882.1

20

991.101757.1

31

991.108813

15

991.120207

18

991.120902

16

991.51508

3

891.68910

8

991.101790

15

991.108813.1

15

991.120207.1

18

991.120902.1

16

991.51508.1

3

891.68910.1

8

991.101790.1

15

991.108815

17

991.120208

19

991.121189

8

991.51509

3

891.68910.13

8

991.102043

5

991.108815.1

17

991.120208.1

19

991.12487

14

991.51509.1

3

891.68913

13

991.102045

17

991.108815.5

17

991.120208.5

19

991.12487.1

14

991.51510

3

891.68913.1

13

991.102052

17

991.108817

17

991.120209

20

991.12487.5

14

991.51524

5

891.68913.13

13

991.102052.1

17

991.108817.1

17

991.120209.1

20

991.124983

3

991.51525

5

891.690

16

991.102052.5

17

991.108817.5

17

991.120209.5

20

991.129265

23

991.51526

5

891.6904

16

991.102058.5

17

991.108818

15

991.120210

19

991.129265.1

23

991.51528

5

891.6904.1

16

991.102082

15

991.108818.1

15

991.120210.1

19

991.130587

23

991.51539

30

891.701

6

991.102103

24

991.108823.5

29

991.120213

9

991.130587.1

23

991.51542

30

891.702

18

991.102217

4

991.108823.55

29

991.120213.1

9

991.130714

3

991.51550

30

891.704

38

991.102394

5

991.108825.5

6

991.120213.55

9

991.130714.1

3

991.51550.1

30

891.709

1

991.102396

5

991.108825.55

6

991.120214

9

991.133932

28

991.51551

30

891.7101

1

991.102403

4

991.108827

14

991.120214.1

9

991.133932.1

28

991.51565

23

891.712

1

991.102403.1

4

991.108827.1

14

991.120215

9

991.135809

32

991.51565.1

23

891.720

28

991.102542

24

991.108828

10

991.120215.1

9

991.135809.1

32

991.51569

23

891.724

32

991.102542.1

24

991.108828.1

10

991.120217

18

991.1505.30

32

991.51569.1

23

891.725

34

991.102676

6

991.108828.55

10

991.120217.1

18

991.1505.5

32

991.51576

31

891.7280

28

991.102690

13

991.108829

7

991.120218

20

991.1505.55

32

991.51577

31

891.7281

28

991.102690.1

13

991.108829.1

7

991.120218.1

20

991.162508

2

991.51594

15

891.7282

28

991.102769

3

991.108829.5

7

991.120219

19

991.162508.1

2

991.51594.1

15

891.731

34

991.102788

4

991.108829.55

7

991.120219.1

19

991.168948

3

991.51604

1

891.7310

35

991.102789

4

991.108836

14

991.120220

18

991.168948.1

3

991.51604.1

1

891.73120

34

991.102799

3

991.108836.1

14

991.120220.1

18

991.194766

9

991.51618

2

891.73121

34

991.102799.1

3

991.108844

3

991.120241

21

991.194766.1

9

991.51618.1

2

891.7313

34

991.102801

3

991.108844.1

3

991.120241.1

21

991.195409

23

991.51623

2

891.735

27

991.102801.1

3

991.108844.5

3

991.120242

21

991.195409.1

23

991.51623.1

2

891.735.1

27

991.102833

17

991.108846

19

991.120242.1

21

991.208120

5

991.51623.30

2

891.743

38

991.103002

13

991.108846.1

19

991.120243

21

991.3710.55

6

991.51623.5

2

891.743.1

38

991.103002.1

13

991.108849

16

991.120243.1

21

991.51457

17

991.51623.55

2

891.7431

38

991.103152

3

991.108849.1

16

991.120244

21

991.51457.1

17

991.51836

30

891.7431.1

38

991.103260

5

991.108851

9

991.120244.1

21

991.51460

15

991.52482

8

891.7437

37

991.103489

4

991.108851.1

9

991.120245

21

991.51460.1

15

991.52482.1

8

891.7437.1

37

991.103726

2

991.108853

9

991.120245.1

21

991.51461

15

991.52483.5

8

891.7444

38

991.103726.1

2

991.108853.1

9

991.120246

21

991.51461.1

15

991.58770

29

891.745

38

991.103745

2

991.108854.5

9

991.120246.1

