Page 1

Prakiraan Cuaca Selasa (29/9) Medan 25-320C

Berastagi 18-28 0C

R. Prapat 24-330C

Parapat 18-28 0C

P. Siantar 20-300C

Sibolga 21-32 0C BMKG Polonia

Hujan guntur

Berawan

WASPADA Demi Kebenaran Dan Keadilan

http://epaper.waspadamedan.com

SELASA, Kliwon, 29 September 2009/10 Syawal 1430 H

No: 22923 Tahun Ke-63

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman

Harga Eceran: Rp 2.500,-

Ketsana Berpeluang Ke Sini Antara

TOLAK RUU TIPIKOR: Wakil Koordinator Indonesia Corruption Watch (ICW) Emerson Yuntho (kiri) memberikan pembersih telinga raksasa kepada Ketua Badan Kehormatan DPR, Irsyad Soediro, di Ruang BK DPR, Jakarta, Senin, (28/9). ICW berharap DPR dapat mendengarkan aspirasi rakyat dan menolak pengesahan RUU Pengadilan Tipikor.

ICW Hadiahi DPR Korek Kuping Raksasa

Belum Ada WNI Jadi Korban Badai Di Manila MEDAN (Waspada): Ba d a i Ke t s a n a y a n g menghantam Kota Manila diperkirakan berpeluang berembus ke Sumatera Utara. Masyarakat diingatkan untuk meningkatkan kewaspadaan, jika kondisi cuaca panas pada siang berlangsung berhari-hari.

JAKARTA (Waspada): Indonesia Corruption Watch (ICW ) memberikan hadiah istimewa kepada Dewan Perwakilan Rakyat (DPR), Senin (28/9). Hadiah tersebut berbentuk korek kuping berukuran raksasa. Kenapa korek kuping? Wakil Koordinator ICW Emerson Yuntho mengatakan, hadiah tersebut sebagai simbolik terhadap ketidakpedulian DPR dalam menerima dan menampung aspirasi masyarakat. Korek kuping sepanjang sekitar satu meter itu dibuat pada sebuah kayu silinder berwarna hijau yang di kedua ujungnya dibuat menyerupai korek kuping. Hadiah ini diberikan sebagai bentuk keprihatinan atas ngotot-nya DPR mengesahkan RUU Pengadilan Tipikor, dan diserahkan kepada Wakil Ketua Badan Kehormatan DPR Irsyad Soediro di Ruang Badan Kehormatan (BK), Gedung DPR, Jakarta.

“Kondisi panas menyengat itu berpeluang meningkatkan intensitas curah hujan disertai angin kencang di Sumatera Utara. Kalau itu terjadi tidak tertutup kemungkinan gejala badai Ketsana akan menghantam Indonesia dan Sumatera Utara pada umumnya. Sebelumnya arah badai itu tidak

Lanjut ke hal 2 kol. 1

Lanjut ke hal 2 kol. 5

DPR: Kasus Bank Century Harus Tuntas

AP

USUNG MAYAT: Regu penyelamat bersama sejumlah warga mengusung jasad korban tewas dan tertutup lumpur akibat badai Ketsana yang menghantam ibukota Manila dan 25 provinsi lainnya di Filipina Sabtu. Jasad itu ditemukan tim di pinggir sungai di kota Maraikina, bagian timur Manila Senin (28/9).

Bocoran Tiga Plt Pimpinan KPK

JAKARTA (Antara): Ketua DPR Agung Laksono menegaskan, DPR bersikap kasus Bank Century harus diselesaikan sampai tuntas dan jika ditemukan ada tindak pidana dalam persoalan itu harus ditindaklanjuti tanpa adanya diskriminasi dan nuansa politisasi. Hal itu ditegaskan Agung Laksono menjawab pers seusai peluncuran bukunya yang berjudul “Dari Rumah Rakyat Mengawal Demokrasi” di ruang Pustaka Loka Gedung MPR/DPR RI Jakarta, Senin(28/9). Dia mengemukakan, pihaknya telah menerima laporan dari Badan Pemeriksa Keuangan tentang pemeriksaan atau audit investigasi terhadap kasus Bank Century. “Saya belum bisa berkomentar karena saya juga belum membaca laporan itu. Cukup tebal,” ujar Agung seraya menambahkan, tentunya segala kerahasiaan dari laporan itu belum dapat dibuka untuk umum.

Lanjut ke hal 2 kol. 1

BACA DI HALAMAN DALAM Tiket Pesawat Meroket 200 Persen Seminggu lebaran berlalu harga tiket rute dalam negeri Medan-Jakarta di Bandara Polonia Medan mencapai Rp1,6 juta lebih. Berarti ada kenaikan 200 persen. 16

Bank Indonesia Jamin Tak Sembunyikan Data Bank Century Bank Indonesia menjamin pihaknya tidak menyembunyikan data-data terkait Bank Century dalam proses audit investigasi oleh BPK. 15

95% Pasangan Khalwat Mengaku Berzina Selama tahun 2009 terjadi 104 kasus khalwat di Pidie. Sebanyak 95 persen diantaranya, pasangan non muhrim itu kepada petugas mengaku telah melakukan hubungan badan (berzina). 22

PLN Belum Dapat Pastikan Listrik Normal PLN Wilayah Sumatera Bagian Utara belum dapat memastikan pasokan listrik ke pelanggan normal kembali, setelah terjadi gangguan pembangkit besar di Belawan pada 24 September 2009 yang menyebabkan 38,07 persen daya atau sebesar 495 MW hilang. 9

Program Kerja DPRD Medan Lamban Program kerja DPRD Medan berjalan sangat lamban. Sampai Senin (28/9), praktis anggota dewan periode 2009-2014 belum melakukan kerja apapun. 10

Iran Ujicoba Rudal Tahap Tiga Iran mengatakan negaranya berhasil mengujicoba rudal jarak jauh tahap tiga. Senjata tersebut mampu membawa hulu ledak dan menyerang Israel, pangkalan militer AS di Timur Tengah dan beberapa negara bagian Eropa. 3

Siswa SD Hadiahi Kejari Sidikalang Parsel Obat Kuat

Satu Orang Dalam Dua Dari Luar

Korban Tewas Sudah 140 Orang, 32 Hilang

JAKARTA (Waspada): Anggota Tim 5 pencari Plt pimpinan KPK Adnan Buyung Nasution memberi bocoran soal komposisi tiga orang Plt yang tengah dicari. Pastinya, satu di antara mereka adalah perwakilan dari dalam. “ Satu orang dalam KPK, dua dari luar. Satu harus dari dalam karena memperhatikan saran dari pimpinan KPK yang ada, mereka meminta karena sudah ada yang tune in. Jadi tinggal masuk kerja,” kata Buyung di kantor Wantimpres, Jl Veteran, Jakarta, Senin (28/9). Buyung tidak memerinci lebih jauh mengenai yang dimaksud orang dalam tersebut. Menurut dia, orang dalam itu tidak dibatasi pada mereka yang saat ini masih aktif di KPK. “Kita belum tahu siapa. Bisa jadi direktur atau mantan anggota yang lama. Bisa juga dari orang yang lulus seleksi

MANILA, Filipina (AP): Akibat badai Ketsana, pemerintah Filipina meminta bantuan internasional untuk menanggulangi korban yang kini dalam keadaan payah dan terancam kelaparan. Sedangkan korban tewas menurut laporan resmi pemerintah hingga Senin(28/9) malam, mencapai 140 orang, 32 hilang dan ribuan warga masih berada di tempat pengungsian. Jumlah korban, baik tewas ataupun hilang, diyakini masih akan terus bertambah karena sampai Senin malam sejumlah tim penyelamat yang diturunkan di berbagai lokasi banjir untuk membantu mencari para korban masih terus bekerja, terutama untuk kawasan ibukota Manila dan kawasan tetangga Provinsi Rizal, di mana korban tewas lebih dari 99 orang, kata Menteri Pertahanan Gilbert Teodoro. Sementara puluhan ribu warga yang rumahnya terkena banjir Senin secara serentak membersihkan lantai dan barang-barang yang masih bisa diselamatkan dari amukan banjir besar yang bermula dari badai Ketsana yang terjadi Sabtu dan berlanjut sampai Minggu. Namun belum diketahui warga korban tanah longsor di berbagai daerah di luar Manila, termasuk arus lalu lintas yang putus akibat tertimban longsor di 25 provinsi bagian selatan Filipina. Khusus di kota Marikina, kawasan pingir kota Manila, sebuah sofa masih terlihat tergantung di atas kabel listrik yang menunjukkan derasnya banjir yang bermula dari badai Ketasana yang bekecepatan 100 kph (kilometer per jam). (m23)

angkatan pertama dan kedua,” terangnya. Buyung menjelaskan, orang dari dalam juga memberikan keuntungan yakni tidak

Oleh H Fadly Nurzal, SAg

Opini - 13

JAKARTA (Waspada): Dua pimpinan non-aktif Komisi Pe m b e ra n t a s a n Ko r u p s i (KPK), Chandra M. Hamzah dan Bibit Samad Rianto datang ke Mabes Polri untuk memenuhi wajib lapor, Senin (28/9). Keduanya menjadi tahanan kota (luar) Mabes Polri, tiba sekira pukul 11:05, langsung memasuki gedung Bareskrim Polri, namun enggan memberikan komentar kepada wartawan yang menanyakan status hukum keduanya.

Lanjut ke hal 2 kol. 5

Seorang penasihat hukum Chandra dan Bibit, Bambang Widjojanto menyatakan, kliennya datang ke Mabes Polri selain wajib lapor atas status tersangka, juga melaporkan Kepala Bareskrim Polri Komjen Pol. Susno Duadji kepada Inspektorat Pengawasan Umum (Irwasum) Mabes Polri, Komjen Pol. Yusuf Manggabarani. Menurut Bambang, Susno diduga bertindak secara tidak profesional menangani kasus

menimpa Chandra dan Bibit. “Dia (Susno) diduga memaksakan penyidikan,” kata Bambang yang lebih dulu tiba di Mabes Polri sebelum Chandra dan Bibit datang. Chandra datang mengenakan kemeja putih lengan panjang dan Bibit mengenakan setelan jas abu-abu. Baik Bibit maupun Chandra mengaku tidak tahu mengenai substansi dari wajib lapor yang mereka

Lanjut ke hal 2 kol. 5

DPD Tolak Perppu Plt KPK JAKARTA (Antara): Dewan Perwakilan Daerah (DPD) menolak Perppu penunjukan pelaksana tugas (Plt) pimpinan Komisi Pemberantasan Korupsi (KPK). “Kami termasuk yang menandatangani penolakan terhadap Perppu,” kata anggota DPD Marwan Batubara ketika ditemui di gedung KPK, Jakarta, Senin(28/9). Kehadiran Marwan ke KPK didampingi oleh beberapa anggota DPD. Mereka mewakili Tim Upaya Pemberantasan Tindak Pidana Korupsi DPD. Menurut Marwan, keputusan Presiden Susilo Bambang Yudhoyono untuk mengeluarkan Perppu penunjukan pe-

laksana tugas pimpinan KPK tidak tepat. Hal itu disebabkan tidak ada kondisi mendesak dan genting setelah penetapan beberapa pimpinan KPK ditetapkan sebagai tersangka oleh polisi. Marwan menegaskan, KPK masih bisa berjalan meski jumlah pimpinan mereka tidak lengkap. “KPK masih bisa bekerja dengan pimpinan yang ada,” kata Marwan, juga Ketua Tim Upaya Pemberantasan Tindak Pidana Korupsi DPD. Marwan juga mempertanyakan proses penyidikan di kepolisian terhadap pimpinan KPK. Menurut dia, proses itu

Lanjut ke hal 2 kol. 7

Pemondokan Diundi 16-18 Oktober

7.250 Paspor Haji Asal Sumut Sudah Dikirim Ke Jakarta

Antara

WAJIB LAPOR: Pimpinan Komisi Pemberantasan Korupsi (KPK) nonaktif, Bibit Samad Rianto (depan kiri) dan Chandra M Hamzah (kanan) memenuhi panggilan wajib lapor di Bareskrim Polri, Jakarta, Senin (28/9).

Kasus Penculikan Terkuak

Motifnya Sang Anak Kurang Diperhatikan

Oleh Bachtiar Hasan Miraza

Opini - 12

http://epaper.waspadamedan.com da

Mu Waspada/Muhammad H. Ishak

.. ses

iak

hD

paper

pada pemberantasan korupsi. Jangan seperti sekarang ini, agak loyo,” tutupnya.

Pengacara Lapor Susno Duadji Ke Irwasum

Menatap Perekonomian RI Masa Depan

WASPADA

memerlukan job training dalam waktu lama. Tapi kenapa komposisinya lebih sedikit? “Kita butuh banyak darah segar, yang betul comitted

Chandra Dan Bibit Wajib Lapor

Kejari Sidikalang, Kab. Dairi dihadiahi parsel berisi sejumlah obat kuat khusus pria. 18

Label Halal, Bukan Label Haram

Filipina Mohon Bantuan

Kapolres Aceh Timur AKBP Drs Ridwan Usman mewawancarai Khaidir yang merekayasa dirinya diculik hanya untuk mendapatkan uang dari orangtuanya.

SELEPAS konflik, penculikan dengan minta tebusan menjadi isu dan pembicaraan hangat di tengah masyarakat Provinsi Aceh. Kasusnya bukan pertama kali terjadi di wilayah yang sedang menerapkan syari’at Islam sejak tahun 2001. Korbannya pun sudah banyak. Kiranya, Khaidir belajar dari isu-isu tersebut. Dia pun mulai pasang aksi untuk mengaut uang orangtuanya. Skenario pun diatur tetapi setelah ‘korban’ dimintai keterangan berikut saksi-saksi lainnya, polisi mendapati beberapa kejanggalan dan keanehan. Dari sanalah mulai terkuak, bahwa penculikan terhadap Khaidir merupakan rekayasa murni yang sengaja dimainkan dengan dalih mendapatkan uang dari orangtuanya. Sebelumnya, Khaidir berencana uang itu akan digunakan membuka usaha di Medan, Sumatera Utara dan membeli mobil mewah. Sepertinya, Khaidir, anak Haji Karim, asal Desa Gampong Jawa, Kec. Idi, Aceh Timur, ingin kaya mendadak. Hasil wawancara dengan Waspada, Senin (28/9) petang, Khaidir yang kini masih dalam penyelidikan pihak Mapolres mengatakan, dia melakukan itu untuk memperoleh kekayaan ayahnya, di mana selama ini dia merasa dinomorduakan

Lanjut ke hal 2 kol. 5

JAKARTA (Waspada): Pemondokan haji (maktab) akan diundi 16-18 Oktober 2009 di Jakarta. Kanwil Depag masingmasing dari 33 provinsi se-Indonesia akan mewakili pengundian tersebut. “Musim haji 2009 ini kondisi pemondokan haji Indonesia lebih kondusif, terutama dari segi jarak hanya 3-7 kilometer ke Masjidil Haram,” kata Kepala Bidang Penyelenggaraan Haji Zakat dan Wakaf Kanwil Depag Bengkulu, Zahdi Taher di Bengkulu, Senin (28/9). Sedangkan pada musim haji 2008, jarak pemondokan haji Indonesia mencapai

4-12 kilometer ke Masjidil Haram. Dia mengatakan, maktab Indonesia tahun 2009 terdiri atas Ring Satu berjarak 1 sampai 3 km ke Masjidil Haram dan Ring Dua berjarak 4 sampai 7 km ke Masjidil Haram. “Jarak ring dua terjauh dengan Masjidil Haram sekitar tiga jam perjalanan, sehingga kalau mau shalat zuhur berangkat pukul 09:00 waktu setempat agar tidak terjebak macet,” ujarnya. Dia menganjurkan, selanjutnya agar tetap berada di sekitar Masjidil Haram

Lanjut ke hal 2 kol. 7

KD Layangkan Gugatan Cerai JAKARTA (Waspada): Upaya mendapatkan legalisasi perceraian dari Pengadilan Agama (PA) akhirnya ditempuh pasangan penyanyi Krisdayanti dan Anang Hermansyah (foto). Senin (28/9), KD— julu-kan Krisdayanti—melayangkan gugatan cerai ke PA Jakarta Selatan. Gugatan cerai didaftarkan Harry S Marpaung, salah satu staf kuasa hukum Krisdayanti, dengan nomor 1694/pdt.g/ 2009/ PA. Jakarta Selatan. “Krisdayanti tak perlu hadir. Inikan daftar saja. Yang jelas, sudah terjadi kesepakatan untuk bercerai antara keduanya,” kata Harry ditemui usai mendaftarkan gugatan cerai KD.

Lanjut ke hal 2 kol. 1

Kps

Seramp ang erampang - Ketsana saja, jangan sampai datang ketsini - He...he...he...


WASPADA Demi Kebenaran Dan Keadilan

Banda Aceh: Cuaca : Berawan dan peluang hujan Angin : Tenggara - Barat Laut Kec. antara 10 s/d 30 Km/jam

Provinsi NAD: Lereng Timur Pegunungan, Dataran Tinggi, Pesisir Timur, Pantai Barat: Berawan dan hujan ringan

Temperatur Maks/Min: 340C - 240C BMKG Polonia

EDISI ACEH

SELASA, Kliwon, 29 September 2009 /10 Syawal 1430 H � No: 22923/A Tahun Ke-63

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman � Harga Eceran: Rp 2.500,- (belum termasuk ongkos kirim)

Chikungunya Dekati ‘KLB’ Dudi Anung/Setpres

Presiden SBY dan Ibu Ani Yudhoyono melihat foto John F Kennedy yang dipajang di museum.

SBY Tonton Film JFK BOSTON, Massachusetts (Antara): Presiden Susilo Bambang Yudhoyono pada Minggu waktu setempat mengunjungi Perpustakaan dan Museum John F. Kennedy (JFK) di Columbia Point, Boston, dan menonton film tentang perjalanan politik JFK sebagai presiden Amerika Serikat ke-35. Presiden, Ibu Ani dan rombongan disambut oleh Direktur Yayasan Perpustakaan Kennedy, Stephen Smith, dan Wakil Direktur Perpustakaan Kennedy, James Roth, di lobi gedung. Oleh kedua pimpinan museum Kennedy itu, Presiden dan rombongan dibawa ke ruang Stephen E. Smith Center untuk menonton film dokumenter selama 17 menit mengenai masa-masa perpolitikan AS dan dunia yang dilalui JFK sebelum dan saat ia menjadi presiden AS. Sebelumnya, Stephen Smith menyampaikan ucapan Lanjut ke hal 2 kol. 1

Pendatang Di Banda Aceh Akan Didata BANDA ACEH (Antara): Pemerintah Kota Banda Aceh akan mendata para pendatang yang datang ke ibukota Provinsi Aceh itu setelah lebaran Idul Fitri 1430 Hijriah. “Kita tidak melakukan pembatasan terhadap pendatang, paling tidak kita tertibkan dengan mendata mereka,” kata Walikota Banda Aceh, Mawardy Nurdin di Banda Aceh, Senin (28/9). Hal itu disampaikannya usai halal bihalal dengan jajaran pemerintahan Kota Banda Aceh di halaman kantor Walikota yang masih dalam suasana lebaran. Menurutnya, setiap tahun setelah lebaran, warga dari luar Banda Aceh maupun Aceh berdatangan ke daerah tersebut untuk memperbaiki ekonomi mereka. Tidak diberlakukan pembatasan terhadap pendatang itu karena mereka juga memberikan dampak positif bagi perekonomian Banda Aceh, terutama dari sektor Lanjut ke hal 2 kol. 1

BANDA ACEH (Antara): Dinas kesehatan Provinsi Aceh menyatakan kasus Chikugunya di daerah itu sudah mendekati kejadian luar biasa (KLB) yang ditandai meningkatnya kasus penyakit ini di kalangan masyarakat. “Tahun ini penderita Chikungunya meningkat hingga 200 persen dari sebelumnya dan angka itu hampir masuk dalam kategori KLB,” kata Kepala Dinas Kesehatan Provinsi Aceh, dr. Muhammad Thaib, di Banda Aceh, Senin (28/9). Berdasarkan data yang dilansir Dinas kesehatan Provinsi Aceh, hingga Agustus 2009 penderita Chikungunya mencapai 3.355 kasus di seluruh Kabupaten/Kota daerah itu. Angka tertinggi terdapat di kabupaten Aceh Tamiang dengan jumlah 1.200 kasus, menyusul berikutnya Kabupaten Aceh Timur dengan jumlah 1.100 kasus. Sementara Kabupaten Pidie Jaya tercatat 128 kasus, Lhokseumawe 212 kasus dan Aceh Utara 715 kasus. “Untuk dua kabupaten tersebut angkanya saja sudah sangat tinggi dan cukup memprihatinkan,” katanya. Kurangnya pengetahuan masyarakat terhadap penyakit tersebut menjadi faktor utama tingginya penderita Chikungunya di Provinsi yang dilanda bencana alam gempa bumi dan tsunami 26 Desember 2004 itu. “Selain rendahnya pengetahuan masyarakat tentang penyakit itu, juga kurang perhatian warga dalam menjaga kebersihan lingkungan sekitarnya,” katanya. Sebagai langkah antisipasi Lanjut ke hal 2 kol. 6

Korban Badai Di Manila Jadi 100 Orang MANILA (Waspada): Jumlah korban tewas akibat badai yang memicu banjir bandang yang melanda ibukota Filipina, Manila, terus bertambah. Hingga kini sudah tercatat 100 orang

tewas dan 32 lainnya hilang. Pemerintah Filipina menyatakan, pihaknya kesulitan menanggulangi musibah banjir besar yang menggenangi 80% area Manila. Akan tetapi penca-

Lanjut ke hal 2 kol. 3

Gunung Ujeun ‘Makan’ Korban BANDA ACEH (Waspada): Kawasan tambang emas Gunung Ujeun Aceh Jaya kini heboh dengan bau busuk yang diduga kuat jasad manusia yang meninggal, namun begitu pengelola tambang membantah tentang adanya petambang yang meninggal. Helmi, pengurus tambang menyebut tidak ada laporan tentang aroma tak sedap dari lubang-lubang tambang. “Memang sebelumnya ada isu akhir puasa (Ramadhan) lalu, tapi itu tidak ada, ada yang turun mengatakan juga tidak ada,” ungkap Helmi Senin (28/9) siang. Begitupun Helmi akan kembali mencari tahu kabar tersebut. Namun secara terpisah sumber Waspada kemarin menyebutkan, beberapa pekerja mencium aroma tak enak dari beberapa lubang tambang. “Mungkin pencuri, sudah masuk tidak bisa keluar lagi,” ungkap sumber yang enggan namanya dipublikasikan. Menurutnya, jumlah korban jiwa petambang sudah Lanjut ke hal 2 kol. 1

rian masih terus dilakukan. Demikian dilansir AFP, Senin (28/9). “Kita berkonsentrasi pada pemberian pertolongan yang masif. (Tetapi) sistem kelebihan

beban. Pemerintah lokal kewalahan,” ujar Kepala Badan Koordinasi Bencana Nasional, Anthony Golez. Anthony menyatakan hingga kini jumlah warga yang

mengungsi akibat air bah tersebut meningkat hingga 451.000 jiwa. Ancaman wabah penyakit dan penyediaan bantuan bagi Lanjut ke hal 2 kol. 6

Kursi Plt KPK Terancam Kosong

Ratusan Guru Depag Pertanyakan Uang Sertifikasi BIREUEN (Waspada): Sebanyak 425 orang guru di jajaran Departemen Agama (Depag) Bireuen belum menerima tunjangan profesi guru. “Padahal sebelumnya Kepala Departemen Agama kantor wilayah Aceh, HA Rahman TB LT mengatakan uang itu cair sebelum lebaran,” ujar salah seorang guru MAN yang enggan ditulis namanya, Senin (28/9). Dia mengaku heran, sampai saat ini belum cairnya dana profesi guru sebanyak satu kali gaji seperti halnya guruguru di Diknas, padahal pihaknya sudah lama melengkapi bahan-bahan yang diperlukan. “Menjelang lebaran Kantor Wilayah Aceh mengatakan pihaknya tidak bisa mentransfer karena bank tutup, namun sekarang bank sudah buka kembali juga belum ditransfer,” keluhnya. Ironisnya lagi, sejumlah kabupaten lain di Aceh seperti Banda Aceh dan Kota Lhokseumawe uangnya sudah cair, kenapa Bireuen belum cair. “Kami sudah malu dengan pihak bank, setiap hari kami mengecek apakah dana tersebut sudah masuk ke rekening bank,” sebutnya. Menanggapi permasalahan ini, Kakandepag Bireuen Drs. Zulhelmi.A Rahman, M.Ag, Senin (28/9) mengakui guru di Kabupaten Bireuen belum menerima dana tunjangan profesi tersebut, namun tanggung jawab pihaknya telah selesai karena semua berkas-berkas telah dikirim ke Kanwil

Reuters

Seorang warga mengevakuasi anak kecil dari sebuah rumah yang terendam.

Antara

SIDANG PARIPURNA SEPI: Suasana sidang paripurna Dewan Perwakilan Rakyat (DPR), yang dipimpin oleh Wakil Ketua DPR, Muhaimin Iskandar, Jakarta, Senin (28/9). Agenda sidang antara lain pengambilan keputusan RUU tentang Kearsipan, RUU tentang Rumah Sakit, membahas kebijakkan pemerintah menaikkan BBM, laporan penanganan bencana alam Aceh, laporan Pansus penyelidikan orang hilang 1997-1998, serta penyusunan rencana strategi DPR RI 2010-2015.

Ingin Kaya, Ayahnya Dikorbankan… TIDAK disangka, anak kandung rela mengorbankan orangtuanya sendiri untuk mendapatkan uang. Hanya dengan bermodal beberapa teman, yang tak lain sepupunya sendiri, sang anak kabur dari rumah, dan menyuruh beberapa orang untuk memberitahu keluarganya bahwa sang anak diculik OTK. Disaat Aceh pasca konflik, penculikan desngan dalih tebusan menjadi isu dan pembicaraan hangat di masyarakat. Apalagi harus dengan dalih tebusan uang mencapai ratusan juta rupiah. Kasus penculikan disertai tebusan bukan yang pertama terjadi di wilayah yang sedang diterapkan syari’at Islam sejak tahun 2001. Khaidir, 16, pelajar MAN Idi, Aceh Timur,

beberapa waktu lalu berhasil menipu orangtuanya. Dimana dari hasil pemeriksaan dan saksi lainnya, polisi mendapati beberapa kejanggalan dan keanehan. Dari sanalah mulai terkuak, bahwa penculikan terhadap Khaidir merupakan rekayasa murni yang sengaja dimainkan dengan dalih mendapatkan uang dari orangtuanya. Sebelumnya, Khaidir berencana uang itu akan digunakan untuk membuka usaha di Medan, Sumatera Utara dan membeli mobil mewah. Sepertinya, Khaidir, anak Haji Karim, asal Desa Gampong Jawa, Kec. Idi, Aceh Timur, ingin kaya mendadak. Hasil wawancara dengan Waspada, Senin Lanjut ke hal 2 kol. 1

Baca Halaman Dalam 95% Pasangan Khalwat Mengaku Berzina Selama tahun 2009 terjadi 104 kasus khalwat di Pidie. Sebanyak 95 persen diantaranya, pasangan non muhrim itu kepada petugas mengaku telah melakukan hubungan badan (berzina-red).

Waspada/Muhammad H. Ishak

KAPOLRES Aceh Timur, AKBP Drs Ridwan Usman mewawancarai Khaidir, 16, pelajar MAN Idi, Aceh Timur yang merekayasa dirinya diculik hanya untuk mendapatkan uang dari orangtuanya. Lanjut ke hal 2 kol. 1

JAKARTA (Waspada): Kerja Tim Lima bentukan Presiden SBY untuk memilih pelaksana tugas (Plt) pimpinan KPK tiga hari ke depan akan berakhir. Namun, diperkirakan bakal mengalami kebuntuan karena sejumlah nama menolak ditunjuk Plt pimpinan KPK. Perppu No 4/2009 yang baru diteken Presiden SBY pekan lalu sepertinya terancam tidak memiliki pengaruh apapun bagi Komisi Pemberantasan Korupsi (KPK). Bukan karena Tim Lima yang dibentuk melalui Keputusan Presiden No 27/2009 belum menemukan nama Plt pimpinan KPK. Tim Lima telah menemukan nominasi Plt KPK sebanyak 10 orang untuk diserahkan kepada Presiden SBY paling lambat 1 Oktober mendatang dan akan dilantik sehari berikutnya pada 2 Oktober 2009.

Menurut anggota Tim Lima Taufikuurahman Ruki, sebanyak 10 nama yang sudah terjaring oleh Tim Lima yang kemudian akan dikerucutkan. “Yang namanya pengerucutan tidak bisa disebutkan. Jumlah namanya 1, 2, 3, 4, 5 sampai 10,” katanya usai halal bihalal di Gedung KPK, Jakarta, Senin (28/9). Ia juga mempertimbangkan masukkan agar Plt pimpinan KPK itu berasal dari orang dalam atau mantan petinggi KPK. “Belum termasuk salah satu sumber yang dipertimbangkan. Saya belum bisa sebut nama,” ujarnya. Persoalan justru muncul dari nama-nama yang dinominasikan menjadi Plt KPK. Beberapa nama justru menolak untuk menduduki posisi tersebut. Alasannya seragam, khawatir terjadi kriminalisasi oleh kepolisian jika duduk di posisi Plt

pimpinan KPK sebagaimana dialami anggota komisioner KPK Chandra M Hamzah dan Bibit Samad Riyanto. Salah satu nama yang telah diminta untuk menduduki kursi Plt KPK tersebut namun menolaknya yaitu Teten Masduki, Sekjen Tranparency Internasional Indonesia (TII). Teten beralasan ketidaksediaan dirinya menjadi Plt KPK karena khawatir terjadi kriminalisasi oleh kepolisian sebagaimana dialami Chandra M Hamzah dan Bibit Samad Riyanto. “Saya khawatir kalau kriminalisasi polisi terhadap kewenangan KPK tidak dikoreksi,” jelasnya kepada INILAH.COM, di Jakarta, Minggu (27/9). Ia menuturkan, koreksi yang dimaksud adalah, proses hukum yang kini menjerat ChandraBibit. Lanjut ke hal 2 kol. 6

Bayi Makrosomia Diprediksi Tinggal Lama Di RSU Namanya Bertambah Jadi Muhammad Akbar Risuddin Ilham OK Arya KISARAN (Waspada) : Bayi makrosomia (besar) terus mendapat perawat tim medis RSU H Abdul Manan Simatupang (HAM) Kisaran, sehingga diprediksi akan tinggal lama di RSU setempat. “Sebelum penelitian selesai, bayi makrosomia belum diizinkan pulang,” jelas Direktur RSU HAM dr Herwanto, SpB melalui Dokter Spesialis Anak dr Alfian Nasution, SpA dikonfirmasi Waspada, Senin (28/9). Menurutnya, penelitian bayi itu akan dilakukan dengan bekerja sama dengan Ikatan Dokter Anak Indonesia (IDAI) Jakarta, sehingga diperlukan waktu untuk penelitian itu. “Masalah bayi ini sudah sampai ke Menteri Kesehatan, sehingga bayi ini mendapat perhatian khusus dari IDAI,” jelas Alfian. Untuk waktu penelitian, lanjut Alfian, belum bisa diprediksi, karena info dari Jakarta, dalam waktu dekat ini mereka akan datang ke Kota Kisaran. “ Dengan demikian bayi itu, harus diperhatikan terus perkambangannya,” kata Alfian. Hingga kini, kata Alfian, bayi dalam keadaan sehat dan normal, dan belum ada tanda-tanda adanya penyakit yang menyertainya. “ Semua organ tubuhnya berjalan dengan nor-

Waspada/Sapriadi

mal,” jelas Alfian. Senada dengan hal itu, dr Binsar P Sitanggang, SpOg menjelaskan, kondisi ibu bayi sehat dan normal. “ Alhamdulillah, ibu bayi dalam keadaan sehat wal afiat, namun belum boleh pulang, karena luka bekas operasi belum sembuh total,” jelas Sitanggang. Janji Perhatikan Sementara Bupati Batubara OK Arya Zulkarnaen berjanji akan memperhatikan bayi itu dengan memberi bantuan biaya pendidikan hingga ke perguruan tinggi. “Pemkab Batubara akan menanggung biaya pendidikan bayi besar raksasa ini hingga Lanjut ke hal 2 kol. 6

MENGGENDONG : Bupati Asahan OK Arya Zulkarnaen menggendong bayi makroso-mia didampingi Direktur RSU HAM Kisaran dr Herwanto, SpB (kiri) dan ayah bayi Hasanud-din. Bayi diberi nama Bupati Batubara dengan nama Ilham Arya. Foto direkam, Senin (28/9).

erampang Seramp ang - Kaya hati yang perlu Dhir - He...he...he....


2 SBY Tonton Film JFK ... selamat datang kepada Yudhoyono, yang disebutnya pemimpin negara yang memiliki semangat kuat seperti mantan presiden JFK untuk menjunjung tinggi demokrasi. Smith dan Yudhoyono juga sempat bertukar kenangkenangan. Cendera mata yang diserahkan kepada Smith adalah berupa kain batik, yang dijelaskan Presiden sebagai salah satu warisan sejarah dunia dari Indonesia. Usai menonton film tentang sejarah JFK, Presiden berkeliling melihat koleksi-koleksi museum yang menunjukkan hidup, kepemimpinan dan peninggalan JFK dan menggambarkan betapa ia mencintai politik dan pelayanan terhadap publik. Perpustakaan dan Museum Presiden John F. Kennedy adalah fasilitas dan gedung yang dipersembahkan untuk mengenang JFK serta semua pihak yang memberikan sumbangan mereka melalui seni politik untuk menciptakan dunia baru yang lebih baik. Presiden Yudhoyono usai berkunjung ke museum itu mengatakan, Indonesia dapat mengambil beberapa pelajaran dari perjuangan-perjuangan JFK yang sesuai pada zamannya. Ia mengambil contoh tentang perjuangan Kennedy, yang dengan berani, mengambil berbagai langkah untuk menghilangkan diskriminasi di negaranya. “Semangat seperti ini harus juga diterapkan di negeri kita... tidak boleh ada diskriminasi, pembedaan karena agama, suku, etnis,” kata Yudhoyono. Pengembangan teknologi modern dan teknologi dirgantara yang diterobos oleh JFK juga disebutkan Presiden sebagai beberapa contoh perjuangan yang perlu dicontoh dari JFK. “Ini mengingatkan kita bahwa untuk mewujudkan tujuan-tujuan mulia, itu harus diikuti dengan semangat kuat dan ketegaran,” kata Yudhoyono. John Fitzerald Kennedy, yang dilahirkan di Brookline, Massachusetts, pada 29 Mei 1917, diangkat sebagai Presiden AS yang ke-35 pada tahun 1960. Ia politisi termuda yang dipilih menjadi presiden AS. Namun jabatan kepresidenannya pada tahun 1963 berakhir dengan tragis. Ia tewas tertembak di Dallas pada 22 November 1963 di atas mobil terbuka ketika melintas di antara kerumunan masyarakat setempat yang menyambut kunjungannya ke Dallas. Presiden SBY dan Ibu Ani Yudhoyono melihat foto John F Kennedy yang dipajang di museum. Dudi Anung/Setpres.

Pendatang Di Banda Aceh ... jasa dan perdagangan. Ia mengaku banyak pendatang dari luar Banda Aceh yang mencari nafkah di ibukota provinsi paling ujung barat Sumatera itu, namun masih terdata di daerah asalnya. Selain tidak memiliki kartu tanda penduduk (KTP) Kota Banda Aceh, bahkan banyak diantara pendatang tidak melapor ke aparat setempat tentang keberadaan mereka. Kini Kota Banda Aceh mencatat sebanyak 219.659 jiwa penduduk, namun diperkirakan terdapat lebih besar jumlah yang belum terdata terutama setelah tsunami 2004.

Gunung Ujeun ‘Makan’ ... banyak. Namun selalu ditutupi oleh pengelola, ini terjadi karena wilayah yang menjadi sumber pendapatan warga itu pernah ditutup pemerintah, tapi dibuka kembali setelah diprotes warga serta pemilik-pemilik lubang yang terdiri atas 20 koperasi pengelola. Sementara Kapolres Persiapan Aceh Jaya, Kompol Hasanuddin yang dihubungi mengaku belum mendapat laporan atas kematian petambang emas. “Tapi terimakasih, nanti saya akan cek dulu,” kata Hasanuddin. Kapolres juga menyebut pihaknya tidak memberikan pengamanan di wilayah tersebut, karena tambang itu adalah tambang ilegal yang dikelola secara tradisional. “Sekali lagi terimakasih, akan coba saya cari tahu kebenarannya,” kata Hasanuddin.(b32)

Ingin Kaya, Ayahnya ... (28/9) petang, Khaidir yang kini masih dalam penyelidikan pihak Mapolres mengatakan, dia melakukan itu tidak lain untuk memperoleh kekayaan ayahnya dimana selama ini dia merasa dinomorduakan dalam keluarga. “Lagian saya melihat orang punya mobil mewah, kenapa orang tua saya yang punya segala-galanya tidak mau memberi saya mobil,” katanya. Selain permintaannya terhadap orang tua yang gagal, Khaidir juga mengaku, sebelumnya pernah dijanjikan orangtuanya dibelikan mobil dan diberi uang banyak, namun janji itu dianggap diingkari sang orang tua. Karena dianggap orangtuanya telah mempermainkannya, Khaidir pun membuat skenario. Beberapa temannya diajak ikut dalam mendapatkan uang ayahnya yang nilainya mencapai ratusan juta. “Tidak tertutup kemungkinan otak di balik penculikan tersebut adalah korban sendiri, sehingga kasus ini perlu didalami, bahkan keluarganya telah membuat pengaduan tertulis,” demikian Waka Polres Aceh Timur, Kompol Junaidi, menjawab Waspada, Jumat (25/9), di ruang kerjanya. Keterangan lain dari Khaidir juga diperoleh, selama dia hilang selalu berusaha untuk mendapatkan uang dengan melakukan kontak langsung via telepon dengan keluarga. Meski bukan dia yang menelepon, dikhawatirkan ketahuan, semua ide, termasuk ancaman bunuh, diciptakan untuk memperoleh uang. Selama tujuh hari sejak hari pertama hilang, Khaidir mengaku berada di Kota Lhokseumawe. Karena orangtuanya ingin memberi uang tebusan, maka Khaidir dengan menggunakan sepeda motor pulang ke Aceh Timur dan menetap di rumah familinya di Kecamatan Peudawa. Selama di Peudawa Khaidir selalu keluar masuk dan mondar-mandir di jalan raya, apalagi pada malam lebaran Idul Fitri. Khaidir juga mengaku takut, ketika mengetahui kasus itu telah dilaporkan ke polisi. Dengan sandiwara, Khaidir melukai badannya. Hal itu untuk meyakinkan polisi jika suatu saat perlakuannya terbongkar. Pengakuan Khaidir, luka di pergelangan tangannya merupakan hasil goresan dirinya sendiri. Hal ini dilakukan untuk meyakinkan polisi dan orangtuanya pasca pelepasannya setelah ditebus Rp25 juta. Ternyata drama rekayasa itu terkuak setelah sejumlah nama pelaku berhasil dikantongi petugas berdasarkan pengakuan Khaidir. Selain Khaidir yang kini dalam proses penyelidikan, polisi juga akan memburu empat pelaku lainnya. Ke empatnya adalah sepupu korban sendiri. Dugaan penculikan yang menimpa keluarga Haji Karim tersebut sempat menjadi isu dan pembicaraan hangat di kalangan tertentu. Karena dikira saat kejadian Khaidir dibawa kabur kawanan penculik. Usai orang tua Khaidir menyerahkan uang Rp25 juta yang diantar langsung ke salah satu titik di Aceh Timur, Selasa (22/9) sore, keesokan harinya, Rabu (23/9) sekira pukul 20:00, Khaidir pura-pura dibebaskan di depan MTsN Idi. Apakah polisi akan menjerat Khaidir dengan pasalpasal tertentu akibat ulahnya itu? Ataukah Khaidir akan dibebaskan mengingat dia masih berumur 16 tahun? Apalagi dia seorang pelajar. Kita tunggu! - Muhammad H. Ihsak

Berita Utama Trawl, Aparat 207 Calhaj Lhokseumawe Cegah Diminta Proaktif Patroli Periksa Kesehatan WASPADA Selasa

29 September 2009

KOTA LHOKSEUMAWE (Waspada): Untuk menunaikan ibadah haji ke tanah suci, sebanyak 207 calon jamaah haji asal Kota Lhokseumawe periksa kesehatan di Dinas Kesehatan kota itu, yang dimulai dari 28 hingga 30 September. DR. Ratna Zahara, Kabid P2P pada Dinas Kesehatan Kota Lhokseumawe, saat dikonfirmasi wartawan, Senin (28/9), mengatakan, calon jamaah haji yang diperiksa itu berupa, kencing, darah, imunisasi, pemberian suntikan vaksin influeza dan beberapa hal lainnya. “Kalau ada diantara Calhaj kita yang terindikasi virus flu babi, maka akan segera dirujuk ke rumah

sakit,” jelas Ratna, menambahkan, gagal atau tidaknya yang bersangkutan berangkat ke tanah suci sangat tergantung kepada hasil pengobatan. Untuk memeriksa para Calhaj, sebut Ratna, pihaknya melibatkan dokter dari rumah sakit, sehingga setiap penyakit yang diderita para calon jamah akan terdeteksi, sehingga memudahkan untuk mengobati. Drs. Salahuddin, Kepala Kantor Depag Kota Lhokseumawe kepada wartawan menyebutkan, para Calhaj asal Lhokseumawe akan berangkat ke tanah suci pada 31 Oktober, tergabung pada kelompok terbang (Kloter) delapan yang digabungkan dengan para calon

jamah dari Banda Aceh dan Aceh Besar. Disebutkan, secara umum persiapan para calhaj Kota Lhokseumawe telah matang dan siap berangkat. Isi tas yang diperbolehkan untuk tiap-tiap calon jamah hanya diperbolehkan seberat 15 Kg. Dikatakan, untuk Kota Lhokseumawe, jumlah jamah calon haji yang telah masuk dalam daftar tunggu mencapai 1.690 orang, diperkirakan, jumlah tersebut akan habis diberangkatkan enam tahun mendatang. “Mereka semua telah membayar biaya masing-masing Rp20 juta yang dikirim ke rekening Menteri Agama RI di Jakarta sebagai bukti tanda jadi,” katanya. (cmun)

Maling Kambing Diamuk Massa BIREUEN (Waspada): Satu diantara dua tersangka pelaku maling kambing sempat mejadi bulanbulanan warga usai menjalankan aksinya di halaman belakang meunasah Desa Blang Reum, Kecamatan Jeumpa, Bireuen, Senin (28/9) sekira pukul 10:00. Warga Desa Blang Reum sejak beberapa hari terakhir ini diresahkan dengan maraknya aksi pencurian hewan ternak. Ujungnya, warga sempat melampiaskannya dengan hantaman dan pukulan ke tubuh dan wajah serta tersangka juga sempat dimandikan di aliran irigasi setempat. Menurut Jalaluddin Idris, 45, warga Dusun Masjid, Desa Blang Reum, Kecamatan Jeumpa, Bireuen, pemilik kambing yang ditemui di kantor Polsek Jeumpa, awalnya aksi tersangka dipergoki seorang bocah. Kambing milik korban sempat dibawa kabur dengan sepedamotor Supra Fit BK 3524 TS oleh pelaku. Berkat teriakan bocah, warga yang saat itu sedang menghadiri pesta di kawasan tersebut langsung mengejar tersangka dengan sepedamotor dan menangkap basah tersangka dengan seekor kambing yang saat itu berada dalam gendongan tersangka. “Sebelum kejadian ini, pada 15

menjelang lebaran saya juga telah kehilangan satu ekor kambing dari kandang. Hingga kini belum ditemukan. Kejadian hilangnya kambing saya itu terjadi pada malam hari, kini dari enam ekor kambing yang saya miliki hanya tinggal 5 ekor lagi, kambing yang hampir dicuri tadi bila dijual senilai Rp300 ribu,” kata Jalaluddin. Kapolres Bireuen AKBP.T. Saladin, SH melalui Kapolsek Jeumpa Iptu. Shaiful Anam, S.TP membenarkan pihaknya telah mengamankan tersangka yang berinisial Muk, 39, warga Desa Matang Kule, Kecamatan Peulimbang, Bireuen, hasil dari tangkapan warga. “Dari tangan tersangka kita berhasil mengamankan seekor kambing, satu unit sepedamotor Supra Fit BK 3524 TS. Sedangkan rekan tersangka saat ini sudah menjadi Daftar Pencarian Orang (DPO) Polsek Jeumpa,” terang Shaiful Anam. Kapolsek Jeumpa Iptu. Shaiful Anam menyebutkan, tersangka akan dijerat pasal 363 ayat 1e KUHPidana dengan hukuman tujuh tahun kurungan. Masuk Bui Dalam kasus lain sebut Kapolsek Jeumpa, seorang oknum yang mengaku bekerja sebagai penjaga

tower telkom Bireuen harus mendekam dalam jeruji besi Polsek Jeumpa, setelah tertangkap tangan mencuri di kios rokok milik Rosnidar Aritonang di kawasan terminal bus Bireuen. “Tersangka berinisial Mah, 37, warga Desa Pulo Ara, Kecamatan Kota Juang, Kabupaten Bireuen, selama ini bekerja sebagai penjaga tower telkom di kawasan terminal bus Bireuen,” terang Kapolsek. Shaiful menyebutkan, tersangka diamankan pada 15 September 2009 sekira pukul 04:00. Sebelum penangkapan, polisi menerima laporan dari warga sekitar, salah satu kedai rokok milik warga sedang disatroni maling pada saat itu. “Anggota langsung terjun ke lapangan dan melakukan penyergapan, kendati tersangka saat itu berhasil kabur dari dalam kedai, namun di luar tersangka berhasil ditangkap dengan barang bukti,” ujar Shaiful. Menurut Kapolsek, tersangka mengaku menjalankan aksinya ditemani seorang rekannya yang saat ini masuk daftar DPO Polsek Jeumpa. Tersangka akan dikenakan pasal 363 ayat 3e junto 406, pencurian dan perusakan dengan ancaman tujuh tahun penjara.(cih)

Jaringan Listrik Bermasalah Meresahkan BANDA ACEH (Antara): Warga masyarakat mengaku resah karena jaringan listrik di Banda Aceh sering bermasalah seperti yang terjadi dalam dua hari terakhir. “Di rumah kami saja listrik sebentar padam, sebentar hidup dan arusnya pun tidak stabil mengakibatkan banyak peralatan elektronik rusak,” kata Fuadi, 45, warga Lamteumen di Banda Aceh, Senin (28/9). Perusahaan Listrik Negara (PLN)

Ratusan Guru Depag ... Aceh sebelum lebaran Idul Fitri 1430 H. “Sementara pesoalan pencairan dana, akan dikirim sendiri oleh Kanwil Aceh ke nomor rekening guru yang telah lulus sertifikasi tersebut, mungkin Bireuen belum dikirim karena jumlahnya banyak,” jelasnya. (b03)

mengaku terpaksa mematikan sebagian sejak beberapa hari terakhir ini. Bahkan di beberapa daerah, hingga kini masih gelap gulita. “Sudah seharian lebih listrik di rumah kami dan kawasan tempat tinggal kami belum menyala. Kami tidak tahu harus berbuat apa, hanya bisa menunggu,” kata Fuadi. Bahkan sebagian warga mengaku pemadaman listrik di tempat tinggal mereka dalam sehari terjadi berulang-ulang dan tidak sedikit bahan dapur di kulkas mengeluarkan bau kurang sedap. “Dalam sehari ini saja, PLN memadamkan listrik di tempat tinggal kami ada sekitar 20 kali,” kata Indra Azmi, 30, warga Ajun, Aceh Besar. Pemadaman listrik mulai dilakukan sejak hari Minggu (27/9). Warga mengaku mengalami kesulitan dalam menjalani aktivitas-

nya di akhir pekan. “Barang elektronik rusak akibat arus listrik yang tidak stabil dan ini justru dapat merugikan masyarakat. Kami berharap PLN lebih berhati-hati dalam menangani masalah ini,” jelas Indra. Sementara Manajer Teknik PLN Wilayah 1 Aceh Muntazar mengatakan, gangguan jaringan listrik disebabkan angin kencang yang melanda Banda Aceh beberapa hari terakhir. “Ada pohon yang tumbang akibat angin kencang dan terkena dengan pembangkit listrik kita, dan ini amat mengganggu sekali. kini kami sedang berupaya memperbaikinya,” katanya. Upaya memperbaiki jaringan yang terganggu terus dilakukan, biar suplai arus listrik kembali normal, kata Muntazar tanpa menyebutkan berapa lama dapat diselesaikan perbaikan tersebut.

Gelora Cinta Kakek Badung Berujung Di Kantor WH SIGLI (Waspada): Gelora cinta memang tidak mengenal batas umur. Namun bila dilampiaskan dengan yang bukan muhrim (pasangan sah-red) di Provinsi Aceh, gelora cinta bisa berujung di Kantor Wilayatul Hisbah (WH). Begitulah nasib Kakek AR, 64, warga Desa Utue, Kec Pidie. Kab. Pidie. Bersama kekasihnya War, 28, warga Desa Kuli, Kec. Pidie yang masih bersatus istri orang, si kakek diciduk warga sedang berdua-duaan di dalam gubuk tambak di Desa Blang Galang, Kec, Pidie, Minggu (27/9) sekira pukul 20:00. Kepala Kantor Satuan Polisi Pamong Praja (Satpol PP) dan Wilayatul Hisbah (WH) Kab. Pidie Sabaruddin, SH kepada Waspada, Senin (28/9) mengungkapkan, kakek badung ini tertangkap basah melakukan khalwat atau melakukan hubungan layaknya suami-istri di tempat sepi padahal bukan muhrim. Mereka ditangkap warga lalu diserahkan ke Mapolsek Pidie dan WH untuk diproses lebih lanjut. Sejak bulan Ramadhan hingga kini, petugas WH dan Satpol PP Kab. Pidie rutin melakukan razia atas pasangan pelaku khalwat. Dua sejoli yang satunya telah uzur itu tampaknya pasangan tertua yang ditangkap aparat keamanan di Pi-

die, terkait pelanggaran Syariat Islam di daerah itu. Sebelumnya sebut dia, pihaknya juga telah menangkap beberapa pasangan khalwat yang terjadi di bulan Ramadhan, namun setelah diberi bimbingan pasangan-pasangan itu diserahkan kepada tokoh masyarakat untuk proses hukum selanjutnya. Kakek AR kepada Waspada, kemarin di kantor WH mengakui telah melakukan hubungan layaknya suami istri bersama kekasihnya War yang masih berstatus istri orang lain. Ia sendiri mengaku masih ada hubungan saudara dengan kekasihnya tersebut. “Sejak dia masih kecil, War sudah sama saya dan kami masih ada hubungan saudara,” aku A. Rani. Ia juga mengaku perbuatan mesum itu dilakukannya atas suka sama suka, tidak karena paksaan. Sebelum perbuatan itu diketahui warga sekira pukul 17:00, War berangkat dari rumahnya di Padang Tiji menggunakan jasa ojek menuju ke tempat AR yang berprofesi sebagai penjaga tambak di Desa Utue. Kedatangan War rupanya diketahui beberapa pemuda setempat. Sekira pukul 20:00 datang puluhan warga kampung dan men-

dobrak gubuk tempatnya bermadu cinta bersama War. Saat itu menurut pengakuan AR, dia duduk di pematang tambak, sedangkan War di dalam gubuk. “Kami ditangkap bukan lagi melakukan itu, tetapi saya lagi duduk di luar gubuk. War di dalam. Warga menanyakan di mana War, saya bilang di dalam. Kami hanya melakukan perbuatan itu satu kali, sebelum warga datang,” kata kakek AR. Dijelaskannya, kedatangan War ke gubuknya sebenarnya membicarakan persoalan utang senilai Rp300 ribu. Karena Wardiah belum ada uang untuk melunasinya, dia minta penangguhan pembayaran. Namun hubungan itu dilakukannya berdua bukan didasari persoalan utang tersebut. Tetapi murni karena didasari rasa sukasama suka sudah cukup lama. Kakek AR mengaku sudah beristrikan delapan perempuan, namun semuanya meninggalkan dia, karena cemburu hubungannya dengan War. Ia mengaku kerap diminta bantu War dalam hal ekonomi. “Saya siap bertanggung jawab atas perkara ini. Apakah suaminya siap melepaskan War untuk saya. Saya terus terang saja suka sama dia,” aku AR lagi kepada Waspada. (b20)

BANDA ACEH (Waspada): Sekretaris Jenderal Lembaga Hukom Adat Laot/Panglima Laot Aceh, M. Adli Abdullah meminta aparat keamanan di laut proaktif mengawasi perairan dari penjarahan ikan oleh kapal-kapal asing. Pengawasan itu bagian dari melindungi sumber daya kelautan dan nelayan kecil yang mencari nafkah di laut. “Yang lebih penting lagi adalah mengawasi wilayah penggunaan alat tangkap sesuai batas-batas yang ditentukan dalam perizinannya,” tegas Adli Abdullah menanggapi keresahan nelayan pantai timur Aceh akibat merajalelanya puluhan kapal trawl asal Thailand yang tidak mampu dicegah masyarakat nelayan setempat. Penggunaan seperti alat tangkap trawl, sebut Aldi, sebenarnya dilarang undang-undang dan Panglima Laot Aceh juga telah menegaskan trawl itu haram digunakan di Aceh. Karena penggunaan alat tangkap tersebut bisa merusak sumber daya kelautan dan sangat merugikan masyarakat nelayan pesisir yang mencari nafkah dilaut. Untuk itu, pihaknya berharap pemerintah komit membela nelayan kecil dengan tidak memberikan izin penangkapan ikan menggunakan alat tangkap trawl. “Tapi karena alat tangkap trawl dilarang, alat tangkap itu diubah meski pada intinya sama sebagai akalanakalan untuk melegalkan alat tangkapnya,” ujar Adli kepada Waspada, Senin (28/9) di Banda Aceh. Menurutnya, kapal-kapal besar dengan alat tangkap seperti

trawl itu seharusnya melakukan penangkapan ikan ditengah laut atau dikawasan Zona Ekonomi Esklusif (ZEE). “Seharusnya mereka melakukan penangkapan di tengah laut bukan di kawasan pinggir pantai yang membuat nelayan kecil menjerit karena alat mereka disapu trawl,” tandasnya. Kenapa boat trawl itu memilih kawasan yang dekat dengan pantai? Menurut Adli, mereka lebih memilih ke pinggir karena di kawasan itu banyak udangnya. “Kalau di tengah laut tidak ada udang maka ketika patroli laut lengah mereka masuk kawasan yang banyak udang,” cetus Adli yang berharap aparat keamanan meningkatkan patrolinya untuk menghalau trawl tersebut. Sekjen Panglima Laot Aceh ini juga meminta Pemerintah Aceh dan Dinas Kelautan dan Perikanan untuk lebih tegas melindungi perairan Aceh dari jarahan kapal-kapal ikan asing. “Kita minta nelayan kecil itu dilindungi pemerintah, karena mereka memang nelayan miskin. Kalau yang mempunyai armada kapal-kapal besar itu memang pengusaha sudah kaya,” tutur Adli. Sebagaimana diberitakan, masyarakat nelayan di Aceh Timur resah karena aksi kapal-kapal trawl asal Thailand dikawasan itu semakin merajalela. Akibatnya para nelayan setempat mengaku rugi karena alat tangkap (rawe) mereka dilibas trwal. Nelayan setempat juga tidak berani mencegah kapal trawl tersebut karena mereka mempunyai izin dari Pemerintah RI.(b04)

Chikungunya Dekati ‘KLB’ ... pemerintah daerah melalui instansi terkait tengah mengintensifkan kembali aktivitas fogging atau pengasapan dikawasan yang rawan terserang penyakit berbahaya itu. “Pasca lebaran ini aktivitas Fogging kembali kita tingkatkan sebagai langkah awal mengantisipasi pencegahan penyakit Chikugunya,” katanya. Selain itu peningkatan sosialisasi terhadap pentingnya menjaga kebersihan lingkungan juga menjadi program pendampingan pencegahan penyakit Chikungunya. “Kesadaran masyarakat menjaga kebersihan masih sangat kurang sehingga kita masih tetap fokus mensosialisasikan gaya hidup sehat dengan menjaga kebersihan lingkungan,” katanya. Chikungunya penyakit berbahaya yang disebabkan nyamuk Aedes Aegepty. Penderita yang terserang ditandai demam panas tinggi dan kejang-kejang yang bisa menyebabkan kelumpuhan atau kematian.

Korban Badai Di Manila ... korban selamat kini menjadi prioritas perhatian terlebih dahulu. Jumlah korban masih terus bertambah. Stasiun radio DZBB memberitakan ditemukan 58 jenazah baru di Marikina. Sementara kepala desa Quezon juga menyatakan pihaknya menemukan 29 jenazah baru dan mendapati 108 warganya hilang. Jumlah ini belum dimasukkan ke perhitungan pihak pemerintah.(dtc)

Kursi Plt KPK Terancam ... Bila tidak ada bukti kuat, maka harus dicabut status tersangka keduanya sehingga tidak diperlukan lagi Plt pimpinan KPK. “Atau presiden membentuk independent inquiry untuk mengusut kemungkinan penyimpangan dalam kasus Chandra-Bibit,” paparnya. Meski demikian, Teten mengusulkan, yang masuk menjadi Plt KPK merupakan bekas pimpinan KPK periode pertama atau orang dalam KPK (deputi KPK). Langkah ini sebagai jalan moderat atas munculnya tudingan terhadap tas Perppu KPK sebagai upaya memasukkan figur titipan dari eksekutif maupun pihak-pihak tertentu. “Plt KPK baiknya memilih mantan pimpinan KPK atau figur dari tubuh KPK. Ini langkah moderat yang relatif aman, karena KPK harus diselamatkan selain kinerja juga citranya,” paparnya. Sementara terpisah mantan Wakil Ketua KPK Erry Hardjapamengkas menegaskan, kekhawatiran Teten Masduki atas kriminalisasi pimpinan KPK menjadi kekhawatiran banyak pihak. Karena logikanya, jika pimpinan KPK yang lama saja bisa dikriminalisasi oleh polisi, bagaimana dengan pimpinan KPK yang baru. “Polisi memperkarakan soal penerbitan surat cekal dan mencabut surat cekal itu merupakan kewenangan teknis,” tegasnya. Ketika ditanya apakah dirinya siap jika diminta menjadi Plt pimpinan KPK, Erry menegaskan, ia harus konsisten dengan sikapnya menolak Perppu dan turunannya. Tim Lima bentukan presiden, merupakan turunan dari Perppu tersebut. “Saya dalam posisi sulit, karena saya menolak Perppu maka juga menolak turunannya. Jika Tim Lima merekomendasikan saya, dan saya terima, maka saya tidak konsisten,” ujarnya. Terlepas dari itu, Erry menegaskan, kriminalisasi pimpinan KPK oleh Polri harus diselesaikan terlebih dahulu. “Intinya, harus diselesaikan terlebih dahulu soal kriminalisasi KPK oleh Polri,” cetusnya. Erry justru menilai, pihak-pihak yang menerima posisi Plt pimpinan KPK di tengah kondisi seperti saat ini justru merupakan sosok nekat. “Kalau paham, cerdas dan berpikir strategis, pasti akan berpikir ke arah sana (soal kriminalisasi KPK oleh Polri dan menolak Plt KPK, red),” tegasnya.

Bayi Makrosomia Diprediksi ... sarjana,” ujar OK Arya Zulkarnaen kepada sejumlah wartawan, saat membesuk bayi itu, Senin (28/9). Pemkab Batubara mengucapkan terima kasih kepada pihak RSU yang telah membantu persalinannya dengan selamat, dan tak lupa juga ucapan terimaksih kepada Pemkab Asahan yang telah ikut memperhatikan mereka, meskipun bayi tersebut bukan warga Asahan. “Terima kasih banyak atas segala perhatian segala pihak yang telah membantu ikut peduli dengan keadaan bayi dan orang tuanya ini,” ungkap OK Arya. OK Arya juga menyempatkan menamai bayi dengan nama Ilham Arya, dengan harap bayi ini menjadi ilham bagi Pemkab Batubara dalam melaksanakan pembangunan. “ Semoga saja orang tuanya setuju nama ini melekat di bayi yang membawa ilham bagi kabupaten yang baru berdiri ini,” ungkapnya. Sebelumnya, Bupati Asahan Risuddin telah menamai bayi itu Muhammad Akbar Risuddin, sehingga orang tuanya berencana menggabungkan dua nama. “Insya Allah kami akan namai anak ketiga ini dengan nama Muhammad Akbar Risuddin Ilham Ok Arya,” ungkap Hasnuddin didampingi Istri. Ikut mendampingi Bupati Batubara, Wakil Bupati Asahan Taufan Gama, Direktur RSU HAM dr Herwanto didampingi dr Binsar P Sitanggang SpOg, serta dr Alfian Nasution, SpA dan perwakilan dari Kodim 0208/AS. (csap)


Berita Utama

2

Chikungunya Dekati ‘KLB’ Di Aceh BANDA ACEH (Antara): Dinas Kesehatan Provinsi Aceh menyatakan kasus chikugunya di daerah itu mendekati kejadian luar biasa (KLB) ditandai meningkatnya kasus penyakit ini di kalangan masyarakat. “Tahun ini penderita chikungunya meningkat hingga 200 persen dari sebelumnya dan angka itu hampir masuk dalam kategori KLB,” kata Kepala Dinas Kesehatan Provinsi Aceh dr. Muhammad Thaib di Banda Aceh, Senin (28/9). Berdasarkan data Dinas Kesehatan Provinsi Aceh, hingga Agustus 2009 penderita chikungunya mencapai 3.355 ka-

sus di seluruh kabupaten/kota daerah itu. Angka tertinggi terdapat di Kab. Aceh Tamiang dengan jumlah 1.200 kasus, menyusul Kab. Aceh Timur dengan jumlah 1.100 kasus. Sementara Kab. Pidie Jaya tercatat 128 kasus, Lhokseumawe 212 kasus dan Aceh Utara 715 kasus. “Untuk dua kabupaten tersebut angkanya saja sudah sangat tinggi dan cukup memprihatinkan,” katanya. Kurangnya pengetahuan masyarakat terhadap penyakit tersebut menjadi faktor utama tingginya penderita chikungunya di Provinsi yang dilanda bencana alam gempa bumi

dan tsunami 26 Desember 2004 itu. “Selain rendahnya pengetahuan masyarakat tentang penyakit itu, juga kurang perhatian warga dalam menjaga kebersihan lingkungan sekitarnya,” katanya. Sebagai langkah antisipasi pemerintah daerah melalui instansi terkait tengah mengintensifkan kembali aktivitas fogging atau pengasapan di kawasan yang rawan terserang penyakit berbahaya itu. “Pasca lebaran ini aktivitas fogging kembali kita tingkatkan sebagai langkah awal mengantisipasi pencegahan penyakit chikugunya,” katanya.

Selain itu peningkatan sosialisasi terhadap pentingnya menjaga kebersihan lingkungan juga menjadi program pendampingan pencegahan penyakit chikungunya. “Kesadaran masyarakat menjaga kebersihan masih sangat kurang sehingga kita masih tetap fokus mensosialisasikan gaya hidup sehat dengan menjaga kebersihan lingkungan,” katanya. Chikungunya penyakit berbahaya yang disebabkan nyamuk Aedes Aegepty. Penderita yang terserang ditandai demam panas tinggi dan kejangkejang yang bisa menyebabkan kelumpuhan atau kematian.

Tujuh Desa Korban Banjir Bandang Madina Harus Direlokasi MEDAN (Waspada): Hingga kemarin, tim Reserse dan intelijen Poldasu yang diturunkan untuk melakukan penyelidikan penyebab banjir bandang di Madina masih bekerja. Dari hasil sementara menyebutkan banjir bandang disebabkan bencana alam. Kabid Humas Poldasu Kombes Pol. Baharudin Djafar menyebutkan, alasan sementara banjir bandang disebabkan bencana alam, karena faktanya banyak ditemukan pohon beserta akarnya tercabut dari tanah. “ Dari fakta yang dilaporkan tim di lapangan mengatakan di sepanjang sungai terda-

pat pohon yang akar-akarnya tercabut dari tanah. Ini membuktikan banjir bandang bukan akibat perambahan hutan ataupun pengalihan hutan menjadi areal perkebunan. Selain itu, warga yang bermukim disana juga membangun rumahnya di sepanjang bantaran sungai yang membahayakan jiwa mereka,” ujarnya kepada wartawan, Senin (28/9). Namun kata Baharudin, keterangan itu masih hasil pengamatan tim di lapangan. “Untuk memastikan kebenarannya, harus ada pernyataan dari Dinas Kehutanan dan Dinas Pemukiman,” kata dia.

Selain itu, ada tujuh desa di Muara Batang Gadis yang rawan longsor. Karenanya, penduduk di tujuh desa di Kec. Muara Batang Gadis harus segera direlokasi. “Apalagi lokasi bencana masih rawan longsor. Karena di lereng pegunungan sudah terjadi pengikisan tanah, sehingga hujan bisa menyebabkan longsor dan banjir.” Dari tujuh desa yang segera direlokasi kata Baharudin, terdapat dua desa yang mengalami rusak parah yakni, desa Rantau Panjang dan Desa Hutaimbaru. Soal pernyataan Kapoldasu Irjen Pol Badrodin Haiti beberapa waktu lalu terkait ada-

nya dugaan tiga perusahaan yang menggunakan hak penguasaan hutan (HPH), Baharudin belum bisa memastikannya. “Kalau masalah itu saya belum tahu. Yang pasti hasil sementara dari tim peneliti di lapangan banjir bandang di Madina dikarenakan bencana alam,” kata dia. Dia menjelaskan, dari hasil penelitian menyebutkan bahwa lokasi bencana sudah mulai bisa ditempuh, namun belum bisa digunakan personel memberikan bantuan kepada para korban. “Bantuan sampai saat ini masih didistribusikan melalui jalur sungai,” katanya. (m11)

Ketua MPR Setuju Kabareskrim Dinonaktifkan JAKARTA (Antara): Ketua MPR Hidayat Nurwahid menyatakan setuju apabila Kabareskrim Mabes Polri Komjen Pol. Susno Duaji dinonaktifkan demi tuntasnya dugaan persoalan hukum yang melilit dirinya. “Saya kira wajar saja jika hal itu (penonaktifan) dipertimbangkan supaya sekali lagi Pak Susno bisa berkonsentrasi terkait masalah ini,” ujar Hidayat kepada pers seusai bersilaturahmi dengan kalangan pers di Gedung MPR/DPR Jakarta, Senin(28/9). Hidayat menegaskan hal itu terkait menguatnya desakan dari berbagai kalangan ke-

pada Kapolri untuk menonaktifkan Kabareskrim karena diduga terlibat dalam kasus pengucuran sejumlah uang ke Bank Century, sesuai keterangan yang diberikan KPK beberapa waktu sebelumnya. Menurut Hidayat, apabila dugaan keterlibatan dalam persoalan hukum itu bisa dijernihkan maka segala persoalan bisa selesai dan yang bersangkutan juga bisa kembali aktif. Jadi, Hidayat menegaskan, tuntutan sejumlah kalangan agar Susno Duaji dinonaktifkan adalah satu hal yang sangat wajar. Ia mengungkapkan harapannya agar proses hukum

yang sedang dijalankan Bareskrim Mabes Polri terhadap dua anggota KPK yakni Bibit Samad Riyanto dan Chandra Hamzah dalam kasus penyalahgunaan wewenang, tidak dilatari dengan adanya konflik kepentingan. Apabila motif penegakkan hukum yang saat ini dilakukan Mabes Polri terhadap dua anggota KPK itu dilatari oleh persaingan antara dua lembaga hukum tersebut, maka hal itu akan berdampak pada matinya tindakan pemberantasan hukum di Indonesia. “Kalau itu yang terjadi, saya khawatir yang tertawa terbahak-bahak adalah para ko-

ruptor atau mereka yang berkonspirasi untuk mematikan semangat pemberantasan korupsi di Indonesia,” ujarnya. Oleh karena itu, Hidayat mengingatkan Polri agar bertindak secara profesional dalam menjalankan proses penegakkan hukum. Polri harus mampu memberikan buktibukti yang kuat jika merasa yakin bahwa dua pimpinan KPK tersebut telah menyalahi prosedur hukum. “Tapi siapapun tidak boleh dihukum hanya karena rumor atau dalam rangka stigmatisasi yang melemahkan pemberantasan korupsi,” demikian Ketua MPR.

