Page 1

Penyelesaian Fasilitas PON Terkendala Wapres Tinjau Sejumlah Arena PEKANBARU (Antara): Wakil Presiden Boediono menilai masih terdapat kendala untuk menyelesaikan fasilitas yang digunakan dalam PON XVIII di Pekanbaru, Riau, namun demikian hal itu jangan sampai menurunkan prestasi atlet nasional. “Memang di sana-sini masih ada kendala walaupun memang sudah ada banyak perbaikan dan kemajuan fasilitas,” kata Wapres kepada pers usai meninjau sejumlah arena PON di Pekanbaru, Minggu (9/9). Hal tersebut disampaikan Wapres usai meninjau sejumlah lapangan seperti menembak, sepak bola, senam, wushu, tenis, serta Stadion Utama Riau yang akan digunakan pertandingan PON XVIII. Hadir dalam peninjauan tersebut Ibu Herawati Boediono, Menko Kesra Agung Laksono, Wakil Menteri PU Hermanto Dardak, Wakil Mendikbud Musliar Kasim, serta Gubernur Riau Rusli Zainal. Menurut Wapres, sekalipun menemui sejumlah kendala sehingga penyelesaian fasilitas pendukung pertandingan dan atlet belum selesai 100 persen, hal itu hendaknya tidak mengurangi semangat atlet untuk mencapai prestasi terbaiknya. Terkait dengan belum rampungnya fasilitas PON, Boediono mengingatkan semua pihak untuk tidak saling menyalahkan atas berbagai kekurangan dalam persiapan penyelenggaraan. “Kendala yang terjadi harus sama-sama diatasi dan jangan saling salahkan. Buat event PON yang bisa dibanggakan masyarakat Riau dan nasional dan yang penting bukan soal menang kalah tapi semangat kebersamaan,” Boediono Satu hal yang harus diperhatikan, kata Wapres, yaitu kegiatan ini harus ajang nasional yang semangatnya harus dijaga seperti PON pertama di Solo.

Lanjut ke hal A2 kol. 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Pahing, 10 September 2012/23 Syawal 1433 H

No: 23978 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: 2.500,-

Kemenag Beri Kesempatan Calhaj 87 Tahun Ke Atas


KAPAL LANCANG KUNING: Sejumlah pekerja menyelesaikan pelataran di sekitar tugu kapal Lancang Kuning yang berada di depan Stadion Utama Riau, Pekanbaru, Riau, Minggu (9/9). Tugu tersebut akan menandakan simbol dari negeri melayu Riau yang menjadi tuan rumah PON XVIII 2012. Pembukaan PON akan oleh Presiden Susilo Bambang Yudhoyono pada 11 September 2012.

JAKARTA ( Waspada): Kementerian Agama (Kemenag) melalui Direktur Jenderal Penyelenggaraan Haji dan Umrah (PHU) memberikan kesempatan kepada calon jamaah haji berusia 87 tahun ke atas, berdasarkan database Sistem Komputerisasi Haji Terpadu (Siskoat) Kemenag per 31 Agustus 2012, dan satu orang pendampingnya untuk segera melakukan pelunasan Biaya Penyelenggaraan Ibadah Haji (BPIH/ ONH = Ongkos Naik Haji) tahap ketiga dimulai Selasa (11/9) besok sampai Jumat (14/9). Adanya kesempatan bagi calon jamaah haji usia 87 tahun ke atas bersama pendampingnya, menurut Dirjen PHU Anggito Abimanyu kepada wartawan di kantor Kemenag Jakarta, Sabtu (8/9) karena sampai hari terakhir masa pelunasan BPIH/ ONH tahap kedua 7 September, kuota haji tahun 2012 sebanyak 211.000 orang belum terisi penuh, baik untuk haji reguler maupun haji khusus (BPIH Khusus/ONH plus). Untuk itu, Kementerian Agama membuka masa pelunasan BPIH/ ONH tahap ketiga dari tanggal 12 sampai 14 September 2012 bagi jamaah calon haji khususnya yang berusia 87 tahun ke atas bersama satu orang pendamping. Namun demikian, Anggito tidak menyebutkan berapa jumlah

Lanjut ke hal A2 kol. 4

Suami Istri Tewas Terpotong-potong Presiden SBY: Cegah Terorisme VLADIVOSTOK, Rusia (Antara): Presiden Susilo Bambang Yudhoyono (SBY) mengajak semua pihak untuk ikut aktif mencegah peluang terjadinya tindakan terorisme antara lain dengan ikut mengamati dan melaporkan apabila

ada hal-hal yang mencurigakan dan ikut serta mengamankan lingkungan tempat tinggal masing-masing. “Tindakan terorisme tidak dibenarkan oleh kalangan manapun dan apapun sukunya. Mari kita terus menerus berani

menyerukan hal tersebut termasuk para pemuka agama dan tokoh masyarakat. Tindakan preventif terus dilakuan bukan hanya tugas polisi dan intelijen namun juga semua

Lanjut ke hal A2 kol. 3

AEKKUASAN, Asahan (Waspada): Sepasang suami istri ditemukan tewas dengan tubuh terpotong-potong diduga kena sabetan senjata tajam di rumah mereka, Minggu(9/9) pagi. Belum diketahui, siapa pelaku dan motif pembunuhan itu. Sementara, pihak Polres Asahan melakukan olah tempat kejadian perkara (TKP) dan memintai keterangan sejumlah saksi. Informasi dihimpun Waspada, korban Bangga Hutapea,57, dan istrinya Masaulina br Simajuntak, 57, warga Dusun VII, Lanjut ke hal A2 kol. 4

Deteksi Dini Konflik Jelang Pilgubsu MEDAN ( Waspada): Plt Gubsu H Gatot Pujo Nugroho mengingatkan bupati dan wali kota menggerakkan kepekaan masyarakat memperkuat basis deteksi dini mencegah konflik termasuk menjelang pelaksanaan Pilgubsu 2013.

”Melindungi masyarakat termasuk dari konflik merupakan kewajiban kepala daerah beserta menjaga kerukunan, persatuan, dan kesatuan serta NKRI,” kata Plt Gubsu diwakili Kepala KesbangPol Linmas Sumut Drs Eddy Syof-

yan di hadapan para Kepala Badan Kesbangpol Linmas kabupaten dan kota se-Sumut, dalam Orientasi Deteksi Dini, Cegah Dini Kemampuan Penanganan Konflik di Hotel Grand Kanaya Medan, Sabtu (8/9). Lanjut ke hal A2 kol. 1

Gegana Amankan Granat Dan Peluru


SEJUMLAH anggota polisi beserta Tim Labfor dan INAFIS Polri mengamankan sejumlah barang bukti saat olah TKP di lokasi ledakan rumah Yayasan Yatim Piatu Pondok Bidara, Jalan Nusantara, Beji, Depok, Jabar, Minggu (9/9).

Pemerataan Dan Istri Tewas Suami Kritis Kesejahteraan AKHIR pekan lalu dan kemarin siang saya menghadiri beberapa acara paguyuban keluarga Jawa. Bayangkan ternyata paguyuban Jawa Catatan yang ada di Sumut itu sampai lebih Gus Irawan 30. Kalau sampai mereka menggelar acara masing-masing satu per hari alamat tak akan bisa saya datangi. Untunglah akhir pekan lalu itu ada beberapa paguyuban yang menyelenggarakan halal bi halal sekaligus. Tentu saja semua nuansa yang mereka tampilkan adalah kedaerahan. Mulai dari musik sampai makanan. Sebagian besar pengurusnya saya kenal. Dan ketika didaulat memberi sambutan saya langsung tertuju pada jagung rebus. Lanjut ke hal A2 kol. 6

Al Bayan

Al-Mukhbitin Oleh Tgk. H. Ameer Hamzah Dan berilah kabar gembira kepada almukhbitin (orang-orang yang merendahkan diri di hadapan Allah) Yakni orang-orang yang apabila disebut nama Allah akan gemetar hatinya..... (QS. al-Hajj:35) CUCU Rasulullah SAW Al-Hasan bin Ali bin Abi Thalib mengatakan; Alkhabat pada asalnya bermakna tempat yang rendah di tanah. Ikhbat artinya merendahkan diri, atau dengan kata lain memiliki sifat tawadhu’ (merendahkan diri di hadapan Allah SWT). Orang-prang yang merendahkan diri disebut al-mukhbitin. Sifat semacam ini sangat dicintai Allah dan manusia. Al-Hasan menjelaskan, al-Mukhbitin ini sebenarnya orang mukmin yang dijanjikan Allah masuk surga. Penjabaran dari sifat ini, seseorang itu benar-benar takut kepada Allah SWT, kusyuk dalam shalatnya, tidak tergesa-gesa dalam mengambil tindakan, suka bertafakkur

Lanjut ke hal A2 kol. 3

Ditabrak Bus

TELUKMENGKUDU (Waspada): Bus penumpang PT. RAPI BK 7076 DH menabrak pasangan suami istri (Pasutri) saat melintas di Jalinsum KM 47-48, Desa Sei Buluh, Kec. Teluk Mengkudu, Kab.Serdang Bedagai, Minggu (9/9) siang. Peristiwa itu mengakibatkan, sang istri Siti Hanum ,40, warga Dusun VIII, Desa Gambus, Kec. Lima Puluh, Kab.Batubara tewas, suaminya Ali kritis.

Lanjut ke hal A2 kol. 4

JAKARTA (Waspada): Akibat ledakan yang diduga bom di Yayasan Yatim Piatu Pondok Bidara, Jl. Nusantara Raya No 63. RT/04. RW 013. Kel. Beji, Depok, Jawa Barat, Sabtu (8/9) malam, sekira pukul 21:27, tiga orang korban satu di antaranya mengalami luka berat dan dua luka ringan. Kabid Humas Polda Metro Jaya, Kombes Pol Rikwanto mengatakan, ketiga korban adalah Mulyadi Tofik Hidayat,22, dan Febri Bagus Kuncoro,20, rumah persis di belakang TKP mengalami luka ringan. Sedangkan MR X (belum diketahui namanya) diduga kelompok pelaku ledakan mengalami luka berat pada bagian tangan kanan patah dan luka bakar sekitar 50 persen hingga 70 persen. “Selanjutnya korban dibawa ke RS Mitra Keluarga Jalan Margonda Raya Depok, pada Minggu (9/9) pukul 03:00 dinihari, kemudian korban yang luka parah dirujuk ke RS Polri Kramat Jati,” kata Rikwanto kepada wartawan di Mapolda Metro Jaya, Minggu (9/9).

Lanjut ke hal A2 kol. 4

Camat Namorambe Tutup Ternak Buaya Dua Ekor Masih Berkeliaran MEDAN ( Waspada): Setelah lepasnya tiga ekor buaya, Camat Namorambe Hendra Wijaya menyatakan menutup lokasi usaha peternakan buaya di Dusun III, Desa Delitua kecamatan tersebut sesegera mungkin. Penutupan dilakukan setelah pihak pengusaha tidak dapat menunjukkan izin usaha dari Pemkab Deliserdang, dan berdasarkan pertimbangan keamanan lokasi usaha yang tidak cocok dengan pemukiman warga sekitar. Menurut Hendra Wijaya kepada wartawan, Minggu (9/9), penutupan usaha ternak buaya terebut segera dilakukan, sementara evakuasi reptil yang dilindungi itu sesuai kesepakatan pengusaha dengan warga akan berlangsung selama enam bulan hingga delapan bulan ke depan. Lanjut ke hal A2 kol. 4

Kades, Masyarakat Asahan, T. Balai Dan Batubara Tepungtawari Amri KISARAN (Waspada) : H Amri Tambunan berasal dari lingkungan birokrat tulen merupakan salah seorang kandidat calon gubernur Sumatera Utara periode 2013-2018, bersama masyarakat Asahan, Tanjungbalai dan Batubara melakukan silaturrahmi bersama alim ulama, tokoh agama, pimpinan organisasi masyarakat dan generasi muda di pelataran Hotel Bumi Asahan, Kisaran Sabtu (8/9) sore. Silaturrahim yang diprakarsai Forum Aspirasi Kepala Desa (FAKDA) Asahan, Tanjungbalai dan Batubara berlangsung akrab

Lanjut ke hal A2 kol. 1

Waspada/Armin Nasution

PLT Gubsu didampingi para pejabat bank daerah saat meresmikan perubahan status Bank Sumut menjadi bank devisa, Jumat lalu.

Plt Gubsu Minta Eksportir Manfaatkan Fasilitas Devisa Bank Sumut MEDAN (Waspada): Plt Gubsu Gatot Pujo Nugroho meminta eksportir memanfaatkan Bank Sumut yang sudah ditingkatkan statusnya menjadi bank devisa untuk transaksi ekspor dan impor. Hal itu dikatakan Gatot saat peluncuran peningkatan status Bank Sumut dari bank umum daerah menjadi bank devisa di Ballroom Gedung Bank Sumut lt. 10, Jumat (79) malam. Dia mengatakan bank milik daerah itu juga jangan cepat

berpuas diri karena persaingan semakin ketat. Apalagi sudah ada satu bank daerah yang akan membuka cabang sampai ke luar negeri, itu patut ditiru, jelasnya. Tapi paling penting sesuai denga kebijakan BI, bahwa eksportir harus menempatkan hasil devisanya di bank dalam negeri, maka sudah sepantasnya para pedagang antar negara itu pun menyimpan di Bank Sumut, tutur Gatot. PT Bank Sumut memang berhasil meningkatkan status

dari bank pembangunan daerah menjadi bank devisa. Sekarang, bank ini bisa melayani transaksi devisa dan jasa bank terkait valuta asing. Direktur Umum PT Bank Sumut M Yahya mengatakan, Bank Indonesia (BI) sudah meningkatkan status Bank Sumut menjadi bank umum devisa. Dengan demikian, Bank Sumut bisa melayani transaksi devisa yang dibutuhkan eksportir dan importir

Lanjut ke hal A2 kol. 6

Ada-ada Saja Ceraikan Istri Karena Wajah Anak GARA-gara wajah sang anak tak mirip dengan kedua orangtua mereka, seorang suami asal China menggugat cerai istrinya. Seperti dilansir Weird News Asia pada Minggu (9/9), sebelum dikarunia anak, Jian Feng

Lanjut ke hal A2 kol. 2

Serampang Waspada/HM Husni Siregar

BUPATI Deliserdang H Amri Tambunan didampinggi Ketua PW NU Sumut H Ashari Tambunan disambut para ulama dan sejumlah tokoh masyarakat di Kab. Asahan, Sabtu (8/9).

- PON bukan Pekan Olah Nasional - He...he...he...