21

991.51466

17

991.58812

2

891.750

34

991.103834

13

991.108870

9

991.120247

21

991.51466.1

17

991.59029

2

891.753

34

991.104021

13

991.108870.1

9

991.120247.1

21

991.51472

9

891.759

33

991.104805

2

991.108871

9

991.120249

21

991.51472.1

9

891.7590

33

991.105041.55

4

991.108871.1

9

991.120249.1

21

991.51480

14

891.7591

33

991.105505

6

991.108871.55

9

991.120250

22

991.51480.1

14

891.7592

33

991.106198

14

991.109256

15

991.120250.1

22

991.51482

14

891.763

27

991.106348

6

991.109450

23

991.120251

22

991.51482.1

14

891.8499

2

991.106399

4

991.109450.1

23

991.120251.1

22

991.51483

3

891.8499.1

2

991.107152

23

991.109600

27

991.120252

22

991.51483.1

3

891.8517

12

991.107152.1

23

991.110601

29

991.120252.1

22

991.51485

4

891.8556

28

991.107309

9

991.110602

29

991.120253

22

991.51485.1

4

891.8561

31

991.107309.1

9

991.110603

29

991.120253.1

22

991.51486

2

891.8563

28

991.108010

18

991.110941

2

991.120254

22

991.51487

2

891.8565

27

991.108010.1

18

991.110996

4

991.120254.1

22

991.51487.1

2

891.8565.1

27

991.108544

4

991.110996.1

4

991.120255

22

991.51495

29

891.8566

28

991.108544.1

4

991.112201

3

991.120255.1

22

991.51496

29

891.8566.1

28

991.108591

6

991.11390.5

4

991.120275

8

991.51497

29

891.8603

34

991.108591.1

6

991.120180

3

991.120275.1

8

991.51498

29

891.8603.1

34

991.108807

18

991.120200

19

991.120390

16

991.51499

3

991.0041

30

991.108807.1

18

991.120200.1

19

991.120390.1

16

991.51499.1

3

991.100046

30

991.108808

16

991.120201

19

991.120605

8

991.51500

3

991.100046.1

30

991.108808.1

16

991.120201.1

19

991.120619

8

991.51501

3

991.100046.5

30

991.108809

15

991.120202

19

991.120693

14

991.51502

3

991.101548

24

991.108809.1

15

991.120202.1

19

991.120693.1

14

991.51502.1

3

92

&RS\ULJKW‹


Index 3$571$0( =/($7+(5&$5( ´)/225648((*((6<5 3,(&(5$,168,7 6+(/)),567$,'67$7,21 ´)2$0)/225648((*((6 0$872027,9(5(63,5$7251 0($6,&$5(3$,17635$<5(63,5$725$66(0%/< 03$57,&8/$7(5(63,5$7251 075,00$6.,1*7$3( 0Œ$/80,180)2,/7$3( 0Œ&/($5'8&77$3( 0Œ&/27+)5,&7,217$3( 0Œ&21)250$%/(6$)(7<:$/.Œ 0Œ&2163,&8,7< 5()/(&7,9( 7$3( 0Œ'225$3(5785(5(),1,6+7$3( '$57  0Œ'28%/(&2$7('32/<(7+</(1()2$07$3( 0Œ'28%/(&2$7('85(7+$1()2$07$3( 0Œ'8$//2&.Œ5(&/26$%/()$67(1(56 0Œ*(1(5$/385326(0$6.,1*7$3( 0Œ+22.$1'/2235(&/26($%/()$67(1(56 0Œ58%%(563/,&,1*7$3(& 0Œ6$)(7<:$/.Œ 0Œ6&27&+Š3$&.$*,1*7$3( 0Œ6&27&+02817Œ'28%/(&2$7(' 0Œ6&27&+02817Œ'28%/(&2$7(' 0Œ6&27&+02817Œ1$0(3/$7(5(3$,57$3( 0Œ7$57$1Œ3$&.$*,1*7$3( 0Œ7(0)/(;Œ9,1</(/(&75,&$/7$3( ,121(&$53(7&/($1(5 6+(/)),567$,'67$7,21 ´:+,7( ´)/2256&5$3(56<5 $&)/86+ $&,'%586+(6 $&,'758&.:$6+ $&2867,&$/7,/(5(6725(5 $&2867,&$/7,/(5(6725(5 $&5</,&)2$07$3( $&5</,&)2$07$3( $&5</,&75$16)(57$3( $,5&21',7,21,1*6($/$177$3( $,5(66(1&( $,520$ $,5:25.6Š ',675,%87,21)5201(9$'$  $,5:25.6Š%2:/&/,36 $,5:25.6Š85,1$/6&5((1 $,6/(0$5.,1*7$3( $//)$//287 $//:$7(563275(029(5 $//:($7+(5,168/$7,1*7$3( $/7,78'(6$)(7<*/$66(6 $/80,1$7( $/80,180(;7(16,21+$1'/( $/80,180)2,/7$3( $/80,1806:,9(/*5,3 $1&+25/8%( $17,$%5$6,217$3(5(' $17,6(,=(7$3(32/<7(037$3( $17,63/$6+)2**2**/( $48$0(1' $77$&+0(177$3(²&/($5 %$0%226+(///$7(;&2$7('3$/0 %$1'('($53/8*6 %$55,&$'( %$55,&$'(7$3( %$77(5<$&,'63,//.,7 %* %,* %,*3,1( %,*3,1( %/$&.87,/,7<3$' %/$'(%$1. %/$'(',6326$%/(&217$,1(5 %/22'%251(3$7+2*(1%2',/<)/8,'63,//.,7 %/8(1,75,/(&87 6(:1 %2'<%586+(6 %5$.( 3$576&/($1(5