Tak Beri Layanan Baik, Rumah Sakit Bisa Dituntut JAKARTA (Waspada): Parlemen lewat paripurna Dewan Perwakilan Rakyat RI mengesahkan Rancangan UndangUndang Rumah Sakit (RUU RS), Senin (28/9). Untuk pertama kalinya Indonesia mempunyai Undang-Undang Rumah Sakit. Menteri Kesehatan RI Siti Fadilah Supari mengatakan, dengan adanya undang-undang tersebut pemerintah dapat lebih mengawasi rumah sakit demi perlindungan kepada masyarakat. Dalam perundangan tersebut diatur hak dan kewajiban rumah sakit

serta pasien. Kalau terjadi pelanggaran akan ada sanksinya, ujarnya. Lebih rinci dalam perundangan itu disebutkan, pasien berhak memeroleh layanan yang manusiawai, adil, jujur dan tanpa diskriminasi. Pasien juga berhak mengajukan pengaduan atau kualitas pelayanan yang didapatkan. Bahkan, menggugat dan menuntut rumah sakit apabila rumah sakit diduga memberikan pelayanan tidak sesuai standar baik secara pidana maupun perdata. Termasuk, mengeluhkan pelayanan ruamh sakit

yang tidak sesuai standar pelayanan melalui media cetak dan elek tronik. Terdapat 20 kewajiban rumah sakit dan diantaranya ditegaskan rumah sakit melaksanakan fungsi sosial antara lain dengan memberikan fasilitas pelayanan pasien tidak mampu atau miskin, pelayanan gawat darurat tanpa uang muka, ambulan gratis , pelayanan korban bencana alam, kejadian luar biasa atau bakti sosial bagi misi kemanusiaan. Kewajiban rumah sakit lainnya mulai dari memberikan informasi yang benar tentang

rumah sakit kepada pasien, menghormati hak pasien dan melindungi para pekerja kesehatan di rumah sakit tersebut. Pelanggaran atas seluruh kewajiban tersebut dikenakan sanksi administratif mulai dari teguran, teguran tertulis atau denda hingga pencabutan izin rumah sakit. Dalam perundangan tersebut, menteri menetapkan pola tarif nasional rumah sakit pemerintah. Pola tarif nasional menjadi pedoman dasar yang berlaku secara nasional dalam pengaturan besaran tarif rumah sakit. (kps)

DPR: Kasus Bank ...

rikan lagi laporan-laporan berikutnya, termasuk aliran-aliran dana yang terjadi di bank bermasalah itu. “Dan sekali lagi saya tak bisa mengungkapkan isi dari laporan awal tersebut karena ini baru bagian pertama, masih ada jilid-jilid berikutnya,” katanya. Namun demikian, Agung yang juga Wakil Ketua Umum DPP Partai Golkar itu menegaskan, DPR mengapresiasi BPK yang telah menunjukkan komitmennya menjawab permintaan DPR untuk melaku-

kan audit investigatif atas kasus itu dan kemudian melaporkan hasilnya sebelum selesainya masa bakti keanggotaan DPR saat ini. Menurut Agung, DPR dan juga masyarakat telah menunggu bagaimana kasus itu sehingga laporan BPK tersebut bisa lebih membuka persoalan yang sesungguhnya. Karena itu pula, Agung berharap agar tidak saja DPR periode saat ini yang memberikan perhatian penuh, tetapi juga DPR periode mendatang yang diharapkan meneruskan

pengawasan dan penuntasan kasus itu, apakah dengan membentuk pansus atau menjadi bagian dari hak angket. Sementara mengenai kemungkinan adanya tindak pidana dalam kasus tersebut, Agung menegaskan, apabila ditemukan indikasi itu, maka semuanya harus ditindaklanjuti atau harus ada dugaan-dugaan pidana yang diproses secara hukum. “Tentu siapapun yang terkena, betul-betul harus diproses dan saya minta tak ada politisasi di sini. Tidak boleh ada diskriminasi,” katanya.

memang harus ada koordinasi terlebih dahulu,” ujarnya. “Tapi kalau Mbak Yanti pernah bilang pada saya, kalau dia ingin hadir pada persidangan karena ini sangat penting dalam kehidupan dia selama 13 tahun pernikahan bersama Anang,” lanjut Elsie. Menanggapi soal gugatan yang dilayangkan KD, Elsie menegaskan hal tersebut bukanlah hal yang penting. Sebab, keduanya sudah sepakat bercerai. “Sebelum adanya gugatan ini, mereka sudah adakan pertemuan dan sepakat guga-

tannya atas nama Krisdayanti,” ujar Elsie. Secara Islam, status hubungan suami istri Anang dan KD sudah berakhir, setelah Anang sempat menjatuhkan talak kepada ibu dari Auriel ,12, dan Azriel ,10, itu. Jatuhnya talak disebut-sebut lantaran KD lagi-lagi dituding main serong dengan pria lain. KD disebutsebut punya hubungan istimewa dengan salah satu pengusaha asal Timor Leste, yang kerap disapa Yanti dengan nama Amor (cinta-red). Namun hal tersebut sempat dibantah KD dalam sebuah jumpa pers di hadapan wartawan. PA:Tak Bisa Sekali Sidang Pengadilan Agama Jakarta Selatan telah menentukan jadwal sidang pertama gugatan cerai Krisdayanti terhadap Anang Hermansyah. Sidang tersebut akan diadakan pada 8 Oktober mendatang dan dipimpin oleh drs Pahlawan Harahap, SH, selaku Ketua Majelis Hakim. “Materi gugatan tidak bisa dijelaskan, karena sifatnya rahasia. Kami tidak berhak memberitahukan kepada publik, walaupun di luar sana sudah ada berita yang beredar mengenai perceraian me-

reka,” kata drs Harum Rendeng, SH, MH, selaku Humas PA Jaksel, Senin (28/9). Selain itu, Harum menerangkan, meskipun sudah ada kesepakatan Anang-KD di luar sidang untuk bercerai, pihak manapun tidak bisa meminta sidang untuk diadakan sekali saja atau sekian kali saja. Lanjutnya, sidang digelar sesuai proses pengadilan yang berjalan. “Kalau ada permintaan persidangan, ada hukum acaranya. Jadi, ada tahapan yang harus dilalui dan tidak ada permintaan untuk melangsungkan sidang satu kali,” terangnya lagi. “Jadi, sidang ditempuh dengan cara yang sama, yaitu melalui mediasi dan pemeriksaan lainnya,” sambungnya. Asal tahu saja, dalam sebuah kesempatan beberapa waktu lalu di Jakarta, Anang menyampaikan kepada para peliput bahwa ia ingin sidang digelar satu kali saja. Kata Harum lagi, hak asuh atas kedua anak mereka, Aurel dan Azriel, akan diatur oleh pengadilan. “Tidak ada yang katakan kuat atau lemah, karena kalau sudah diajukan ke pengadilan pasti ada satu pihak yang dirugikan atau diuntungkan. (kps)

Ketua DPR juga masih perlu meminta pandangan pimpinan fraksi-fraksi DPR, karena laporan awal audit BPK itu baru bagian awal dan juga apakah harus diumukan kepada publik atau tidak karena ada pula catatan BPK yang harus diperhatikan terkait kerahasiaan yang mencakup subtansi laporan. Ia menambahkan bahwa laporan yang saat itu diterimanya masih tahap awal dan BPK telah berjanji akan membe-

KD Layangkan ... Sementara itu, Elsie Lontoh, kuasa hukum KD yang dihubungi melalui telepon genggamnya mengatakan, pihaknya tengah mengusahakan proses persidangan hanya satu kali sidang saja, “karena sudah ada kesepakatan bercerai di antara keduanya,” katanya. Elsie belum bisa menjamin apakah dalam persidangan ke depan keduanya akan hadir atau tidak. “Kalau untuk menghadirkan kedua belah pihak dalam persidangan nanti

ICW Hadiahi DPR ... “Masukan masyarakat selama ini tidak didengarkan. Sejauh yang kita catat, DPR ngotot mengesahkan RUU Pengadilan Tipikor. BK sebagai garda terdepan citra DPR harus bertindak agar tidak ada tindakan-tindakan yang merugikan citra DPR,” ujar Emerson saat menyerahkan korek kuping raksasa tersebut. Menerima “hadiah istimewa” itu, Irsyad tampak tersenyum. Ia mengatakan, DPR tidak tersinggung menerima hadiah tersebut. “Walaupun

bingung juga, korek kupingnya sebesar ini, kupingnya sebesar apa ya?” katanya sambil tertawa. Ia menyadari bahwa masing-masing elemen masyarakat punya cara masing-masing dalam menyampaikan aspirasinya. “Korek kuping itu kan hanya simbol, seni dari berkomunikasi. Wajar saja, ICW atau lembaga masyarakat lain mengomunikasikan dengan caranya. Mereka meminta kepekaan DPR dalam mendengarkan aspirasi masyarakat,” ujar Irsyad. (kps)

WASPADA

Selasa 29 September 2009

Nama Bayi ‘Raksasa’ Bertambah KISARAN (Waspada): Nama bayi makrosomia (besar) yang semula Muhammad Akbar Risuddin Ilham, kini bertambah menjadi Muhammad Akbar Risuddin Ilham OK Arya. Nama terakhir adalah nama Bupati Batubara OK Arya Zulkarnaen. Kedua orangtua bayi tersebut bertempat tinggal di kawasan Limapuluh yang masih masuk wilayah Kabupaten Batubara. Sedangkan kondisi bayi terus mendapat perawat tim medis RSU H Abdul Manan Simatupang (HAMS) Kisaran, sehingga diprediksi akan tinggal lama di RSU setempat. “ Sebelum penelitian selesai, bayi makrosomia belum diizinkan pulang,” jelas Direktur RSU HAM dr Herwanto, SpB melalui Dokter Spesialis Anak dr Alfian Nasution, SpA dikonfirmasi Waspada, Senin (28/9). Menurutnya, penelitian bayi itu akan bekerja sama dengan Ikatan Dokter Anak Indonesia (IDAI) Jakarta, sehingga diperlukan waktu untuk itu. “ Masalah bayi ini sudah sampai ke Menteri Kesehatan, sehingga bayi ini mendapat perhatian khusus dari IDAI,” jelas Alfian. Namun, Alfian, belum tahu. Pihak RSU HAMS masih menunggu info dari Jakarta, dan dalam waktu dekat ini mereka akan datang ke Kota Kisaran. Sampai saat ini, kata Alfian, bayi dalam keadaan sehat dan normal, dan belum ada tanda-tanda adanya penyakit yang menyertainya. “ Semua organ tubuhnya berjalan dengan normal,” jelas Alfian. Senada dengan hal itu, dr Binsar P Sitanggang, SpOg menjelaskan, kondisi ibu bayi sehat dan normal. “ Alhamdulillah, ibu bayi dalam keadaan sehat wal afiat, namun belum boleh pulang, karena luka bekas operasi belum sembuh total,” jelas

Chandra Dan Bibit ... jalani. “Nggak tahu,” kata Bibit singkat. “Silahkan tanya penyidik,” tambah Chandra. Laporkan Kabareskrim Usai wajib lapor, bersama pengacaranya, Chandra dan Bibit memasuki ruangan Irwasum untuk melaporkan Susno Duadji. “Kita melaporkan dugaan penyalahgunaan kekuasaan dan kewenangan dengan menetapkan tersangka melanggar peraturan pemerintah No. 2 tahun 2002. Disana ada rekayasa penyidikan yang bukan wewenangnya,” kata Ahmad Rifai, tim pengacara Chandra dan Bibit. Diakatakannya, penyidikan kepada Bibit dan Chandra tidak berdasarkan kepentingan hukum dan dinilai melanggar Pasal 19 UU kepolisian serta Pasal 4 KUHP. “Karenannya kami mendesak Irwasum melakukan sidang disiplin dan kode etik terhadap Susno, karena memeriksa berdasarkan testimoni tanpa bukti kuat menjadikan Chandra dan Bibit sebagai tersangka. Polisi seharusnya melakukan penyidikan, bukan memaksakan. Apalagi pengacara Antasari mengatakan

Satu Orang Dalam ... Diserahkan Pada Presiden Kamis Daftar nama calon pelaksana tugas Pimpinan KPK akan diserahkan Tim 5 kepada Presiden Susilo Bambang Yudhoyono, Kamis (1/10). Tim 5 pun saat ini telah mengantongi 10 nama yang akan direkomendasikan untuk menggantikan Chandra M Hamzah dan Bibit Samad Riyanto untuk sementara. Anggota Tim 5 Todung Mulya Lubis mengaku, saat ini Tim 5 telah mengerucutkan nama yang akan direkomendasikan tersebut. “Nama sudah mulai mengerucut. Tidak lebih dari 10, tapi kan nama terus bermunculan dan kita juga masih menunggu jawaban dari mereka (apakah menerima dicalonkan atau tidak),” kata Todung di Kantor Dewan Pertimbangan Presiden, Jakarta, Senin (28/9). Meski begitu, Todung mengaku belum bisa menyebutkan nama-nama yang akan

Ketsana Berpeluang ... mengarah kepada kita bahkan menjauh dari Sumut, namun Senin, sudah ada gejala arah angin bakal berhembus ke daerah ini,” kata Firman, Kepala Data dan Informasi (Datin) BMKG Wilayah I Stasiun Bandara Polonia Medan kepada Waspada, Senin (28/9). Begitupun Firman menilai, kawasan Sumatera Utara aman terhindar dari bencana alam itu, karena arah angin berputar ke wilayah lain, tidak mengarah ke Sumatera Utara. “Yang namanya arah angin bisa saja setiap jam berubahubah dan ternyata peluang badai itu untuk Sumatera Utara cukup besar,” ujarnya. Menurut Firman, di Laut China Selatan yang berdekatan dengan Filipina saat ini ter-

testimoni dibuat karena ada paksaan,” ujarnya. Wapres Minta Kapolri Tuntaskan Wakil Presiden Jusuf Kalla (JK) meninta Kapolri Jenderal (Pol) Bambang Hendarso Danuri secepatnya menuntaskan pemeriksaan atas dua pimpinan KPK Bibit Samad Riyanto dan Chandra M Hamzah dan kejelasan status mereka. “Saya kira polisi akan sanggup menuntaskan status hukum dua pimpinan KPK dalam waktu seminggu. Tadi saya minta untuk segera dituntaskan dan Polri bisa memenuhi itu dalam waktu seminggu. Jadi kira-kira minggu depanlah statusnya jelas,” kata Wapres kepada wartawan seusai mengadakan pembicaraan dengan Kapolri di ruang kerja Wapres di Istana Wakil Presiden, di Jakarta, Senin (28/9). Kapolri Jenderal (Pol) Bambang Hendarso Danuri menyatakan proses pemeriksaan akan dituntaskan apabila tindak pidananya terbukti dan proses hukum berlanjut. Sebaliknya, jika tidak terbukti, Polri akan mengeluarkan Surat Perintah Penghentian Penyidikan (SP3). (j02/kps) direkomendasikan oleh Tim 5. Ia juga mengatakan, latar belakang calon bisa berasal dari lingkungan mana saja, termasuk internal KPK sendiri. “Bisa jadi dari internal KPK,” katanya. Dijamin Tak Ada Titipan Presiden Tudong menepis keraguan akan nama-nama yang nanti menjabat sarat dengan intervensi presiden. Dijamin Tim 5 independen. “Tidak ada titipan Presiden. Kita tidak melihat Pak Widodo (Menko Polhukam) dan Pak Andi (Menkum HAM) bawa titipan,” kata Todung. Menurut Todung, semua nama calon murni ditentukan Tim 5. “Ya kita mencari yang independen dan mempunyai integritas,” tambahnya. Dalam mencari calon ini, Todung menyebut, ada sejumlah calon yang mengirim SMS dan surat bersedia untuk menjadi Plt pimpinan KPK. Namun tentunya semuanya harus diseleksi. (kps/dtc) jadi pemanasan suhu permukaan laut luar biasa akibat adanya tekanan rendah. Misalnya, Minggu (27/9), lanjutnya, kondisi pumpunan awan dari Sumatera Utara dan Medan pada umumnya malah tersedot ke kawasan Manila menyebabkan curah hujan berkurang di daerah ini. “Kalaupun ada hanya hujan-hujan lokal.” Awan menjulang tinggi seperti awan cumulonimbus (CB) lebih banyak tersedot ke kawasan badai Ketsana Filipina “Inilah perlu diwaspadai dan meningkatkan kewaspadaan masyarakat Sumut khususnya Medan, sehingga masyarakat terhindar dari bencana alam seperti di Manila,” ujarnya. Dalam dua hari belakangan ini, sesuai data BMKG, curah hujan berkurang di kawasan Sumatera Utara karena pumpu-

Motifnya Sang Anak ... atau kurang diperhatikan dalam keluarga. “Lagian saya melihat orang punya mobil mewah, kenapa orang tua saya yang punya segala-galanya tidak mau memberi saya mobil,” katanya. Selain permintaannya terhadap orang tua yang selalu gagal, Khaidir mengaku, sebelumnya pernah dijanjikan orangtuanya dibelikan mobil dan diberi uang banyak, namun janji itu dianggap diingkari sang orang tua. Karena dianggap orangtuanya telah mempermainkannya, Khaidir pun membuat skenario. Beberapa temannya diajak ikut dalam mendapatkan uang ayahnya yang nilainya mencapai ratusan juta. Keterangan lain dari Khaidir, selama dia hilang selalu berusaha untuk mendapatkan uang dengan melakukan kontak langsung via telefon dengan keluarga. Meski bukan dia yang menelefon karena takut ketahuan, semua ide, termasuk ancaman bunuh, diciptakan untuk memperoleh uang. Selama tujuh hari sejak hari pertama hilang, Khaidir mengaku berada di Kota Lhokseumawe. Karena orangtuanya ingin memberi uang tebusan, Khaidir dengan menggunakan sepeda motor pulang ke Aceh Timur

Sitanggang.

Bupati Batubara Janji Perhatikan Sementara itu, Bupati Batubara OK Arya Zulkarnaen berjanji memperhatikan bayi itu dengan memberi bantuan biaya pendidikan hingga ke perguruan tinggi. “ Pemkab Batubara akan menanggung biaya pendidikan bayi ini hingga sarjana,” ujar OK Arya Zulkarnaen kepada sejumlah wartawan, saat membesuk bayi itu, Senin (28/9). Pemkab Batubara mengucapkan terima kasih kepada pihak RSU HAMS yang telah membantu persalinannya dengan selamat, dan tak lupa ucapan terimaksih kepada Pemkab Asahan yang telah ikut memperhatikan mereka, meskipun bayi tersebut bukan warga Asahan. Pada saat itu, OK Arya menyempatkan menamai bayi dengan nama Ilham Arya, dengan harapan bayi ini menjadi ilham bagi Pemkab Batubara dalam melaksanakan pembangunan. “ Semoga saja orang tuanya setuju nama ini melekat di bayi yang membawa ilham bagi kabupaten yang baru berdiri ini,” ungkapnya. Sebelumnya, Bupati Asahan Risuddin telah menamai bayi tersebut Muhammad Akbar Risuddin, sehingga orang tuanya berencana menggabungkan dua nama. “ Insya Allah kami akan namai anak ketiga ini dengan nama Muhammad Akbar Risuddin Ilham Ok Arya,” ungkap Hasanuddin didampingi Istri. Ikut mendampingi Bupati Batubara, Wakil Bupati Asahan Taufan Gama, Direktur RSU HAM dr Herwanto didampingi dr Binsar P Sitanggang SpOg, serta dr Alfian Nasution, SpA dan perwakilan dari Kodim 0208/AS. (csap)

7.250 Paspor Haji ... menunggu tiba waktu shalat Asar dan secara berturut-turut Maghrib dan Isya. Kalau soal makan, katanya, tidak perlu khawatir karena banyak kantin di sekitar Masjidil Haram, dan bahkan ada rumah makannya. Sedangkan informasi mengenai angkutan pada pukul 05:00 sampai pukul 22:00 waktu Arab Saudi panitia menyediakan bus gratis bagi para jemaah haji pulang pergi dari maktab ke Masjidil Haram. Dikirim Ke Jakarta Sementara itu sebanyak 7.250 paspor jamaah calon haji (calhaj) tahun 1430 H/2009 M asal Sumut sudah dikirim ke Jakarta untuk pembuatan visa, selebihnya 766 masih akan menyusul. Kabid Haji dan Wakaf Kanwil Departemen Agama Sumatera Utara (Depagsu) Abdul Rahman Harahap menyebutkan hal itu kepada Waspada di Medan, Senin (28/9), sebagai tahap proses persiapan pemberangkatan jamaah haji asal Sumut ke Makkah, Arab Saudi. Menurut Harahap, dari jumlah paspor yang sudah dikirim sebanyak 4.100 sudah berada di Sumut. Untuk mengambil sisanya, Depagsu menunggu informasi dari Jakarta. Sebagaimana rencana, lanjutnya, pihak Depagsu akan berangkat ke Jakarta untuk mengambil sisa yang sudah divisa sekaligus mengantarkan sisa paspor yang belum akan divisa. “Kita sedang menunggu 10 paspor asal Labuhanbatu untuk sekaligus dibawa ke Jakarta,” ujarnya. Harahap menyebutkan, proses pembuatan paspor haji yang berubah dari coklat menjadi hijau di Sumut berjalan lancar dan tidak ada kendala signifikan. “Kini soal pembuatan paspor sudah rampung.”. Sesuai rencana, Depagsu akan melaksanakan pembagian kelompok terbang (qur’ah) pada Oktober 2009 setelah dilakukannya qur’ah makhtab di Jakarta pada 29 dan 30 September 2009. Pelaksanaan qur’ah akan dihadiri para pimpinan Kelompok Bimbingan Ibadah Haji (KBIH), Kakandepag se Sumut, Pengadilan Agama (PA), pihak penerbangan, Dinas Kesejatan, Majelis Ulama Indonesia. Diperkirakan Sumut masih tetap akan memberangkatkan 18 kloter dengan dua gelombang penerbangan. Gelombang pertama langsung ke Madinah dan gelombang ke dua di Bandara King Abdul Azis, Jeddah, untuk selanjutnya jamaah langsung menuju Makkah. Menyinggung soal kesehatan, menuurt Harahap, pemeriksaan dilakukan di masing-masing kabupaten/kota sehingga pihak Depagsu sulit untuk mengomentarinya. Namun, dia berharap para jamaah sudah harus menjaga kesehatan dengan baik seperti berolah raga serta mengonsumsi makanan bergizi.(mch/m14)

DPD Tolak ... sarat kepentingan di luar hukum. Sebelumnya, sejumlah kalangan menolak Perppu penunjukan pelaksana tugas pimpinan KPK. Penolakan itu muncul dalam rangkuman diskusi bertema penyelamatan KPK dan perlawanan terhadap korupsi yang diadakan oleh Inside Forum di Jakarta, Senin. Ketua Pusat Kajian Antikorupsi Universitas Gajah Mada (UGM), Zainal Arifin Mochtar menganggap Perppu yang dikeluarkan oleh presiden tersebut tidak sejalan dengan amanat reformasi. Menurut Zainal, bagaimanapun, Perppu tersebut memberi kewenangan kepada presiden untuk menunjuk pelaksana tugas pimpinan KPK melalui tim penyeleksi. Hal itu bisa menyebabkan independensi KPK terganggu karena lembaga tersebut dipimpin oleh orang yang ditunjuk oleh penguasa. Perppu adalah alat kelengkapan luar biasa yang dimiliki oleh presiden. Menurut Zainal, alat kelengkapan itu seharusnya tidak digunakan dengan sembarangan. “Kalau diobral seperti ini rasanya kurang sedap,” kata Zainal. Sementara itu, Koordinator Indonesia CorruptionWatch (ICW) Danang Widoyoko menegaskan, seharusnya presiden mengutamakan evaluasi terhadap proses hukum di kepolisian karena publik menduga bahwa proses itu sarat konflik kepentingan. nan awan tersedot ke kawasan Manila. Bahkan prakiraan ke depan, pumpunan awan meningkat lagi di Sumatera Utara akibat tarikan angin ke sana semakin melemah. Akibatnya, curah hujan akan semakin meningkat lagi, baik kawasan pesisir timur maupun pesisir barat Sumatera Utara. Sebagaimana pemberitaan Waspada, Senin, sedikitnya 83 orang tewas, 23 orang hilang dan lebih dari 250 ribu orang mengungsi ketika badai Ketsana menghantam Kota Manila dan 25 provinsi lainnya, Sabtu hingga Minggu (27/9). Belum Ada WNI Jadi Korban Badai Di Manila Jumlah korban tewas akibat badai yang memicu banjir bandang yang melanda ibukota Filipina, Manila, terus ber-

tambah. Data terakhir tidak ada warga negara Indonesia (WNI) yang menjadi korban. “Menurut staf KBRI di Manila hingga saat ini belum ada WNI,” kata Direktur Perlindungan WNI, Teguh Wardoyo melalui telefon, Senin (28/9). Diketahui data terakhir korban tewas akibat bencana ini mencapai 100 orang dan 32 lainnya hilang. Pemerintah Filipina menyatakan, pihaknya kesulitan menanggulangi musibah banjir besar yang menggenangi 80% area Manila. Jumlah warga yang mengungsi akibat air bah tersebut pun meningkat hingga 451.000 jiwa. Ancaman wabah penyakit dan penyediaan bantuan bagi korban selamat kini menjadi prioritas perhatian terlebih dahulu oleh pemerintah setempat. (m32/dtc)

dan menetap di rumah familinya di Kec. Peudawa. Selama di Peudawa, Khaidir selalu keluar masuk dan mondar-mandir di jalan raya, apalagi pada malam Lebaran Idul Fitri. Tetapi Khaidir mengaku takut ketika mengetahui kasus itu telah dilaporkan ke polisi. Dengan sandiwara, Khaidir melukai badannya untuk meyakinkan polisi jika suatu saat perlakuannya terbongkar. Pengakuan Khaidir, luka di pergelangan tangannya merupakan hasil goresan dirinya sendiri. Hal ini dilakukan untuk meyakinkan polisi dan orangtuanya setelah ia ‘lepas’ dari tangan penculik setelah ditebus Rp25 juta. Ternyata drama rekayasa itu terkuak setelah sejumlah nama pelaku berhasil dikantongi petugas berdasarkan pengakuan Khaidir. Selain Khaidir yang kini dalam proses penyelidikan, polisi juga akan memburu empat pelaku lainnya. Ke empatnya adalah sepupu korban sendiri. Usai orang tua Khaidir menyerahkan uang Rp25 juta yang diantar langsung ke salah satu titik di Aceh Timur, Selasa (22/ 9) sore, keesokan harinya, Rabu (23/9) sekira pukul 20:00, Khaidir pun ditemukan di depan MTsN Idi. Muhammad H. Ihsak


3

Luar Negeri

WASPADA Selasa 29 September 2009

Jordania Dengan Keras Mengutuk Penerobosan Israel Ke Al-Aqsha AMMAN, Jordania (Antara/Xinhua-OANA) : Pemerintah Jordania dengan keras mencela penerobosan ke tempat suci Muslim, Masjid Al-Aqsha, oleh tentara Israel bersama sekelompok orang Yahudi radikal, yang mengakibatkan beberapa orang Palestina menjadi cedera demikian laporan kantor berita resmi Jordania, Petra. “Jordania mengutuk penerobosan ke dalam masjid oleh tentara Israel karena ini adalah tindakan provokatif yang tampaknya meningkatkan ketegangan,” kata Menteri Negara Urusan Komunikasi dan Media Jordania Nabil Sharif dalam satu pernyataan Minggu (27/9). Nabil Sharif mengatakan penerobosan ke dalam masjid suci tersebut tampaknya mengakibatkan kerusuhan lebih lanjut dan mengancam keamanan serta kestabilan di wilayah itu. Ia menyatakan Jordania menolak setiap

upaya oleh tentara Israel yang melanggar kesucian Masjid Al-Aqsha dan tempat suci di Jerusalem karena kesucian itu dijamin oleh konvensi, hukum dan resolusi internasional, yang melindungi semua tempat suci dari pelanggaran apa pun. Ahad pagi, bentrokan terjadi antara orang Palestina di bagian timur Jerusalem dan polisi Israel saat sekelompok orang Yahudi radikal menerobos ke halaman Masjid Al-Aqsha, tempat suci ketiga umat Muslim. Sebanyak 16 orang Palestina dan beberapa polisi Israel cedera dalam bentrokan tersebut, demikian laporan media. Sharif mengatakan penerobosan ke halaman masjid itu memicu kerusuhan pada saat berbagai upaya internasional meningkat untuk meluncurkan perundingan perdamaian Palestina-Israel.

Sudan Kecam Larangan Perjalanan AS Atas Politisi KHARTOUM, Sudan (Antara/XinhuaOANA) : Partai Kongres Nasional (NCP), yang berkuasa di Sudan mengecam keputusan pemerintah AS untuk memberlakukan larangan perjalanan buat pemimpin politik di Sudan, Kenya dan Zimbabwe. “Keputusan ini jelas menunjukkan bahwa pemerintah saat ini Presiden AS Barack Obama mengikuti langkah yang sama dengan pemerintah sebelumnya presiden George W. Bush,” kata Sekretaris Politik NCP Mohamed Mandour Al Mahdi Minggu (27/9). “Pemerintah AS ingin menekan Sudan melalui cara baru,” tambahnya. AP

Foto rilis dari Iran Fars News Agency memperlihatkan misil Revolutionary Guard sedang diluncurkan dalam sebuah pelatihan di dekat kota Qom, Teheran selatan, Minggu (27/9).

Iran Lakukan Ujicoba Rudal Tahap Tiga TEHERAN, Iran (AP): Iran mengatakan negaranya berhasil mengujicoba rudal jarak jauh Senin (28/9), senjata tersebut mampu membawa hulu ledak dan menyerang Israel, pangkalan militer AS di Timur Tengah dan beberapa bagian Eropa. Televisi negara mengatakan Garda Revolusioner, yang menguasai program rudal Iran,

berhasil mengujicoba rudal jarak sedang Shahab-3 dan Sajjil yang bisa menempuh jarak 2.000 km. Ujicoba tersebut merupakan tahap ketiga dalam latihan dua hari yang dilakukan Garda Revolusioner itu. Rudal Sajjil-2 merupakan rudal dua tahap yang paling canggih milik Iran dan diperkuat dengan bahan bakar padat sementara Shahab-3 menggunakan gabungan antara bahan bakar padat dan cair dalam bentuk paling canggih. Bahan bakar padat dipandang sebagai kemajuan teknologi dalam program rudal karena bahan bakar padat meningkatkan ketepatan rudal dalam mencapai sasaran.

Latihan perang itu dilakukan di saat Iran mendapat tekanan keras dari internasional untuk menghentikan kegiatan nuklirnya. Latihan tersebut dimulai Minggu, dua hari setelah AS dan sekutunya mengungkap bahwa Iran secara diamdiam membangun fasilitas pengayaan uranium bawah tanah dan mengingatkan negara itu untuk membuka tempat tersebut bagi pemeriksaan internasional atau akan menghadapi sanksi yang lebih keras. Jenderal Hossein Salami, Kepala Angkatan Udara Garda Revolusioner, mengatakan Minggu latihan itu ditujukan untuk memperlihatkan bahwa Iran siap menghadapi setiap

ancaman militer dari negara lain. Menlu AS Hillary Clinton mengatakan dia tidak percaya Iran bisa meyakinkan AS dan negara kuat lainnya pada pertemuan mendatang bahwa program nuklirnya hanya untuk tujuan damai, seperti selama ini dinyatakan Teheran. Hal itu akan menyebabkan Iran mendapat sanksi ekonomi yang lebih keras dari ‘sanksisanksi yang telah dijatuhkan’, katanya. Menurut perkiraan AS, Iran masih butuh waktu satu sampai lima tahun lagi untuk bisa memiliki senjata nuklir, meski badan intelijen AS juga meyakini para pemimpin Iran belum

membuat keputusan untuk membuat senjata nuklir. Jubir Kemlu Iran Hasan Qashqavi mengatakan, fasilitas pengayaan uranium yang baru diungkapkan itu bernama Fordo, desa yang terletak 180 km sebelah selatan Teheran. Tempat itu 100 km jauhnya dari Natanz, yang dikenal sebagai reaktor pengayaan uranium Iran. Qashqavi lebih jauh mengatakan, ujicoba rudal itu tidak ada kaitannya dengan ketegangan berkaitan fasilitas tersebut dan mengatakan ujicoba itu bagian dari kegiatan rutin, latihan militer yang telah lama direncanakan. (m18)

Pakistan, India Akhiri Korban Badai Ondoy Di Filipina Pembicaraan Tanpa Terobosan Lebih Dari 100 MANILA, Filipina (Antara/PNA-OANA): Hujan deras yang menimbulkan banjir di daerah-daerah Marikina, Pasig dan Rizal mengancam jalannya operasi penyelamatan dan pencarian di wilayah itu. Meskipun badai tropis Ondoy telah berlalu, namun meninggalkan ratusan orang tewas, kebanyakan hanyut oleh arus banjir. Badai ini menyebabkan bencana besar di seluruh Metro Manila pada akhir pekan lalu. Tidak ada badai di dalam wilayah tanggungjawab Filipina, kata Lembaga Dinas Atmosfir Filipina (Pagasa), namun bagian tengah dan selatan Luzon diperkirakan masih terjadi hujan, yang akan diperkuat oleh angin musim barat daya. Pada Minggu (27/9), badai Ondoy berada di 560 kilometer di barat Iba, Zambales, pada sekitar pukul 22:00 waktu setempat. Metro Manila kembali dilanda awan gelap dengan beberapa bagian diguyur hujan dan kilatan halilintar, kata Pagasa. Wilayah barat Visayas dan Mindanao juga akan mengalami hujan yang menyebar luas. Pemerintah menginginkan provinsi ini agar tetap waspada terhadap banjir bandang dan longsoran lumpur, terutama di Marikina, Pasig dan Rizal. Pagasa memantau perkembangan badai tropis di dekat Guam, yang mengarah ke barat barat-laut ke arah Filipina. Hal itu dianggap tak terlalu mengkhawatirkan karena cuaca buruk masih sangat jauh dari negara, sekitar 1.000 kilometer, namun mungkin akan diperkuat oleh angin musim baratdaya pada tempo 24 jam mendatang. Sementara itu, program berita televisi Balitanghali mengatakan, para penduduk desa diharapkan secara sukarela membantu operasi pencarian dan penyelamatan meskipun mereka kurang terlatih. Mereka menyatakan ingin membantu menemukan kembali orang-orang yang hilang, kebanyakan dari penduduk desa tetangga, yang hilang setelah terjadi banjir besar Sabtu lalu. Dua hari setelah tragedi itu, banyak orang masih berada di atap-atap rumah mereka dengan ketakutan terjadinya banjir lagi, akibat hujan Senin pagi. Badai Ondoy juga merusak rumah sakit Marikina, termasuk peralatan CT scan dan kamar gawat daruratnya digenangi banjir akibat hujan lebat itu.

NEW YORK, AS (Antara/ Reuters) : Pakistan mengisyaratkan keinginannya untuk membetulkan hubungan dengan India sementara para menteri luar negeri kedua negara yang memiliki nuklir itu bertemu tapi tidak sampai mengumumkan perundingan perdamaian kembali yang macet. Menlu India S.M. Krishna dan rekan sejawatnya Shah Mahmood Qureshi Minggu (27/9) mengadakan pertemuan 100-menit di sela pertemuan tahunan Sidang Umum PBB dalam usaha memperbaiki hubungan yang diganggu oleh serangan-serangan kelompok pria bersenjata di Mumbai, November lalu. Pakistan mengakui bahwa serangan terkoordinasi itu yang menewaskan 166 orang dirancang dan sebagian dilancarkan dari wilayahnya. Negara itu mengadili tujuh tersangka dalam sidang tertutup yang dimulai lagi pekan lalu tapi dijadwalkan mulai 3 Oktober. Komentar-komentar yang dikeluarkan para menteri pada konferensi pers terpisah memperjelas Pakistan ingin memulai pembicaraan luas mengenai apa saja dari Kashmir hingga perdagangan. Namun, India yang tetap hati-hati, menuntut aksi lebih keras oleh Islamabad untuk

menghukum mereka yang berada di balik seranganserangan itu. Qureshi mengatakan ia telah membuat proposal kepada India mengenai bagaimana kedua negara yang berseberangan itu memperbaiki hubungan, termasuk jadwal waktu tapi dia tak memberi perincian. Pejabat lain Pakistan mengatakan proposal diajukan untuk mendorong dialog yang beku setelah serangan Mumbai. Peluang logis bagi perdana menteri keduanya untuk bertemu bisa terjadi pada pertemuan tingkat tinggi Persemakmuran pada November di Trinidad. Qureshi mengatakan ia ingin pergi ke India jika hal itu mungkin memperbaiki sentimen publik. “Saya telah menyarankan kepada rekan sejawat saya satu cara dan peta jalan bagi masa depan,” kata Qureshi kepada wartawan. Ia menolak menjelaskan dengan mengatakan ia ingin memberi waktu kepada pihak India untuk mempertimbangkan proposalnya. Krishna menyebut pertemuan tersebut “berguna, konstruktif dan tulus” tetapi mengatakan bahwa untuk dialog berarti “penting untuk menjamin lingkungan yang bebas dari kekerasan, terorisme dan ancaman untuk menggunakan kekerasan”.

“Kami tetap khawatir mengenai ancaman kelompokkelompok dan individu di Pakistan yang diarahkan kepada kami,” ujarnya. Ia menambahkan bahwa ia telah menekankan kepada Qureshi perlunya “langkah-langkah konkrit dan efektif” terhadap mereka”. Krishna mengakui tindakan hukum yang Pakistan ambil terhadap para tersangka dalam serangan Mumbai tetapi mengatakan “pusat kejahatan yang dilakuakan di Mumbai tidak dapat dilakukan oleh tujuh atau delapan indivdidu”. India dan Pakistan telah terlibat dalam tiga perang sejak kemerdekaan pada 1947 dan hampir terjadi lagi pada 2002. Permusuhan yang berlangsung bertahun-tahun berpusat pada pertikaian mereka soal Kashmir, kawasan di Himalaya yang mayoritas penduduknya beragama Islam. Kedua negara menguji bom nuklir pada 1998. Setelah serangan-serangan Mumbai, India membekukan proses perdamaian yang telah berlangsung lima tahun. Pertemuan kedua menlu pada Minggu merupakan yang keempat sejak Juni yang bertujuan memulai kembali dialog. Pertemuan-pertemuan itu telah berlangsung di sela konferensi internasional.

Pemerintah AS, Sabtu, memberlakukan pembatasan perjalanan atas politisi dari ketiga negara Afrika tersebut ke Amerika Serikat. Al Mahdi mengatakan ia tidak optimiss bahwa peningkatan hubungan antara Khartoum dan Washington mungkin terjadi, dan mengatakan, “Ada tanda yang tak mendorong optimisme, termasuk pendirian yang bertolakbelakang oleh AS dan utusannya Scott Gration”. “Pusat pembuat keputusan AS telah dipengaruhi oleh lobi Zionis, yang secara keras memusuhi Sudan dan bekerja untuk memisahkan Sudan utara dari selatan serta mensahkan jalur pemisahan,” katanya.

Merkel Raih Mandat Kedua Sebagai Kanselir Jerman BERLIN, Jerman (Antara/AFP) : Angela Merkel meraih mandat kedua kali dalam pemilihan di Jerman untuk memimpin aliansi baru tengah-kanan, demikian hasil penghitungan sementara menunjukkan. “Kita telah mencapai tujuan dengan meraih suara mayoritas untuk membentuk pemerintahan baru,” kata Merkel kepada para pendukungnya yang bersuka ria di Berlin Minggu (27/9). “Saya ingin menjadi kanselir semua warga Jerman untuk membawa perbaikan bagi negeri kita.” Hasil awal yang disiarkan televisi menunjukkan blok Uni Kristen (CDU/CSU) yang konservatif pimpinan Merkel, 55, meraih 33,5 persen suara. “Para pemilihan telah memberikan suara, dan hasilnya merupakan hari getir bagi Demokrasi Sosial di Jerman,” kata Menteri Luar Negeri Frank-Walter Steinmeier, saingan Merkel dari kubu Sosial Demokrat (SPD), kepada para pemilih yang kesal. “Tak ada cara lain untuk berkata, ini merupakan kekalahan yang getir.” SPD, mitra yunior dalam “koalisi besar” Merkel meraih antara 22 dan 23 persen — angka terburuk mereka sejak Perang Dunia II — dan akan beroposisi setelah 11 tahun dalam pemerintahan. Mitra-mitra yang disukai Merkel, Demokrat Bebas (FDP) yang pro bisnis, meraih hampir 15 persen suara. Dengan demikian mereka akan kembali ke pemerintahan untuk pertama kali sejak 1998. Dengan hasil mayoritas, Merkel, pemimpin

wanita pertama Jerman dan satu-satunya kanselir dari timur yang bekas komunis, akan memimpin lagi untuk masa empat tahun. Berdasarkan penghitungan hasil pemilihan yang rumit di Jerman, gabungan suara kubu Merkel dan mitranya yang mencapai 48 persen sudah cukup menempatkan mereka di posisi teratas. Koalisi tengah-kanan pernah memerintah Jerman selama 28 dari 60 tahun sejak republik pasca perang itu didirikan. Keduanya terbiasa dalam konstalasi politik Jerman. Pemimpin FDP GuidoWesterwelle sekarang bertujuan menjadi wakil kanselir dan menteri luar negeri. Dalam jajak pendapat menjelang pemilihan, Merkel tetap berada di atas Steinmeier, 53. Merkel, yang oleh majalah Forbes disebut sebagai wanita paling berpengaruh di atas planet selama empat tahun pemerintahan, mengatakan Jerman yang merupakan eksporter nomor dua terbesar di dunia dan dilanda krisis global memerlukan satu pemerintahan tengahkanan guna mengakhiri penurunan ekonomi pasca-perang. Koalisi baru Merkel akan menghadapi sejumlah masalah domestik seperti pengangguran, perawatan kesehatan, pendidikan dan sistem keamanan sosial yang perlu direformasi. Di luar negeri, tantangan utama adalah Afghanistan, tempat Jerman telah mengerahkan sekitar 4.200 serdadu di bawah pimpinan NATO yang bertempur selama delapan tahun melawan Taliban.

Lima Anggota OAS Ditahan Di Honduras, Empat Diusir TEGUCIGALPA, Honduras (Antara/AFP): Lima anggota Organisasi Negara Amerika (OAS) ditahan selama enam jam di bandar udara internasional di Honduras, dan empat lagi diusir, kata John Biehl, satu-satunya pejabat OAS yang memasuki negeri itu. Utusan OAS tersebut bermaksud meletakkan kerangka kerja bagi upaya penengahan sementara ketegangan meningkat antara presiden terdepak Manuel Zelaya, yang telah berlindung di kedutaan besar Brazil di Tegucigalpa selama satu pekan belakangan, dan para pemimpin de fakto negeri itu. “Kami ditahan di bandar udara. Ada dua warga negara Amerika, dua Kanada, satu orang Kolombia dan saya sendiri di dalam kelompok tersebut,” kata Biehl, penasehat Sekretaris Jenderal badan pan-Amerika itu, Jose Miguel Insulza Minggu (27/9) . Satu anggota kelompok tersebut dikirim ke Amerika Serikat dan tiga orang lagi dikirim ke Kosta Rika, kata Biehl. “Kami ditahan selama enam jam ... sebagai orang Chile, saya harus mengatakan itu mem-

bawa kembali kenangan buruk,” kata Biehl, yang menyinggung kediktatoran Augusto Pinochet. Rejim de fakto di Honduras, yang telah menghadapi kecaman yang meningkat karena caranya melakukan penindasan secara keras sejak penggulingan Zelaya pada 28 Juni, telah berusaha menunda misi OAS tersebut. Dua pejabat dari Kedutaan Besar Spanyol juga ditolak masuk di bandar udara Honduras pada Ahad, sewaktu mereka kembali ke Honduras setelah berlibur di luar negeri, kata satu sumber diplomatik. Pemerintah sementara Sabtu malam memberi Brazil ultimatum 10 hari untuk memutuskan apa yang akan dilakukan pada Zelaya. Rejim tersebut juga menyeru semua diplomat dari negara yang telah memutuskan hubungan dengan Honduras sejak kudeta dukungan militer agar berhenti menggunakan plat nomor diplomatik dan surat kepercayaan mereka, serta mencabut bendera negara itu dan berbagai lencana lain dari semua bangunan.

Kasus Flu Babi Di Vietnam Naik Jadi 8.419 HANOI, Vietnam (Antara/ Xinhua-OANA):Vietnam mengkonfirmasi 206 lagi kasus influenza A/H1N1, sehingga menaikkan jumlah keseluruhan pasien flu tersebut jadi 8.419,

demikian antara lain isi laporan di laman Kementerian Kesehatan Vietnam, Senin (28/9). Di antara kasus baru tersebut, 118 pasien berada di bagian selatan, 69 di utara, dan 19 di

provinsi dataran tinggi, kata kementerian itu. Sejauh ini, 6.736 pasien telah diperkenankan pulang setelah pulih, kata laporan tersebut. Vietnam sejauh ini telah melaporkan 13 kematian akibat influenza A/H1N1.

AP

Sejumlah penduduk berjalan melintasi jalanan berlumpur saat hendak kembali ke rumah masing-masing di Marikina City, Manila timur, Filipina, Senin (28/9). Banjir tersebut juga merupakan bencana terburuk yang menimpa ibukota tersebut dalam empat dekade terakhir.


Agenda

4

WASPADA Selasa 29 September 2009

Mengenang Saat Jatuh Cinta, KD Terharu Sebagai seorang perempuan, Krisdayanti tentu pernah jatuh cinta. KD mengenang masamasa indahnya saat jatuh cinta dengan menyanyi dan terharu. Saat menjadi bintang tamu di acara ulang tahun Ketua Umum PKB, Muhaimin Iskandar, Minggu (27/9) malam, KD menyanyikan 6 lagu. Saat menyanyikan lagu ‘Menghitung Hari’, ibu 2 anak itu sempat berhenti di tengah-tengah lagu dan curhat. “Dua belas tahun lalu saya menyanyikanlaguiniuntukorang lain, sekarang lagu ini buat saya sendiri,” ujarnya dengan mata berkaca-kaca di kediaman Muhaimin Iskandar Jl Denpasar Blok C3No.5,Kuningan,JakartaSelatan. KD pun kembalu bernyanyi

dan memukau tuan rumah serta undanganyanghadir.KDkembali emosional ketika melantunkan lagu ‘Mencintaimu’. “Ini untuk orang-orang yang sa-ling jatuh cinta,” tuturnya sebelum menyanyi dengan wajah sendu. Sidang Cerai Krisdayanti resmi mengajukangugatanceraiterhadapAnang Hermansyah di Pengadilan Agama (PA) Jakarta Selatan. KD pun berjanjiakanhadirdisidangcerainya. “Yanti pernah berbicara ke saya kalau dia niat datang ke sidang,” jelas Elsie Lontoh, pengacara KD, Senin (28/9). KD, melalui pengacaranya sudah mendaftarkan gugatan cerainya di PA Jakarta Selatan

Aktor Pemenang Emmy Pimpin Perhimpunan Hollywood

pada Senin (28/9) pagi dengan nomor register 1694/pdtg/2009/ PAJS. Menurut sumber di PA Jakarta Selatan, sidang perdana akan digelar pada 8 Oktober 2009 mendatang. Soal materi gugatan cerai, Elsie tak mau membocorkannya karena hanya akan dibahas di dalampersidangan.Soalmengapa KD mendaftarkan gugatan cerai, Elsie mengungkapkan kalau hal itu sudah disepakati.“Anang dan Yanti kok yang menyepakatinya seperti itu,” imbuhnya. Pasangan KD dan Anang bercerai secara Islam pada 19 Agustus 2009 lalu. Keduanya menyepakatisoalhakasuhanak akan dipegang Anang juga harta gonogini.(dth)

KD dan Anang/dth

Lagu Terakhir Michael Jackson Dirilis Oktober

Michael Jackson/blogspot.com

Sebelum menghembuskan nafas terakhirnya, Michael Jackson memiliki satu lagu belum dirilis. Lagu terakhir Michael Jackson akan dirilis pada Oktober mendatang. Lagu tersebut diberi judul ‘This Is It’. Single tersebut akan dirilis pada 12 Oktober. Single tersebut akan dikemas dalam dua CDdenganjudulyangsama.Lagu ini juga akan dipilih menjadi penutup dalam film Michael. “Film ini akan ditonjolkan sebagai penutup rangkaian film Michael dan juga termasuk suara kakak-kakak Michael menjadi backing vokal,” demikian pernyataan dari website Michael seperti dikutip dari Femalefirst, Kamis (24/9). Albuminiakandijualserentak ke seluruh dunia pada 26 Oktober mendatang sedangkan di Ame-

rika Utara pada 27 Oktober mendatang. Benci Thriller Album‘Thriller’milikMichael Jackson dirilis tahun 1982 termasuk salah satu karya sang King of Pop yang laris manis. Namun ternyata sesungguhnya, Michael membenci album tersebut. Michael bahkan berencana untuk tak menyelesaikan album tersebut karena menurutnya ‘Thriller’ sangatlah jelek. Bahkan Michaelsempatmenangiskarena mengira suara rekaman album tersebut tidak menyenangkan. “Ketika mendengarkan seluruh album, ada tangis. Saya menangis seperti bayi. Saya berlalu dari ruangan dan mengatakan ‘Kami tak akan merilis album ini’,” ujar Michael lewat rekaman wawancara belum sempat dirilis harian World dan dikutip dari

Contactmusic, Senin (28/9). Namun sesuatu mengubah cara pandang Michael terhadap album tersebut. Kala itu Michael mengunjungi sebuah taman bermain anak-anak. Tiba-tiba ia sangat ingin memperdengarkan album tersebut kepada seluruh dunia. Tak percuma, akhirnya album itu laris sebanyak 100 juta copy di seluruh dunia. Album fenomenal tersebut memuat karya Michael seperti ‘Baby Be Mine’, ‘The Girls is Mine dikerjakannya bersama Paul McCartney, ‘Beat It’, ‘Billie Jeans’ dan banyak lagi. Tahun 2001, album tersebut dirilis ulang dengan edisi spesial. Disertaiwawancaradariproduser Quincy Jones dan orang-orang yang membantu album tersebut. (vivanews/dth)

Pacar Anna Nicole Smith Hadapi Tuntutan Berat Pacar gadis cantik Playboy, Anna Nicole Smith, dan pengacara Hoeward K Stern didakwa dengan lima tuntutan lagi yang cukup berat dan berpangkal dari kematiannya pada 2007. Tuntutan tambahan itu —yang sudah diajukan terhadap ahli ilmu jiwa Smith, Khristine Eroschevich, dan dokter ahli pe-nyakit dalamnya, Sandeep Kapoor— menghadapi empat dakwaan memperoleh resep secara curang dan satu dakwaan pemberian resep, memberikan atau menyalurkan bahan yang dipantau kepada seorang pecandu. Jaksa Los Angeles mendakwa ketiga orang tersebut pada Maret melakukan persekongkolan untuk memberi dia bahan yang dipantau. Ketiga orang tersebut telah menyatakan mereka tak bersalah. Stern, yang juga adalah seorang pengacara, menghadapi tiga dakwaan persekongkolan untuk melakukan kejahatan, dua dakwaan melibatkan pemberian resep secara melanggar hukum atas bahan dipantau dan satu dakwaan pemberian resep, pelaksanaan atau penyaluran bahan yang dipantau buat

07.00 Film Keluarga Spesial Lebaran 09.00 Musik : Dahsyat 11.00 Silet 12.00 Seputar Indonesia 12.30 Sergap 13.00 Film Spesial Lebaran 15.00 Cek & Ricek 15.30 Mata Mata 16.00 Minta Tolong 17.00 Seputar Indonesia 17.30 Baim Anak Sholeh 18.00 Manohara 19.00 Safa Dan Marwah 20.30 Cinta Dan Anugerah 22.00 Deddy Corbuzier Master Mentalis 23.30 Black And News 01.00 Seputar Indonesia Malam 01.30 UEFA Champions League : Barcelona vs Dyname Kyiv 03.30 Florentina vs Liverpool

CATATAN

07.30 Inbox 09.30 Halo Selebriti 10.00 Sinema Pagi 12.00 Liputan 6 Siang 12.30 Sinema Siang 13.30 Kasak Kusuk 14.30 Status Selebriti 15.00 Pejuang Cinta 15.30 Playlist 17.00 Liputan 6 Petang 17.30 Kepompong 19.00 Melati Untuk Marvel 20.00 Cinta Fitri 21.30 Terlanjur Cinta 22.30 Gala Sinema 01.00 Liputan 6 Malam 01.00 Buser

pecandu. Stern menyatakan ia tak bersalah atas dak-waan paling akhir dalam proses pengadilan Rabu. Smith, pernah menjadi Playboy Playmate, berusia 39 tahun, ketika ia meninggal di Hollywood, Florida, pada 8 Februari 2007, akibat kelebihan dosis obat, sekitar lima bulan setelah kelahiran putrinya dan kematian putranya berusia 20 tahun dan juga meninggal akibat kelebihan dosis obat hanya tiga hari setelah kelahiran sau-darinya lain ayah. Menyusul kematian Smith, pergolakan hukum meletus mengenai siapa yang akan menjadi ayah putrinya, Dannielyn Hope. Pemeriksaan DNA memastikan ayah anak tersebut adalah juru kamera Larry Birkhead, kini telah menjadi wali putrinya. Stern juga menyatakan bahwa ia adalah ayah anak perempuan itu.(ant)

07.00 Cerita Pagi 08.30 Layar Pagi 10.30 Nekad’z 11.00 Sidik 12.00 Layar Kemilau 13.30 1001 Cerita 14.30 Go Show 15.00 Twist & Shout 17.00 Ninja Warrior 18.00 Putri Dongeng 19.00 Ingat Ingat Lupa 20.00 Sinema Asyik 21.30 Sinema Layar Lebar 23.30 Cerita Malam 01.00 Galaxy Kumpulnya Para Bintang

07.00 Pororo The Little Penguin 07.30 Dino Babies 08.00 Star Kids Ya Iyalah 09.00 Espresso 10.00 Heboh 11.30 Topik Siang 12.00 Musik : Klik 13.30 Kartun 15.00 Demian Sang Penakluk 16.30 Topik Petang 17.00 Mantap 18.30 Kena Deh 19.00 Segeerr 20.00 4 M 21.30 Tawa Sutra 23.00 4 Lawan Satu 00.00 Topik Malam 00.30 Lensa Olahraga Malam

07.00 KiSS Vaganza 08.30 Kid’s Song 09.30 FTV Drama 11.30 Patroli 12.00 Fokus Siang 12.30 Happy Song 14.30 KiSS Sore 15.30 FS : Starlit 17.00 Amira 18.00 Tangisan Isabella 19.00 Jiran 20.00 Inayah 22.00 A Love To Kill 00.00 FS : The Hospital 01.00 Fokus Malam 01.30 Kasih Dan Amara

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Anna Nicole Smith/foxnews.com

07.05 Indonesia This Morning 07.30 Metro Xin Wen 08.05 Healthy Life 09.05 Archielago 10.00 Kreasi 10.30 The Interview 11.05 Expedition 11.30 Megapolitan 12.05 Metro Siang 13.30 Economic Challenges 14.30 Metro Sore 15.30 Public Corner 19.05 Suara Anda 20.30 Inside 21.05 Top Nine News 21.30 Auto Zone 22.05 Today’s Dialogue 23.05 Secret Operations 23.30 Metro Sports 00.05 Metro Malam

Aktor watak Ken Howard dipilih sebagai ketua Serikat Kerja Aktor Layar Hollywood (SAG) Kamis, kata perhimpunan itu, empat hari setelah dia memenangkan Emmy untuk film TV HBO ‘Grey Gardens.‘ Howard, mewakili kubu moderat dalam perpecahan tajam di serikat itu, memenangkan dukungan 47 persen dari suara dalam satu pemungutan suara untuk menggantikan Alan Rosenberg, yang tak berhasil melanjutkan masa jabatan dua tahunan ketiganya. Rosenberg adalah pengikut kubu garis keras tak berhasil menghadapi suatu kontrak pekerjaan baru dengan beberapa studio pada awal tahun ini. Dia mendukung AnneMarie Johnson, yang hanya meraih dukungan 33 persen suara untuk jabatan yang tak dibayar itu. Howard, 65 tahun, mengusulkan hubungan erat dengan perhimpunan Hollywood yang lebih kecil, AFTRA (Federasi Artis Televisi dan Radio Amerika), dalam rangka membuat para aktor lebih kuat dalam posisi tawar-menawarnya di perundingan. Para anggota SAG hampir membatalkan penggabungan itu pada 2003, ketika Melissa Gilbert memimpin serikat kerja. “Meskipun terjadi perbedaan tajam tapi kami terus aktif dalam masalah perhimpunan, bahkan terkadang meliputi strategi dan taktik, kami ingin terus

Ken Howard/buddytv.com

mengingatkan diri kami bahwa semua adalah dalam satu tim, berjuang untuk kepentingan yang sama dan hanya dengan bersatu kami akan tumbuh lebih kuat,” kata Howard. Howard mendapat penghargaan Minggu untuk peran pendukungnya sebagai Phelan Beale, mantan suami ‘si Besar‘ Edie Beale dalam ‘Grey Gardens,‘ suatu proyek berdasarkan dokumentasi mengisahkan sepasang sosialita eksentrik yang hidup dalam kemelaratan. Dalam pemungutan suara itu, kelompok moderat memperkokoh posisi mereka dalam me-nguasai perhimpunan, dengan memenangkan sebagian besar kursi pada badan nasional SAG beranggotakan 71 orang.(ant/rtr)

Figuran Berebutan Main Di Film Julia Roberts Film bertajuk Eat, Pray, Love dibintangi aktris Hollywood Julia Roberts menarik minat ratusan orang. Mereka berebut menjadi figuran dalam film berlatar ka-wasan wisata Ubud, Bali. Seleksi untuk mencari figuran dan pemain latar dalam film lokasi syutingnya di Italia, India dan Indonesia telah dilakukan bebe-rapa waktu lalu. Casting pemain lokal digelar selama dua hari di Hotel Sanur Agung, Jalan By Pass Ngurah Rai, Denpasar. Film ini membutuhkan pe-main figuran dan latar pria dan wanita usia 17-50 tahun, anak-anak berusia usia 4-12 tahun dan ibu beserta bayi usianya berkisar 9 bulan sampai satu tahun. “Kita butuh puluhan orang untuk figuran, sedangkan untuk pemain latar ratusan orang,” ujar Asisten Casting Director Inneke saat dihubungi Senin (26/ 9). Inneke mengatakan, casting film tersebut diminati banyak orang baik dari Bali maupun luar Bali. Salah satu figuran yang sulit ditemukan adalah peran balian

07.30 Musik : Derings 09.00 Skesa 09.30 D’Show 11.00 Insert 12.00 Reportase Siang 12.30 Missing Lyrics 13.30 Bioskop Indonesia 15.30 Insert Sore 16.00 Orang Ketiga The Series 17.00 Reportase Sore 18.00 Suami Suami Takut Istri 19.00 Bioskop Indonesia 21.00 Bioskop Trans TV 23.00 Bioskop Trans TV 01.00 Reportase Malam

08.30 Bunga Rampai 09.00 Kabar 9 09.30 Kabar Pasar 10.30 Pariwara 11.00 Opini 12.00 Kabar Siang 13.30 Expose 14.00 Kamus Kuliner 15.00 Kabar 15 15.30 Kabar Pasar 17.30 Kabar Petang 19.00 Bang One Show 19.30 Janji Wakil Rakyat 20.30 Telusur 21.00 Apa Kabar Indonesia Malam 22.00 World Report 23.00 Highlight Barclays Premier League

tua (dukun, red). Karakter ini dipe-rankan seorang kakek berusia minimal 70 tahun yang mampu berbahasa Inggris dan membaca skrip. Salah seorang peserta casting Rigas Swan berharap terpilih da-lam film yang bakal syuting di Ubud, Gianyar dan Uluwatu, Badung pada 16 Oktober hingga 6 November 2009. “Siapa tahu bisa bertemu Julia Roberts,” ujarnya.(dth)

07.00 Back At Barnyard 08.00 Go Diego Go 09.00 Obsesi 10.00 Bukan Sinetron 11.00 Dimas & Raka 12.00 Abdel & Temon 13.00 Global Siang 14.30 FTV 16.30 Berita Global 17.00 Spongebob 18.00 Naruto 19.00 Big Movies Robon Hood 22.00 Big Movies Creepies Hell On Eigh Legs 00.00 F1 Sensation 01.00 MTV Insomnia

Julia Roberts/fanpop.com

07.30 I Gosip 08.00 Selamat Pagi 09.00 Dorce 10.0 Dengarlah Aku 10.30 60 Minutes 11.30 Redaksi Siang 12.00 I Gosip Siang 12.30 Bocah Petualang 13.00 Laptop Si Unyil 13.30 Cita Citaku 14.00 Tom & Jerry 15.00 Asal Usul Fauna 16.00 Jejak Petualang 16.30 Redaksi Sore 18.30 On The Spot 20.00 Opera Van Java 20.45 OKB 22.00 Bukan Empat Mata 23.30 Begadang 00.30 Sport 7 Malam 01.00 Redaksi Malam

**m30/B


Nusantara 5 200 Ribu Pendatang Baru Tiba Di Jakarta

WASPADA Selasa 29 September 2009

JAK ARTA ( Waspada): Setiap tahun Jakarta bagai magnit bagi pencari kerja dari berbagai daerah di Indonesia. Jumlahnya terus bertambah. Tahun 2009 ini diperkirakan 150-200 ribu pendatang baru akan tiba di Jakarta bersamaan arus balik lebaran. Jumlah ini naik dibanding 2008 yaitu 88.473 pendatang baru dan 109.617 pendatang pada 2007. Kepala Dinas Kependudukan dan Catatan Sipil DKI Jakarta, Franky Mangatas Panjaitan menyatakan, sebagian

pendatang baru hanya transit di Jakarta, lalu menuju kota lain seperti Bogor, Tangerang, Depok dan Bekasi. Namun separuhnya diperkirakan tinggal di Jakarta. “Untuk mengantisipasi pendatang baru ini kami melakukan pengawasan di terminal dan stasiun. Mereka akan ditanya apakah sudah punya keterangan penduduk yang resmi atau belum,” kata Franky. Sementara, sekira 2.500 pencari kerja baru dari Banyumas, Jawa Tengah akan menyerbu Jakarta setelah lebaran. Kadis Sosial dan Tenaga Kerja Banyu-

mas, Rofiq Widadi dihubungi lewat ponsel mengatakan, para pencari kerja itu sedang membuat kartu kuning untuk bekal di ibukota. Sejak Kamis (24/9), Dinas Sosial Banyumas kembali melayani permohonan pembuatan kartu kuning setelah tutup karena libur lebaran. Meski kantor baru dibuka, ratusan pemohon kartu kuning sudah antre di loket pelayanan. Hingga Kamis siang itu lebih 120 pemohon kartu kuning datang. Jumlah itu naik 300 persen dibanding hari biasanya. “Kalau hari biasa paling 30-40 pemohon,” katanya.

Menanggapi fenomena itu, ahli kependudukan Prof. Dr. Ascobat Gani mengaku tidak terlalu heran. Kenyataan tersebut menggambarkan belum semua program pembangunan di daerah berjalan baik. Karena itu ibukota masih dianggap sebagai ‘ladang emas’ atau justru sebagai pilihan akhir. “Kalau mereka datang tanpa bekal, tentunya akan menjadi masalah baru. Mereka hanya menjadikan Jakarta sebagai pilihan terakhir untuk mengadu nasib. Jadi pemulung pun akan dilakoni,” tandasnya.(dianw)

Tim Lima Bertemu Perwakilan LSM Antara

PERBATASAN PAPUA: Sejumlah anggota personil TNI Yonif 527 Kabupaten Lumajang, memperagakan kondisi siaga dalam operasi pembersihan dan menghadapi musuh, saat inspeksi keberangkatan 650 pasukan Yonif 527 oleh Asop Palingma TNI.Mayjen Supiayadin, di lapangan Batalyon Yonif 527, Lumajang, Jawa Timur, Senin (28/9). Hal tersebut dalam rangka keberangkatan tugas menjaga wilayah perbatasan di Propinsi Papua.

TNI Siap Berdialog Dengan Keli Kwalik TIMIKA (Antara): Jajaran TNI di Papua terutama Korem 171 Praja Vira Tama (PVT ) Sorong, siap berdialog dengan Pimpinan Tentara Pembebasan Nasional Organisasi Papua Merdeka (TPN-OPM) wilayah Timika, Keli Kwalik. “Kalau memang dia (Keli Kwalik-red) mau, kita siap berdialog. Saya jamin aman dan tidak akan diapa-apakan,” kata Komandan Korem 171 PVT Sorong, Kolonel Inf. Fransen Siahaan di Timika, Senin (28/9). Kelompok TPN-OPM wilayahTimika pimpinan Keli Kwalik selama ini disebut-sebut berada di balik aksi teror penembakan di areal PT Freeport Indone-

sia yang terjadi sejak Juli-September. Aksi teror itu mengakibatkan tiga orang tewas, dua di antaranya karyawan perusahaan masing-masing Drew Nicholas Grant (warga Australia) dan Markus Rate Alo serta seorang lainnya, Briptu Marson Petipelohi merupakan anggota Propam Polda Papua. Menurut Siahaan, setiap saat TNI membuka diri berdialog dengan jajaran pimpinan TPNOPM untuk mengetahui aspirasi mereka, sekaligus bisa kembali ke masyarakat untuk membangun Papua secara bersamasama. Siahaan juga memberikan

perhatian khusus bagi terciptanya situasi kamtibmas yang kondusif di Mimika, khususnya di areal kerja PT Freeport Indonesia yang dilanda teror penembakan sejak Juli lalu. Terkait hal itu, Siahaan menegaskan, penanganan masalah gangguan kamtibmas sepenuhnya menjadi kewe-nangan pihak Kepolisian dengan dukungan TNI. Dia berharap situasi yang mulai kondusif di areal Freeport saat ini tetap terjaga dengan baik agar operasional perusahaan tetap berlangsung dan masyarakat sekitar tidak dilanda ketakutan dan kekhawatiran. Berkaitan kunjungan kerja

Cawapres RI terpilih periode 2009-2014, Boediono ke Timika, Senin, pihak TNI dan Polri mengerahkan sedikitnya 300 personel gabungan yang bertugas mengamankan area sekitar Bandara Mozes Kilangin Timika. Selama kunjungan Boediono di Timika yang hanya setengah jam untuk melanjutkan perjalanan menuju Wamena, Jayawijaya, kondisi kamtibmas di wilayah ini cukup aman. “Situasi di Timika saat ini sangat aman, mudah-mudahan masyarakat tetap membantu menjaga keamanan agar Timika bisa menjadi zona damai,” harapnya.

JAKARTA (Antara): Tim Lima bertugas memberikan rekomendasi kepada Presiden Susilo Bambang Yudhoyono untuk mengisi pelaksana tugas pimpinan Komisi Pemberantasan Korupsi (KPK) bertemu dengan perwakilan lembaga swadaya masyarakat (LSM) di Jakarta, Senin (28/9) sore. Tim beranggotakan Menteri Koordinator Politik, Hukum dan Keamanan Widodo AS, Menkum HAM Andi Mattalatta, mantan ketua KPK Taufiequrahman Ruki, anggota timWantimpres Adnan Buyung Nasution, serta tokoh hukum Todung Mulya Lubis, bertemu dengan perwakilan dari Lumbung Informasi Rakyat (Lira), Forum Rektor, Masyarakat Transparansi Indonesia, YLBHI serta Indonesian Center for Environmental Law. Pertemuan di Gedung Dewan Pertimbangan Presiden berlangsung tertutup. Dari lima anggota hanya dua anggota yang hadir yaitu, Adnan Buyung Nasution dan Todung Mulya Lubis.

Sebelumnya, Tim Lima sudah bertemu dengan perwakilan advokat dan para pemimpin redaksi media massa untuk meminta masukan. Hingga pukul 15.45 pertemuan tertutup itu masih berlangsung. Presiden menandatangani keputusan presiden (keppres) tentang pembentukan tim yang akan memberikan rekomendasi nama calon yang akan menjadi pelaksana tugas pimpinan KPK. Sebelumnya, Menteri Koordinator Politik Hukum dan Keamanan Widodo AS menjelaskan, Presiden ingin agar nama yang diangkat sebagai pejabat sementara pimpinan KPK mendapat kelayakan dan dipercaya kredibilitasnya oleh masyarakat. Karena itu, Presiden membentuk tim yang akan membantunya. Menurut dia, tidak mudah memilih nama pejabat sementara pimpinan KPK. Karena itu, sebelum ditetapkan, Presiden juga perlu meyakini nama itu benar-benar memiliki kelayakan, baik dalam arti menempati

Warga Jakarta Diminta Berbatik 2 Oktober JAKARTA (Antara): Warga Jakarta diminta mengenakan baju batik pada 2 Oktober sebagai tanda dukungan terhadap pengukuhan batik sebagai warisan budaya dunia bukan benda oleh Badan PBB Mengenai Pendidikan, Ilmu dan Budaya (UNESCO) pada hari tersebut. Gubernur DKI Jakarta Fauzi Bowo mengeluarkan seruan gubernur bernomor 9 tahun 2009 tentang pemakaian baju batik pada 2 Oktober 2009 yang dikeluarkan 25 September, sebagai imbauan bagi seluruh warga Jakarta. “Ini sebagai bentuk dukungan moral dari masyarakat agar batik bisa dikukuhkan sebagai warisan budaya bukan benda,” ujar Deputi Bidang Budaya dan Pariwisata DKI Aurora Tambunan di Jakarta, Senin (28/9).