Simpan 46 Keping Koin Hindia Belanda 1920 LHOKSEUMAWE (Waspada): Mustafa Kamal, 31, warga Gampong Matang Panyang, Kec. Seunuddon, Kab. Aceh Utara, Minggu (9/9) mengaku menyimpan 46 keping koin Hindia Belanda keluaran tahun 1920. Koin tersebut peninggalan almarhum iparnya Basyaruddin, warga Lanjut ke hal A2 kol.6

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

SENIN, Pahing, 10 September 2012/23 Syawal 1433 H z zNo: 23978 Tahun Ke-66

Usul BNPT Soal Sertifikasi Ustadz Ditolak NU JAKARTA (Waspada): Pengurus Besar Nahdlatul Ulama (PBNU) menentang keras usulan Badan Nasional Penanggulangan Terorisme (BNPT) soal sertifikasi pemuka agama, sebagai salah satu langkah menekan aksi teror. Gelar kiai atau ustadz ditegaskan bukan pemberian pemerintah, sehingga tidak dibutuhkan langkah sertifikasi untuk melihat nasionalisme penyandangnya. “Panggilan kiai atau ustadz itu yang menyebutkan masyarakat, bukan pemberian dari Pemerintah. Pemerintah terlalu jauh kalau ngurusi hal-hal seperti ini,” tegas Ketua Umum PBNU KH Said Aqil Siroj di Jakarta, Minggu (9/9). Kiai Said lantas menganalogikan pernyatannya pada perintah menjalankan shalat, yang tidak perlu diatur dan diawasi secara langsung oleh Pemerintah. Ada elemen masyarakat yang memiliki kewajiban menjalankan tugas tersebut, dengan Pemerintah berada pada posisi memberikan dukungan. Terkait tudingan gagalnya deradikalisasi oleh pemuka agama, ditambahkan oleh Kiai Said, dinilai bukan sematamata karena rendahnya peran ulama. Kondisi yang ada saat ini diminta menjadi bahan introspeksi, baik oleh kalangan ulama, BNPT selaku institusi resmi, maupun seluruh elemen masyarakat. “Yang perlu diingat terorisme tidak mengakar pada budaya Islam. Jadi kalau aksi teror sampai sekarang masih ada, itu tidak semata-mata karena peran ulama yang kurang dalam deradikalisasi agama,” tambah Kiai Said. Lanjut ke hal A2 kol.2


SEJUMLAH pekerja menyelesaikan pelataran di sekitar tugu kapal Lancang Kuning yang berada di depan Stadion Utama Riau, Pekanbaru, Riau, Minggu (9/9). Tugu tersebut akan menandakan simbol dari Negeri Melayu Riau yang menjadi tuan rumah PON XVIII 2012. Pembukaan PON akan dibuka oleh Presiden Susilo Bambang Yudhoyono pada 11 September 2012.


WAKIL Presiden Boediono meninjau Stadion Kaharudin Nasution arena sepak bola PON XVIII 2012 di Rumbai Sport Center, Pekanbaru, Minggu (9/9).

Penyelesaian Fasilitas PON Terkendala PEKANBARU (Antara): Wakil Presiden Boediono menilai masih terdapat kendala untuk menyelesaikan fasilitas yang digunakan dalam PON XVIII di Pekanbaru, Riau, namun demikian hal itu jangan sampai menurunkan prestasi atlet nasional. “Memang di sana-sini masih ada kendala walaupun memang sudah ada banyak perbaikan dan kemajuan fasilitas,” kata Wapres kepada

pers usai meninjau sejumlah arena PON di Pekanbaru, Minggu (9/9). Hal tersebut disampaikan Wapres usai meninjau sejum-

Wapres Tinjau Sejumlah Arena lah lapangan seperti menembak, sepak bola, senam, wushu, tenis, serta Stadion Utama Riau yang akan digunakan pertandingan PON XVIII. Hadir dalam peninjauan tersebut Ibu Herawati Boediono, Menko Kesra Agung Laksono, Wakil Menteri PU Herman-

to Dardak, Wakil Mendikbud Musliar Kasim, serta Gubernur Riau Rusli Zainal. Menurut Wapres, sekalipun menemui sejumlah kendala sehingga penyelesaian fasilitas pendukung pertandingan dan atlet belum selesai 100 persen, hal itu hendaknya

tidak mengurangi semangat atlet untuk mencapai prestasi terbaiknya. Terkait dengan belum rampungnya fasilitas PON, Boediono mengingatkan semua pihak untuk tidak saling menyalahkan atas berbagai kekurangan dalam persiapan

Waspada/Armin Nasution

PLT Gubsu (kanan) didampingi para pejabat bank daerah itu saat meresmikan perubahan status Bank Sumut menjadi bank devisa, Jumat lalu.

Pemerataan Dan Plt Gubsu Minta Eksportir Manfaatkan Kesejahteraan Fasilitas Devisa Bank Sumut

AKHIR pekan lalu dan kemarin siang saya menghadiri beberapa acara paguyuban keluarga Jawa. Bayangkan ternyata paguyuban Jawa Catatan yang ada di Sumut itu sampai lebih Gus Irawan 30. Kalau sampai mereka menggelar acara masing-masing satu per hari alamat tak akan bisa saya datangi. Untunglah akhir pekan lalu itu ada beberapa paguyuban yang menyelenggarakan halal bi halal sekaligus. Tentu saja semua nuansa yang mereka tampilkan adalah kedaerahan. Mulai dari musik sampai makanan. Sebagian besar Lanjut ke hal A2 kol.3

Al Bayan

Al-Mukhbitin Oleh: H. Ameer Hamzah Dan berilah kabar gembira kepada almukhbitin (orang-orang yang merendahkan diri di hadapan Allah) Yakni orang-orang yang apabila disebut nama Allah akan gemetar hatinya..... (QS. al-Hajj:35) CUCU Rasulullah SAW Al-Hasan bin Ali bin Abi Thalib mengatakan; Alkhabat pada asalnya bermakna tempat yang rendah di tanah. Ikhbat artinya merendahkan diri, atau dengan kata lain memiliki sifat tawadhu’

Lanjut ke hal A2 kol. 6

kesalahan karena itu tidak baik, serta harus bisa tetap menjaga semangat PON di Solo. Jangan Ganggu Prestasi Saat meninjau lapangan menembak dan berdialog dengan sejumlah atlet menembak, Boediono menyampaikan pesan agar kendala sejumlah fasilitas jangan mengganggu prestasi atlet nasional. Lanjut ke hal A2 kol.1

Kuota Belum Terpenuhi, Kemenag Beri Kesempatan Calhaj 87 Tahun Ke Atas

Presiden Ajak Semua Pihak Berperan Cegah Terorisme VLADIVOSTOK, Rusia (Antara): Presiden Susilo Bambang Yudhoyono mengajak semua pihak untuk ikut aktif mencegah peluang terjadinya tindakan terorisme antara lain dengan ikut mengamati dan melaporkan apabila ada hal-hal yang mencurigakan dan ikut serta mengamankan lingkungan tempat tinggal masing-masing. “Tindakan terorisme tidak dibenarkan oleh kalangan manapun dan apapun sukunya. Mari kita terus menerus berani menyerukan hal tersebut termasuk para pemuka agama dan tokoh masyarakat. Tindakan preventif terus dilakuan bukan hanya tugas polisi dan intelejen namun juga semua pihak,” kata Presiden dalam keterangan pers usai KTT APEC di Vladivostok, Rusia, Minggu (9/9) malam waktu setempat terkait ledakan bom yang terjadi di Depok pada Sabtu (8/9) malam yang mencederai tiga orang. Kepala Negara, tindakan yang dilakukan adalah mencegah pikiran ekstrim dan cenderung melakukan aksi kekerasan melalui upaya persuasif dan pendidikan harus dilakukan secara berkelanjutan di lingkungan masyarakat. Lanjut ke hal A2 kol.4

penyelenggaraan. “Kendala yang terjadi harus sama-sama diatasi dan jangan saling salahkan. Buat event PON yang bisa dibanggakan masyarakat Riau dan nasional dan yang penting bukan soal menang kalah tapi semangat kebersamaan,”

Boediono Satu hal yang harus diperhatikan, kata Wapres, yaitu kegiatan ini harus ajang nasional yang semangatnya harus dijaga seperti PON pertama di Solo.“Semangat PON adalah kepercayaan diri untuk prestasi dan kebersamaan,” katanya. Wapres menegaskan bahwa, panitia penyelenggara harus fokus menyelesaikan kekurangan dan tidak saling lempar

MEDAN (Waspada): Plt Gubsu Gatot Pujo Nugroho meminta eksportir memanfaatkan Bank Sumut yang sudah ditingkatkan statusnya menjadi bank devisa untuk transaksi ekspor dan impor. Hal itu dikatakan Gatot saat peluncuran peningkatan status Bank Sumut dari bank umum daerah menjadi bank devisa di Ballroom Gedung Bank Sumut lt. 10, Jumat (79) malam. Dia mengatakan bank milik daerah itu juga jangan cepat

berpuas diri karena persaingan semakin ketat. Apalagi sudah ada satu bank daerah yang akan membuka cabang sampai ke luar negeri, itu patut ditiru, jelasnya. Tapi paling penting sesuai denga kebijakan BI, bahwa eksportir harus menempatkan hasil devisanya di bank dalam negeri, maka sudah sepantasnya para pedagang antar negara itu pun menyimpan di Bank Sumut, tutur Gatot. PT Bank Sumut memang berhasil meningkatkan status

Bus RAPI Tabrak Pasutri, Satu Tewas Satu Kritis

dari bank pembangunan daerah menjadi bank devisa. Sekarang, bank ini bisa melayani transaksi devisa dan jasa bank terkait valuta asing. Direktur Umum PT Bank Sumut M Yahya mengatakan, Bank Indonesia (BI) sudah meningkatkan status Bank Sumut menjadi bank umum devisa. Dengan demikian, Bank Sumut bisa melayani transaksi devisa yang dibutuhkan eksportir dan importir Sumut Lanjut ke hal A2 kol.1

Lanjut ke hal A2 kol.4

Gegana Amankan Sejumlah Granat Dan Peluru

Lanjut ke hal A2 kol.6

Adanya kesempatan bagi calon jamaah haji usia 87 tahun ke atas bersama pendampingnya, menurut Anggito Abimanyu, Dirjen PHU kepada wartawan di kantor Kemenag Jakarta, Sabtu (8/9) karena sampai hari terakhir masa pelunasan BPIH/ ONH tahap kedua 7 September, kuota haji tahun 1433H/2012 M sebanyak 211.000 orang belum terisi penuh, baik untuk haji reguler maupun haji khusus (BPIH Khusus/ ONH plus). Untuk itu, Kementerian Agama membuka masa pelunasan BPIH/ ONH tahap keti-

TELUKMENGKUDU (Waspada): Bus penumpang PT. RAPI BK 7076 DH menabrak pasangan suami istri (Pasutri) saat melintas di Jalinsum KM 47-48, Desa Sei Buluh, Kec. Teluk Mengkudu, Kab.Serdang Bedagai, Minggu (9/9) siang. Peristiwa itu mengakibatkan, sang istri Siti Hanum ,40, warga Dusun VIII, Desa Gambus, Kec. Lima Puluh, Kab.Batubara tewas, suaminya Ali kritis. Informasi Waspada himpun, saat itu kedua korban mengendarai Honda Supra BK 3898 VAK dari arah Tebingtinggi menuju Medan, setibanya di lokasi kejadian, sepedamotor mereka diserempat salah satu kendaraan yang belum diketahui identitasnya, kemudian keduanya bersama sepeda motor oleng dan jatuh. Di saat bersamaan muncul bus penumpang PT. RAPI BK 7076 DH, dikemudikan U. Sirait ,35, warga Jl. Perjuangan, Desa Sigara-gara, Patumbak, Kab.Deliserdang yang datang dari belakang melindas keduanya yang sedang

Kelompok Pengebom Luka Parah JAKARTA (Waspada): Akibat ledakan yang diduga bom di Yayasan Yatim Piatu Pondok Bidara, Jl. Nusantara Raya No 63. RT/04. RW 013. Kel. Beji, Depok, Jawa Barat, Sabtu (8/9) malam, sekira pukul 21:27, tiga orang korban satu di antaranya mengalami luka berat dan dua luka ringan. Kabid Humas Polda Metro Jaya, Kombes Pol Rikwanto mengatakan, ketiga korban adalah Mulyadi Tofik Hidayat,22, dan Febri Bagus Kuncoro,20, rumah persis di belakang TKP mengalami luka ringan. Sedangkan MR X (belum diketahui namanya)

JAKARTA (Waspada): Kementerian Agama (Kemenag) melalui Direktur Jenderal Penyelenggaraan Haji dan Umrah (PHU) memberikan kesempatan kepada calon jamaah haji berusia 87 tahun ke atas, berdasarkan database Sistem Komputerisasi Haji Terpadu (Siskoat) Kemenag per 31 Agustus 2012, dan satu orang pendampingnya untuk segera melakukan pelunasan Biaya Penyelenggaraan Ibadah Haji (BPIH/ ONH= Ongkos Naik Haji) tahap ketiga dimulai Selasa (11/9) besok sampai Jumat (14/9).

ga dari tanggal 12 sampai 14 September 2012 bagi jamaah calon haji khususnya yang berusia 87 tahun ke atas bersama satu orang pendamping. Namun demikian, Anggito tidak menyebutkan berapa jumlah jamaah calon haji diatas 87 tahun bersama pendampingnya yang mendapat kesempatan melunasi BPIH/ ONH tahap ketiga tersebut. Menurut Anggito, teknis pengisian kuota untuk pendamping, dilakukan di Kanwil dengan User ID khusus dan Lanjut ke hal A2 kol.1

Ada-ada Saja

Ceraikan Istri Karena Wajah Anak GARA-gara wajah sang anak tak mirip dengan kedua orangtua mereka, seorang suami asal China menggugat cerai istrinya. Seperti dilansir Weird News Asia pada Minggu (9/9), sebelum dikarunia anak, Jian Feng hidup bahagia dengan istrinya yang cantik. Namun setelah istrinya melahirkan, Feng mendadak kecewa karena wajah sang anak tidak memiliki kemiripan dengan mereka. Dengan perasaan curiga, Feng memaksa istrinya untuk mengatakan siapa sebenarnya ayah dari bayi mereka. Pria ini juga memaksa istrinya untuk mengakui bahwa sebelum menikah sang istri melakukan operasi plastik supaya memiliki penampilan bisa lebih cantik. Setelah dibawa ke pengadilan, Feng akhirnya memenangkan gugatan cerai atas istrinya dan berhak mendapat uang tuntutan sebesar 120.000 dolar AS atau sekira Rp 1,1 miliar, setelah membuktikan bahwa istrinya telah menipunya agar wanita itu bisa menikah dengannya. (rzl)

Serampang Antara

SEJUMLAH anggota polisi beserta Tim Labfor dan INAFIS Polri mengamankan sejumlah barang bukti saat olah TKP di lokasi ledakan rumah Yayasan Yatim Piatu Pondok Bidara, Jalan Nusantara, Beji, Depok, Jabar, Minggu (9/9).