&RS\ULJKW‹

3$*(                                                                             

3$571$0( %5,*+7./((1 %5,//,$1&( %52:1-(56(<*/29(6 %586+(6 %586+21(/(&75,&$/7$3( %8*-8,&( %803+$76 %: &$37$3( &$867,&&/($1(5 &'3 &'3 &'3 &'3%277/(:$//5$&. &'3:$//02817',63(16(5 &'3 &'3 &'3 &'3 &'3 &'3 &'3 &'3 &'3 &'3 &'3 &(17(538//',63(16(56 &(17(538//72:(/6 &+$03,21$,5)5(6+(1(56 &+$03,21%$6(%2$5'675,3 &+$03,21)2$0 ',675,%87,21)5201(9$'$  &+$03,210(7(5(''(2'25,=(56 ',675,%87,21)5201(9$'$  &+$03,2167$,1/(6667((/&/($1(5 &+$5*( &+($7(566$)(7<*/$66(6 &+(0,&$/*2**/(6 &+,()9,6,725*/$66(6 &+,3$1'2,/%586+ &+/25)2$0 &+87(6 '80367(56 &2$56( &2%$/76$)(7<*/$66(6 &2%5$ &2& &2/'6+5,1.7$3( &20%20-%8&.(7(:5,1*(5 &200$1' &200(1' &203$&71(875$/,=(563,//.,7 &217285('7,5('5(66,1*$33/,&$725 &27721$1'5$<21023+($'6 &27721&+$1*(50236<5 &27721-(56(<*/29(6 &277211%023 &27721675,1**/29(6 &3&&,7586'(*5($6(5 &5&%(/7'5(66,1* &5&'867(5Π&5&)22'*5$'(0$&+,1(2,/ &5&:+,7(/,7+,80*5($6( &6 96 &859('+$1'/(6&5$7&+%586+ &86+,21*5,35$7&+(7/2&.87,/,7<.1,)( &87(1' '(%$(52%/8(62$3 '(%$(52&/($16(62$3 '(%$(52*5((162$3 '(%$(52,462$3 '(%$(52526(62$3 '(%$17,%$&7(5,$/)2$0 '(%$48$5(66+$1'$1'%2'<62$3 '(%$=85()2$07) '(%&859('',63(16(5 '(%)2$0,1*',63(16(5 '(%,167$17)2$0$/&2+2/ '(%,167$17)2$01$ '(%,167$17)2$06$1,7,=(5