Aurora menyebutkan, Gubernur juga mengeluarkan Instruksi No. 136/2009 tentang pemakaian batik pada 2 Oktober 2009 sebagai seruan bagi seluruh pegawai di lingkungan DKI. “Kami sangat menghargai dukungan warga Jakarta mengenakan batik pada tanggal tersebut,” kata Aurora. Batik Indonesia didaftarkan oleh kantor Menko Kesejahteraan Rakyat RI kepada UNESCO untuk mendapatkan status Intangible Cultural Heritage (ICH), yang keputusannya akan diberikan 2 Oktober dari rapat yang sedang dilakukan mulai 28 September hingga 2 Oktober di Abu Dhabi, Uni Emirat Arab. Bila permintaan itu diterima, batik akan menjadi warisan ketiga Indonesia yang terdaftar dalam Intangible Her-

itage of Humanity UNESCO, setelah wayang (2005) dan keris (2003). “Selanjutnya sedang didaftarkan gamelan dan angklung,” ujar Aurora. Untuk 2009, sebanyak 111 dari total 160 negara anggota UNESCO mengajukan salah satu budayanya untuk dikukuhkan sebagai ICH. “Batik salah satu yang terunggul untuk menjadi warisan budaya dunia bukan benda, tapi keputusan baru diberikan 2 Oktober pukul 16:00 waktu setempat atau 20:00 WIB,” papar Aurora. Sementara, untuk menunjukkan dukungan bagi warga menggunakan batik, Pemprov DKI memberikan potongan harga bahkan menggratiskan tempat hiburan bagi warga yang mengenakan batik pada hari itu. “Seluruh museum yang dikelola

Pemprov DKI akan digratiskan mulai 3 hingga 7 Oktober khusus bagi pengunjung mengenakan batik,” ujar Kadis Pariwisata dan Budaya DKI Arie Budhiman. Selain itu, khusus Senin, 5 Oktober, Taman Margasatwa Ragunan memberikan tiket gratis untuk masuk dengan syarat mengenakan batik. “Segala macam batik diterima, bahkan sarung batik dengan baju koko juga diterima. Mungkin yang tidak diterima hanya piyama batik,” kata Arie. Ancol juga memberikan diskon 50 persen bagi tiket masuk gerbang utama, Atlantis dan Gelanggang Samudera. Sementara untuk Dunia Fantasi memberikan diskon 40 persen. Sekali lagi dengan syarat pengunjung harus mengenakan batik.

Ketua MPR: Pimpinan MPR Cukup 3 Orang JAKARTA (Antara): Ketua Majelis Permusyawaratan Rakyat (MPR), Hidayat Nur Wahid menyatakan bahwa sebenarnya jumlah pimpinan MPR cukup tiga orang saja. Ditemui dalam acara halal bihalal di Gedung DPR-MPR Jakarta,Senin(28/9),Hidayatmengungkapkan dirinya bersama anggota MPR yang lain pernah mengusulkan kepada DPR mengenai perampingan jumlah pimpinan MPR. “Namun entah mengapa, jumlah pimpinan MPR malah menjadi lima orang, sementara tugas tidak ditambah melainkan tetap,” katanya.

Padahal menurut dia, berdasarkan pengalaman dan hasil observasi, jumlah pimpinan yang diperlukan oleh MPR hanyalah tiga orang. “Tentu saja disertai penambahan tugas bagi masing-masing pimpinan MPR tersebut”, ujarnya. Dalam acara yang dihadiri sejumlah pekerja media itu, Hidayat juga menyampaikan bahwa MPR pernah mengajukan usulan kepada DPR mengenai upaya evaluasi terhadap efektivitas undang-undang yang telah diamandemen. “Tapi sayangnya usul itu ditolak oleh panitia khusus

(Pansus) DPR sehingga MPR tidak memiliki kewenangan untuk melakukan evaluasi UU yang telah diamandemen tersebut,” kata Hidayat sesal. Menanggapi wacana yang beredar di masyarakat supaya kembali kepada UUD ‘45 yang asli, Hidayat hanya mengatakan bahwa dia akan melakukan halhal yang diperlukan sesuai ketentuan UU yang berlaku. “MPR lembaga yang bertugas membuat UU, sehingga harus mematuhi UU itu sendiri,” jelasnya. Sementara, Wakil Ketua MPR AM Fatwa menilai bahwa amandemen UU merupakan

sesuatu yang berkelanjutan dan memerlukan momentum politik untuk dilakukan. “Perlu kondisi politik yang obyektif dalam masyarakat untuk mendorong dilakukannya amandemen terhadap sebuah UU,” kata Fatwa. Fatwa juga menyatakan bahwa kembali kepada UUD ‘45 yang asli juga tidak mungkin. “Kembali pada UUD ‘45 yang asli merupakan langkah mundur yang tidak rasional, karena amandemen terhadap UUD adalah wujud dari dinamika politik masyarakat Indonesia,” sebut Fatwa.

Jenazah Susilo Akan Diserahkan RS Lapangan Mudahkan Penanganan Bencana Kepada Keluarganya SOLO (Antara): Jenazah Susilo alias Adib, diduga teribat kasus terorisme dalam penyergapan di Mojosongo, Jebres, Solo, 17 September 2009 diperkirakan pekan ini sudah bisa diambil dan segera diserahkan kepada pihak keluarganya. Kuasa hukum dari anggota Tim Pengacara Muslim (TPM), Anis Priyo Ansori di Solo, Senin (28/9) mengatakan, pihaknya sudah menghadap pejabat Kepolisian Mabes Polri dan jenazah Susilo diperkirakan pekan ini sudah bisa diambil setelah selesai identifikasi. “Jenazah Susilo paling lambat Sabtu (3/10) sudah diizinkan diambil dan dibawa ke Solo untuk dimakamkan,” kata Anis. Menurut dia, jenazah Susilo belum dapat diambil pihak keluarganya, karena polisi masih melakukan identifikasi dan kepolisian memperkirakan pekan ini sudah selesai. Jena-

zahnya akan segera diserahkan pihak keluarga Susilo. Mengenai perkembangan Istri Susilo, Putri Munawaroh yang dirawat di Rumah Sakit Polri Kamat Jati dalam keadaan sehat. “Munawaroh sudah bisa bertemu dengan keluarganya. Orang tua dan kakaknya sudah menjenguk di ruamah sakit,” kata dia. Menurut Ketua RT 2 RW 11 Kagokan, Katino, pihaknya belum mengetahui perkembangan tentang informasi jenazah Susilo, karena yang mengurusi pemakaman jenazah dari TPM. “Saya mendapat informasi yang mengurus jenazah hingga acara p e m a k a m a n d a r i T P M ,” katanya. Menurut keterangan pihak keluarga Susilo, jenazahnya rencananya dimakamkan di tempat Pemakaman Umum Pracimaloyo, Kel. Makam Haji, Kec. Kartasura, Kab. Sukoharjo.

JAKARTA (Waspada): Mendukung peran dan fungsi pasukan reaksi cepat penanggulangan bencana (PRCPB) TNI, Departemen Kesehatan menyerahkan bantuan rumah sakit lapangan dan ambulan bencana. Bantuan senilai Rp6,8 miliar diserahkan Menteri Kesehatan, Siti Fadillah Supari kepada Menteri Pertahanan, Juwono Sudarsono di ruang Leimena gedung C Depkes, Jakarta, Senin (28/9). Menkes mengatakan, bantuan itu merupakan realisasi kesepakatan kerjasama antara Depkes dan TNI dalam bidang pembinaan kesehatan dan pertahanan negara yang terjalin sejak 1999 dan diperbarui pada 2008. “Bantuan ini selaras dengan UU 24/2007 tentang bencana, yang penjabarannya mentitikberatkan pada peningkatan koordinasi lintas program dan lintas sektor,” kata Menkes. Menhan, Juwono Sudar-

sono mengatakan, sangat menghargai bantuan Depkes. Dalam situasi dan kondisi darurat, RS lapangan (tenda-tenda permanen) mudah didirikan. Selain itu RS lapangan mencapai belasan tenda cukup luas dan dilengkapi pembangkit listrik tenaga diesel, tabung oksigen, berbagai alat kesehatan memadai, 100 tempat tidur pasien serta 10 tenda operasi darurat. Saat ini sumbangsih TNI mengatasi kondisi pasca bencana semakin baik dengan kehadiran PRCPB. Khusus untuk RS lapangan dan ambulan bencana, penanganannya ada di masing-masing divisi kostrad. Dalam upaya tanggap bencana, Depkes sudah membentuk 9 pusat penanggulangan krisis regional di 9 kota yakni, Medan, Palembang, DKI Jakarta, Semarang, Surabaya, Banjarmasin, Bali, Makassar dan Manado.(dianw)

posisi itu serta melaksanakan tugas, peran dan fungsinya maupun kelayakan dalam aspek kepercayaan masyarakat. “Tim diberi waktu tujuh hari

dan diminta melaporkan hasilnya kepada Presiden 1 Oktober 2009, dan yang terpilih akan dilantik 2 Oktober 2009,” kata Widodo.

Penculikan Aktivis 97-98 Pelanggaran HAM Berat JAKARTA (Waspada): Ketua panitia khusus (pansus) penanganan pembahasan atas hasil penyelidikan penghilangan orang secara paksa (1997-1998), Effendi MS Simbolon mengatakan, telah terjadi pelanggaran hak asasi manusia berat dalam peristiwa penculikan dan penghilangan para aktivis 1997-1998. Dia mengatakan itu dalam sidang paripurna dipimpin Wakil Ketua DPR RI Muhaimin Iskandar, Senin (28/9) di DPR, Jakarta. Rekomendasi diputuskan pansus setelah mendengar masukan melalui rapat dengar pendapat dengan Komisi Nasional HAM dan rapat dengar pendapaat umum serta masukan dari saksi, para korban dan keluarga korban. Effendy melaporkan pansus tidak banyak mendapat masukan dan tambahan data dari pemerintah serta pihak-pihak diduga sebagai pelaku yang telah direkomendasikan Komnas HAM untuk mendengar keterangannya. Pansus beranggota 50 orang telah terbentuk dalam rapat paripurna DPR 27 Februari 2007, dan juga mengalami pergantian ketua yang semua ditugaskan kepada Panda Nababan, selanjutnya digantikan Effendi MS Simbilon. Pada akhirnya pansus merekomendasikan kepada presiden membentuk pengadilan ad hoc, merekomendasikan kepada presiden serta instansi pemerintah serta pihak-pihak terkait melakukan pencarian 13 orang yang oleh Komnas HAM masih dinyatakan hilang. Merekomendasikan kepada pemerintah merehabilitasi dan memberikan kompensasi terhadap keluarga korban yang hilang, merekomendasikan kepada pemerintah segera meratifikasi konvensi anti penghilangan paksa sebagai komitmen dan dukungan menghentikan praktek penghilangan paksa di Indonesia. (aya)

Sidang Paripurna DPD Sahkan Rancangan Peraturan Tatib

Antara

PENGUNGSI KEBAKARAN: Sejumlah warga mengungsi di kolong jembatan Tol, akibat rumah mereka terbakar di kawasan Penjaringan, Jakarta, Senin ( 28/9). Warga yang rumahnya terbakar terpaksa mengungsi di kolong jembatan tol, tendatenda darurat dan di tempat sanak famili.

JAKARTA (Waspada): Melalui voting sidang paripurna DPD menyepakati Rancangan Peraturan Tata Tertib DPD sebagai bahan masukan untuk anggota DPD periode 2009-2014. “Sidang paripurna menyepakati menerima,” ujar Ketua DPD Ginandjar Kartasasmita, Senin (28/9) di Gedung DPD Jakarta. “Ini juga keputusan, bukan berarti tidak ada keputusan,” kata Ginandjar didampingi kedua wakil ketua, Laode Ida dan Irman Gusman, dan calon terpilih anggota DPD 2009-2014. Sebelumnya antaranggota DPD dipersilakan berdebat melalui dua termin waktu. Draft Rancangan Peraturan Tata Tertib DPD yang diajukan Panitia Perancang Undang-Undang (PPUU) DPD memuat dua alternatif tatacara pemilihan pimpinan DPD yang dipilih dari dan oleh anggota dalam sidang paripurna DPD. Alternatif ke satu, pemilihan pimpinan DPD dengan prinsip keterwakilan tiga wilayah RI yang meliputi barat (Sumatera, Kepulauan Riau, Kepulauan Bangka Belitung), tengah (Jawa, Bali, Kalimantan) dan timur (Sulawesi, Maluku, Papua, Nusa Tenggara). Model ini memilih ketua DPD mendahului wakil ketua DPD. Alternatif kedua, pemilihan pimpinan DPD dengan prinsip keterwakilan tujuh gugus kepulauan RI meliputi Sumatera (Aceh, Sumut, Sumbar, Riau, Jambi, Bengkulu, Sumsel, Lampung, Kepulauan Riau, Bangka Belitung), Jawa (DKI Jakarta, Jabar, Jateng, DI Yogyakarta, Jatim, Banten), Kalimantan (Kalsel, Kalteng, Kalbar, Kaltim), Bali dan Nusa Tenggara (Bali, Nusa Tenggara Barat, Nusa Tenggara Timur), Sulawesi (Sulsel, Sulteng, Sultra, Sulut, Gorontalo, Sulawesi Barat), Maluku, Maluku Utara, Papua (Papua, Papua Barat). Model ini memilih ketua DPD sekaligus wakil ketua.(aya)


Sport

6 Hasil lengkap: Catania vs AS Roma Chievo vs Atalanta Juventus vs Bologna Lazio vs Palermo Napoli vs Siena Parma vs Cagliari Udinese vs Genoa Sampdoria vs Inter Livorno vs Fiorentina AC Milan vs Bari

Reuters

Penampilan motor serangan AC Milan, Ronaldinho, tak kunjung membaik sehingga timnya mampu ditahan Bari di Giuseppe Meazza, Senin (28/9) dinihari WIB.

Milan Mandul MILAN, Italia (Waspada): AC Milan hanya mampu bermain imbang tanpa gol ketika menjamu Bari dalam lanjutan Serie A di Stadion Giuseppe Meazza, Senin (28/9) dinihari. Milan pun melanjutkan rekor buruk mereka dengan gagal mencetak gol dalam dua laga terakhir. Pada duel Serie A terakhirnya, Milan juga tak men-cetak gol saat menghadapi Udinese. Mereka akhirnya dipaksa menyerah 0-1. Pelatih Leonardo pun memahami masalah tumpulnya lini depan Milan. Menghadapi Bari, ia mencoba formula baru dengan menduetkan Klaas-Jan Huntelaar dan Ronaldinho didukung Clarence Seedorf sebagai penyerang lubang. Dukungan para tifosi juga

diharapkan memberikan energi lebih untuk Massimo Ambrosini cs. Sayang, mimpi Leonardo tak menjadi kenyataan. Bermain di kandang, AC Milan malah tertekan. Usaha membangun koordinasi permainan solid kandas oleh lugasnya permainan Bari yang rajin mengejar dan memotong alur umpan Milan. Ketika mendapat peluang pun, mereka tanpa pikir panjang langsung melepas ancaman. Dari delapan usaha di babak pertama, Bari hanya mampu menciptakan satu ancaman serius ke gawang Milan melalui Paulo Vito Barreto. Saat itu, tembakannya dari luar kotak penalti mengarah lurus ke dalam dekapan Marco Storari. Milan belum juga bangkit

Klasemen Sampdoria Juventus Inter Milan Fiorentina Udinese Genoa Parma Chievo AS Roma Lazio AC Milan Bari Cagliari Napoli Palermo Bologna Siena Catania Atalanta Livorno

1-1 1-1 1-1 1-1 2-1 0-2 2-0 1-0 0-1 0-0

6 5 0 1 11-5 15 6 4 2 0 11-4 14 6 4 1 1 12-4 13 6 4 1 1 7-4 13 6 3 2 1 10-7 11 6 3 1 2 11-10 10 6 3 1 2 7-8 10 6 2 2 2 7-5 8 6 2 2 2 12-12 8 6 2 2 2 6-7 8 6 2 2 2 3-6 8 6 1 4 1 6-4 7 6 2 1 3 5-6 7 6 2 1 3 8-11 7 6 1 3 2 7-8 6 6 1 3 2 4-5 6 6 1 1 4 7-11 4 6 0 3 3 6-10 3 6 0 2 4 2-8 2 6 0 2 4 1-8 2

ketika Bari berhasil menciptakan dua peluang beruntun di babak kedua melalui Massimo Donati dan Rivas. Di tengah derasnya serbuan Bari, Milan menemukan kesempatan unggul melalui Ignazio Abate di menit ke-76 namun tendangannya mudah diamankan. Sepanjang pertandingan itu, Milan menciptakan lima peluang emas dari 12 kali usaha. (m33/rtr)

Sunderland Ramaikan Papan Tengah LONDON (Waspada): Sunderland melanjutkan kekuatan merekadalammengawalimusim Liga Premier dengan kemenangan kandang 5-2 atas WolverhamptonWanderers di Stadium of Light, Minggu (27/9). Sunderland, musim lalu nyaris terkena degradasi, naik

untuk berada satu level dengan AstonVilla, Manchester City dan Arsenal dengan 12 poin. Tottenham Hotspur dan Liverpool mengumpulkan15poin.Chelsea, kehilangan poin untuk pertama kalinya musim ini ketika kalah 13 di kandang Wigan Athletic, mengumpulkan 18 poin seperti

AP

Kenwyne Jones melakukan gerakan akrobatik setelah mencetak gol ke gawang Wolves.

juga Manchester United yang menang 2-0 atas Stoke City. Pada satu-satunya pertandingan Minggu, Sunderland memimpin2-0padababakkedua setelah dua penalti menyusul pelanggarankepadaDarrenBent. Striker tersebut mencetak gol pertama setelah menit kesembilan, sementara Kenwyne Jones menyarangkan yang kedua setelah menit ke-48. Permainan kian seru ketika Wolves membalas dengan dua gol cepat.Yang pertama hasil gol bunuh diri John Mensah setelah penjaga gawang Craig Gordon meninju bola lurus ke arahnya. Wolves membuat kedudukan imbangmelaluitendanganbebas Kevin Doyle. SunderlandkembalimemimpinmelaluitembakanJones.Setelah itu, Michael Turner menyundulkan gol keempat tiga menit kemudian dan Bent menggenapi kemenangan dengan menciptakan gol kelima untuk menambahpengumpulangolnyamusim ini menjadi tujuh. (m33/ant/rtr)

WASPADA Selasa 29 September 2009

Kuyt Ingin Ulangi Memori LIVERPOOL, Inggris (Waspada): Duel melawan Inter Milan adalah terakhir kali Liverpool melawat ke Italia. Memori kemenangan malam itu diharapkan Dirk Kuyt akan kembali terulang kala The Reds bertandang ke kandang Fiorentina dalam lanjutan Grup E Liga Champions, Rabu (30/ 9) dinihari nanti. Pada 11 Maret 2008 silam, gol tunggal Fernando Torres menamatkan perlawanan Inter di babak 16 besar Liga Champions. Liverpool pun maju dengan agregat 3-0, setelah sebelumnya menang 2-0 di Anfield. Setelah satu setengah tahun berlalu, Liverpool kembali akan mengunjungi negeri Pizza. “Malam yang indah di San Siro waktu itu. Aku sangat menikmati setiap menitnya dan mudah-mudahan kami dapat melakukannya lagi melawan Fiorentina nanti,” tegas striker tim nasional Belanda itu. Menjelang laga ini, skuad besutan Rafa Benitez memiliki modal bagus. Selain kemenangan di laga awal melawan Debrecen, penampilan Pool tengah memanas. Di Liga Inggris pekan lalu, The Reds sementara menjadi tim terproduktif dengan 22 gol dan Torres memimpin daftar top skorer dengan delapan gol. Seperti kebanyakan tim asal Italia yang lebih mengedepankan sisi pertahanan, La Viola bisa jadi ujian sebenarnya

AP

Dirk Kuyt percaya Liverpool mampu merebut kemenangan melawan Fiorentina. bagi lini serang Liverpool. Apalagi selain Fiorentina di grup ini, Steven Gerrard cs harus meladeni perlawanan jagoan Perancis, Lyon. “Akan sangat baik jika kami mampu menang di Florence dan mendapat enam poin dari dua laga awal. Ini akan memberikan kami kepercayaan diri lebih menatap pertandingan grup lainnya,” demikian Kuyt. Pada duel lain, Barcelona menegaskan tetap akan mewaspadai striker Dynamo Kiev Andriy Shevchenko. Meski tak sehebat dulu, Barca pernah

dipermalukan Shevchenko di Nou Camp. Pada November 1997, striker Ukraina itu pernah jadi mimpi buruk El Barca dengan mencetak hatrik dalam kemenangan 4-0 kala itu. Saat ini, Kiev juga memimpin Grup F berkat kemenangan 3-1 atas Rubin Kazan di partai pembuka. Pasukan Catalan yang masih dibesut Louis van Gaal tersebut akhirnya tersingkir dengan menjadi juru kunci Grup C di bawah Kiev, PSV Eindhoven dan Newcastle. Bukan tak mungkin mimpi

Jadwal Rabu (30/9) Fiorentina vs Liverpool Debrecen vs Olympique Lyon Rubin Kazan vs Inter Milan Barcelona vs Dynamo Kiev Unirea Urziceni vs VfB Stuttgart Rangers vs Sevilla Arsenal vs Olympiakos Piraeus AZ Alkmaar vs Standard Liege buruk itu bisa terulang lagi jika Barca tak mewaspadai Sheva dan rekannya lain di Kiev. Apalagi Josep Guardiola tengah

dibuat pusing dengan badai cedera yang tengah menimpa skuadnya itu. (m33/ap/ini)

Bordeaux Kembali Ke Puncak PARIS (Waspada): Juara bertahan Girondins Bordeaux membuat Olympique Lyon hanya sebentar di puncak klasemen Ligue 1 dengan merebut kembali posisi tersebut setelah meraih kemenangan kandang 1-0 atas Stade Rennes, Senin (28/9). Bordeaux hanya sekali mencetak gol dalam pertandingan yang menghibur itu, melalui sundulan gelandang asal Brazil Wendel atas umpan silang dari Benoit Tremoulinas pada menit

ke-23, tetapi menggetarkan fans mereka dengan serangkaian gerakan cerdas. Klubasalpusat“wine”itunaik ke posisi teratas dengan 19 poin dari tujuh pertandingan, unggul dua poin dari tim di tempat kedua Olympique Lyon, yang sempat memimpin sebentar setelah kemenangan kandang 2-1 atas Toulouse pada Sabtu. “Kami tahu bahwa Rennes adalah tim kuat dan meskipun sulit kami sangat menginginkan

Reuters

Hasil lengkap: BordeauxvsStadeRennes LeMansvsRacingLens Lille vs Nice Auxerre vs Grenoble MonacovsStEtienne ASNancyvsSochaux FC Lorient vs Paris St Germain MontpelliervsBoulogne-sur-Mer OlympiqueLyonvsToulouse Valenciennes vs Marseille

1-0 3-0 1-1 2-0 1-2 2-1 1-1 1-0 2-1 3-2

posisi pertama itu,” kata gelandang Bordeaux Mathieu Chalme kepadasalurantelevisiCanalPlus. Bordeaux, mengakhiri tujuh tahun kekuasaan Lyon untuk meraih gelar pertama mereka dalam 10 tahun pada Mei lalu, sekarang sudah menjalani 21 pertandingan tanpa kekalahan dalam semua kompetisi. Sementara itu, Lille membutuhkan gol menjelang akhir pertandingan dari striker PierreAlain Frau untuk meraih hasil imbang 1-1 di kandang dengan sesama tim yang terseok-seok, Nice. Sebelumnya, Nice memimpin berkat gol Loic Remy. (m33/ant/rtr)

Santi Cazorla cs sudah lama tidak merasakan nikmatnya kemenangan bagi Villarreal.

Kapal Selam Villarreal Tenggelam MADRID (Waspada): Villarreal masih mencari kemenangan pertama mereka di ajang kompetisi La Liga musim ini setelah tendangan bebas yang luar biasa dari Juca memberi Deportivo Coruna kemenangan 1-0 di kandangnya di Stadion Riazor, Senin (28/9) dinihari. Tendangan melengkung pemain Brazil itu melesak masuk gawang pada menit kedelapan dan walaupun Villarreal membangun serangan setelah waktu turun minum, mereka tetap tidak bisa menembus penjagaan kiper Daniel Aranzubia. Pelatih baruVillarreal Ernesto Valverde menyaksikan kekalahan ketiga beruntun klubnya itu dan kinimerekaberadadiposisikedua dari papan bawah klasemen dengan dua poin. “Kami memiliki peluang dan

Hasil lengkap: Deportivo Coruna vs Villarreal Osasuna vs Sporting Gijon Espanyol vs Xerez Real Mallorca vs Valladolid Real Zaragoza vs Getafe Almeria vs Racing Santander Athletic Bilbao vs Sevilla Malaga vs Barcelona Real Madrid vs Tenerife Valencia vs Atletico Madrid terus melakukan serangan di babak kedua dan saya pikir suatu hasil imbang mungkin bisa menjadi hasil yang cukup adil,” kata PresidenVillarreal Fernando Roig kepada televisi Canal Plus. Valverde bergabung dengan pelatihValencia Unai Emery dan pelatih Atletico Madrid Abel Resino dalam berjuang menangani klub mereka untuk bisa

1-0 1-0 0-0 3- 0 3-0 2-2 0-4 0-2 3-0 2-2

lebih berprestasi dan terangkat naik ke posisi atas. Atletico Madrid, juga belum pernah menang, berhasil membukukan hasil imbang 2-2 di menit akhir saat menghadapiValencia. El Che sendiri menempati posisi ketujuh dengan delapan poin, sedangkan Atletico di posisi 18 dengan tiga poin. (m33/ant/rtr)

AP

Vedad Ibisevic (biru) mencetak gol kedua bagi Hoffenheim, Senin (28/9). Torehan tersebut juga tak terlepas dari sepatu baru Ibisevic yang berwarna kuning menyala.

Tuah Sepatu Baru Ibisevic BERLIN - Striker Hoffenheim, Vedad Ibisevic, memperoleh manfaat besar dari sepatu barunya. Melawan Hertha Berlin, ia mencetak tiga gol alias hatrik untuk membawa Hoffenheim menang telak 5-1, Senin (28/9). Berkat kemenangan ini, Hoffe kini merangsek ke posisi ketiga klasemen sementara Bundesliga. Bagi Hertha, ini merupakan dua kekalahan beruntun setelah

pekan lalu dipukul Freiburg 0-4. Ibisevic, musim lalu jadi pencetak gol terbanyak hingga paruh musim pertama, hanya perlu waktu 21 menit untuk mengemas hatrick perdananya musim ini. Dua gol pertama diciptakan pada lima menit pertama. “Dalam beberapa laga terakhir, aku tak mencetak gol dan tak bermain baik. Hari ini gol datang dengan

sendirinya, aku bermain dengan sepatu baru dan senang mencetak tiga gol,” kata Ibisevic yang sudah bermain tujuh kali musim ini. Sepatu itu setidaknya membantu pemain 25 tahun tersebut melepas tendangan keras dari jarak 15 meter yang berbuah gol pertama. Tiga menit kemudian, giliran kepalanya membuahkan gol bagi tuan rumah. Pada menit ke-21, ia lepas dari kawalan

lawan dan mencetak gol ketiganya. Setelah itu, tim tamu sempat mengejar ketinggalan melalui tendangan bebas kaki kanan Raffael. Namun, Hoffe kembali mengamuk di babak kedua. Striker Nigeria Chinedu Obasi membuat gol di menit ke-58, sebelum Eduardo menjebol gawang Hertha lewat titik putih empat menit kemudian. (m33/ant/rtr)

Klasemen: HamburgSV Bayer Leverkusen Hoffenheim Schalke04 WerderBremen VfLWolfsburg BayernMunich Mainz EintrachtFrankfurt Freiburg VfBStuttgart Borussia M’gladbach VfLBochum Hanover96 BorussiaDortmund Nuremberg Cologne Hertha Berlin

7 5 2 0 17-7 17 7 5 2 0 14-5 17 7 4 2 1 14-5 14 7 4 1 2 9-5 13 7 3 3 1 12-6 12 7 4 0 3 15-14 12 7 3 2 2 13-7 11 7 3 2 2 10-2 11 7 2 4 1 8-8 10 7 3 1 3 11-12 10 7 2 2 3 9-10 8 7 2 1 4 9-15 7 7 2 1 4 8-14 7 7 1 3 3 6-8 6 7 1 3 3 6-13 6 7 1 2 4 4-8 5 7 1 1 5 5-10 4 7 1 0 6 6-17 3


Sport

WASPADA Selasa 29 September 2009

TAK jua mendapatkan posisi di tim inti Arsenal, Carlos Vela tampaknya harus mencari opsi lain. Kebetulan, klub Spanyol, Xerez, mengincar penyerang asal Meksiko tersebut. Vela membutuhkan jam terbang yang tinggi agar ia bisa memperoleh satu tempat di timnas Meksiko yang berpeluang lolos ke Piala Dunia 2010.Tetapi hal itu tidak bisa diberikan oleh Arsenal. Meski dianggap berbakat, Vela tak cukup mendapat kepercayaan AP dari manajer Arsenal, Arsene Wenger. Bomber 20 tahun itu baru tampil sekali sebagai pengganti di laga Piala Carling kontra West Brom. Xerez, klub yang untuk sementara menghuni papan bawah Liga Spanyol, melihat hal itu sebagai peluang bagus. Tim berjuluk Azulinos itu berniat merekrut Vela Januari mendatang, entah dengan permanen atau meminjam. Kans Vela untuk menerima pinangan Xerez terbuka mengingat ia sudah berpengalaman bermain di Spanyol. Bomber lincah berkaki kiri dahsyat itu pernah dipinjamkan ke Salamanca dan Osasuna. (m33/ap/bb/ini/vvn)

siden Brazil Luiz Inacio Lula da Silva, yang intinya meminta dukungan Indonesia agar Brazil dapat mewujudkan impiannya menjadi tuan rumah Olimpiade Musim Panas 2016. “Kami sangat berharap keinginan ini dapat terwujud menjadituanrumahOlimpiade2016,” kataSantoskepadawartawanusai menemui Rita Subowo. Sebagai Anggota IOC Rita, menyambut baik tekad dan

keinginan Brazil tersebut yang begitu antusias ingin menjadi tuan rumah Olimpiade 2016. “Saya sangat menghargai tekad dan keinginan Brazil, namun semua itu akan diputuskan dalam voting saat penentuan tuan rumah Olimpiade 2016 di Kopenhagen awal Oktober ini,” kata Rita didampingi Wakil Ketua Umum KOI Indra Karta-

sasmita dan Sekjen KOI Arie Ariotedjo. Selain Rio De Janeiro, empat kota pesaing terdiri dari Chicago (Amerika Serikat), Tokyo (Jepang) dan Madrid (Spanyol). Pada Sidang Komite Olimpiade Internasional IOC di Kopenhagen nanti, tuan rumah Olimpiade 2016 tersebut baru akan diputuskan. (yuslan)

Kontingen Pomnas MEDAN (Waspada): Badan Pembina Olahraga Mahasiswa Indonesia (Bapomi) Sumatera Utara berkekuatan 125 atlet, pelatih dan ofisial untuk mengikuti Pekan Olahraga Mahasiswa Nasional (Pomnas) XI di Palembang, 9-17 Oktober. Atlet yang mengikuti Pomnas merupakan mereka yang mengikuti Pomdasu dan seleksi

beberapa waktu lalu. Menurut Ketua Umum Bapomi Sumut Drs Agussani MAP didampingi Sekretaris Budi Indra Syahdewa, Senin (28/9), Bapomi Sumut mengikuti 10 dari 12 cabang olahraga yang dipertandingkan. Cabang olahraga yang diikuti adalah atletik, gulat, karate, panjat tebing, pencak silat, renang, sepak takraw, tae-

kwondo, tenis lapangan dan tenis meja. Dua cabang olahraga yang tidak diikuti adalah sepakbola dan panahan. Disebutkan, para atlet yang dipercaya membela nama Sumut di Pomnas nanti seluruhnya merupakan hasil seleksi pihaknya dengan Pengprov masingmasing cabang olahraga. Tak lupa dalam kesempatan

itu, Agussani menyampaikan terima kasih kepada seluruh pimpinan cabang olahraga atas dukungan dan kerjasama serta bantuannya, sehingga seleksi Pomnas di Palembang berjalan lancar. Kontingen Bapomi Sumut, tambah Agussani, dijadwalkan bertolak menuju Palembang melalui Bandara Polonia Medan pada 8 Oktober. (m20)

Patriot Gelar Festival SSB U-11 MEDAN (Waspada): Sekolah Sepakbola (SSB) Patriot Medan menggelar festival sepakbola kelompok U-11 antar SSB se Sumatera Utara. Menurut Ketua Panpel Heri Dodi Saptono, festival ini merupakan agenda rutin dan rangkaian HUT SSB Patriot ketiga. Kepada Waspada, Senin (28/9), Dodi mengatakan, pendaftaran peserta dibuka 5-25 Oktober sekaligus akan dilakukan screening pemain. “Screening dilakukan untuk memastikan usia pemain yang akan bertanding dengan mencocokkan biodata dengan ijazah atau dokumen lainnya,” terang Dodi menjelaskan pertandingan dilaksanakan 31 Oktober sampai 8 November mendatang. Pelaksanaan yang sekira diikuti 48 SSB di Sumut akan dilangsungkan di lapangan SSB Patriot Jl Air Bersih Medan. “Kita sudah persiapkan lapangan untuk pertandingan. Seperti terdahulu, akan digelar di lapangan SSB Patriot Jalan Air Bersih,” terang Dodi didampingi Sekretaris Syahril WP.

Dijelaskan, setiap SSB boleh mendaftarkan lebih dari satu tim, dengan batas maksimal kelahiran pemain 1 Januari 1998. Festival ini, kata Dodi, juga sebagai bukti pembinaan sepakbola usia dini masih terus dila-

kukan dengan tujuan mencari bibit-bibit pesepakbola handal. “Festival sepakbola U-11 ini juga telah mendapat dukungan positif dari Ketua Umum SSB Patriot Medan Drs Hendra DS dan Ketua Harian Pengurus

Cabang PSSI Medan yang juga Pembina SSB Patriot Goklas Butar-butar,” tambah Dodi menambahkan tim yang mendaftar dapat menghubungi panitia di sekretariat SSB Patriot Jl Air Bersih No.114 Medan.(m11)

Event Motocross AMPI Kacau KISARAN (Waspada): Event turnamen motocross AMPI merebutkan piala Muspida Asahan yang digelar 26-27 September di Sirkuit Air Batu, Kabupaten Asahan, terbilang kacau akibat banyak dugaan pemotongan hadiah yang tidak sesuai brosur. “Kami telah memberikan semua hadiah kepada semua pemenang, termasuk sepeda motor kepada juara umum,” ungkap Sekretaris DPD AMPI Asahan, Ali Sakban, kepada Waspada, Senin (28/9). Ali mengakui, hadiah sepeda motor sempat tertunda pemberiannya karena pemenang harus memenuhi administrasinya. “Namun Senin (28/9) telah kami berikan kepada sang pe-

menang,” ujar Ali. Disinggung soal hadiah dalam brosur, dia mengatakan hadiah itu bukan tanggung jawabnya, tapi panitia. “Sama halnya hadiah yang tertera di brosur, itu bukan kami yang membuat, namun Racing Committee (RC),” tambah Ali. Menurut Ali, hasil penjualan tiket sebesar Rp45 juta telah digunakan untuk keperluan event motocross, namun uang pendaftaran sebanyak Rp12 juta dipegang RC untuk memenuhi hadiah undian. “Karena RC memegang uang, maka mereka pula yang bertanggung jawab untuk memenuhi hadiah,” imbuh Ali lagi. Sementara itu, anggota RC Ha-

bib menyatakan uang yang dipegangnya adalah honor yang akan diberikan kepada 16 anggota RC. “Uang yang saya pegang hanya untuk membayar honor anggota. Saat ini, saya dan kedua teman dari Medan pun belum mendapat honor karena harus menutupi kekurangan dana pemenang,” jelas Habib. Di tempat terpisah, Bupati Asahan Risuddin melalui Kabag Humas Rahmad Hidayat Siregar mengharapkan seluruh panitia bertanggung jawab dan dapat menyelesaikannya permasalahan dengan profesional karena event tersebut membawa nama Muspida Asahan. (csap)

8 Pemain Timnas Mangkir PALEMBANG (Waspada): Delapan pemain tim nasional (Timnas) U-23 yang dinyatakan lulus seleksi belum bergabung dalam Pelatnas SEA Games Laos di Palembang, Senin (28/9). Ofisial Timnas U-23, Deddy Riswanto, di Palembang mengatakan, kedelapan pemain itu 6 4 5 8 9 3 2 1 7

Xerez Tertarik Rekrut Vela

JAKARTA (Waspada): Brazil meminta dukungan Indonesia agar keinginan menjadi tuan rumah Olimpiade Musim Panas 2016 dapat terwujud. Demikian disampaikan Duta Besar Brazil untuk Indonesia Manuel Innocencio Santos saat mengunjungi Ketua Umum KONI/KOI Rita Subowo di Gedung KONI /KOI, Senin (28/9). Duta Besar Brazil itu menyampaikan pesan khsusus Pre-

Sumut Berkekuatan 125 Atlet

8 7 1 4 6 2 9 3 5

ARSENAL menghentikan catatan kekalahan mereka di Liga Premier, setelah mengalahkan tuan rumah Fulham berkat gol tunggal Robin van Persie. Meski demikian, Arsene Wenger memuji penampilan anak asuhnya, khususnya kiper Vito Mannone. Terlepas dari gol van Persie ini, pelatih asal Perancis ini layak memuji penampilan kiper mudanya yang berhasil tampil AP gemilang dalam laga ini. “Penampilannya membaik. Kami mengakhiri kesialan kami, dengan sikap, semangat dan ambisi. Tentu saja, dari penampilan bagus Mannone,” kata Wenger. “Anda menjalani laga demi laga, Anda menilai seorang kiper dari berapa banyak laga yang dilakoninya. Dia telah menunjukkan dirinya memiliki kualitas dan telah mengambil keputusan yang bagus, tapi Anda tidak bisa menolak kiper lainnya,” tegas The Professor. “Kemenangan ini penting bagi kami, karena kami bisa bangkit. Dengan kekalahan Chelsea, kami kembali bersaing lagi dan itu menarik. Kami dalam posisi yang kuat,” papar Wenger lagi.

Waspada/Yuslan Kisra

Duta Besar Brazil untuk Indonesia Manuel Innocencio Santos (kiri) foto bersama Ketua Umum KONI/KOI Rita Subowo di Gedung KONI /KOI, Senin (28/9).

3 2 9 1 5 7 4 6 8

Wenger Puji Habis Mannone

Tim voli putra Indonesia sukses memetik kemenangan keduanya di ajang Kejuaraan Asia Senior ke-15 setelah melibas Thailand di kompleks olahraga San Andres, Manila, Senin (28/9). -Antara-

Brazil Minta Dukungan Indonesia

4 8 6 2 3 5 7 9 1

PERBEDAAN strategi permainan rupanya mengganggu pikiran Karim Benzema. Itu dialaminya di klub Real Madrid dan tim nasional (timnas) Perancis. Sebagai pemain baru Madrid, Benzema memberikan banyak kontribusi. Tapi, justru berbeda ketika pria 21 tahun ini berseragam timnas Perancis. Benzema menjadi striker AP mena-kutkan di daratan Spanyol seiring performa Madrid yang kian mengkilap sejak awal musim. Total tiga gol dari empat penampilannya bersama Los Merengues dan terakhir dua gol ia tabung ketika Real menjamu Tenerife. Kenyataan itu berbanding terbalik dengan apa yang diraihnya di timnas saat ini. Dalam kualifikasi Piala Dunia 2010, Perancis tidak meraih hasil sempurna. Tercatat dua laga terakhir Les Bleus berakhir imbang ketika bertemu Serbia dan Rumania. Merunut hasil tersebut, mantan pemain Olympique Lyon itu yakin kalau strategi di Madrid diterapkan di timnas akan membuat penampilan Les Bleus menjadi lebih baik lagi. Selain itu, Benzema meyakini itu tidak akan melahirkan polemik dengan pelatih Perancis, Raymond Domenech. Di Real, Benzema seringkali dipasang sebagai target man sehingga bisa produktif. Beda dengan di timnas, Benzema harus berbagi posisi di lini depan dengan Thierry Henry maupun Nicolas Anelka.

babak delapan besar. India dan Thailand telah sama-sama menderita sekali kekalahan. Dua tim terbaik di Pool B akan menghadapi dua tim teratas Pool D yang diisi juara bertahan Australia, Korea, Lebanon, Qatar dan Maladewa. Sementara itu, empat tim lainnya diisi oleh dua tim terbaik dari Pool A dan C. Pool A dihuni tuan rumah Filipina, Taiwan, Kazakstan dan Myanmar, sedangkan Pool C diisi China, Iran, Hong Kong, Vietnam dan Sri Lanka. “Karena sudah mengantongi dua kemenangan, 95 persen kita sudah lolos ke babak berikutnya, tinggal menunggu hasil pertandingan lainnya. Kalau Jepang menang terus, maka sudah pasti kita lolos,” kata Li. Jika melihat kekuatan Jepang selama ini, rasanya tim Matahari Terbit ini akan memenangi semua laga di Pool B. Bila Jepang menang pada tiga laga, Indonesia akan menemani mereka ke babak delapan besar. “Belum sepenuhnya aman, tetapi peluang kita sangat besar,” ujar pelatih asal China itu menambahkan Indonesia pada partai terakhir Pool B akan menghadapi Jepang, Kamis (1/10). (yuslan)

Pencalonan Tuan Rumah Olimpiade 2016

9 5 3 7 8 1 6 2 4

Benzema Ingin Tiru Madrid

Kemenangan itu merupakan yang kedua kalinya setelah sehari sebelumnya menundukkan India 3-1. Di hadapan puluhan penduduk Indonesia yang tinggal di Manila dan mahasiswa yang tengah belajar di negeri itu, tim asuhan Li Qiujiang ini menang 3-0 (25-23, 25-21, 25-20). Dengan kemenangan ini, Indonesia selangkah lagi akan dapat mempertahankan posisi mereka layaknya dua tahun lalu ketika kejuaraan dilaksanakan di Jakarta. Saat itu, anak-anak Sentul ini berada pada posisi ketujuh. Kali ini, Indonesia tergabung pada Pool B bersama India, Thailand dan India. Hanya dua tim teratas yang berhak masuk

2 1 7 6 4 9 5 8 3

BURSA transfer memang baru kembali dibuka pada Januari 2010 mendatang, tapi itu tak lantas membuat rumor mengenai persaingan beberapa klub mendapatkan seorang pemain menjadi dingin. Salah satu pemain yang masih terus menjadi perdebatan hangat, yakni Simon Kjaer. Bek masa depan milik Palermo ini kini terus AP berusaha didekati dua klub elit Eropa, yakni Manchester United dan AC Milan. Bek Denmark berusia 20 tahun ini juga mengakui bahwa kiprahnya membela klub asal Sicilia ini kemungkinan akan segera berakhir tahun depan. Namun Milan dan MU tentu harus berani menjamin tempat utama jika ingin mendapatkan bek timnas Denmark ini. “Musim ini, mungkin akan menjadi tahun terakhir saya di Palermo, tapi mungkin juga saya akan bertahan. Yang jelas itu semua belum diputuskan. Saya baik-baik saja di Palermo dan juga masih sangat muda. Saya tidak ingin hijrah ke klub besar hanya untuk duduk di bangku cadangan,” ujar Kjaer.

MANILA (Waspada): Tim voli putra Indonesia memelihara peluang masuk babak delapan besar Kejuaraan Asia Senior ke-15 setelah melibas Thailand pada laga kedua di kompleks olahraga San Andres, Manila, Senin (28/9).

5 3 4 9 1 6 8 7 2

Pesona Kjaer Goda MU, Milan

Indonesia Jaga Peluang

7 6 8 3 2 4 1 5 9

K E P E R G I A N Wa y n e Rooney ke Manchester United beberapa tahun lalu mungkin menjadi penyesalan terbesar Everton. Tapi, kini The Toffees telah melahirkan ‘Rooney Baru.’ Sosok itu adalah Jack Rodwell. Dilansir Sport, Manajer Everton David Moyes tanpa sungkan membandingkan pemain belianya itu dengan sosok Rooney. Meski baru berusia 18 tahun, performa Rodwell memang membuat Moyes puas. AP Meski berposisi sebagai gelandang, Rodwell juga piawai menusuk pertahanan lawan dengan lincah. Tak hanya itu, penampilan menawan Rodwell kabarnya juga sempat membuat Manajer Inggris Fabio Capello jatuh cinta. “Wayne (Rooney) sesuai harapan telah menjadi talenta besar. Dan kami akan segera mendapatkan satu pasang pemain yang lain. Jack Rodwell salah satunya. Dia mempunyai karakter yang berbeda dengan Wayne. Tapi, dia sangat potensial di posisi berbeda, dan dia akan menjadi besar, talenta besar,” tambah Moyes.

1 9 2 5 7 8 3 4 6

Everton Punya ‘Rooney Baru’

7

tidak memberikan keterangan kepada ofisial Pelatnas perihal penyebab belum bergabung. “Kedelapan pemain ini tidak memberikan kabar kepada kami mengenai alasan mengapa belum bergabung. Namun, ada kemungkinan mereka mengalami kesulitan mencari tiket penerbangan ke Palembang seiring dengan padatnya jadwal penerbangan selama musim mudik lebaran,” kata Deddy. Kedelapan pemain itu adalah Nasution Karubaba (Persisam), Joko Sidik (Bontang FC), Engel Bert Sanii, Rachmat Latief, Titus Bonai (Persiram), Corneles Sergius Gedy, Sultan Samma (Persiba Balikpapan) dan Tony Sucipto (Sriwijaya FC).

Dia mengatakan, beberapa waktu lalu pelatih timnas U-23 Alberto Bica merilis namanama 25 pemain yang dinyatakan lolos seleksi tahap II. Alhasil, dari 25 pemain itu telah 17 pemain bergabung di sesi latihan Pelatnas. Ke-25 pemain itu masingmasing M Fauzan Djamal (Semen Padang), Yongky Aribowo (Persik Kediri), Dendy Santoso (Arema Malang), Lucky Wahyu (Persebaya), Rendi Siregar (Persikota Tangerang), Johan Juansyah (Persijap Jepara),Windu Anggoro, Elvis Nelson Anes (PON DKI),Yudi Choirudin (Pro Duta), Ruben Karel Sanadi, Andika Yudistira Lubis (PSMS), Frengki Irawan, Djayusman

Triasdi (PSM Makassar), Kalasut (Persi Tembilang Riau), M Ridwan (Persita U-21), Egi Melgiansyah dan Jajang Mulyana (Pelita Jaya). Dia mengatakan, dari 25 pemain ini, Alberto masih akan menambah dengan empat pemain asal Persipura Jayapura. Keempat pemain itu yakni Boaz Sollosa, Ian Kabes, Imanuel Wanggai dan Bon Satia. “Keempat pemain tidak dapat bergabung timnas U-23, karena sedang memperkuat timnas senior Indonesia,” ucapnya sembari menambahkan Pelatnas SEA Games ini telah memulai sesi latihan perdana pada 25 September lalu. (ant/m20)

Waspada/Maimun Asnawi

Wakil Walikota Lhokseumawe, Suaidi Yahya, menyerahkan piala kepada Firman Farera yang berhasil memenangi dua kelas seeded pada kejuaraan balap motor seri OMR Yamaha Putaran III 2009 di Lanud Malikussaleh Aceh Utara.

Firman Rajai RR Wakil Walikota Lhokseumawe KOTA LHOKSEUMAWE (Waspada): Firman Farera yang membela Team Yamaha Ten Mild Tan’s Motor asal Sumatera Utara, merajai Road Race Piala Wakil Walikota Lhokseumawe. Dalam event tersebut, Firman memenangkan dua kelas seeded, Bebek 4T Tune Up 110 cc dan 125 cc. Sementara itu, pembalap andalan Kota Lhokseumawe Nova S hanya memenangkan satu kelas pada MP3 (Bebek 4T Tune Up 110 cc Pemula A) setelah gagal di kelas MP4 (Bebek 4T Tune Up 125 cc Pemula A) karena tabrakan di race 15 sehingga sepeda motor yang ditung-ganginya terpaksa meninggalkan arena. Kejuaraan balap motor seri OMR Yamaha Putaran III 2009 berlangsung di Lanud Sultan Malikussaleh Aceh Utara, Minggu (27/9), memperebutkan piala Wakil Walikota Lhokseumawe. Kegiatan yang diselenggarakan oleh Profesional Speed Lhokseumawe secara umum berlangsung sukses. Ketua Pelaksana Seri OMR Yamaha Putaran III 2009, Begem mengaharapkan, pada tahun-tahun berikutnya agar kembali dilaksanakan kegiatan serupa dengan tetap didukung berbagai pihak. Delapan kelas yang dipertandingkan adalah Kelas MP 1 (Bebek Tune Up 110 cc Seeded), Kelas MP2 (Bebek Tune Up 125 cc Seeded), Kelas MP3 (Bebek 4T Tune Up 110 cc Pemula), Kelas MP4 Kelas MP3 (Bebek 4T Tune Up 125 cc Pemula), Kelas Bebek 4T Jupiter MX STD Usia 18 Thn, Kelas MP3 (Bebek 4T Tune Up 110 cc Pemula A), MP4 (Bebek 4T Tune Up Pemula A) dan Kelas MP6 (Bebek 4T s/d 125 Open). (cmun)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di kolom 8. 3

1 7 5 3 8 6 6 5 7 4 9 9 6 2 1 7 6 9 5 7 8 4 5 3 2 8 5 7 6 9 2


Sport

8

WASPADA

Selasa 29 September 2009

Akhir Tragis Bagi Sugiyama TOKYO (Waspada): Petenis nomor satu dunia, Dinara Safina, secara mengejutkan menelan kekalahan 7-6, 4-6, 7-5 dari petenis kualifikasi asal Taiwan Chang Kai-chen pada pertandingan pertamanya di Turnamen Pan Pacific Terbuka, Senin (28/9). Petenis Rusia ini, tersingkir pada babak ketiga AS Terbuka, susah-payah sejak awal pertandingan ketika melawan pemain yang peringkatnya 131 tingkat di bawahnya. “Ini saat yang tidak mudah. Saya memiliki banyak peluang pada set ketiga namun saya membiarkannya berlalu begitu saja,” kata Safina. Kekalahan ini kian menjadikan posisi nomor satu Safina sumber pertarungan setelah kegagalannya menjuarai turnamen Grand Slam perta-

ma pada 2009 dan juga melakukan awal yang buruk di Tokyo. Di laga lain, juara Perancis Terbuka Svetlana Kuznetsova juga tersingkir di setelah dikalahkan petenis Jerman Andrea Petkovic. Unggulan kelima asal Rusia, mendapat bye pada babak pertama bersama tujuh pemain unggulan lainnya, menelan kekalahan 5-7, 6-4, 3-6 pada petenis peringkat 58 itu. Petenis tuan rumah Ai Sugiyama juga terpaksa mundur

Hasil lain Maria Sharapova (Rusia) vs Francesca Schiavone (Italia) Peng Shuai (China) vs Anabel Medina Garrigues (Spanyol) Iveta Benesova (Rep Ceko) vs Virginie Razzano (Perancis) Agnieszka Radwanska (Polandia) vs Ekaterina Makarova (Rusia) Zheng Jie (China) vs Sania Mirza (India) Kateryna Bondarenko (Ukraina) vs Anna-Lena Groenefeld (Jerman) Samantha Stosur (Australia) vs Alexa Glatch (AS) Vera Dushevina (Rusia) vs Alona Bondarenko (Ukraina) Daniela Hantuchova (Slovakia) vs Jill Craybas (AS) Marion Bartoli (Perancis) vs Sorana Cirstea (Rumania) Magdalena Rybarikova (Slowakia) vs Urszula Radwanska (Polandia) pada putaran pertama sekaligus mengakhiri karirnya di tunggal putri secara menyedihkan. Adalah sakit yang menjadi penyebab Sugiyama mundur pasca bertarung selama 17 tahun. Petenis berusia 34 tahun yang juga mantan juara dunia ganda putri itu mengaku sakit

4-6, 7-5, 6-1 6-3, 6-3 3-6, 7-5, 6-0 7-5, 6-3 5-7, 6-2 6-3 6-3, 6-1 7-5, 6-0 1-6, 7-5, 6-1 6-3, 6-3 6-3, 6-0 6-4, 6-4

ketika melawan Nadia Petrova (Rusia) dalam keadaan skor 6-0, 2-1. Mundurnya Sugiyama turut mengecewakan pada pendukungnya, termasuk Putri Michiko yang khusus datang ke Ariake Colosseum untuk menyaksikan pertandingannya. (m33/ant/rtr)

Hamilton-Nicole ‘Masih’ Mesra

AP

Nicole Scherzinger dan Lewis Hamilton ternyata masih berhubungan.

SINGAPURA (Waspada): Ada pemandangan menarik dari paddock McLaren sepanjang pergelaran GP Singapura baru-baru ini. Di sana, tampak ada sosok Nicole Scherzinger yang sempat dikabarkan telah putus dari Lewis Hamilton. Itulah gosip yang ramai berkembang di tabloid-tabloid hiburan Inggris dua pekan silam. Kabar Hamilton dan Nicole putus konon dipicu oleh keengganan Hamilton menikah dan punya anak. Kemunculan Nicole di paddock Sirkuit Marina Bay menjawab semua pertanyaan itu. Keduanya tampak mesra tampil bersama di depan publik dan Hamilton menegaskan hubungannya dengan Nicole baik-baik saja.

“ Tidak, itu tidak benar. Kami masih (bersama). Saat Anda terpisah selama dua bulan, Anda pasti ingin mendengarkan suaranya,” tukas Hamilton menjawab rasa penasaran publik. Seperti biasa, Nicole yang merupakan vokalis grup Pussycat Dolls dengan setia menyaksikan setiap momen yang terjadi dengan sang kekasih di lintasan melalui monitor yang tersedia di kubu timnya. Saat Hamilton menjadi pembalap pertama yang melihat garis finish pada lomba, Minggu (27/9), Nicole dan ayah Hamilton (Anthony) turut larut dalam kegembiraan di garasi The Silver Arrows. (m33/rtr)

Gelar Kedua Monfils METZ, Perancis (Waspada): Unggulan utama Gael Monfils (foto) mengalahkan unggulan kedua Philipp Kohlschreiber 7-6, 3-6, 6-2 pada final Turnamen Metz Terbuka, Senin (28/9), sehingga mendapatkan gelarnya yang kedua di Perancis. Monfils, 23, selama ini mengincar gelar sejak meraih kemenangan pada 2005 di Sopot, Polandia. Ia kalah pada pertandingan final sejak kemenangannya itu. Melawan Kohlschreiber, Monfils memperagakan gerakan cepat dan pukulan keras untuk mengakhiri pertandingan dalam dua jam 13 menit itu. Kedua petenis sama-sama melancarkan servis keras pa-

da set pertama sehingga dibutuhkan permainan tiebreak yang dimenangi Monfils 7-1 lewat pukulan backhand cukup keras. Kohlschreiber berjuang kembali pada game keenam set kedua untuk menyamakan kedudukan, namun Monfils kembali bangkit pada set penentu dan menutup permainan dengan menggunakan pukulan forehand kemenangan pada game keenam. “Saya gembira dapat menunjukkan permainan yang benar sehingga memenangi set kedua dan ketiga. Saya gembira karena meraih gelar untuk kedua kalinya dalam turnamen di Perancis,” kata Monfils.

AP

Ai Sugiyama (kiri) turut dihibur petenis Rusia Nadia Petrova setelah terpaksa mengakhiri karirnya secara tragis di putaran pertama Turnamen Pan Pacific Terbuka di Tokyo, Senin (28/9).

AP

“Ini amat membanggakan tetapi saya belum puas. Saya baru merasa lega bila nanti dapat memenangi Prancis Terbuka,” katanya petenis yang menunjukkan ketangkasan prima sejak awal tampil di Metz. (m33/ap)

Pasang Iklan � 4528431 HP.081370328259 Email: iklan_waspada@yahoo.co.id

PELABUHAN INDONESIA I

PENGUMUMAN PELELANGAN Nomor: UM58/24/12/PI-09 PT Pelabuhan Indonesia I (Persero) akan melaksanakan Pelelangan Umum dengan Pascakualifikasi menggunakan dana internal PT Pelabuhan Indonesia I (Persero) sebagai berikut:

Reuters

Phil Mickelson (kiri) memegang trofi Tour Championship didampingi Tiger Woods yang memenangi trofi FedEx Cup, Senin (28/9).

No.

Nama Pekerjaan

Klasifikasi: Bidang/Sub. Bidang

Kualifikasi

Perkiraan Nilai Pekerjaan (Rp)

1

Perbaikan Kerusakan struktur Dermaga Internasional Belawan International Container Terminal.

Sipil/Pelabuhan atau dermaga

(Gred 5)

7.875.000.000,-

1. Persyaratan Peserta: a. Memiliki Surat Izin Usaha (SIUJK/SBU Jasa Pelaksanaan Konstruksi) yang masih berlaku. b. Perusahaan yang bergerak dalam bidang Sipil, Subbidang Pelabuhan atau Dermaga. c. Dalam waktu 7 (tujuh) tahun terakhir telah berpengalaman dalam perbaikan Struktur Dermaga Pelabuhan Laut dengan nilai pekerjaan minimal Rp. 3.937.500.000,- (Tiga milyar sembilan ratus tiga puluh tujuh juta lima ratus ribu rupiah). 2. Persyaratan Pendaftaran a. Pendaftaran harus dilakukan sendiri oleh pimpinan perusahaan yang namanya tercantum dalam akte pendirian perusahaan/daftar susunan pengurus perusahaan atau dikuasakan dengan menunjukkan KTP asli yang masih berlaku. b. Pada saat mendaftar menyerahkan foto copy Surat Izin Usaha (SIUJK/SBU Jasa Pelaksana Konstruksi) yang masih berlaku, Akta Pendirian Perusahaan yang telah disahkan oleh Menteri Kehakiman (berbentuk PT) dan oleh pengadilan (Badan usaha yang lain), pengalaman kerja perusahaan, KTP pendaftar (seluruhnya memperlihatkan aslinya). c. Pada saat mendaftar menandatangani Pakta Integritas. d. Membayar biaya pengganti dokumen lelang sebesar Rp 750.000,- (tujuh ratus lima puluh ribu rupiah). 3. Pendaftaran dan pengambilan dokumen lelang pada: a. Hari : Rabu s.d. Jumat (pada hari kerja) b. Tanggal : 30 September s.d. 2 Oktober 2009 c. Jam : 08.00 s.d. 16.00 WIB d. Tempat : Kantor Pusat PT (Persero) Pelabuhan Indonesia I, Biro Logistik Lantai III, Jln. Krakatau Ujung No. 100 Medan. 4. Aanwijzing pada: a. Hari : Selasa (pada hari kerja) b. Tanggal : 6 Oktober 2009 c. Jam : 10.00 WIB d. Tempat : Kantor Pusat PT Pelabuhan Indonesia I (Persero) Biro Logistik Lantai III, Jln. Krakatau Ujung No. 100 Medan. Medan, 28 September 2009

PT PELABUHAN INDONESIA I (PERSERO) BIRO LOGISTIK


Medan Metropolitan

WASPADA

Selasa 29 September 2009

9

Bupati-Walikota Diminta Waspadai Banjir

Waspada/Surya Efendi

FLY OVER AMPLAS: Kendaraan roda dua melaju di atas fly over Amplas, Senin (28/9). Fly over yang dibuka untuk mengantisipasi arus mudik dan arus balik itu sangat tepat. Kondisi persimpangan Terminal Terpadu Amplas yang biasanya padat kini lancar.