- Yang lancar korupsinya - He.... he....he....

Berita Utama


WASPADA Senin 10 September 2012

Gus: Masyarakat Sumut Ingin Sejahtera

Kuota... petugas khusus yang ditunjuk oleh Kepala Kantor Wilayah Kementerian Agama Provinsi. “Jamaah haji yang telah dikonfirmasi ke dalam database Siskoat, akan diberi surat pengantar oleh Kanwil Kementerian Agama Provinsi ke Bank Penerima Setoran (BPS) BPIH tempat setor semula untuk melakukan pelunasan BPIH,” ujar Anggito sambil menambahkan, untuk calhaj yang berdomisili jauh dari Kanwil, surat pengantar dapat diberikan oleh Kantor Kementerian Agama Kabupaten/Kota setelah mendapat pemberitahuan dari Kanwil Kemente-

rian Agama Provinsi. Selain untuk calon haji reguler, sisa kuota jamaah haji khusus (ONH plus) tahun 1433H/ 2012 M juga dialokasikan untuk calon haji khusus berusia minimal 87 tahun sesuai database Siskoat per tanggal 31 Agustus 2012. Selain itu, bagi petugas Penyelenggaraan Ibadah Haji Khusus (PIHK) yang belum memiliki petugas kesehatan, serta penggabungan antara suami dengan istri dan orangtua dengan anak. “Tapi ini harus dibuktikan dengan dokumen yang sah,” ujar Anggito menambahkan bahwa aturan ini dimaksudkan untuk meningkatkanpelayanankepada

Penyelesaian... “Semangat yang baik walau memang ada kendala tapi jangan ganggu prestasi dan jaga sikap baik terhadap PON,” kata Wapres. Di depan atlet, Wapres juga mengingatkan bahwa PON bisa jadi sarana untuk saling mengenal sama lain kenal. “Selamat bertanding,” kata Wapres. Dalam kunjungan ke sejumlah lapangan memang masih banyak bangunan dan fasilitas yang belum selesai. Seperti di lokasi pertandingan Wushu, jalan menuju ke tempat itu masih berupa tanah sehingga becek saat hujan. Demikian juga di gedung lapangan menembak, sebagian ruangan belum dipasang lantai keramik tapi masih dilapisi semen. Juga di Stadion Utama Riau yang nanti akan digunakan untuk acara pembukaan, puing sisa bangunan masih berserakan dan beberapa bagian bangunan belum terpasang partisi. Sebelum meninggalkan Riau, Wapres juga berkesempatan meninjau ruang VVIP Bandara Sultan Syarif Kasim II yang juga belum selesai 100 persen pembangunannya, terlihat dengan masih berserakan puing2 di sekitar gedung.

Plt Gubsu... sekaligus meningkatkan kontribusi Bank Sumut dalam menggerakkan perekonomian daerah. “Keberhasilan yang dicapai Bank Sumut karena kemampuan seluruh jajaran pengelola dan karyawan Bank Sumut yang sudah dibangun manajemen sebelumnya,” kataYahya. Bank devisa merupakan bank yang memeroleh surat penunjukan dari BI untuk melakukan kegiatan usaha perbankan dalam valutas asing. Bank devisa dapat menawarkan jasa-jasa bank yang berkaitan dengan mata uang asing seperti transfer ke luar negeri, jual-beli valuta asing, transaksi eksporimpor, hingga pengucuran kredit dengan mata uang asing. Yahya menuturkan,besarnya transaksi ekspor-impor di Sumut menjadi salah satu pertimbangan manajemen untuk meningkatkan status Bank Sumut menjadi bank devisa. Sebab bisa dilihat Sumut sangat kaya sumber daya alamnya dengan keberagaman komoditas berorientasi ekspor yang prospektif, terutama komoditas unggulan seperti crude palm oil(CPO), kata dia. Kemudian ada juga calon nasabah potensial Bank Sumut yang kegiatan usahanya perdagangan ekspor impor. “Sebagai tahap pertama, kami menargetkan setidaknya 10 persen sampai 20 persen transaksi ekspor di Sumut dapat dilayani Bank Sumut,” ujarnya. Selain itu, setelah menjadi bank devisa, Bank Sumut juga meluncurkan Call Center 14002 untuk meningkatkan pelayanan menuju BPD Regional Champion 2014. Layanan ini disediakan untuk memenuhi kebutuhan masyarakat khususnya nasabah guna mengetahui produk,menyampaikan keluhan,dan membantu nasabah dari penipuan pihak yang tidak Jawaban Problem Catur, bertanggung jawab. (m06)

TTS Dan Sudoku


Dari Halaman Sport.

Kiai Said meminta BNPT tidak meragukan peran ulama dalam menjalankan deradikalisasi, terutama dari kelompok Organisasi Kemasyarakatan yang berdiri jauh sebelum kemerdekaan Indonesia seperti NU dan Muhammadiyah. “Saya selalu katakan, ormas-ormas dan ulamanya yang keberadaannya memperkuat Umum Pancasila sebagai dasar negara, Serba “Wang” itu harus didukung. Sebaliknya, Ormas yang keberadaannya merongrong Pancasila, itu bahkan tidak perlu sertifikasi, tetapi langsung bubarkan saja,” pungkas Kiai Said menandaskan. Sebelumnya, BNPT melalui Direktur Deradikalisasi Irfan Idris, mengusulkan dilakukannya sertifikasi da’i dan ustadz. Langkah yang sudah dijalankan di Singapura dan Arab Saudi tersebut dinilai bisa mengukur sejauh mana peran ulama dalam menumbuhkan gerakan radikal sehingga dapat diantisipasi.(vn)

Jawaban Problem Catur: 1. Kf6xh7+, Rg8. 2. Kh7-f6+, Rf8. 3. Mh8+, Bg8. 4. MxB+, Re7. 5. Mf7+mat atau Mg7+mat. Jawaban TTS: TTS Topik


Jawaban Sudoku: 8 6 9 1 4 7 5 2 3

7 3 2 9 8 5 4 1 6

1 4 5 6 3 2 9 7 8

9 2 1 8 7 4 6 3 5

3 8 7 5 1 6 2 9 4

6 5 4 3 2 9 7 8 1

4 9 8 2 6 3 1 5 7

2 1 6 7 5 8 3 4 9

5 7 3 4 9 1 8 6 2

Tulisan Kuliner di Kolom Dapur Kita berjudul Sup Iga yang terbit Minggu (9/9) di halaman B5 terjadi kesalahan tekhnis dalam pengambilan file artikel, termuat berjudul Sup Iga, seharusnya Sup Daging Sapi, akan dimuat pada edisi kuliner minggu depan. Demikian diperbaiki. Redaksi

jamaah haji khusus (ONH plus). Anggito meminta kepada Asosiasi/ Himpunan penyelenggara ibadah haji khusus segera melakukan verifikasi atas usulan PIHK dan menyampaikan hasilnya kepada Dirjen PHU paling lambat tanggal 11 September 2012 pukul 15:00. Untuk itu, Asosiasi/ Himpunan penyelengaraan ONH plus, diminta mengambil surat pengantar setoran pelunasan BPIH khusus mulai 12 September 2012 pukul 11:00 di Direktorat Pelayanan Haji. Setelah itu, mereka harus menginformasikan kepada PIHK untuk melakukan pelunasan pada tanggal 13 sampai 14 September 2012 pukul 08:00 -15.00 melalui BPS BPIH tempat setor awal. Kepada seluruh calon jamaah haji, baik reguler maupun khusus, yang sesuai dengan ketentuan-ketentuandiatas,agarsegera melakukan pelunasan BPIH, harap Anggito Abimanyu. ( j06 )

Pemerataan... pengurusnya saya kenal. Dan ketika didaulat memberi sambutan saya langsung tertuju pada jagung rebus. Karena dikemas kedaerahan maka makanan yang tersaji di situ juga sederhana. Ada jagung rebus, ubi goreng, ubi rambat rebus serta beberapa yang lain. Lalu saya pun bercerita soal jagung rebus itu. Bukan untuk mengecilkan arti perkebunan di Sumut. Lalu saya bilang dan yakin jagung yang dimakan tadi adalah jagung hawai. Ini sekadar pengantar buat saya berbicara lebih luas. Maksudnya adalah Sumut yang dikenal daerah pertanian, perkebunan, peternakan dan keunggulan di sektor lain tetap harus bergulat dengan barang impor. Uniknya barang impor itu cenderung yang kita konsumsi. Jagung itu jadi contoh. Belum lagi kalau kita bicara soal sapi Australia. Atau beras impor yang didatangkan pemerintah pusat. Semua menunjukkan betapa lemahnya kita menguasai perekonomian sendiri. Saya cenderung yakin kalau tak sanggup memaksimalkan potensi yang ada terutama kebutuhan pangan daerah ini kita akan selalu ‘terjajah’. Karena itu baru sebagian komoditas. Belum lagi misalnya gula, tepung terigu, gandum dan kacang kedele yang sempat diributkan perajin tahu dan tempe tempo hari. Kalau kondisinya begini berarti Sumut memang belum mapan secara ekonomi. Belum mampu memenuhi kebutuhan sendiri. Dengan menggantungkan kebutuhan pokok saja pun dari impor itulah pangkal

KIRA-KIRA apa prioritas utama yang diinginkan masyarakat Sumut? Itulah yang selama ini menjadi beban fikiran yang dihadapi Gus Irawan Pasaribu, mantan direktur utama Bank Sumut itu. Klaim pertumbuhan tinggi bukan acuan untuk menentukan masyarakat hingga level terbawah bisa menikmatinya. Di tengah kesibukannya yang sedang merintis menjadi calon gubernur Sumut 2013, dia sempat meluangkan waktunya diwawancarai khusus wartawan di Gus Center akhir pekan lalu. Walau tensi politik kian meninggi, namun lelaki kelahiran 48 tahun lalu itu tetap santai dan seperti tanpa beban. Jika dulu dia sering dihadapkan pada pertanyaan berapa dana terhimpun, berapa pinjaman bergulir dan berapa rasio kredit bermasalah, kini topik itu berganti drastis. Pertanyaan wartawan kini sudah mencakup skala yang

lebih luas yaitu seputar Sumatera Utara. Kira-kira menurut Gus, apa yang diharapkan warga Sumut. Menurut dia, itu hanya memerlukan jawaban singkat. “Sumut Sejahtera.” Itulah yang diinginkan masyarakat Sumut. Dalam berbagai kesempatan sebenarnya Gus Irawan selalu berteriak “salam Sumut Sejahtera’. Biasanya salam tersebut dibalas masyarakat dengan menyatakan hidup Gus Irawan. Membawa jargon Sumut Sejahtera pun membuat popularitas ketua Masyarakat E k o n o m i Sy a r i a h ( M E S ) Sumut terus naik karena sudah identik dengannya. Kerja kerasnya saat menjadi Dirut di Bank Sumut menggulirkan Kredit Peduli Usaha Mikro Sumut Sejahtera 1 dan Kredit Peduli Usaha Mikro Sumut Sejahtera 2 ( disingkat KPUM SS1 & KPUM SS2 ) atau biasa disebut SS1 dan SS2 kian menguatkannya sebagai


memiliki latar belakang yang terpelajar,” kata Presiden. Oleh karena itu, selain tugas negara dan aparat keamanan untuk terus menerus mencegah potensi aksi terorisme peran elemen masyarakat lainnya juga sangat penting sehingga pencegahan aksi terorisme bisa berlangsung dengan baik.

“Akar kekerasan sudah sejak lama. Dan bukan hanya di Indonesia, di seluruh dunia pun ada. Ini yang pertama harus kita pahami. Akarnya sendiri ada berbagai macam penyebab adak karena kebodohan namun ada juga yang

terkapar di badan jalan, mengakibatkan sang istri tewas dan suami kritis. Pihak Satlantas bersama warga yang mengetahui peristiwa itu langsung melakukan pertolongan, walaupun bus RAPI sempat kabur menuju

Medan, namun berkat informasi masyarakat bus tersebut berhasil diamankan Polisi. Kasatlantas Polres Sergai, A K P. Ha s a n B a s r i k e t i k a d i k o n f i r m a s i Wa s p a d a membenarkan peristiwa tersebut dan pihaknya telah menanga ni perkaranya, terangnya. (c03)

instabilitas ekonomi. Andai harganya naik di pasar internasional tentu di dalam negeri akan ikut. Acuannya begini, kalau kita sekarang mengimpor beras dari Thailand dan kemudian harganya di sana naik pasti di dalam negeri pun begitu. Sama dengan kacang kedelai yang dibutuhkan perajin tahu dan tempe beberapa waktu lalu. Masalah klasik waktu itu karena kacang kedelai mahal di luar negeri lalu di dalam negeri pun begitu. Intinya adalah kita tidak mampu mencegah ‘intervensi harga asing’ Harga naik otomatis inflasi (daya beli kita rendah). Kita pun mengimpor inflasi dari negara lain. Hakikat jadi konsumen memang begitu. Maka saya sering nyatakan bahwa ekonomi kita itu tumbuh karena dorongan konsumsi. Sudah terlalu banyak barang dan bahan kebutuhan pokok impor. Menyenangkan negara produsen lain tapi membuat kita makin tersudut. Saya bukan ingin berwacana tapi mana kekuatan Sumut yang dulu kita miliki. Produksi beras Sumut dulu terkenal selalu berlebih. Bahkan bisa dijual ke provinsi tetangga. Namun secara perlahan kita pun sempat beberapa kali menikmati beras impor itu. Pertumbuhan ekonomi Sumut memang tinggi. Selalu di atas angka nasional dan tahun ini seperti biasa bergerak di angkaenampersendantujuhpersen. Secara makro indikator itu bagus. Siapa pun akan memujinya. Bahkan kita sangat bangga ketika Presiden berpidato tentang pertumbuhan ekonomi di Asia sepanjang tahun lalu hanya ada tiga negara tumbuh

positif. Termasuk Indonesia. International Monetary Fund (IMF) lembaga yang dulu menolong kita saat krisis ekonomi dan Bank Dunia pasti memuji pertumbuhan itu. Termasuk Sumut. Tapi ambivalen. Saya pekan lalu bertemu dengan seorang pelaku bisnis yang bergerak di bidang ekspor. Dia bercerita kalau mau indikator yang sesungguhnya adalah lihat angka kemiskinan. Kemudian coba tanya supir angkot dan abang-abang becak. Apa jawaban mereka soal ekonomi kini. Pasti jawabannya kian sulit dibanding tahun lalu dan tahun sebelumnya. Kalau jawaban mereka riil seperti itu masih maukah kita mengklaim pertumbuhan tinggi. Dia juga menyinggung tentang kemiskinan di Nias, banyaknya pasien miskin serta tingkat kematian bayi yang juga tak berubah. Saya fahami, maksud si pebisnis sebenarnya adalah ingin mengatakan kalau mau melihat pertumbuhan cek dengan angka riil. Pertumbuhan boleh tinggi tapi harus merata, itu yang ingin dia sampaikan sepertinya. Masyarakat tak peduli ekonomi tumbuh tinggi. Mereka hanya tahu harga beras murah, kebutuhan pokok tidak naik dan tetap terjangkau, kesehatan terjamin, anak-anak bisa sekolah tinggi. Dan satu lagi indikator nya kalau di kampung saya Tapsel dan Mandailing Natal bisa menyimpan emas sedikitsedikit dan mampu naik haji. Intinya pertumbuhan ekonomi boleh tinggi tapi dengan memperhatikan pemerataan untuk seluruh Sumut yang sejahtera. ‘Salam Sumut Sejahtera’.