3$*(                                                                             

93


Index 3$571$0( '(%3,1.62$3 '(%8/75$*5((1*(/ '()(16(() '()2$0(5 '(*5($6(56; '(,&( '(/,0(51) '(/7$+($9<'87<*/$666&5$3(5 '(/8;( '(/8;( '(/8;(() '(/8;(+($'*($55$7&+(7$66(0%/< '(/8;(.1((3$' '(/8;(72,/(7%2:/023 '(7$,/&/$< ',6326$%/(*/29(',63(16(5 ',6326$%/(*/29(6 '220 '25$'248,&.),; '28%/(6,'('$77$&+0(177$3( '580723$%625%(173$' '5<*5$3+,7(/8%5,&$17 '5<023)5$0( '5<5(/($6(7()/21Š '5<635$<$,5 )$%5,&'(2'25$176 '8&77$3( '86702375($70(17 '8673$16 ($508))6 ($53/8*67$7,21 ($53/8*6²',6326$%/()2$0 ($6<*5((1 (&2120< +($9<'87<  (&2120< (&2120<%8*6321*( (&266(17,$/ ',675,%87,21)5201(9$'$  (/(&75,&$/&/($1(5 (/(&75,&$/7$3( (1(5*,=(5Š,1'8675,$/%$77(5,(6 (;35(66:,3(6 (;75$+($9<'87<5$7&+(7/2&.&877(5 (;75$+($9<'87<5(3/$&(0(17%/$'( (;75$&7$//&21&(175$7( (;75(0(Œ1,75,/(',6326$%/(*/29(6 (<(:$6+67$7,216 (=:,3(6 (=:,3(6 )$&(6+,(/'6 )$//7(&+$1&+25¶6 )$//7(&+&$5$%,1((56 )$//7(&+)$//.,7 )$//7(&++$51(66 )$//7(&+/$1<$5'6 )$//7(&+5(675$,17%(/76 )$67%$// )$6767((/ )($7+(562)7%$7+52207,668( )(1'(5:$6+%586+(6 )*0,1(5$/2,/ ),%(5*/$66+$1'/( ),/$0(173$&.$*,1*7$3( ),567$,'.,76 )/$**,1*7$3( )/((&(+$51(66 648($.7$3( )/2$7,1*/,)767$7,21 )/225$1''5,9(:$<648((*((6 )/225),1,6+675,33(5 )/2256:((3 )/2256:((3 )/2256:((3 )/2253$&Š%/(1'/223023 )/2:287 )2$0$1$725 )22'6(59,&(6$1,7,=(5 )2817$,1%586++$1'/( )2817$,1%586+(6 )3.,//=2'25

94

3$*(                                                                             

3$571$0(

3$*(

)5(6+&+(55,(6 )5(6+67$57 )5(6+67$576; )5(=(,7 )8//%5,0+$5'+$7 )80()5(( *$))(567$3( *$5$*(%586+ *($5/8%(() *(1(5$/87,/,7<3/86*/29(6 *(18,1(:$7(5635,7(Š'5<,1*&/27+ *(50$:$< ** */$66&/($1(5 */29(*5$%%(5 */29(3/86Œ%/$&.1,75,/(',63263$%/(*/29(632:'(5)5(( */29(3/86Œ+($9<'87<1,75,/(',6326$%/(*/29(632:'(5)5(( */29(3/86Œ/$7(;',6326$%/(*/29(6 */29(:25.6Œ+($9<'87</$7(; */29(:25.6Œ1,75,/(',6326$%/(*/29(6/,*+7/<32:'(5(' */29(:25.6Œ1,75,/(',6326$%/(*/29(632:'(5)5(( *2/'18**(7Š352)(66,21$/&$5:$6+3$' *22'*5,3 *5$)),7,*21( *5((11,75,/(*/29(6 *5((139&*/29(6 *5287%586+6<5 +$1'$1'1$,/%586+ +$1',)2$0Š +$1'/( +$1'/(´6<5 +$1'/(%5$&( +$1'/(6&58%%586+ +$1'/(7+5($' +$5'+$7 +$5'+$76 +'*5,0(%867(5'(*5($6(5 +':+,7( +($'*($5 )$&(6+,(/'127,1&/8'('  +($7:25.6:$50(56 +($7:25.6:$50(56 +($9<'87<0,//'867(5 +($9<'87<675,33(5 +($9<:(,*+7:,3(56 +($9<'87< +($9<'87<$872/2&.87,/,7<.1,)( +($9<'87<%/$&.)/2253$' +($9<'87<)(1'(5:+((/6&58%%586+(6 +($9<'87<,17(5,25 83+2/67(5<%586+ +,*+*/266)/225),1,6+ +,*+75$&7,216$)(7<7$3(²$17,6/,3 +20(581 +231¶&+(55< +270,//*/29(6 +86.(<+96 ,//86,216$)(7<*/$66(6 ,6,&,75866:,3( ,6,($6<&/($1 ,6,),5(%$// ,6,),5(%$//3/86 ,6,)2$0*(/29(1*5,// ,6,+$1'62$3',63(16(56 ,6,29(1%5,7( ,6,32/<&,75$=<0( ,6,32/<(/,0,1$725 ,6,6327)5(( ,6,8/75$%/($&+ ,6/$1')5(6++$,5%2'< -$:6Š -$:6Š -80%252//%$7+52207,668( -867 .(9/$5Š6+(//1,75,/(&2$7('3$/0 ./((1$:$< ./((1*8$5'$&29(5$//6 .1((/,1*3$' .12&.,7287