PLN Belum Dapat Pastikan Listrik Normal MEDAN (Waspada): PT PLN (Persero) Wilayah Sumatera Bagian Utara belum dapat memastikan pasokan listrik ke pelanggan normal kembali, setelah terjadi gangguan pembangkit besar di Belawan pada 24 September 2009 yang menyebabkan 38,07 persen daya atau sebesar 495 MW hilang. Pasalnya, kerusakan diakibatkan pemakaian secara maksimal menjelang Ramadhan hingga Hari Raya Idul Fitri, sehingga beberapa mesin pembangkit mengalami gangguan. Bahkan ada suku cadang (sparepart) yang rusak dari mesin pembangkit sampai kemarin masih dicari di gudang mesin pembangkit di Jakarta, Muara Tawas yang sama dengan mesin pembangkit di Belawan. General Manager Pembangkitan Sumbagut, Misbachul Munir, kepada wartawan di Kantor PLN Wilayah Sumbagut, Senin (28/9), menyatakan keberadaan sparepart mesin pembangkit itu baru dapat diketahui informasinya Selasa (29/9) pagi. “Jika sparepart itu tersedia di pembangkit Muara Tawas, maka paling lambat 5 Oktober 2009 dibawa ke Medan sehingga mesin dapat beroperasi kem-

bali,” ujarnya. Namun, lanjutnya, jika opsi itu tidak berhasil maka kita akan melakukan pembelian ke manufacturing yang memungkinkan memakan waktu yang cukup lama atas persediaan sparepart tersebut. General Manager Wilayah Sumbagut, Manarep Pasaribu, menyatakan pada 24 September 2009 yang lalu beberapa mesin pembangkit PLN mengalami gangguan, dimana dua unit GT (gas turbin) 21 dan GT 22, satu unit PLTU DI PLTGU Sicanang, Belawan dan PLTU Labuhan Angin. “Hal ini mengakibatkan berkurangnya kemampuan pasokan listrik PLN sebesar 495 MW atau 38 persen dari total beban puncak sehingga PLN terpaksa melakukan pemadaman listrik bergilir ke beberapa daerah secara tersebar,” ujarnya. Hingga saat ini, lanjutnya,

Camat Medan Perjuangan Diganti MEDAN (Waspada): Pj Walikota Medan, Rahudman Harahap mengganti Camat Medan Perjuangan, Syaifuddin Harahap karena tersandung masalah tindak pidana kriminal. Penggantinya Sekcam Medan Tembung, Budi Haryono. “Camat Medan Perjuangan telah bertindak arogan kepada bawahan. Tindakan ini tak pantas dan telah mencoreng muka pemerintah Kota Medan,” katanya, (28/9) di Kantor Walikota Medan. Rahudman menjelaskan, tindakan pencopotan sudah melalui koordinasi dengan Sekda Medan dan para asisten serta adanya hasil pemeriksaan yang dilakukan Inspektorat Kota Medan. Sehingga kesimpulan pencopotan harus dilakukan untuk menegakkan kebenaran. Rahudman menegaskan, tugas harian Camat Medan Perjuangan harus melaksanakan kinerja dengan baik dan bersinergi. Tugas ini diberi waktu selama satu bulan, bila ternyata tidak mampu maka akan dilakukan evaluasi kembali. Kilaf Camat Medan Perjuangan, Syaifuddin saat dikonfirmasi wartawan di Poltabes Medan mengatakan bahwa dia saat itu kesal dengan ulah bawahannya sehingga dia kilaf. Syaifuddin mengatakan saat itu dia hanya mengacungkan senjata gas. “Saat itu saya kilaf,” ujarnya. (h10/m39)

Boleh Miliki Senpi Bila Ada Izin MEDAN (Waspada): Kapoltabes Medan, Kombes Pol Drs Imam Margono menegaskan, masyarakat sipil diperbolehkan memiliki senpi (senjata api) apabila ada izinnya. “Terus terang saja, perampok sekalipun bila mempunyai izin boleh memiliki senpi. Karena semuanya itu berdasarkan surat izin. Tidak ada larangan bagi masyarakat yang punya senpi tapi dengan satu catatan harus memiliki surat izin kepemilikan,” jelasnya kepada wartawan ketika dihubungi melalui telefon selular, Senin (28/9). Dijelaskan, bila ada warga sipil yang memiliki izin tapi tidak dilengkapi dengan surat, maka pihaknya akan memprosesnya secara hukum dan bila perlu akan melakukan penangkapan. “Namun bila ada masyarakat sipil yang memiliki senpi dilengkapi surat izin, maka pihak kepolisian akan melakukan pendataan,” katanya. Bukan berarti, lanjutnya, memiliki senpi dengan surat izin bisa menggunakannya sesuka hati. Bila ada ditemukan warga sipil yang memiliki senpi resmi dengan surat dan digunakan untuk melakukan tindak pidana, maka akan diambil tindakan tegas dan diproses secara hukum yang berlaku. (m39)

sedang dilakukan proses pemulihan secara maksimal sehingga dapat kembali beroperasi dalam waktu yang tidak lama lagi. Seperti 27 September 2009, satu unit GT dan sebagian PLTU telah kembali normal atau dapat memasok daya ke sistem kelistrikan sebesar 190 MW. “Sedangkan PTLU Labuhan Angin berkapasitas 115 MW direncanakan akan berfungsi kembali Rabu (30/9). Dan untuk satu unit GT lainnya akan diusahakan akan pulih dalam waktu dekat karena masih menunggu perbaikan kerusakan yang ada,” ujarnya. Menurut Pasaribu, daya PLN yang berkurang berimbas kepada pelanggan saat ini berkisar 180 MW, dimana pada siang hari untuk pelanggan akan dikenakan pemadaman sebesar 100 MW, pelanggan industri & bisnis (TM) sebesar 50 MW, sedangkan pelanggan industri (TT) sebesar 30 MW. Pada malam hari untuk pelanggan rumah tangga akan dikenakan pemadaman sebesar 110 MW, industri & bisnis (TM)

sebesar 20 MW, dan pelanggan industri (TT) sebesar 70 MW. Begitupun untuk pelanggan RT kita akan melakukan pemerataan seadil-adilnya. “Setelah nantinya kembali normalnya PLTU Labuhan Angin pada 30 September nanti, maka defisit akan mengalami penurunan sehingga pemadaman tidak mencapai 4 jam kembali,” sebut Pasaribu. Dia atas nama manajemen PLN Sumbagut menyampaikan permohonan maaf atas ketidaknyamanan yang ditimbulkan akibat pemadaman. Sementara GM PLN Pikitring Wilayah Aceh Dan Sumut, Bintatar Hutabarat, menyatakan kerusakan mesin pembangkit PLTU yang saat ini sedang dilakukan percobaan bersifat minor, jika dibiarkan akan menyebabkan kerusakan fatal terhadap mesin pembangkit. Ibu Rumah Tangga Repot Padamnya listrik akhirakhir ini semakin membuat ibu rumah tangga kerepotan, terutama mereka yang bekerja tetapi tidak mempunyai pemban-

tu rumah tangga. Pemadaman sering membuat kacau rencana menyiapkan sarapan anakanak dan menyiapkan makan malam untuk keluarga. Demikian Kemalawati, Divisi Hukum dan HAM, Badan Kerjasama Organisasi Wanita (BKOW) Sumut, Senin (28/9). Menurut Kemala, Gubsu harus memberikan perhatian serius terhadap masalah ini. Bila perlu ikut memberikan masukan kepada PLN agar pemadaman tidak dilanjutkan lagi. Apalagi, kata Kemala, Gubsu pernah berjanji tahun 2009 ini tidak akan ada pemadaman. “Penggunaan listrik untuk keperluan mengolah makanan begitu penting, terutama bagi wanita bekerja yang punya waktu sedikit untuk menyiapkan makanan pagi dan sore hari. Jika hendak bekerja, dengan waktu yang sempit ternyata listrik padam, bagaimana menyiapkan keperluan memasak,” ujarnya. Begitu juga, lanjutnya, saat listrik padam pada sore hari sepulang bekerja, semakin membuat sulit. (m38/m36)

DPRDSU: Bentuk Pansus PLN MEDAN (Waspada): Meski sedang disibukkan dengan pembentukan alat kelengkapan dewan, namun anggota DPRD Sumatera Utara yang baru dilantik perlu segera menyikapi kebijakan pemadaman listrik PLN di daerah. Bila perlu, dewan membentuk Pansus (panitia khusus) untuk meminta pertanggungjawaban manajemen PLN Sumut. “Karena sudah beberapa periode anggota dewan berlalu, tapi persoalan krisis listrik di Sumut seperti tidak pernah selesai. Padahal persoalan PLN selalu itu-itu saja,” kata Bendahara Fraksi PDI Perjuangan DPRDSU, Brillian Moktar, kepada Waspada di gedung dewan, Senin (28/9). Brillian mengatakan, sebagai perusahaan yang disubsidi

oleh negara dan selalu memonopoli penjualan listrik di Indonesia, maka sikap PLN yang selalu melakukan pemadaman dan meminta maaf dengan alasan kerusakan sudah tidak wajar lagi. Apalagi melihat besarnya tarif listrik saat ini, seharusnya PLN sudah tidak layak lagi menerima subsidi. Brillian yakin persoalan kerusakan dan krisis listrik di Sumut pasti disebabkan kesalahan manajemen. Karena segala fasilitas dan kemudahan sudah diberikan kepada PLN. Seharusnya sudah tidak ada lagi masalah. “Berarti ada miss management di internal PLN.” Karena itu, menurut Brillian, sebagai perpanjangan tangan rakyat Sumut, DPRDSU harus segera menyikapi persoalan krisis listrik yang beru-

jung dengan kebijakan pemadaman bergilir yang dilakukan PLN. Salah satunya dengan cara segera membentuk Pansus untuk meminta pertanggungjawaban manajemen PLN terhadap masyarakat. Secara terpisah, Ketua Fraksi PPP (Partai Persatuan Pembangunan) DPRDSU, Fadly Nurzal, meminta PLN Sumut untuk tidak memancing emosi masyarakat Sumut dengan melakukan pemadaman listrik saat masyarakat membutuhkan listrik. “Kebijakan PLN untuk menyelesaikan persoalan jangan hanya searah. Seharusnya PLN bisa membuktikan kalau mereka sahabat masyarakat dan masyarakat sahabat PLN. Sesama sahabat jangan menyakiti,” ujarnya Ketua DPW PPP Sumut itu. (h11)

MEDAN (Waspada): Gubsu kembali mengingatkan para bupati dan walikota mempersiapkan satuan pelaksana bencana alam seiring laporan Badan Meteorologi Klimatologi dan Geofisika (BMKG) yang mengumumkan peringatan dini akan terjadinya hujan lebat, petir dan angin kencang di wilayah Sumatera Utara. “Laporan BMKG sampai akhir tahun wilayah Sumut berpotensi hujan lebat disertai petir dan angin kencang sehingga berpotensi menimbulkan banjir besar seperti yang pernah terjadi di Bahorok maupun di Madina,” kata Syamsul Arifin kepada wartawan di Gubernuran Medan, Minggu (27/9). Gubsu mengatakan, laporan BMKG dalam kurun waktu 3 hari kemarin curah hujan cukup tinggi mencapai 273/mm selama 8 jam rata-rata. Padahal banjir bandang di Bahorok tahun 2002 curah hujan hanya mencapai 101/mm. Karenanya kata Gubsu, bagi daerah kabupaten/kota yang berpotensi hujan lebat seperti Medan, Deliserdang, Sergai, Langkat, Asahan, Labuhan Batu, Tebing Tinggi, Sibolga dan Madina agar melakukan kewaspadaan dini. “Siapkan kebutuhan logistik, obat-obatan, kebutuhan penanggulangan bencana dan yang paling penting berikan so-

sialisasi kepada masyarakat untuk mewaspadai fonemena alam ini,” tegas Gubsu didampingi Kadis Kominfo, Eddy Syofian. Bagi masyarakat yang tinggal di bantaran sungai agar melakukan kewaspadaan bahkan siapkan ronda untuk mengantisipasi munculnya banjir. Gubsu juga kembali mengingatkan untuk tidak melakukan penebangan liar dan minta aparat di daerah melakukan pengawasan dan tindakan hukum bagi pelakupelaku illegal logging. Menurut informasi BMKG, fonemena alam ini akibat aktifitas daerah tekanan rendah di Samudra Pasifik sebelah timur Filipina mempengaruhi kondisi atmosfir di wilayah sekitar Indonesia dengan terbentuknya daerah pusaran angin yang memanjang dari Sumatera Bagian Utara, Laut China Selatan dan perairan lainnya. Sementara dilaporkan, Wagubsu Gatot Pujonugroho, Senin (28/9), memimpin Rakor Penanggulangan Bencana di Kecamatan Natal Madina sekaligus memantau dampak bencana yang sampai hari ini masih masa tanggap darurat yang akan berakhir 29 September. “Bapak Wagub memimpin Rakor yang diiikuti pimpinan SKPD Provinsi dan Pemkab Madina untuk mengevaluasi bantuan dan kendala di lapang-

an sekaligus untuk membahas apakah masa tanggap darurat masih diperpanjang atau dihentikan” ujar Kadis Kominfo kepada wartawan. Menurut Eddy Syofian, Gubsu telah memerintahkan Sekdapropsu untuk melakukan inventarisasi permasalahan dan menugaskan Bappeda Sumut bekerjasama dengan Pemkab Madina menyusun daftar kebutuhan dalam menyiapkan tahap masa Rehabilitasi dan Rekonstruksi. Dalam masa rehabilitasi dan rekonstruksi Gubsu telah menugaskan Sekda membahas dengan pihak pusat atas kerugian material baik infrastruktur dan fasilitas publik milik pemerintah maupun milik masyarakat termasuk persawahan dan pertanian lainnya. Dalam kesempatan ini Gubsu juga meminta Pemkab Madina agar menugaskan Dinas Pendidikan setempat untuk tetap menjalankan proses belajar mengajar di pengungsian karena mulai Senin ini proses belajar akan dimulai. Dalam kunjungan ke Madina, Wagubsu juga menyerahkan bantuan dana tanggap darurat dari Gubernur Sumatera Utara sebesar Rp100 juta dan diharap agar semua bantuan yang masuk dicatat dengan baik, akuntabel dan transparan.(m19)

Pembongkaran Kios Di Atas Parit Gagal MEDAN (Waspada): Rencana pembongkaran terhadap beberapa lapak pedagang kaki lima dan bangunan kios di atas parit di Jalan Bhayangkara Ujung/Simpang Jalan Pancing gagal dilaksanakan, akibat lambatnya alat berat (skopel) dan personel PP Pemko Medan turun ke lokasi, Senin (28/9). Lurah Indra Kasih, Kecamatan Medan Tembung, Ramli Lubis, mengatakan, meski gagal dilakukan kemarin, pembongkaran tetap akan dijadwal ulang. Sedangkan skopel hari itu baru datang sejam lebih dari waktu yang ditentukan pukul 09.00 yang telah dihadiri pejabat Muspika. Menurut Ramli didampingi Kasie Trantib, Medan Tembung,

Suwarno, rencana pembongkaran dilakukan sesuai surat perintah Camat Medan Tembung, Azwanto, pada 12 Agustus 2009 dan 24 September 2009. Sebelumnya, camat telah meminta agar pemilik bangunan kios/PKL segera membongkar bangunan sebelum ada pembongkaran dari Pemko. Namun, imbauan itu tidak diindahkan. Secara terpisah, koordinator alat berat Dinas Bina Marga Kota Medan, Buchari, mengatakan, kendala lambatnya turun skopel ke lokasi itu karena hari bersamaan mereka membersihkan lapak dan bangunan kios di atas parit di Jalan Bulan dan Sutomo. Secara terpisah, para peda-

gang, mengatakan keberatan digusur alasannya karena mereka sudah bertahun-tahun berjualan di lokasi itu. Pedagang, Suherman dan Suhendro, mengatakan, mereka telah membayar uang sewa kepada Golkar Sinulinnga Cs yang mengaku sebagai pemilik kios. “Silahkan gusur, tapi beri kami diberi ganti rugi untuk tempat usaha,” ujar pedagang itu menambahkan camat Medan Tembung jangan memanfaatkan surat edaran walikota terkait penggusuran untuk kepentingan kelompoknya. Masalah ini juga telah diadukan pedagang kepada ketua DPRD Kota Medan (Komisi C) tertanggal 1 November 2008 dan 1 Desember 2008. (m25)

Kuis THR Waspada-Honda Periode IV Berakhir

Warga Karantina II Medan Raih Hadiah Utama MEDAN (Waspada): Iswandi, warga Jl. Karantina II No.65 Medan, memenangkan hadiah utama Kuis THR WaspadaHonda periode keempat, pada pengundian di Lantai 3 Gedung Bumi Warta Harian Waspada Medan, Senin (28/9). Iswandi memenangkan hadiah uang tunai senilai Rp 1,5 juta setelah kupon miliknya diundi Redaktur SumutWaspada, M. Zeini Zein, disaksikan panitia dan karyawan. Ketua panitia kuis Zultamser, SE mengatakan, antusiasme peserta pada periode IV cukup tinggi, dimana kupon yang masuk mencapai 30-an ribu lembar. “Kuis terselenggara berkat kerjasama HarianWaspada dan Honda serta didukung beberapa sponsor yakni, Harian Berita Sore, BNI, Bank Sumut, Telkomsel, Bank BPD Aceh dan AXIS. Kuis ini merupakan agenda tahunan Harian Waspada di bulan suci Ramadhan yang dipersembahkan bagi pembaca setia Waspada,” jelas Zultamser. Selain pemenang hadiah Rp 1,5 juta, juga terdapat 2 pemenang uang tunai Rp 800 ribu,

4 pemenang Rp 600 ribu, 6 hadiah mulai Kamis (1/10), di pemenang Rp 400 ribu, dan 10 Harian Waspada, Jl. Letjen pemenang Rp. 200 ribu. “Para Suprapto/Brigjen Katamso No. pemenang dapat mengambil 1 Medan (jam kerja),” katanya. Daftar Pemenang Kuis THR Waspada-Honda Pemenang Utama Rp. 1,5 juta · Iswandi, Jl. Karantina II No.65 Medan 2 Pemenang @ Rp. 800 ribu · Ramadhana Jl. Limau Manis Gang Armed Deli Serdang · Suken Jl. Bunga Asoka Pasar VI Kec. Medan Selayang 4 Pemenang @ Rp. 600 ribu · Usrijal Pulungan Jl. Sekata Gang Mawar Medan · Rinaldy Jl. Abadi, Setia Budi Medan · Susilawati Jl. Pasar Merah Medan · Siti Nurahmi Jl. Brigjen Katamso Gang Rame Medan 6 Pemenang @ Rp. 400 ribu · Chairuddin Lubis Jl. Perjuangan Gg. Keluarga No.120 C Medan · Sugiman Jl. Pantai Labu Kebun Kelapa Lubuk Pakam · Syahfitri Jl. Letda Sujono Gang Aman Medan · Nor Asrul Jl. Halat Gang Makmur No.12 Medan · Dendi Purnama Jl. Marelan Gang Syukur Medan · Nopidawati Jl. Rawa Sembilan No.66 Medan 10 Pemenang @ Rp. 200 ribu · Syahrial JL. Buku Ayahanda Medan · M. Fikri Jl. Pertahanan Medan · Khairul Jl. Bandar Labuhan Tanjung Morawa · Abadi Jl. Jeruk Atas No.20 Pematang Siantar · Syahrul Jl. Seto No.1 Medan · Irvan Zulfani Jl. Marelan I Pasar IV Barat Gg. Keramat No.63 · Pupu Diana Jl. Gurilla Gang Kartiwi No.1 Medan · Zainuddin Jl. Selamat, Simpang Limun Medan · HM. Siregar Jl. Pimpinan Gang Salam No.4 Medan · Dedi Syahputra Jl. Sosro No.04 B Medan Tembung (cmai)

Hari Ini Rapat Bahas Penertiban Ternak Babi MEDAN (Waspada): Pj Walikota Medan, Rahudman Harahap mengatakan, pihaknya sedang menyusun langkah melakukan penertiban ternak kaki empat di wilayah Kota Medan. Salah satunya meminta masukan dari Muspida Plus sehingga pemindahan ternak kaki empat dapat berjalan lancar. Rahudman mengatakan itu ketika dikonfirmasi, Senin (28/ 9) di kantor Walikota menanggapi lambannya penertiban ternak babi. Bahkan hingga kini belum lahir Peraturan Walikota (Perwali) Medan terkait untuk penertiban ternak kaki empat. “Besok (hari ini) saya akan melakukan rapat koordinasi

dengan Muspida Plus. Bila dalam rapat itu nantinya didapatkan langkah-langkah, maka dengan segera kita lakukan penertiban,” ucapnya. Rahudman menyebutkan, pelaksanaan penertiban ternak itu tetap harus dilaksanakan, hanya saja pelaksanaannya masih dibahas. Hal ini juga berkaitan dengan pembersihan di wilayah yang ada ternak kaki empat. “Kita ingin kota Medan bersih dan tertata. Untuk itu, penertiban ternak kaki empat harus berjalan agar Medan yang menuju Kota metropolitan, madani dan religus dapat terwujud. Apalagi daerah Kecamatan Medan Denai merupakan larangan

untuk berternak kaki empat,” paparnya. Di tempat terpisah, pimpinan sementara DPRD Medan, Surianda Lubis menegaskan, penertiban ternak kaki empat diKotaMedankhususnyaMedan Denai jangan sampai menimbulkan kesan lambat, makanya dari mulai sekarang harus dibuat aturan hukumnya serta komitmen untuk penertiban. “Kita sangat mengharapkan Pemko segera menertibkan ternak kaki empat di Medan khususnya Medan Denai. Jangan sampai masyarakat beranggapan Pemko tidak pernah berpikir untuk menertibkan ternak itu,” demikian Surianda Lubis. (h10)

Waspada/Mursal AI

MENUNJUKKAN: Redaktur SumutWaspada M.Zeini Zein (tengah) menunjukkan nama pemenang hadiah utama di lantai 3 Gedung Bumi Warta Harian Waspada, Senin (28/9).


Medan Metropolitan

10

WASPADA

Selasa 29 September 2009

Sumut Belum Bebas Campak Dan Polio MEDAN (Waspada): Provinsi Sumatera Utara (Sumut) belum terbebas dari wabah penyakit campak dan polio. Sedang di tingkat nasional, baru tiga daerah saja yang bebas dari kedua penyakit tersebut, yakni Bali, Nusa Tenggara Barat dan Jogjakarta.

hatan yang ingin mereduksi penyakit campak dan melakukan eradikasi penyakit polio di Indonesia pada tahun 2010 nanti. Selain itu, pihaknya juga ingin menghilangkan kelompok rawan campak di daerah risiko tinggi dan menjangkau

“Karena itulah pemerintah pusat melalui Departemen Kesehatan akan mengampanyekan pentingnya imunisasi campak dan polio kepada bayi-bayi di seluruh Indonesia, termasuk di Sumut, agar nantinya terbebas dari penyakit tersebut,” ujar Kepala Dinas Kesehatan Provsu dr Chandra Syafei, SPOG, dalam pertemuan dengan Asisten III Provsu, Asrin Naim, di Kantor Gubsu, Senin (28/9). Chandra saat itu didampingi Konsultan WHO untuk Kampanye Campak dan Polio Tambahan di Sumut, dr Bikash Lamichhane. Sementara Asrin Naim didampingi Kepala Biro Pemberdayaan Perempuan, Vita Lestari dan Pelaksana Kepala Bidang Humas Pimpinan Provsu, Maike Moganai Ri-

Program Kerja DPRD Medan Lamban

tonga, SH. Kata Chandra, di tahun 2006 Sumut tidak memiliki sedikitpun kasus penderita campak dan polio. Namun sepanjang tahun 2007-2008, jumlah penderita kedua penyakit itu mencapai 555 orang. Dan tahun ini, hingga bulan Juli terdapat 164 penderita campak dan polio. “Kami menargetkan 95% dari penderita penyakit polio dan campak harus bisa sembuh,” kata Chandra. Selain itu, pihaknya akan melakukan kampany e pemberantasan kedua penyakit itu di semua Posyandu yang ada di Sumut. Chandra mengatakan, pihaknya ingin menjalankan program Departemen Kese-

283 CPNS Depagsu Terima SK MEDAN (Waspada): Sebanyak 283 orang pelamar umum di lingkungan Kanwil Departemen Agama Provsu menerima SK CPNS yang diserahkan langsung oleh Kakanwil Depagsu, Syariful Mahya Bandar di aula kantor itu, Senin (28/9). Hadir dalam acara itu, Kabag Tata Usaha, H.M Idrus Hasibuan, Kasubag Hukmas/ KUB, Solehuddin dan undangan lainnya. Mahya mengatakan, dari angkatan formasi tahun 2008, sampai saat ini masih ada 40 orang lagi yang masih dalam proses penyelesaian SK CPNS-nya di Departemen Agama RI. CPNS ini terdiri dari: tenaga administrasi, penyuluhan dan guru. Sebelumnya, Kabag TU H.M.Idrus Hasibuan menyebutkan pelamar umum yang diusulkan ke Depag RI sebanyak 323 orang. Sedangkan yang terbit SK-nya baru 283 terdiri dari CPNS di Kanwil 4 orang, Kandepag Tapteng 51 orang, Nias Selatan 23 orang, Humbang Hasudutan 23 orang ( 1 orang mengundurkan diri), Samosir 20 orang, Serdang Bedagai 21 orang, Padang Sidempuan 9 orang, Mandailing Natal 13 orang, Labuhan Batu 12 orang, Kabupaten Langkat 14 orang, Toba Samosir 3 orang, Asahan 13 orang, Tanjung Balai 1 orang, Pakpak Barat 5 orang, Sibolga 4 orang, Pematangsiantar 6 orang, Kota Medan 5 orag, Binjai 3 orang,Tebing Tinggi 2 orang, Nias 6 orang, Simalungun 4 orang, Tapsel 12 orang, Deliserdang 9 orang,Taput 7 orang,Dairi 6 orang dan Karo 7 orang. (m36)

Tender Di Palas Diduga Tak Sesuai Kepres MEDAN (Waspada): Panitia tender di Kabupaten Padang Lawas untuk peningkatan jalan jurusan Mondang-Pinarik Kec. Batang Lubu Sutam dengan nomor paket 04 diduga tidak mengikuti peraturan Kepres. Hal ini disampaikan Direktur PT. Koalisi Bumi Agung Ir. Sori Pada Hasibuan melalui Jubir Harahap di kantor Waspada, Senin (28/9). Menurutnya, berdasarkan Kepres, panitia lelang harus memberi kesempatan kepada pengikut lelang untuk memeriksa keabsahan dokumen, baik dari segi administrasi maupun teknis. “Pembukaan lelang pada Jumat (11/9) lalu dinilai tidak sehat. Sebab, pengikut lelang tidak diberi kesempatan untuk melihat dan memeriksa keabsahan dokumen. Panitia lelang juga menginstruksikan tidak boleh membuat sanggahan di waktu pembukaan penawaran. Kami menilai ada permainan antara panitia lelang dengan kontraktor yang menang, kita dari PT. Koalisi Bumi Agung (kalah-red) merasa dirugikan” terang Jubir. Untuk itu, Jubir meminta agar tender peningkatan jalan Mondang-Pinarik Kec. Batang Lubu Sutam dengan nomor paket 04 diulang. “Dan pihak-pihak terkait untuk memeriksa keabsahan ketiga pemenang tender.” (cmai)

Grand Angkasa Sumbang Rp17 Juta Ke RZI MEDAN (Waspada): Grand Angkasa International Hotel menyerahkan sumbangan zakat dari hasil penjualan 1.430 cokelat kepada Rumah Zakat Indonesia (RZI) di lobi hotel itu, Senin (28/9). Sumbangan itu diserahkan langsung oleh General Manager Hotel Grand Angkasa Internasional Terence T Lee kepada Yudha E. Setiawan selaku Program Manager Sumatera Rumah Zakat Indonesia. Asisten Public Relation Manager Hotel Grand Angkasa Idawati Onggo menjelaskan, sebagaimana yang diketahui masyarakat umum, pihak hotel bekerjasama dengan Gordon Max dan PT Gandum Mas Kencana membuat 1430 cokelat berbentuk bulan dan bintang yang digantung di lobi hotel sejak 19 Agustus 2009. Setiap cokelat seharga Rp20.000 per batang dan sebulan terkumpul dana Rp17.500.000. Hasil penjualan diserahkan kepada RZI. Sementara itu, Yudha E Setiawan dari RZI mengatakan, selama Ramadhan ini, pihaknya telah memperoleh dana Rp1 ,3 miliar dan mengalami peningkatan dari tahun sebelumnya. (cat)

Rektor UMY Hadiri Halal Bi Halal Kaumy MEDAN (Waspada): Rektor Universitas Muhammadiyah (UMY) Yogyakarta, Ir Dasron Hamid, Msi menghadiri halal bi halal keluarga alumni Universitas Muhammadiyah Yogyakarta (Kaumy) di Semba Café Medan, Jumat (25/9). Rektor merasa bangga dengan rasa cinta dan kebanggaan para alumni pada almamaternya. ‘’Saya merasa bangga melihat para alumni yang mencintai dan juga membanggakan kampus tempatnya menuntut ilmu,’’ ujar Rektor UMY. Hadir juga dalam acara itu Sekretaris Umum DPP Kaumy Satriawan Guntur Zass, SH, Ketua DPD Kaumy Boyke Chandra, Sekretaris DPD Agus Marwan dan para alumni yang berasal dari berbagai daerah di Sumut dan Aceh. Pada acara itu rektor menyampaikan beberapa kemajuan yang dicapai UMY. Antara lain kerjasama dengan universitas di luar negeri seperti Australia, Arab Saudi, Iran, Amerika Serikat, Singapura dan Irak. UMY juga telah memiliki berbagai prestasi seperti juara lomba robot nasional dan juara debat bahasa Ingggris. ‘’Para dosen juga sudah 80 persen lulus Strata-2, 10% Strata3 dan UMY juga sudah memiliki tiga guru besar sendiri,’’ katanya. Sementara Guntur menyatakan bahwa ke depan Kaumy akan menjalin hubungan intensif dengan berbagai pihak termasuk dengan Gubsu. Dia menekankan agar Kaumy juga memiliki andil untuk merumuskan dan mengusulkan ide-ide cemerlang pada Muktamar Muhammadiyah ke-100 pada tahun depan. Muktamar ini sendiri akan digelar di UMY. ‘’Kita juga perlu memberdayakan DPD-DPD di daerah untuk semakin memiliki peran yang setrategis,’’ kata Guntur yang berniat mencalonkan diri menjadi Bupati Asahan ini.(m12)

MEDAN (Waspada): Program kerja DPRD Medan berjalan sangat lamban. Sampai Senin (29/9), praktis anggota dewan periode 2009-2014 belum melakukan kerja apapun. Sementara pelaksanaan rapat pembentukan alat kelengkapan dewan yang dijanjikan ketua sementara Denni Ilham Panggabean, hari itu belum berlangsung. Menurut pengamatan wartawan, sejak dilantik tanggal 15 September 2009, sampai kini anggota DPRD Medan belum melakukan kegiatan. Pelaksanaan program DPRD berjalan sangat lamban. Jangankan untuk melaksanakan fungsi dan tugas dewan, membentuk alat kelengkapan dewanpun belum dilakukan. Setiap hari, sejumlah anggota dewan yang datang ke kantor hanya mondar-mandir dan duduk ngobrol. Tidak ada pembahasan masalah pekerjaan. Lepas tengah hari, umumnya anggota dewan sudah tidak nampak lagi di kantor itu. Seorang anggota dewan Muslim Maksum Lc, kepada wartawan mengaku belum dapat melakukan tugas-tugas karena belum tahu membidangi apa. Katanya, jangankan komisi, fraksi-fraksi juga belum

anak yang belum mendapatkan imunisasi polio dan campak pada pelayanan rutin. Pihaknya berharap, Gubsu bersedia membuka kampanye anti-kedua penyakit itu yang dijadwalkan pada 8 atau 9 Oktober di Medan.

dibentuk. Seharusnya, kata Muslim Maksum, dewan segera menetapkan fraksi-fraksi dan membentuk panitia khusus (Pansus) yang bertugas untuk menyusun tata tertib (Tatib). Dari sanalah kemudian alat kelengkapan dewan lainnya, seperti komisikomisi dibentuk. Termasuk menetapkan pimpinan DPRD devenitif. Menurut informasi yang diperoleh wartawan, kemungkinan fraksi di DPRD Medan akan bertambah satu dari periode sebelumnya, menjadi delapan. Yakni Fraksi Partai Demokrat (FPD), Fraksi Partai Keadilan Sejahtera (FPKS), Fraksi Partai Demokrasi Indonesia Perjuangan (FPDIP), Fraksi Partai Golkar (FPG), Fraksi Partai Amanat Nasional (FPAN), Fraksi Partai Damai Sejahtera (FPDS) Fraksi PPP dan tambahannya Fraksi Partai Bersatu (FPB). Dengan bertambahnya satu fraksi di DPRD Medan, maka gedung dewan juga membutuhkan satu ruangan tambahan. Untuk hal ini juga sampai sekarang belum terlihat tandatanda pembenahan. Akibatnya, empat orang anggota yang rencananya akan bergabung di fraksi ini, untuk sementara belum memiliki ruangan. Keseha-

Menanggapi hal itu, Asrin Naim memberi support atas rencana tersebut. Kata Naim, rencana Dinkes itu akan dia komunikasikan kepada Gubsu Syamsul Arifin agar bisa hadir dalam launching kampanye nanti.(m19)

rian mereka di gedung dewan saat ini, kebanyakan mereka duduk di ruangan ketua. Ketua DPRD Medan sementara Denni Ilham Panggabean, kepada wartawan, mengakui baru hari ini (Selasa 30/ 9), akan melakukan rapat pimpinan. Setelah itu, baru digelar rapat dengan sejumlah pimpinan parpol untuk menyusun alat kelengkapan dewan. Usai melakukan rapat dengan seorang pimpinan dewan lainnya, yakni Surianda Lubis, kata Denni, pihaknya juga akan melakukan rapat dengan sekretaris dewan. Yakni guna mengakomodir agenda dewan. ‘’Kita berharap minggu depan seluruh alat kelengkapan dewan sudah terbentuk,’’ katanya. Sementara itu, Sekretaris DPRD Erwin Lubis, mengakui kalau akan dilakukan penambahan satu ruang untuk Fraksi Partai Gabungan. Fraksi ini gabungan dari PIB, PKDI, PPRN dan Partai Buruh. Sementara satu orang anggota dewan dari Partai Patriot, bergabung dengan anggota dewan dari Partai Persatuan Pembangunan. ‘’Sementara ini, ruangan Fraksi Partai Bersatu kita tempatkan di ruangan humas, lantai I,’’ kata Erwin. (m17)

Tiga Perampok Ditangkap Gasak 1,5 Kg Emas Dan Uang Rp 15 Juta MEDAN (Waspada): Tiga pria komplotan perampok bersenjata tajam ditangkap Reskrim Unit Jahtanras Poltabes Medan dari kediaman masingmasing, Senin (28/9). Tersangka Alfred Lumban Tobing, 40, warga Jalan Pertahanan, Desa Sigaragara Patumbak, Saut Richard Simamora alias Birong, 48, warga Jalan Binjai Km 8,5 Pasar IV Kampung Lalang dan Hardi, 38, warga Jalan Putri Hijau Medan. Kapoltabes Medan, Kombes Pol Drs. Imam Margono, melalui Kasat Reskrim, Kompol Gidion Arif Setyawan, SIK didampingi Kanit Jahtanras, AKP Faidir Chan, saat dikonfirmasi wartawan mengatakan, terungkapnya kasus ini berawal polisi mendapat informasi tentang keberadaan tersangka Alfred. Kemudian dilakukan pengintaian hingga akhirnya Alfred

diringkus dari rumahnya. Selanjutnya dilakukan pengembangan dan berhasil diringkus tersangka Saut dan Hardi di rumah masing-masing. Dari ketiga tersangka polisi menyita barang bukti handphone serta sejumlah uang. Kepada polisi, ketiga tersangka mengaku merampok korban yang juga pemilik toko emas, Nurli Tarigan, warga Binjai saat menumpang Angkot di Jalan Binjai 11 September 2009 sekira pukul 17:00. Dari korban, tersangka berhasil merampok perhiasan emas seberat 1,5 kg serta uang tunai Rp 15 juta. Korban ketika itu sempat melakukan perlawanan hingga akhirnya ditikam salah seorang tersangka dibahagian tubuhnya. Dengan kondisi mengenaskan, korban melaporkan peristiwa tersebut ke Polres Binjai.

Masih pengakuan tersangka, saat beraksi mereka berjumlah 8 orang. Satu dari delapan orang berperan menggambar situasi di toko emas korban, empat orang mengikuti korban dengan menumpang Angkot yang ditumpangi Nurli dan tiga orang lagi mengikuti dari belakang dengan menaiki mobil Toyota Avanza. Setibanya di Jalan Binjai, Angkot yang ditumpangi korban disetop tersangka dengan modus berpura-pura razia. Hingga saat ini polisi masih melakukan pengembangan sekaligus mengejar lima orang lagi kawanan pelaku perampokan tersebut. Menurut Kanit Jahtanras, ketiga tersangka Alfred, Saut dan Hardi akan diserahkan ke Polres Binjai karena lokasi kejadian diwilayah hukum Polres Binjai. (m39)

Sumut Berpeluang Ekspor Bahan Makanan Ke Rusia MEDAN (Waspada): Sumatera Utara memiliki peluang besar menerobos ekspor bahan makanan ke Rusia, terutama sayur mayur, buah-buahan, perikanan dan berbagai komoditas perkebunan seperti crude palm oil (CPO), kopi, teh, coklat, frozen food hingga produk kerupuk dan lainnya. Sekdaprovsu, RE Nainggolan, mengatakan hal itu kepada wartawan di Medan, Minggu (27/9), setelah selama tiga hari melakukan kunjungan kerja ke Moskow, Rusia, pada 15 – 18 September 2009 bersama Kepala Dinas Perindustrian dan Perdagangan Sumut, Hasbi Nasution, dan beberapa pengusaha Sumut. Selama di Rusia, Sekdaprovsu berkesempatan bertemu Duta Besar RI di Moskow, Hamid Awaludin, dan sejumlah pengusaha setempat, berbincang dan berdialog, terutama

pada saat Sekdaprovsu mengunjungi peserta dari Sumut yang ambil bagian pada World Expo Moskow yang dibuka resmi Selasa (15/9) lalu. “Peluang Sumut cukup besar untuk menerobos ekspor bahan makanan ke Rusia. Ini harus kita manfaatkan secara baik dan terencana. Meski selama ini sudah ada, namun volume dan kuantitasnya perlu lebih kita tingkatkan karena peluang itu cukup signifikan,” ujarnya seraya mengemukakan beberapa langkah yang dipersiapkan mem-follow up kunjungan ini. Didampingi Kadis Kominfo Sumut, Eddy Syofian, Sekdaprovsu optimis pasar makanan yang cukup besar di Rusia dapat dimanfaatkan oleh Sumut meski diakui persaingan juga akan cukup ketat. Dijelaskan, beberapa fakta yang diperolehnya dari pihak berkompeten di Moskow

Waspada/Ist

Sekdaprovsu DR RE Nainggolan, MM (kiri) dan Kadis Perindag Sumut, HM Hasbi Nasution, di salah satu pojok areal lokasi World Expo Moskow yang berlangsung 15 hingga 18 September 2009 di Moskow.

menggambarkan bahwa tahun lalu produk makanan meliputi 40 persen produk consumer price index di Rusia. Selain itu, hampir 90 persen produk konsumen yang dijual di Rusia saat ini merupakan produk impor dari luar Rusia di mana 35 persen di antaranya adalah produk makanan. Ini merupakan peluang besar bagi kita (Sumut –red). “Itulah sebabnya Sekdaprovsu menyambut baik dan mendorong sejumlah pengusaha Sumut mengikuti World Expo Moskow di jantung Rusia,” katanya. Pameran produk makanan yang disebut-sebut kedua terbesar di dunia ini juga direspon positif dengan memfasilitasi pengusaha Indonesia berperan di dalamnya oleh pihak Kedubes RI di Moskow. 23 Peserta dari Indonesia termasuk Sumut berperanserta aktif pada pameran itu. Sekdaprovsu mengemukakan, menurut informasi yang diperolehnya, ketergantuangan pihak Rusia pada impor bahan makanan ini telah berlangsung sejak lama dengan nilai impor sebesar 20 miliar dolar AS di tahun 2007 melonjak tajam menjadi 36 miliar dolar AS tahun 2008 lalu. Menurut Dubes RI di Moskow, Hamid Awaludin semua itu antara lain sebagai sebuah konsekuensi pasar bebas yang diberlakukan Rusia ditambah kebijakan pemerintah atas pertaniannya. Negeri beruang putih itu hanya mensubsidi petaninya sebesar 6 persen dari nilai total produksinya dibandingkan dengan Uni Eropa 32 persen. (m19)

Waspada/Anum Saskia

AKRAB : Dari kanan Kadis pendidikan Medan Drs Hasan Basri MM, Pj Walikota Drs Rahudman, Kadis Pendidikan Sumut Drs Bahrumsyah dan Sekda Medan Drs Dzulmi Eldin nampak akrab saat berlangsung halal bi halal, Senin (28/9).

Walikota Minta Kadisdik Evaluasi Program Kerja MEDAN (Waspada) : PJ Walikota Medan, Drs H Rahudman Harahap, meminta Kepala Dinas Pendidikan Kota Medan, melakukan evaluasi program kerja. Hal ini sangat diperlukan, guna memastikan apakah pendidikan di Medan berkualitas atau belum. “Evaluasi juga bertujuan untuk meningkatkan mutu pendidikan maupun tenaga pendidik di kota ini. Sehingga berbagai anugerah bidang pendidikan yang didapatkan bukan hanya sebagai lambang tetapi wujud dari apa yang telah dilakukan,” kata Rahudman saat berlangsungnya acara halal bi halal di lingkungan Dinas Pendidikan Kota Medan di Komplek Vila Malina Indah Permata Hijau, Senin (28/9). Hadir Sekda Kota Medan, Drs Dzulmi Eldin, Kadis Pendidikan Kota Medan, Drs Hasan Basri MM, Kadis Pendidikan Sumut, Drs Bahrumsyah, Kepala Cabang Dinas Kecamatan, Kepala Sekolah (SD,SMP,SMA dan SMK) serta sfaf dan pegawai dan kepala bagian di jajaran Dinas Pendidikan Kota Medan

dan Sumut serta pejabat lainnya. “Tinjau kembali sistem kerja. Jangan berjalan monoton, karena pendidikan itu mengalami perkembangan yang pesat. Harapan saya dengan evaluasi dan meninjau kembali, akan dapat dilihat apakah sistem yang berjalan sudah mantap atau perlu diperbaharui lagi. Terutama untuk sistem belajar efektif lima hari. Saya ingin ada evaluasi, selambatnya Oktober nanti sudah ada pembahasan apakah ini akan diteruskan atau dihentikan,” katanya. Dia juga menyampaikan keluhan masyarakat yang diterimanya, masih ada guru yang berprilaku tidak mendidik dan memberikan citra buruk di tengah masyarakat. Hal itu diketahuinya berdasarkan SMS yang diterima dari masyarakat, yang keberatan atas sikap dan prilaku guru yang tidak menunjukkan bagaimana selayaknya menjadi seorang pendidik. Disamping perlunya meningkatkan citra sebagai tenaga pendidik yang baik di mata masyarakat, sambung dia, tentu

saja persoalan kualitas seorang pendidik harus benar-benar menjadi pemikiran bagi Dinas Pendidikan Medan serta upayaupaya yang harus dilakukan untuk berbagai perbaikan. “Mendapatkan hal itu perlu dukungan dari berbagai pihak, khususnya DPRDSU, untuk membahas adanya Perda Pendidikan agar menjadi payung hukum bagi peningkatan kualitas dan mutu pendidikan di Medan,” katanya. Sebelumnya Kadis Pendidikan Medan, Drs Hasan Basri, MM dalam sambutannya mengatakan, kegiatan ini sebagai sarana pertemuan silaturahmi antar sesama pegawai maupun tenaga pendidik di lingkungan pendidikan yang digelar setiap tahunnya. Di samping itu untuk lebih meningkatkan ikatan silaturahmi yang dijalin. Acara diiringi dengan penampilan band dari siswa SMKN 11 Medan, Pj Walikota dalam kesempatan itu turut menyumbangkan suara emasnya diiringin acara salamsalaman seluruh yang hadir kepada walikota. (m36)

DPRDSU Bentuk Susunan Kepengurusan 10 Fraksi MEDAN (Waspada): DPRD Sumatera Utara mengesahkan susunan kepengurusan 10 fraksi, yakni: Fraksi Partai Demokrat, Partai Golkar, PDI Perjuangan, PKS, PAN, PPP, PDS, PPRN, Fraksi Gerindra Bintang Reformasi dan Hanura dalam rapat paripurna dipimpin Ketua Dewan Sementara Palar Nainggolan dan Wakil Ketua Chaidir Ritonga, di gedung dewan, Senin (28/9). Pengesahan pimpinan 10 fraksi itu sesuai Keputusan Pimpinan Sementara Dewan No.01/KPS/2009 tentang pembentukan susunan pimpinan dan anggota fraksi-fraksi DPRD Sumut, berdasarkan pasal 301 UU 27/2009 tentang MPR, DPR, DPD dan DPRD. Sesuai Keputusan Pimpinan Sementara, ditetapkan pimpinan FP Demokrat, antara lain, Ketua Palar Nainggolan, Sekretaris Mustofawiyah, Wakil

Ketua Jamaluddin Hasibuan, Wakil Sekretaris Guntur Manurung, Penasihat H Saleh Bangun, Hasbullah Hadi dan Amarullah Nasution. Kemudian, FPG diketuai oleh Biller Pasaribu dan Sekretaris Isma Padly AP, Wakil Ketua Zefri Januar Pribadi, Wakil Sekretaris Richard Eddy M Lingga, Bendahara Syafrida Fitrie, Penasihat Chaidir Ritonga, Syahrul Pasaribu dan Ajib Shah. FPDIP diketuai Budiman P Nadapdap, Sekretaris Analisman Zalukhu, Wakil Ketua Syamsul Hilal,Wakil Sekretaris Alamsyah Hamdani, Bendahara Brilian Moktar, Panasihat Japorman Saragih, Taufan A Ginting dan Eddi Rangkuti. FKS diketuai Timbas Tarigan, Sekretaris Hidayatullah, Bendahara Zulkarnain ST, Wakil Ketua Nur Azizah Tambunan, Wakil Sekretaris Amasal Nasution, Penasihat Muhammad Nuh dan Sigit Pramono

Asri. Pimpinan FPDS Ketua Tonnies Sianturi dan Sekretaris Darmawan Sembiring. Sedangkan FPPRN diketuai Wasington Pane dengan anggota Rinawati Sianturi, Restu Kurniawan Sarumaha, Rahmiana Delima Pulungan, Roslyda Marpaung, Oloan Simbolon dan Sonny Firdaus. Untuk pimpinan Fraksi Gerindra Bintang Reformasi diketuai Yan Syahrin, Sekretaris Ferry Suando Tanuray,Wakil Ketua Mulyani, Anggota Khairuddin Syah dan Imam B Nasution. Dan pimpinan Fraksi Hanura Ketua Musdalifah, Sekretaris Suasana Dachi, Bendahara Adohot Simamora. Seusai paripurna penetapan dan pengesahan pimpinan fraksi, masing-masing fraksi melakukan rapat fraksi dalam melanjutkan agenda kegiatan dewan selanjutnya sesuai kelompok kerja yang sudah dibentuk sebelumnya.(h11)

152 Guru Tidak Lulus PLPG MEDAN (Waspada): Penjaringan 2.083 guru pada Pendidikan dan Latihan Profesi Guru (PLPG) Sumut 2009 gelombang pertama lalu, menyisihkan 152 peserta yang tak lulus. Karena 152 orang guru ini tak memenuhi syarat kelulusan pada PLPG Sumut 2009 tersebut. Demikian diungkapkan Ketua Divisi Diklat PLPG Universitas Negeri Medan (Unimed), Berlin Sibarani, kepada wartawan, Senin (28/9). “Syarat yang dibutuhkan untuk lulus pada PLPG Sumut 2009 ini tak hanya dari penilaian portofolio saja, tapi juga ujian tulis, ujian praktek mengajar, penilaian teman sejawat dan penilaian partisipasi,” jelas Berlin. Berlin mengatakan, 152 peserta yang tak lulus ini masih dapat mengikuti ujian ulang, yang akan digelar pada 30 September 2009 mendatang di Unimed. “Pelaksanaannya digelar satu hari penuh, dari pukul 08:00 hingga 18:00. Sedangkan jenis ujian ada dua yakni ujian tulis dan praktek mengajar,” terangnya. Lebih lanjut Berlin mengatakan, pada diklat yang telah memakan waktu sekitar 90 jam lalu tidak diikuti 44 orang peserta dengan mengemukakan

alasan mereka masing-masing. “Dengan ketidakhadiran 44 orang peserta ini pada PLPG Sumut 2009 gelombang pertama, mereka tetap kami imbau untuk mengikuti PLPG pada gelombang berikutnya. Dengan begitu, mereka tetap memiliki peluang untuk lolos sertifikasi guru pada tahun ini,” ujarnya. Berlin menyebutkan, mereka yang lulus PLPG tahun ini akan menerima tunjangan profesi guru mereka. “Penerimaan tunjangan profesi guru bagi peserta yang lulus PLPG Sumut 2009 ini, pada tahun depan memang sudah dianggarkan dananya di APBD. Jadi, tahun depan mereka telah berhak menerima tunjangan profesi guru mereka,” katanya. Jadi, lanjut Berlin, dari 2.083 peserta dikurangi 152 yang tak lulus dan dikurangi 44 peserta yang tak mengikuti PLPG gelombang pertama ini, maka jumlah peserta PLPG Sumut 2009 yang lulus adalah 1.887 orang guru. Pada pelaksanaan PLPG yang memakan waktu 10 hari tersebut, masing-masing peserta diberikan modul yang telah disediakan. Dengan modul tersebut, Berlin berharap para

peserta dapat meningkatkan mutu seorang guru. “Modul tersebut terdiri dari beberapa materi, yakni, materi pertama, pengembangan profesionalitas guru, kedua, metodologi pembelajaran yang meliputi penilaian hasil belajar, model dan media pembelajaran, dan rencana pelaksanaan pembelajaran (RPP), dan ketiga penelitian tindakan kelas dan penulisan karya ilmiah (PTK PKI),” paparnya. Disebutkannya, untuk pengumuman kelulusan pada PLPG Sumut 2009 gelombang pertama yang digelar Unimed pada 7-16 September 2009 lalu telah dapat diakses di website resmi Unimed, unimed.ac.id, dan dapat dilihat secara langsung di papan pengumuman yang berada di depan Gedung Biro Rektor Unimed Jalan Willem Iskandar Medan Estate. PLPG Sumut 2009 lalu diikuti 2083 orang guru Kota Medan yang pada sertifikasi 2008 lalu gagal portofolio. Adapun peserta diklat ini merupakan guru SD sebanyak 668 orang, guru SMP sebanyak 577 orang, guru SMA sebanyak 639 orang, guru SMK sebanyak 66 orang, dan guru BK sebanyak 132 orang.(m41)


WASPADA

Selasa 29 September 2009

Medan Metropolitan

Dua Jurtul Togel Diringkus

Penulis Togel, Pemilik Pistol Mainan Dibekuk

MEDAN (Waspada): Dua juru tulis judi toto gelap (togel) seorang diantaranya purnawirawan TNI, diringkus petugas Polsekta Medan Timur, Senin (28/9) siang, dari kawasan Jalan HM Said Medan. Kedua tersangka masing-masing Halim, 30, warga Jalan HM Said Gang India dan Syahruddin, 62, warga jalan HM Said Gang Kacung Kampung Durian Medan. Dari kedua tersangka, polisi menyita Rp40 ribu dan beberapa lembar kertas berisikan nomor-nomor angka tebakan dari para pemesannya. Awalnya, polisi menangkap tersangka Halim ketika sedang menerima pesanan nomor tebakan dari pembelinya di salah satu warung di Jalan HM Said Gang India. Dari pengakuan Halim, polisi kemudian meringkus tersangka Syahruddin, purnawirawan TNI, di Jalan HM Said Gang Kacung. Kedua jurtul togel tersebut tak berkutik lagi saat ditangkap karena beberapa barang bukti turut disita. Guna pengusutan selanjutnya, kedua jurtul togel tersebut dijebloskan ke dalam tahanan Polsekta Medan Timur. Kapolsekta Medan Timur, AKP Yatim Syahri Nasution menyebutkan, kedua tersangka sudah beberapa bulan ini menjadi jurtul togel dan menjalankan profesi ilegalnya itu secara sembunyi-sembunyi. “Saat disergap, kedua tersangka tak bisa mengelak lagi karena beberapa barang bukti seperti lembaran nomor-nomor togel serta uang hasil penjualan turut disita,” jelas Nasution. (cat)

Kejatisu Terima Perkara Dari Kejari Jantho MEDAN (Waspada): Kejaksaan Tinggi Sumut (Kejatisu) menerima pelimpahan berkas perkara dan barang bukti dua tersangka kasus penganiayaan disertai penculikan dari Kejaksaan Negeri Jantho, Aceh, Senin (28/9). Menurut Kasipenkum/Humas Kejatisu Edi Irsan Tarigan, tersangka yang diserahkan ke Kejatisu adalah Azhari alias Tengku Alue bin Ibrahim dan Burhanuddin bin alm Syarifuddin. Keduanya terdaftar sebagai anggota Komite Peralihan Aceh (KPA). “Locus delictinya memang di Aceh, namun atas pertimbangan kondusivitas proses persidangan maka dialihkan ke Kejatisu,” ujarnya seraya menambahkan berkas perkara kedua tersangka murni tindak pidana dan tidak ada hubungannya dengan kapasitasnya terlibat dalam struktur di KPA. Menurut Tarigan, atas perbuatan yang dilakukan kedua tersangka, Kejari Jantho menjerat keduanya dengan pasal, 333, 351 dan 365 ayat 2 yo 55 ayat 1 ke 1 jo pasal 65 ayat 1 KUHPidana. Tarigan mengatakan, awal terjadinya perkara itu pada 20 April 2008. Kedua tersangka saat berada di Pos KPA di Desa Labernut Kab. Jantho, Aceh Besar, melakukan penganiayaan serta penculikan terhadap dua saksi korban, Syawaluddin bin Marhaban dan Ibrahim Yusuf. Mereka dituduh melakukan perusakan terhadap satu unit alat berat proyek di bawah pengawasan kedua tersangka. Selain itu, kedua tersangka juga merampas sepeda motor dan membawa kedua saksi korban keluar dari wilayah Jantho. Setelah berhasil kabur dari kedua tersangka korban kemudian melapor kepada polisi. (h05)

BAP Tersangka Pembunuh Pengusaha Valas Segera Dilimpahkan MEDAN (Waspada): Poltabes Medan segera melimpahkan Berkas Acara Pemeriksaan (BAP) tersangka pembunuhan Pengusaha PT Surya IndoValas (SIV) Medan ke Kejaksaan Negeri (Kejari) Medan. “Sekarang ini tersangka Richard masih menjalani pemeriksaan secara itensif. Dalam dua pekan ini, pihak kepolisian selaku penyidik masih melengkapi berkas sebelum dilimpahkan ke Kejari Medan,” kata Kanit Jahtanras, AKP Faidir, Sabtu (26/9). Dijelaskan Faidir, pihaknya masih memintai keterangan tersangka dan para saksi-saksi serta mengumpulkan barang bukti. Bila pemeriksaan sudah selesai dan bukti sudah dikumpulkan, akan kita limpahkan ke Kejaksaan. Seperti diberitakan sebelumnya, pengusaha penukaran Valuta Asing (Valas) yakni PT Surya Indo Valas Medan, Junan alias Ajun, 42, warga Jalan Yos Sudarso No.1 Medan, ditemukan tewas membusuk di dalam kamar mandi lantai dua gedung kosong Jalan Krakatau No. 102 Medan, Jumat (18/9). Korban tewas dibunuh Richard Leo, 26, warga Jalan Brigjend Katamso Gg. Datuk No. 63 Medan, yang saat ini menjadi tersangka. Mertua korban, Apuk, yakin jika kasus pembunuhan dan perampokan terhadap menantunya itu berencana. Pasalnya, sebelum ditemukan tewas, Jumat lalu, pagi itu A Jun ketika hendak pergi ke tempat yang dijanjikan Richard, sempat ingin pergi dengan anak buahnya. Namun saat itu Richard melarang. “Makanya kita yakin ini pembunuhan berencana,” jelasnya. (m39)

Polsekta Medan Baru Tingkatkan Pengamanan MEDAN (Waspada): Untuk menciptakan Kamtibmas kondusif dan mengantisipasi aksi kejahatan apalagi disaat masyarakat merayakan lebaran Idul Fitri, Kapolsekta Medan Baru AKP M Adenan AS,SH,SIK, bersama personelnya secara terus menerus secara rutin melakukan patroli di wilayah hukumnya. Pantauan Waspada di lapangan, Minggu (27/9), personel Polsekta Medan Baru baik mengendarai mobil dan sepeda motor berpatroli di beberapa ruas jalan antara lain Jalan Gatot Subroto, Iskandar Muda, Gajah Mada, Darussalam, KH Wahid Hasyim, S Parman dan lokasi lainnya yang dinilai rawan aksi kejahatan. Disela-sela melakukan patroli, AKP Adenan mengatakan, patroli yang mereka lakukan ini sesuai instruksi Kapoltabes Medan, Kombes Pol Drs Imam Margono, agar suasana Kamtibmas kota Medan tetap kondusif. Selain melakukan patroli pihaknya juga menurunkan personel ke pusat-pusat perbelanjaan antara lain plaza dan pasar. Pengamanan yang dilaksanakan ini secara langsung mengedepankan kegiatan pencegahan, penangkalan dan didukung kegiatan intelijen, kegiatan penindakan serta penegakan hukum guna mewujudkan dan memelihara stabilitas Kamtibmas yang aman serta tertib dan lancar. Adenan juga mengimbau petugas-petugas satpam harus peduli dan proaktif menjaga lingkungan di tempat tugasnya untuk menghindari terjadi hal-hal yang tidak diinginkan. Sebab, satpam sebagai Pam Swakarsa dan perpanjangan polisi.(m31)

Teruskan Nama Besar Mandailing MEDAN (Waspada): Pengurus Daerah Himpunan Keluarga Besar Mandailing (PD HIKMA) Sumatera Utara mengadakan acara halal bi halal di kediaman Ketua Umum PD HIKMA H.Tamanah Lubis di Jalan Prof HM Yamin, SH Medan, Sabtu (26/9). Ustadz Amhar Nasution memberikan tausiyah agama dalam acara tersebut yang menekankan tentang arti pentingnya penguatan tali silaturahim guna mengembangkan semangat kebersamaan untuk membangun bangsa yang dimulai dari lingkungan keluarga. Ketua Umum PD HIKMAH, Tamanah Lubis, mengatakan, perlu melestarikan dan mengembangkan seni budaya Mandailing yang memang sudah cukup dikenal di seantero ini. Bahkan ke negara tetangga Malaysia dan banyak sekali tokohtokoh Mandailing yang telah berkarya secara Nasional maupun Internasional seperti Adam Malik sebagai Wapres dan Jenderal Besar AH Nasution dan sekarang ada Adnan Buyung Nasution, Anwar Nasution, Todung Mulya Lubis dan lain-lain. Kepada generasi muda, Tamanah berharap dapat meneruskan nama besar Mandailing. Hadir pada acara itu, antara lain, Samuel Lubis, Marwan Efendi, Efdi Boy Nasution, HMD Sakti Hasibuan, Dr Arsyad Lubis, Yasir Ridho Lubis, Prof Dr. Arif Nasution, Sigit Pramono Asri dan Kamaluddin Harahap. (cmai/rel)

11

Waspada/Rustam Effendi

PARAH: Jembatan yang menghubungkan tepat pendaratan ikan (TPI) di Kelurahan Bagan Deli, Kecamatan Medan Belawan ini rusak parah dan tidak diperbaiki. Jembatan ini merupakan satu satunya penghubung di daerah itu. Foto diambil pekan lalu.

Bandar Judi Segera Diberantas MEDAN ( Waspada): Poltabes Medan segera memberantas dan menangkap seluruh bandar judi di Medan yang telah menjadi target operasional (TO). “Tidak ada pandang bulu. Siapapun bandar judinya jika memang masih berani beroperasi akan diringkus dan ditindak sesuai kepentingan hukum,” tegas Kapoltabes Medan Kombes Pol. Drs Imam Margono, Senin (28/9). Diakui Kapoltabes, masih ada beberapa orang lagi bandar judi yang menjadi TO. Namun identitas para bandar judi itu masih dirahasiakan guna memperlancar pengintaian anggotanya di lapangan. Selain target meringkus para bandar judi, Kapoltabes

juga telah memiliki tekat untuk menindak tegas setiap anggotanya yang terbukti melakukan pembekingan terhadap kasus perjudian dalam jenis apapun. “Jika terbukti dan menjalani hukuman diatas 3 bulan, akan diusulkan kepada atasannya agar oknum polisi yang membekingi perjudian itu untuk dipecat,” tegasnya. Dijelaskan Kapoltabes, dari hasil penyelidikan di lapangan bahwa para bandar judi yang diduga masih beroperasi di Medan cara kerjanya sangat rapi dan bahkan terbilang licin se-

tiap kali polisi hendak meringkusnya. Kendati demikian, Poltabes Medan tidak akan tinggal diam untuk menindaklanjuti atensi Kapolri dalam memberantas perjudian. Diharapkan, masyarakat agar mendukung polisi dalam memberantas kasus perjudian. Apabila masyarakat mengetahui ada beroperasi perjudian agar melaporkannya ke Poltabes Medan guna penindakan lebih lanjut. Dari hasil pengamatan di berbagai kawasan di Medan, seperti kawasan Cemara, Perjuangan, Helvetia, Menteng, Sukaramai, Teladan, Simalingkar, Serdang, Patumbak, Pancing, Tembung, Gaperta, Sunggal, masih saja ada perjudian togel

yang beroperasi secara sembunyi-sembunyi. Masih Ditahan Sementara itu, ratu judi Acu dan dua orang rekannya Abeng dan ST masih ditahan di dalam sel Reskrim Poltabes Medan. Ketiga tersangka kasus judi togel itu masih terus menjalani pemeriksaan secara intensif di Unit Judi/Sila Reskrim Poltabes. Sebagaimana dikatakan Kombes Pol Drs Imam Margono beberapa hari lalu, bahwa ketiga tersangka itu akan ditindak lanjuti hingga kepersidangan dan barang bukti yang disita dari mereka sudah cukup kuat untuk memenuhi unsur sebagaimana pasal yang dikenakan kepada para tersangka tersebut. (m39)

Anggota DPRD Medan Dituntut 8 Bulan Damai Yona: Saya Hanya Ingin Bertemu Anak MEDAN (Waspada): Anggota DPRD Kota Medan, Damai Yona Br Nainggolan dituntut 8 bulan masa percobaan 1 tahun di Pengadilan Negeri (PN) Medan, Senin (28/9). Dia didakwa melakukan penyerangan ke rumah Erik LTP Siahaan di Jln Samanhudi Medan. “Terdakwa terbukti secara sah dan menyakinkan bersalah melakukan perbuatan tindak pidana sesuai pasal 335 ayat 1 ke 1 KHUPidana, “ papar Jaksa Penuntut Umum (JPU), Lila Nasution, SH. Di hadapan majelis hakim diketuai Wahidin, SH, JPU Lila Nasution, SH, mengatakan Damai Yona, melanggar pasal 335 ayat 1 ke 1 KHUPidana. “Untuk itu, kami mohon agar majelis hakim menghukum terdakwa,” pinta JPU. Menurut JPU, berdasarkan keterangan sejumlah saksi dan terdakwa di persidangan ditemukan ada persesuaian. “Semua unsur perbuatan pidana yang dilakukan terdakwa sesuai

pasal 335 ayat 1 ke 1 KHUPidana yang dijeratkan terpenuhi,” tandas JPU. Bahkan saksi Rohim, mengemukakan, terdakwa saat mendatangi rumah korban sempat emosi dan mengeluarkan kalimat ancaman “siapa yang ke luar akan kami habisi”. Selain Rohim, saksi lain yang diperiksa di persidangan adalah korban Erik LTP Siahaan, Supen, Effredy, Suherman, dan M. Afandi, serta dua anggota polisi. Keterangan mereka menguatkan dakwaan JPU. Atas tuntutan itu, terdakwa yang hadir di persidangan mengenakan pakaian warna coklat didampingi kuasa hukumnya, Ojak Nainggolan akan menyampaikan pledoi (pembelaan) pada sidang 5 Oktober 2009. Pada persidangan sebelumnya JPU dalam dakwaannya me-ngatakan, terdakwa Damai Yona Br Nainggolan mendatangi rumah korban, Selasa 2 dan 3 Maret 2009 sekira pukul

13:30. Terdakwa sempat memarkirkan mobilnya persis di depan pagar masuk ke dalam rumah serta hampir 1 jam bertahan di lokasi itu. Pemilik rumah dan keluarganya merasa terancam, hingga tidak berani keluar dari rumah. Ingin Ketemu Anak Usai menjalani persidangan, Damai Yona Nainggolan, kepada wartawan membantah tuduhan JPU. Katanya, dia datang ke rumah Erik LTP Siahaan hanya ingin ketemu anaknya yang masih balita. Didampingi kuasa hukumnya Ojak Nainggolan dan Raymond B. Pardede,Yona, mengaku sangat merindukan anaknya yang sudah sejak 9 Januari 2009 tidak pernah ketemu. “Apa tidak pantas saya bertemu anak saya,” katanya dan melanjutkan: “Saya harus bertemu dengan anak saya,’’ katanya. Kuasa hukum Yona, Ojak Nainggolan, mengaku kecewa dengan tuntutan Jaksa Lila Na-

sution. Katanya, dalam membuat tuntutan jaksa hanya berpedoman pada perbuatan formal berdasarkan berkas. “Seharusnya jaksa juga mengungkap kebenaran materil dalam tuntutannya,” kata Ojak Nainggolan. Kliennya Damai Yona, kata Ojak Nainggolan, sama sekali tidak melakukan perbuatan kriminal. Yang dilakukannya hanya berupa usaha seorang ibu untuk bertemu dengan anaknya yang masih balita. ‘’Itu saja. Tidak lebih,’’ tambahnya. Kesannya, kata Ojak, JPU dalam membuat tuntutan mengharuskan Yona, bersalah. Padahal, seorang jaksa seharusnya dapat membuat penjelasan kalau Damai Yona Nainggolan, tidak bersalah. Begitupun, kedua kuasa hukum ini berkeyakinan, hakim yang menyidangkan perkara ini mampu bersikap adil, dengan membuat putusan, membebaskan klien mereka dari tuduhan. (h05)

Pembunuh Naya Miraza Dihukum 18 Tahun Penjara MEDAN (Waspada): Marhandi Sitompul, 26, pelaku pembunuh istri guru besar Universitas Sumatera Utara (USU) Onaya Siti Kadarsih Miraza dihukum 18 tahun penjara oleh majelis hakim dalam persidangan yang digelar di Pengadilan Negeri (PN) Medan. Vonis majelis hakim diketuai Bambang Utomo lebih ringan dua tahun dari tuntutan Jaksa Penuntut Umum (JPU) yang meminta agar terpidana dihukum 20 tahun penjara. “Saya menyatakan pikir-pikir atas putusan itu,” ujar JPU Fitri Sumatri, SH kepada wartawan usai sidang, Senin (28/9). Dalam amar putusan majelis hakim mengatakan, terpidana telah terbukti secara sah dan menyakinkan melakukan perbuatan pidana yang mengakibatkan hilangnya nyawa orang lain, sebagaimana diatur dan diancam pasal 365 ayat 4 KHUP tentang pencurian disertai dengan kekerasan yang menyebabkan kematian. Kekerasan yang dilakukan terpidana mengakibatkan istri

Guru Besar Prof Bachtiar Hasan Miraza meninggal dunia. Sebelum majelis hakim menjatuhi hukuman itu, Bambang menyebutkan hal yang memberatkan dan meringankan. Hal yang memberatkan, perbuatan terdakwa tergolong sadis. Bukan hanya telah menimbulkan kerugian materil namun juga non materi, yang membuat keluarga korban trauma dan mengalami kesedihan akibat kehilangan anggota keluarga. “Sedangkan hal yang meringankan, terdakwa belum pernah dihukum dan berlaku baik dan sopan dalam setiap persidangan. “Atas pertimbangan itu terpidana dijatuhi hukuman 18 tahun penjara,” ucap Bambang Utomo. Mendengar putusan itu, majelis hakim mempersilahkan terdakwa untuk menempuh jalur hukum jika keberatan atas putusan itu. Namun, terdakwa hanya menyatakan piker-pikir. Sementara, JPU Fitri Sumarni menyatakan hal serupa. Sebelumnya dakwaan JPU

menyampaikan secara singkat kronologi peristiwa. Terjadi tanggal 11 April 2009 sekitar pukul 20:30. Terpidana masuk ke rumah korban melalui pintu di lantai II yang dalam kondisi terbuka. Setelah itu, terpidana bersembunyi di salah satu ruangan menunggu sampai pukul 24.00. Setelah pukul 24.02 , terpidana turun ke lantai I dan duduk diruangtamumenunggukorban ke luar dari dalam kamarnya. Sambilmelihat-melihatisirumah yang bisa diambilnya. Ia sempat mengambil kunci mobil untuk mengambil barang dalam mobil seperti tape mobil dan monitor. Namun, karena menimbulkan cahaya dan suara terpidana mengurungkan niatnya. Sekitar pukul 05.00, korban Prof Dr Bachtiar Hassan Miraza ke luar dari dalam kamar menuju dapur. Saat itu juga terpidana masuk ke dalam kamar korban dan mengampil perhiasan yang terletak di atas meja kamar tidur korban. Sedangkan Onaya Siti Ka-

darsih Miraza ketika itu masih tertidur pulas di dalam kamar. Tiba-tiba Bachtiar Hasan Miraza masuk ke dalam kamar dan terdakwa bersembunyi di dalam kamar mandi yang ada di kamar itu. Namun, saat keluar dari dalam kamar, terlihat oleh Bachtiar Miraza. Tak ingin aksi kejahatannya diketahui, terpidana memukul kepala sebelah kiri Bachtiar dengan linggis. Melihat Onaya Siti Kadarsih terbangun, terpidana memukulnya dengan linggis persis di atas tempat tidur. Dalam keadaan terkapar, terpidana meminta korban menyerahkan uang sebesar Rp1 juta. Namun, korban menyatakan tidak memiliki uang dalam jumlah itu di dalam rumahnya. Karena tidak mendapatkan keinginannya, lalu ia hanya mengambil dua telefon genggan milik korban yang terletak di dalam kamar. Setelah behasil, terpidana selanjutnya ke luar melalui atap dan bersembunyi di rumah kostnya Jalan Djamin Ginting Medan. (h05)

MEDAN (Waspada): Operasi Pekat (penyakit masyarakat) yang dilaksanakan Polsekta Medan Labuhan lima hari terakhir ini berhasil menangkap sembilan tersangka penulis judi toto gelap (togel) dan satu orang pemilik pistol mainan yang digunakan untuk merampok dari lokasi berbeda. Delapan orang tersangka adalah laki-laki warga Kecamatan Medan Deli dan Medan Labuhan yakni Is, 32, TS, 49, AA, Muk, Isk, RH, Her dan TP dan seorang wanita Mur, warga Gang Bantenan, Kecamatan Helvetia, Kabupaten Deli Serdang. Dari para tersangka, disita barang bukti uang Rp700 ribu, HP, buku tafsir mimpi dan kertas rekap. Kapolsekta Medan Labuhan, AKP Dony Aleksander, SIK didampingi Kanit Reskrim, Iptu Antonie Rajaguguk mengatakan, kedelapan tersangka merupakan penulis yang dibandari oleh tersangka Ac yang telah ditangkap Poltabes MS beberapa hari lalu. “Judi tidak boleh marak di wilayah hukum Polsekta Medan Labuhan. Oleh karenanya pemberantasan judi ini terus dilakukan,” katanya saat memberikan keterangan di Aula Sanika Satyawadana Mapolsekta Medan Labuhan. Pistol Mainan Sebelumnya Polsekta Medan Labuhan menangkap tersangka LPA, 32, warga Jalan RPH Mabar, pemilik pistol mainan mirip senpi yang digunakan untuk merampok korbannya, Roy, warga Mabar, Kecamatan Medan Deli. “Senjata ini mirip revolver taurus buatan Brazil,” kata Dony. Kepada petugas tersangka mengaku mendapat pistol mainan itu dari seorang temannya, Win, 18, anak seorang oknum polisi yang tinggal di Desa Hamparan Perak, Deli Serdang. “Senjata seperti ini banyak sama bapak kawanku itu dan bapaknya Polisi,” kata tersangka yang berprofesi sebagai tukang becak itu. Dony minta warga tidak panik menghadapi aksi perampokan yang menggunakan senjata api (senpi) yang marak belakangan ini. Sebab dari beberapa kasus yang ditangani, pihaknya berkeyakinan senjata yang digunakan pelaku adalah pistol mainan. “Walaupun demikian tetaplah waspada dan bila ada warga yang melihat atau menjadi korban, segera melapor atau SMS ke nomor 0813 7642 7222,” ujar Dony. (cre)

Polsekta Medan Baru Tangani 30 Kasus Judi MEDAN (Waspada): Polsekta Medan Baru sampai 27 September 2009 menangani 30 kasus judi dengan 48 tersangka diantaranya judi toto gelap (togel), bola dan kartu joker. “Dari para tersangka disita barang bukti uang Rp1.375.000, 12 unit handphone, 66 lembar potongan kertas berisikan rekapan nomor togel, 2 buku mimpi, 18 pulpen, 2 buku notes togel, 2 set bola bilyar, 1 kalkulator, 1 set kartu joker,” kata Kapolsekta Medan Baru, AKP M Adenan AS, SH.SIK kepada Waspada melalui telefon selular, Senin (28/9) malam. Disebutkan Adenan, para tersangka ditangkap sejak Juli sampai saat ini, mereka ini wajah-wajah baru di kawasan Kota Medan dan Deli Serdang. Menurutnya, berkas BAP tersangka sudah ada yang dilimpahkan ke JPU karena sudah P-21 (sempurna) dan ada juga masih dalam proses pemberkasan. “Kita terus melakukan razia judi secara rutin sesuai komitmen pimpinan Polri. Selain itu juga kasus tindak pidana lainnya dan narkoba,” tegasnya. (m31)

Warga Keluhkan Sikap Oknum Jaksa Dan Hakim MEDAN (Waspada): Nikmah Yapinas, 60, warga Jalan Raya Menteng Medan, korban pemalsuan surat tanah yang dilakukan terdakwa, Mariyani Nasution, mengeluhkan prilaku seorang oknum jaksa di Kajari Medan, AH, dan seorang majelis hakim, K, yang tidak kooperatif kepadanya. Hal ini disampaikan Nikmah di redaksi Waspada, Senin (28/9). Nikmah mengatakan, sebagai korban, dirinya berhak mengetahui tuntutan terdakwa agar mengetahui vonis yang dijatuhi kepada terdakwa, sebelum keputusan vonis diputuskan. “Terdakwa sudah sampai tuntutan. Saat saya menanyakan ke majelis hakim, dia menyuruh saya ke jaksa. Saya dioper-oper seperti bola,” katanya. Namun saat Nikmah menanyakan tuntutan terdakwa, jaksa sepertinya menghindar. “Saya disuruh datang ke Kantor Kejari Medan, Senin (24/8). Tapi saat saya datang ke sana, saya tidak dilayani. Dia pergi begitu saja setelah tamunya keluar dari ruangannya. Sebagai korban saya tidak diperdulikan. Saya pengen tahu vonis yang dijatuhi berapa tahun,” ujarnya. Untuk mengetahui tuntutan terdakwa bukan tanpa alasan karena ada rasa kekhawatirannya, saat vonis diputuskan terdakwa hanya dihukum satu bulan masa percobaan. “Dia kena dua pasal, satu pasal membuat dan menggunakan surat palsu tanah, dan kedua pasal 263 tentang penguasaan tanah tanpa hak. Itu hukumannya minimal lima tahun,” ujarnya. Nikmah juga mengeluh tentang perubahan jadwal sidang yang biasanya dilakukan hari Rabu dirubah menjadi hari Senin, tanpa sepengetahuan dirinya sebagai korban. “Perubahan jadwal tidak diberi tahu ke kita, tiba-tiba sidangnya sudah sampai tuntutan saja,” katanya. (cmai)

Besok IKA UII Sumut Halal Bi Halal MEDAN (Waspada): Ikatan Keluarga Alumni Universitas Islam Indonesia Sumatera Utara (IKA-UII Sumut) menggelar acara halal bi halal di Hotel Arya Duta, Rabu (30/9). Hal itu diungkapkan Ketua Harian IKA UII Sumut H. Ir. Soleh Idoan Siregar didampingi Sekretaris Rahmad El Mujamil, ST di sekretariat IKA UII Sumut Jalan Garuda No. 78 Sei Sikambing B Medan, Senin (28/9). Dikatakan Soleh Idoan Siregar yang juga ketua panitia pelaksana halal bi halal, acara digelar dalam rangka memperkokoh tali silaturahmi yang sudah terjalin dan sekaligus memperkenalkan para Pengurus IKA UII Sumut yang akan dilantik. “Semoga dengan adanya halal bi halal ini dapat memperkokoh tali silaturrahmi yang sudah terjalin para alumni IKA UII di Sumut,” jelasnya. Diharapkan Soleh, para alumni IKA UII di Sumut yang belum mendaftarkan diri agar segera mendaftarkan di sekretariat IKA UUI Sumut. Acara yang digelar bernuansakan religius ini dihadiri Walikota Medan sekaligus memberikan bimbingan dan arahannya. (rel/m39)

Waspada/Rustam Effendi

SAMPAH: Dua anak nelayan bermain di atas tumpukan sampah di belaknang rumah warga Kelurahan Bagan Deli Kecamatan Medan Belawan. Tumpukan sampah itu sangat banyak sehingga membuat pantai di sekitar itu jorok. Foto diambil pekan lalu.