salah satu ikon pendorong ekonomi kerakyatan. Kini Sumut Sejahtera melekat dengannya. Namun yang sedikit membuatnya perlu menjelaskan kenapa itu melekat dalam pribadi Gus, ketika salah seorang dosen USU mengkritisinya Kira-kira dosen itu menyatakan Gus Irawan tidak pantas membawa konsep Sumut Sejahtera dalam setiap pertemuannya atau saat berkunjung dengan masyarakat. Sebab itu dulu dirintisnya di Bank Sumut, jadi tak pantas Gus mendengung-dengungkan Sumut Sejahtera sekarang apalagi dibawa-bawa untuk mencapai cita-citanya menjadi salah satu bakal calon Gubsu. Gus Irawan agak terkejut dan merasa tergelitik dengan itu. Namun dia bertutur program Sumut Sejahtera sudah menjadi cita-citanya sejak lama dah bahkan sudah berada dialam bawah sadarnya. “Sumut Sejahtera itu cita-cita abadi saya, sebagai putera

daerah yang lahir, besar, bersekolah, berkarir dan tentu berkewajiban untuk membangun Sumut. Saya berharap dan seyogianya Sumut Sejahtera menjadi cita-cita bersama seluruh masyarakat Sumut karena sesungguhnya itulah yang dibutuhkan masyarakat.” Untuk apalah pertumbuhan ekonomi tinggi bila tidak terjadi pemerataan. Sesungguhnya yang tidak kalah pentingnya adalah meningkatkan daya beli masyarakat, sehingga mereka dapat hidup layak, kata dia. Gus Irawan ingin menjelaskan sesungguhnya Sumut Sejahtera itu harus wujud siapa pun pemimpin Sumut. “Saya fikir tidak salah, bahkan itu menjadi kewajiban bagi setiap pemimpin mensejahterakan rakyatnya. Dan kebetulan dulu saya bergelut dengan 70 ribuan ibu-ibu. Memfasilitasi mereka mendapatkan modal.” Itu mensejahterakan mereka, kata Gus Irawan. “Hanya saja itu kan masih dalam satu

bidang,” kata dia. Padahal Sumut butuh kesejahteraan di bidang kesehatan, pendidikan, masyarakat miskin, infrastruktur, pariwisata, budaya, olahraga bahkan reformasi birokrasi. “Lalu kenapa harus diperdebatkan kalau konsep itu bagus. Saya fikir bukan itu yang perlu disoal tapi bagaimana kita saling mengisi untuk Sumut yang lebih sejahtera,” ujarnya. Saat ini yang difahaminya adalah Sumut harus sejahtera yang kemudian dituangkannya dengan dua kata melekat yaitu Sumut Sejahtera. “Jadi bukan karena itu dulu program di Bank Sumut lalu dibawa-bawa sampai sekarang. Namun itulah cita-cita abadi yang datang dari alam bawah sadar.” Dan siapa pun yang sebenarnya ingin mengusung Sumut Sejahtera tidak perlu dipermasalahkan karena citacita tersebut pasti ditujukan untuk seluruh masyarakat Sumatera Utara.(m06)


ga utuh hingga sekarang. Sekitar tiga tahun lalu, Basyaruddin mewasiatkan kepada Syamsidar, jika dia sudah meninggal dunia agar menjaga mata uang tersebut dengan baik dan tidak boleh bilang sama siapa-siapa, karena siapa tahu mata uang tersebut berharga. Kini Basyaruddin telah tiada, dan sesuai amanah almarhum, Mustafa Kamal kini sedang mencari peminat mata uang kuno. Kalau ada yang berminat, mata uang tersebut akan dijual. Untuk komunikasi selanjutnya, peminat dapat menghubungi nomor HP 085224285825. (b18)

MUSTAFA Kamal memperlihatkan mata uang kuno peninggalan Hindia Belanda tahun 1920.

butir peluru dan dua pucuk senpi Enggran masih dalam rangkaian. “Disamping itu, kami juga menyita peluru 9 mm sebanyak 50 butir, 22 mm sebanyak 30 butir, batre 9 volt sebanyak 5 buah, swiching dalam rangkaian sebanyak 6 buah, talkit, gambar pejera, laras dan magazen (manual ), serta black powder, potasium kl 7 kg, 1unit detonator elektrik, kabel serabut dan tunggal serta paralon ukuran 11/4 inci sebanyak 6 buah sudah terisi,” terang Rikwanto. Dari hasil olah TKP (tempat kejadian perkara) serta hasil pemeriksaan sejumlah saksi yang dilakukan tim gabungan kepolisian, setelah ledakan yang terjadi di Yayasan Yatim Piatu Pondok Bidara beberapa saksi melihat ada dua orang menggunakan sepeda motor. “Kami telah memeriksa

saksi Nano Triawan,63, tukang bangunan, orang tua dari korban Mulyadi Tofik Hidayat,22, dan Febri Bagus Kuncoro, 20, Wulandari ,27, bekerja seharihari sebagai SPG, anak dari Nano Triawan yang merupakan warga di belakang TKP dan pemilik tanah dan bangunan Lukman Fariz,45, melihat dua sepeda motor sesaat peristiwa ledakan tersebut terjadi,” kata Rikwanto. Dari keterangan korban Mulyadi Tofik yang baru pulang kerja dari Pondok Kelapa, Jakarta Timur, melihat dua unit motor Honda Grand yangg bertamu ke tempat Mr. X, tidak lama kemudian saksi melihat seorang teman Mr. X meloncat dari pagar dan satu orang lagi pergi mengendarai sepeda motor. “Sekitar 5 menit kemudian terjadi ledakan yang diduga bersumber dari kamar Mr. X,” ungkap Rikwanto.(j02)

dalam menghadapi tantangan, membayar zakat, menunaikan ibadah haji, dan gemar bersilaturahmidengansesamamanusia. Al-Mukhbitin tidak dilalaikan oleh duniawi, tidak tertipu oleh rayuan nafsu birahi, setan, tidak tergoda oleh harta, pangkat dan jabatan, maksudnya tidak akan dicari secara haram, tetapi bila harta, pangkat dan jabatan itu datang secara halal juga tidak ditolak karena itu amanah Allah SWT. Mereka tidak ingin menzalimi manusia, karena hatinya yang sangat bersih dan suci, tidak pernah meminta-minta karena harga dirinya tinggi, tidak mudah marah apabila manusia yang menjelek-jelekkan, dan tidak terlena dengan sanjungan

manusia kepadanya. Mereka memilki sifat tadharru’ dan tawazzu’. Para al-Mukhbitin ini kadang-kadang sudah langka di zaman modern ini. Jika ada satu-satu tidak mencuat ke permukaan. Sebab kaum ini tidak mendapat perhatian dari kegelapan dunia yang buta kepada kebenaran. Beda dengan kaum munafik yang terkenal namanya karena mendapat perhatian luas dari media massa, baik televisi maupun media cetak. AlMukhbitin ibarat emas dan intan yang tersembunyi dalam tanah. Harga tetap mahal, namun har us digali dan didulang dulu baru mendapatkannya.

Rambong, Kab. Bener Meriah. “Mata uang kuno itu merupakan mata uang masa peninggalan kolonial Nederlandsch Indie dengan harga per koin 2,5 sen. Saya tidak tahu bagaimana uang itu ada sama Abang Basyaruddin. Uang kuno tersebut diberikan kepada saya oleh Syamsidar, 48, kakak kandung saya yang disimpan di kantong sebanyak 46 koin,” kata Mustafa Kamal. Menurut Syamsidar, mata uang kuno tersebut disimpan keluarga Basyaruddin secara turun temurun dan tetap terja-

Kelompok... diduga kelompok pelaku ledakan mengalami luka berat pada bagian tangan kanan patah dan luka bakar sekitar 50 persen hingga 70 persen. “Selanjutnya korban dibawa ke RS Mitra Keluarga Jalan Margonda Raya Depok, pada Minggu (9/9) pukul 03:00 dinihari, kemudian korban yang luka parah dirujuk ke RS Polri Kramat Jati,” kata Rikwanto kepada wartawan di Mapolda Metro Jaya, Minggu (9/9). Dari lokasi ledakan tersebut, kata Rikwanto, polisi menemukan dua granat dan tiga pucuk senjata api berbagai jenis serta benda-benda berbahaya lainnya. Tim penjinak bom (Gegana) Polda Metro Jaya telah mengamankan granat yakni, satu granat manggis dan satu granat asap, satu pucuk senjata api Bareta berisi amunisi 17

Al-Bayan... (merendahkan diri di hadapan Allah SWT). Orang-prang yang merendahkan diri disebut almukhbitin. Sifat semacam ini sangat dicintai Allah dan manusia. Al-Hasan menjelaskan, al-Mukhbitin ini sebenarnya orang mukmin yang dijanjikan Allah masuk surga. Penjabaran dari sifat ini, seseorang itu benar-benar takut kepada Allah SWT, kusyuk dalam shalatnya, tidak tergesagesa dalam mengambil tindakan, suka bertafakkur dan bersyukur, memuliakan manusia, bermurah tangan (suka menolong), suka berpuasa sunat, tidak menghitung-hitung rezeki sehingga tidak kikir, bersabar

Waspada/Maimun Asnawi


Berita Utama Istri Tewas ... Informasi Waspada himpun, saatitukeduakorbanmengendarai Honda Supra BK 3898 VAK dari arah Tebingtinggi menuju Medan, setibanya di lokasi kejadian, sepedamotormerekadiserempet salah satu kendaraan yang belum diketahuiidentitasnya,kemudian keduanya bersama sepeda motor oleng dan jatuh. Di saat bersamaan muncul bus penumpang PT. RAPI BK 7076 DH, dikemudikan U. Sirait ,35, warga Jl. Perjuangan, Desa Sigara-gara, Patumbak, Kab. Deliserdang yang datang dari

Kemenag Beri ...

Deteksi Dini ... Plt Gubsu mengakui heterogenitas Sumut berpotensi terjadinya gesekan sebagai pemicu terjadinya konflik melalui isu SARA. ”Sejauh ini masyarakat Sumut cukup dewasa dan cer-

das mengelola heterogenitas itu sehingga Sumut tetap kondusif, namun kita tidak boleh lengah, terutama mendeteksi secara dini jika ada potensi ke arah itu,” ujarnya pada orientasi yang berlangsung dua hari tersebut. Kabid Pembinaan Kewas-

Penyelesaian Fasilitas PON ... “Semangat PON adalah kepercayaan diri untuk prestasi dan kebersamaan,” katanya. Wapres menegaskan bahwa, panitia penyelenggara harus fokus menyelesaikan kekurangan dan tidak saling lempar kesalahan karena itu tidak baik, serta harus bisa tetap menjaga semangat PON di Solo. Saat meninjau lapangan menembak dan berdialog dengan sejumlah atlet menembak, Boediono menyampaikan pesan agar kendala sejumlah fasilitas jangan mengganggu prestasi atlet nasional. “Semangat yang baik walau memang ada kendala tapi jangan ganggu prestasi dan jaga sikap baik terhadap PON,” kata Wapres. Di depan atlet, Wapres juga mengingatkan bahwa PON bisa jadi sarana untuk saling mengenal sama lain kenal. “Selamat bertanding,” kata Wapres. Dalam kunjungan ke sejumlah lapangan memang masih banyak bangunan dan fasilitas yang belum selesai. Seperti di lokasi pertandingan Wushu, jalan menuju ke tempat itu masih berupa tanah sehingga becek saat hujan. Demikian juga di gedung lapangan menembak, sebagian ruangan belum dipasang lantai keramik tapi masih dilapisi semen. Juga di Stadion Utama Riau yang nanti akan digunakan untuk acara pembukaan, puing sisa bangunan masih berserakan dan beberapa bagian bangunan belum terpasang partisi.

Kades, Masyarakat Asahan, ... dan penuh kekeluargaan disambut hangat dengan kesenian Reog Ponorogo, Gondang Batak, pengalungan bunga, diulosi dengan iringan shalawat badar. Di awali pembacaan ayat suci Alquran, selanjutnya sebagai ungkapan rasa syukur dan kekeluargaan dilakukan penepung tawaran pemberi semangat dan doa oleh masyarakat yang dihadiri berbagai elemen masyarakat diantaranya Syech Muda Tajudin SPd, Zulfan S.Sos, Abd Kholiq, Syahrul Gani, Persulukan Naksabandiyah, pengusaha daerah Amiruddin Siregar, Rusli Indra Gunawan Sirait, H Razali Damanik, tokoh Nahdlatul Ulama Batubara H Syahrum HH, Abd Hamid MS, Drs Mohd Masrob MPd, tokoh Nahdlatul Ulama Asahan KH A Fadillah, Ketua Nahdlatul Ulama Tanjung Balai Drs H Ashari Sima dan Ulama H Ismail Efendi serta seribuan wargamasyarakatdankaumibudariberbagaiperkumpulanpengajian. H Amri Tambunan yang didaulat menyampaikan maksud kunjungan menyatakan rasa haru dan gembira melihat suasana kekeluargaan yang ditunjukkan warga dalam menyambut kehadirannya. Amri menyatakan kehadirannya tidak sekedar bernostalgia mengenang daerah kelahirannya di Kota Tanjungbalai pada 63 tahun lalu (23 Januari 1949-red), tapi dalam kehidupannya ia terus mengikuti jejak perjuangan ayahnya H Djamaluddin Tambunan (alm) yang pernah menjabat sebagai wedana di Tanjungbalai pada 1946, Patih Asahan tahun 1947, Bupati Labuhanbatu tahun 1949, Walikota Pematangsiantar tahun 1957, Bupati Simalungun tahun 1959. Amri mengatakan, dirinya sebagai birokrat tulen dilatar belakangi pendidikan, karir dan pengalaman di pemerintahan. Karenanya, niat baik untuk maju dalam bursa Pilkada Gubsu 2013 tidak terlepas dari upaya membangun pemerintahan yang sesungguhnya. Menurutnya, tidak dapat dipungkiri untuk membangun sebuah provinsi yang baik sebagaimana yang menjadi harapan harus dimulai dari penataan kabupaten dan kota dengan melibatkan seluruh unsur.Untuk mencapai sasaran itu, perlu dukungan doa restu dari seluruh lapisan masyarakat, terutama warga masyarakat di daerah ini yang sudah dianggapnya sebagai Jawaban Problem Catur, keluarga terdekat Sementara mewakili maTTS Dan Sudoku syarakat Fahrurrozi Sitorus warga Kota Tanjungbalai menyataDari Halaman Sport. kan siap mendukung sepenuhnya.Tidak ada pilihan lain dengan alasan mereka sudah sejak Jawaban Problem Catur: lama mendengar dan melihat kinerja H Amri Tambunan yang 1. Kf6xh7+, Rg8. tidak mengenal lelah mengga2. Kh7-f6+, Rf8. gas berbagai program dan memihak kepada kepentingan ma3. Mh8+, Bg8. syarakat sehingga berhasil dan dipercaya menjabat Bupati De4. MxB+, Re7. liserdang dua priode (2004-2009 dan 2009-2014).(a06) 5. Mf7+mat atau


Ada-ada Saja ...