                                                                            

&RS\ULJKW‹


Index .5</21*$/9$1,=,1*35,0(5 .85/<.$7(6&58%%(5 .:,.67(3 /$5*(/(16&/($1,1*67$7,21 /$7(;*/29(6 /$81'5<'(7(5*(17/,48,' /($7+(53$/0:25.*/29(6 /($7+(53$/0:25.*/29(6 /(12;*2/'%,0(7$/87,/,7<.1,)(%/$'(6 /(12;*2/'87,/,7<.1,)(3$&. /(16&/($1,1*72:(/(77(6 /,)7,1*7$3( /,*+7'87< /,0(62/9 /,1(0$1¶6*/29(.,7 /2%%<'8673$1 /2&7,7( /223('(1''5<023 /2:0$,17(1$1&(),1,6+ /8;85</27,2162$3 0$67(5%2:/ 0($685,1*&832= 0(&+$1,&6*/29(%/$&. 0(&+$1,&66$)(7<*/29(%/$&. 0(',&$7,216),567$,' 0(',80 0(7$/+$1'/( 0(7(5('0,67 0,&52),%(5&+(1,//(6321*( 0,&52),%(5'8673$' 0,&52),%(53$'+2/'(5 0,&52),%(5:(70233$' 0,5$*(576$)(7<*/$66(6 0,5$*(6$)(7<*/$66(6 0,67<'8$/&,'(3 02'(5$7('87< 023+$1'/( 05*5((1 052%8&.(763,//.,7 08/7,%/$'($872/2$'87,/,7<.1,)( 08/7,385326(87,/,7<.1,)( 0;¶66/,321*/29(<(//2: 13$57,&8/$7(5(63,5$725 1$0 1$12+,*+62/,')/225),1,6+ 1$785$/&27721&$19$6*/29(6 1$785$/728&+ 1(875$/3+ 1(875$/,=(55,16( 1,75,/(&2$7*/29(6:&8)) 1,75,/(',6326$%/(*/29(6 1,75,/(',6326$%/(*/29(6 1,75,/(*/29(6 1,75,/(3$/06$)(7<*/29(6 1,752)2$0Œ$//7(55$,1.1((3$'6 121$/&2+2/)2$0,1*+$1'6$1,7,=(5 18%/8 1</216+(//1,75,/(&2$7('3$/0 1</216+(//32/<85(7+$1(&2$7('3$/0 2$7(<$//385326(/($.'(7(&725 2&($1%/8( 2,/%$6('$%625%(173$'6 2,/%$6('$%625%(1752//6 25$1*( 25$1*( 3$&.$*,1*7$3(',63(16(56 3$,170$5.(56 3$,17(5¶60$6.,1*7$3( 3$3(5&2//(&7,21%$*7251$'2&9 3$56(/<3/86 3$576&/($1,1*%586+ 3$576'(*5($6(5 3(5)25$7('*2**/(6 3(50$7(;Š3(50$32;< 3+(120(1$/ 3,1(2./((1 3,1.2)),&(+$1'62$3

&RS\ULJKW‹

                                                                            