Opini

12

WASPADA Selasa 29 September 2009

Menatap Perekonomian RI Masa Depan Oleh Bachtiar Hassan Miraza

B

TAJUK RENCANA

Biarkan Hukum Bicara

K

asus yang mencuat di jajaran KPK dan Polri saat ini harus dilihat dari dua sisi. Sisi positif dan negatif. Yang positif dilanjutkan, sisi negatif jangan diteruskan. Oleh karena itu, semua pihak hendaknya menahan diri untuk melakukan intervensi (negatif) karena memperburuk upaya penegakan hukum, termasuk Presiden tidak boleh mengintervensi kedua lembaga independen itu. Keluarnya Perppu untuk mencari tiga Plt pimpinan KPK setelah Antasari Azhar ditetapkansebagaitersangkakasuspembunuhanNasruddin,dandualainnya–Chandra Hamzah dan Bibit Samad Riyanto—ditetapkan sebagai tersangka dalam kasus penyalahgunaan wewenang/kekuasaan kemudian (versi Kapolri) tersangkut kasus suap, menurut hemat kita sudah merupakan tindakan intervensi dari Presiden terhadap KPK. Perppu itu pun menimbulkan pro dan kontra. Kita berharap Perppu menetapkan tim lima untuk mencari Plt KPK yang kosong berjalan sukses. Artinya, mereka yang terpilih benar-benar berkualitas, berani menjalankan tugas berat KPK untuk memberantas korupsi tanpa pilih kasih. Oleh karena itu tugas tim lima sangat berat, dalam waktu singkat harus dapat mencari Plt KPK yang segera dapat bekerja di lembaga pemberantasan korupsi itu. Jika salah pilih, dampaknya sangat negatif bagi masa depan bangsa dan negara, khususnya upaya pemberantasan korupsi ke depannya. Wajar saja kalau banyak pihak yang menolak campur tangan pemerintah dalam hal ini Presiden SBY dalam mengatasi masalah KPK. Apalagi, KPK meski ditinggal ketuanya Antasari Azhar masih tetap bertaring dalam mengejar para koruptor. Bahkan, dengan dijatuhkannya status tersangka terhadap Chandra dan Bibit, dua pimpinan KPK yang tersisa masih sanggup menjalankan tugas-tugas KPK karena memang sistemnya sudah berjalan dengan baik. Maraknya kasus Polri dengan KPK berawal dari kecurigaan KPK terhadap salah seorang petinggi Polri terlibat dalam kasus Bank Century. Sangat disesalkan, mengapa Intisari petinggi Polri sampai mengetahui kalau ia sedang dalam inceran KPK untuk disadap? Pastilah ada orang dalam KPK yang Proses hukum menja- membocorkannya. Itu menunjukkan kalau darikepolisianyangditempatkan di acuan.Tak ada kebal orang-orang diKPKbisajadimasihmemilikirasasolidaritas, hukum. Oknum KPK sa- tidak senang pimpinannya disadap KPK lah dihukum, pimpinan untukditangkapkarenaujung-ujungnyaakan mempermalukan institusi Polri. Kalau tidak Polri salah juga menjalani ada yang membocorkan, bagaimana mungkin Kepala Badan Reserse Kriminal proses hukum. (Kabareskrim) Mabes Polri Komjen Pol Susno Duajisampaitahudirinyadisadap?Meskipun ia tidak secara implisit menyatakan KPK lah yang menyadap dirinya, namun terjadinya ‘’perang’’antaraKPKdanPolridenganistilah‘’cicak’’lawan‘’buaya’’sudahmenunjukkan hal itu. Kalau akhirnya tim pengacara Wakil Ketua KPK nonaktif Bibit Samad Riyanto dan Chandra M. Hamzah menyatakan akan melaporkan Kabareskrim ke Inspektorat Pengawasan Umum (Irwasum) Mabes Polri, hal itu perlu diberi dukungan. Apalagi kalau KPK berani menangkap petinggi Polri yang terlibat kasus korupsi. Kita memang menyesalkan mengapa KPK kelihatannya malah takut sehingga banyak kasus korupsi di Polri yang disebut-sebut media tidak terungkap ke permukaan. Begitu juga kasus korupsi di kejaksaan. Baru kasus Urip saja yang berhasil diungkap KPK dengan barang bukti sangat lengkap karena pelakunya tertangkap basah. Melihat sistem kerja KPK yang lambat, meskipun wewenangnya sangat besar sehingga terkesan sebagai lembaga ‘’super body’’ namun kasus korupsi yang berhasil diungkap relatif masih sedikit (kecil). Namun begitu, kita patut memberi apresiasi kepada KPK karena sebelumnya upaya pemberantasan korupsi mengalami gagal total. Polri dan Kejaksaan dinilai tidak bertaring, sehingga dibentuklah KPK. Justru itu, tim lima dalam mencari Plt pimpinan KPK tidak perlu memasukkan orang-orang dari Polri dan Kejaksaan. Sebab, selama ini saja mereka sudah gagal. Kalaupun ada, orangnya harus bersih, berani, seperti Baharuddin Lopa. Orang-orang dari Parpol juga harus dihindarkan karena akan menimbulkan ‘’conflict interest’’ mengingat banyak politisi yang ditangkap KPK selama ini. Kalauadausulandariberbagaipihakkepadatimlimasebagaitindaklanjutkeluarnya Perppu agar Plt pimpinan KPKdipilih dari orang dalam atau mantan pimpinan KPK sebelumnya, hal itu cukup rasional. Tentu sangat riskan kalau ternyata Plt pimpinan KPK yang baru ternyata antek-anteknya Orba dan punya kedekatan hubungan dengan para koruptor kelas kakap sehingga semua rahasia KPK dijualnya, maka hancurlah KPK.HancurnyaKPKberartijugamenghancurkancitraPresidenSBYyangmengeluarkan perppu. Hal ini sangat tidak diharapkan! Harapan kita, biarkan hukum bicara. Siapa pun yang bersalah harus diproses sesuai hukum yang berlaku. Tidak hanya tersangka di KPK, tetapi juga petinggi Polri jika bersalah harus diajukan ke pengadilan. Kalau semuanya mengacu pada proses hukum pastilah rakyat senang, dan masa depan bangsa menjadi cerah.+

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksiwaspada@gmail.com KANTOR PERWAKILAN � Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. � Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109 � Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: BW Rp. 11.000,FC Rp. 30.000,Halaman depan BW Rp. 33.000,Halaman depan FC Rp. 90.000,Ukuran kolom: 40,5 mm

anyak pihak yang tidak melihat bahwa ketenteraman yang terjadi selama berjalannya kegiatan politik (pemilu dan pilpres) baru-baru ini sebagai suatu kondisi yang menyebabkan terjaganya stabilitas ekonomi dan sekaligus ikut mendorong pemulihan ekonomi Indonesia. Setidak-tidaknya tidak sampai mengganggu jalannya pemulihan ekonomi yang sedang berjalan. Memang masih ada satu langkah lagi yang menyangkut kegiatan politik yang erat hubungannya dengan stabilitas ekonomi yaitu pembentukan pemerintahan baru. Sebagaimana biasa pembentukan pemerintahan baru tidak saja menjadi perhatian masyarakat di dalam negeri tetapi juga masyarakat luar negeri, khu-susnya investor luar negeri. Dunia usaha di dalam negeri juga tidak luput ikut memperhatikannya karena pembentukan pemerintahan baru tersebut memberikan isyarat arah dari pemerintahan yang akan datang, khususnya arah perkembangan ekonomi dalam negeri. Saat ini kita sudah berada pada kwartal III tahun 2009. Diharapkan pada kwartal ini kondisi perekonomian akan semakin baik jika dibandingkan dengan kwartal II sebelumnya. Kwartal II menunjukkan bahwa kinerja ekonomi makro Indonesia berjalan positif dengan hasil pertumbuhan ekonomi mencapai lebih kurang 4 persen, laju inflasi lebih

kecil 5 persen sementara nilai tukar rupiah berada pada kisaran Rp 10.000 per dolar Amerika Serikat. Walaupun secara rata rata pencapaian ini terhitung rendah tapi dapat kita maklumi karena perekonomian Indonesia saat ini baru dalam tahap pemulihan. Bagaimana mempercepatnya dan meningkatkannya pada masa mendatang adalah suatu tantangan bagi kita. Kita harus banyak berpikir dan meninggalkan cara cara baku yang berjalan selama ini. Pemulihan ekonomi tidak bisa kita lakukan dengan cara cara biasa tapi harus ada terapi khusus bagi mempercepat pemulihan dimaksud. Oleh sebab itu kita perlu mencari dan lebih merinci langkah langkah yang akan kita tempuh pada kwartal IV ataupun setelah pemerintahan baru terbentuk. Lima tahun ke depan, pemerintahan baru adalah lambang pembangunan ekonomi Indonesia. Baik buruknya masa depan perekonomian Indonesia ditentukan oleh siapa yang dipercaya duduk mengurus perekonomian itu. Maka marilah kita berdoa semoga para menteri yang duduk dalam pemerintahan yang akan datang adalah para menteri yang mengetahui permasalahan inti ekonomi bangsa dan mencarikan solusinya sesuai dengan struktur permasalahan bangsa ini. Bukan mereka yang berpikir di luar kebutuhan bangsa, tapi berpikir harmonis sesuai permasalahan dan kebutuhan bangsa.

Bagi mendorong pemulihan ekonomi yang lebih cepat perlu diperhatikan beberapa hal. Pertama, pembangunan masa mendatang agar lebih memperhatikan masalah pemerataan, baik daerah maupun sektor agar kepincangan ekonomi yang ada selama ini dapat dihilangkan. Pemerataan pembangunan secara sektoral dan daerah mampu memperkuat daya dorong pertumbuhan ekonomi itu sendiri. Kita hendaknya tidak melihat manfaat jangka pendek yang sifatnya instant tapi berpikir jangka panjang walau manfaat nya saat ini adalah kecil. Indonesia masa mendatang sangat memerlukan daya dorong bagi menumbuhkan perekonomian nasional. Daya dorong inilah yang harus dikejar bukan manfaat jangka pendek. Pembangunan adalah sebuah proses yang berjalan secara bertahap dan berakumulasi. Kedua, adalah sasaran pembangunan yang harus tertuju pada pembangunan infrastruktur, khususnya infrastruktur yang dapat membuka dan menembus kantong kantong wilayah produktif. Pembukaan akses ke wilayah produktif merupakan suatu persyaratan pertumbuhan ekonomi secara merata sekaligus memperkuat daya dorong pertumbuhan ekonomi itu sendiri. Kita tidak menghendaki pertumbuhan hanya terjadi pada satu wilayah karena akan menimbulkan dampak memperlemah pertumbuhan itu. Ia harus berjalan secara merata bagi mempercepat pertumbuhan secara simultan. Dimulai dari manfaat yang mungkin relatf kecil menuju pada manfaat yang relatif besar.

Terbuka akses perekonomian pada daerah sekeliling maupun pada daerah lainnya pada berbagai sektor kegiatan. Ketiga, memperbesar peran pemerintah daerah dengan memberikan kewenangan dan pembiayaan pembangunan yang lebih sepadan sesuai dengan pembangunan wilayah yang hendak dikerjakan. Dengan berbagai mekanisme pemerintah pusat dapat menyerahkan bagian dari pembangunan ekonomi nasional pada pemerintah daerah karena secara tepat merekalah yang lebih tahu permasalahan dan prioritas pembangunan di daerahnya. Pemerintah daerah didorong meningkatkan laju pertumbuhan daerah dengan memanfaatkan sumberdaya dan tenaga kerja lokal. Akhirnya, apa yang hendak kita tuju nantinya adalah meningkatkan daya beli mayarakat melalui penciptaan kesempatan kerja dan peningkatan pendapatan masyarakat sebagai kelompok pengguna (users/demanders) atas barang yang dihasilkan. Dengan demikian terjadi dorongan pada pertumbuhan sektor produksi yang dapat menciptakan bangkitnya sektor konsumsi untuk selanjutnya. Kita tidak dapat menyatakan yang satu lebih penting dari lainnya karena pada dasarnya kedua sektor tumbuh secara serentak dan saling mendukung. Sinkronisasi keduanya merupakan proses pertumbuhan ekonomi yang akan menciptakan kesejahteraan masyarakat secara keseluruhan. Penulis adalah pemerhati ekonomi

PKS Dan Sejarah Kota Medan Oleh Budi Agustono

S

etelah pelantikan anggota Dewan Perwakilan Rakyat Daerah Medan tanggal 15 September lalu, Partai Keadilan Sejahtera (PKS) langsung menggelar rapat kerja (raker) fraksi untuk menyusunprogramkerjakedepan.Salahsatu program yang disusun adalah usulan memasukkan sejarah kota Medan menjadi mata pelajaran tambahan di sekolah. Menurut Ikrimah Hamidy, Ketua FPKS DPRD Medan, pelajaran sejarah kota Medan itu penting untuk mendidik agar para siswa mengetahui karakter dan sejarah kotanya guna menimbulkan kecintaan terhadap daerahnya. Selama ini, banyak siswa yang tidak mengenal dan merasa asing dengan sejarah kotanya. Padahal itu penting agar kelak bisa lebih mencintai dan melestarikan tempat-tempat bersejarah yang ada di daerah tersebut. Kota Medan punya banyak peninggalan sejarah, salah satu cara melestarikannya adalah dengan memberikan pengetahuan dan pemahaman kepada generasi muda lewat pelajaran di sekolah (Waspada Online, 17 September 2009). Usulan program kerja PKS ini patut diacungi jempol karena usai pelantikan PKSbukannyatenggelamdalamgemuruh suka cita, tetapi langsung menggelar rapat kerja fraksi. Menariknya lagi dan ini mungkin tidak pernah terpikirkan partai lainnya yang ada di DPRD Medan, PKS mengusung program memasukkan sejarah kota Medan menjadi mata pelajaran tambahan di sekolah. Soal sejarah kota Medan menjadimatapelajaran disekolah mungkin tidak menarik partai lainnya karena tidakbisamencuriperhatianpublik yang suka dengan isu sexy, apalagi soal sejarah tentu akan semakin luput dari perhatian, kalau bukan terabaikan dalam pembahasan agenda partai. Sebaliknya, PKS menganggap sejarah kota Medan ini sangatpentingdanprinsipilkarenabanyak masyarakat, terutama siswa dan kalangan terpelajar lainnya yang tidak mengerti sejarah kota Medan. Namun, PKS tidak merinciapadanbagaimanaisisejarahkota Medan yang diusulkan menjadi mata pelajaran di sekolah. Tulisan ini akan mencoba membentangkan tema-tema tertentu secara diakronik untuk mengisi muatan sejarah kota Medan sebagaimana yang diagendakan dalam program kerja FPKS DPRD Medan. Berdasarkanperiodesasiadabeberapa halyangperludisampaikanuntukmengisi muatan sejarah kota Medan. Pertama, terbentuknya sejarah kota Medan (modern) tidak berdiri sendiri dan tidak pula dapat diterangkan dengan penjelaskan tunggal. Pembentukan sejarah kota Medan terkait erat dengan perluasan kekuasaan Belanda pada pertengahan abad 19 ke Sumatera Timur. Akan tetapi kota Medan sendiri dibangun bukan oleh pemerintah Belanda, namun perkembangan dan pertumbuhannya lebih banyak difasilitasi oleh pemilik modal asing dari berbagai negara yang diwakili dalam bentuk perkebunan. Para pemilik modal kolonial inilah yang meletakkan pondasipembangunankotaMedan.Jikadilihat darimasuknyaBelandakeSumateraTimur tahun 1861 melalui kontrak politik dengan kesultanan Asahan, Serdang, Deli, dan

Langkat, yang mengakui kedaulatan Belanda sampai terbentuknya pembangunan kota Medan tahun 1910-an, maka hampir lima puluh tahun itulah kota Medan beserta infrastruktur modernnya dibangun untuk kepentingan politik dan ekstrasi ekonomi kolonial ke negeri induk kapitalisme (Belanda dan negara Eropa lainnya). Di sepanjang kekuasaannya pemerintah kolonial Belanda dan hegemoni perkebunan membawa dampak politik, ekonomi, sosial, dan budaya. Oleh karena, dampak politik kekuasaan kolonial mempunyaimagnitudeyangbesar,maka ketika terjadisuatuperistiwapolitikdiluarMedan dapat berpengaruh ke wilayah lainnya. Misalnya, perang Sunggal atau sering disebutperangBatakyangmeletuptahun1872 sebagai protes orang Karo terhadap dominasi perkebunan dan kekuasaan Sultan Deli yang merampas tanah ulayat mereka bukan terjadi di Medan, tetapi dampak politiknya sangat terasa sekali di sekitar Medan. Masuknya kekuasaan Belanda tahun 1861 yang diikuti dengan mengalirnya modal kolonial sampai awal abad keduapuluhtahun,mendorongperubahan besar dalam bidang politik dan ekonomidisekitarMedan.Menciutnyakekuasaan Kesultanan, perubahan birokrasi tradisional patrimonial ke birokrasi modern (kolonial), pengelolaan politik yang represif sebagai akibat kekuasaan kolonial yang mengutamakan keamanan dan ketertiban, kekerasan politik di luar batas kemanusiaan oleh pemilik modal (perkebunan) adalah contoh dari perubahan politik tersebut. Sedangkan di bidang ekonomi, Medan menjadi termasyhur dalam masyarakat international karena salah satu penghasil tembakau bermutu dunia. Selainitu, Kesultanan(Deli)melaluikonsesi tanah yang diberikan kepada pemilik modal tumbuh menjadi salah satu aktor ekonomi dalam masyarakat kolonial. Dengan kekuatan ekonomi inilah Kesultanan Deli menegakkan dan membangun simbol budayanya seperti mendirikan Istana Maimoon, Masjid Raya, Gedung Kerapatan, dan sebagainya. Kedua, tahun 1900 – 1942 merupakan masa perkembangan nasionalisme. Munculnya pergerakan kebangsaan (nasionalisme) awalnya dipelopori oleh lahirnya Budi Utomo, Sarikat Islam, Partai Nasional Indonesia(PNI)yangtokoh-tokohnya berasal dari Jawa. Kemudian gerakan kebangsaan yang mulanya dari Jawa itu pada tahun 1920-an kepemimpinannya mulai diambil-alihpemimpinlokal.Parapemimpin lokal inilah yang melawan penguasa kolonial, kapitalisme, imperalisme, dan hegemoni perkebunan. Dengan meneriakkan anti-kapitalisme, anti-imperialisme, dan anti-feodalisme gerakan nasionalisme mendapat tempat di kalangan buruhperkebunan.Kaumburuhdiberbagai dikantong-kantongperkebunanmulai terlibatdalampergerakannasional.Dalam kaitannya dengan kelahiran nasionalisme, di awal abad 20 masyarakat Karo melawan penguasa kolonial yang mesin perangnya jauh lebih modern itu. Perlawanan orang Karo ini, dalam batas-batas tertentu merupakan munculnya nasionalisme (etnik) lokalpertamadisekitarMedan.Disamping itu, pada periode ini pula bermunculan pers yang menjadi instrumen perjuangan

melawan kekuasaan kolonial. Pers yang mengecam dan mengejek kekuasaan kolonial dan arogansi pemilik modal (perkebunan)semakinmeradikalisasipergerakan kebangsaan. Gejolak pergerakan kebangsaan lokal berjalin kelindan dengan dinamika pergerakan kebangsaan di Jawa. Ketika Gubernur Jenderal De Jong menjadi penguasa utama di Hindia Belanda pada tahun 1930-an, suasana pergerakan tampak lumpuh dan tidak berdaya. Gubernur Genderal De Jong sangat konservatif dan tetap mendambakan Belanda tetap berkuasa ratusan tahun lagi. Akibat kebijakan politiknya yang reperesif, karena aktivitas politiknya banyak pemimpin pergerakan banyak yang ditangkap. Apa yang terjadi di tahun 1930-an di Jawa berimbas di Medan dan sekitarnya, Residen SumateraTimur danpemilikmodal(perkebunan)menindak keras kaum pergerakan yang berakibat padamnya gerakan kebangsaan di wilayah ini sampai menjelang tahun 1942. Ketiga, tahun 1942 –1945 adalah masa pendudukan Jepang sampai perang kemerdekaan. Masa pendudukan Jepang membawa perubahan politik dalam pergerakan kebangsaan. Di masa ini kaum pergerakankebangsaanmendapat tempat dalamkekuasaanJepang.Jepangmemberi jabatan di pemerintahan kepada kaum pergerakan tidak lain untuk mendukung politik perangnya dengan Sekutu. Meski memihak kaum pergerakan, tetapi Jepang tetap mempertahankan relasinya dengan Kesultanan. Namun di masa ini terjadi perubahan struktural di tingkat bawah yaitu kelompok etnik lain yang bermigrasi kesekitarMedandidorongJepangmengolah tanah dengan menanam padi dan jagung, satu hal yang tidak pernah terjadi sebelumnya. Sementara pihak penduduk asli (Melayu) tidak senang dan marah atas apa yang dilakukan Jepang karena dengan masuknya pendatang mengolah tanah membuat etnik Melayu kehilangan hak istimewanya sebagai penduduk asli. Hal inilah yang mendorong meletupnya konflik pertanahan antara pendatang dan penduduk asli. Konflik tanah ini berhimpitan dengan persoalan etnik sehingga konflik tanah bergeser menjadi konflik etnik. Selain itu Jepang juga membentuk Heiho, Gyugun, Bompa, Talapeta dan sebagainya. Kelahiran organisasi semakin meradikalisasi kaum pergerakan menyuarakan kemerdekaan. Namun begitu di masa ini pula banyak penduduk yang direkrutmenjadiromusha,kerjapaksatanpa upah, yang dipekerjakan ke berbagai daerah. Jepang kalah perang dengan Sekutu tahun 1945 dan Indonesia mengumandangkan kemerdekaan. Keempat, 1945 – 1965 adalah masa kemerdekaan sampai meletusnya peristiwa 1965. Di Sumatera Utara, terutama Medankemerdekaandiproklamirkanagak terlambat. Akan tetapi, pada masa ini ketegangan politik, terutama sesudah berdirinyalaskar-laskar,konflikpolitiksemakin menajam. Seturut dengan itu partai politik yang dengan beragam ideologi bermunculan.Demikianpuladengankonfliksosial antara rakyat dengan Kesultanan semakin membubung tinggi. Bagaimana mana peran antar laskar memperebutkan sumber daya lokal yang hasilnya dibarter dengan persenjataan modern di Semenanjung Malaya dan peran laskar dalam mempertahankankemerdekaanmerupakan sebuah episode yang menarik. Namun, belum genap 12 bulan merdeka di

Medan dan sekitarnya pada tahun 1946 pecah revolusi sosial yang merenggut ratusan korban jiwa. Tidak lama sesudah berakhir amuk revolusi sosial, Belanda ingin kembali menjajah Sumatera Timur lewataksipolisionil(clash)yangmelahirkan perang kemerdekaan. Di masa ini Belanda membentukNegaraSumateraTimuryang didukung Kesultanan. Namun, NST hancur berantakan lantaran mendapat perlawanan dari rakyat. Memasuki tahun 1950andenganmeningkatnyakonstelasipolitik sebagaidampakdaripolitiknasionalpecah pemberontakan daerah. Setelah pemberontakan daerah dipadamkan berlangsung nasionalisasi perusahaan Belanda, termasuk perkebunan. Setelah itu tahun 1960-an partai politik (PNI, Masyumi, NU, PKI, dan Parkindo) dan organisasi massa seperti Serikat Buruh, Serikat Petani, dan sebagainya memainkan peranan penting dalampolitisasimasyarakat.Dimasainilah konflik politik aliran mewarnai wilayah ini. Puncak dari konflik politik itu adalah gerakan 30 September 1965. Periode 1950an- 1960-an merupakan zaman kelabu diMedandansekitarnya.Dikatakankelabu karena masih banyak historical events yang belum terungkap sampai sekarang. Mencerdaskan Periodesasi sejarah kota Medan di atas masih umum dan memerlukan diskusi lebih lanjut. Jika PKS ingin memasukkan sejarah kota Medan menjadi mata pelajaran di sekolah dapat mempertimbangkan periodesasi di atas. Namun, bila sejarah kota Medan disajikan tidak utuh dan tidak komprehensif dengan menghilangkan aspek strukturalnya tidak saja akan merugikan masyarakat, tetapi justu membuat masyarakat Sumatera Utara bingung dan terasing dengan sejarahnya sendiri.Olehkarenaituuntukmewujudkan salah satu agenda Fraksi PKS DPRD Medan, PKS perlu mengajak Dinas Pendidikan dan Kebudayaan, Masyarakat Sejarawan Indonesia Sumatera Utara, dan Departemen Sejarah Fakultas Sastra USU, dan pemangku kepentingan lainnya duduk bersama mendiskusikan sejarah kota Medan. Agenda Fraksi PKS DPRD Medan ini merupakan pekerjaan besar karena jika terlaksana, PKS Medan telah memberikan konstribusinya dalam mencerahkan dan mencerdaskan masyarakat Sumatera Utara. Penulis adalah staf pengajar Jurusan Sejarah Fakultas Sastra USU.

SUDUT BATUAH * Presiden ajak rakyat pesta batik 2 Oktober - Takutnya harga batik pun ikut melambung * Rakyat tak ingin kabinet SBY diisi politisi - Maklum ‘talk only’ * Masyarakat kembali kecam pemadaman listrik - Habis terang datanglah gelap, he...he...he el

o

D Wak

WASPADA

Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


Opini

WASPADA Selasa 29 September 2009

13

Label Halal, Bukan Label Haram Oleh H Fadly Nurzal, SAg

T

erminologi ‘halal’ dan ‘haram’ memang lekat dengan Islam, tapi setiapagamamemilikikriteriahalal dan haram-nya masing-masing. Dalam agama Yahudi dikenal kata ‘kosher’, mirip dengan halal, namun kriterianya berbeda. Seperti juga Umat Islam, orangorangYahudi juga cukup berhati-hati terkait dengan makanan yang dikonsumsi. Indonesia yang penduduknya mayoritas muslim, sampai saat ini belum memiliki peraturan atau undang-undang yang tegas mengatur tentang label halal. Karena itu makanan yang beredar di pasaran, dapat dikategorikan syubhat. Mengapa syubhat? karena memang meragukan, tidak ada jaminan makanan tersebut halal. Halal memiliki pengertian yang sangat luas, yakni halal dari segi bahan, proses dan cara memperolehnya, hingga pada akibat mengkonsumsinya. Ternyata sejumlah pasar di Indonesia, baik restoran, rumah makan, tempat pemotongan hewan, maupun pasar tradisional belum sepenuhnya memberikan jaminan halalterhadapprodukyangmerekapasarkan. Permasalahannya adalah, tidak semua umat muslim memiliki pengetahuan yang cukup untuk mengetahui apakah pagangan dan barang yang akan dikonsumsinya halal 100 persen. Bagisetiapmuslim,pengetahuantentang kehalalan produk makanan yang akan dikonsumsinyamenjadisangatpenting,karena terkait dengan ketenangan hati dalam melaksanakan aktivitas penghambaan dirinya kepada Allah. Islam mengajarkan kepada umatnya untuk mengkonsumsi makanan dan minuman yang halal dan baik, termasuk barang-barang yang digunakan dalam kehidupan. Itulah pula sebabnya kehalalan makanan dan barang-barang mendapatkan perhatian serius dalam Islam. Al Quran secara

tegas telah memberikan pengaturan tentang makanan dan minuman. Telaah tentang kehalalan panganan dan/atau barang tidak saja terhenti demi kesehatan, namun jauh dari itu, kehalalan panganan atau barang yang dikonsumsi sangat terkait dengan penciptaan perilaku manusia. Artinya dengan mengkonsumsi panganan dan barang yang jelas kehalalannya, maka akan melahirkan perilaku manusia yang baik pula. Dari sudut pandang akidah, mengkonsumsi panganan dan barang yang halal merupakan ibadah bagi umat muslim. Jika seluruh umat Islam pendudukan mayoritas Indonesia mengkonsumsi panganan dan barang yang halal, sama artinya bahwa pemerintah sedang mempersiapkan masyarakat yang berperilaku baik. Jika alur pikir ini yang digunakan, maka sesungguhnya pengesahan Rancangan Undang-Undang Jaminan Produk Halal (RUU-JPH) harus disegerakan untuk menjadi UU, demi keselamatan masyarakat Indonesia. Perlu dipahami, pembentukan UU JPH sebagai payung hukum yang mengatur tentang label halal, bukan untuk memenangkan masyarakat mayoritas dan mengalahkan warga minoritas, dan bukan pula mengunggulkan satu agama dan mengkerdilkanagamalain.Sesungguhnyapengaturan labelhalalmerupakanjaminanhukumuntuk melindungi hak-hak warga negara. Bagi masyarakatyangtidakmembutuhkanlabelhalal, silahkan.Namunbagimasyarakatyangmembutuhkan jangan pula dihalangi untuk mendapatkan jaminan halal itu. Merugikan Ketiadaan jaminan label halal terhadap produkpanganandanbarang,sesungguhnya sangat merugikan masyarakat muslim. Keresahanitutampaknyatapadasaatmenjelang bulan Ramadhan dan Syawal. Momentum seperti ini kerap sekali dimanfaatkan oknum pedagang dengan menjual panganan dan barang yang tidak jelas halal-haramnya, bahkan kadaluarsa. Padahal umat Muslim dalam mengkonsumsi makanan, minuman serta produk-produk lainnya membutuhkan jaminan keselamatan, baik jaminan keselamatanJasmani,rohanimaupunkeselamatan aqidah. Secara umum ada tiga kategori makanan yang dikonsumsi manusia, yakni; nabati,

hewani, dan bahan penolong untuk produk olahan. Pada prinsipnya semua bahan panganan tersebut adalah halal, kecuali yang diharamkan oleh syari’at Islam. Padangan Islamterhadappanganantidakhanyahalalan saja, namun juga harus thayyiban. Dalam beberapa ayat Alquran, kata halalan selalu diiukuti dengan kata thayyiban, hal ini menunjukkan, masyarakat Muslim harus mengkonsumsi panganan yang halalan dan thayyiban dari sisi zat, proses produksi, distribusi, tujuanproduksi,hinggapadaakibatmenkonsumsi panganan itu. Maka panganan yang halal dari segi zatnya dapat menjadi haram, ketika cara memproduksi dan tujuan menkonsumsinya melanggar ketentuan-ketentuan syara’. Konsumen dalam Islam, tidak sematamata mengkonsumsi kebendaan hanya didasarkan pada rasionalisme semata, tetapi juga konsumen untuk kerohanian, sosial dan lingkungan. Allah SWT memerintahkan kepada umatnya. Dalam hal ini konsumen, untuk mengkonsumsi makanan yang baik, halal dan bermanfaat bagi manusia, juga memanfaatkan segala anugerah-Nya sebagai wujud ketaatan kepada-Nya. Karena itu pula, tujuan konsumen muslim dalam mengkonsumsi panganan bertujuan untuk mengabdi dan merealisasikan tujuan yang dikehendaki Allah Swt. Fuqaha’ memberikan empat tingkatan bagi konsumen dalam mengkonsumsi panganan, yakni: (1) Wajib, untuk menghindari dari kebinasaan. (2) Sunnah, agar mampu melaksanakan ibadah secara paripurna. (3) Mubah, sesuatu yang lebih dari sunnah sampai batas kenyang. (4) Makruh, melebihi batas kenyang dan menggangu aktifitas. (5) Haram, membahayakankeselamatanbaikjasmani,rohani, dan akidah. Variasi Variasi produk panganan dan barang pada satu sisi memberikan manfaat bagi konsumen, karena kebutuhan akan produk yang diinginkan dapat terpenuhi, serta semakin terbuka lebar kebebasan untuk memilih aneka jenis dan kualitas produk yang sesuai dengan keinginan dan kemampuan. Pada sisi lain, fenomena itu mengakibatkan kedudukan produsen dan konsumen tidak seimbang, dimana daya tawar konsumen berada pada posisi yang lemah. Secara etis, setiap perusahaan mempunyai tanggung jawab sosial (corporate so-

cial responsibility), yaitu kepedulian dan komitmen moral perusahaan terhadap kepentingan masyarakat, terlepas dari kalkulasi untung dan rugi perusahaan. Salah satu tanggung jawab sosial perusahaan tersebut adalah perlindungan terhadap konsumen. Perlindungan konsumen memiliki cakupan yang luas, meliputi perlindungan terhadap konsumen barang dan jasa, yang berawaldaritahapkegiatanuntukmendapatkan produk hingga sampai akibat-akibat dari pemakaian produk tersebut. Labeladalahsetiapketeranganmengenai pangan yang berbentuk gambar, tulisan, kombinasi keduanya, atau bentuk lain yang disertakan pada pangan, dimasukkan ke dalam, ditempelkan pada, atau merupakan bagian kemasan pangan. Sedangkan makanan halal adalah pangan yang tidak mengandung unsur atau bahan yang haram atau dilarang untuk dikonsumsi umat Islam, baik yang menyangkut bahan baku pangan, bahan tambahan pangan, bahan bantu dan bahan penolong lainnya termasuk bahan pangan yang diolah melalui proses rekayasa genetika dan iradiasi pangan, dan yang pengelolaannyadilakukansesuaidenganketentuan hukum agama Islam. Terkait dengan keselamatan konsumen muslim, baik secara akidah, rohaniah maupun jasmaniah, dalam mengkonsumsi makanan, minuman serta bahan olahan lain bergantung pada informasi produk itu. Maka informasi yang menyesatkan konsumen muslim tentang kehalalan produk akan merusak keselamatan akidah, rohaniah dan jasmaniah konsumen muslim itu. Hal ini pulalah yang mengaharuskan minuman serta bahan olahan lain harus memiliki label, baik label halal untuk dikonsumsiumatIslammaupunlabelharamuntuk dikonsumsiselainumatIslam.Karenasesungguhnya antara halal dan haram harus jelas, maka produk minuman serta bahan olahan lain juga harus memiliki kepastian hukum apakah produk itu halal atau haram untuk dikonsumsi umat Islam. Bukankah hukum bertujuan untuk menciptakan keadilan, kemanfaatan, dan kepastian? Selama ini pengaturan label halal hanya diatur dalam beberapa pasal diberbagai peraturan perundang-undangan saja, yakni: Pasal 34 ayat (1) Undang-undang Nomor 7 Tahun 1996 tentang Pangan, Pasal 8 ayat (1) hurufhUndang-undangNomor8Tahun1999 tentang Perlindungan Konsumen, dan Pasal

10 ayat (1) Peraturan Pemerintah Nomor 69 Tahun 1999 tentang Label dan Iklan Pangan. Kondisi ini pulalah yang melahirkan perbedaan sanksi atas penyalahgunaan label jalal, sehingga bukan tidak mungkin akan menimbulkan kesulitan dalam penetapan sanksi yang harus diterapkan terkait dengan penyalahgunaan label halal. Jika Singapura yang berpenduduk mayoritas non-muslim dijadikan perbandingan dengan Indonesia yang berpenduduk mayoritas Muslim, maka akan nyata, perhatian Singapura terhadap warga Muslim cukup besar. Hal ini dibuktikan, Singapura telah menetapkan Badan Sertifikasi Halal Singapura, Majelis Ulama Islam Singapura sebagai lembaga satu-satunya yang berwenang menerbitkan sertifikat halal, Hal ini terlihat dari keberadaan Sertifikat Halal MUIS telah terbit sejak tahun 1978. Bahkan di negara-negara sekuler sekalipun seperti Eropa telah mengatur tentang label halal, hal ini menunjukan keseriusan mereka untuk melindungi hak-hak wargannya, khususnya konsumen muslim. Pemerintah Republik Indonesia menyerahkan kewenangan untuk menerbitkan sertifikasi halal kepada Majelis Ulama Indonesia (MUI) melalui Piagam Kerjasama Departemen Kesehatan, Departemen Agama, dan Majelis Ulama Indonesia Tahun 1996 tentang Pelaksanaan Pencantuman Label Halal pada Makanan. Sedangkan pelaksanaan pencantuman Label Halal menjadi kewenangan Departemen Kesehatan yang didasarkan atas hasil pembahasan bersama antara Departemen Kesehatan, Departemen agama dan Majelis Ulama Indonesia. Rancangan Undang-undang Jaminan Produk Halal (RUU-JPH) yang sedang digodok DPR RI merupakan angin segar bagi masyarakat Islam di Indonesia, dengan harapan produk barang dan/atau jasa yang beredar nantinya harus melewati pemeriksaan apakah produk tersebut halal atau haram untuk dikonsumsi oleh masyarakat muslim. Terlepas dari perdebatan yang sedikit panjang tentang apakah sertifikasi halal diserahkan kepada pemerintah atau tetap dipegang MUI, namun kita semua berharap, lembaga yang berwenang menerbitkan sertifikasi halal nantinya memiliki teknologi yang cukup, serta memiliki tim auditor yang kualified dan kompeten.

Penggodokan RUU-JPH juga diharapkan terhindar dari conflict of interest, yang dapat merugikan dan membahayakan konsumen muslim sendiri, sehingga dapat menjadikan fungsi pengawasan terhadap produsen menjadilemahdalamhalpenerbitansertifikat halal. Karena kehalalan suatu produk merupakan kepentingan umat untuk mendapatkan haknya mengkonsumsi barang dan/atau jasa yang berkualitas dan sehat yang diwajibkanSyariatIslam.Maka,biarkanlahDPR RI dan Pemerintah, secara bijak dan mendengarkan aspirasi masyarakat khususnya umat Islam guna menyempurnakan menyempurnakan pembahasan RUU-JPH. Penutup Pada hakikatnya, kepedulian dan tanggungjawab perusahaan terhadap konsumen muslim adalah wujud kepentingan untuk perusahaan itu sendiri guna mendapatkan keuntungan. Keuntungan itu diperoleh dari tanggung jawab dan kepedulian terhadap konsumenmuslim,yangdirealisasikandalam bentuk kepercayaan publik dan kemudian bergerak ke arah pemetikan hasil dari kepercayaan publik. Terkait dengan kehalalan produk pangan dan barang, biasanya konsumen merupakan golongan yang sangat rentan diekpsloitasi secara buruk oleh produsen, terlebih lagi terhadap konsumen muslim. Kondisi ini dapat meruntuhkankepercayaankonsumensecara publik terhadap produsen itu, yang akhirnya merugikan pihak produsen sendiri, karena produknya tidak dikonsumsi lagi oleh konsumen. Pengaturan label halal sesungguhnya tidak dimaksudkan untuk mematikan ataupun melemahkan aktifitas produsen, tetapi justru sebaliknya. Sebab pengaturan lebel halal diharapkan mampu mendorong iklim dan persaingan usaha yang sehat, serta diharapkan dapat melahirkan perusahaan yangtangguhdalammenghadapipersaingan sehat melalui penyediaan barang dan jasa yang berkualitas. Label halal bukanlah hantu yang menakut-nakuti produsen ataupun virus yang mematikan produsen. Jadi, tidak perlu takut, karena yang dibutuhkan label halal bukan label haram. wallahu a’lam bissawab… Penulis adalah Ketua DPW Partai Persatuan Pembangunan (PPP) Sumut dan Ketua Majelis Alumni Fakultas Syariah IAIN Sumut.

Baliho Rahudman & Pilkada Medan Oleh Choking Susilo Sakeh Ada yang berbeda pada lebaran di Medan kali ini! i puluhan tempat, minimal pada 21 lokasi, terdapat baliho relatif besar berisi ucapan selamat Idulfitri dari Pejabat Walikota Medan, Rahudman Harahap, bersama camat di masingmasing wilayah kecamatan. Mau tidak mau, baliho semacam ini menjadi barang baru di Medan. Sebab, selama ini baliho ucapan selamat hanya dibuat oleh Walikota, Wakil dan Sekda Medan. Sepintas, disadari atau tidak, keberadaan baliho ini telah menambah kesemarakan Idul Fitri di kota berpenduduk sekitar dua juta jiwa ini. Sampai pada tahap ini, tentunya kita berterima kasih kepada Pejabat Walikota Medan beserta ke 21 camat yang telah berkenan menambah anggaran-

D

nya untuk kesemarakan Kota Medan menyambut Idul Fitri 1430 H. Bung, bisa dibayangkan kemeriahan bagaimana yang akan muncul di Medan andai 161 lurah yang ada juga ‘diperintahkan’ untuk ikut membuat baliho. Dan selanjutnya, kemeriahan pun akan semakin menjadi-jadi lagi, jika ratusan kepling juga diwajibkan membuat baliho serupa. Asyik… Sepintas, baliho-baliho ucapan selamat Idul Fitri dari Pejabat Walikota Medan didampingi para camat tersebut, bisa menimbulkan kesan bahwa dalam tempo sesingkat-singkatnya Rahudman Harahap sebagai Pejabat Walikota Medan telah mampu melakukan koordinasi yang hangat, bahkan juga ‘diterima’ oleh seluruh camat yang ada di Pemko Medan. Ini tentu kabar menggembirakan bagi

warga kota. Sebab, koordinasi yang hangat tersebut tentunya akan semakin mempermudah Pejabat Walikota melaksanakan semua programnya hingga ke masyarakat. Andai para lurah dan kepling ikut memasang baliho ucapan selamat bersama PejabatWalikota Medan, maka kesan yang muncul tentunya akan lebih meluas lagi.. Tapi, untuk tahap awal okelah, pada momen berikutnya mungkin para lurah dan kepling bisa dipaksa ikut-ikutan. Namun berhubung Pilkada Medan sudah di pelupuk mata, maka membaca baliho pak Pejabat dan pak Camat itu mau tak mau boleh dikaitkan dengan niat lain yang ada di benak Rahudman. Benar bahwa salah satu tugas Rahudman Harahap sebagai Pejabat Walikota Medan adalah mempersiapkan pelaksanaan Pilkada Medan. Namun sah-sah saja jika kemudian Rahudman Harahap memanfaatkan segala peluang yang ada untuk ‘menjajakan’ dirinya.Tokh, jejak rekam Rahudman memang

memperlihatkan bakatnya di dalam memanfaatkansegalapeluang.Lagipula,kesempatan kan tidak pernah datang dua kali. Sah dan tidak salah. Yang salah adalah jikalau minat Rahudman maju sebagai kandidat pada Pilkada Medan dilarang, karena itu dianggap melanggar hak asasi Rahudman sebagai warga negara. Yang diharapkan Rahudman dari baliho-baliho itu kemudian adalah : mudahmudahan banyak warga yang mendukung minatnya untuk muncul sebagai salah satu kandidat pada Pilkada Medan yang akan berlangsung awal tahun depan. Dengan demikian, mestinya kita juga membaca baliho Rahudman dan para camat tersebut dalam konteks Pilkada Medan. Apalagi jika kita amati kebijakan Rahudman sebagai Pejabat Walikota Medan, hampir semuanya mengarah kepada kebijakan yang populis. Rahudman belum sekalipun memperlihatkan kebijakan yang struktural bagi perbaikan kota.

Dengan terbacanya minat Rahudman maju sebagai kandidat pada Pilkada Medan, semestinya harus dicermati oleh banyak figur yang sudah lebih dahulu memasang niat untuk maju. Paling tidak, mereka harus mendesain ulang strategi komunikasi yang telah dilakukannya selama ini. Strategi komunikasi yang telah disusun oleh para peminat, tentunya menjadi berbeda tatkala incumbent ikut muncul. Berbagai prakiraan yang sudah disusun, pun harus didesain ulang. Andai pertarungan pada Pilkada Medan semula diperkirakan akan berlangsung penuh warna-warni karena dilaksanakan tanpa kandidat incumbent, namun kini, warna pertarungan akan menjadi lain dengan kemunculan niat Rahudman untuk ikut maju. Sebab, sebagai incumbent, tentu Rahudman mempunyai peluang yang lebih besar dalam menjajakan dirinya -–antara lain dengan memanfaatkan parangkat yang ada— dibanding peluang yang di-

miliki kandidat lainnya. Paling tidak, para figur lainnya harus menyiapkan logistik dua kali lipat dibanding pilkada tanpa incumbent. Kalau aspek itu sudah tersedia, ya, monggo, para figur kainnya silakan maju terus pantang mundur. Nah, sampai beberapa saat ke depan menjelang Pilkada Medan, ada beberapa momen yang bisa dimanfaatkan untuk berbaliho ria. Momen Idul Adha disusul Natal dan Tahun Baru 2010, menantang para kandidat untuk menyiapkan balihonya. Namun mesti diperhitungkan secara tepat materi dan desain baliho —terutama dari aspek komunikasi— setelah kehadiran sang incumbent. Untuk selanjutnya, bersiaplah untuk kalah… Penulis adalah jurnalis, Direktur Eksekutif Konsultan Komunikasi Publik “Citra Media Communication” Medan.

Tingkatkan Iman Dan Takwa Pasca Idul Fitri Oleh Fauzil Husni, S.Si

I

dul Fitri yang tengah kita rayakan merupakan salah satu dari hari-hari besar agama Islam. Dalam Islam, Idul Fitri dan Idul Adha merupakan dua hari raya yang diagungkan dan menjadi kebanggaan umat Islam. Secara umum, umat muslim di Indonesia biasanya lebih memeriahkan Idul Fitri, padahal di dalam Islam Idul Adha itu lebih agung seperti terlihat di daerah Aceh dan di sejumlah negara Islam lainnya. Khusus di Indonesia, sepertinya beberapa hal yang paling menonjol dari kemeriahan Idul Fitri adalah tradisi mudik yang dibalut dengan nuansa maaf maafan (halal bihalal) serta tradisi memakai pakaian baru dan sajian makanan yang beraneka ragam.

Kebiasaan ini mungkin berawal dari pemahaman kita bahwa Idul Fitri merupakan ajang untuk bermaafmaafan. Sehingga dari sana muncullah kebiasaan mudik, dan juga bertamu. Karena tradisi bertamu ditambah rasa senang setelah melewati ujian berat maka dilampiaskan dengan memakai pakaian yang baru, dalam hadist juga dikatakan bahwa Idul Fitri bukan dengan berpakaian yang serba baru. Di sisi lain karena tradisi bertamu pula, maka tak enak rasanya jika tidak menyajikan panganan yang nikmat kepada tamu yang datang di hari kemenangan itu. Sebenarnya istilah halal bihalal sendiri diambil dari bahasa Arab halla yahullu yang artinya meluruskan (mengurai) benang

Mengharap Syafa’atnyaTapi Mengabaikan Sunnahnya Setiap kesempatan Pengajian natau Majelis Ta’lim atau ceremonial bernu7ansa Da’wah selalu terucap kata-kata :”Ke4pada Allah kita bermohon kiranya SHALAWAT dan SALAM disampaikan kepada Rasulullah Muhammad SAW beserta keluarganya,sahabat dan yang I’tiba pada sunnahnya beliau sampai akhir hayat kita atau hingga akhir zaman kelak”. Versi lain menyebutkan:”marilah kita menyampaikan Shalwat dan Salam KITA HADIAHKAN kepada Baginda kita Rasulullah Muhammad SAWse,oga dengan shalawat yang kita sampaiakninsyaAllahkitamendapatkansyafa’atnyadihariakhirkelak“kemudianserentaklah jama‘ah menyahutinya dengan lafadz Amiiiin. Kedua bentuk kalimat diatas serupa tapi tak sama lalu dimana bedanya ? Shalawat itu adalah do’a kita kepada Allah SWT untuk Rasulullah Muhammad SAW, para keluarga beliau, sahabat beliau dan para Thabi’in beliau yang setia dan menjunjung tinngi, mempertahankan keutuhan Sunnah beliau (Rasulullah SAW) dengan tidak mebgenal menyerah walau terkadang kelompok minoritas ini selalu mendapat diskriminasi dari sekitar lingkungan dengan alasan Taqlik Klasik. Sedangkan kelompok yang menghadiahkan Shalawat dan juga mengaharap syafa’at dari Nabi Muhammad SAW dihari Akhirat kelak disebut kelompok Taqlik Mayoritas tapi

yang kusut. Istilah dan kebiasaan halal bihalal pada perayaan hari raya Idul Fitri tampaknya lebih dikaitkan dengan suatu opini yang bersandarkan pada definisi Idul Fitri yaitu kembali suci yaitu suci dari dosadosa. Untuk itulah lahir tradisi maaf-maafan. Mengapa harus ada halal-bihalal? Karena dosa kita yang berkaitan dengan orang lain baru dihapuskan bila orang tersebut telah memaafkan. Padahal tidak ada perintah untuk saling bermaafan pada Idul fitri, yang ada yaitu pada saat akan memasuki bulan Romadhan, dan juga arti dari Idul Fitri yang sebenarnya adalah kembali berbuka. Efek dari semua ini adalah banyak harga dagangan yang naik sehingga tradisi inilah yang menyebabkan orang-orang kurang mampu merasa kesusahan, karena bingung memikirkan dana untuk itu semua. Dan yang lebih buruknya, muncul

tradisi di mana di akhir Ramadhan aktivitas ibadah menurun karena sibuk memikirkan dan mempersiapkan hal-hal tersebut di atas, dan muncul suatu ungkapan yaitu umat muslim di akhir Ramadhan bukan disibukkan dengan Lailatul Qadar tetapi disibukkan dengan lailatul bakar. Terlepas dari apakah arti Idul Fitri yang sesungguhnya, tidak ada yang salah sebenarnya dengan tradisi-tradisi lebaran di atas. Cuma, apakah hanya sebatas itu kita memaknai Idul Fitri? Padahal, ada beberapa hal pokok yang berkaitan dengan Idul Fitri, yang lebih penting dilakukan untuk memeriahkan Idul Fitri agar menjadi lebih bermakna. Hal-hal tersebut antara lain menunaikan zakat fitrah yang tentunya sduah kita bayar. Zakat fitrah adalah zakat badani yang harus dikeluarkan setiap individu muslim yang masuk dalam kategori mampu sesuai dengan yang disyariat-

sayang kelompok ini selalu menghindar dan mengabaikan tuntunan Sunnah nabi SAW terutama pada kaifiat Ibadah – Ibadah Maqdha yang sudah diUndangkan oleh Rasulullah SAW melaui Hadist – Hadist beliau yang Shahiha dan Maqbula. Kalau saja ilmu Manthiq atau Logika selau pengendali akal manusia berfungsi maksimal maka ibaratkan jika kita berkonsultasi kepada Dokter Specialis Penyakit Dalam karena keluhan sesuatu penyakit. Kita mengharapkan kesembuhan atas Idzin Allah SWT tapi kita sendiri melanggar dan mengabaikan petunjuk Dokter Konsultan kita terutama dalam pengendalian diri tentang konsumsi makanan/minuman yang terkesan berlebih-lebihan alias tidak petunjuk Dokter, akhirnya semua menjadi siasia. Maka demikian halnya dengan syafa’at, untuk memperoleh tidaklah segampang membalekkan telapak tangan. Syafa’at adalah hak istimewa yang diberikan Allah SWT kepada Rasulullah SAW pada waktu digelarnya Mahkamah Rabuul Jalil kelak dan diperuntukkan bagi ummat Muhammad SAW yang memenuhi persyaratan dan seleksi Super Maximal Ketat. Oleh sebab itu jangan pernah bermimpi untuk memperoleh syafa’at dari Rasulullah kalau saja SUNNAH – SUNNAH BELIAU (RASULULLAH MUHAMMAD SAW) terutama tentang Ibadah-Ibadah maqda yang justru kita ingkati secara terang-terangan padahal Risalahnya sudah dipermaklumkan,sementara golongan yang kita sebut-sebut minoritas yang yang berpegang teguh kepada Sunnah Rasulullah SAW menjadi musuh nyata kita hanya dikarenakan Taqlik Klasik. Mahlil Hamdani Pemerhati sunnah

kan, laki-laki maupun perempuan, merdeka maupun budak. Zakat fitrah setidaknya mempunyai dua sasaran pokok yaitu pertama untuk mensucikan diri dari segala perbuatan yang sia-sia dan keji, dan kedua untuk menyenangkan orang-orang tidak mampu terutama fakir dan miskin pada 1 Syawal. Oleh sebab itulah diwajibkan kita membayar zakat fitrah. Zakat fitrah lebih diutamakan untuk tidak dibayar dengan uang, walaupun ada ulama yang membolehkan, karena dikhawatirkan uang tersebut digunakan untuk hal yang tidak baik oleh si penerima. Selain itu, bertakbir atau mengumandangkan takbir di malam Idul Fitri merupakan suatu sunnah yang dilakukan berkaitan dengan perayaan Idul Fitri. Di dalam Alqur‘an Allah berfirman “Wa litukmilul i‘ddata wa litukabbirullaaha a‘laa maa hadaakum wa la‘allakum tasykuruun ” (Albaqaroh 185). Bertakbir pada malam Idul Fitri mengandung makna rasa syukur kepada Allah SWT atas nikmat dan rahmatnya terlebih nikmat iman dan Islam yang diberikan Allah, sehingga kita mampu menunaikan dan menjalani ujian yang begitu berat yaitu ibadah puasa Ramadhan. Dengan kalimat takbir Allaahu akbar, kita mengakui tiada daya upaya kami untuk menunaikan perintahMu kecuali karena kebesaran dan limpahan rahmatMu. Selain itu takbiran juga berguna untuk mengumandangkan syiar Islam kepada seluruh jagat raya. Tentu saja kita disunnahkan untuk melaksanakan shalat Ied berjamaah. Hukumnya adalah sunnat muakkad. Saling memaafkan Memang anjuran saling memaafkan adalah pada saat akan memasuki bulan Ramadhan, tetapi tidak ada salahnya kita juga memeriahkan Idul Fitri dengan saling memaafkan bukan sekadar bermaaf-maafan, sehingga dengan sikap saling memaafkan, tanpa seseorang itu meminta maaf pun, kita sudah memaafkan, karena kita tidak seluruhnya tahu kepada siapa

saja kita pernah berbuat salah. Dengan demikian maka implementasi hadist Rasulullah yang menyatakan bahwa puasa Ramadhan bisa menghapuskan dosa-dosa yang telah lalu lebih sempurna dengan saling memaafkan karena dosa kita yang berkaitan dengan orang lain baru bisa terampuni bila orang yang bersangkutan telah memaafkan, sehingga jadilah kita orang-orang yang suci kayaumin waladathu ummuhu. Hal yang terakhir ini, mungkin sering kita abaikan, padahal inilah visi yang paling penting dari perayaan hari raya Idul Fitri. Selama ini, di Indonesia sudah menjadi tradisi, apabila Ramadhan usai, maka aktivitas ibadah pun selesai. Sesuai dengan arti Idul Fitri “kembali berbuka” dan Syawal “peningkatan”, berarti pula kita kembali membuka lembaran baru, maka seyogianya dalam membuka lembaran baru setiap individu haruslah berpikir dan berencana untuk sebelas bulan yang akan datang dengan melakukan peningkatan hal-hal yang baik dan mengurangi hal-hal yang buruk yang selama ini telah diperbuat. Maka benarlah suatu ungkapan yang menyatakan bahwa “puasa kita pada bulan ini bukan sekadar untuk menghapuskan dosa-dosa yang telah lalu, tetapi juga jadikanlah ia sebagai tabungan kita untuk sebelas bulan yang akan datang”. Sehingga jadilah kita orang-orang yang beruntung seperti yang dikatakan Rasulullah yaitu kita termasuk orang yang beruntung apabila hari ini lebih dari pada hari kemarin, dan sebaliknya jika tidak jadilah kita orangorang yang merugi atau pun yang dilaknat Allah. Semoga kita termasuk orang-orang yang benar-benar menjadikan Ramadhan sebagai madrasah dan akhirnya menjadi orang-orang yang beruntung, di mana iman dan takwa kita meningkat pasca Idul Fitri ini. Penulis adalah alumni Pon-Pes ArRaudhatul Hasanah dan mahasiswa pascasarjana USU.


14 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM 4 CM

Bursa

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

CHEVROLET Long Bed Pick Up Thn. 88 Asli Medan. Body seksi, mesin bagus. Harga 26 Jt. Damai. Hub. 061-77584982 CHEROKEE 4X4 M/T ‘95 BK Mdn, AC, RT, VR, BR 31”, PS, PW, CL, AL, EM, Biru Met, DP 20 Jt, Angs: 2,2 Jt Hub. 7670.0976 DAIHATSU Espass 1.6 ‘96, P. Sorong, Mrh Maron Met, AC, RT, VS, BR, Jok Klt, DP 15 Jt, Angs. 1 Jt Hub. 0813.7588.7306/ (061) 76700.976

Rp. 36.000 Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000

TOYOTA Kijang Super Thn. 92. BK Medan asli. W. Merah metalic. AC, Tape, VR, Lengkap, siap pakai. Mulus. Hub. 0813 6114 8433

SUZUKI Futura DRV 1.5 Thn. 2001. Hijau met. AC/RT/VR. Mulus, Siap L. Kota. Nego. Rp. 55 Jt. Serius Hub. (061) 77799419 / 76820955

TOYOTA FORTUNER - G TH. ‘08. Warna hitam, komplet, Ban Radial, manual. Rp. 325Jt. Solar Jl. SM. Raja No. 200. Dpn. Sklh Eria Kembar Ponsel - 0812 6038 5555

SUZUKI Katana Thn. 92. Hijau metalik, BK Bln 6.10. VR, BR, AC, RT, Telp. 7863182 HP. 0812 6300 0077 Hg. 37,5Jt. SUZUKI Carry DRV Th. 2003 W. Hitam. Lengkap. BK Mdn Asli Cat dan mesin mulus. Siap pakai. Harga 58Jt Nego. Hub. 0811 652506 SUZUKI Katana Thn. 87 dijual. War na merah, AC, Tape, BK Medan asli, mulus. Serius TP. Hub. 0813 7000 7127 / 061-6949 0067

SUZUKI KATANA GX 93/94

Warna hitam, AC, TP, VR, BR, CL. BK Asli Medan, mulus, orisinal, siap pakai. Harga Rp. 41Jt/ Nego. Hub. 6625188 / 0813 6214 8312

DAIHATSU Espass 1.6 Thn. 2003. W. Biru met. AC DB, VR, RT, BR, cantik, mulus. H. 51,5Jt/Nego. Hub. 0815 314 7717. Jl. Mustafa G. Mawar No. 6 A.

Warna hitam. Velg Racing. AC, Tape. BK Mdn asli. Mobil masih orisinil. Rp. 30Jt. Hub. 0812 64 150 194

DAIHATSU BARU DP RINGAN

Xenia VVT-i...DP 15 Jt-an, Angs. 3 Jt-an Terios TX...DP 20 Jt-an, Angs. 4 Jt-an Serius Hub. AGUSTINA (0852 7003 9888 / 7630 4788) DAIHATSU Taft GT 4x4 Th. ‘85. W. Hitam. BK Panjang. VR, AC Dingin, Tape, mesin gerdang sehat. Hrg. 39Jt/ Nego. Hub. 061-77679495

FORD PICK UP 4X4

Rp. 91.000 Rp. 104.000

SUZUKI Carry Real Van DRV Thn. 96. Merah mulus, Tape, VR, BR, Jok kulit, BK Asli Medan, mesin bagus. Siap pakai. Terima pasang AC. Rp. 40,5 juta/nego. 0812 6578 790 - 777 88 647

DAIHATSU Rocky Th. ‘94 BK Medan. W. Hitam. Cat dan mesin mulus. Siap pakai. Harga Nego. Hub. (061) 6626 705 - HP. 0852 7080042

DAIHATSU Taruna CSX Thn. 2000 Asli Medan, Mulus, siap pakai. Lengkap. Harga 86 Jt damai. Hub. 0812 650 8819

7 CM 8 CM

SUZUKI AMENITY TH. 90

SUZUKI CARRY MINIBUS TH. 84. Warna merah. Velg Racing. Tape. Mobil sgt mulus sekali. Rp. 14Jt. Hub. (061) 766 74 598

SUZUKI APV Type-X Th. ‘07. Silver, komplit. Mulus sekali. Blk DP. 35Jt. Sdh. Bayar 9x. Jl. SM. Raja No. 200 Kembar Ponsel. Dpn Sklh. Eria - 0815 3373 3688

TOYOTA Innova- G Th. ‘08. Silver, Bensin. Komplit, mobil mulus seperti baru Rp. 192Jt. Jl. SM. Raja No. 200. Kembar Ponsel - 0811 613107

Ranger Single Cabin, Thn 2006, Masih orisinil, Terawat dari baru, Hrg Rp. 108 Jt Hub. 0812.657.1372 (unit banyak, ada wrn silver & putih)

TOYOTA Kijang Capsul New LSX (diesel) Thn. 2002. BK Asli Mdn. Wrn. Hijau tua met. PS, CL, AC, Tape, BR, VR, jok kulit. Electric Mirror. Body & mesin sgt mulus skl (sehet, terawat, original). Hub. 0812 6013 966 (Asun). Hrg. Rp. 117Jt/Nego.

HONDA CITY NEW-IDSi 04/05 TIPTRONIC, BK Mdn, Htm Met, Jok Klt, Full body kit, VR 17”, BR, AC, PW, EM, ABS, Air Bag, DP 37,5 Jt, Angs. 3,9 Jt Hub. 76700.976

TOYOTA Kijang Jantan Thn. 96 . Tipe lengkap. AC, Tape, VR, PW, PS, Dashboard sedan mulus. Siap pakai. 55Jt/ Nego. Hub. 0816 310 4197 / 7790 5359

Bawa Pulang L300 Angs. 3Jt-an. T 120 ss, Colt 110, 125 PS, Pajero Sport, L200,... Serius Hub. (061) 76728071 / 0812 653 3319

MITSUBISHI BARU

TOYOTA Kijang Commando Short 6 Speed Thn. 87. Mulus, luar dalam. Mesin sehat, VR, BR, RTP, AC. Hrg. 38Jt Nego. Hub. 0812 6477 7088. Lampu, Bumfer, Grand Extra.

SUZUKI Carry Pick Up 1.3 Dijual. Thn. 1997. Plat BK Asli Medan. Warna biru. STNK, buku kit panjang. Tinggal pakai. Peminat Hub. 061-773870 - 061-77387024

TOYOTA Kijang Krista DSL ‘02/01, Face Lift, Silver Met, AC DB, VR 16”, jok klt, Mls, DP 36 Jt, Angs. 3,63 Jt Hub. (061) 76700.976

KEMBAR MOBIL

Jl. Tritura No. 8K - HP. 0812 6058 6666 Colt - Diesel Pump Truck, Mobil sehat2, siap pakai. Jenis Mobil Th. Hrg 1. Colt Diesel Dam PS.125 ‘07 215Jt 2. Colt Diesel PS 120 ‘06 175Jt 3. Colt Diesel PS 120 ‘99 135Jt 4. Colt Diesel Truck PS 100 ‘00 110Jt 5. Toyota Dyna 125 HT ‘03 120Jt

Bursa

SEPEDA MOTOR

HONDA 100% BARU Semua Type, Cash/Credit. Tersedia Program murah, Proses Cepat. Hub. Aron. 08388 591614 HONDA KHARISMA Thn. 2004. Mulus, hitam, siap pakai. Harga 6,4Jt/Nego. HP. ( 0 6 1 ) 66477734 / 0813 9779 1077 HONDA TIGER 2008 Dijual BU Jarang pakai, sangat mulus, hitam, Velak Resing. M Belakang Cakram. P. Panjang. 18Jt/ Nego. Hub. 0813 9725 1113

DIJUAL OVER KREDIT

Yamaha Vixion ‘07 merah maroon, mulus. Sisa angsuran 12x727rb, Pajak bln 9 Kembali DP. 10 Jt Nego. Terima Tukar tambah shogun RR/SP. Hub. 0819 858 589

Bursa

SERVICE/ASESORIS MOBIL

SHAMPOO MOBIL / KERETA. Untuk Door Smeer Rp. 5.000/ Liter. Tel. (061) 76688574

Harian

WASPADA Tempat Iklan Anda

Hub.4576602

9 CM Rp. 126.000 10 CM Rp. 140.000

Bursa

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Bursa

Selasa, 29 September 2009

FAX.4561347 HARGA BELUM TERMASUK PPN 10%

Bursa

BUTUH UANG

ELEKTRONIK

RENTAL MOBIL MURAH Rp. 250.000/Hari (Kijang Kapsul). Harian, Bulanan, Jemput Tamu, dll. HP. (061) 664 77734 / 0813 9779 1077 (TP). (Khusus Muslim)

Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. 061-8222774, HP. 0816 314 1807

ANDA BUTUH DANA

JUAL BELI PS 1, 2, 3 TV, Keyboard, Mixer, Power, Laptop, LCD Projector, Handycam, Camera, Kulkas, M. Cuci, Tape compo, LCD, dll Hub. MARKET ELECTRONIC Telp. 821.0097 - 6690.0693 Jl. Setia Budi No. 424 B dekat Simp. Ring Road

APV ‘06 RENTAL

IKHLAS RENT CAR

Dalam Kota: Innova G 300rb, Avanza G: 270rb Luar Kota: Innova G 350rb, Avanza G : 330rb Termasuk supir Non BBM. Hub. 0852 61182 406 - 91312308

ALAT PELACAK KENDARAAN

With GPS Tracking System

Dengan iTrack anda setiap saat dapat mengetahui

* Keberadaan Mobil anda * Laju Kecepatan Mobil * Rute Perjalanan * Berbagai Aktifitas Lainnya Hub. Kami: ITrack Medan

Komp. Asia Mega Mas Blok LL No. 32 Telp. 0813 6075 0388 - 7321 726 - 77872232 Kunjungi Situs kami: iTrack.iqios.com

WASPADA

ANDA BUTUH DANA TUNAI Jaminan BPKB Sepeda Motor / Mobil. Bunga Ringan, Data Bisa dijemput. BPKB Aman. Hubungi: (061) 66477734 / 0813 9779 1077

Bursa

KOMPUTER

OBRAL LAPTOP SPEKTAKULER TERMURAH LEBARAN

2

Gebyar Habiskan Stok Gudang. Toshiba, Rp. Hrg. Mulai Acer, Fujitsu, HP Merk Terkenal & Kwalitas no. 1. Didesain dgn Tampilan yg Elegans, Fasilitas Lengkap. Internet Wifi, Bluetooth, kamera. Bisa dipakai utk segala keperluan. Terjamin & Digaransi.Miliki segera...... Mencoba sampai puas oke-oke saja. -Medan Mall Lt. Dsr -Millenium Lt. Dsr -Medan Plaza Lt. Dsr -Aksara Lt. Dsr -Paladium Lt. Dsr -Binjai Super Mall

-

Jt-an

0812 6455 7274 081396930390 0812 6085 2666 0813 9742 2213 0813 7666 9353 0813 6125 4113

Buruan......Ribuan org sdh memiliki, Anda????

xpress

AC BARU “HARGA” SPECIAL SEWA 5 PK & 3 PK FLOOR STANDING

HUB:

- PANASONIC INTERTER - MITSUBISHI ELECTRONIC - SAMSUNG - GENERAL - CHANGHONG - SHARP PLASMA CLUSTER

- LG - AUX - DAST - FUJI - DAIKIN

TOKO SUPER ELECTRONIC

Jln. Sutomo No. 139 C (Simp Gandhi) Tel. 7347810 - 7360741 Tel. 77982281 MEDAN INSTALASI & PEMASANGAN SERVICE, REPARASI AC - KULKAS

Bursa

KOMUNIKASI

MAU JUALAN PULSA...????? DENGAN MOMENTUM REFILL AJA!!!!! 061.76216.595 - 0813.76704.595 MomentuM

Ref ill efill Bonus Hingga JUTAAN Rupiah !!!! PASTI UNTUNGGG !!!!!! www.momentumrefill.com

Service

ELEKTRONIK AHLI

TV

Bursa

TERCECER

RENTAL MOBIL

Harian/Bulan, Terima Antar Jemput Anak Sekolah, Harapan I, SMU I dan sekitarnya. Karyawati, supir Ibu2. Hub. 0813 70430 346

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

TO S H I BA , S O N Y, P O LY T RO N , S A M S U N G , S H A R P, S A N YO , SANKEN, FUJI, DIGITEC, LG, JVC, TV CHINA, DLL. Murah, Full Garansi

SIGIT. 76547004 - 0812 6067 7344

TERCECER / HILANG TERCECER 1 BPKB No. 8985729-B, BK 701 EC. Pemilik Drs. Risno Johannes. Jl. SM. Raja Gg. Purnama No. 11 Medan. TERCECER 1 BPKB No. 9134029 - B BK 1591 EZ. Pemilik PT. Mitra Kerinci, Jl. RA. Kartini No. 23 Medan. TERCECER BPKB Mobil Toyota Kijang BK 1571 H a/n. Pemda Tk. I Sumatera Utara. Jl. P. Diponegoro No. 30 Medan. No. BPKB A5752333-B. Bagi yang menemukan hub. (061) 77084760

TERCECER 1 (Satu) bh Asli BPKB BK 4144 KS a/n. Hendra Limbong. Jl. Sekip No. 87-A Medan.