Jawaban TTS: TTS Topik

Umum Serba “Wang”


Jawaban Sudoku: 8 6 9 1 4 7 5 2 3

7 3 2 9 8 5 4 1 6

1 4 5 6 3 2 9 7 8

9 2 1 8 7 4 6 3 5

3 8 7 5 1 6 2 9 4

6 5 4 3 2 9 7 8 1

hidup bahagia dengan istrinya yang cantik. Namun setelah istrinya melahirkan, Feng mendadak kecewa karena wajah sang anak tidak memiliki kemiripan dengan mereka. Dengan perasaan curiga, Feng memaksa istrinya untuk mengatakan siapa sebenarnya ayah dari bayi mereka. Pria ini juga memaksa istrinya untuk mengakui bahwa sebelum menikah sang istri melakukan operasi plastik supaya memiliki penampilan bisa lebih cantik. Setelah dibawa ke pengadilan, Feng akhirnya memenangkan gugatan cerai atas istrinya dan berhak mendapat uang tuntutan sebesar 120.000 dolar AS atau sekira Rp 1,1 miliar, setelah membuktikan bahwa istrinya telah menipunya agar wanita itu bisa menikah dengannya. (rzl)

4 9 8 2 6 3 1 5 7

2 1 6 7 5 8 3 4 9

5 7 3 4 9 1 8 6 2

Tulisan Kuliner di Kolom Dapur Kita berjudul Sup Iga yang terbit Minggu (9/9) di halaman B5 terjadi kesalahan tekhnis dalam pengambilan file artikel, termuat berjudul Sup Iga, seharusnya Sup Daging Sapi, akan dimuat pada edisi kuliner minggu depan. Demikian diperbaiki. - Redaksi-

padaan Nasional Badan Kesbangpol Zulkarnain Rangkuti mengemukakan, orientasi guna mensinkronkan gerak sinerjitas penanganan potensi konflik mulai dari tingkat kelurahan dan desa sebagai ujung tombak melalui interaksi produktif bupati dan wali kota dalam menggerakkan potensi Kesbangpol di wilayahnya masing-masing. Eddy Syofian atas nama Plt Gubsu mengimbau para bupati dan wali kota mendayagunakan potensi Kesbangpol Linmas setempat guna menggerakkan dan mengasah kepekaan masyarakat dalam deteksi dan cegah dini penanganan konflik. Khusus dalam menyikapi suasana perpolitikan dan kemasyarakatan menjelang Pilgubsu 2013, diakui konstalasi akan semakin meningkat sehingga semuapihakharuslebihpekadalam menjaga suasana agar tetap kondusif, aman dan damai. “Kita bersyukur komitmen untuk ini sudah tergalang baik di Sumut hanya saja perlu terus diaktualisasikan,” sebutnya seraya menginformasikan bantuan perguruan tinggi juga signifikan antara lain telah hadirnya Pusat Studi Konflik dan Radikalisme di Fakultas Psikologi USU yang didukung oleh Badan Nasional Penanggulangan Terorisme (BNPT) RI.(m28)

Presiden SBY: Cegah ... pihak,” kata Presiden dalam keterangan pers usai KTT APEC di Vladivostok, Rusia, Minggu (9/9) malam waktu setempat terkait ledakan bom yang terjadi diDepokpadaSabtu(8/9)malam yang mencederai tiga orang. Kepala Negara, tindakan yang dilakukan adalah mencegah pikiran ekstrim dan cenderung melakukan aksi kekerasan melalui upaya persuasif dan pendidikan harus dilakukan secara berkelanjutan di lingkungan masyarakat. “Akar kekerasan sudah sejak lama. Dan bukan hanya di Indonesia, di seluruh dunia pun ada. Ini yang pertama harus kita pahami. Akarnya sendiri ada berbagai macam penyebab adak karena kebodohan namun ada juga yang memiliki latar belakang yang terpelajar,” kata Presiden.

calon haji diatas 87 tahun bersama pendampingnya yang mendapat kesempatan melunasi BPIH/ONHtahapketigatersebut. Menurut Anggito, teknis pengisian kuota untuk pendamping, dilakukan di Kanwil dengan User ID khusus dan petugas khusus yang ditunjuk oleh Kepala Kantor Wilayah Kementerian Agama Provinsi. “Jamaah haji yang telah dikonfirmasi ke dalam database Siskoat, akan diberi surat pengantar oleh Kanwil Kementerian Agama Provinsi ke Bank Penerima

Camat Namorambe ... Pertemuan pihak pengusaha dengan warga yang difasilitasi Muspika Namorambe berlangsung Sabtu (8/9) malam, dimana pihak pengusaha bersedia menutup usahanya. ’’ Pihak pengusaha dalam pertemuan tersebut hanya dapat menunjukkanizindariDirjenKonservasiAlamKementrianKehutanan RI, namun tidak dapat menunjukkan izin usaha dari Pemkab Deliserdang, ’’ tutur Hendra. Hadir dalam pertemuan tersebut, Kapolsek Namorambe AKP SH Karokaro, Camat Namorambe HendraWijaya, Kades Delitua Adi Darma Barus dan A Siahaan mewakili pengusaha serta sejumlah tokoh masyarakat. Menurut Siahaan kepada wartawan, pihaknya meminta waktumenutupusahanyaselama dua tahun, namun warga mem-

Suami Istri Tewas ... Desa Rawasari, Kec. Aekkuasan, Kab. Asahan, ditemukan warga tewas dengan kondisi memprihatinkan.Tangan, kepala, kaki bahkan tangan kedua korban terputus akibat sabetan benda tajam. Saat pagi hari, salah seorang warga menemukan keduanya, kemudian dilaporkan ke pihak berwajib. Berdasarkan informasi dari warga, pelaku diduga adalah putrakorban.Ianekatmelakukan pembunuhan itu karena stres akibatpermasalahanrumahtangga dan kini menghilang.

Gegana Amankan ... Dari lokasi ledakan tersebut, kata Rikwanto, polisi menemukan dua granat dan tiga pucuk senjata api berbagai jenis serta benda-benda berbahaya lainnya. Tim penjinak bom (Gegana) Polda Metro Jaya telah mengamankan granat yakni, satu granat manggis dan satu granat asap, satu pucuk senjata api Bareta berisi amunisi 17 butir peluru dan dua pucuk senpi Enggran

Al Bayan ... dan bersyukur, memuliakan manusia, bermurah tangan (suka menolong), suka berpuasa sunat, tidak menghitung-hitung rezeki sehingga tidak kikir, bersabar dalam menghadapi tantangan, membayar zakat, menunaikan ibadah haji, dan gemar bersilaturrahmi dengan sesama manusia. Al-Mukhbitin tidak dilalaikan oleh duniawi, tidak tertipu oleh rayuan nafsu birahi, setan, tidak tergoda oleh harta, pangkat dan jabatan, maksudnya tidak akan dicari secara haram, tetapi bila harta, pangkat dan jabatan itu datang secara halal juga tidak ditolak karena itu amanah Allah SWT. Mereka tidak ingin mezalimi manusia, kare-

belakang melindas keduanya yang sedang terkapar di badan jalan, mengakibatkan sang istri tewas dan suami kritis. Pihak Satlantas bersama warga yang mengetahui peristiwa itu langsung melakukan pertolongan, walaupun bus RAPI sempat kabur menuju Medan, namun berkat informasi masyarakat bus tersebut berhasil diamankan Polisi. Kasatlantas Polres Sergai, AKP.Hasan Basri ketika dikonfirmasi Waspada membenarkan peristiwa tersebut dan pihaknya telah menangani perkaranya, terangnya. (c03) Setoran (BPS) BPIH tempat setor semula untuk melakukan pelunasan BPIH,” ujar Anggito sambil menambahkan, untuk calhaj yang berdomisili jauh dari Kanwil, surat pengantar dapat diberikan oleh Kantor Kementerian Agama Kabupaten/Kota setelah mendapat pemberitahuan dari Kanwil Kementerian Agama Provinsi. Selainuntukcalonhajireguler, sisa kuota jamaah haji khusus (ONH plus) tahun 1433H/ 2012 M juga dialokasikan untuk calon haji khusus berusia minimal 87 tahun sesuai database Siskoat per tanggal 31 Agustus 2012.(j06) beri waktu delapan bulan untuk memindahkan ternak buayanya ke daerah lain. Disinggung izin yang dimiliki pengusaha, Siahaan menolak memberi keterangan dengan alasan lagi pening. Kapolsek Namorambe AKP SH Karokaro kepada wartawan menjelaskanpihaknyadalampertemuan tersebut hanya sebatas pengamanan agar pertemuan antara warga dan pengusaha berjalan lancar dan aman sehinggamenciptakansuasantetap kondusif. Sementara, informasi Waspada peroleh, dua ekor dari tiga ekor buaya yang lepas dari peternakan tersebut saat ini masih berkeliaran dan menghantui warga sekitar. Satu ekor buaya yang ditemukan warga telah diserahkan kepada pihak pengusaha disaksikan Muspika setempat.(m40) Kapolres Asahan AKBP Yutsan Alpiani dikonfirmasi Waspada, melalui Kapolsek Puloraja AKP SM Sitanggang, yang dikonfirma-si Waspada melalui selulernya, membenarkan penemuan dua mayat itu. Kedua jenazah dievakuasi ke RSUD Pematangsiantar untuk keperluan autopsi. “KejadiandiperkirakanSabtu malam. Hingga saat ini kita masih melakukan penyidikan, sedangkan untuk tersangka belum bisa kita tentukan, karena kita masih mengumpulkan bukti dan saksi dalam perkara ini,” ujar Sitanggang. (a15) masih dalam rangkaian. “Disamping itu, kami juga menyita peluru 9 mm sebanyak 50 butir, 22 mm sebanyak 30 butir, baterai 9 volt sebanyak 5 buah, swiching dalam rangkaian sebanyak 6 buah, talkit, gambar pejera, laras dan magazen (manual ), serta black powder, potasium kl 7 kg, 1unit detonator elektrik, kabel serabut dan tunggal serta paralon ukuran 11/4 inci sebanyak 6 buah sudah terisi,” terang Rikwanto. (j02)

na hatinya yang sangat bersih dan suci, tidak pernah meminta-minta karena harga dirinya tinggi, tidak mudah marah apabila manusia yang menjelek-jelekkan, dan tidak terlena dengan sanjungan manusia kepadanya. Mereka memiliki sifat tadharru’ dan tawazzu’. Para al-Mukhbitin ini kadang-kadang sudah langka di zaman modern ini. Jika ada satu-satu tidak mencuat ke permukaan. Sebab kaum ini tidak mendapat perhatian dari kegelapan dunia yang buta kepada kebenaran. Beda dengan kaum munafik yang terkenal namanya karena mendapat perhatian luas dari media massa, baik televisi maupun media cetak. Al-Mukhbitin ibarat emas dan intan yang tersembunyi dalam tanah. Harga tetap mahal, namun harus digali dan didulang dulu baru mendapatkannya.

WASPADA Senin 10 September 2012

Gus: Masyarakat Sumut Ingin Sejahtera KIRA-KIRA apa prioritas utama yang diinginkan masyarakat Sumut? Itulah yang selama ini menjadi beban fikiran yang dihadapi Gus Irawan Pasaribu, mantan direktur utama Bank Sumut itu. Klaim pertumbuhan tinggi bukan acuan untuk menentukan masyarakat hingga level terbawah bisa menikmatinya. Di tengah kesibukannya yang sedang merintis menjadi calon gubernur Sumut 2013, dia sempat meluangkan waktunya diwawancarai khusus wartawan di Gus Center akhir pekan lalu. Walau tensi politik kian meninggi, namun lelaki kelahiran 48 tahun lalu itu tetap santai dan seperti tanpa beban. Jika dulu dia sering dihadapkan pada pertanyaan berapa dana terhimpun, berapa pinjaman bergulir dan berapa rasio kredit bermasalah, kini topik itu berganti drastis. Pertanyaan wartawan kini sudah mencakup skala yang lebih luas yaitu seputar Sumatera Utara. Kira-kira menurut Gus, apa yang diharapkan warga Sumut. Menurut dia, itu hanya memerlukan jawaban singkat. “Sumut Sejahtera.” Itulah yang diinginkan masyarakat Sumut. Dalam berbagai kesempatan sebenarnya Gus Irawan selalu berteriak “salam Sumut Sejahtera’. Biasanya salam tersebut dibalas masyarakat dengan menyatakan hidup Gus Irawan. Membawa jargon Sumut Sejahtera pun membuat popularitas ketua Masyarakat Ekonomi Syariah (MES) Sumut terus naik karena sudah identik dengannya. Kerja kerasnya saat menjadi Dirut di Bank Sumut menggulirkan Kredit Peduli Usaha Mikro Sumut Sejahtera 1 dan Kredit Peduli Usaha Mikro Sumut Sejahtera 2 ( disingkat KPUM SS1 & KPUM SS2 ) atau biasa disebut SS1 dan SS2 kian menguatkannya sebagai salah satu ikon pendorong ekonomi kerakyatan. Kini Sumut Sejahtera melekat dengannya. Namun yang s edikit membuatnya perlu menjelaskan kenapa itu melekat dalam pribadi Gus, ketika salah seorang dosen USU mengkritisinya. Kira-kira dosen itu menyatakan Gus Irawan tidak pantas membawa konsep Sumut Sejahtera dalam setiap pertemuannya atau saat berkunjung dengan masyarakat. Sebab itu dulu dirintisnya di Bank Sumut, jadi tak pantas Gus men-