3/$67,',3Š 3/$67,',3Š/,48,'(/(&75,&$/7$3( 3/$67,&%/$'( 3/$67,&&2$7(' 3/$67,&)811(/6 3/$67,&+$1'/(³7227+%586+´ 3/$67,&635$<%277/(6 3/$67,&635$<%277/(6:,7+75,**(56 32/<3523</(1(&29(5$//6 3257$%/(*$//2163,//.,7 3257$52//%$7+52207,668( 3267,7Š5(029$%/(/$%(/,1*7$3( 32:(5&/($1 32:(53/86 32:(5%$// 32:(57521 35(0,80&5(7( 35(0,80/($7+(5'5,9(5*/29( 35(0,80:22'+$1'/(),77,1* 35(6(59(Š+$5':281'72:(/6 352+$1'/,1**/29(*5(< 352&(//Œ81,9(56$/ 352&(//Œ81,9(56$//,*+7'87<727(%2; 352)/(;(&2120<%$&.6833257 352)/(;+,*5,3*/29(6 352)/(;67$1'$5'%$&.6833257 3527(&&$53(73527(&725 35272:(/Š+($9<'87< 4' 48$75,16( 48,&.&+$1*('5<023+$1'/( 48,&.&+$1*(0(7$/+($'023+$1'/( 48,.&233(5 48,./((1Š$%625%(17 48,./((1Š5(&<&/(.,7 48,.3/$67,. 48,.:22' 48,.=,1& 5$'²$32&$/<36(6$)(7<*/$66(6 5$'²6(48$/6$)(7<*/$66(6 5$'$7$&6$)(7<*/$66(6 5$7&+(7/2&.87,/,7<.1,)( 5$9(11,75,/(*/29(6 5$=25%/$'(6&5$3(5 5(')/2253$' 5('6.<( 5(':+,7( %/8(6$)(7<*/$66(6 5()/(;,7(Š'27&2163,&8,7< 5()/(&7,9( 7$3( 5(0,1*72176$)(7<*/$66(6 5(3/$&(0(17 5(3/$&(0(17 5(75$&7$%/(87,/,7<%/$'(*/$666&5$3(5 5(86$%/(&25'('($53/8*6 5(9(/$7,216$)(7<*/$66(6 5(92/87,21 5,0&$*( 52&.6$)(7<*/$66(6 6$)(7<&21(6 6$)(7<1(&.&25'6 6$)(7<9(67(&2120<&/$66 6$)(7<9(67(&2120<&/$66 6$)(7<9(6767$1'$5'&/$66 6$/7$:$< 6&27&+Š9,1</(/(&75,&$/7$3()25&2/25&2',1* 6&27&+Š$872027,9(5(),1,6+0$6.,1*7$3( 6&27&+Š(/(&75,&$/02,6785(6($/$177$3( 6&27&+Š),5(5(7$5'$17(/(&75,&$5&3522),1*7$3( 6&27&+Š*/$66&/27+7$3( 6&27&+Š/21*0$6.Œ0$6.,1*7$3( 6&27&+Š3/$67,&7$3(²%/8( 6&27&+Š683(5Œ9,1</(/(&75,&$/7$3( 6&27&+Š9,1</3/$67,&(/(&75,&$/7$3(683(5 6&5$7&+%586+ 6&5$7&+%586+(6 6&58%1¶6+,1( 6&58%%(56 6(/(&7Œ:,3(632383%2;

                                                                            