1 BPKB Spd. Motor Honda Thn. 2005. BK 4279. PQ. Pemilik Kristina Br. Sembiring. AFD. VIII Kuala Sawit Kec. Batang Serangan Langkat.

PERCETAKAN

HILANG/TERCECER 1 Buah BPKB Mobil. BK 12 FP a/n. Moch. Ichsan. Alamat Komp. Tasbi Blok HH No. 22. Kel. Tj. Rejo Mdn. No. BPKB 8669516-B

TERCECER/ HILANG

Surat Tanah Atas Nama Abdul Rahman Siregar, terletak di Jl. Bukit Kencur, Lingkungan 02 Kec. Rambutan T. Tinggi Luas ±25x25m

Bursa

ALAT MUSIK

TECHNICS KN - 7000 Dijual Cepat. Harga Damai. Hub. 66900693 - 0813 6240 4002

Bursa

PERCETAKAN

WC WC WC

Service

KONSTRUKSI

ANDA TUMPAT - SEDOT

Hub. 8219951 Jl. Setia Budi No. 2 TUMPAT/ SAL. AIR Hub. 8477835

(061) 77077334

Jl. Gaperta Gg. Partiasa No. 8 Bergaransi 3 Bulan

TUMPAT/ SAL. AIR

845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F Jl. Brayan Medan

WC 08128442246 642 71725 . PAK PIAN WC TUMPAT 0813 7035 7291

Tumpat Sedot

Telp.:

ADI

Ada Garansi

Hub

WC TUMP AT, Sal. AIR, K. Mandi TUMPA Tel. 7878078, 77008458 NARO SERVICE Jl. Sisingamangaraja

FD CD

KIRIMKAN... DATA IKLAN ANDA DALAM BENTUK

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:

Harian

WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347


Ekonomi & Bisnis

WASPADA Selasa 29 September 2009

Bank Indonesia Jamin Tak Sembunyikan Data Century JAKARTA (Antara): Bank Indonesia (BI) menjamin pihaknya tidak menyembunyikan data-data terkait Bank Century dalam proses audit investigasi oleh Badan Pemeriksa Keuangan (BPK). “Dari BI, tidak ada data yang disembunyikan, kecuali data rahasia kita tidak bisa jawab, kalau mau diperiksa oleh BPK ya silahkan,” kata Deputi Gubernur BI, Budi Rohadi di Jakarta, Senin (28/9). Pemeriksaan oleh BPK dalam kasus Bank Century hingga saat ini belum final namun BPK akan menyampaikan laporan sementara kepada DPR.

“Ini masih interim belum final atau masih sebagian, mungkin data interim itu berubah pada waktu dia melakukan pemeriksaan lebih lanjut,” katanya. Budi menyebutkan, BPK memang intensif melakukan pemeriksaan dalam kasus Bank Century. Pada Sabtu (26/ 9) juga masih ada pertemuan para pengawas bank sehingga tidak ada keraguan. “Kami pihak yang diperiksa, mereka minta apa, kami harus kasih,” katanya. Sementara itu mengenai kondisi alat pembayaran saat lebaran, Budi mengatakan, berbeda dengan lebaran ta-

hun sebelumnya, permintaan uang pecahan kecil pada lebaran tahun 2009 ini lebih besar. “Tahun lalu permintaan uang kecil gak banyak seperti sekarang. Permintaan uang kecil melebihi prediksi,” katanya. RUU JPSK Sementara itu mengenai RUU tentang Jaring Pengaman Sistem Keuangan ( JPSK), Deputi Gubernur Senior BI, Darmin Nasution mengatakan, pihaknya tetap berharap RUU itu dapat disetujui pengesahannya menjadi UU oleh DPR masa bakti saat ini.

“Kalau gak ada UU tentang JPSK, bisa-bisa kita saling tunggu. Jadi harapannya bisa selesai,” kata Darmin. Dia menyebutkan sebagian besar materi dalam RUU itu tampaknya sudah disepakati, dan tinggal 1 atau 2 yang masih harus dibahas. Menurut Darmin, UU tentang JPSK akan merupakan protokol untuk menghadapi krisis atau mengantisipasi kalau ada krisis sehingga negara yang mempunyai protokoler seperti itu mestinya lebih siap menghadapi kondisi kalau ada goncangan.

Rupiah Terpuruk Di Atas 9.700 JAKARTA (Antara): Kurs rupiah terhadap dolar AS di pasar spot antarbank Jakarta, Senin (28/9) merosot tajam hingga melewati angka Rp9.700 per dolar, karena pelaku pasar melepas rupiah akibat memburuknya bursa regional. Nilai tukar rupiah terhadap dolar AS menjadi Rp9.720Rp9.730 per dolar dibanding penutupan hari sebelumnya Rp9.650-Rp9.665 atau turun 70 poin. Pengamat pasar uang Harry Kurniawan di Jakarta, Senin (28/9) mengatakan, pasar uang didominasi aksi lepas rupiah oleh pelaku pasar sehingga mata uang Indonesia tertekan, akibat memburuknya bursa Wall Street.

Merosotnya rupiah itu terutama disebabkan kenaikan mata uang Indonesia cukup tajam menjelang lebaran Idul Fitri akibat tinggi kebutuhan masyarakat terhadap rupiah, ucapnya. Menurut dia, koreksi terhadap rupiah saat ini dinilai wajar setelah mengalami kenaikan cukup tajam hingga mencapai angka Rp9.580 per dolar. “Kami memperkirakan koreksi ini tidak akan berlanjut hingga mencapai angka Rp10.000 per dolar,” ujarnya. Dia mengatakan pasar Indonesia dinilai masih positif dibanding pasar Asia lainnya akan kembali diserbu pelaku asing, karena prospek pasarnya masih tinggi.

Apabila investor kembali ke pasar Indonesia, maka peluang rupiah untuk kembali menguat akan terjadi, katanya. Bahkan, lanjut dia rupiah akan dapat mendekati angka Rp9.300 per dolar, apalagi sisa waktu yang hanya tinggal tiga bulan ini memberikan arti

JAKARTA (Waspada): Bank Indonesia (BI) memperkirakan inflasi pada bulan September 2009 akan mencapai 3 persen secara year on year (yoy). Hal itu dikatakan Deputi Gubernur Bank Indonesia (BI) Hartadi A Sarwono ketika ditemui di Gedung Bank Indonesia, Jakarta, Senin (28/09). “Kalau kita bisa menjaga pasokan dan distribusi barang domestik yang baik maka inflasi (yoy) pada bulan September 2009 bisa mencapai 3 persen,” ujarnya. Ia menambahkan, sampai akhir tahun 2009 masih ada

Bursa

Bursa PROPERTY

DICARI

Informasi Pembaca Bursa Property

Bidan, Perawat dan PRT Hub. 0813.7164.1555 - (061) 7657.8941

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

DICARI TUKANG PANGKAS

Berpengalaman, Jaminan 40.000 Alamat: Jl. Karya Jaya No. 298 Hub. 0852.6144.3233

DIBUTUHKAN

Tenaga kerja/ karyawan bergerak di bidang perbengkelan bersedia ditempatkan di Psr. Merah, Pdk. Kelapa, Setia Budi, posisi sebagai: 1. Tk. Bubut 2. Kpl. Mekanik 3. Pem. Mekanik 4. Tk. Cat Lamaran diantar ke: BENGKEL STAR SERVIS Jl. Setia Budi Psr. V No. 435/ 88-S

LOWONGAN KERJA KE MALAYSIA

Diperlukan segera Tenaga Kerja Indonesia untuk ditempatkan secara resmi di perusahaan electronics sbb: 1. Shin Etsu (M) Sdn. Bhd (100 org) - Company/ Langsung Lokasi: Shah/ Alam - Selangor 2. Sumitomo Metal (SMI) Electronics Devices (M) Sdn. Bhd (50 org) Lokasi: Bayan Lepas - Pulau Pinang 3. TIM Electronics Sdn. Bhd (30 org) - Company/ Langsung Lokasi: Bayan Lepas - Pulau Pinang 4. Sony EMCS (M) Sdn. Bhd (100 org) - Company/ Langsung Lokasi: Seberang Prai - Pulau Pinang 5. Finisar (M) Sdn. Bhd (50 org) Lokasi: Ipoh, Perak Gaji & Fasilitas: 1. Gaji pokok 2. Tunjangan: Kehadiran, shift, makan, pekerja asing, perhidmatan 3. Perlindungan asuransi Indonesia & Malaysia 4. Jaminan perlindungan kesehatan 5. Asrama & perlengkapannya 6. Transportasi ke tempat kerja (PP) 7. Pakaian kerja (uniform) 8. Cuti tahunan, cuti umum dan cuti sakit 9. Levi subsidi 100% 10. Kesempatan Kerja lembur (OT) 11. Berangkat naik pesawat 12. Dan lain-lain kemudahan Persyaratan pendaftaran: 1. Wanita, usia 18 - 30 thn 2. Pendidikan SMU/SMK/ MA 3. Fotocopy KTP, Ijazah & KK 2 lbr 4. Pasfoto warna 3x4 cm 4 lbr 5. Sanggup kontrak kerja 2 tahun 6. Mendapat izin orang tua - Tidak dikutip biaya pendaftaran - Bagi yang lulus seleksi akan dikenakan biaya penempatan secara tunai bertahap atau angsuran melalui potongan gaji di Malaysia Pendaftaran setiap hari kerja, langsung ke: Perusahaan Penempatan Tenaga Kerja Indonesia Swasta

PT. TIMURAYA JAYA LESTARI

Izin Menteri Tenaga Kerja No: KEP 788/MEN/2006 Jl. AH. Nasution, Ruko Tenaga Asri, No.1 Sp. Pos, Pd. Bulan - Medan Telp. 822.7419 HP. 0812.6035.7181 - 0813.6159.5866 - 0813.6100.3033 (Belakang Bank Mandiri Sp. Pos)

LOWONGAN KERJA KE MALAYSIA

DICARI NAZIR MESJID Syarat-syarat: - Usia min. 40 thn & sudah berkeluarga - Berpaham pada Al-Qur’an & As-Sunnah/ Muhammadiyah - Bisa menjadi Imam & Khatib - Bersih & mampu merawat mesjid Diutamakan dari luar kota Hub. 0813.9673.8171

DIBUTUHKAN TEKNISI/ SERVICEMAN

Panasonic Sentra Service, membutuhkan: - Tamatan SMK Electro/ Sederajat - Usia max. 21 thn, 31 bulan October 2009 - Belum menikah - Pria - Bersedia di training - Tidak buta warna, berbadan sehat Lamaran diantar langsung ke:

PANASONIC SENTRA SERVICE Jl. Willem Iskandar No. 265 Medan Telp. 664.5650 - (061) 7714.7600 Lamaran berlaku untuk 8 hari sejak iklan ini dimuat

LOWONGAN KERJA RESMI KE MALAYSIA

Dibutuhkan Tenaga Kerja Wanita untuk di pekerjakan pada perusahaan Electronic terkemuka di Malaysia. Kilang COMPANY, bukan KONTREK (OUT SOURCING), sebagai berikut:

BIDANG WAITRESS & WAITER Sebuah Hotel berbitang lima TANJUNG RHU RESORT yang berlokasi di Pulau Langkawi, Malaysia, memerlukan beberapa pekerja laki-laki & perempuan sebagai Waiter & Waitress Dengan persyaratan sebagai berikut: 1. Perempuan berumur antara 19 - 30 tahun 2. Laki-laki berumur antara 19 - 30 tahun (Tanjung Rhu Resort) 3. Pendidikan minimal SMU, SMIP, Diploma 4. Dapat berbahasa Inggris aktif 5. Memiliki pengalaman kerja di Hotel Restoran atau Cafe exklusif (Vintage Bulgaria Restaurant & Bar) 6. Kontrak kerja 2 tahun 7. Mendapat izin dari orang tua/ keluarga Fasilitas dan gaji: 1. Gaji memuaskan 2. Uniform, Duty Meals, Asrama & Trans port disediakan 3. Dilindungi asuransi selama bekerja Jika berminat segera mendaftar dengan membawa foto copy Ijazah, KTP, dan Pasphoto warna, Curiculum Vitae (Daftar Riwayat Hidup) & Resume dapat diantar langsung ke alamat berikut: Testing akan dilaksanakan awal bulan Oktober (Tanggal akan dikonfirmasikan lebih lanjut)

1. WESTERN DIGITAL M SDN. BHD 2. SANYO AUTOMEDIA M. SDN BHD, SEBRANG PRAI

JALAN KANGKUNG NO. 61 MEDAN 20153 TELP. 415.7621 - 455.1305

TELP: (061) 845.2956 (DEKAT RSU SARI MUTIARA)

PT. SAHARA FAJARINDO CORP

LB LT RM RT

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

Syarat-syarat pendaftaran dan seleksi: 1. Wanita Umur 18 s/d 30 tahun 2. Pendidikan minimal SMP sederajat 3. Membawa Fotocopy Ijazah, KTP, Kartu Keluarga (asli di bawa sewaktu interview) 4. Membawa phas photo warna 3x4: 3 lbr A. RINCIAN GAJI 1. WESTERN DIGITAL (M) SDN. BHD - Gaji Pokok : RM 450/ bln - Tunjangan kehadiran : RM 50/ bln - Tunjangan shift : RM 107/ bln - Tunjangan makan : RM 16,50/ bln - Tunjangan lainnya : RM 57 - RM 78/ bln - Bonus: Bonus Prestasi dan tahunan 2. SANYO AUTOMEDIA SDN. BHD - Gaji Pokok : RM 430/ bulan - Tunjangan Kehadiran : RM 60/ bulan - Tunjangan Berdiri : RM 1/ hari - Bonus : RM 40/ bulan - Tunjangan Makan : RM 0.50/ hari - Tunjangan di bagian Mesin : RM 60/bulan - Tunjangan Makan (Waktu Lembur/ Overtime): a.2Jam atau Lebih: RM 1.50, B. 4 Jam atau lebih: RM 2.50 - Tunjangan Shift: a. Petang: RM 3, b. Malam (8 Jam): RM 8, c. Malam (12 Jam): RM 10 B. FASILITAS - Levy subsidy 100% - Asrama, tiket pulang, kemudahan kesehatan, asuransi, berangkat naik pesawat terbang - Bagi yang tidak mampu dapat mencicil biaya pemberangkatan C. JADWAL PENDAFTARAN/ SELEKSI: - Setiap Hari Kerja - Selama libur lebaran kantor tetap buka untuk informasi dan pendaftaran

C. Untuk Perusahaan Sanyo Automedia boleh yang mantan/ eks TKI Sanyo Prai dan Bayan Lepas Segera daftarkan diri anda sekarang juga ke:

PT. MUTIARA KARYA MITRA SIUP NO: 629/MEN/2006 JL. KAPTEN MUSLIM NO. 89 C MEDAN Contact Person: Mega 0813.6220.2213, Ecy: 0813.7515.5055

JAKARTA ( Waspada): Nasabah PT Asuransi Jiwa Bakrie (Bakrie Life) telah melayangkan surat kepada Presiden Susilo Bambang Yudhoyono agar ikut serta membantu masalah gagal bayar dana mereka senilai Rp 360 miliar. Dalam surat dilayangkan pada tanggal 14 September 2009 tersebut dijelaskan, para nasabah mengh e n d a k i P re s i d e n S B Y memberikan penugasan kepada Menteri Keuangan agar memeriksa dan mengungkap manajemen Bakrie

Life yang telah memberikan jaminan produk menyimpang dari prospektus. “Kita, para nasabah meminta agar Presiden memerintahkan Menteri Keuangan untuk memeriksa Bakrie Life. Dimana Ketua Bapepam seharusnya menunjuk kepala biro pemeriksaan dan penyelidikan melakukan pemeriksaan menyeluruh terhadap Bakrie Life,” ujar perwakilan nasabah yang ditemui wartawan di Kawasan Permata Hijau, Jakarta, Senin (28/09). Nasabah yang menolak disebut namanya itu juga me-

JAKARTA ( Waspada): Susutnya anggaran subsidi pupuk pada tahun 2010 menjadi hanya Rp 11,3 triliun dari tahun ini berkisar Rp17 triliun,harus diimbangi dengan kenaikan Harga Pembelian Pemerintah (HPP) untuk beras/gabah petani minimal 10 persen. Jika tidak maka para petani

akan semakin tertekan terlebih ancaman El Nino pada tahun depan. Demikian disampaikan oleh anggota Dewan Pengawas (Dewas) Perum Bulog Kaman Nainggolan dalam acara halal bihalal di kantor Bulog, Senin (28/9). “HPP itu sudah seharusnya naik 10 persen minimal,

DIBAYAR TINGGI GURU PRIVATE UMUM Mafia, B. Inggris utk TK, SD, SMP, SMA SMS data 0852.6210.3287

kenaikan potensi inflasi dan diprediksikan bisa mencapai 4 persen. Hartadi juga mengatakan, permintaan uang kartal yang menurun pada saat hari raya kemarin juga diperkirakan akan menyumbang kenaikan inflasi. “Itu termasuk (permintaan uang kartal), karena dengan adanya resesi sebagian pendapatan orang berkurang,” jelasnya. Selain itu, Hartadi mengungkapkan, pertumbuhan ekonomi Indonesia sampai akhir tahun akan berada di posisi 4 persen.(dtc)

RUMAH DIJUAL

Jl. Air Bersih Gg. Melati No. 4, LT. 25x12,5m, Hrg 250 Jt, Sertifikat Hub. 0812.6442.4373 RUMAH DIJUAL

Johor Indah Permai Blok A No. 3, 3 KT, 2 KM, LT. 319m, Sudut, Sarana lengkap Telp. 786.4023

RUMAH DIJUAL

DIJUAL CEPAT

1 Ruko 3 Tkt di Marelan Raya T. 600, SHM, LT. 4x28, LB. 4x16m, Lkp, PLn, PAM, Telp, Siap huni, Hrg Rp. 650 Jt/nego 2 unit Rmh Permanen (Gandeng) di Jl. AMD Ling. 36 Titipapan, SHGB, Masing2, LT. 6x22m, LB. 6x12m, Siap huni, Hrg @Rp. 160 Jt/nego

Ruko 2½ Tkt Uk. 7x21m, Ada usaha, Grosir, 4 KT, 4 KM, Full keramik,Telp, Air Bersih di Binjai Peminat hubungi:- 0831.9897.3540 - 0813.6179.1839 - (061) 69680806

TG. BALAI - ASAHAN DIJUAL RUMAH

DIJUAL CEPAT

Hub. 0813.7164.1555 (061) 7657.8941 (Maaf TP)

TANAH Luas 1240m, SK. Akte Notaris, Lokasi pinggir jalan Klambir V Kampung. Tanaman Duku, Rambutan (berbuah), Durian, Kelapa Harga 75 Rb/meter nego Hub. 0812.6489.8982, TP

DICARI TK. PANGKAS MUSLIM

DICARI BAGI HASIL TANAH

LOWONGAN KERJA

DIJUAL CEPAT 1 Unit Rumah Kondisi 90% Selesai. Jl. Eka Suka Depan Gang Eka Suka 9 Gedung Johor. Ukuran tanah 15 x 24 M2. Ukuran rumah 12 x 16 M2. Kamar 4 buah, Garasi 1 buah, SHM, IMB. Hub.0819 2112101

RUMAH TOKO (RUKO) DIJUAL DUA PINTU

TANAH DAN SAWAH DIJUAL

Dibutuhkan Lulusan SMK jurusan Akuntansi, persyaratan: 1. Wanita 2. Usia max. 23 tahun 3. Paham dan mampu dalam bidang Akuntansi/ Pembukuan 4. Dapat mengoperasikan Komputer dengan baik 5. Mampu berkomunikasi dengan baik Lamaran diantar langsung ke: Jl. Nibung Baru No. 61-63 Petisah Medan Paling lama 3 hari setelah iklanini terbit

DIBUTUHKAN SEGERA

Beberapa orang tenaga kerja berpengalaman dibidang perawatan & kecantikan kulit Syarat: 1.Wanita maximal 25 tahun 2.Berpengalaman minimal 1 tahun 3.Mahir, pedicure/ medicure 4.Ramah, jujur, rajin 5.Berpenampilan bersih & menarik Lamaran lengkap di tujukan ke: Harian Waspada dengan kode “SEGERA 2009” paling lambat 10 hari terhitung iklan ini diterbitkan

Harga: 240 Juta (nego) Alamat: Jl. KL. Yos Sudarso Km. 6,5 Tanjung Mulia depan Pabrik Garuda Mas Luas Tanah: 8x12m Luas Bangunan: 8x11m HP. 0812.600.6002 - 0813.9784.0330

RUKO RP. 350 JUTA Dan Rumah Type 45 di Griya Ladang Bambu Jl. Jamin Ginting Km. 14 Medan Hub. 821.3007/ 0812.6356.735 0812.6000.6519

> 2 Ha dekat Kota, Strategis Utk buat Ruko/ Perumahan Hub. 0853.6120.5673

± 2890 mtr, SHM di Desa Bintang Meriah Kec. Bt. Kuis, Harga Rp. 277 Juta/nego Hub. 0812.6040.1953

SALES Dengan kualifikasi /persyaratan: 1.Pria/Wanita usia 20 - 35 tahun. 2.Minimum tamatan SMU/Sederejat 3.Memiliki Sepeda Motor dan SIM C 4.Mampu berkomunikasi dgn baik 5.Disiplin,mempunyai motivasi tinggi dan siap bekerja keras memenuhi target. 6.Insentif/komisi memuaskan. Surat lamaran lengkap/ CV dan dilampirkan Pasphoto dan KTP terbaru (scan) dan dikirim paling lambat 7 (tujuh) hari setelah iklan ini terbit ke e -mail:

mandiri_hrd55@yahoo.com

MINI & EFEKTIF IKLANKAN PRODUK ANDA

itu belum dimakan inflasi,” katanya. Pada tahun ini, HPP Gabah Kering Panen (GKP) mencapai Rp2.400 per kg, Gabah Kering Giling (GKG) Rp3.000 per kg dan beras Rp4.600 per kg. Diharapkan dengan adanya kenaikan minimal 10 persen ditambah tingkat inflasi, maka tekanan terhadap petani tahun depan akibat naiknya ongkos produksi harga pupuk naik akibat susutnya subsidi pupuk dapat dikurangi. “Kita harapkan dengan demikian petani bisa mencapai tingkat keuntungan usaha petani yang wajar kita ambil dari 30 persen (margin) per hektarnya,” ucapnya. Dia menegaskan subsidi pupuk harus tetap ada, jika pun ada pengurangan maka hal itu harus dikompensasi

oleh upaya peningkatan infrastruktur pertanian di pedesaan seperti jalan, irigasi dan lainlain. “Makanya HPP harus disesuaikan secara proporsional dengan kenaikan harga pupuk,” serunya. Dengan demikian margin petani tidak melorot tajam atau paling tidak, bisa stabil dari margin 30 persen yang diharapkan, karena umumnya para petani di Indonesia memiliki lahan yang sedikit, margin 30 persen cukup mengimbangi pendapatan riil petani. Biasanya HPP beras/gabah baru akan dikeluarkan oleh pemerintah setiap awal tahun dengan mempertim-bangkan inflasi, bahkan lebih jauh lagi harus dipertimbangkan kenaikan harga pupuk. (dtc)

Bursa

MATERI BANGUNAN JASA PEKERJA KONTRUKSI

Menerima segala jenis bangunan Design Gambar bangun baru renovasi, Gedung perumahan Taman Keramik, Interior Klening Servis dll, dengan Tenaga Kerja yg handal Hub kami Jl. Air Bersih Teladan No. 8 Telp. (061) 7872.628 - 7872.789 HP. 0812.6363.416 - 0813.7007.7621

ATAP & DINDING EURODEK ALUMINIUM ZINC - AZ - 150

PAGAR EURO

R

GALVANIS

EUROMESH BAJA U-50

R

KOLOM PRAKTIS EURO R

Bursa

BAJA U-50 SIAP PAKAI LEBIH PRAKTIS & HEMAT DARI BESI BETON

PERABOT TEMPAHAN MURAH -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 Hub Telp. (061) 6618116 - 6616802

PRODUKSI:

PT. REZEKI PRIMA JAYA ABADI

Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Spring Bed 5 kaki 2 lapis Spring Bed 4 kaki 2 lapis Spring Bed 3 kaki 2 lapis Spring Bed 3 kaki Dorong

Rp. 1.100.000 Rp. 1.075.000 Rp. 1.000.000 Rp. 900.000 Rp. 1.000.000

Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802

Bursa

JUAL TANAH CEPAT/ B.U

PENGOBATAN

1. Jl. Sei Tuan No. 49 M. Baru, Uk. 13x40m, SHM, Listrik, Air Tembok keliling, Sudah timbun, IMB, Siap bangun 2. Jl. Bunga Sedap Malam IX/ depan Badan Sar, Ring Road NG. Surbakti, L. 1.147m2, Bentuk Trapesium Strategis Pembeli serius hub. 0812.6005.561 - (061) 762.15551, TP

Bursa

BUTUH ALA TB ANTU DENGAR? ALAT BANTU TRA HEARING AID Hub. MEL MELTRA Jl. Kediri No. 36 Medan Tel. 4516161

BUSANA / AKSESORIS

PECI MURNI TEMPAHAN ISTIMEWA H. ADAM AKIL HSB Jl. Setia Budi No. 49 A 8223975

Ingin Promosikan Produk Anda Harian

MINI & EFEKTIF WASPADA Media yang Tepat

DIBUTUHKAN SEGERA Kami adalah distributor electric dan phone stabilizer akan memasarkan produk kami terbaru dan membutuhkan beberapa orang sebagai:

Pasar Saham hingga 80 persen. Hal itu sama sekali menyalahi prospektus awal. “Itu kan, menyalahi prospektus yang kita ketahui dimana dalam prospektus, dikatakan diamond investa diinvestasikan secara hati2 dan aman,” katanya. Para nasabah itu berharap bisa mendapatkan perlindungan, termasuk dari Bapepam. Dalam surat tersebut, Nasabah juga menuntut agar Bapepam mendesak Bakrie Life untuk menyediakan dana segar untuk pembayaran mereka.

TANAH DIJUAL

LT. 1679m2, Jl. Jend. SUdirman Km. 4, Lokasi strategis Harga Rp. 1,5 M/ nego Peminat serius hub. Tato 0819.840.733 0813.9649.3777

Bklrga Hub. J. Brasa Pangkas Mantap Millenium dpn Mesjid Assyakirin Jl. Besar Delitua No. 38 HP. 0812.6417.2978 (Jaminan berdamai)

ngatakan, produk Bakrie Life dengan nama Diamond Investa tidak sesuai dengan apa yang tertera didalam prospektus perusahaan. “Sesuai dengan prospektus, keunggulan produk Diamond Investa menitikberatkan pada pengelolaan dan pengembangan investasi yang optimal melalui instrumen investasi obligasi sebesar 90 persen, saham 5 persen dan deposito sebesar 5 persen,” katanya. Namun nyatanya, belakangan diketahui Bakrie Life menginvestasikan dananya di

Subsidi Pupuk Susut, HPP Beras Wajib Naik

OVER KREDIT Rumah T. 36, LT. 8x12, P. Cendana Asri Namorambe Desa Jaba Namombelin sdh berjalan 6 thn, Sisa kredit 9 thn, Angs. 240 Rb/ bln, Hrg 12 Jt Hub. 0852.9788.2803 - 0852.6217.1165

Perum. Tj. Per mai 14 Blok N/ No. 1 Tj. Gusta Medan, LT. 200m, LB. 170m2/sudut, SHM, KT 5, KM 2 Hub. 0813.6177.4931

LOWONGAN MEK & TK. LAS

Jl. Medan - Tg. Morawa Km. 10 Gg. Dame No. 30 Telp. (061) 7867.451

Nasabah Minta SBY Turun Tangan Atasi Kasus Bakrie Life

Inflasi Hingga September Capai 3 Persen

LOWONGAN KERJA

Beberapa org mekanik alat2 berat (Doser, Beko, Greder, Loder), Mekanik mobil Diesel, Tk. Las alat berat, Tk. Cat alat berat, Pengalaman diatas 5 thn Lamaran lengkap diantar ke:

yang positif terhadap rupiah. Kondisi ini juga didukung oleh membaiknya bursa Wall Street setelah tiga hari merosot akibat data indikator ekonomi AS seperti indeks kepercayaan konsumen cenderung melemah, ucapnya.

15

- 0813 7628 2301

061-6846 2888 061- 6846 3888

IKLANKAN PRODUK ANDA

untuk Iklan Anda

Pengobatan Alat Vital H. Suhendar Besar dan panjang di tempat Tidak ada hasil, Mahar kembali Ditangani secara profesional Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Paling aman tidak ada efek samping

H. Suhendar sudah di kenal sebagai pakar kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang (garansi), meningkatkan Mahar kekerasan, tambah Rp. 500 ribu kuat dan tahan lama dalam berhubungan

Klinik H. Suhendar di bawah kontrol dan pengawasan langsung H. SUHENDAR Diberitahukan kepada masyarakat untuk berhati-hati terhadap pengobatan sejenis yang mengaku-ngaku kerabat atau saudara, soal cara boleh sama tapi keahlian yang membedakan

Untuk keluhan dan pengaduan silahkan hubungi langsung:

H. SUHENDAR HP. 0812.131.6364 Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan

Telp. (061) 663.4220

Saksikan !!! Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB


Ekonomi & Bisnis

16

WASPADA Selasa 29 September 2009

Tiket Pesawat Meroket 200 Persen

MEDAN (Waspada) : Seminggu lebaran berlalu harga tiket rute dalam negeri MedanJakarta di Bandara Polonia Medan mencapai Rp1,6 juta lebih. Berarti ada kenaikan 200 persen selama pergerakan arus balik Lebaran 1430 H, dari harga tiket penerbangan reguler selama ini antara Rp500 ribu hingga Rp550 ribu sekali jalan. Sebelumnya Administrator Bandara (Adban) Polonia Medan Razali Abubakar mengingatkan jajaran airline agar jangan menjual tiket melebihi tarif batas harga atas Rp1,6 juta sekali jalan. Namun kenyataan di lapangan, warga yang balik ke Jakarta harus mengeluarkan biaya lebih dari batas harga atas,

sanksi kepada operator airline melanggar berat sekali yaitu pencabutan izin operasional. Pantauan, hingga Senin (28/9), masih banyak warga masyarakat yang balik ke Jakarta mengeluh harga tiket tidak terjangkau saat padat penumpang. Bahkan untuk memperoleh seat pesawat juga susah. Sementara itu Muni, agen tiket dari Kings Travel Medan dan Maizuar, agen tiket dari Raya Utama Travel (RUT) Medan ketika dikonfirmasi membenarkan, harga tiket sejak Sabtu, Minggu dan Senin (28/ 9) melambung tinggi, banyak permintaan. Penyebabnya karena permintaan seat pesawat bagi para calon penumpang arus

balik meningkat. “Disitu permintaan seat meningkat harga juga meningkat, sehingga banyak calon penumpang mengeluh,” ujar Muni. Muni dan May membenarkan, harga tiket Rp1,6 juta untuk kelas Yengky (Y), tiket kelas lainnya rata-rata sudah habis, yang terjual harga kelas tinggi, itupun susah diperoleh baik melalui penerbangan Garuda Indonesia, Lion Air, Batavia Air, Sriwijaya dan jenis penerbangan lainnya. Sementara arus penumpang dari Medan tujuan Jakarta bahkan Batam, hingga Senin sore masih padat, sehingga pihak airline berpeluang menjual tiket harga tinggi. Bahkan, arus balik dari luar

negeri baik dari Singapura, Kuala Lumpur dan Penang tujuan Medan juga masih meningkat menyebabkan sejumlah airline mengadakan extra flight hingga Selasa (29/9). Fetty, warga Jalan Kapten Muslim, saat mendarat di Bandara Polonia Medan dengan penerbangan Air Asia menyatakan, ribuan orang Medan melancong ke Kuala Lumpur, selama suasana Lebaran. Plaza-plaza tempat penjualan pakaian dipadati orang Sumatera Utara dan Medan pada umumnya. “Melancong ke luar negeri menyenangkan, kami sudah seminggu disana,” ujarnya. (m32)

Usaha Pedagang Tak Diproteksi, Ratusan Juta Kontribusi PD Pasar Diboikot MEDAN (Waspada): PD Pasar Medan diduga bakal mengalami kerugian tidak sedikit, ratusan pedagang lantai II Pasar Aksara yang dirugikan akibat pengelolaan tidak jelas akan memboikot pembayaran retribusi sebanyak ratusan juta rupiah. Menurut tokoh pedagang Aksara, Muslim Sikumbang bersama ratusan pedagang lantai II, Senin (28/9), merencanakan boikot tidak membayar retribusi ratusan juta rupiah sampai PD Pasar melakukan pengelolaan yang benar di pasar itu. Para pedagang Aksara mendesak Walikota Medan Rahudman Harahap kembali

meninjau ulang jabatan Dirut dan Direktur Operasional PD Pasar Medan karena selama menjabat tidak ada menunjukan kinerja sebagai pengelola pasar yang baik, katanya. Menurut Yuni, pedagang Aksara, boikot dilakukan akibat selama bertahun-tahun pasar dibiarkan terlantar mengalami kebocoran dan kotor tanpa direnovasi secara serius oleh PD Pasar sebagai pengelola, sehingga banyak barang dagangan rusak terendam air. Selain itu PD Pasar secara sengaja tidak melindungi usaha pedagang resmi dengan cara menata pedagang kaki lima (PKL) berjualan ke dalam pasar seperti di tangga masuk

dan tempat lainnya, akibatnya pengunjung sulit naik ke lantai II, sebutnya. Uang dari PKL Disamping itu banyak pedagang menyaksikan para petugas PD Pasar menerima sejumlah uang dari para PKL agar memuluskan usaha berjualan ditempat terlarang sehingga menjadi saingan pedagang resmi, sebutnya. Terhadap kondisi tersebut pihaknya telah berulangkali menghubungi dan memberitahukan ke pihak PD Pasar, namun Direktur Operasional Martua Simanungkalit bersama Dirut Mustafa Sutan Nasutuion tidak pernah turun ke Pasar Aksara, ujarnya.

RI Belum Siap Lepas Subsidi BBM JAKARTA (Waspada): Indonesia masih belum siap untuk melepaskan subsidi BBM. Hal ini dikarenakan harga energi alternatif di Indonesia masih lebih mahal daripada harga BBM. Hal ini disampaikan Ketua Komisi VII, Airlangga Hartanto di sela-sela acara Halal Bihalal di Departemen ESDM, Jalan Medan Merdeka Selatan, Jakarta, Senin (28/9). “Negara-negara maju memang tidak ada subsidi BBM apalagi G8. Negara kita belum siap melepaskan subsidi BBM karena energi alternatif yang disiapkan harganya masih lebih tinggi dari harga fosil fuel,” ujar Airlangga. Menurut Airlangga, besaran subsidi BMM baru bisa diturunkan kalau pengembangan energi alternatif berlangsung di Indonesia. “Itu jalan dulu baru kita bisa turunkan subsidinya,” ujarnya. Untuk mendukung pengembangan subsidi energi alternatif (Bahan Bakar Nabati/ BBN) tersebut, lanjut Airlangga, pemberian subsidi tersebut sudah dibahas di DPR. “Jadi disubsidi dulu untuk sampai ke skala keekonomian. Kenapa disubsidi karena muliltiplier efeknya besar untuk industrinya dan petaninya,” tandas Airlangga. Terkait penghapusan subsidi BBM, Menteri ESDM Purnomo Yusgiantoro mengatakan, Indonesia memang ingin

mengubah paradigma subsidi dari subsidi harga ke subsidi langsung, sebagaimana yang akan diterapkan G20 untuk negara berkembang. “Yang kita lakukan adalah mebgubah subsidi harga menjadi subsidi langsung seperti BLT dan raskin, tapi harus dikembalikan kepada rakyat,” ujarnya. Menurut Purnomo, pemerintah kini memang masih menyediakan anggaran subsidi BBM Rp 50 triliun. Program pengurangan subsidi BBM diharapkan bisa memangkas angka subsidi itu hingga setengahnya. “Jadi nanti subsidi hanya Rp 15-20 triliun. Suatu saat nanti subsidi hanya elpiji dan BBM dan energi terbarukan,” tambahnya lagi. Terkait subsidi listrik, Purnomo mengatakan, nantinya untuk daerah-daerah yang penduduknya kaya tidak akan diberikan. “Harga listrik di Pondok Indah akan lebih mahal dari harga listrik di Tanjung Priok. Jadi kita ingin PLN itu sekarang tahu persis dimana pantasnya itu mereka tidak perlu subsidi listrik, seperti Menteng dan Pondok Indah nggak perlu disubsidi,” ujar Purnomo. Dia menambahkan, PLN kini sedang melakukan survei terhadap purchasing power ability di berbagai daerah terkait perbedaan tarif listrik tersebut. Harga minyak

Sementara itu harga minyak mentah jatuh di perdagangan Asia, Senin (28/9), di tengah berlanjutnya kekhawatiran atas permintaan energi di Amerika Serikat, pengguna minyak terbesar di dunia, kata analis. Kontrak berjangka utama New York, minyak mentah light sweet untuk pengiriman November, turun 21 sen menjadi 65,81 dolar AS per barel, sebagaimana dikutip dari AFP. Minyak mentah Brent North Sea untuk pengiriman November turun 39 sen menjadi 64,72 dolar AS. Kekhawatiran terhadap permintaan energi AS muncul kembali setelah data dikeluarkan Jumat menunjukkan pesanan barang tahan lama turun 2,4 persen pada Agustus terhadap ekspektasi pasar untuk kenaikan sebesar 0,4 persen. Barang tahan lama adalah mereka cenderung berusia tiga tahun atau lebih, seperti mobil dan peralatan, dan mewakili segmen kunci dari sektor manufaktur. “Berita ekonomi internasional pada umumnya mengecewakan ekspektasi pasar, sehingga pasar minyak dan logam dan kurang terdorong,” analis dari Commonwealth Bank of Australia mengatakan dalam sebuah laporan. “Data ekonomi AS gagal meredakan kekhawatiran bahwa permintaan minyak AS tetap suam-suam kuku,” kata mereka.(dtc)

Sementara itu Dasrial salah seorang pedagang pasar tersebut membenarkan kondisi pasar Aksara yang sudah sangat memprihatinkan akibat tidak adanya kepedulian pengelola pasar hanya tahu mengutip kontribusi tanpa melindungi usaha pedagang. Menurutnya usaha pedagang selama Ramadhan mengalami penurunan akibat PKL menjamur dan dibiarkan oleh petugas PD Pasar di Aksara, pasar kelas I A dengan jumlah kontribusi dan uang kebersihan yang mahal dibiarkan terlantar. Sebagai pedagang mengatakan pihaknya sangat setuju memboikot uang kontribusi sebanyak ratusan juta kepada PD Pasar sampai pengelolaan pasar tersebut dilakukan secara benar oleh Dirut PD Pasar. Untuk menyelesaikan persoalan tersebut DPRD Medan dan Walikota dihimbau segera meninjau ulang jabatan Dirut PD Pasar yang telah hampir setahun menjabat namun bgelum melakukan pembenahan yang baik di pasar, sebutnya.(m40)

Harga Ikan Di Kisaran Mulai Normal KISARAN (Waspada): Harga ikan laut mulai normal di Pusat Pasar Kisaran yang sebelumnya pada Lebaran sampai hari ketiga sempat melonjak 20 sampai 40 persen dari harga biasanya. Pantauan Waspada hingga Senin (28/9), suplai ikan dari Tanjungbalai dan Tanjungtiram mulai berangsur pulih. “Nelayan sudah mulai melaut kembali,” tutur S. Siregar, distributor ikan di Pasar Kisaran. Siregar menyebutkan, sejak lebaran pertama sampai lebaran ketiga hasil laut yang beredar di pasaran berasal dari stok kulkas, sehingga distributor menawarkan ikan dengan harga Rp10.000-Rp12.000 per kg, akan tetapi harga eceran di pasaran mencapai Rp18.000 untuk ikan gembung. Melonjaknya harga diperkirakan ‘dimainkan’ oleh pengecer yang terpaksa tidak berlebaran karena melayani kebutuhan masyarakat akan ikan. “Sekarang ini, baik paso-

kan barang maupun harganya sudah berangsur normal,” tutur M. Rafi, awak truk ikan asal Tanjungbalai yang sempat dikonfirmasi Waspada. Kondisi sama juga berlangsung di pusat pasar ikan Tanjungtiram dan Tanjungbalai. “Sudah mulai normal kembali, sebelumnya sempat meroket harganya, maklumlah nelayan tidak turun ke laut,” tutur Johan, 45, pemilik salah satu gudang ikan di Tanjungbalai. Sedangkan Udin, 40, pedagang ikan di Pasar Kisaran menjelaskan, harga ikan Cincaro Rp7.000, Gembung Rp15. 000, Udang Senja Rp24.000, ikan Belida Rp13.000, Kelotok Rp15.000, Senangin Rp20.000, Gembung Kuring Rp18.000, Tongkol Rp14.000, Cumi-cumi Rp10.000, Parang-parang Rp7. 000, Gulama Rp4.000, Selar Rp7.000, Cucut Rp4.000, Ikan Merah Rp12.000, dan Bawal Rp23.000. “Harga ikan laut sudah mulai turun dari harga sepe-

kan menjelang hingga hari ketiga lebaran lalu,” tutur Erlina, 30, warga Kel. Siumbut-Umbut, Kec. Kisaran Timur Kab. Asahan yang kebetulan membeli ikan di pasar Kisaran. Sementara ikan air tawar seperti Ikan Lele Rp12.000 per kg, Ikan Mujahir Rp15.000, dan ikan Mas Rp18.000. “Biasalah pasar Pak, kebutuhan meningkat sedangkan pasokan menurun maka harga akan naik. Sekarang pasokan sudah mulai normal kebutuhan pun menurun, maka harga kembali normal seperti biasa,” tutur pedagang ikan air tawar.(a10)

Reuters

TERGULING: Investor sedang berbincang di depan papan elektronik saham di Taiyuan China, Senin (28/9). Indeks saham China terguling tiga persen dalam sesi akhir perdagangan kemarin karena jatuhnya pasar global dan prospek ekonomi yang merosot secara berkelanjutan.

Beras, Migor Turun Usai Lebaran M E D A N ( Wa s p a d a ) : Harga bahan kebutuhan pokok seperti beras dan minyak goreng (migor) di sejumlah pasar tradisional, usai lebaran mengalami penurunan sangat tajam, sementara itu harga gula pasir masih bertahan di Rp10 ribu per kg. Menurut R Sembiring, pedagang bahan pokok di Pasar Aksara, Senin (28/9), harga minyak goreng curah tanpa merek usai lebaran mengalami penurunan dari Rp8.500 per kg menjadi Rp7.500 per kg. Harga beras juga mengalami penurunan akibat ma-

sih tingginya pasokan dari berbagai daerah sentra produksi ke pasar tradisional Medan sehingga beras IR 64 kualitas I dari Rp173 ribu per karung 30 kg dijual menjadi Rp165 ribu, katanya. Sementara itu walaupun tingkat kebutuhan masyarakat mulai kembali turun ke titik normal seperti hari biasa sebelum Ramadhan, harga gula pasir di pasaran masih mahal dan belum turun dan tetap bertahan di Rp10 ribu per kg, ujarnya. Penurunan tersebut juga diikuti bahan pokok lainnya khususnya jenis komoditi

pertanian diantaranya cabai merah lokal dari Rp32 ribu per kg turun menjadi Rp25 ribu per kg, sedangkan kentang, tomat, dan wartel tetap stabil yakni di kisaran Rp7000 per kg. Menurut Rahmita Tarigan pedagang sayuran di Pusat Pasar Medan, turunnya harga bahan pokok hasil pertanian tersebut didorong menurunnya permintaan masyarakat usai lebaran sehingga pasokan lebih banyak. Di samping itu banyaknya pasokan tersebut juga akibat pengaruh suasana libur lebaran selama sepekan yang mengakibatkan harga bahan

pokok selama beberapa hari sempat naik, namun setelah itu turun drastis setelah buruh normal pekerja, katanya. Sedangkan turunnya harga beras, menurut Rahmat, akibat banyaknya pasokan hasil panen dari daerah provinsi Nanggroe Aceh Darusalam seperti Tamiang, Aceh Timur hingga Lhokseumawe ke Medan. Kondisi tersebut juga bersamaan dengan panen di sejumlah kabupaten lain di Sumatera Utara seperti Deli Serdang, Kisaran, Serdang Bedagai, Asahan dan lainnya, sebutnya.(m40)

Asahan Butuh Industri Kelapa Terpadu KISARAN (Waspada) : Direktur Eksekutif Pondok Ilmiah Potensi Asahan (PIPA) Zaid Afif, Senin (28/9) menyatakan, pengembangan industri kelapa terpadu di areal perkebunan tanaman kelapa lokal yang memiliki luas 44,641 ha dengan kapasitas produksi dari 30,526.95 ton (kopra basah) di Asahan hingga sekarang belum tercapai. Sementara, kata Zaid,

rencana pengembangan sudah didengungkan Badan Perencanaan dan Pembangunan Daerah (BAPPEDA) Asahan sejak 2007 lalu. Namun hingga kini, komoditas kelapa lokal masih berupa tanaman perkebunan rakyat dan masih dikelola secara tradisional. Dijelaskan, Asahan saat ini memiliki sejumlah sentra tanaman perkebunan kelapa meliputi Kec. Sei Kepayang, kawasan pesisir Kec. Air Joman dan pesisir pantai Kec. Tanjung Balai. “Potensi baik ini perlu pengkajian ulang dan benar,” kata Zaid didampingi Sekretaris Eksekutif PIPA, Aziz AR Panjaitan. Keduanya dalam kesempatan itu juga menjelaskan tentang belum adanya peru-

sahaan swasta, nasional maupun perusahaan asing yang tertarik untuk mengembangkan kebun kelapa menjadi perkebunan besar. Padahal, sebut Zaid, baik inti kelapa maupun limbahnya dapat dimanfaatkan dan menjadi nilai jual cukup lumayan. Batang pohon kelapa bisa dijadikan indutri mebel, lidi kelapa bisa bernilai eksport. Sementara batok kelapa dapat diolah menjadi arang kelapa. Seharusnya, lanjutnya, industri pengelolaan kelapa terpadu dapat segera dibangun dengan konsep pengembangan teknologi tepat guna. Kemudian dioperasikan dengan metode industri partisipatif, melibatkan petani kelapa dan

masyarakat sekitarnya, serta membentuk beberapa plasma berbentuk home industri dari perusahaan pengelola. Dari home industri ini, tambahnya, juga bisa dihasilkan serbuk kelapa untuk bahan dasar kompos atau media tanam intensif. Sementara sabut atau serat kelapa yang telah dipisahkan dari serbuknya (cocopeat) dapat diolah pabrik menjadi karpet setelah dipress dan ditenun. “Sebenarnya banyak sekali manfaat dari pohon kelapa. Tinggal bagaimana kita mengolahnya lebih serius dan maksimal,” pungkas Zaid yang mengaku sekolah dibiayai dari hasil perkebunan kelapa keluarganya. (a10)

Lonjakan SMS XL Sepanjang Lebaran Lancar Trafik SMS tertinggi, dalam kurun tiga hari sejak H-2 hingga hari H Lebaran, terjadi pada 19 September (H-1 Lebaran), yakni sekitar 270 juta SMS. “H-1 Lebaran tercatat sebagai trafik tertinggi SMS XL, yakni 270 juta SMS dari 100 juta SMS di tahun sebelumnya, naik signifikan hingga sekitar 170 persen,” ucap kata Manager Public Relations XL Febriati Nadira, di Jalarta. Dibandingkan hari H Lebaran, Ira menuturkan, XL hanya mencatat sekitar 240 juta SMS dari kurang lebih 100 juta SMS di tahun sebelumnya, atau melonjak hingga 140 persen. Sementara itu, untuk trafik layanan data (GPRS) XL tertinggi justru jatuh pada hari H-2 Lebaran, yakni sekitar 2,7TB. Jika dibandingkan dengan trafik sebesar 0,65TB di tahun sebelumnya, XL mencatat pertumbuhan pesat 315 persen. “Pada hari H Lebaran, XL membukukan trafik data sekitar 2,4TB, meningkat 328 persen dari tahun sebelumnya yang hanya membukukan 0,57 TB,” ucap Ira. PT Excelcomindo Pratama Tbk (XL) menyatakan trafik layanan suara dan layanan pesan singkat (SMS) melonjak selama Lebaran 2009. “Jaringan XL aman dan sukses. Secara nasional peningkatan trafik suara mencapai 44 persen,” kata Ira. Dia menjelaskan, kenaikan trafik signifikan sudah terjadi sejak H-2 (18/9) Lebaran. Trafik percakapan tertinggi terjadi hari H Lebaran (20/9) dengan 925 juta panggilan, meningkat 6 persen dibanding hari H Lebaran 2008 sebanyak 870 juta panggilan. Pada Lebaran 2009 lama percakapan mencapai 630 juta menit, meningkat 40 persen dari sebelumnya 450 juta menit. Sementara trafik SMS saat Idul Fitri 1430H mencapai 240 juta SMS, melonjak 140 persen dari 100 juta SMS tahun sebelumnya. Sedangkan layanan data/GPRS melonjak 328 persen menjadi 2,44 terabites dari 0,57 terabytes. Nadira menjelaskan, secara nasional terjadi pergerakan pelanggan dari kotakota besar ke sejumlah kota di daerah. Dengan kata lain tidak terjadi gangguan pada layanan panggilan maupun pengiriman SMS. “Peningkatan trafik tertinggi terjadi di Jawa Tengah yang mencapai 68 persen, dan DI Yogyakarta 58 persen,” kata Ira.

Harga Emas Di Medan Jenis

Kadar

Harga

London Murni London 24 Karat Emas Putih 22 Karat Suasa

99% 97% 90 s/d 93% 75 % 70% 20 s/d 35%

Rp304.000 Rp290.000 Rp260.000 Rp230.000 Rp165.000 Rp100.500

Waspada/H. Rusli Ismail

LENGANG: Suasana Jalan dan pertokoan di Jalan Ratu Syafiatuddin, Kota Banda Aceh, yang hari-hari biasanya terkenal cukup padat. Kini kelihatan masih lengang bahkan sangat sepi dari aktivitas transportasi atau lalu-lintas dan jual beli karena sebagian besar toko yang masih tutup total. Foto diambil Minggu (27/9).

Pasar Tradisional Di Banda Aceh Masih Sepi BANDA ACEH (Waspada): Hingga hari kedelapan pasca Idul Fitri 1430 H, Minggu (27/ 9), suasana pasar-pasar tradisional di Banda Aceh dan Aceh Besar, terlihat masih sepi. Namun begitu harga-harga barang khususnya kebutuhan pokok masih tetap tinggi. Berdasarkan pantauan, masyarakat di daerah itu masih larut dalam merayakan hari kemenangan umat Islam setelah sebulan penuh berpuasa di bulan suci Ramadhan dan Idul Fitri. Hanya sebagian kecil pedagang yang tampak menggelarkan dagangannya. Selain aktivitas perdagangan di kaki lima dan pasarpasar tradisional termasuk pasar kebutuhan pokok suasana-

Valuta Asing Di Medan Mata Uang

Jual

Beli

Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

9.730 8.225 9.664 16.748 1.389 110,43 7.230 14.523 2.957

9.720 7.925 9.287 16.305 1.283 105,88 7.000 14.123 2.924

nya masih sepi, juga sebagian besar toko masih kelihatan tutup total, sebagaimana terlihat di, Pasar Aceh, Pasar Peunayong, Pasar Neusu, Pasar Lamlagang, Pasar Seutui (Kota Banda Aceh), Pasar Keutapang, Pasar Lambaro dan Pasar Indrapuri (Kabupaten Aceh Besar) dan sejumlah pusat pasar perbelanjaan lainnya. Hingga Minggu (27/9), di kawasan pekan Pasar Aceh, Pasar Peunayong, Pasar Neusu, Lamlagang, (Kota Banda Aceh), Pasar Keutapang dan Pasar Lambaro (Aceh Besar) yang selama ini tertkenal sebagai pusat pasar tergolong padat pengunjung, hingga pasca delapan hari lebaran Idul Fitri, suasananya masih sepi. Hanya sekira 40 persen pedagang yang menggelar dagangannya. Maklum, sebagian masih tutup karena pedagang yang selama ini berdatangan dari berbagai penjuru Kota Banda Aceh dan Aceh Besar bahkan dari seluruh penjuru Provinsi Aceh dan Sumetera Barat (Sumbar) masih menghabiskan waktu lebaran di kampung

halaman mereka masingmasing. Yang paling menyolok, suasana terlihat ramai di berbagai stasiun angkutan atau terminal mopen yang berlokasi di sekitar pusat pasar tradisional tersebut, petugas stasiun tampak sibuk dan lancar melayani warga yang ingin bepergian dan arus balik pemudik. Sementara itu sejumlah pedagang yang sudah mulai melakukan transaksi jual beli di beberapa kawasan tertentu kepada Waspada, Minggu (27/ 9), mengaku persediaan barang sudah menipis dan terbatas. “Stoknya hampir habis, sedangkan harga sebagian besar belum menunjukkan penurunan sejak terjadi kenaikan menjelang Idul Fitri beberapa waktu lalu,” ujar R. Dian, seorang pedagang barang kelontong di Pasar Neusu. Belum normalnya aktivitas dan suasana pasar, ternyata menimbulkan kesulitan bagi ibu rumah tangga yang ingin berbelanja sayur-mayur untuk kebutuhan sehari-hari selepas lebaran.(b21)


Sumatera Utara

WASPADA Selasa 29 September 2009

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane

Zhuhur 12:18 12:31 12:18 12:25 12:25 12:22 12:18 12:14 12:21

‘Ashar 15:27 15:43 15:28 15:37 15:36 15:28 15:27 15:23 15:30

Magrib 18:21 18:34 18:22 18:29 18:28 18:26 18:22 18:18 18:24

‘Isya

Imsak

Shubuh Syuruq

Kota

19:29 20:43 19:30 19:37 19:37 19:34 19:30 19:26 19:32

04:48 05:01 04:49 04:56 04:55 04:52 04:48 04:44 04:51

04:58 05:11 04:59 05:06 05:05 05:02 04:48 04:54 05:01

Langsa 12:20 L.Seumawe 12:24 L. Pakam 12:17 Sei Rampah12:16 Meulaboh 12:28 P.Sidimpuan12:15 P. Siantar 12:16 Balige 12:16 R. Prapat 12:13

06:12 06:26 06:13 06:20 06:19 06:16 06:13 06:08 06:15

Zhuhur ‘Ashar 15:31 15:36 15:26 15:26 15:38 15:22 15:25 15:24 15:20

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:24 18:27 18:20 18:19 18:31 18:19 18:20 18:20 18:17

19:32 19:35 19:29 19:28 19:39 19:27 19:28 19:28 19:25

04:51 04:54 04:47 04:46 04:58 04:45 04:46 04:46 04:43

05:01 05:04 04:57 04:56 05:08 04:55 04:56 05:56 04:53

Sabang 12:31 Pandan 12:17 Sibolga 12:17 Sidikalang 12:19 Sigli 12:28 Singkil 12:21 Stabat 12:18 Takengon 12:25 T.Balai 12:13 Tapaktuan 12:24

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:15 06:18 06:11 06:10 06:22 06:09 06:10 06:10 06:07

Zhuhur ‘Ashar 15:43 15:24 15:24 15:27 15:40 15:29 15:28 15:36 15:22 15:33

17

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:34 18:21 18:21 18:22 18:32 18:25 18:22 18:28 18:17 18:27

19:42 19:29 19:29 19:30 19:40 19:33 19:30 19:36 19:25 19:35

05:01 04:47 04:47 04:49 04:59 04:51 04:48 04:55 04:43 04:54

05:11 04:57 04:57 04:59 05:09 05:01 04:58 05:05 04:53 05:04

Tarutung 12:17 T.Tinggi 12:16 Panyabungan 12:14 Teluk Dalam12:21 Salak 12:19 Limapuluh 12:15 Parapat 12:17 GunungTua 12:14 Sibuhuan 12:13 Lhoksukon 12:23

06:25 06:11 06:11 06:13 06:23 06:15 06:13 06:19 06:07 06:18

Zhuhur ‘Ashar 15:24 15:25 15:19 15:26 15:27 15:24 15:25 15:20 15:19 15:35

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:20 18:19 18:18 18:25 18:23 18:18 18:20 18:18 18:17 18:26

19:28 19:27 19:26 19:33 19:31 19:26 19:28 19:26 19:25 19:35

04:46 04:46 04:44 04:51 04:49 04:45 04:47 04:44 04:43 04:53

04:56 04:56 04:54 05:01 04:59 04:55 04:57 04:54 04:53 05:03

06:11 06:10 06:08 06:15 06:13 06:09 06:11 06:08 06:07 06:18

Diduga Hasil Curian, Polres Langkat Sita Mobil Mewah STABAT (Waspada): Sepekan terakhir Polres Langkat menahan mobil mewah Hyundai Santa Fee Turbo B 2998 II warna hijau muda. Dasar penahanan dijelaskan Kasat Reskrim, AKPWahyudi, Senin (28/9), mobil tidak dilengkapi surat Bukti Pemilik Kendaraan Bermotor (BPKB). Polisi meragukan mobil bernopol wilayah Jakarta itu hasil curian maupun ilegal dan Kasat Reskrim tidak membantahnya. ‘’Ia, mobil tidak dilengkapi BPKB,’’ katanya

singkat. Namun Ka-sat Reskrim enggan menyebutkan identitas pemilik maupun pemakai mobil yang telah dimintai keterangan sebelumnya. AKPWahyudi juga enggan menjelaskan kronologis penahanan apakah sewaktu razia kendaraan bermotor atau adanya informasi masyarakat. Keterangan lain yang dihimpun, sebelum ditahan, mobil tersebut beberapa kali digadaikan oleh oknum pengusaha di Stabat kepada yang berminat dengan harga Rp25

juta tanpa diperlihatkan BPKB. ‘Bisnis penggadaian mobil mewah berplat luar provinsi Sumut di Stabat salah satunya menjerumuskan Hyundai Santa Fee Turbo untuk penyelidikan polisi lebih lanjut. Sementara pantauan Waspada di Mapolres Langkat, mobil yang ditahan diistimewakan, diparkir sejajar dengan mobil perwira lainnya di areal parkir samping kanan, tidak selayaknya mobil barang bukti lain yang diparkir di halaman belakang. (a38)

Sidang Lanjutan DAK, Uang Miliaran Disetor Ke Terdakwa AZ Waspada/Abdul Hakim

TRANSPORTASI GETEK: Bukan hanya saat lebaran, transportasi getek di Desa Bukit Melintang, Kec. Wampu, Kab. Langkat yang melintasi Sei Wampu merupakan harapan warga untuk bepergian dari desa ke kota. Ratusan warga memanfaatkan jasa penyeberangan non stop 24 jam itu setiap harinya karena tidak ingin menempuh satu jalur lain yang menyita waktu lama dengan kondisi jalan rusak parah. Saat lebaran, penyeberangan itu padat karena warga 10 desa di Kec. Wampu berkunjung dan dikunjungi kerabat mereka. Gambar direkam Minggu (27/9).

Warga Aceh Tamiang Ditemukan Tewas Di Teluk Mengkudu TELUKMENGKUDU (Waspada): Azwar,22, warga Desa Penaga, Kecamatan Bendahara, Kabupaten Aceh Tamiang, ditemukan tewas mengenaskan dengan sekujur tubuh luka bekas penganiayaan. Korban ditemukan warga di tepi jalan Desa Mata Pao menuju ke Sialang Buah,persisnya diareal kebun kelapa sawit milik PT.Socfindo kebun Mata Mata Pao, Kec.Teluk Mengkudu, Kab.Serdang Bedagai, Senin (28/9) sekira pukul 07:00. Penemuan mayat bermula dari salah seorang karyawan kebun yang akan melaksanakan tugasnya di lokasi itu. Melihat adanya sesosok tubuh manusia yang dalam keadaan posisi telungkup tidak bernyawa lagi lalu memberitahukannya kepada aparat pemerintahan desa dan dilanjutkan ke Polsek Teluk Mengkudu. Kapolsek Teluk Mengkudu AKP Robert Simbolon yang menerima laporan langsung turun ke lokasi penemuan mayat bersama beberapa anggotanya. Saat saku celana korban diperiksa petugas menemukan sebuah dompet berwarna merah dan didalam dompet ada Kartu Tanda Penduduk(KTP). Dari kartu tersebutlah petugas mengetahui identitas korban adalah warga Kabupaten Aceh Tamiang. Untuk mengetahui dan melihat semua kondisi luka ditubuh korban Kapolsek Teluk Mengkudu memberitahu ke Polres Serdang Bedagai. Beberapa saat kemudian petugas dari identifikasi yang langsung dipimpin Kasat Reskrim AKP Sonny Marisi Nugroho Tampubolon, SIK tiba di tempat. Saat dilakukan penelitian, banyak sekali luka yang ada di tubuh korban bekas tusukan dan sayatan benda tajam. Tempo Lima Jam Dalam tempo lima jam, dua dari tiga pelaku pembunuhan Azwar ditangkap dari rumah mereka masing-masing di Desa Pekan Tanjung Beringin, Kec.Tanjung Beringin, Kabupaten Serdang Bedagai, Senin (28/9) sekira pukul 12:00 . Ketiga yang ditangkap itu masing masing, JP,21, warga Dusun I, Keramat Asam,Desa Pekan Tanjung Beringin,SRN,22, warga Dusun Kampung Baru, Desa Pekan Tanjung Beringin (keduanya sebagai pelaku) dan Hendra ,19,warga Desa Kuala Simpang,AcehTamiang masih sebagai saksi. Sedangkan seorang lagi pelaku pembunuhan itu yakni Rz masih kabur. Menurut pengakuan JP di Mapolsek Teluk Mengkudu yang merupakan pelaku utama dalam kasus pembunuhan itu kepada petugas, pembunuhan dilakukan karena dendam lama. Tahun 2007 pipi JP pernah disayat korban gara- gara tidak mau mengantarkan korban ke Rumah Sakit Umum Melati Kampung Pon.Waktu itu sudah larut malam dan menunjukkan pukul 02:00.. “Karena saya tidak mau korban marah dan menggores pipi saya,”kata JP. Akibat sayatan pisau itu hingga saat ini pipi JP masih cacat sebelah kiri. Karena itu korban ditangkap polisi dan diadili di pengadilan Negeri Tebingtinggi serta divonis selama satu tahun. Setelah menjalani tahanan,korban pulang dan langsung pergi merantau ke Aceh. Setelah setahun di Aceh korban pulang berlebaran ke rumah keluarganya di Gang Dame ,Desa Pekan Bedagai, Kec.Tanjung Beringin, Kab.Serdang Bedagai Sabtu (26/9). Minggu(27/9) pelaku dan korban bertemu. Saat itu korban tertawa melihat pelaku, sehingga dendam pelaku melihat korban bankit kembali. Saat korban menonton hiburan keyboard di Desa Nagur JP menyuruh temannya SRN menjemput korban dengan mengendarai sepeda motor Honda Supra warna hitam BK 6534 GA dan dibawa ke arena hiburan keyboard di Desa Bogak Besar,Kecamatan Teluk Mengkudu,Kab.Serdang Bedagai. Usai melihat keyboard di Bogak Besar ketiga pelaku membawa korban ke salah satu tempat yang sunyi di kawasan Jalan Bogak Besar ke Desa Nagur. Di tempat inilah Azwar dibantai ketiganya dengan menggunakan pisau serta menginjak wajah dan leher korban sehingga remuk dan patah. Dalam kondisi sekarat korban dibopong dengan mengendarai sepeda motor dan dibawa kea rah areal Perkebunan Kelapa Sawit milik PT Socfindo Kebun Mata Pao. Di tempat itu korban diseret dan ditinggalkan begitu saja. Kapolres Serdang Bedagai AKBP Drs.Eri Safari yang turun langsung ke Mapolsek Teluk Mengkudu didampingi Kapolsek AKP Robert Simbolon membenarkan motif pembunuhan akibat dendam lama. ‘’Seorang pelaku lagi masih dalam buronan petugas karena kabur,’’ kata Kapolres. (a07)

Waspada/Eddi Gultom

DIPERIKSA: Kapolres Sergai AKBP Eri Safari didampingi Kapolsek AKP R.Simbolon dan kedua tersangka di Mapolsek Teluk Mengkudu, Senin (28/9).