Plt Gubsu Minta ... Sumut sekaligus meningkatkan kontribusi Bank Sumut dalam menggerakkan perekonomian daerah. “Keberhasilan yang dicapai Bank Sumut karena kemampuan seluruh jajaran pengelola dan karyawan Bank Sumut yang sudah dibangun manajemen sebelumnya,” kataYahya. Bank devisa merupakan bank yang memerolehsuratpenunjukandariBI untuk melakukan kegiatan usaha perbankan dalam valutas asing. Bank devisa dapat menawarkan jasa-jasa bank yang berkaitan dengan mata uang asing seperti

dengung-dengungkan Sumut Sejahtera sekarang apalagi dibawabawa untuk mencapai citacitanya menjadi salah satu bakal calon Gubsu. Gus Irawan agak terkejut dan merasa tergelitikdenganitu.NamundiabertuturprogramSumut Sejahtera sudah menjadi cita-citanya sejak lama dah bahkan sudah berada dialam bawah sadarnya. “Sumut Sejahtera itu cita-cita abadi saya, sebagai putera daerah yang lahir, besar, bersekolah, berkarir dan tentu berkewajiban untuk membangun Sumut. Saya berharap dan seyogianya Sumut Sejahtera menjadi cita-cita bersama seluruh masyarakat Sumut karena sesungguhnya itulah yang dibutuhkan masyarakat.” Untuk apalah pertumbuhan ekonomi tinggi bila tidak terjadi pemerataan. Sesungguhnya yang tidak kalah pentingnya adalah meningkatkan daya beli masyarakat, sehingga mereka dapat hidup layak, kata dia. Gus Irawan ingin menjelaskan sesungguhnya Sumut Sejahtera itu harus wujud siapa pun pemimpin Sumut. “Saya fikir tidak salah, bahkan itu menjadi kewajiban bagi setiap pemimpin mensejahterakan rakyatnya. Dan kebetulan dulu saya bergelut dengan 70 ribuan ibu-ibu. Memfasilitasi mereka mendapatkan modal.” Itu mensejahterakan mereka, kata Gus Irawan. “Hanya saja itu kan masih dalam satu bidang,” kata dia. Padahal Sumut butuh kesejahteraan di bidang kesehatan, pendidikan, masyarakat miskin, infrastruktur, pariwisata, budaya, olahraga bahkan reformasi birokrasi. “Lalu kenapa harus diperdebatkan kalau konsep itu bagus. Saya fikir bukan itu yang perlu disoal tapi bagaimana kita saling mengisi untuk Sumut yang lebih sejahtera,” ujarnya. Saat ini yang difahaminya adalah Sumut harus sejahtera yang kemudian dituangkannya dengan dua kata melekat yaitu Sumut Sejahtera. “Jadi bukan karena itu dulu program di Bank Sumut lalu dibawa-bawa sampai sekarang. Namun itulah cita-cita abadi yang datang dari alam bawah sadar.” Dan siapa pun yang sebenarnya ingin mengusung Sumut Sejahtera tidak perlu dipermasalahkan karena cita-cita tersebut pasti ditujukan untuk seluruh masyarakat Sumatera Utara. (m06)

transfer ke luar negeri, jual-beli valuta asing, transaksi eksporimpor, hingga pengucuran kredit dengan mata uang asing. Yahya menuturkan, besarnya transaksi ekspor-impor di Sumut menjadi salah satu pertimbangan manajemen untuk meningkatkan status Bank Sumut menjadi bank devisa. Sebab bisa dilihat Sumut sangat kaya sumber daya alamnya dengan keberagaman komoditas berorientasi ekspor yang prospektif, terutama komoditas unggulan seperti crude palm oil(CPO), kata dia. Kemudian ada jugacalonnasabahpotensialBank Sumut yang kegiatan usahanya

Pemerataan Dan Kesejahteraan ... Karena dikemas kedaerahan maka makanan yang tersaji di situ juga sederhana. Ada jagung rebus, ubi goreng, ubi rambat rebus serta beberapa yang lain. Lalu saya pun bercerita soal jagung rebus itu. Bukan untuk mengecilkan arti perkebunan di Sumut. Lalu saya bilang dan yakin jagung yang dimakan tadi adalah jagung hawai. Ini sekadar pengantar buat saya berbicara lebih luas. Maksudnya adalah Sumut yang dikenal daerah pertanian, perkebunan, peternakan dan keunggulan di sektor lain tetap harus bergulat dengan barang impor. Uniknya barang impor itu cenderung yang kita konsumsi. Jagung itu jadi contoh. Belum lagi kalau kita bicara soal sapi Australia. Atau beras impor yang didatangkan pemerintah pusat. Semua menunjukkan betapa lemahnya kita menguasai perekonomian sendiri. Saya cenderung yakin kalau tak sanggup memaksimalkan potensi yang ada terutama kebutuhan pangan daerah ini kita akan selalu ‘terjajah’. Karena itu baru sebagian komoditas. Belum lagi misalnya gula, tepung terigu, gandum dan kacang kedele yang sempat diributkan perajin tahu dan tempe tempo hari. Kalau kondisinya begini berarti Sumut memang belum mapan secara ekonomi. Belum mampu memenuhi kebutuhan sendiri. Dengan menggantungkan kebutuhan pokok saja pun dari impor itulah pangkal instabilitas ekonomi. Andai harganya naik di pasar internasional tentu di dalam negeri akan ikut. Acuannya begini, kalau kita sekarang mengimpor beras dari Thailand dan kemudian harganya di sana naik pasti di dalam negeri pun begitu. Sama dengan kacang kedelai yang dibutuhkan perajin tahu dan tempe beberapa waktu lalu. Masalah klasik waktu itu karena kacang kedelai mahal di luar negeri lalu di dalam negeri pun begitu. Intinya adalah kita tidak mampu mencegah ‘intervensi harga asing’. Harga naik otomatis inflasi (daya beli kita rendah). Kita pun mengimpor inflasi dari negara lain. Hakikat jadi konsumen memang begitu. Maka saya sering nyatakan bahwa ekonomi kita itu tumbuh karena dorongan konsumsi. Sudah terlalu banyak barang dan bahan kebutuhan pokok impor.

perdagangan ekspor impor. “Sebagai tahap pertama, kami menargetkan setidaknya 10 persen sampai 20 persen transaksi ekspor di Sumut dapat dilayani Bank Sumut,” ujarnya. Selain itu, setelah menjadi bank devisa, Bank Sumut juga meluncurkan Call Center 14002 untuk meningkatkan pelayanan menuju BPD Regional Champion 2014. Layanan ini disediakan untuk memenuhi kebutuhan masyarakat khususnya nasabah guna mengetahui produk,menyampaikan keluhan, dan membantu nasabah dari penipuan pihak yang tidak bertanggung jawab. (m06)

Menyenangkan negara produsen lain tapi membuat kita makin tersudut. Saya bukan ingin berwacana tapi mana kekuatan Sumut yang dulu kita miliki. Produksi beras Sumut dulu terkenal selalu berlebih. Bahkan bisa dijual ke provinsi tetangga. Namun secara perlahan kita pun sempat beberapa kali menikmati beras impor itu. Pertumbuhan ekonomi Sumut memang tinggi. Selalu di atas angka nasional dan tahun ini seperti biasa bergerak di angka enam persen dan tujuh persen. Secara makro indikator itu bagus. Siapa pun akan memujinya. Bahkan kita sangat bangga ketika Presiden berpidato tentang pertumbuhan ekonomi di Asia sepanjang tahun lalu hanya ada tiga negara tumbuh positif. Termasuk Indonesia. International Monetary Fund (IMF) lembaga yang dulu menolong kita saat krisis ekonomi dan Bank Dunia pasti memuji pertumbuhan itu. Termasuk Sumut. Tapi ambivalen. Saya pekan lalu bertemu dengan seorang pelaku bisnis yang bergerak di bidang ekspor. Dia bercerita kalau mau indikator yang sesungguhnya adalah lihat angka kemiskinan. Kemudian coba tanya supir angkot dan abangabang becak. Apa jawaban mereka soal ekonomi kini. Pasti jawabannya kian sulit dibanding tahun lalu dan tahun sebelumnya. Kalau jawaban mereka riil seperti itu masih maukah kita mengklaim pertumbuhan tinggi. Dia juga menyinggung tentang kemiskinan di Nias, banyaknya pasien miskin serta tingkat kematian bayi yang juga tak berubah. Saya fahami, maksud si pebisnis sebenarnya adalah ingin mengatakan kalau mau melihat pertumbuhan cek dengan angka riil. Pertumbuhan boleh tinggi tapi harus merata, itu yang ingin dia sampaikan sepertinya. Masyarakat tak peduli ekonomi tumbuh tinggi. Mereka hanya tahu harga beras murah, kebutuhan pokok tidak naik dan tetap terjangkau, kesehatan terjamin, anak-anak bisa sekolah tinggi. Dan satu lagi indikator nya kalau di kampung saya Tapsel dan Mandailing Natal bisa menyimpan emas sedikit-sedikit dan mampu naik haji. Intinya pertumbuhan ekonomi boleh tinggi tapi dengan memperhatikan pemerataan untuk seluruh Sumut yang sejahtera. ‘Salam Sumut Sejahtera’.

Medan Metropolitan MoU Proyek Crystal Square Batal Demi Hukum WASPADA

Senin 10 September 2012


Aset PD Perhotelan Aman MEDAN (Waspada): Pelanggaran aturan terhadap pelaksanaan proyek Crystal Square semakin terbuka. Anggota Komisi C DPRDSU Hardi Mulyono mengatakan, Memorandum of Understanding (MoU) yang dilakukan pihak PD Perhotelan dengan PT Cakrawala Dekatama batal demi hukum. Sebab, jabatan Dirut PD Perhotelan Ruslan Hasyim telah kadaluarsa. Berbicara kepada Waspada, Minggu (9/9), Hardi Mulyono mengatakan, ternyata banyak sekali pelanggaran atas pelaksanaan proyek Crystal Square itu. Dia mengaku, baru membuka sedikit berkas tentang PD Perhotelan dan pelaksanaan proyek Crystal Square, tapi sudah banyak terlihat pelanggaran yang dilakukan. “Kalau pasal demi pasal MoU dan Perda tentang PD Perhotelan ini ditelaah, saya yakin lebih banyak lagi ditemukan pelanggaran,’’ kata Hardi. Dengan tegas, Hardi Mulyono menyebut nota kesepahaman (MoU) yang dibuat antara PD Perhotelan dengan PT Cakrawala Dekatama batal demi hukum. Karena, Dirut PD Perhotelan Ruslan Hasyim, tidak berwenang menandatangani perjanjian itu. Kepada Waspada, Hardi memperlihatkan SK pengangkatan Ruslan Hasim. Yakni No. 539/1069.K, tanggal 16 Juni 1999. Dalam SK yang ditandatangani Gubsu alm. H.T. Rizal Nurdin itu, Ruslam Hasyim hanya ditunjuk sebagai Pelaksana Tugas Dirut PD Perhotelan. Kemudian, dia memperlihatkan lagi Perda No. 23 tahun 1985 tentang PD Perhotelan. Pada pasal 18 Perda itu disebutkan bahwa direktur diangkat untuk masa jabatan empat ta-

hun. Sedangkan batas usia seorang direktur maksimal 60 tahun. Yang terjadi sekarang ini, kata Hardi, sejak tahun 1999 sampai saat ini SK tentang pengangkatan Pelaksana Tugas Dirut PD Perhotelan itu belum pernah diperbaharui. Artinya, jabatan itu telah diduduki Ruslan Hasyim selama 13 tahun dan SKnya tidak pernah diperbaharui. ‘’Belum lagi tentang usia. Saya mendapat data bahwa Pak Ruslan Hasyim lahir tanggal 16 Agustus1941.Berarti,sekarangusianya sudah 71 tahun,’’ kata Hardi. Dikaitkan dengan kontrak kerja dalam pembangunan proyek Crystal Square, disebutkan Hardi, harusnya telah batal demi hukum. Kontrak kerja pertama proyek itu dimulai tahun 2003. Yang berarti pada masa akhir jabatan Ruslam Hasyim. Tapi kemudian kontrak itu di addendum pada tahun 2005 dan addendum II tahun 2010. ‘’Sesuai hukum, harusnya Ruslan Hasyim tidak boleh lagi menandatangani addendum. Baik addendum I, apalagi addendum II,’’ kata Hardi. Berkaitan dengan berbagai pelanggaran yang terjadi itu, Hardi Mulyono, meminta Pemprovsu sebagai pemilik PD Perhotelan segera membatalkan kontrak kerja dengan PT Cakrawala Dekatama. Kalau ini diteruskan, dia khawatir akan menjadi masalah hukum.‘’Itu belum lagi bila kita lihat Perda tentang Usaha PD Perhotelan. Pada pasal 5 disebutkan, perhotelan, restoran, bar dan usaha lainnya disektorkepariwisataan,’’katanya. Aset PD Perhotelan Sementara itu, aset lahan Perusahaan Daerah (PD) Perhotelan Jln. Imam Bonjol dipastikan masih menjadi aset Pemprovsu. Selain itu, lahan eks Hotel Dirga Surya tersebut juga tetap memberikan fixed income