95


Index 6(/))86,1*7$3( 6(:(56:((7(1(5&+(55< 6(:(56:((7(1(5/(0216; 6(<02855$3,'6($/ 6+$5.6$)(7<*/$66(6 6+2(&29(56 6+2(+$1'/(6&5$7&+%586+ 6+2(+$1'/(6&5$7&+%586+ 6+2372:(/6 6+2:1¶*2Œ'(*5($6(5 6+2:1¶*2Œ(;7(5,25'5(66,1* 6+2:1¶*2Œ,17(5,2575($70(17 6+2:1¶*2Œ/($7+(56($/$17 6+2:1¶*2Œ:$6+1¶:$; 6+2:1¶*2Œ:+((/&/($1(5 6,'(:,1'(5 6,/(1&(5($508))6 6/,&. 6/,3127 60$///(16&/($1,1*67$7,21 61$32))%/$'( 61$32))%/$'(.1,)( 00  61$32))%/$'(.1,)( 00  612:%5220 62/9 63$5./( 635$<21+,*+3(5)250$1&(/8%( 635$<211(875$)25&(Š+' 635$<217+(3527(&725Œ 6381*2/'Š&$5:$6+3$' 648($.5('8&7,217$3( 648((*((.,7 648((*((7$3(5+$1'/(6 67$,1/(6667((/$872/2&.87,/,7<.1,)( 67$,1/(6667((/6/,'(/2&.87,/,7<.1,)( 67$,1/(6667((/61$32))%/$'( 67$.()/$*6 67$/8%(Š)22'*5$'( 67$/8%(Š67$3/(; 67$1'$5' 67$1'$5' +($9<'87<  67$1'$5' 675($.)5(( 675,1*.1,7*/29(6 675,1*.1,7*/29(6%/($&+(':+,7( 6811<675($./(66 683(5.29(1&/($1(5 683(535(3Œ72:(/ 683(535(3Œ72:(/-80%252// 683(535(3Œ72:(/727(%2; 683(55$*Œ81,9(56$/ 683(55$*Œ81,9(56$/ 683(55$*Œ81,9(56$/-80%252// 683(5:,3(56727(%2; 683(5%$// 685(6&58%Œ6321*( 685)$&(3527(&7,217$3( 6855281' 6:($7%$1'6 6:,9(/'(&.%586+6<5 6:,9(/3$'+2/'(5 7+(+285Œ 7+(0$*,&,$1 7+(&+$03Š&(17(538//52// 7+,&.67(5Œ/$7(;',6326$%/(*/29(6 7+5($'6($/$177$3( 7,06(1 7,5('5(66,1*$33/,&$725 72,/(76($7&29(56 725.$'9$1&('&(17(5)(('52// 725.$'9$1&('32383%2; 725.&(17(5)(('-80%252// 725.',63(16(56 725.35(0,8032383%2; 7251$'2&.352 7251$'2&9 7251$'206(5,(6)/2250$&+,1(

96

                                                                            

7251$'20,1,0$5$7+21 7251$'23 7251$'26:(7'5<9$&880 7251$'2:,1'6+($5 727$/ 727$/5(/($6( 728&+'2:1 728*+-2% 728*+6:((3 7285*8$5',,,6$)(7<*/$66(6:',63(16(5 72</2%%<3/$67,&%5220 75$)),&/$1(&/($1(5 75,)(&7$17',6,1)(&7$1732:'(5 75,**(5635$<(56 75,0/,)7,1*7$3( 7523+<9,1</'5(66,1* 758&.:$6+%586+(6 7<9(.&29(5$//6 7<9(.7<3(/$%&2$76 8/75$&/($1%/($&+ 8/75$0$;61$32))%/$'( 8/75$0$;61$32))%/$'( 81,7,=('),567$,'.,76 81,9(56$/$%625%(173$'6 81,9(56$/$%625%(1752// 81,9(56$/$%625%(1762&.6 85,1$/%5,*+7(1(5 85,1$/6&5((1 85,1$/6&5((1%/2&. 87,/,7<%/$'(6 87,/,7<)811(/:,7+6&5((1 87,/,7<.1,)( 89(;;&Š6$)(7<*/$66(6 9$1,6+ 9(&7$,59$,5 9(17 '$6+%586+ 9,1</',6326$%/(*/29(6 921'5(+/()$&,$/7,668( 921'5(+/()2/'('72:(/6 936; :$6+ 6&58%&20%26321*( :$6+ :$; :$7(53522):,17(5*/29( :$; 32/,6+$33/,&$725 :+,6.%5220 :+,7()/2253$' :+,7(287 :+,7(6,'(:$//%586+ :,//621Š'8670$6. :,1'6+,(/'6&5$3(5 :,5(:+((/632.(%586+(6 :22'(1+$1'/(³7227+%586+´ :25; :5$3µ16($/6(/))86,1*6,/,&21(7$3( :5(&.:5$3 ;75(0(;'1,75,/(',6326$%/(*/29(6 ;75(0(;Œ1,75,/(',6326$%/(*/29(6 <(//2:',6+62$3 =(671'',6,1)(&7$17

                                                          

&RS\ULJKW‹

Chemcat 2013  
Advertisement