Kasus Lahan Perg.Taman Siswa T.Tinggi, Ada Dugaan Persidangan Gelap TEBING TINGGI (Waspada): Persidangan gelap diduga terjadi di Pengadilan Negeri Kota Tebingtinggi, terkait kasus lahan Perguruan Taman Siswa di Jalan Deblot Sundoro, Kel. Rambung, Kec. T.Tinggi Kota, karena nomor perkara kasus itu tak ada dalam administrasi PN. Bahkan, terdakwa merasa telah dipecundangi Polresta, Kejari dan PN Tebingtinggi, dalam proses perjalanan kasus itu sejak awal, sehingga harus ditahan di Lapas Tebingtinggi. Adi Hariono, 44, warga Jl Deblot Sundoro No.15, Kel. Rambung, merupakan salah satu terdakwa kasus dugaan pemalsuan surat dengan penggelapan hak atas barang yang tidak bergerak, Senin (28/9). Dia, menguraikan kronologis perkara itu hingga sampai di PNTebingTinggi. Dikatakan, kasus itu muncul terkait pengaduan saudara sepupunya bernama dr Adi Rahmat, pada 2006 ke Polresta Tebing Tinggi. Pengadu yang sejak puluhan tahun tinggal di Malaysia itu, menuduh Adi Hariono dan abangnya Agus Hari-yanto, telah menjual lahan seluas 4.125 M2, kepada Perg.Taman SiswaTebing-tinggi, senilai Rp75 juta. Lalu, pada Mei 2006 itu juga terdakwa menjalani pemeriksaan di Polresta dengan Juper E. Saragih. Anehnya, selama tiga tahun kasus itu mengendap di Polresta dan baru muncul kemudian pada 2009. Lalu, 8 Mei 2009 terdakwa mendapat panggilan Polresta dan menghadap 12 Mei 2009. Pada pemanggilan pertama itu, BAP telah siap dan segera dilimpahkan polisi ke Kajari. Sebelum ke Kejari ada jaminan dari polisi, mereka tidak akan ditahan. Anehnya sesampai di Kejari, pihak kejaksaankemudianmengeluarkansurat penahanan. Akibat surat penahanan No.Print362/N-214/Rt.3/LP/i/05/2009 yang ditandatangani Kasi Pidum Hamka Nasution, SH, terdakwa ditahan dari 13 Mei- 17 Juni 2009. Persidangan pertama dimulai pada 20 Mei 2009. Setelah beberapa kali siding, barulah terdakwa mendapat status tahanan kota dengan jaminan Rp50 juta. Setelah menjalani beberapa kali persidangan JPU menuntut Agus Harianto dengan kurungan 1 tahun dan Adi Hariono dengan6bulankurungan.Padahal,pasal yang dituduhkan 385 KUH Pidana dengan hukuman maksimal 4 tahun. Hingga2minggukemudian,sidangselalu saja diundurkan dengan alasan tak jelas. Bahkan, anehnya pada 17 September 2009, pengacara terdakwa menyampaikan kepada terdakwa, sidang terpaksa ditunda lagi, karena nomor perkara tidak ada di administrasi PN Tebingtinggi. Diungkapkan,kasustuduhanpemalsuan dan penggelapan lahan itu tidaklah

benar. Lahan seluas 4.125 M2 itu oleh terdakwa tidak dijual tapi dihibahkan kepada Perg.Taman Siswa untuk lahan sekolah. Sedangkan pihakTaman Siswa, mengeluarkan dana Rp75 juta untuk mengganti aset yang ada di atas lahan itu, kepada keluarga terdakwa. Hal itu dilakukan,karenadulunyapemiliklahan M Sabtu, sering mengibahkan lahan kepada masyarakat yang memakai lahanmiliknya.Atasdasaritupula,kedua terdakwa dengan persetujuan ibunya menghibahkan lahan itu untuk sekolah. “Kalauitujualbelimanasegituharganya,” kata dia. Status lahan itu sendiri, hingga meninggalnya pemilik lahan yakni M Sabtu (ayah angkat dari ibu terdakwa Alm. Romana dan kakek angkat pengadu Adi Rahmat), tidak jelas. Karena alas hak yakni Grant Sultan No.127 sampai kini tidak ada yang mengetahuinya. Namun, lahan itu selama puluhan tahun, setelah meninggalnya ayah angkat mereka, diusahai dan diambil manfaatnya oleh orang tua kedua terdakwa, yakni Alm. Romana dan suaminya Mugiono. Sedangkan pengadu Adi Rahmat, sejak puluhan tahun sama sekali tidak berada di tempat, karena mandah ke Malaysia. ‘’Karena statusnya milik kakek angkat kami, atas izin orang tua kami, lahan itu kami hibahkan, ‘’ kata Hariono. Atas dasar itu pula, kedua terdakwa tidak mengerti mengapa mereka justru dituduh melakukan pemalsuan surat dan penggelapan lahan. “Saya merasakan ada skenario untuk menzhalimi saya,’ kata Adi Hariono. Selain itu, keduanya heran, kenapa pengaduan Adi Rahmat diproses, padahal status bersangkutan hanya cucu angkat, sedang ibu mereka anak angkat dari pemilik lahan.Tegasnya, lahan itu milik M Sabtu bukan milik Adi Rahmat. Tapi pasca meninggalnya M Sabtu lahan itu diusahai Alm Romana sebagai anak angkatdansuaminya.Bahkan,keduanya tinggal di rumah warisan M Sabtu bersama anak-anaknya hingga kini. “Secara de facto, orang tua kami yang berhak menguasainya dan bukan Adi Rahmat,” tegas Adi Harianto. Tapi, nyatanya fakta itu tak muncul di pengadilan, keluh dia. Terkait masalah itu, JPU Fitriani, SH, saat dikonfirmasi membenarkan penahanan terhadap terdakwa. “Kasus itu memang dapat ditahan, jadi kami tahan,” kata dia. Di PN Tebingtinggi. Fitriani, juga mengatakan jika terdakwa merasa ada penzhaliman, itu hak terdakwa. Demikianpuladengantuntutanyanghanya 1 tahun dan 6 bulan untuk masingmasing terdakwa, hal itu dilakukan berdasarkan pertimbangan dia semata. Fitriani, membantah pula perkara itu tidak punya nomor perkara di PN Tebingtinggi. “Ah masak tak ada. Tapi itu urusan PN lah,” kilah dia. (a08)

STABAT (Waspada): Dalam sidang lanjutan perkara dugaan korupsi penyimpangan DAK tahun 2007 di PN Stabat, Senin (28/9), diulas terkait terdakwa AZ menerima uang cas miliaran rupiah dalam koper dari terdakwa IG dan AB usai pemotongan uang DAK dari 75 kepala sekolah. Berdasarkan pengakuan saksi IG dan AB sebelumnya, uang miliaran itu mereka serahkan kepada AZ di kediamannya di Stabat sesuai permintaannya. Namun dalam persidangan Senin saat AZ dihadirkan sebagai saksi untuk terdak-

wa IG, dia membenarkan memerintah kedua terdakwa untuk menghantarkan uang kepadanya, tetapi digunakan untuk membeli alat peraga kebutuhan sekolah juga membayar utang-utang terkait program DAK yang belum lunas. Melihat adanya kejanggalan keterangan AZ, majelis hakim kembali bertanya untuk memperjelas. AZ kemudian menyebut uang itu merupakan titipan kepala sekolah kepadanya. Sesaat setelah mengatakan itu

AZ minta maaf dan menyebutkan maksudnya bukan titipan kepala sekolah, tetapi semacam amanah. Majelis hakim semakin bingung dengan keterangan AZ. Kemudian saat JPU bertanyaapakahuangmiliaranituhabis terpakai untuk utang program DAK dan membeli alat peraga, AZ mengatakan habis terpakai seluruhnya. Akhirnya majelis hakim menyatakan persidangan berakhir dan dilanjutkan Rabu (30/9) masih beragenda mendengarkan keterangan saksi. (a38)

Pengawasan Proyek Pembangunan Di Langkat Perlu Ditingkatkan STABAT (Waspada): Sejumlah kalangan tokoh masyarakat mengimbau Pemkab Langkat bersama instansi terkait untuk meningkatkan pengawasan pada proyek pembangunan yang saat ini sedang dikerjakan. ‘’ Pengawasan sangat penting sehingga mutu pekerjaan tidak asal jadi,’’ ucap seorang tokoh masyarakat yang enggan disebutkan indentitasnya menjelaskan kepada Waspada di Stabat, Senin (28/9). Dikatakan, selama ini kucuran dana untuk proyek pembangunan berupa sarana perhubungan dan pendidikan cukup besar, tetapi karena pengawasan model 86, perkerjaan proyek kurang berkualitas. Selain pengawasan bidang pembangunan, tokoh masyarakat tersebut juga meminta agar pengawasan dibidang keuangan juga diperketat, sehingga kasus korupsi yang sekarang ini masih digelar di PN Stabat tidak

terulang. Ironisnya, aparat Pemkab Langkat memiliki personil pengawasan yang cukup baik melalui Inspektorat, nyatanya pengawasan yang mereka lakukan selama ini setali tiga uang, lanjutnya. Sementara itu guna menindaklanjuti temuan tentang beberapa proyek fisik yang tidak sesuai dengan bestek atau adanya proyek fisik yang terbengkalai, Bupati Langkat Ngogesa Sitepu telah membentuk tim pengawasan proyek yang dikoordinir oleh Sekdakab Langkat Drs H Surya Djahisa. Bupati merespon apa yang menjadi keluhan masyarakat terha-dap pengerjaan proyek dan sejak kepemimpinannyaakandibentuktim,kata

Kabag Humas H Syahrizal mengutip pernyataan Sekda. Menurutnya tim pengawas akan memprioritaskan berbagaipengerjaanproyekyangberkaitan dengan kepentingan masyarakat banyak seperti sarana perhubungan, transportasi, pendidikan, pertanian dan kesehatan. Pelaksanaantugastimefektifmulai Oktober 2009 dan setiap selesai melaksanakantugaspengawasan,timakan membuat laporan secara tertulis kepada Bupati Langkat. Mekanisme kerja tim telah diatur dalam upaya untuk memberikan masukan kepada Kepala Daerah untuk mengevaluasi hasil-hasil pekerjaan proyek untuk kemudian kepada SKPD yang bersangkutan agar menjadi catatan bagi pihak ketiga yang melaksanakan pekerjaan. (a01)

12 Elemen Masyarakat Tolak Rini Jadi Ketua DPRD Binjai BINJAI (Waspada): 12 elemen masyarakat yang tergabung dalam Lembaga Sosial masyarakat ( LSM) dan pratisi hukum Senin ( 28/9) mendatangi DPRD Binjai menolak Hj Rini Sopianti (foto) sebagai ketua DPRD Binjai sementara maupun defenitif. Pernyataan sikap 12 elemen masyarakat Kota Binjai menolak Hj Rini Sopianti sebagai ketua DPRD sebagai menentang nepotisme. Seperti dikatakan Gito Affandi dariWanacakra dan Syamsuddin Damanik serta Jaspen Pardede dari P3H, Hj Rini Sopianti adalah istri Walikota Binjai HM Ali Umri menimbulkan sistem nepotisme legislatif dan eksekutif . Ketika delegasi elemen masyarakat memasuki gedung DPRD Binjai , Ketua DPRD sementara Hj Rini Sopianti langsung meninggalkan gedung wakil rakyat. Menurut Asbat dari Pemuda Peduli Binjai, pemerintah sudah mencanangkan penghapusan Kolusi dan Nepotisme . Ternyata di Binjai nepotisme dilahirkan dengan merekayasa Ketua DPRD Binjai istriWalikota HM Ali Umri. 12 elemen masyarakat dan berbagai tokoh LSM minta wakil rakyat yang baru dilantik melawan kezaliman dan adanya intervensi penguasa. Serta menolak Hj Rini Sopianti sebagai ketua DPRD Binjai. Di antara delapan amanah rakyat yang disampaikan disebutkan jangan libatkan Sekwan dan jajarannya ke dalam wilayah politik. Sebab sekwan adalah instansi pemerintah sebagai fasilitator. 12 Elemen masyarakat minta mekanisme yang dilakukan Sekwan DPRD Hanizar Rawi dalam penetapan Ketua sementara DPRD Binjai. Menurut Gito

Affandi rekayasa penetapan ketua sementara dilakukan rapat di kantor Satpol PP Jalan Jambi,yang dihadiri Wakil Walikota, Sekdako, Sekwan DPRD Hanizar Rawi, pengurus Golkar. “Berarti unsur pemerintah sudah ikut campur ke dalam ranah politik,” sambung David. Ricuh Sidang pleno DPRD Binjai menetapkankomposisipimpinanDPRD, diwarnai kericuhan. Hj Rini Sopianti yang diusung Partai Golkar akhirnya terpilih sebagai Ketua DPRD Binjai. SedangkanHermanSembiring(PDIP) dan Bahman Nasution (Partai Demokrat) mendampingi sebagaiWakil Ketua DPRD Binjai. Jalannya sidang pleno DPRD Binjai langsung alot dan panas, sesaat setelah pimpinan sementara legislatif setempat, Erna Kaloko mengetuk palu tanda dibukanya sedang pleno. Apalagi saat disampaikan, Partai

Golkar sebagai peraih kursi dewan terbanyak di daerah itu mengusung Rini Sopianti sebagai calon ketua DPRD Binjai. Haris Harto mengajukan interupsi sempat menyoal pengusungan nama Rini sebagai calon Ketua DPRD Binjai. Mengaku masih sebagai Ketua DPD Partai Golkar Binjai yang sah, mantan Ketua DPRD Binjai periode 2004-2009 terang-terangan menentang pencalonan Rini Bahkan kapasitas Rini sebagai salah satu unsur ketua di DPD Partai Golkar Binjai juga sempat dipertanyakan. Namun kemudian seorang anggota DPRD dari Partai Golkar, Zainuddin Purba, SH secara tegas mengakui Rini sebagai calon yang sah diusung Partai Golkar. Kembali diwarnai hujan interupsi antar sesama kader Partai Golkar di dewan tersebut, Rini akhirnya tetap terpilih sebagai Ketua DPRD Binjai. Hj Rini Sopianti ketika ditemui wartawan mengaku siap mengemban amanah. Dia berharap, masyarakat membantu memberi masukan yang positif demi majunya pembangunan di daerah itu. Secara terpisah,Wakil Ketua DPRD Binjai terpilih Herman Sembi-ring mengatakan sidang pleno yang dilaksanakan pada hari itu sesuai dengan tuntunan yang diamanahkan Undang-undangNomor27tahun2009 Pasal 353.”Hasil rapat pleno hari ini, kita sampaikan ke Gubsu. Sehingga unsur pimpinan DPRD Binjai dapat segera dilantik,”sebutnya.(a03/a04)

TBM Pelita Hati T.Tinggi Terima Bantuan Baperasda Sumut TEBING TINGGI (Waspada): Taman Bacaan Masyarakat “Pelita Hati” Kel. Deblot Sundoro, Kec. Padang Hilir, Kota Tebingtinggi mendapat bantuan ratusan buku bacaan dari Badan Perpustakaan,ArsipdanDokumentasiDaerah Sum. Utara. Bantuan itu, langsung diserahkan,Senin(28/9),olehIndraHadi Kesuma Parhimpunan Nasution, ST diwakili stafnya di sekretariat TBM itu. Buku bantuan sebanyak 300 eksemplar itu, berdasarkan berita acara penyerahan No.481.3/5959/BPAD/2009, terdiri dari 78 judul buku. Buku-buku itu terdir dari buku agama, sosial, politik, komunikasi, ketrampilan, pertanian, rumah tangga, cerita rakyat serta teknologi. Sedangkan dana bantuan buku itu diperoleh dari APBD Provsu TA 2009

untuk TBM. Ketua TBM Pelita Hati Drs Abdul Khalik, MAP, menyatakan syukur atas bantuan 300 eksemplar buku yang diberikan Baperasda Sumut, khususnya pada Kepala Baperasda Sumut Drs H Syaiful Syafri. Dikatakan, bantuan itu sangatbesarmanfaatnya,karenaselama ini, upaya pengadaan buku-buku serta berbagai kegiatan di TBM Pelita Hati dilakukan melalui swadaya pengelola. Tingkat membaca warga di sini tinggi, setahun belakangan mereka minta pengadaan buku baru. Jadi kami upayakan dengan minta bantuan ke sana kemari, kata Khalik. Diakui pula, untuk 2007 TBM Pelita HatijugamenerimabantuandariGubsu untuk pengadaan buku dan kegiatan

TBM senilai Rp50 juta. Bantuan itu, kata Khalik, diperoleh melalui Bagian Bina Sosial Setprovsu dan telah digunakan sesuai peruntukannya. Dari bantuan itulah, kata Khalik, TBM Pelita Hati, memiliki buku Ensikplopedi Oxford Dunia Islam Modern yang harganya mencapai Rp2,5 juta untuk 6 jilid. Demikian pula dengan pengadaansejumlahbukutafsirdiantaranya Tafsir Quran Syeikh Aid Al Qarni untuk mengisi rak buku TBM. “Mungkin cuma TBM ini yang punya ensiklo dan tafsir. Banyak masyarakat yang memanfaatkannya,” kata Khalik. Hingga kini, TBM Pelita Hati Kel. Deblot Sundoro,perharidikunjungisekira30hingga 50 orang pengunjung .Di Kota Tebingtinggi sendiri, hanya terdapat dua TBM yang dikelola masyarakat. (a08)

Waspada/Ist

BANTU BUKU : Baperasda Sumut memberikan bantuan buku kepada TBM Pelita Hati Kota Tebing Tinggi, sebanyak 300 eksemplar. Terlihat salah seorang staf Baperasda menyerahkan bantuan secara simbolis dan diterima Sekretaris TBM Alisyah Fitri. Foto direkam, Senin (28/9).


18

Sumatera Utara

BERASTAGI (Waspada ) :Wakil Ketua DPRD Karo Adil Bangun, Sabtu (26/9) sekira pukul 05:00 meninggal dunia di RSU Elisabeth Medan akibat sakit yang sesak yang dideritanya beberapa bulan terakhir. Menurut beberapa keluarga dekat, jenazah Adil disemayamkan di rumah duka Jalan Djamin Ginting gang Harapan Berastagi, sedangkan upacara adat akan dilakukan Selasa (29/ 9) di Jamburta Ras Berastagi Kedatangan jenazah Adil Bangun yang dikawal Pospam Berastagi hingga sampai ke rumah duka disambut isak tangis keluarga begitu pula dengan sejumlah kalangan pejabat pemerintahan kabupaten Karo beserta kalangan anggota DPRD, pemuda dari organisasi dan wartawan datang silih berganti melayat. Ketua DPD Partai Golkar Karo Paulus Sitepu kepada wartawan mengungkapkan rasa duka cita yang sedalam-dalamnya karena merasa kehilangan kader partai yang gigih dalam membangun Karo. (a17)

KISARAN (Waspada) : Sedikitnya 165 kasus judi masih terjadi di wilayah hukum Polres Asahan. “ Selama Jaunuari-September, kami mengamankan 165 judi dengan 377 orang tersangka,” ujar Kapolres Asahan AKBP Rudy Sumardiyanto melalui Waka Polres Kompol DH Ginting didampingi Kabag Binamitra AKP Zulfikar kepada Waspada, Senin (28/9). Menurut data, kata Ginting, ada peningkatan kasus setiap triwulan, pada Januari-Maret pertama kita mengamankan 22 kasus namun pada triwulan kedua April-Juni menjadi 54 kasus dan bertambah lagi pada triwulan ketiga JuliSeptember sebanyak 89 kasus. “ Dari 165 kasus, ada sebanyak 49 kasus togel, ditambah 110 kasus menggunakan kartu joker

TKS Dishub Batubara Tewas Diterjang Kereta Api

Bantuan Mensos Di Batubara ‘Macet’ TANJUNGTIRAM (Waspada): Warga kurang mampu yang menghuni rumah tak layak huni di Kecamatan Tanjungtiram dan Talawi, Kabupaten Batubara merasa kecewa janji Mensos memberikan bantuan ternyata sampai, Senin (28/9) belum menjadi kenyataan Padahal menurut warga, bantuan Mensos Rp1 miliar untuk rehab rumah tak layak huni 100 rumah di Kecamatan Tanjungtiram dan Talawi itu sudah berlangsung sejak dua bulan lalu. “Yang jelas sampai hari ini bantuan Mensos belum kami terima,” sebut seorang warga di Desa Sukamaju, Tanjungtiram, Senin (28/9). Pendistribusian bahan bangunan untuk rehab rumah tak layak huni ditangani Kadis Sosial Batubara yang membuat kebijakan dinilai serba aneh. Untuk memudahkan penyaluran bahan bangunan seharusnya diprioritaskan panglong terdekat dengan rumah warga mendapat bantuan,seperti panglong di Tanjungtiram/Talawi .Yang aneh sebut warga bahan bangunan pekayuan pohon kelapa, seng, semen, tepas, batubata, paku, diangkut truk dari Indrapura Airputih Kepala Desa Sukamaju Kusrin, Senin (28/9) mengatakan bahan bangunan bantuan Mensos belum juga sampai dan tidak jelas penyebabnya. Begitu juga Kades Petatal Talawi,Sarwoto mengaku dapat bantuan Mensos untuk 16 orang warga ternyata belum juga menerima bahan bagunan. (a30)

Warga Sergai Yang Hilang Di Batubara Belum Ditemukan LIMAPULUH(Waspada): Suriyadi,39, warga Dusun lima, Desa Penggalangan, Kec. Tebing Syahbandar, Kab.Serdang Bedagai yang dikabarkan hilang sejak Kamis (24/9) sekira pukul 17:00 di sekitar kawasan perkebunan PT Socfindo perkebunan Tanah Gambus tepatnya 200 meter dari Desa Simpang Gambus, Kec. Limapuluh, Batubara, sampai saat ini belum ditemukan. (Waspada, 27/9). Menurut istri korban Ika Amriani ,31, senin (28/9) saat memberikan keterangan selanjutnya di Mapolsek Limapuluh, korban berangkat dari rumahnya dengan tujuan hendak menyusul dirinya ke Tanjungtiram, Batubara dengan mengenderai sepeda motor miliknya Yamaha Mio Soul BK 6936 SN. Selanjutnya menurut Ika, hari keberangkatan korban dari Desa Penggalangan, dirinya sempat menghubungi suaminya melalui HP sekira pukul 18:30 dan dijawab oleh korban masih dalam perjalanan,namun setelah ditunggu-tunggu korban tak kunjung sampai, akhirnya sekira pukul 20:00 Ika kembali menghubungi, namun HP korban tidak aktif lagi. Kapolsek Limapuluh AKP TP Butar Butar, SH, ketika dikonfirmasi mengaku ada menemukan Satu buah sepeda motor Yamaha Mark Mio Soul BK 6936 SN dan sebuah helm serta bungkusan berisi ayam yang sudah dipotong. Setelah olah TKP, barang bukti berupa sepeda motor dan helm diamankan di Mapolsek Limapuluh. TP Butar Butar mengimbau kepada masyarakat yang melihat keberadaan korban dapat menghubungi handphone 0813761960001. (a31)

1 Calih Asal PG Dilantik Ketua Sementara DPRD P.Siantar PEMATANGSIANTAR (Waspada): Satu calon anggota legislatif terpilih (Calih) asal Partai Golkar (PG) Hj. Nurasiah Lubis yang tidak turut diambil sumpah/janji dan dilantik menjadi anggota DPRD Kota Pematangsiantar periode 2009-2014 bersamaan dengan 29 Calih lainnya pada Senin (31/9)akhirnya dilantik Ketua sementara DPRD. Pengambilan sumpah dan pelantikan itu dilaksanakan Ketua sementara DPRD Marulitua Hutapea, SE disaksikan Wakil Ketua sementara Hotman M Lingga, SH dan 27 anggota DPRD lainnya dalam rapat paripurna istimewa di ruang sidang DPRD Pematangsiantar, Senin (28/9).ksanakannya pengambilan sumpah/janji anggota DPRD periode 2009-2014, masa bhakti DPRD periode 2004-2009 berakhir.(a14)

Kapolsek Perbaungan Sita Miras Pedagang Pantai Kelang PERBAUNGAN(Waspada): Kapolsek Perbaungan AKP. Syahril SH melakukan penertiban minuman keras (miras) terhadap pedagang di Pantai Kelang yang berada di Desa Nagalawan, Kecamatan Perbaungan,Kabupaten Serdang Bedagai, Jumat (25/9). “Kepada para pedagang yang ada di objek wisata Pantai Kelang dan sekitarnya Kapolsek mengatakan agar tidak melakukan tindakan yang melanggar hukum seperti, bermain judi, menjual minuman keras dan sebagainya. Hal itu untuk menghindari terjadinya situasi yang tidak aman dan kondusif. “ jelas Syahril kepada pedagang yang berada di lokasi itu. Sebelumnya Polsek Perbaungan telah mengimbau para pedagang dan pengunjung agar tidak menjual dan meng-gunakan minuman keras. Hal itu untuk menciptakan situasi dan kondisi yang aman, nyaman dan kondusif mengingat lokasi itu merupakan objek wisata yang ramai dikunjungi turis domestik. (a07)

Selasa 29 September 2009

165 Kasus Judi Terjadi Di Wilayah Polres Asahan

Wakil Ketua DPRD Karo Adil Bangun Meninggal Dunia

LIMAPULUH (Waspada) : Mangasi Parsoruan Sitorus,25,warga Batam berpakaian Dinas Perhubungan, Senin (28/9) ditemukan tewas ditubruk kereta api di pintu lintasan kereta api tanpa palang Limapuluh - Simpang Dolok. Pagi itu korban dari tempat tinggalnya di Desa Pahang,Kec. Talawi bermaksud ke Limapuluh tempat bekerjanya di Dinas Perhubungan Pemkab Batubara. Sesampainya di perlintasan kereta api Limapuluh yang tanpa pintu, sebuah truk akan melintas di atas rel tapi sukarelawan diperlintasan itu berhasil menahannya. Tiba - tiba dari samping truk itu dua sepeda motor berusaha menerobos. Satu unit berhasil lolos, malang bagi korban yang mengendarai Honda Supra Fit BK 4550 QS, kereta api yang datang dari arah Tanjungbalai menuju Medan tanpa basa - basi menghantamnya, hingga sepeda motornya terseret sampai seratusan meter, sedangkan tubuh korban terlempar sejauh 50 meter hingga tewas di tempat . Warga setempat langsung mendatangi Tempat Kejadian Perkara (TKP) sementara itu petugas polantas pos Limapuluh langsung melakukan cek TKP dan mengevakuasi jenazah korban ke Puskesmas Limapuluh. Dinas Perhubungan Batubara melalui Plt Sekretaris Zainal Azhar kepada Waspada mengaku tidak mengenal korban. “Saya baru dua bulan di sini jadi tidak mengenal dia, kalau statusnya, bukan PNS dan bukan honorer, pos tugasnya juga tidak diketahui,” ujar Zainal. Menurut Zainal, korban telah mengkuti seleksi sebagai tenaga honorer tapi hingga saat ini belum ada yang benar-benar lulus menjadi tenaga honorer, meskipun seluruh pelamar saat ini sudah berpakaian seragam Dishub dan sudah bertugas di berbagai pos. (a31)

WASPADA

Waspada/Sapriadi

MEMERIKSA : Kapolres Asahan AKBP Rudy Sumardiyanto didampingi Waka Polres Kompol DH Ginting dan Kabag Binamita AKP Zulfikar sedang memeriksa 10 tersangka penjual minyak CPO tanpa izin intasi terkait, dan juga mengamankan 4 truk dan 3 drum serta 3 drum potong berisikan CPO. foto direkam Senin (28/9).

4 Truk Pengangkut CPO Diamankan Polres Asahan KISARAN (Waspada) : 4 truk berisikan minyak CPO diamankan Polres Asahan, di Kel Seiputih, tepatnya di Simpang Tanahmerah, Kec. Airputih, Kab Batubara, Senin (28/9) sekira pukul 02:30. 4 truk diamankan disebabkan tidak melengkapi surat jalan, dan 4 truk dengan no polat BK 988 US, BK 9835 LY, Bk 9166 TL dan B 8991 EJ serta menahan10 orang inisial RS, 25, (so-

pir) , AH (37) (sopir) warga Desa Penggalang, Kampung Pon Kab Serdang Bedagai, SY,41, (sopir) warga Desa Seirampah, serta AN,19, IS,35, Rusli,52, SS,42, JS,44, warga Desa Aras, Kec Air Putih, Kab. Batubara yang diduga kaki tangan penadah digiring ke Mapolres Asahan. “ 4 truk berisikan CPO kami tahan, dan semua tersangka sedang kami periksa,” ujar Kapolres Asahan AKBP Rudy Sumardiyanto didampingiWaka Polres Kompol DH Ginting dan Kabag Binamita AKP Zulfikar kepada sejumlah wartawan, Senin (28/9). Selain itu, ujar Kapolres, pihaknya mengamankan 3 drum

dan 3 drum potong berisikan CPO, dan menurut keterangan para tersangka minyak itu akan dijual kembali oleh penadah insial AZ. “ Sampai saat ini, kami masih melakukan pengembangan kasus, dan mengungkap siapa sebenarnya pemilik CPO dan akan dijual kemana,” ujar Kapolres. Kapolres juga menjelaskan, penangkapan ini berasal dari informasi warga sekitar, sehingga, aktivitas ini dapat digagalkan oleh Polres Asahan. “ Ini semua atas kerja sama antara masyarakat sekitar,” ujar Kapolres. (csap)

Truk Angkutan Kayu Rugikan Warga L.Batu RANTAUPRAPAT (Waspada): Aktivitas pengangkutan kayu gelondongan yang berasal dari kawasan hutan Kabupaten Padanglawas Utara (Paluta) menuju pelabuhan Tanjung Sarang Elang, Kecamatan Panai Hulu, Kab. Labuhanbatu diduga sebagai penyebab rusaknya jalan dan jembatan sepanjang jalan yang dilintasinya. Demikian siaran pers Direktur Eksekutif Lembaga Advokasi dan Kebijakan (Elsaka) Effendi Panjaitan yang diterima wartawan, Senin (28/9) setelah melakukan penelusuran atas jalur yang dilalui pengangkutan kayu itu. Menurutnya, ditengarai setiap harinya sebanyak 250 sampai 300 truk dengan muatan 25 ton melintasi jalan raya yang relatif sempit dan berdaya tahan rendah, khususnya jalan Aek Nabara (Kec. Bilah Hulu) - Negeri Lama (Kec. Bilah Hilir) – Ajamu (Kec. Panai Hulu). Jalan Lintas Sumatera sepanjang 60 km yang dibangun tahun 2008 dengan sumber dana dari APBN berbiaya Rp 120 milyar itu kini mulai rusak. Jembatan panjang yang terletak di Negeri Lama yang baru selesai dikerjakan 8 tahun lalu, harus diganti semua lantai dan besi-

nya. Demikian halnya dengan fisik jembatan di Desa Sei Mambang dan beberapa jembatan lainnya, juga mengalami hal yang sama. Padahal, masyarakat Negeri Lama dan Ajamu, telah lama merindukan dan menantikan infrastruktur jalan darat yang baik. Effendi menambahkan, kerusakan fisik jalan secara lambat laun akan berdampak pada roda perekonomian daerah tersebut khusunya warga sekitar. Hal ini sangat merugikan masyarakat setempat, Terutama para petani sawit yang akan menjual buah sawitnya ke pabrik. “Harga sawit petani akan anjlok, sebab cost transportasi yang tinggi dang turunnya rendemen minyak sawit akibat kelamaan di jalan yang rusak “ ujarnya. Ironisnya, tambah mantan DirekturWALHI Sumut ini, kondisi itu sudah berlangsung hampir 3 tahun. Namun, terindikasi pihak terkait sama sekali tidak peduli. Sepertinya pemerintah membiarkannya dan pura-pura tidak tahu,” kata dia. Beberapa kelompok masyarakat memang pernah mempersoalkanya. Tetapi, pi-

hak PT RAPP sepertinya tidak peduli dengan keluhan masyarakat. PT RAPP hanya memikirkan keuntungannya sendiri. Sebab, dengan menggunakan jalur ini jauh lebih efisien dan berisiko rendah jika dibandingkan melalui jalur PalutaKota Pinang via Bagan Batu sampai ke pabrik PT RAPP di Kerinci (Provinsi Riau). Dengan menggunakan rute jalur air dari Negeri Lama, ongkos transportasi lebih rendah. Karena jalan lebih sepi, kutipan liar dan kutipan resmi relatif sedikit karena pos-pos kutipan jalan raya juga sedikit yang dilalui dan juga jarak tempuhnya lebih pendek. “Tapi sebaliknya pihak PT RAPP tidak memperdulikan kerugian yang dialami oleh masyarakat,” tambahnya. Oleh karena itu, Pemprovsu harus menertibkan truk-truk pengangkut kayu balok (log) yang melintasi jalur itu. “Jikalau dibiarkan kerusakan jalan dan jembatan akan hancur yang tentunya akan menambah beban negara,” paparnya. Di lain pihak, dia meminta PT RAPP agar segera menghentikan aktivitasnya atau atau mencari jalan keluar agar masyarakat tidak dirugikan,” tandasnya. (a27)

Siswa SD Hadiahi Kejari Sidikalang Parsel “Obat Kuat” SIDIKALANG ( Waspada):Kejari (Kejaksaan Negeri) Sidikalang Kabupaten Dairi dihadiahi parsel berisi sejumlah obat kuat khusus pria. Penyerahan dilakukan dua siswa SD didampingi para teman sekolah mengenakan seragam diterima Dayan Rally Pasaribu, SH Kepala Seksi Peradilan dan TataUsahaNegaradipintumasuk kantor tersebut, Senin (29/9). Kemasan itu kemudian diletakkan di meja piket dan menjadi tontotan pegawai di sana . Masing-masing mereka mempelototi isi bungkusan indah itu. Roder Nababan SH Direktur Eksekutif LBH (Lembaga Bantuan Hukum) Sekolah selaku penanggung jawab delegasi mengatakan, langkah itu ditempuh guna memberi semangat kepada kejaksaan agar lebih gigih memberantas praktik korupsi khususnya yang membelenggu Dinas Pendidikan. Menurutnya, banyak dugaan penyelewengan keuangan negara tetapi tak kunjung diusut secara serius. Akibatnya, kebocoran anggaran tetap tinggi sedang beban orang tua tetap saja berat. Pendidikan gratis pun kian jauh dari realita. Dana APBN berupa DAK (Dana Alokasi Khusus) dan BOS (Bantuan Operasional Sekolah) yang dialokasikan pemerintah diduga disunat. Konsekwensinya, siswa tetap saja membeli buku bacaan. Kalaupun ada dibagi, totalitasnya masih jauh

dari angka global. Di sisi lain, Roder mengatakan, pemberian “ucapan terima kasih” dari kepala sekolah kepada pengelola dinas pendidikan bernilai Rp 100 ribu merupakan lingkaran setan yang mesti diputus. Tidak boleh terjadi praktik sedemikian dimana diyakini sumber keuangannya tetap saja dari kegiatan sekolah. Tanpa laporan pun korupsi harus diusut sebab kasus itu bukan delik aduan, karenanya dituntut nurani dan kejelian jaksa. Dayan Rally merespon positif kedatangan warga sebagai untuk memberi dorongan kepada penegak hukum. Kepada

wartawan, dia tidak bersedia memberi keterangan lebih lanjut mengingat dirinya adalah orang baru di institusi ini. Beberapa bulan lalu, Kajari Sidikalang, Saut Simanjuntak SH pernah mendampingi Gortap Marbun SH (kala itu Kejatisured) guna meninjau beberapa proyek didanai DAK. Namun, akhir pemeriksaan itu tampak kabur. Padahal, di beberapa SD di Kecamatan Sumbul dan Sidikalang , jaksa jelas-jelas telah mencatat poin-poin dugaan penyelewengan sesuai fakta lapangan. Tak heran, kepala sekolah pun gugup menghadapi cercaan juru periksa itu. (a28)

dan domino, dan selebihnya judi yang tidak menggunakan kartu” jelas Ginting. Oleh sebab itu, lanjut Ginting, Polres Asahan akan berusaha terus mengungkap kasus judi yang masih marak di wilayah hukumnya, dan tidak akan memandang siapa pelakunya. “ Semua akan kita sikat, siapa saja terlibat judi,” ujar Ginting. Ginting juga menambahkan, kenaikan kasus judi ini disebabkan, masyarakat masih tergiur dengan keuntungan yang bersifat sementara, dan tidak memikirkan akibat dari tindakan mereka itu. “ Dengan demikian, kami berharap masyarakat lebih cerdas dalam melakukan sesuatu, dan tidak terjebak dalam tindakan yang melanggar hukum, meskipun perekonomian kita sulit,” ungkap Ginting. (csap)

Pemancing Hilang Di Sungai Asahan Belum Ditemukan SIMPANGEMPAT,Asahan ( Waspada) : Pemancing yang hilang akibat perahu ditumpangi tenggelam di Sungai Asahan, Desa Sei Dua Hulu, Kecamatan Simpang Empat, belum ditemukan. Dan, sampai Senin (28/9) sore, Kapolsek Simpang Kawat Resort Asahan AKP Rudy Candra,SH bersama personelnya dibantu Tim SAR Kota Tanjungbalai dan Kepala Desa serta masyarakat setempat, masih mencari korban dengan menyisir sepanjang aliran Sungai Asahan. “ Belum ditemukan, kita bersama Tim SAR dan masyarakat serta keluarganya, masih menyisir aliran Sungai Asahan guna mencari keberadaan korban,” ujar Kapolsek Simpang Kawat kepada Waspada melalui saluran telefon. Sebelumnya, korban, Sugeng Irawan, 38, warga Jalan Malik Ibrahim, Kecamatan Kisaran Barat, Kabupaten Asahan, bersama rekannya

Deni, warga Jalan Kartini Kisaran, mengisi waktu luang dengan pergi memancing di Sungai Asahan, Desa Sei Dua Hulu. Setibanya di lokasi, keduanya meminta Mutiara Pamungkas, 12, warga setempat, mengantarkan ke seberang sungai dengan menggunakan perahu kecil. Permintaan itu sempat ditolak Mutiara, sebab perahunya hanya muat untuk satu penumpang. Akan tetapi, karena terus didesak, Mutiara bersedia mengantar Sugeng dan Deni. Dan, naas, ketika hendak sampai di tepi seberang sungai, perahu kecil itu oleng dan terbalik hingga akhirnya tenggelam. Mutiara dan Deni berhasil menyelamatkan diri, sedangkan Sugeng dinyatakan hilang dan sampai kemarin belum ditemukan. Kapolres Asahan melalui Kapolsek Simpang Kawat AKP Rudy Candra mengatakan, insiden ini terjadi akibat perahu over kapasitas. (a37)

Balita Gizi Buruk Di Asahan Dirawat TANJUNGBALAI (Waspada) : RSUD Tanjungbalai, kembali merawat balita asal Kabupaten Asahan yang mengidap gizi buruk, Senin (28/9). Pasien gizi buruk itu, Lilis Susanti, 3, warga Dusun Pematang Kandang, Desa Pematang Sei Baru, Kecamatan Tanjungbalai Asahan, Kabupaten Asahan. Berat badan anak perempuan itu hanya 5,7 kg, atau di bawah berat badan anak 3 tahun menurut standar Departemen Kesehatan. “ Tubuhnya sangat kurus, lemas dan wajahnya seperti orang tua. Idealnya, usia 3 tahun berat badan minimal 14 kg,” kata Direktur RSUD Tanjungbalai Diah Retno melalui Humas Cosmas Siagian. Selain itu, lanjut Siagian, kulit tubuhnya banyak yang terkelupas dan mengendur. “ Kondisinya cukup parah, sehingga harus dirawat intensif. Dan, sebelum dibawa ke rumah sakit, pasien ini demam selama 2 minggu,” tambah Siagian. Ibukorban,Sarifah,39,mengatakan,LilisSusanti merupakan anak ke 10 dari 11 bersaudara. Menurut

Sarifah, sejak lahir, kondisi anaknya tidak sehat. “ Sejak lahir sudah kelihatan dia kurang sehat, dan kulit tangannya yang terkelupas ini awalnya bintikbintik merah dan bengkak,” kata Sarifah. Humas RSUD Tanjungbalai Cosmas Siagian menambahkan, meskipun pasien ini warga Kabupaten Asahan, tapi pihak rumah sakit akan berupaya maksimal merawat dan mengobatinya hingga sembuh total. Penanganan terhadap korban, kata Siagian, akan diprioritaskan pada perbaikan gizi terlebih dahulu. Dan, lanjutnya, untuk mempercepat pemulihan Lilis Suryani, pihaknya akan memberikan makanan tambahan pengganti ASI dan vitamin lainnya, termasuk mineral mix. “ Kami belum bisa memastikan penyebab gizi buruk anak itu. Gizi buruk bisa akibat anak tidak diberi asupan gizi yang cukup, dan bisa juga dampak mengidap penyakit yang membuat anak enggan makan. Mudah-mudahanlah anak ini bakal sembuh total, karena kita berupa maksimal memulihkan kondisinya,” kata Siagian. (a37)

Ratusan Personel Polresta Tanjungbalai Amankan Pelantikan Wakil Rakyat TANJUNGBALAI (Waspada) : Sedikitnya 153 personel dari jajaran Polresta Tanjungbalai, akan mengamankan pelantikan anggota DPRD setempat di gedung dewan, Selasa (29/9). Ratusan personel itu, terdiri dari 11 Satuan Reskrim, 10 Satuan Intelkam, 5 Satuan Narkoba, 34 Satuan Samapta, 8 Satuan Pol Air, 15 Satuan Lantas, 5 Satuan P3D dan 40 personel lainnya berasal dari 5 Polsekta di wilayah Polres Tanjungbalai. Demikian Kapolres Tanjungbalai AKBP Mestron Siboro melalui Perwira Humas AKP Lukman Sirait kepada Waspada Senin (28/9). “ Kami sudah mengecek langsung persiapan personel dalam mengamankan pelantikan anggota DPRD besok, dan kordinatornya juga sudah diangkat, yakni

Kompol Agustinus Tarigan dan penanggung jawab AKP Jon Rinaldi Purba serta penanggung jawab terbuka Kasat Samapta AKP Zul Efendi,” kata Sirait. Unjuk Rasa Perwira Humas AKP Lukman Sirait juga menambahkan, diperkirakan pelantikan anggota DPRD Tanjungbalai akan diwarnai unjuk rasa puluhan mahasiswa. “ Surat pemberitahuannya sudah disampaikan mereka ke Polres Tanjungbalai,” ujar Sirait. Dijelaskan Sirait, dalam surat pemberitahuan itu, saat aksi nanti mahasiswa akan meminta dan mendesak wakil rakyat Tanjungbalai yang telah dilantik untuk menandatangani kontrak politik 5 tahun ke depan. (a37)

Polresta Tanjungbalai Akan Tuntaskan Kasus Penganiayaan Wartawan TANJUNGBALAI (Waspada) : Kapolres Tanjungbalai AKBP Mestron Siboro menegaskan, akan menuntaskan kasus penganiayaan yang diduga dilakukan oknum wakil rakyat terhadap salah satu wartawan media cetak di kota itu. “ Kami akan tetap memproses masalah ini sampai ke Kejaksaan,” tegas Kapolres melalui Perwira Humas AKP Lukman Sirait kepada Waspada, Senin (28/9). PenganiayaanituterjadiseusaiparipurnaDPRD Tanjungbalai, Rabu (16/9) lalu. Korban, Syamsul Darma Sirait, mendapat pukulan dari oknum anggota DPRD itu di bagian wajah seba-nyak 3 kali, hingga tersungkur. Tidak itu saja, meskipun sudah tak berdaya, korban masih terus diburu dan wajahnya ditendang oleh wakil rakyat berasal dari partai berlambang Banteng tersebut. Akibat pemukulan itu, korban mengalami luka di bibir, dan bagian wajah lainnya, serta luka memar di bagian kaki kiri. Selain itu, menurut korban, dia mengalami rasa sakit di bagian rahang, kepala pusing dan trauma. Siraitmelanjutkan,dalamperkarapenganiayaan itu, pihak penyidik telah memanggil saksi-saksi antara lain Syamsul Darma Sirait. Selain itu, tambah Sirait, surat pemanggilan kepada saksi Abdi Nusa selaku Sekretaris DPRD Tanjungbalai juga telah dilayangkan. “ Proses penyidikan ini sedikit terhambat karena pemanggilansaksilainnyayakniparaanggotaDPRD

Tanjungbalai Safaruddin,Tedy Erwin dan tersangka BudiMulia,masihmenungguizintertulisdariGubsu untuk dilakukan pemeriksaan. Surat permintaan itu telah dikirimkan ke Gubsuj melalui Dir Reskrim Polda Sumut,” jelas Sirait. Sebelumnya, selain organisasi jurnalis, sejumlah Lembaga Swadaya Masyarakat juga mendesak jajaranKepolisianmenangkapdanmenahanoknum anggota DPRD Tanjungbalai yang diduga menganiaya wartawan. Pernyataan itu ditegaskan pimpinan LSM Independen Solidaritas Anak Negeri (Insani) Ahmad Efendi Sibarani dan LSM Sumatera Goverment Wacht Zulham Effendi kepada Waspada, Minggu (27/9). Kedua pimpinan LSM itu, juga telah melayangkan surat perihal pengusutan dan penahanan oknum anggota DPRD Tanjungbalai,BM, kepada Kapolda Sumut dan Kapolres Tanjungbalai. “ Kami melayangkan surat ke Kapolda Sumut yang intinya meminta agar kasus penganiayan itu diusut dan pelakunya ditahan, mengingat sampai saat ini diduga belum ada proses hukum terhadap pelakunya,” kata Zulham Efendi. Hal sama dikatakan Ahmad Efendi Sibarani. Menurutnya, sampai saat ini, dia melihat oknum anggota DPRD dari partai berlambang Banteng itu, masih berkeliaran,padahalpenyidiktelahmemilikibuktipermulaan yangcukup,yaknilaporankorbanditambahdengansalahsatu BeritaAcaraPemeriksaandanhasilvisumRSUDTanjungbalai. (a37)

Mahasiswa Padanglawas Datangi Kantor Bupati

Waspada/ Natar Manalu

KORUPSI PENDIDIKAN: Beberapa siswa SD sedang berdiri di depan gedung Kejari Sidikalang Kabupaten Dairi sembari menggantungan aspirasi, menuntut penuntasan dugaan korupsi anggaran pendidikan, Senin (29/9).

SIBUHUAN ( Waspada): Sebanyak 20 mahasiswa mengatasnamakan petisi peru-bahan Front Perjuangan Mahasiswa (FPM) Padanglawas, Senin (28/9), mendatangi kantor bupati setempat. Dalam orasi, pimpinan aksi Ansor Harahap menyatakan mereka menolak kepemimpinan statis dan tanpa visi. Dalam selebaran subpetisi yang dibagikan kepada warga, mereka membacakan prioritaskan perbaikan infrastruktur (jalan listrik), peningkatan pendapatan rakyat, hentikan illegal logging di Desa Sayur Matua Kec.Barumun, Batang Lubu Sutam, Desa Pagaran Bira, Kec.Sosopan), pendidikan dan kesehatan yang murah serta agar pemda segera merealisasikan perda tata ruang yang strategis dan visioner.

Kemudian meminta agar pemda menindak tegas perusahaan yang tidak peduli dan patuh CSR (corporate social responsibility), menuntut transparansi pengangkatan honor daerah. Mereka menuding APBD 2009 banyak melang-gar undangundang pengelolaan keuangan daerah. Meminta bupati agar profesional dan sesuai dengan mekanisme baperjakat dalam melakukan mutasi. Orasi yang disertai dengan penunjukan poster dan spanduk di antaranya bertuliskan guru yang menduduki jabatan struktural dikembalikan, berakhir setelah Bupati Padanglawas Basyrah Lubis menerima para mahasiswa. Dalam pertemuan tersebut, bupati menyatakan siap dikritik sebagai bahan masukan untuk mengevaluasi kinerja pemerintahan. (crif)


Sumatera Utara

WASPADA Selasa 29 September 2009

Waspada/Hasuna Damanik

SIAP MAJU KEMBALI: HT Zulkarnain Damanik saat menyampaikan pernyataan kesiapan untuk maju kembali menjadi Bupati Simalungun periode 2010-2015 dihadapan para pengurus ormas Islam dan ribuan warga pada acara halal bi halal Idul Fitri 1430 H di lapangan stadion Radjamin Purba, jalan Sang Naualuh Damanik, Senin (28/9). (Waspada/Hasuna Damanik)

HT Zulkarnain Damanik Nyatakan Siap Maju Pilkada 2010 SIMALUNGUN (Waspada): Bupati Simalungun, HT Zulkarnain Damanik, menyatakan siap maju kembali pada pemilihan kepala daerah (bupati) Simalungun periode 2010-2015. Pernyataan itu langsung dikemukakan HT Zulkarnain Damanik, dihadapan ribuan umat Islam dan masyarakat Kab. Simalungun pada acara halal bi halal antara Pemkab, Muspida, ormas Islam, OKP dan masyakat yang digelar, Senin (28/9), di Stadion Radjamin Purba Jalan Sang Naualuh Damanik, Kec. Siantar. Dikatakan, kesiapannya untuk maju kembali menjadi Bupati Simalungun untuk kedua kalinya sebagai menyahuti harapan dan keinginan masyarakat. “ Berkat semangat dan dan dukungan umat, saya berjanji untuk bekerja sekuat tenaga. Insya Allah saya akan maju untuk melanjutkan pembangunan di ‘tanoh habonaron do bona’ bersama-sama masyarakat,” tegas Zulkarnain

Damanik. Setelah menyampaikan pernyataan kesiapannya untuk maju kembali, HT Zulkarnain Damanik, juga menyampaikan permohonan maafnya kepada seluruh masyarakat Kab Simalungun, dimana selama 4 tahun memimpin pasti banyak yang belum dapat dilaksanakan disamping keberhasilan yang telah dicapai. Dia berjanji pada harihari mendatang akan lebih bekerja keras bersama seluruh staf agar seluruh program yang telah direncanakan dapat terwujudsebagaimanadiharap-kan. Dukungan Sebelumnya, sejumlah pengurus Organisasi Kemasyarakatan (Ormas) Islam Kab. Simalungun dipandu Drs Ki Dardjat Purba, Sanusi Damanik, H Rivai Damanik, Hj Siti Aminah, Wahyudi Hardianto dan Syirwan Hazli Nasution mendeklarasikan dukungan kepada HT Zulkarnain Damanik untuk dicalonkan kembali menjadi bupati Simalungun periode 2010-

2015. Dalam pernyataan itu dijelaskan bahwa dukungan itu diberikan karena HT Zulkarnain Damanik memiliki komitmen mengembangkan dan membangun daerah Simalungun kearah yang lebih baik. Kemudian, Zulkarnain juga dinilai berhasil menyelenggarakan pemerintahan dan ini telah teruji pada periode 2009-2010. “ HT Zulkarnain Damanik memiliki kompetensi kepemimpinan, memiliki jiwa kepemimpinan yang dapat dijadikan suri tauladan bagi segenap masyarakat Kabupaten Simalungun,” tegas Ki Dardjat Purba saat membacakan isi pernyataan dukungan. Selain itu, lanjutnya lagi, HT Zulkarnain Damanik juga dinilai telah berhasil mewujudkan masyarakat Kab. Simalungun yang berpengetahuan dan berpendidikan di samping keberhasilan dalam meningkatkan produksi dan kualitas pertanian di daeranya. Kemudian, keber-

Penyerahan Sertifikat Warnai Peringatan HAN Di BPN Simalungun PE M ATA N G S I A N TA R (Waspada): Penyerahan sertifikat Program Nasional (Prona) dan Wakaf tahun 2009 kepada para pemohon dari beberapa desa mewarnai peringatan Hari Agraria Nasional (HAN) ke-49 yang berlangsung secara sederhana di Kantor BPN Kabupaten Simalungun, Senin (28/9). “Sertifikat tanah masyarakat tidak hanya sekedar sertifikat, tapi diharapkan bisa sebagai modal guna meningkatkan pendapatan dan kesejahteraan masyarakat,” sebut Kakan BPN Simalungun Henri P Sibarani didampingi Kasi Hak Tanah dan Pendaftaran Tanah Paulus Damanik dan Kasi Pengendalian Yandi Kusuma di ruang kerja Kakan BPN usai peringatan HAN di halaman Kantor BPN setempat, Senin (28/9). Bertindak sebagai Pembina Upacara Kakan BPN dan Komandan Upacara Dj. Situmorang saat peringatan yang dihadiri Bupati Simalungun Drs HT

Zulkarnaen Damanik, MM diwakili Asisten I Drs Oberlin Hutagaol, mewakili Kakan Depag, Notaris/PPAT Esterdina Sinaga, SH dan Irvo Melika Lum-bantobing, SH, para penerima sertifikat, para Kasi, Kasubsi dan pegawai BPN serta ibu-ibu Dharma Wanita. Peringatan diisi dengan pembacaan Pancasila dilakukan Kakan BPN, pembacaan Pembukaan UUD 1945 dan Panca Prasetya Korpri dilakukan dua pegawai, pembacaan sambutan Kepala BPN RI Joyo Winoto, PhD dilakukan Kakan BPN, penyerahan sertifikat secara simbolis dan ditutup dengan doa. Peringatan turut diisi ramah tamah dan makan bersama keluarga besar BPN Simalungun dan penerima sertifikat. Paulus Damanik menyebutkan sertifikat Prona yang diserahkan sebanyak 15 sertifikat masing-masing kepada lima orang warga dari Nagori Perdagangan II, Kecamatan Bandar,

BSMS Santuni Anak Yatim Piatu SERBELAWAN (Waspada): Sekelompok orang muda yang bergabung dalam Badan Sosial Masyarakat Serbelawan (BSMS) Kelurahan Serbelawan, Kecamatan Dolok Batunanggar, Kabupaten Simalungun berbagi kebahagiaan dengan yatim piatu. Pelaksanaan acara santunan itu diberikan usai shalat Idul Fitri 1430 H, Minggu (20/9) pagi. Sekretaris BSMS, Maharuddin Saragih kepada Waspada menyatakan, kegiatan telah terprogram sejak berdiri tahun 1973. Pengurus BSMS selalu didatangi para donatur yang untuk berinfak. Lebaran itu saja terkumpul 90 orang putra-putri yang diberikan santunan kepada mereka paket amplop berisi uang tunai sekitar Rp 40.000 per orang. (c03)

Pengunjung Kawasan Wisata Padat SIMALUNGUN (Waspada): Perayaan Idul Fitri 1430 H tahun ini, kawasan wisata Hutan Taman Monyet Bahlonggur dan kolam renang Bahapal Nagori Nagajaya Kecamatan Bandar Huluan, Kabupaten Simalungun, ramai dikunjungi. Pantauan Waspada, Senin (21/9) walaupun Hutan Taman Monyet Bahlonggur yang terletak di komplek mesin pompa air PTPN 4 unit Kebun Laras Nagori Nagajaya I, jalannya penuh lubang, namun para pengunjung tak mempedulikannya. Menurut Salimin, 30, pengunjung asal Desa Gondang Rejo, kehadiran di sana khusus melihat anak-anaknya bermain dengan monyet Bahlonggur (HTMB). (c03)

Kamtibmas Polsek Serbelawan Terkendali SERBELAWAN ( Waspada): Keamanan dan ketertiban Masyarakat (Kamtibamas) di jajaran Kepolisian Sektor Serbalawan Kecamatan Dolok Batu Nanggar aman terkendali hingga Rabu (23/9). Kapolres Simalungun AKBP Rudi Hartono melalui Kapolsek Serbelawan AKP Edison Siagian yang dikonfirmasi mengakui suasana lebaran aman terkendali. (c03)

lima warga Nagori Naga Jaya I dan lima warga Nagori Sidotani, Kecamatan Dolok Batunanggar. Sedang sertifikat Wakaf, lanjut Damanik, diserahkan sebanyak 19 sertifikat dan tersebar di beberapa nagori/kelurahan. Menjawab pertanyaan, Kakan BPN yang baru dua bulan pindah dari Kantor BPN Bandung ke Simalungun itu menyebutkan kuota sertifikat Prona tahun 2009 di Simalungun mengalami peningkatan kuota dari 560 bidang tahun 2008 menjadi 1.000 bidang dan sudah terealisasi atau diterbitkan sertifikatnya sebanyak 143 sertifikat serta sebagian besar lagi sudah masuk permohonannya dan masih dalam proses penserti-fikatannya. “Pada Desember 2009 seluruhnya akan diterbitkan.” Sedang kuota sertifikat Program Pembaharuan Agraria Nasional (PPAN), lanjut Kakan BPN, mengalami penyesuaian dari 6.100 bidang tahun 2008 menjadi 4.500 bidang tahun 2009 serta sampai saat ini seluruhnya masih dalam proses dan akan dituntaskan sebelum akhir tahun 2009. “Sertifikat PPAN itu khususnya bagi tanah pertanian dan diharapkan para petani kelak dapat memanfaatkan sertifikat itu menambah modal dan meningkatkan kesejahteraan mereka.” Mengenai permohonan sertifikat rutin yang diterbitkan Kantor BPN itu, menurut Paulus Damanik, rata-rata 500 bidang setiap tahunnya, sedang tanah bersertifikat di Simalungun sesuai data yang ada masih mencapai 40 persen. “Inilah yang dikejar agar status tanah bisa menjadi akses permodalan.” Kakan BPN menyebutkan salah satu cara yang ditempuh BPN saat ini secara nasional meningkatkan pelayanan kepada masyarakat itu dengan sistem jemput bola melalui Larasita (Kantor BPN bergerak). “Para petugas BPN akan turun ke desa-desa melakukan sosialisasi dan melaksanakan proses pensertifikatan hingga sertifikat diterbitkan serta diserahkan langsung kepada masyarakat tanpa harus datang ke Kantor BPN.” Desa/kelurahan sasaran Larasita tahun 2009, lanjut Kakan BPN, terdiri Nagori Silau Malela, Nagori Silulu, Nagori Dolok Malela dan Bandar Malela, Kecamatan Gunung Maligas.(a14)

hasilan HT Zulkarnain Damanik membangun silaturrahmi sebagai media komunikasi untuk mempererat dan mempersatukan umat sehingga situasi dan kondisi ketertiban dan keamanan di Kab. Simalungun tetap dalam keadaan kondusif. Sementara, acara halal bi halal berlangsung meriah, dihadiri ribuan umat Islam dan masyarakat Kab.Simalungun. Tampil sebagai mubaligh Ustadz Jefri Al Bukhori dari Jakarta. Ustadz Jefri dalam tausyiahnya menyampaikan agar umat Islam di Kab. Simalungun dapat mengaplikasikan kegiatan dan amalan selama bulan Ramadhan dalam kehidupan seharihari. Dia juga mengharapkan agar umat tetap bersatu, menjaga hati agar terhindar dari hawa nafsu yang tidak terkontrol. Sebelumnya, ketua panitia H Evra Sassky Damanik, S.Sos, melaporkan kegiatan halal bi halal diikuti warga dari 31 kecamatan se-Kab Simalungun. Halal bi halal diselenggarakan masyarakat, pemerintah, ormas dan OKP bertujuan menjalin silaturahmi dan sekaligus sebagai merayakan Idul Fitri 1430 H. (a15)

19


Sumatera Utara

20

WASPADA Selasa 29 September 2009

Bupati Madina: Curah Hujan Dan Kemiringan Wilayah Penyebab Utama Banjir MEDAN (Waspada): Banjir bandang dan longsor yang terjadi Kecamatan Muara Batanggadis pada 5 September lalu disebabkan curah hujan dan kemiringan yang berada di wilayah itu. Demikian diungkapkan Bupati Mandailing Natal, H Amru Daulay kepada Waspada di Medan kemarin. ‘’Jadi sebenarnya yang terjadi di banjir bandang 5 September yang lalu itu adanya curah hujan yang tinggi yang terjadi tiga hari tiga malam di daerah Taman Nasional Batanggadis dan berbatasan dengan kawasan eks lahan HPH PT Aek Gadis Timber. Aek Gadis Timber iniadalahHPHyangsudahdicabut pemerintah kira-kira 12 tahun,’’ ungkap Amru Daulay (foto). Berdasarkan pemantauan dari udara dapat disaksikan penyebab banjir ini akibat timbunan-timbunan potongan kayu gelondongan di hulu sungai perbatasanTapanuli Selatan dan Mandailing Natal yang merupakan peninggalan HPH PT Aek Gadis Timber dengan luas lebih kurang 90.000 ha. Sebagian lokasinya berada di Tapanuli Selatandansebagianlainnyaberada di Kabupaten Mandailing Natal. Selain itu juga, Amru menyebutkan kondisi struktur tanah yang ada di Taman Nasional ada bagian konstruksi tanah yang rapuh. Akibat dari konstruksi tanah yang kemiringannya sangat curam dan ditambah dengan ketinggian 1.300 meter di atas permukaan laut padahal desa yang di bawah ini 4 desa lainya itu seperti Rantau Panjang

dan lainnya itu itu ketinggiannya hanya 40 meter dari permukaan laut. Jadi karena hujan yang terus menerus membuat pohon-pohon yang berada di kemiringan tercabut dan kemudian terbawa di aliran sungai ‘’Tingkat kemiringan sekira 80 sampai 90 derajat. Ada pohon tapi sudah tidak kuat lagi, akarnya sudah lemah, jadi kalau curah hujan tinggi terus hal ini akan terjadi lagi. Jadi sekarang penduduk yang kita ungsikan yang ada 2000 KK lebih itu harus kita pindah ke daerah yang tinggi. Saya sudah minta kepada dinas PU untuk mengukur berapa ketinggian dari sungai karena semalam itu sungai meluap sampai 4 meter jadi harus dicari yang lebih tinggi,’’ urainya. Sebelumnya Gubsu Syamsul Arifin, SE yakin, banjir bandang yang terjadi di Labupaten Madina akibat adanya illegal logging (pembalakan liar) dan pengalihfungsian hutan menjadi perkebunan. Hal itu dikatakan Gubsu kepada wartawan usai melakukan

silaturahmi dengan pejabat di lingkungan Pemprovsu, Jumat (25/9) di rumah dinas Gubernur, Jalan Sudirman, Medan. Untuk menyelidiki hal itu kata Gubsu, pihaknya sudah berkoordinasi dengan Kepolisian Daerah Sumutera Utara dan meminta Pemkab Madina melakukan koordinasi kepada Pemprovsu. “Kita sama-sama tahu, bajir bandang yang terjadi beberapa waktu lalu di Madina membawa banyak balok-balok kayu. Balokbalok tersebut kemungkinan adalah hasil pembalakan liar yang belum terangkut,” ujar Gubsu kala itu. Menurut Amru Daulay lagi, Menteri Kehutanan MS Kaban sudah mengitari kawasan banjir bandang dan menyatakan tidak ada illegal logging di sana. Bahkan menteri memuji sikap yang diambil Pemkab Madina terkait keberadaan Taman Hutan Nasional Muara Batanggadis. ‘’Jadi pohon yang disitu (hutan) tidak ada yang ada ikut dengan akarnya kalaupun ada satu, dua yang berasal dari Aek Simber itu yang sudah puluhan tahun yang masuk kepada 3 sungai di bawah yaitu Sungai Batang Gadis, sungai Gapak dan Sugai Palampungan, jadi ketiga sungai ini masuk ke Desa Rantau Panjang dan lainnya dengan curah hujan yang tinggi sampai banjir bandang. Jadi setelah ini terjadi kala kita lihat yang longsor itu bukan satu titik tapi ratusan titik bahkan ribuan titik itu memang kondisi alam jadi kalau yang di bilang di sana ada illegal

Waspada/Sukri Falah Harahap

KONDISI DESA: Ribuan batang kayu yang hanyut dibawa banjir bandang dari Sungai Lubuk Siapar berserakan di Desa Lubuk Siapar pasca banjir. Foto direkam, Rabu (23/9).

logging itu tidak mungkin, cuma dari kelongsoran itu, ini akan

terulang,’’ tegasnya. Terkait waktu rekonstruksi,

Bupati Madina itu menyebutkan mungkin makan waktu 6 bulan.’’

Kalau tempat sudah kita dapatkan, maka akan segera dilaksa-

nakan,’’ demikian Amru Daulay. (m10)


Sumatera Utara

WASPADA Selasa 29 September 2009

Pimpinan SKPD Dan PNS Diingatkan Netral Hadapi Pilkada MEDAN (Waspada): Lembaga Independen Pemantau Pilkada Kabupaten Mandailing Natal (Madina) meminta para pimpinan SKPD dan pegawai negeri sipil (PNS) di kabupaten itu bersikap netral menghadapi pilkada yang akan digelar tahun 2010 mendatang. Pasalnya, Lembaga pemantau Pilkada Madina yang dibentuk Forum Kajian Pembangunan (FKP) Madina mendapatkan banyak informasi, adanya upaya dari pimpinan SKPD di Madina menggiring PNS untuk mendukung salah satu kandidat bupati Madina. “Ini tentu sangat buruk bagi perkembangan demokrasi di

Madina. Tidak zamannya lagi giring-menggiring. PNS harus netral menghadapi Pilkada Madina,” kata Ketua FKP Madina, Yusuf Hasibuan kepada wartawan di Medan, Senin (28/9). Yusuf yang merupakan putra Madina menjelaskan, sesuai PP No 30 tahun 1980 bahwa PNS diwajibkan untuk bersikap netral. Dia juga mengatakan jika ada PNS di Madina yang ikut-ikutan menjadi pendukung salah satu kandidat bupati Madina, hal itu sudah merendahkan harkat dan martabat PNS. “Inibukansajamelanggaraturantapijugamelecehkannetralitas PNS. Kita memperingatkan ini dengan serius,” kataYusuf lagi.

Ketika ditanya SKPD mana saja yang sudah dilaporkan melakukan penggalangan untuk mendukung kandidat bupati Madina, Yusuf enggan menyebutkannya. Menurutnya, laporan dari masyarakat Madina yang dikirim ke kantor FKP Madina di Medan sudah ditelusuri kebenarannya. “Kitasudahmengirimkantim ke Madina untuk mengecek kebenaran hal itu. Makanya kita memberikan semacam warning bagimereka.Kitainginmerekatak meneruskannya,”tukasYusuflagi. Sementara itu pengamat ko-munikasi politik dari Universitas Negeri Medan (Unimed) Aulia Andri menambahkan kon-

disi politik di Madina kini semakin menghangat jelang pilkada. Dikatakan Aulia, semua pihak disana harus tetap tenang hingga pencalonan bakal calon bupati Madina dilaksanakan KPU. “Kita pahami bahwa kondisinya memanas. Ini memang menarik, jika dibanding dengan kabupaten atau kota yang juga akan menggelar pilkada, Madina sangat unik. Kondisi politik disana sangat dinamis. Ini patut diapresiasi,” kata Aulia. Lebih lanjut Aulia mengharapkan “politik birokrat” dengan cara-cara menggiring dukungan dari PNS harus segera ditinggalkan. Menurutnya selain melanggar aturan, politik ma-

cam itu juga sangat tidak mempunyai etika.

“Kita tentu tak boleh menuduh. Tapi ini pasti bisa dirasa-

21 kan. Makanya kita ingin suasananya tenang dulu. Politik pijak

kaki tentu harus ditinggalkan,” kata Aulia lagi. (m10)


Aceh 22

B. Aceh, Sigli, Bireuen, Lhokseumawe

PLN Wilayah NAD Segera Putuskan Jaringan Penunggak LHOKSEUMAWE (WAaspada): Tunggakan listrik di seluruh ranting dan Rayon PLN di Nanggroe Aceh Darussalam (NAD) senilai Rp152,9 miliar, memaksa perusahaan milik pemerintah ini menurunkan tim untuk memutuskan jaringan pelanggan yang bermasalah. Koordinator Forum Komunikasi Manajemen Ranting (FKMR) PLN NAD, Ali Basyah Ibrahim kepada Waspada, Senin (28/9) menjelaskan, jaringan yang akan diputukan pada pelanggan yang menunggak sampai 12 bulan. “Pemutusan akan dilakukan serentak di seluruh Aceh mulai 1 Oktober 2009,” tegasnya seraya menambahkan, tindakan ini untuk menekan tunggakan rekening listrik di Wilayah Aceh yang hingga Agustus 2009 senilai Rp152,9 miliar. Ali Basyah yang juga Manajer PLN Rayon Kota Lokseumawe menjelaskan, tungkanan listrik di Kantor Cabang Banda Aceh Rp69,5 miliar, Lhokseumawe Rp20,4 miliar, Langsa Rp28,5 miliar, Meulaboh Rp18,4 miliar, Cabang Subussalam Rp4,4 miliar, Cabang Sigli Rp10,5 miliar, dan Kantor Wilayah 902,9 miliar. Untuk menagih tunggakan yang dapat menurunkan pelayanan perusahaan ini, 4 manejer rayon bersama 30 manajer ranting dan 4 kepala PLTD yang tergabung dalam FKMR PLN-NAD sepakat menurunkan tim pemutusan secara serentak. Ketua FKMR bersama wakilnya, Yusbainur menjelaskan pelanggan yang menunggak dua hingga tiga bulan akan dilakukan pemutusan sementara. Sedangkan yang menunggak empat bulan keatas akan dibongkar KWH meter. “Tim juga akan memutuskan terhadap seluruh pemakai arus secara liar. Ini untuk menekan losis atau lehilangan arus yang saat ini mencapai 15 persen,” tambahnya.(b17)

Jalan Arongan Rusak Parah BIREUEN (Waspada): Akibat tidak ada perawatan dan setiap tahunnya digenangi luapan banjir bandang, kondisi jalan kabupaten sepanjang 5,7 kilometer mulai dari simpang lapangan bola kaki Desa Sangso dan Meulik Kecamatan Samalanga, hingga ke Meunasah Mesjid, Kecamatan Simpang Mamplam, kondisinya sejak beberapa tahun terakhir sudah rusak parah. Informasi yang Waspada Minggu (27/9), menyebutkan, selain menjadi salah satu jalur alternatif hubungan antar dua kecamatan. Setiap hari jalan itu menjadi salah satu jalur transportasi berbagai geliat ekonomi masyarakat dan para santri di Dayah Arongan. Masyarakat berharap kepada Pemkab Bireuen melalui dinas terkait dapat segera memperbaiki kembali kerusakan badan jalan yang menghubungkan sembilan desa di dua kecamatan wilayah barat kota Bireuen tersebut. “Badan jalan rusak parah karena nyaris setiap tahunnya sering digenangi luapan banjir, bahkan kondisi satu unit jembatan di ruas jalan Desa Arongan juga telah rusak,” ujar Camat Samalanga Darwansyah, ketika ditemui wartawan, Minggu (27/9) di Desa Arongan. Menurutnya, usulan perbaikan ruas jalan menghubungkan dua kecamatan tersebut telah pernah diajukan ke kabupaten tetapi belum terealisasi sampai sekarang.(b03)

Ketua DPRK Minta Kasus Kas Aceh Utara Diselesaikan ACEH UTARA (Waspada): Ridwan M. Yunus, Ketua Dewan Perwakilan Rakyat Kabupaten (DPRK) Aceh Utara Sementara saat dihubungi Waspada, Minggu (27/9) via telepon menyebutkan, kasus bobolnya kas Pemda Aceh Utara harus diselesaikan dengan baik, agar masyarakat tidak dirugikan. “Ya, kita minta pihak berwenang menyelesaikan kasus bobolnya deposito Aceh Utara sebagaimana baiknya,” ucap Ridwan M. Yunus. Untuk masuk ke persoalan itu, sebut Ridwan, pihaknya mengaku belum begitu mengerti, karena jangankan tentang persoalan tersebut, jumlah kamar yang ada di gedung DPRK saja belum diketahuinya. “Kami masih baru, dan butuh waktu untuk mendalami persoalan itu. Yang pasti, kasus tersebut harus diselesaikan dengan baik, dan kami sebagai anggota dewan berpihak kepada rakyat, bukan kepada yang lainnya.” Disebutkan, hingga kini pihaknya di DPRK Aceh Utara baru berhasil membentuk fraksi-fraksi, belum berhasil membentuk komisi. Begitu pun dalam waktu dekat semua itu akan terwujud sesuai harapan.(cmun)

Selasa 29 September 2009

Aceh Utara Harus Contoh Idi Dan Bener Meriah

Pembawa Kabur L 300 Diringkus BIREUEN (Waspada): Setelah sempat buron selama 12 hari pasca melarikan satu unit mobil jenis pick up L300 milik A Hadi H M Saleh, 32, warga Kota Bireuen, Minggu (13/9) lalu saat diparkir di depan Toko Besi Mulia Sari, di jalan Ramai Kota Bireuen. Af, 24, pemuda mengantongi KTP Batuphat, Lhokseumawe, berhasil ditangkap berkat kerjasama Polres Bireuen dan Polres Pidie, Jumat (25/9) siang di Kabupaten Pidie, saat tersangka hendak menjual kendaraan hasil jarahan itu. Demikian Kapolres Bireuen AKBP T Saladin SH melalui Kapolsek Jeumpa, Iptu Shaiful Anam kepada wartawan, Minggu (27/9). Pelaku pencurian mobil itu berjumlah tiga orang, dua lainnya berhasil kabur ketika ditangkap, sedangkan tersangka Af berhasil diringkus. “Tersangka diamankan di Polsek Jeumpa untuk pengusutan lebih lanjut,” jelas Iptu Shaiful Anam, STP. Sebagaimana dikabarkan sebelumnya, Mobil L300 Pikup Minggu (13/9) usai shalat subuh, satu unit pick up L-300 Mitsubishi BK 8661 BR milik A Hadi H M Saleh, 32, warga Kota Bireuen, diparkir di depan toko bahan bangunan Mulia Sari digondol maling. Mobil dengan nomor rangka MHML 300 DP5R329814, dengan nomor mesin 4D56C-A46466 diketahui hilang ketika pemilik toko bangunan itu pada pagi harinya. Korban mengalami kerugian senilai Rp70 juta. Berdasarkan hasil pemeriksaan, dari pengakuan sementara, saat melakukan pencurian mobil menjelang shalat subuh itu, pelaku berjumlah tiga orang. Setelah mendapat laporan dari pemilik kendaraan, Polsek Jeumpa melakukan pengembangan termasuk kerjasama dengan Polres lain. “Tersangka berhasil ditangkap sekitar 12 hari pasca kejadian, di wilayah hukum Polres Pidie,” terang Kapolsek Jeumpa. (b03)

WASPADA

Waspada/Muhammad Riza

RAZIA: Akhir-akhir ini Jajaran Satuan Polisi Pamong Praja (Satpol PP) dan Wilayatul Hisbah (WH) Kab. Pidie, makin memperketat melakukan razia busana muslim dan pasangan non muhrim di objek wisata lokal daerah itu. Tampak salah seorang petugas WH sedang memberi bimbingan kepada wanita muda yang terjaring razia di jalan-jalan, Senin (28/9).