(pendapatan tetap) bagi kas daerah setiap tahunnya meski pembangunan belum selesai. Direktur PD Perhotelan Ruslan Hasyim mengatakan, sejak 1 Mei 2012 fasilitas kredit yang diberikan Bank Bukopin kepada PT. Crystal Cakrawala Indah (CCI) yaitu perusahaan perseroan yang dibentuk PD Perhotelan dan PT Cakrawala Dekatama telah selesai dilunasi. Hal itu sesuai dengan surat Bank Bukopin No. 6305/DKKM II/2012 tanggal 15 Mei 2012. Dengan demikian, sertifikat tanah yang sebelumnya diagunkan telah kembali dikuasai PD Perhotelan. “Sertifikat sekarang sudah sama kita. Urusan agunan dengan bank sudah selesai. Jadi tidak benar lahan ini telah beralih atau dikuasai pihak lain,” kata Ruslan sambil menunjukkan sertifikat asli BPN No 2263 atas lahan eks Hotel Dirga Surya tersebutkepadawartawandiKantor PD Perhotelan, Kamis (6/9). Selama ini, kata Ruslan, PD Perhotelan tetap mendapatkan fixed income meski pembangunan belum juga selesai sejak 2003. Dalam addendum pertama yaitu pada November 2003 melalui surat perjanjian No 01/ PKS/PD/CD/XI/03 disebutkan PD Perhotelan mendapatkan Rp600juta setiap tahun selama pembangunan berlangsung. Lalu ketika batas waktu pembangunan terlewati karena krisis ekonomi global yang terjadi saat itu, PT Cakrawala Dekatama juga dikenakan penalti sebesar Rp1,08miliar. “Ini di luar fixed income tadi,” sebutnya. Fixed income saat ini bahkan sudah naik menjadi Rp750 juta per tahun yang dibayar setiap bulan. Selain itu, disebutkan juga jika dalam jangka waktu tiga tahun sejak addendum kedua bangunan belum juga beroperasi, maka akan langsung

take over (diambilalih) PD Perhotelan. Hal itu sesuai dengan isi perjanjian pada addendum kedua yang dibuat Januari 2011. “Jadi sebenarnya kita tetap mendapatkan penghasilan meski bangunan belum beroperasi. Banyak keuntungan yang kita peroleh pada addendum kedua,” terangnya. Ruslan mengakui pada saat pembahasan addendum kedua, perjanjian kerjasama hampir deadlock mengingat banyaknya keuntungan yang dapat diperoleh PD Perhotelan. Karena saat itu isi addendum sudah dianalisis terlebih dulu oleh Prof Ningrum seorang pakar hukum perdata dari Universitas Sumatera Utara (USU). Salah satu perubahan yang krusial dari addendum pertama dengan addendum kedua adalah adanya batas waktu kerjasama selama 30 tahun. Dan bisa diperpanjang kembali jika disetujui gubernur. Sebelumnya, di addendum pertama batas waktu ini tidak ada makanya sempat ribut. Sekarang sudah ada. Jangka waktu 30 tahun itu memang dimanamana seperti itu perjanjiannya,” ujarnya. Fasilitas tambahan Dalam addendum kedua diakuinya ada penambahan peruntukan di lahan tersebut. Tapi bukan perubahan dari hotel ke rumah sakit. Dalam pasal 3 disebutkan, selain akan difungsikan sebagai perkantoran, gedung komersil, lahan parkir dan hotel minimal 120 kamar, ditambahkan juga sarana kesehatan. Sarana kesehatan tersebut masuk dalam bagian addendum tanpa menghilangkan atau mengurangi jumlah kamar hotel yang nantinya akan dibangun. Penambahan tersebut sudah disetujui langsung Gubernur Sumut setelah melalui beberapa kali kajian dari berba-

Soal Dukungan Kandidat Gubsu

38 Ormas Jawa di Sumut Jangan Terseret Politik Praktis MEDAN (Waspada): Sebanyak 38 organisasi masyarakat (ormas) Jawa di Sumatera Utara diingatkan untuk tidak terlibat politik praktis mendukung salah satu Cagubsu pada Pilgub 2013. Sebab, hal itu hanya untuk kepentingan sesaat dan dapat menimbulkan kerugian bagi warga Jawa itu sendiri. Demikian dikatakan Tokoh Jawa Sumatera Utara yang juga Penasihat Forum Komunikasi Warga Jawa (FKWJ) Nusantara H. Wagirin Arman S.Sos (foto) saat memberi sambutan pada HUT ke-8 FKWJ Nusantara di Lapangan Sepakbola, Titikuning Medan, Minggu (9/9). Menurut Wagirin, bolehboleh saja secara pribadi mendukung salah satu Cagubsu, namun tidak membawa embelembel ormas Jawa. “Misalnya, saya secara pribadi mendukung Cagubsu Drs H Amri Tambunan, itu boleh saja. Tapi tidak membawa FKWJ Nusantara,” sebut Wagirin. Ormas Jawa yang dibentuk

di daerah ini harus dapat mengangkat harkat dan martabat warga Jawa. Jangan sampai latah ikut mendukung Cagubsu karena ada sesuatu. “Sekali lagi saya ingatkan warga Jawa tak perlu memilih Cagubsu yang sama sekali tidak peduli terhadap orang Jawa,” tegas Wagirin. Kehadiran ormas Jawa pada hakikatnya untuk mempererat tali silaturahmi, rasa persatuan dan kesatuan. “Jadi bukan dukung mendukung salah satu calon Gubsu. Sebab hal itu bertentangan dari jati diri ormas Jawa itu sendiri yang independen dan netral,” tambah Wa-

girin. Pada kesempatan yang sama, Wagirin yang juga Wakil Ketua DPRD Deliserdang ini meminta agar DPD/DPR khususnya asal Sumatera Utara agar terus berjuang. Misalnya, dengan disahkannya UU tentang Keistimewaan Daerah Istimewa Yogyakarta (UUK DIY) oleh DPR yang mana Sri Sultan Hamengku Buwono IX boleh menjadi gubernur DIY kembali, tapi tidak menjadi anggota partai politik. Harusnya, UU itu tidak hanya diterapkan diYogyakarta, namun juga di seluruh Indonesia. Sebab memang yang namanya bupati, wali kota, gubernur, bahkan presiden itu tidak boleh anggota parpol. Hal itu bertujuan untuk menciptakan rasa keadilan dan pejabat dimaksud harus fokus mengurus bangsa ini. Sementara itu, Anggota DPD RI asal Sumatera Utara Parlindungan Purba, SH, MM yang hadir pada HUT ke-8 FKWJ

Nusantara itu menyatakan dukungannya agar gubernur, wali kota/bupati bukan anggota parpol. “Apa yang dikemukakan Wagirin Arman, sangat saya dukung. Hal itu nantinya akan kami bahas pada rapat paripurna DPD RI,” tambahnya. Sedangkan Plt Gubsu Gatot Pudjo Nugroho mengatakan, ormas Jawa harus mandiri. Dia juga sependapat ormas Jawa di daerah ini dapat mengangkat harkat dan martabat warga Jawa itu sendiri. Salah satu solusinya tentu dengan melakukan pembinaan misalnya melalui pendidikan, ekonomi dan sosial budaya. “Jadi, ormas Jawa itu harus diberdayakan. Satu lagi yang terpenting harus bersatu padu,” ujar Gatot. Sedangkan Ketua Umum DPP FKWJ Nusantara Gusti Kanjeng Ratu Pembayun mendukung pernyataan Plt Gubsu Gatot Pudjo Nugroho. “Ormas Jawa harus kompak dan jangan mau dipecah belah,” tegas Kanjeng Ratu.(m25)

gai pihak baik biro hukum, inspektorat dan Sekdaprov Sumut pada 28 Desember dengan nomor surat 539/14198/2010. ”Perusahaan PT Cakrawala Dekatama ini mengajukan surat ke gubernur. Di samping hotel, mereka mau buat rumah sakit. Keluarlah izin prinsipnya dan dilanjutkan dengan addendum kedua,” kata Ruslan. Jadi, bangunan yang rencananya berdiri 11 lantai tersebut sudah melalui semua proses yang legal. Termasuk izin dari Walikota Medan untuk membangun minimal 120 kamar hotel dan fasiltas lain seperti sarana kesehatan. Sekretaris Badan Pengawas PD Perhotelan Jalinus menambahkan, Pemprov Sumut akan mendapatkan saham 20% dalam perseroan yang telah dibentuk bersama yaitu PT CCI sebagai pengelola gedung. Jadi, jika telah operasional, setiap tahun PemprovSumutakanmendapatkan 20% dari euntungan setelah diaudit oleh akuntan publik. Dalam addendum kedua setelah 30 tahun seluruh aset baik lahan maupun gedung akan dikuasai sepenuhnya oleh Pemprov Sumut. Namun jika tidak selesai atau tidak operasional hingga akhir 2014, maka tidak akan ada perpanjangan lagi langsung diambil alih. Ruslan kembali menambahkan dalam perjanjian sewa dan jual beli, transaksinya tetap akan mebawa nama PD Perhotelan. Sebab sertifikat aset tetap berstatus milik PD Perhotelan. Dalam operasionalnya nanti pemasaran dilakukan dengan sistem strata title di mana yang disewa atau dijual hanya bangunan dan tidak termasuk lahan. Karena itu yang dipecah hanya sertifikat bangunan sementara lahan tetap sepenuhnya milik PD Perhotelan.(m12/m28)

Waspada/Surya Efendi

KETUA Umum IKA SMAN 4 Medan T. Erry Nuradi (duduk, 2 dari kanan) dan Ketua Dewan Pembina IKA SMA Negeri 4 Medan yang juga Menko Kesra Agung Laksono (duduk, 3 dari kanan) foto bersama sejumlah pengurus IKA SMA Negeri 4 Medan Periode 2011 – 2016.

Agung Laksono Ajak Alumni SMAN 4 Dukung T. Erry Nuradi Jadi Gubsu MEDAN (Waspada): Ikatan Keluarga Alumni (IKA) SMA Negeri 4 Medan mendoakan dan memberi dukungan kepada Bupati Sergai T. Erry Nuradi untuk maju dalam Pilgubsu 2013. Dukungan itu dilontarkan Ketua Dewan Pembina IKA SMA Negeri 4 Medan yang juga Menko Kesra Agung Laksono. “Saya dengar Ketua Umum IKA SMA Negeri 4 cabang Medan T. Erry Nuradi akan maju dalam Pilgubsu mendatang. Mari kita mendoakan T. Erry Nuradi. Saya percaya tidak ada dusta diantara kita,” kata Agung Laksono usai melantik Pengurus IKA SMA Negeri 4 cabang Medan periode 2011 - 2016 yang diketuai T. Erry Nuradi di Hotel Danau Toba Medan, Sabtu (8/ 9) malam. Jika Erry Nuradi terpilih, menurut Agung, pasti dia tidak akan lupa kepada alumni dan SMA Negeri 4 Medan ini. “Marilah kita doakan, semoga citacita T. Erry Nuradi untuk membangun Sumut ini bisa terwujud. Saya saja jika punya KTP Medan, saya akan berikan untuk mendukungnya,” kata Agung yang disambut tepuk tangan para alumni. Namun Agung mengingatkan, apapun tugas kita baik gubernur, dokter dan lainnya, haruslah profesional di bidangnya masing-masing. “Karena keprofesionalan itu akan membawa nama baik SMA Negeri 4 Medan,” katanya sembari mengajak alumni dan masyarakat ber-

sama-sama memajukan pendidikan demi memperbaiki kualitas pendidikan dan kemajuan negara Indonesia menjadi lebih baik lagi. Terkait pelantikan itu, Agung mengatakan, acara ini merupakan tujuan mulia, selain untuk silaturahmi juga bisa saling memperhatikan satu alumni dengan alumni tahun lainnya. Kemudian, memperhatikan segala usaha dari program pendidikan serta sarana dan prasarana SMA Negeri 4. “Marilah kita bersatu, kompak untuk memajukan SMA Negeri 4,” tambahnya. Pada kesempatan itu, Ketua Umum IKA SMA Negeri 4 cabang Medan T. Erry Nuradi menyampaikan niatnya untuk maju pada Pilgubsu. “Alumni SMA Negeri 4 ini sudah ada yang menjadi menteri, bupati, dokter dan sebagainya. Hanya menjadi Gubsu saja yang belum ada ini Pak Dewan Pembina IKA Alumni SMA 4,” kata Erry disambut tepuk tangan ratusan alumni. Erry juga menyampaikan, kehadiran Agung Laksono untuk melantik pengurus IKA Alumni SMA Negeri 4 menjadi suatu kebanggaan bagi pengurus. “Ini suatu kebanggaan alumni, kita mempunyai Pak Agung Laksono selaku Menko Kesra,” ujarnya. Erry yakin semua pengurus mempunyai rasa cinta kepada SMA Negeri 4. “Sehingga berkat keberadaan alumni, secara bertahap SMA Negeri 4 sudah nam-

pak kemajuannya. Kita harus bersatu padu, agar bisa melakukan apapun. Jangan cari perbedaan-perbedaan. Karena kita dilahirkan memang berbeda,” pintanya. Sedangkan, Ketua Umum IKA SMA Negeri 4 Effendi Pasaribu menambahkan, kegiatan ini merupakan satu titik awal untuk mencapai kesuksesan. “Ini merupakan satu keinginan untuk kebersamaan. Bekerja-lah sesuai tupoksi. Saya harapkan kita bisa bersama-sama menjalankan program-program terutama program sosial.” Kepengurusan IKA Alumni SMA Negeri 4 Medan Periode 2011 - 2016 yakni Ketua Umum cabang Medan T. Erry Nuradi, Sekretaris Umum Prof. Ir. Posman Seboya, Bendahara Umum Anton Sukma. Dalam kepengurusan ini ada beberapa bidang yakni, Koordinator Bidang Ketahanan Pangan; Koordinator Bidang Ekonomi dan Kerjasama; Koordinator Bidang Seni, Budaya dan Pariwisata; Koordinator Bidang Pendidikan dan Penelitian; Koordinator Bidang Sosial dan Tenaga Kerja; Koordinator Bidang Kesehatan dan Pengabdian Masyarakat; Koordinator Bidang Hukum dan HAM; Koordinator Bidang Humas dan Publikasi; Koordinator Bidang Umum dan Logistik; Koordinator Bidang Alumni dan Keanggotaan; Koordinator Bidang Hubungan LN, Informasi dan Komunikasi.(h02)