95% Pasangan Khalwat Mengaku Berzina SIGLI (Waspada): Selama tahun 2009 terjadi 104 kasus khalwat di Pidie. Sebanyak 95 persen diantaranya, pasangan non muhrim itu kepada petugas mengaku telah melakukan hubungan badan (berzina-red). “Selama tahun 2009 saja kita sudah berhasil menjaring 104 pasangan non muhrim yang ketangkap tangan melakukan khalwat. 95 diantaranya saat kita periksa mereka mengaku sudah melakukan hubungan badan,” kata Kasat Pol PP dan WH Kab. Pidie Sabaruddin, SH, kepada Waspada, di ruang kerjanya, Senin (28/9). Menurut dia, semua pelaku tidak dirajam cambuk, tetapi mereka umumnya dinikahkan dan sebagian dilepaskan. Karena diantara mereka ada yang masih berstatus istri dan suami orang lain (pasangan selingkuh-red). ”Pasangan seperti itu biasanya kita kembalikan ke masyarakat, dan mas-

yarakat nanti yang mengambil tindakan secara adat. Apa mereka dinikahkan atau diusir dari kampong. Karena saat ini kita masih dalam tahap sosialisasi. Ke depan kita tidak tahu langkah apa yang akan diambil karena siapa tahu mungkin hukum jinayah akan berlaku,” ujarnya. Disebutkan, pihaknya tidak dapat mengambil tindakan tegas karena tidak ada wewenang WH menceraikan atau mengawinkan orang. Sehingga setiap pelaku khalwat yang berhasil ditangkap, petugas hanya berwewenang memberi bimbingan saja. “Kita tidak bisa menahan mereka lebih lama di sini, sebab kita tidak punya tempat. Biasanya setelah kita panggil tokoh masyarakat sipelaku, lalau kita serahkan kepada keluarga. Merekalah yang mengambil tindakan,” ujarnya lagi. Kepada Waspada, Sabar mengungkapkan keberadaan petugas WH dan Satpol PP di tengah-tengah masyarakat dalam menegakan hukum Syariat Islam di Pidie tidak perlu ditakuti, bahkan harus dibantu. Selama

ini peran masyarakat dalam mendukung kerja WH dan Satpol PP sangat besar dan berlu ditingkatkan lagi. “Kita mengharapkan dukungan masyarakat dalam membantu tugastugas Wilayatul Hisbah dan Satpol PP. Kini masih ada masyarakat saat petugas melakukan sweeping di jalan-jalan tidak mau berhenti, mereka malah tancap gas sepeda motornya malah hampir tabrak petugas. Ini amat memprihatinkan,” keluh Sabar. Diungkapkannya, selama ini selain kasus mesum, yang paling meningkat terjadi adalah kasus pakaian ketat. Banyak muda- mudi hingga orang dewasa masing dominan menggunakan pakaian ketat saat bepergian, sehingga saat terjaring mereka kerap berdebat atau melawan petugas. “Padahal kita sudah sosialisi, tetapi masih saja ada yang melanggar. Padahal kita hanya membina saja tidak mengambil tindakan apa-apa, karena masih dalam tahap sosialisasi,” tegasnya.(b20)

pedagang dari Dinas Perindustrian Perdagangan Koperasi dan UKM Bireuen, Suhaimi yang dikonfirmasi Kamis pekan lalu membenarkan sosok rekanan pembangunan telah kabur dan pembangunan telah terlantar. Menurutnya, rekanan pelaksana pembangunan itu adalah CV APS milik Su yang dikuasakan kepada Muk serta dilaksanakan Fa, kontraktor asal Jeunieb. Rekanan itu pula yang melaksanakan pembangunan kios pedagang sebanyak delapan pintu di Teupin Mane, Kecamatan Juli yang juga belum dirampungkan sampai sekarang. “Selain di dua lokasi itu, sisanya tersebar di sejumlah kecamatan di Bireuen hingga semuanya ada 42 pintu kios. Konsultan proyek adalah CV SR dan CV MP asal Lhokseumawe dengan direktur Mis, sementara pengawas lapangan bernama Jimy,” jelas Suhaimi. Terkait soal keberhasilan rekanan pelaksana bisa menarik semua biaya sementara bangunan baru selesai 70 persen, Suhaimi mengatakan, penarikan dana seratus persen atas persetujuan Kuasa Pengguna Anggaran (KPA) dan PPTK di dinas

propinsi serta PPTK Bireuen yakni dirinya serta konsultan. “Karena mereka (rekanan) telah kabur, maka kami yang menyetujui penarikan dana akan bertanggung jawab untuk menyelesaikan pembangunan kios pedagang hingga rampung dengan dana pribadi yang ditanggung bersama,” ujar Suhaimi. Suhaimi menjelaskan, sebelumnya rekanan telah membuat perjanjian secara tertulis tetap akan melanjutkan pembangunan hingga rampung. Namun tidak menduga kemudian rekanan malah mangkir setelah berhasil menarik semua dana dengan persetujuan pejabat baik di propinsi, kabupaten dan konsultan. Suhaimi menyebutkan, biaya pembangunan hingga rampung ditanggung bersama, setelah tim inspektorat propinsi turun ke Bireuen melakukan peninjauan dan menemukan proyek tersebut belum selesai sementara dana telah ditarik seluruhnya. Dalam hal ini inspektorat menyarankan kepada pejabat yang bertanggungjawab untuk dapat melanjutkan pembangunan dengan batas waktu akhir 2009. (b03)

Usai Tarik Seluruh Dana Rekanan Telantarkan Proyek BIREUEN (Waspada): Proyek pembangunan 42 pintu kios pedagang di Desa Linggong, Kecamatan Peusangan dan sejumlah kecamatan lainnya, Kabupaten Bireuen telah ditelantarkan rekanan yang diduga kabur setelah menarik seluruh dana hingga terindikasi merugikan keuangan negara. Pembangunan kios untuk pedagang di sejumlah kecamatan senilai Rp770 juta itu bersumber dari dana otonomi khusus (otsus) 2009, kini telah terhenti beberapa bulan. “Pembangunan telah terhenti beberapa bulan lalu, sepertinya rekanan menolak melanjutkan pembangunan, kabar yang beredar dana pembangunan telah ditarik semuanya atas persetujuan pejabat tingkat dinas baik di tingkat propinsi maupun kabupaten,” kata sebuah sumber. Menurut warga setempat, delapan pintu kios yang dibangun di kawasan Desa Linggong, Peusangan dibangun di atas tanah wakaf aset milik Desa Lampoh Rayeuk, belum diketahui mekanisme penggunaan lahan tersebut. Setahu warga, rekanan pelaksana asal Kecamatan Jeunieb dan konsultan dari Kota Lhokseumawe. Pejabat Pelaksana Teknis Kegiatan (PPTK) proyek pembangunan 42 kios

ACEH UTARA (Waspada): Sebagai daerah pemekaran, Kabupaten Aceh Utara harus mencontoh Idi, Ibukota Aceh Timur dan Bener Meriah, yang telah lebih dulu mengaktifkan dan menjalankan roda pemerintahan di tempatnya yang baru. Sementara Aceh Utara, hingga kini pusat administrasinya masih dijalankan di Kota Lhokseumawe, padahal proses pemekaran lebih dulu dilakukan Aceh Ut ara dibanding dua kabupaten itu. H. Syahril Basyah, Wakil Ketua Forum Ranuep Bate, ketika ditanya Waspada, Minggu (27/9) menyebutkan, harusnya Pemkab Aceh Utara merasa malu dengan Pemkab Aceh Timur dan Bener Meriah, karena sekarang mereka berhasil menjalankan roda pemerintahan di tempat baru. “Mereka tidak pernah beralasan, tidak punya dana untuk kembali ke daerahnya yang baru. Kita tidak usah membandingbandingkan Aceh Utara dengan Bireuen, karena Bireuen telah maju. Untuk itu kami sarankan Pemkab Aceh Utara harus mencontoh tiga daerah tersebut,” kata Syahril. Disebutkan, Aceh Utara telah dimekarkan sejak awal tahun dua ribuan. Karena itu sudah sepantasnya, segala macam kegiatan pemerintah dilaksanakan di Lhoksukon. Terkait tempat, ExxonMobil bersedia menyerahkan asetnya berupa Bachelorcamp untuk Pemkab, guna dijadikan pusat administrasi. Memang Bachelorcamp tidak mampu menampung semua dinas, namun itu dapat dilakukan bertahap. “Menurut hemat kami, Bachelorcamp mampu menampung tujuh hingga delapan dinas. Dan sekarang, Pemkab baru menempatkan satu dinas yaitu Dinas Bina

Marga. Terkait dana rehap gedung, Pemkab harus mengupayakan dan tidak boleh beralasan tidak punya uang. Makin cepat, makin baik. Karena untuk mensejahterakan masyarakat, pemerintah harus dekat dengan rakyatnya,” ucap H. Syahril menambahkan, sudah saatnya Bupati Aceh Utara menepati janjijanjinya kepada masyarakat. Kepada anggota DPRK Aceh Utara periode 2009-2014 yang baru dilantik, diminta untuk bersungguh-sungguh memindahkan pusat administrasi Aceh Utara ke Lhoksukon, karena ini merupakan dambaan masyarakat Aceh Utara. Zulfikar Mulieng, Ketua Badan Eksekutif Mahasiswa (BEM) Universitas Malikussaleh Aceh Utara kepada Waspada, Minggu (27/9) mengatakan, masih aktifnya pusat ADM Pemda Aceh Utara di Lhokseumawe menimbulkan kerugian besar bagi rakyat. karena jika pusat ADM dipindah ke Lhoksukon, kontribusi masyarakat akan terlihat, pemberdayaan ekonomi akan terbangun, dan tentunya lapangan pekerjaan akan terbuka lebar. “Semakin lama di Lhokseumawe, Aceh Utara akan semakin merugi. Pemkab Aceh Utara harus segera mengaktifkan Ibukota Lhoksukon.” Menanggapi persoalan di atas Ridwan M. Yunus, Ketua DPRK Aceh Utara Sementara kepada Waspada mengatakan, demi menjalankan amanah rakyat, pihaknya bertekat segera mengembalikan pusat pemerintah Aceh Utara ke Lhoksukon. Begitu pun, untuk melaksanakan keinginan tersebut ada beberapa kendala yang harus segera dicarikan solusinya, yakni ketiadaan gedung untuk dinas-dinas.(cmun)

Kecelakaan Di Indrapuri

Satu Tewas Dan Empat Mahasiswa Kritis KOTA JANTHO (Waspada): Kecelakaan beruntun yang terjadi di menyebabkan tabrakan beruntun di kawasan Indrapuri, Aceh Besar, Minggu (27/9), menyebabkan seorang pengendara sepeda motor tewas di tempat kejadiaan dan empat lainnya berstatus mahasiswa IAIN Ar-Raniry Banda Aceh kritis, sehingga harus menjalani perawatan intensif di Rumah Sakit Umum dr Zainoel Abidin Banda Aceh. Informasi yang Waspada himpun dari berbagai sumber menyebutkan, tabrakan mobil Ford Escape BL 873 JC disopiri Ramadani Ismy, 38, warga Lueng Bata, Banda Aceh yang datang dari arah Medan dengan sepeda motor Honda Vario BL 4789 LV dikendarai Zulfahmi, 34, warga Desa Lamlhom, Kecamatan Lhoknga, Aceh Besar, yang datang dari arah berlawanan, terjadi sekira pukul 15.40 WIB di Kilometer 25 Jalan Banda Aceh-Medan. “Saat itu lalulintas di kawasan itu sedang padat-padatnya karena bertepatan dengan arus balik lebaran yang hari ini (kemarin-red) mencapai puncaknya,” kata Hamdani, seorang warga setempat. Selain Zulfahmi yang tewas di tempat kejadian, empat lainnya kritis setelah sepeda motor yang mereka tumpangi menabrak mobil yang dikendarai Ramadani Ismy. Keempat korban yang kini di rawat di Rumah Sakit Umum Banda Aceh

itu, Eka Agustina, 21, mengendarai Suzuki Smash BL 6664 LN dan berboncengan dengan Putri, 20, serta Taufik, 22, berboncengan dengan Nurkhalis, 22, mengendarai sepeda motor Suzuki Shogun BL 5510 NI. Pantauan Waspada di Instalasi Gawat Darurat RSUZA Banda Aceh Minggu malam, Taufik asal Aceh utara menderita patah kaki. Sedangkan temannya, Nurkhalis, warga Banda Aceh dan Eka Agustina, warga Asrama PHB Lampriet serta Putri warga Lambaro kritis. Jenazah Zulfahmi korban tewas dalam kejadian itu, dievakuasi petugas PMI ke desa tempat tinggalnya untuk diserahkan kepada pihak keluarga. Selain menyebabkan mobil dan dua sepeda motor yang dikendarai korban rusak berat, kecelakaan itu juga sempat menimbulkan kemacetan hingga satu kilometer lebih baru berhasil di atasi setelah aparat Polantas Aceh Besar turum ke lapangan. Kapolres Aceh Besar AKBP Teguh Susilo Raharjo yang Waspada konfirmasi melalui hendphone membenarkan kejadian itu. Ia menyebutkan, sejak Bulan Ramadhan hingga Hari Ketujuh Lebaran Idul Fitri tahun ini, terjadi tujuh kasus kecelakaan lalulintas di wilayah itu yang menyebabkan empat orang meninggal dunia dan tiga lainnya luka-luka. (b09)

Identitas Orangtua Bocah Yang Ditelantarkan Masih Kabur BIREUEN (Waspada): Malang benar nasib dialami seorang bocah lakilaki berusia diperkirakan tiga tahun belum diketahui identitas dan asalnya satu ini, masih kecil dia sudah merasakan penderitaan setelah ditelantarkan ibu kandungnya. Kini bocah itu dalam pengawasan aparat Polsek Samalanga setelah diantar seorang penarik ojek (RBT-red) usai dititip seorang penumpang L300 tujuan Medan, ke rumah pegawai kantor camat setempat, Jumat (25/9). Kapolres Bireuen AKBP Teuku Saladin, SH melalui Kapolsek Samalanga Ipda Syamsul, SH mengungkapkan, himgga kini pihaknya masih terus menyelidiki siapa ibu kandung anak itu. “Dari pengakuan Fakri, 45, warga Desa Matang Kecamatan Samalanga selaku pengendara ojek (RBT-red), perempuan yang menitip anak itu pada malam tiga lebaran dan diantar ke Polsek sekira pukul 23.30 WIB. Ibu si anak itu menumpang mopen L300 dari Banda Aceh, berpostur agak gemuk, warna kulit hitam, dan mengaku minta anak-

nya diantar ke rumah ibu Ida karena dia sedang ribut dengan suaminya,” jelas Ipda Syamsul, SH. Kronologis kejadian berawal ketika pengendara ojek itu, sedang menunggu penumpang di kawasan Simpang Matang. Setahu bagaimana satu unit mobil penumpang L300 berhenti dan si perempuan itu menitipkan anaknya kepada Fakri dan disuruh antar ke Desa Pulo, ke rumahnya ibu Ida pegawai kantor camat setempat. Tanpa pikir panjang dan sama sekali idak menaruh curiga lantas pengendara ojek langsung mengantarkan anak itu, tetapi sudah empat rumah didatangi tidak ada yang mengenal anak itu. “Rumah terakhir didatanggi adalah rumahnya ibu Ida istrinya Yunus pegawai kantor camat setempat, tetapi karena keluarga itu sama sekali tidak mengenal anak itu selanjutnya Fakri membawa anak diperkirakan berusia 3 tahun itu ke Polsek Samalanga,” terang Syamsul, dan sekarang anak yang sering menyebut

nama Haji Dayat itu sudah titipkan dengan keluarga Yunus, dan di bawah pengawasan polisi. Menurut Kapolsek, kondisi si anak seperti masih trauma dia hanya mau didekati laki-laki berpostur tinggi dan hitam kemungkinan ciriciri ayah kandungnya. “Anak yang menyebut namanya Haji Dayat itu, kondisinya sehat tetapi tidak mau sembarangan orang. Sepertinya dia juga rindu dengan ayahnya. Tadi saat sedang tertidur dibangunkan menolak, tetapi saat dikatakan ayahnya datang cepat-cepat dia bangun,” sebutnya. Ipda Syamsul berharap kepada anggota keluarga maupun masyarakat yang menegenali anak itu dapat segera melapor ke Polsek Samalanga atau pos polisi terdekat. “Bagi masyarakat yang mengenal anak ini, segeralah melaporkan ke Polsek Samalanga ke nomor telepon 0644 31275, karena dia masih membutuhkan bimbingan dan kasih sayang dari kedua orang tuanya,” pintanya. (b03)

Waspada/Bustami

Kapolsek Samalanga Ipda Syamsul,SH, Minggu (27/9), mengendong bocah beumur tiga tahun belum yang belum diketahui identitas dan alamatnya ortunya yang menumpang sebuah mopen L300 kepada seorang pengedara ojek dikawasan simpang Matang, Kecamatan Samalanga, Bireuen, malam lebaran ketiga.


WASPADA Selasa 29 September 2009

Langsa, Kualasimpang, Kutacane, Singkil

Pemkab Harus Benahi Pariwisata

Perempuan Kesasar Ternyata Korban KDRT KUALA SIMPANG (Waspada): Perempuan yang diperkirakan mengalami gangguan jiwa dan sejak tiga bulan lalu ditampung di rumah Ti Hajar, 30, di Desa Salah Aji Kecamatan Matang Jaya, Aceh Tamiang ternyata bernama Fatimah, 29, asal Desa Buket Rata, Kecamatan Kejuruan Muda, Aceh Tamiang. Jiwa Fatimah memang labil, diduga akibat tindak kekerasan dalam rumah tangga (KDRT). “Fatimah sudah berumah tangga serta telah dikaruniai sepasang anak. Belakangan rumah tangga Fatimah retak. Ia kerap dikasari suaminya, hingga jiwanya terganggu. Kondisi jiwa Fatimah kian parah setelah sang suami pergi dari rumah bersama kedua buah hati mareka, sekitar setahun lalu,” ungkap Ti Hajar via telefon mengutip keterangan Jamil, 60, ayah Fatimah saat menjemput perempuan malang itu, Minggu (27/9) petang. Menurut Ti Hajar, Jamil yang sehari-hari bekerja sebagai penjual sate mengetahui keberadaan anaknya setelah membaca berita di Waspada, Sabtu (26/9) pagi. Yakin perempuan itu anaknya, Jamil bergegas menuju rumah Ti Hajar. Tapi karena saat itu Fatimah ikut diajak lebaran ke kampung halaman Ti Hajar di Desa Seunebok Pidie Madat Aceh Timur, ayah dan anak yang sudah berbulan terpisah itu baru berhasil bertemu,

Minggu (27/9) petang. “Orang tua Fatimah sangat terharu begitu melihat Fatimah. Apalagi selama ini mareka sudah berupaya mencarinya ke sana – ke mari. Mareka datang dengan membawa KTP dan Ijazah asli Fatimah. Awalnya Fatimah menolak ikut ke rumah orangtuanya, tapi setelah dibujuk akhirnya ia bersedia pulang,” kata Ti Hajar. Dikurung Masih menurut Ti Hajar, sebelum pergi dari rumah ada sedikit kekeliruan penanganan terhadap Fatimah. Orangtuanya mengurung wanita berkulit sawo matang itu di kamar karena khawatir terjadi hal-hal tidak diinginkan. Suatu ketika, Fatimah bisa keluar kamar secara diam-diam dan langsung minggat. “Terkait masalah ini saya sudah menyarankan orang tua Fatimah agar memperlakukan Fatimah layaknya orang normal. Sebab kondisi Fatimah terlihat mulai pulih. Selama tinggal bersama kami ia tak pernah bersikap aneh, apalagi kasar. Ia juga bisa melakukan pekerjaan rumah tangga dengan baik,” ujar Ti Hajar seraya mengucapkan terimakasih kepada Waspada, karena melalui pemberitaan Fatimah bertemu kembali dengan orangtuanya.(cmus)

Tujuh Kapolsek Di Aceh Timur Diganti Sertijab Waka Polres Hari Ini PEUDAWA, Aceh Timur (Waspada): Tujuh Kepala Kepolisian Sektor (Kapolsek) di jajaran Mapolres Aceh Timur, Senin (28/9) diganti. Sementara itu, Kepala Satuan (Kasat) Intelkam juga dimutasi dari Kompol Junaidi diganti mantan Kabag Ops Poltabes Kota Banda Aceh, Kompol Didik S. Ke tujuh Kapolsek yang diganti, Kapolsek Banda Alam sebelumnya dijabat Ipda M. Hasyim Ibrahim, diganti Ipda Didik. Kapolsek Indra Makmur diganti Ipda M. Hasyim Ibrahim. Kapolsek Darul Aman sebelumnya Aipda Rusli diganti Ipda A. Widodo. Kapolsek Julok sebelumnya Iptu Samsuar diganti AKP Burhansyah, Kapolsek Peureulak Timur diganti Iptu Samsuar, dan Kapolsek Ranto Peureulak diganti Ipda Ildani Ilyas, serta Kapolsek Darul Ihsan diganti Aiptu Rusli. Dalam upacara Serah Terima Jabatan (Sertijab) kemarin, Kapolres Aceh Timur, AKBP Drs. Ridwan Usman mengharapkan, ke depan setiap wilayah ataupun kecamatan terus meningkatkan pelayanan terhadap masyarakat dalam meningkatkan ketertiban dan keamanan. Selain itu, para Kapolsek yang bertugas di tempat baru terus memasyarakatkan polisi selaku mitra masyarakat dalam menegakkan hukum. “Tidak ada yang terpenting selain kedamaian yang harus dijaga bersama

masyarakat. Karena apapun tidak akan berjalan lancar tanpa kedamaian,” ujar Ridwan Usman. Usai upacara Sertijab, Kapolres mengatakan, mutasi yang dilakukan ini tidak terlepas dari penyegaran untuk meningkatkan kualitas kinerja Polri dalam bertugas, melaksanakan tanggungjawab selaku pelayan dan pengayom masyarakat. “Bukan tempat dimana kita bertugas yang menjadi tolak ukur seorang personel polisi, tapi bagaimana menciptakan Aceh ke depan yang lebih aman tanpa ada gangguan apapun, sehingga rakyat marasa damai,” sebut Kapolres Ridwan Usman sembari menandaskan pihaknya akan terus berupaya menjaga kedamaian selaku tugas Polri serta memelihara butir MoU Helsinki antara RI-GAM pada 15 Agustus 2005. Sementara Kasat Intekam Mapolres Aceh Timur, sebelumnya dijabat AKP Ade Adriyansyah Putra, SIK, diganti mantan KBO Reskrim Aceh Besar, Iptu Ananda Fauzi Harahap. Untuk Sertijab Waka Polres Aceh Timur akan dilakukan besok (hari ini—red), di mana Waka Polres yang baru dijabat Kompol Didik S. Sementara mantan Waka Polres Aceh Timur, Kompol Junaidi akan menempati posisi Kasi Dirlantas Polda Aceh di Banda Aceh.(cmad/b22)

Selama Lebaran Lokasi Wisata Padat Pengunjung KUTACANE (Waspada): Selama lebaran Idul Fitri sejumlah lokasi wisata di Aceh Tenggara semakin diminati dan jadi tujuan utama warga dari berbagai wilayah di bumi Sepakat Segenep. Beberapa lokasi wisata yang paling diminati itu di antaranya lokasi wisata Lawe Mamas, Ketambe, Lawe Ski, Pante Timur, Pante Barat, Lawe Gerger dan beberapa lainnya. Bahkan akibat besarnya minat warga berlibur, Minggu (27/9), arus lalu lintas menuju Ketambe dan Pantai Lawe Mamas atau yang kerap disebut Pante Goyang, sempat macet dan menimbulkan antrian panjang. Inggit Natasa, warga Kota Kutacane mengatakan, meski jarak tempuh yang harus dilalui terbilang jauh, namun bagi dia dan keluarganya lokasi wisata Ketambe masih jadi tempat paling menyenangkan. Selain hawanya masih sejuk karena rindangnya pepohonan serta melepaskan rasa penat maupun cuaca panas yang sedang menyelimuti Kutacane, di lokasi wisata Ketambe juga masih ditemukan sejumlah fauna yang turun ke badan jalan nasional. Berbeda dengan pengakuan Sahrul, dipilihnya liburan ke lokasi wisata Lawe

Mamas atau Pante Goyang bersama keluarga, karena selain baru dibuka, tempat wisata di pinggiran aliran sungai Lawe Mamas itu juga menyediakan tempat hiburan untuk anak-anak. “Lokasi wisata Lawe Mamas penataannya mampu menimbulkan daya tarik bagi warga di Agara maupun pengunjung dari luar daerah. Karena itu agar lokasi wisata lainnya juga jadi pilihan warga, sebaiknya penataan maupun fasilitasnya, walau tidak menyamai, paling tidak mendekati lokasi wisata Lawe Mamas,” ujar Madiansyah Beroeh. Malik Hamdani, SE, pengelola lokasi wisata Lawe Mamas atau pante Goyang mengatakan, sebenarnya prospek pariwisata di Agara dengan alam yang sangat mendukung, mempunyai prospek menjanjikan. Karena itu, pihaknya akan terus menata lokasi wisata Lawe Mamas yang semakin hari semakin diminati warga Agara dan warga dari luar daerah. “Tahap awal memang baru ada kolam renang, hiburan anak-anak dan hiburan bagi orang dewasa, namun bila modal memungkinkan, penataan akan dibenahi,” jelas Malik Hamdani.(b27)

Objek Wisata Di Abdya Masih Alami SEJUMLAH sungai alam dari perbukitan yang selama ini menjadi objek wisata alam di Kabupaten Aceh Barat Daya (Abdya) terlihat masih alami dan belum tersentuh pengaruh modernisasi. Kondisi alam objek wisata itu belum berubah dan pengelolaan pun masih seadanya, dimana pemuda desa hanya mengelola parkir kenderaan bermotor dan menjaga keamanan sekitar objek wisata itu. Hampir setiap wilayah kecamatan terdapat sungai alam dari bukit yang di jadikan warga sekitar sebagai tempat bersantai yang kemudian ramai di kunjungi warga lain dari wilayah berbeda. Objek Pemandian Ie di Kila, Kecamatan Blangpidie yang dikenal dengan Pemandian Krueng Beukah, Pemandian Pucok Krueng yang terkenal dengan legenda Rakyat putro Bungsu dan Malem Diwa yang berada di Kecamatan Jeumpa, serta Krueng Panto yang berada di Kecamatan Kualabatee merupakan kawasan wisata alam yang paling ramai di kunjungi warga pada liburan idulfitri lalu. Hal yang sama juga terlihat di Krueng Baru di Batas Wilayah Aceh Selatan - Aceh Barat Daya, Krueng Babahrot, serta wilayah Tangan-Tangan.

Beberapa warga sekitar wisata alam yang ditanyai menyebut selama ini pemerintah daerah tidak berupaya membangun fasilitas jalan yang baik untuk memudahkan pengunjung ke wilayah wisata alam itu, “Harusnya pemerintah mambangunnya, agar orang yang ingin bersatai bisa mudah masuk dan tidak mengunakan jalan licin yang membahayakan, “ kata Ihsan warga Alue Sungai Pinang, Kecamatan Jeumpa Minggu. Berbeda di Kawasan Jeumpa, dan Kecamatan Kuala Batee, wilayah menuju wisata alam yang telah dibangun adalah Kawasan Krung Beukah dan kawasan Krueng Baru, serta Krueng Babahrot namun pembangunannya bukan bertujuan untuk wisata melainkan penanggulangan banjir dan irigasi pertanian. Lain Abdya lain pula Aceh Selatan, beberapa kawasan pemandian sudah ada yang dipoles dengan membangun kolam pemandian di sekitar aliran sungai alam itu, seperti di kaki bukit putri naga Lhok Bengkuang, kawasan Panjupian, serta Terbangan. Pembangunan itu kebanyakan mulai efektif dan banyak di kunjungi warga tiga tahun terakhir, pengelola sudah mulai memberlakukan tiket masuk dan biaya parkir.(b32)

23

SINGKIL (Waspada): Pemerintah Kabupaten (Pemkab) Aceh Singkil diminta membenahi sarana dan prasarana wisata Pantai Cemara Indah Gosong Telaga, sebagai salah satu pemasok Pendapatan Asli Daerah (PAD) potensial. Pengelola objek wisata Pantai Cemara, Rusdin Tanjung, Sabtu (26/9) menyebutkan, selama liburan lebaran 1430 H diperkirakan belasan ribu pengujung datang berwisata ke pantai tersebut. Ia mengaku fasilitas air bersih, listrik dan sarana bermain anak merupakan sarana pendukung yang banyak diusulkan sejumlah pengunjung lokal maupun dari luar kabupaten agar dilengkapi. Sedangkan pondok wisata dan pondok untuk berjualan secara bertahap telah dibangun Pemkab. Rusdin mengaku peningkatan kunjungan wisata ke Pantai Singkil Utara terus meningkat dari tahun ke tahun. “Kita berharap pemerintah dapat mengalokasikan dana untuk membangun sarana dan prasana di kawasan pantai ini,” pinta Rusdin. Pemkab melalui pengelola menetapkan tarif karcis masuk Rp2.000 untuk dewasa, Rp1.000 anak-anak dan Rp5.000 untuk parkir kenderaan roda empat. Kawasan pantai tahun 2009 ditargetkan memasukkan PAD Rp25 juta, sementara tahun 2008 pengelola menyetor Rp20 juta, jelas Rusdin.(b30)

Waspada/Khairul Boangmanalu

PERIKSA ABSEN: Wakil Walikota Subulussalam H. Affan Alfian Bintang, SE (pakai peci) didampingi Kabag Kepegawaian Setdako Ibnu Hajar, S.Sos menyaksikan Kepala Dinas Perkebunan dan Kehutanan (Kadibunhut) Ir. Faisal memeriksa absen PNS, CPNS dan tenaga PTT atau honorer di lingkungan Disbunhut Kota Subulussalam pada inspeksi mendadak (Sidak) di lingkungan Pemko Subulussalam, Senin (28/9).

PNS Mangkir Tunjangan Dipotong SUBULUSSALAM (Waspada): Wakil Walikota Subulussalam H. Affan Alfian Bintang, SE ancam memotong tunjangan Pegawai Negeri Sipil (PNS) jika mangkir tiga hari berturutturut tanpa izin atau alasan kuat. Sementara para CPNS yang melakukan kesalahan serupa diperlambat pengeluaran SK PNS 100 persen dan bagi tenaga honorer atau PPT akan diberhentikan. Demikian penegasan Wakil Walikota, Affan dalam inspeksi mendadak (Sidak) terhadap hampir seluruh dinas, kantor dan badan se Pemko Subulussalam, Senin (28/9). Affan didampingi Drs. Mahyuddin Latief, M.Hum staf ahli bidang hukum dan politik, Teuku Abdul Hamid, SH Kepala Inspektorat, Ibnu Hajar, S. Sos Kabag Kepegawaian, Asmardin, SH Kabag Hukum dan

sejumlah staf yang mendapat pengawalan langsung sejumlah personil Satpol PP dan Plt. Kakan Kesbang Linmas dan Satpol PP Sahidin B, SH, juga mengingatkan para Kepala Dinas, Sekretaris dan Kabid agar memberi contoh yang terbaik kepada bawahan, seperti tertib masuk, istirahat dan pulang kantor tanpa pilih kasih. “Saya tegaskan kepada Kepala Dinas, Sekretaris dan para Kabid agar benar-benar menjalankan tugas dan fungsi sebagai pimpinan dan PNS mampu memberikan contoh terbaik kepada para staf,” tegas Affan memasikan, pihaknya akan menindak para PNS yang tidak disiplin dalam menjalankan tugas sebagai abdi negara. Di sisi lain Affan minta para staf, tenaga Pegawai Tidak Tetap (PTT) dan honorer mematuhi semua aturan yang berlaku di kantor masing-ma-

sing. “Tiga hari PNS, CPNS dan PTT atau honorer berturut-turut tidak hadir tanpa izin, akan dipotong tunjangannya, diperlambat SK 100 persennya dan diberhentikan dari PTT atau honorer,” tegas Affan sekaligus minta Kepala Inspektorat merealisasi jika ditemukan pelanggaran itu. Affan juga berjanji mempublikasi di media massa PNS, CPNS maupun PTT atau honorer yang terkena sanksi itu. “Ini bukan sekedar gertak atau menakut-nakuti, tetapi kita serius dalam membangun Kota Subulussalam yang lebih baik,” tegas Affan. Pada sidak itu, Affan sempat terlihat emosi dan menegur keras Kadis PU Ir. Irwan serta Kadisduk dan Capil Dra. Rahmiati yang terlambat masuk kantor. “Kalau kepala saja tidak disiplin, bagiamana dengan staf,” tanya Affan.(b33)

Polisi Kantongi Identitas Pelaku Pembunuh Pengusaha Sawit IDI, Aceh Timur (Waspada): Terkait pembunuhan Amiruddin alias Effendi alias Epi, 35, pengusaha kelapa sawit asal Madat, Kab. Aceh Timur beberapa waktu lalu di pedalaman Kec. Pante Bidari, polisi mengaku telah mengantongi sejumlah nama pelaku. “Kasus ini masih dalam penyelidikan, namun sejumlah nama yang kita duga sebagai pelaku telah kita kantongi. Bahkan beberapa orang juga telah dimintai keterangan sekaitan penembakan korban saat berada di kebun sawitnya,” demikian Kapolres Aceh Timur, AKBP Drs. Ridwan Usman, menjawab wartawan di ruang kerjanya usai

Sertijab sejumlah Kapolsek, Senin (28/9) pagi. Menurut Kapolres, kasus kematian pengusaha kelapa sawit yang ditembak kawanan bersenpi belum lama ini merupakan salah satu kasus besar dalam kurun waktu setahun terakhir. Selain pelaku yang diduga dua orang sebelumnya berkeinginan menyandera korban. “Ketika korban melawan membela diri, justru pelaku menembak korban hingga tewas,” ujarnya. Ketika disinggung apakah pelaku ada kaitannya dengan penyanderaan Alex, paman korban sebelumnya? Dengan tegas Kapolres Ridwan Usman

mengatakan, kasus itu masih dalam penyelidikan. Namun diduga kuat masih ada hubungan. “Ya, tidak tertutup kemungkinan ke arah itu, tapi masih dalam lidik petugas.” Mengenai identitas pelaku, Kapolres mengatakan untuk memudahkan penyelidikan pihaknya untuk sementara tidak memaparkan identitas pelaku. “Tidak usah disebutkan dulu namanya, karena kita masih harus menyelidiki paling dalam lagi. Tapi jika ada yang kita jadikan tersangka akan kita publikasikan nanti,” kata AKBP Ridwan Usman seraya menandaskan, pihaknya komit mengungkap kasus itu.(cmad)

Membangun Abdya, PA Koalisi Dengan Parnas BANDA ACEH (Waspada): Proses Reintegrasi Aceh antara mantan-mantan kombatan GAM dengan masyarakat terhitung berhasil dan berjalan baik di Kabupaten Aceh Barat Daya, tidak hanya dalam urusan kemasyarakatan namun juga dalam urusan politik. Bila dalam urusan kemasyarakatan banyak mantan kombatan yang sukses memimpin desa dan menjadi ustaz, sementara di panggung politik para wakil Partai Aceh (PA) di DPR dipastikan berkoalisi dengan para wakil dari partai politik nasional. “PA membuka diri untuk perubahan, untuk membangun Abdya, kesadaran yang sama juga dimiliki rekan-rekan dari Parnas, makanya kita bergabung menjadi satu fraksi di dewan,” kata Ketua Partai Aceh Abdya, Muhammad Nazir yang di hubungi Waspada, kemarin. Bergabungnya sejumlah kader partai nasional ke fraksi PA diyakini sebagai suksesnya proses reintegrasi paska damai. Dari 25 anggota DPRK Abdya yang dilantik 9 September 2009, 18 menyatakan berkoalisi dengan kesadaran perubahan bersama dalam Fraksi PA. Artinya ada sembilan wakil rakyat dari Parnas menggabungkan diri dalam fraksi PA, selebihnya membangun fraksi gabungan.(b32)

Atraksi Gajah Hibur Masyarakat Bireuen KUALA (Waspada): Delapan ekor gajah terlatih Sumatera dari BKSDA Saree Aceh Besar melakukan serangkaian atraksi menghibur masyarakat Bireuen di lapangan Desa Lancok Kecamatan Kuala Bireuen, Minggu (27/9). Dalam suasana lebaran Idul Fitri, masyarakat bersama keluarganya tumpah ruah menyaksikan 25 atraksi gajah yang cukup menarik itu. Atraksi pertandingan bola kaki yang ditampilkan 4 ekor gajah kesebelasan PSBL Lancok Vs 4 ekor gajah kesebelasan PSSB berlangsung seru. Kedua kesebelasan masing-masing ingin meraih kemenangan. Hingga pertandingan usai tim gajah PSBL Lancok berhasil mengalahkan tim gajah PSSB Bireuen. Sementara di cabang olahraga bola basket, seekor gajah betina diberi nama Fatimah, lebih unggul dalam meraih angka. Atraksi lainnya yang tak kalah menarik, lomba lari ke delapan ekor gajah bertubuh besar dalam berebut bola. Disusul disko bersama menghibur penonton. Menaikkan bendera dengan khidmat, berdiri di atas panggung, berhitung, mengalungkan bunga, melipat orang dengan belalai, melangkahi belasan orang tidur, memberi salam dan berbagai atraksi lainnya.(b16)

360 Warga Gampong Meutia Terima Zakat Fitrah LANGSA (Waspada): 360 Warga tidak mampu dari fakir miskin Desa Gampong Meutia Langsa menerima zakat fitrah dari panitia pengelola zakat fitrah desa setempat. Demikian Geusyik Gampong Meutia M. Noor Yahya yang juga koordinator pelaksana zakat fitrah Masjid Al-Syuhada kepada Waspada, Rabu (23/10). Geusyik didampingi Imum Syik Drs. Abdullah Gade, MPd dan Sekdes HM. Yusuf Hamid menjelaskan, setiap fakir yang berjumlah 40 orang menerima 20,8 kg beras atau 13 bambu dan uang Rp20.000. Sedangkan warga miskin menerima 11,2 kg beras atau 7 bambu dan uang Rp10.000, sementara jumlah warga miskin yang berhak menerima 320 orang. Menurut Geusyik, zakat fitrah warga yang terkumpul tahun 2009 berjumlah 5,6 ton beras atau 3,545 bambu dan uang Rp5.744.000. “Zakat fitrah ini telah disalurkan kepada mereka yang berhak menerimanya,” kata Noor Yahya yang menambahkan, jumlah warga yang membayar zakat fitrah tahun ini 487 orang.(b26/m43)

Dituduh Dukun Santet, Rumah Nenek Dirusak Massa LHOKSUKON, Aceh Utara (Waspada): Rumah semi permanen milik RML, 65, di Desa Kumbang, Km 7, Kecamatan Lhoksukon, Aceh Utara dirusak massa, Sabtu (26/9) sekitar pukul 21:00. Massa menuduh perempuan renta itu terlibat praktek dukun santet dan telah menyantet belasan warga setempat. Informasi dihimpun, aksi pengrusakan rumah RML dipicu karena ratusan warga kesal atas sikap RML yang dinilai tidak menghormati keputusan rapat desa. Sebelumnya dalam rapat darurat di Meunasah (surau desa-red) sudah ada keputusan bersama, RML yang selama ini tinggal bersama anak, menantu dan empat cucunya, harus meninggalkan Desa Kumbang, paling lambat hari ke 10 bulan Ramadhan 1430 H. Namun RML tidak mengindahkan keputusan itu. “Kami memiliki bukti tentang dugaan RML sebagai dukun santet. Antara lain, dua helai kain kafan ukuran kecil, tulang dua pisau silet, pisau dapur dan tiga botol obat warna-warni. Semua bukti itu telah kami serahkan ke pihak berwajib. Berdasarkan bukti ini pula warga sepakat meminta RML meninggalkan desa,” ungkap seorang warga. Menurutnya, selain merobohkan bangunan rumah, massa juga membakar sejumlah benda di dalamnya, termasuk benda – benda aneh yang dianggap mengandung unsur magic. Malah kasur yang diyakini tempat tidur RML ikut dibakar. Kendati demikian,

massa tidak mengusik anak, menantu serta cucu RML yang saat kejadian berada di rumah. Mareka diminta ke luar secara baik-baik sebelum rumah dirubuhkan. Sementara RML sendiri tidak berada di tempat saat aksi massa itu dilancarkan. “Sebelum dihancurkan, massa terlebih dulu berdoa bersama di depan rumah RML. Tujuannya agar tidak ada orang dari pihak massa terkena efek magic RML. Tapi saat doa bersama berlangsung, dua warga sempat pingsan setelah sebelumnya seperti kemasukan roh halus,” ujar sumber. Secara terpisah, T. Samsuddin, Ketua Tuha Peut Desa Kumbang menjelaskan, kasus ini mulai mencuat Agustus 2009. Ketika itu sedikitnya sembilan warga mengalami kesurupan dalam waktu hampir bersamaan. Warga yang kesurupan mengaku dirasuki setan kiriman RML. Mereka menjerit histeris dengan kondisi tidak menentu. Kasus kesurupan itu, sambung T. Samsuddin, terus mencuat sampai akhirnya aparat desa bersama warga mengadakan rapat dadakan di meunasah. Turut diundang RML yang kala itu datang dengan berpakaian serba hitam. Dalam rapat, RML selalu menyangkal dirinya dukun santet meski sejumlah warga mengaku memiliki bukti akurat. “Tak heran rapat sedikit ricuh. Sejumlah warga yang emosi lalu meminumkan air putih yang sudah didoakan ke

mulut RML. Uniknya, tak lama berselang leher RML seperti bengkak dan ia langsung mencret. Sejak itu, warga sepakat meminta RML hengkang dari Desa Kumbang dengan limit waktu terakhir habis lebaran. Namun sampai limit ini terlampaui, RML belum juga pindah, sehingga massa yang terlanjur emosi merubuhkan rumahnya.” Bukan Dukun Santet Sementara MHD, 44, menantu RML membantah mertuanya melakukan praktek dukun santet di Desa Desa Kumbang, Km 7, Kecamatan Lhoksukon, sebagaimana tuduhan warga hingga berujung pengrusakan rumahnya. “Ibu mertua saya bukan dukun. Apalagi sampai mengguna-gunai belasan warga. Saya juga menilai alat bukti yang diserahkan warga ke polisi terbilang berlebihan. Masak pisau dapur yang biasa digunakan mencincang bawang dianggap alat untuk menyantet,” kata MHD saat ditemui wartawan di Mapolsek Lhoksukon, Senin (27/9) siang. Dikatakan MHD, sejak menjadi menantu RML ia belum pernah melihat ibu mertuanya itu melakukan ritual sebagaimana biasa dilakukan dukun. Karenanya ia mengaku heran mangapa massa sampai tega merusak rumah RML. Bahkan aksi tersebut membuat MHD bersama istri dan ke empat anaknya yang selama ini tinggal bersama RML, terpaksa mengungsi ke rumah tetangga. MHD justru balik menu-

ding, otak dari permasalahan ini salah satu oknum pejabat desa berinisial AWG yang rumahnya berdekatan dengan rumah RML. Menurut MHD, pejabat desa itu kurang senang dengan mertuanya RML terkait sengketa tanah, lalu memprovokasi warga supaya memusuhi serta mengusir keluarga RML dari Desa Kumbang. Terkait tudingan MHD, salah seorang anggota keluarga AWG membantah ada persoalan pribadi di balik aksi massa merusak rumah RML. “Aksi itu murni kehendak warga lantaran resah dengan kelakuan RML. Warga berkali-kali mengingatkan RML segera pindah kampung sebelum massa berbuat nekat. Tapi peringatan itu tidak digubris,” katanya sembari minta namanya tidak ditulis. Sementara Kapolres Aceh Utara AKBP Yosi Muhamartha

melalui Kapolsek Lhoksukon Iptu Yusuf Hariadi kepada wartawan menjelaskan, kasus santet di Desa Kumbang sebenarnya telah dilaporkan sekitar sebulan lalu dan masih dalam penyelidikan. “Terlepas dari ada tidaknya benang merah antara dugaan santet dan pengrusakan rumah, yang pasti perbuatan merusak rumah orang tetap masuk kategori melanggar hukum. Itu sebabnya kita akan bertindak tegas terhadap para pelaku. Lagipula ini termasuk main hakim sendiri,” tegas Kapolsek Iptu Yusuf Hariadi. Untuk menghindari terjadinya hal-hal yang tidak diinginkan, kata Kapolsek, pihaknya telah mengamankan keluarga RML. Untuk sementara mareka disarankan pindah ke rumah sanak famili mareka di Km 11, Lhoksukon.(cmus)

Waspada/Musyawir

DIRUSAK MASSA: Seorang warga melintas dekat puing rumah RML yang dirusak massa di Desa Kumbang, Km 7, Kecamatan Lhoksukon, Aceh Utara. Massa menuding RML terlibat praktek dukun santet. Foto direkam Minggu (27/9).


Otomotif

24

Perlunya Mobil Hybrid Bersuara

‘Suara indah’ dapat mendongkrak penjualan Nissan Leaf.

Mobil hybrid dan mobil listrik ternyata tak lepas dari masalah. Senyapnya suara dari kendaraan ramahlingkunganini,menjadikendala bagi kaum tunanetra. Alhasil, Nissan pun merancang bebunyian agar produknya bisa dikenali di jalan raya. “Kamimenginginkansesuatuyang benar-benar berbeda. Kami menginginkan suara yang mendekati suara indah yang memiliki seni,” ujar Toshiyuki Tabata, seorang pegawai yang sudah puluhan tahun bekerja di divisi sound-suppression Nissan. Menurut Tabata, ‘suara indah’ dapat mendongkrak penjualan Nissan Leaf. “Kami tidak ingin menghancurkan merek mobil listrik. Kamihanyainginmempunyaisesuatu yang dapat meningkatkan image merek mobil tersebut,” ujarnya. Mobil listrik ramah lingkungan Nissan Leaf, baru saja diperkenalkan ke depan publik. Namun, beberapa

lembaga swadaya masyarakat yang membela tunanetra, menuntut agar produsen mobil hijau menggunakan bunyi musik untuk memudahkan tunanetra ketika menyebrang jalan. Terhadap permintaan musik tersebut,Tabata sontak bereaksi keras. Menurutnya, bila mobil hybrid-nya dituntut bersuara, sudah seharusnya diciptakan bebunyian yang indah. “Kami memutuskan untuk tidak menggunakan suara musik. Jika kami harus membuat mobil ini bersuara, maka kami akan membuatnya secara indah dan futuristik,” tegas Tabata. Ungkapan Tabata pun tak mainmain. Saat ini, pihaknya tengah bekerjasama dengan beberapa komposer musik dan efek suara Hollywood untuk menciptakan suara pada Nissan Leaf. Menemui tahap akhir, Ia bersama timnya sedang mencoba menggunakan suara mobil terbang (flying cars) yang pernah

digunakan di film Blade Runner, buah karya Ridley Scott. Film yang meraih beberapa penghargaan ini, memang menceritakan tentang kejadian di masa depan, yaitu tahun 2019. Adapun salah satu pemainnya adalah Harrison Ford. Tabata menjelaskan, sistem suara Nissan Leaf secara otomatis terdengar ketika mobil dinyalakan (stater) dan secara otomatis tidak mengeluarkan suarasaatmobilmulaiberjalanhingga mencapai kecepatan 20 km per jam (12mph).Ketikakecepatanmeningkat, maka suara ban dan turbulensi angin mulai terdengar, sehingga bisa diketahuiolehtunanetra.“Namunjugatidak menggangu pengguna jalan raya lain yang non-tunanetra,” paparnya. Sebagai informasi, awal tahun ini asosiasi tunanetra Jepang (Japanese Federation for the Blind/JFB) mengajukan protes terhadap Kementerian Transportasi Jepang,

WASPADA

Selasa 29 September 2009

asosiasi otomototif Jepang (Japan Automobile Manufacturers Association) dan sejumlah produsen mobil Jepang tentang keberadaan mobil hybrid dan mobil listrik yang membahayakan tunanetra. Kementrian Transportasi Jepang pun telah menggelar diskusi panel di bulan Juli dan Agustus lalu dan akan mempresentasikannya 31 Desember mendatang. Sementara itu, Komisi KeselamatanTransportasi Amerika Serikat (AS), U.S. National Highway Traffic Safety Administration (NHTSA) tengah menganalisa data-data kecelakaan yang menyangkut tunanetra dan mobil hybrid. Laporan final akan dirilis pada Januari 2010 mendatang. NHTSA saat ini bekerja dengan sejumlah lembaga advokasi termasuk National Federation of the Blind, yang menuntut produsen mobil hybrid membuat produknya bersuara. Dan hingga kini, baru Nissan yang

mengumpulkan laporan pembuatan suara pada Nissan leaf tanggal 3 September lalu. Pihak regulator di Jepang dan AS belum mengeluarkan peraturan atau perundang-undangan resmi tentang penggunaan suara pada mobil hybrid.Namun,tampaknyahalinitinggal menunggu waktu saja. Di sisi lain, isu mobil hybrid tak bersuara ini dijadikan ladang bisnis baru. Perusahaan audio mobil menjual peralatannya agar dapat dipasang di mobil dan mengeluarkan suara tertentu. Perusahaan elektronik yang berbasis di Tokyo, Datasystem Co., misalnya. Mereka saat ini sudah menjual alat yang dapat mengeluarkan16jenissuaraberbedauntukmobil hybrid, seperti suara kucing, suara kartun, bahkan suara manusia yang mengucapkan kata Excuse me (Permisi). (inc/h09]

Mini Coupe, Si Kecil Yang Tidak Bisa Dianggap Remeh MiniCoupeConcept.Nyawabaru bagi Mini Cooper. Dengan teknologi yang serba modern, keunikan nilainilai tradisi masa lalu tetap dipertahankan. Mobil two-seater tersebut mengambil elemen kekuatan dasar Mini, membenamkannya teknologi modern, serta konsep desain bodi yang inovatif. Mini Coupe Concept dipamerkan pertama kali pada Frankfurt Motor Show 2009, yangbaru saja berakhir. Sumber inspirasinya berasal dari karakteristik fundamental di setiap Mini: kenikmatan berkendara. Konstruksi dua pintu (coupe) mengikuti filosofi untuk memangkas berat mobil secara ekstrem. Dimensi yang kompak membuatnya lincah dan tangkas. Panjang mobil ini hanya 3,7 meter, lebar 1,6 meter,dantinggi1,3meter.Daridepan, cerminan desain Mini klasik tidak hilang. Yang menonjol adalah bentuknya yang makin galak, berotot, dan sporty. Kontur bonnet-nya terlihat sangat smooth. Stripping yang mengalir dari buritan, atap, bonnet,menuju grill radiator depan serupa milik Mini Cooper S, memberikan sentuhan sporty dan dinamis. Mulaiheadlight,grillradiatoryang berbentuk heksagon,air intakedi bawah,hinggakacadepan.Posisihead light, fog lamp, dan bemper depan

begitu menyatu,membuat MINI Coupe Concept terlihat mencolok,dinamis,dan modern. Dibekali mesin 1.6 liter twin-scroll turbocharged MINI ini mampu melontarkan tenaga maksimum 155 kW/211dk;sangatbesaruntukukuran mobil sekecil ini. Sebab, tenaga itu bisa memompa mobil ini menuju kecepatan 250 km/jam. Bagaimana dengan interiornya? Begitu masuk, terasa sekali ambiens kental sport car dengan pilihan warna dan materialnya.Silakan menikmati sentuhan kokpit yang serbaoval. Interior memang jadi penunjang filosofikenikmatanmengemudi.Pintu yang lebar membuat pengemudi masuk dengan mudah.Warna hitam

menegaskan atmosfer tenang, agar pengemudi dapat lebih berkonsentrasi. Ruangkakipengemudilebihlebar, dengan pedal gas yang panjang mengerucut. Sementara tuas kemudi palang tiga sudah dilengkapi kontrol multimedia. Urusan kenyamanan pengemudi EPS (Electronic Power Steering) sidah dibekaliuntukmembantupengemudi saat menyetir ataupun bermanuver. Ia akan menyesuaikan karakter berbelok pengemudi dalam berbagai kondisi jalan. Yang unik adalah, bagaimana pengemudi merasakan sensasi menyetir gokart, karena MINI Coupe Concept terasa sangat ringan dan stabil. (h09/okz)

Lexus LF-Ch (kiri), dan BMW Vision EfficientDynamics.

3 Mobil Konsep Terbaik Di Frankfurt Keseriusan pabrikan mobil yang sedang bergulat dengan isu-isu lingkungan dapat dilihat mobil-mobil konsep dipajang di Internationale Automobil-Ausstellung (IAA) di Frankfurt Motor Show, 15 - 27 September 2009. Penerapan konsep mobil masa depantakhanyasekadarkemewahan. Namunkinitelahberalihpadaefisiensi bahan bakar kendaraan. Belakangan, pabrikan mengubah dari bahan bakar minyakmenjadibahanbakaralternatif yang lebih ramah lingkungan. Karena itu, Road &Track memilih mobilkonsepterbaikdaripertunjukan otomotif bergengsi di Frankfurt bar saja berlalu.

BMW Vision EfficientDynamics Teknologi pencampuran bahan bakar hibrida dengan bahan bakar turbodiesel irit, membuat BMW Vision EfficientDynamics menjadi mobil idaman masa datang. Memadukan konsep styling avantgarde dan kinerja tinggi dalam paket hemat bahan bakar mampu mengangkut empat penumpang. Ruang mobil yang menggunakan frame chassis aluminium dan dilapisi dengan panel polikarbonat membentuk mobil yang aerodinamis. Konsep ini didukung oleh dua motor listrik, satu motor pada setiap poros. Motor maju diaktifkan oleh baterai, sedangkan bagian belakang

2 katup per silinder sebagaimana yang biasa tersemat pada engine Ducati. Namun, untuk urusan bobot, bobot hypermotard 796 lebih ringan. Untuk chassis, pengembangan terus dilakukan pada varian terbaru

ini, salah satunya rancangan baru tersentuh pada garpu atas hingga ke bawah yang mewujudkan refleksifitas varian Hypermotard 796 ketika diajak bermanuver. Dan untuk teknis pengamanan, pihak produsen ternyata tidak asal-asalan. Nyatanya dengan tersemat rem standar brembo pada pelek depan dan belakang, Hypermotard 796 dinilai cukup aman. Sedangkan dari segi fitur, Ducati hypermotard 796 akan banyak menggabungkan banyak fitur terutama pada warna, dan posisi tempat duduk yang lebih tinggi dari sang kakak. Di Amerika, warga sana baru bisa mendapatkan varian tersebut di showroom resmi Ducati pada Desember 2009. Pilihan warna tersedia merah, hitam, dan putih . (dto/h09)

Ducati Luncurkan Hypermotard 796

Land Rover LRX Segera Hadir Setelah lama hanya menjadi mobil konsep, produsen mobil mewah Land Rover mengonfirmasi dimulainya produksi mobil Land Rover LRX. Mobil ini akan menjalani debut pertamanya pada tahun depan dan melengkapi line up Range Rover model 2011. Didesain di fasilitas canggih Land Rover di Gaydon, new Range Rover akan menjadi mobil paling kecil, ringan, dan paling efisien dibandingkan dengan line up Range Rover lainnya. Seperti dikutip dari justauto, pada akhir pekan LRX baru berbasis crossover tersebut rencananya akan dibangun di pabrik Halewood di Merseyside. “Ini adalah rencana dan berita baik dari produksi Range Rover kecil untuk karyawan, dealer dan konsumen. Dan ini adalah komitmen kami dalam berinvestasi untuk masa depan, untuk terus memberikan kendaraan yang relevan kepada pelanggan kami,” kata Managing director Land Rover, Phil Popham. (dto/h09)

Debut VW Polo 3 Pintu Terbaru Volkswagen (VW) Polo 3 pintu akan memulai debutnya. Hatchback Jerman ini pun memiliki rentang pilihan yang cukup beragam. Mulai dari yang powerfull hingga ramah lingkungan. Seperti diberitakan Paultan,VW Polo 3 pintu ini akan masuk dalam segmen B hatchback. “VW Polo 3 pintu ini terlihat lebih maskulin dibanding yang 5 pintu,” tulis situs tersebut. Urusan desain eksterior dan interiornya tidak jauh berbeda dengan generasi sebelumnya. Hanya saja untuk tipe ini VW menyediakan 6 pilihan mesin. Yang paling efisien adalah yang bertenaga 75 PS turbo diesel dengan konsumsi bahan bakar 3,3 liter per 100 km. Sedangkan yang paling bertenaga menyandang mesin 1.2 L TSI yang mampu menghasilkan daya 105 PS. Secara rinci, ada tiga pilihan mesin diesel dan tiga mesin bensin, Yang tipe bensin memiliki tenaga 44 kW (60 PS), 51 kW (70 PS), dan 63 kW (85 PS). Untuk yang diesel pilihan tenaga yang dihasilkan yakni 55 kW (75 PS), 66 kW (90 PS), dan 77 kW (105 PS). Di Jerman, rencananya mobil ini kan dilepas mulai 12.150 Euro atau sekira Rp175.8 juta. Tertarik? Silahkan simak gambarnya sebelum mobil ini tiba di Indonesia. (okz/h09)

Seakan tidak ingin kehilangan konsumennya, Ducati Amerika berencana menyegarkan tampilan kuda besi keluarga hypermotard dengan varian terbaru. Seperti dikutip autoblog pada akhir pekan, perencanaan matang itu akan dibuktikan pada 2010 mendatang dengan mencoba meluncurkan varian Hypermotard 796. Meskimempunyaibentuk bodi yang sama dengan kakaknya yakni Hypermotard 1100, namun sang adik Ducati Hypermotard 796 mempunyai spesifikasi mesin yang lebih kecil dari pada varian Hypermotard 1100 series. Rencananya Ducati hypermotard 796 akan mengemban mesin yang memiliki power sebesar 80 HP dan torsi sebesar 56 lb/ ft,disertaipendingindengan

Mahindra, Raksasa Lain Dari India Di tengah gencarnya ekspansi raksasa otomotif dunia ke India, produsen otomotif lokal, Mahindra & Mahindra Ltd, justru ‘nekat’ merambah pasar luar negeri. Tidak tanggung-tanggung, mereka pun membunyikan genderang perang di pasar otomotif dunia. Setelah terimbas resesi ekonomi dunia, sektor industri otomotif AS saat ini sedang memasuki masa pemulihan, terutama dari kondisi terburuknya sejak tiga dekade terakhir. Situasi ini dinilai sebagai peluang bisnis bagi Mahindra. “Memang tidak populer. Tapi, ada celah,” ujar Presiden Bisnis Otomotif Mahindra Pawan Goenka baru-baru ini. Senada dengan analis industri Car Lab Eric Noble menilai, kondisi otomotif AS yang sedang merosot, dapat dimanfaatkan oleh produsen mobil asal Mumbai, India ini.”Melemahnya ekonomi dan makin murahnya harga diesel bisa membantu produsen mobil India sukses merebut konsumen mobil AS,” ujarnya Mahindra berencana memasarkan mobil bak terbuka dan truk kabin ganda awal tahun depan. Produk pertama yang ditawarkan Mahindra untuk konsumen AS adalah SUV Scorpio dan Bolero. Harga SUV akan ditawarkan Mahindra di kisaran AS$ 20.000 dan AS$ 30.000. Mahindra

telah melakukan investasi AS$ 60 juta-AS$ 70 juta untuk memperbaiki penampilan SUV Scorpio sebagai pickup plus dan mendirikan 336 jaringan dealer di AS. Namun, merk Mahindra saat ini masih memiliki kendala karena tidak dikenal sama sekali oleh konsumen AS. Para analis memperkirakan, produsen mobil ini akan menghadapi masalah seperti yang pernah dialami oleh Hyundai, Toyota, dan Honda dulu. Di sisi lain, produsen senegaranya, Tata Motors mulai menujukkan tajinya sebagai produsen otomotif India yang patut diperhitungkan setelah berhasil mengakuisisi Jaguar Land Rover dan menciptakan mobil termurah di dunia, Tata Nano. Upaya Mahindra berekspansi tidak main-main. Dalam rangka menggenjot volume penjualannya, Mahindra mulai gencar berpromosi lewat jaringan televisi Australia dengan mengibarkan slogan ‘Made for the hardest places on Earth (Dibuat untuk tempat-tempat tersulit di bumi)’. Iklan TV produk pick-up Mahindra ini digarap oleh sebuah agensi iklan Synchromesh Marketing yang berbasis di Sydney. “Hingga saat ini kami terfokus pada perpaduan iklan di lini bawah seperti media cetak, radio, web dan sponsor kegiatan untuk dapat berkomunikasi langsung dengan target konsumen kami para petani dan pedagang,” ujar Chief Executive Officer Mahindra Automotive Australia, Claire Tynan. Menurutnya, Mahindra Scorpio Pick-Up berhasil menempati posisi ketiga di Reli Brazil dos Sertoes, ajang reli terberat kedua setelah reli Dakar. Hal ini membuktukan ketangguhan dan daya tahan produk Mahindra . “Setelahmembangunbrandlebih dari dua tahun, kami ingin mencakup lebih luas secara efektif dengan tambahan promosi lewat jaringan televisi, dan kami yakin promosi ini mampu meningkatkan penjualan kendaraan di lokasi-lokasi terpencil,” ujarnya. (inc/h09)

dijalankan menggunakan 3 silinder turbodiesel 1,5 liter. Mobil ini mampu menghasilkan 356 daya kuda dan torsi 590 lb ft. Kecepatan 100 kilometer per jam hanya ditempuh dalam 4,8 detik dari keadaan berhenti.

Lexus LF-Ch Meniru kampanye milik VW, “Think Small”, Jepang menciptakan mobil mewah irit bahan bakar, Lexus LF-Ch. Toyota kembali mencari keberuntungan dengan menjual coupe 5 pintu di Eropa setelah pasar Amerika tak memiliki harapan. Mobil konsep ini menggunakan mesin hibrida yang menggabungkan mesin 4-silinder dengan baterai. LFCh yang tidak hanya menawarkan bahan bakar yang irit, tetapi kendaraan yang diilhami

coupe styling ini telah melahirkan kendaraan desain tinggi. Mini Coupe 50 tahun yang lalu, ikon Mini diluncurkan. Untuk mengenang peristiwa itu, Inggris meluncurkan mobil konsep Mini Coupe. Mobil yang populer ini memiliki 2 kursi dengan varian hatchback. Atap yang jauh lebih rendah diimbangi dengan membuang bangku belakang, dan meningkatkan bagasi kendaraan menjadi 5,7-8,8 kaki kubik. Konsep wahana Coupe memiliki wheelbase dan lebar yang sama sebagai standar Mini. Namun, mobil konsep ini sedikit lebih panjang dan 2incilebihpendekdaripendahulunya. Dengan mesin empat silinder 1,6 liter turbocharged bisa menghasilkan 208 tenaga kuda. (vvn/h09)

Ford Figo Penantang Tata Nano Segmen city car yang dihuni Tata Nano di India ternyata juga diminati Ford. Pabrikan Amerika ini berniat menghadirkan Ford Figo di negara tersebut. Keputusan untuk menghadirkan Figo di India ini dikemukakan Presiden dan CEO Ford, Alan Mulally dalam keterangan persnya. Hadirnya Ford Figo sebagai pemain baru di pasar India, menurut Mulally menunjukkan bahwa Ford tetap optimis untuk bersaing di pasaran small car Industri otomotif India yang besar. “New Ford Figo yang kami luncurkan menunjukkan bahwa kami serius ingin memasuki pasar India,” ucap dia. Nama Ford Figo terinspirasi dari bahasa Italia yang terkenal dengan desain. Figo dalam bahasa Italia berarti “keren”. Ford Figo memiliki elemen desain kinetik yang menyerupai Ford Focus, Ford Mondeo, dan Ford Fiesta yang masing-masing sudah terkenal secara global. Desain headlamps yang modern, bentuk grill dan bonnet dengan tampilan yang berbeda, spoiler yang terintegrasi serta bentuk jendela di tepi bagian belakang, Ford Figo dilengkapi dengan sentuhan desain kinetik. Desain bentuk jendela samping yang lebar di Ford Figo menunjukkan desain kinetis Ford yang membuat rasa nyaman dan luas bagi penumpang di kursi pengemudi maupun penumpang. Jendela samping dibuat dengan pillar berbentuk B, yang mendapat sentuhan desain elegan yang menyatukan kedua jendela menjadi satu bentuk secara visual. “Kami yakin bahwa new Ford Figo akan menarik perhatian para pecinta otomotif di India,” kata Presiden dan Managing Director Ford India Michael Boneham. (h09/okz)

S TIP

Nyaman Ketika Balik

Hingga akhir pekan, jalan raya diperkirakan masih dipadati para pemudik yang hendak kembali ke kota setelah mudik ke kampung halaman menyambut lebaran. Nah, selama bepergian tersebut, terutama yang mengendarai mobil ada baiknya memperhatikan beberapa tips berikut, agar perjalanan mudik menjadi lebih menyenangkan sekaligus aman. Pertama yang harus diperhatikan adalah kondisi tubuh kita. Pastikan kesiapannya untuk menempuh perjalanan dengan jarak yang jauh, karena dipastikan akan membutuhkan konsentrasi dan ketahanan tubuh. Untuk memastikan kondisi tubuh fit, tidak ada salahnya memeriksakan diri terlebih dahulu sebelum berangkat, terutama bagi anggota keluarga yang bertugas sebagai pengemudi, selain tentunya juga siapkan obatobatan yang sifatnya umum, seperti obat sakit kepala, flu dan mabuk. Sekarang,tinggalmemeriksakankondisikendaraan.Selaincekkondisinya secara rutin, ada baiknya juga untuk melakukan pengecekan terakhir ke beengkel-bengkel resmi yang biasanya sudah menyiapkan programprogram tertentu menyambut lebaran ini. Oli mesin, tekanan ban, minyak rem, air radiator, wiper fluid, dan lampu, menjadi kewajiban standar untuk dicek, agar kondisinya normal, sehingga dapat meminimalisir insiden yang tidak diinginkan. Selainitu,kelengkapansurat-suratkendaraanpuntidakkalahpentingnya untu dipersiapkan, selain untuk mengantisipasi pemeriksaan di tengah jalan, juga untuk memastikan bahwa kendaraan yang kita gunakan resmi bila terjadi hal yang tidak diinginkan. Setelah semua itu beres, tinggal memikirkan bagaimana mengatur barang bawaan. Namanya juga pulang mudik, biasanya barang bawaan pun tidak sedikit, karenanya ada beberapa hal yang bisa membantu untuk mengaturnya. Tapi ingat, susunan barang tersebut, sebisa mungkin jangan sampai menghalangi jangkauan pandang pengemudi ke belakang. Kalau bisa, akan lebih baik bila membagi barang bawaan menjadi beberapa tas kecil, ndaripada koper besar yang lebih memakan tempat. Kemudian susun barang bawaan tersebut, agar posisinya ‘terkunci’ satu sama lain, serta menyimpan barang yang sering dipakai pada tempat yang mudah terjangkau. Giliran di perjalanan, tentunya sudah tidak melupakan sabuk pengaman, serta mematuhi peraturan lalu lintas, serta menghormati para pengguna jalan lain. Selain itu, panel-panel indikator pada mobil jangan sampai lepas dari pantauan. Bila ternyata ditengah jalan terjadi insiden seperti mogok atau ban kempis, sebaiknya sebelum turun dari mobil, wajib untuk mempelajari dulu keadaan sekitar, pastikan tempat tersebut aman. Kemudian hidupkan lampu hazard, dan pasang segitiga pengaman beberapa meter dibelakang mobil,jangan terlalu dekat juga jangan terlalu jauh. (h09/bbg sumber)

waspada selasa 29 september 2009  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you