Medan Metropolitan


WASPADA Senin 10 September 2012

Kapoldasu: Soal Parkir Berlapis Tanya Wali Kota MEDAN (Waspada): Kapolda Sumut Irjen Pol. Wisjnu Amat Sastro “gerah” ditanya soal penindakan parkir berlapis di Medan. “Kalian jangan tanya saya saja, tanya sama gubernur, tanya wali kota, tanya instansi terkait lainya. Coba tanya wali kota kau, udah kerja belum, apa yang sudah dia buat,” kata Wisjnu ketika ditanya wartawan tentang penindakan parkir berlapis di sejumlah kawasan macat di Medan, Sabtu (8/9). Kapolda ketika itu membuka bakti sosial operasi katarak gratis dilaksanakan PDBhayangkaridiMakoBrimobdasu Jl. Wahid Hasyim, Medan. Dengan logat khas Medan, Wisjnu kembali menekankan kepada wartawan untuk menanyakan solusinya ke Pemko. “Tanya juga Pemda, kenapa tidak membuat jalan yang lebih lebar, tanya semua stakeholder, termasuk kalian ingatkan kepada masyarakat supaya tertib berlalulintas,” ujarnya. Laka lantas Tentang lalu lintas di Sumut, Wisjnu mengatakan, pada evaluasi hasil Operasi Ketupat 2012

sebanyak 800 lebih korban kecelakaan meninggal dunia di Indonesia. Sementara di Sumut selama 16 hari menggelar operasi tercatat 87 korban meninggal dunia. “Karena itu kita lakukan langkah-langkah preemptif dan preventif, tetapi tidak semua masyarakat mendukung. Coba kalian lihat, banyak orangtua bangga membelikan anaknya sepedamotor, padahal belum cukup umur,” sebut Wisjnu. Sebab itu pihaknya mencoba memulai penertiban sepedamotor. “Kalian tahu sendiri bagaimana pengendara sepedamotor di Medan, karena itu kita mulai menindak pengendara yang tidak memakai helm, melanggar traffic light dan yang melawan arah,” ujarnya. Tetapi, kata Kapolda, tidak hanya sepedamotor, yang lainnya juga akan dilakukan secara simultan. “Kita melakukan ini menjaga agar tidak ada korban jiwa,” katanya. Evaluasi Dishub Sementara itu, Wali Kota Medan Rahudman Harahap dengan tegas mengatakan segera mengevaluasi jajaran Dinas Perhubungan Kota Medan, bila

tidak mampu menertibkan parkir berlapis dan terminal liar yang mengganggu kelancaran arus lalulintas. “Kalau petugas Dishub tak mampu menertibkan parkir berlapis yang memacatkan arus lalulintas di kota ini, saya akan langsung evaluasi.Walaupun sejumlah pejabatnya masih baru menjabat, kalau tidak mampu melaksanakan tugas untuk apa dipertahankan. Lebih baik kita ganti dengan orang yang lebih baik lagi,” kata Rahudman kepada Waspada, Jumat (7/9). Menurut Rahudman, semua pejabat di jajaran Pemko Medan harus mampu menjalankan tugasnya dengan baik dalam memberikan pelayanan kepada masyarakat. Untuk itu, bagi jajaran Dishub Medan, supaya meningkatkan kinerja dan melakukan koordinasi dengan instansi terkait dalam penertiban parkir berlapis maupun terminal liar yang mengganggu kelancaran arus lalulintas. Kata dia, kemacatan arus lalulintas di Kota Medan belum seperti di Jakarta, tapi bila tidak segera diatasi maka dipastikan akan lebih parah lagi. Sedang-

kan untuk pelebaran jalan tidak akan mungkin bisa secepatnya mengingat anggaran yang masih terbatas. “Salah satu alternatif yang harus kita lakukan menertibkan parkir berlapis dan terminal liar. Selain itu, memperbaiki rambu-rambu lalulintas seperti lampu merah. Inilah yang harus dilakukan bagi jajaran Dishub,” ujarnya. Dia juga meminta kepada Kepala Dinas Perhubungan Kota Medan Renward Parapat agar menertibkan juru parkir liar yang mengacau kondisi parkir di kota ini. “Saya minta kepada Kadishub lakukan penertiban jukirliar.Evaluasisemuaparajukir, dan kalau tidak layak jangan keluarkanlagikartunya,”tegasnya. Petugas jukir jangan hanya mengejar pendapatan, sehingga tidak memikirkan kondisi parkir. Seluruh jukir ditekankan untuk mematuhi rambu-rambu lalulintas dan kelancaran arus lalulintas. “Parkir itu harus mengikuti peraturan. Kalau memang sudah ada rambu-rambu larangan parkir, maka jukir jangan lagi memarkirkan kendaraan di tempat tersebut. Untuk itu, petugas Dishub saya minta untuk

turun ke lapangan setiap saat mengecek parkir yang ada di kota ini,” tuturya. Ketika ditanya mengenai adanya oknum Dishub yang membeking parkir berlapis, Rahudman langsung berang sembari mengatakan, kalau memang ada oknum yang membeking maka langsung dicopot dari jabatannya. Kepala Dinas Perhubungan Kota Medan Renward Parapat ketika dikonfirmasi mengatakan, pihaknya terus menerus melakukan penertiban parkir berlapis dan terminal liar bekerjasama dengan Satlantas Polresta Medan. “Kita tetap bekerja semaksimalnya untuk melakukan penertiban parkir berlapis dan terminal liar bersama jajaran kepolisian. Ini akan menjadi agenda utama kita,” sebutnya. Mengenai adanya oknum petugas Dishub yang membeking parkir berlapis dan terminal liar, Renward menjawab akan memberikan tindakan tegas. “Kalau ada oknum Dishub yang membeking parkir berlapis maupun terminal liar, kita akan ambil tindakan tegas,” ujarnya. (m27/m50)

Geng Kereta Rampok Tiga Sepedamotor MEDAN (Waspada): Tiga sepedamotor dirampok komplotan geng kereta di kawasan Jln. AH Nasution, Jln. Karya Wisata, dan Jln. Cemara Medan. Informasi di Mapolsek Delitua, Minggu (9/9) menyebutkan, korban Irwansyah Putra Nasution alias Ibey, wartawan televisi, menjadi korban perampokan geng kereta di Jln. Karya Wisata, Sabtu (8/9) sekitar pukul 03:00. Sedangkan korban Tarmizi Ananta Lubis, 24, mahasiswa salah satu universitas di Medan, dianiaya dan dirampok belasan anggota geng kereta di Jalan AH Nasution, Minggu (9/9) dinihari. Korban Ananta, warga Jln. Brigjen Katamso, Kel. Kampung Baru, Kec. Medan Maimun, saat hendak pulang ke rumahnya melintas di Jalan AH Nasution. Namun, persis di depan Indomaret/SPBU tiba-tiba belasan anggota geng kereta yang me-

ngendarai sepedamotor memepet kendaraan korban. Korban lalu berhenti dan langsung dikeroyok kawanan geng kereta tersebut. Usai menghajar korban, kawanan geng kereta langsung membawa kabur sepedamotor merk Suzuki Satria Fu plat BK 6421 MAF. Tak hanya itu, kawanan geng kereta juga merampas handphone milik Ananta. Dalam peristiwa itu, korban Ananta mengalami luka-luka dibagian wajahnya. Sehari sebelumnya, Irwansyah Putra Nasution alias Ibey, 27, dirampok anggota geng kereta dalam perjalanan pulang ke rumah usai meliput di Jalan Ngumban Surbakti Medan. Korban ketika melintas di Jalan Karya Wisata tepatnya di depan perumahan CitraWisata, dicegat lima pelaku mengendarai tiga sepedamotor. Korban langsung diserang

pakai senjata tajam sedangkan sepedamotornya Honda Beat BK 2025 XT warna merah dibawa kabur para pelaku. Kapolsek Delitua, Kompol SP Sinulingga yang dikonfirmasi membenarkan kejadian tersebut. Menurutnya, polisi sudah melakukan pengejaran sampai pagi dengan korban Tarmizi Ananta Lubis. “Setelah kita berkeliling sampai larut pagi, kita tidak berhasil menemukan para pelaku,” ujarnya. Kata dia, berdasarkan informasi dan keterangan yang didapat, para pelaku melarikan diri ke arah kawasan Medan Baru. ”Mereka kaburnya ke arah Medan Baru,” ujarnya sembari mengatakui tidak bisa memastikan apakah para pelaku yang merampok Ibey anggota geng kereta yang sama menyerang Ananta. Sementara itu, tiga anggota

geng kereta merampok sepedamotor Yamaha Vega R BK 6599 AAR milik Kun Hernowo Putra, 27, di Jalan Cemara, Desa Sampali, Kec. Percut Seituan, Minggu sekira pukul 02:00. Dalam pengaduannya ke Polsek Percut Seituan, Kun Hernowo Putra, warga Jalan Bersama, Kel. Tembung, Kec. Medan Tembung, mengatakan, malam itu dirinya mengendarai sepedamotor hendak menuju rumah temannya di kawasan Pulo Brayan Medan. Korban melintas seorang diri dari Jalan Pancing dan terus ke Jalan Cemara. Namun, setibanya di Jln. Cemara tak jauh dari Perumahan Cemara Asri, tiba-tiba korban didekati oleh sejumlah orang yang mengendarai sepedamotor. Tiga pelaku langsung memepet sepedamotor korban.

Merasa terkejut dan curiga, korban langsung menabrak sepedamotor pelaku hingga dirinya terjatuh. Melihat korban tergeletak di pinggir jalan, ketiga pelaku langsung menodongkan senjata tajamnya. Sedangkan korban langsung melarikan diri meninggal sepedamotor yang baru 3 bulan dibeli dengan cara kredit itu. Ketiga pelaku yang melihat korban menyelamatkan diri langsung membawa kabur sepedamotor tersebut. Kasus perampokan sepedamotor yang diduga dilakukan komplotan geng kereta itu kini masih dalam penyelidikan petugasPolsekPercutSeituan.“Pelakunya masih dalam penyelidikan sedangkan korban sudah membuat laporan pengaduan,” kata Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan. (m40/h04)

Karyawan Karaoke Ellegant Jual Ekstasi Pada Polisi

Oknum Dokter Ambil Keuntungan Dari Pasien Miskin Harus Ditindak

MEDAN (Waspada): Karyawan Karaoke Ellegant di Jln. Gatot Subroto Medan, ditangkap Sat Reserse Narkoba Polresta Medan, saat menjual narkoba jenis ekstasi kepada polisi yang menyaru, Kamis (6/9) malam. Tersangka J, warga Masjid Taufik Medan, bersama barang bukti empat butir ekstasi warna ungu merk Batman kemudian diboyong ke Polresta Medan. Informasi Waspada peroleh di Polresta Medan, Jumat (7/9), penangkapan itu setelah adanya laporan warga yang menyebutkan sejumlah tempat hiburan malam di antaranya Karaoke Ellegant dijadikan tempat peredaran narkoba. Setiap pengunjung yang datang ke lokasi dengan gampang memperoleh pil ekstasi seharga Rp250 ribu/butir yang diduga disediakan pihak karaoke. Begitu mendapat informasi tersebut, polisi langsung melakukan pengembangan. Panit Idik I Iptu Jamak Purba SH, MH, bersama anggota kemudian melakukan under coverbuy (penyamaran). Anggota Sat Reserse Narkoba menyaru sebagai pengunjung di KTV A-10. Tidak berapa lama tersangka yang merupakan kapten ruangan itu menawarkan ekstasi perbutirnya Rp250 ribu. Setelah terjadi transaksi antara petugas yang menyaru dan karyawan karaoke tersebut, tersangka menunjukkan pil ekstasi kepada polisi dan langsung ditangkap. Selanjutnya polisi melakukan penggeledahan di lokasi dan hanya menemukan empat butir ekstasi. Hasil pemeriksaan, tersangka mengaku baru dua bulan mengedarkan narkoba pada pengunjung KTV. Sedangkan ekstasi diperolehnya dari bandar dengan panggilan Bro. Kasat Reserse Narkoba Kompol Dony Alexander SIK, ketika dikonfirmasi membenarkan penangkapan tersebut. “Tersangka ditangkap anggota saat menjual ekstasi kepada petugas yang menyaru sebagai pembeli. Kami masih melakukan pemeriksaan terhadap J dan mengembangkan kasus ini dengan memburon temannya yang dipanggil Bro,” katanya. (m39)

MEDAN (Waspada): Pihak pimpinan rumah sakit dan Majelis Kode Etik Kedokteran harus menindak oknum perawat dan dokter yang terindikasi meraup keuntungan sendiri dari pasienpasien tidak mampu. “Sehingga di rumah sakit tersebut hanya ada para medis yang berupaya menyelamatkan pasien, bukan petugas medis yang mencari keuntungan dari pasien-pasien pengguna Jamkesmas, JPKMS, dan Jampersal,” kata Ketua Komisi B DPRD Medan H Surianda Lubis, Jumat (7/ 9), menanggapi adanya oknum dokter di RS Mita Sejati yang memanfaatkan kesalahan pasien yang menggunakan Jamkesmas milik orang lain. Menurutnya, seseorang tentu tidak akan mau menggunakan kartu Jamkesmas dan JPKMS ataupun Jampersal jika secara ekonomis dia mapan. “Seharusnya jika pasien tersebut memakai kartu Jamkesmas keluarganya dengan alasan hilang, dokter dan perawat bisa memberi tahu pasien agar segera mengurus surat hilangnya ke kantor polisi dan selanjutnya ke Askes agar dikeluarkan surat

dari Askes bahwa dia memang benar terdaftar di Jamkesmas, atau dimasukkan ke dalam pasien Jampersal,” sebutnya. Kata dia, pelaksanaan asuransi kesehatan bagi warga miskin harus mendapat pengawasan serius dari Dinkes setempat. “Sehingga warga miskin kita semua dapat tercover. Dan RS provider pun harus dievaluasi menstandarkan gedung untuk pasien miskin, sehingga tidak boleh ada kesan pasien Jamkesmas, JPKMS sebagai anak tiri yang ditempatkan di pelayanan dan sarana ke ruang tidak layak,” jelasnya. Ditambahkannya, para petugas medis harus lah menggunakan empati yang kuat dalam melayani pasien kurang mampu itu. “Jangan bertentangan dengan janji yang diucapkan para medis. Apalagi ada pemanfaatan dari ketidaktahuan masyarakat miskin itu,” katanya. Sebelumnya, Dinas kesehatan Medan tidak akan mainmain memberikan sanksi kepada rumah sakit provider untuk melayani peserta Jaminan Pelayanan Kesehatan Medan Sehat

(JPKMS) dalam memberikan pelayanan kesehatan. “Sanksi tegasnya bisa menutup rumah sakit yang memungut biaya JPKMS,” tutur Kadis Medan dr Edwin Effendi usai halal bil halal di Dinkes Medan, Kamis (6/9). Kata dia, pihaknya sudah melakukan tahap pengawasan, sekarang Dinkes Medan masuk dalam tahap kedua yaitu penilaian dan penindakan. “Kalau jelas dan detail kronologisnya, lapor langsung sama saya, kita turun dan saya akan tindak ditempat. Petugas saya jangan ada yang coba main-main dalam hal pelayanan kesehatan masyarakat. Karena ini juga instruksi Wali Kota Medan Rahudman Harahap dalam memberikan pelayanan maksimal dan meningkatkan derajat kesehatan masyarakat,” ujar Edwin. Wali Kota Medan juga memberikan dukungan spirit dalam pelayanan kesehatan agar semakin baik. Untuk merealisasikan hal itu, Dinkes Medan terus melakukan instropeksi, menjalin kerjasama dengan rumah sakit dan mitra kesehatan lainnya. (h02)

Indonesia Butuh Sosok Melanchton Siregar MEDAN (Waspada): Indonesia membutuhkan sosok Melanchton Siregar yang tidak hanya berjasa di bidang politik, namun juga di dunia pendidikan. “Sosok Melanchton Siregar sangat dibutuhkan bangsa Indonesia. Dia seorang yang memegang teguh jati diri bangsa yang sangat tangguh,” kataWakil Ketua MPR RI Melani Leimena Suharli saat membuka seminar “Perjuangan Melanchton Siregar dalam mempertahankan dan membangun Negara Kesatuan Republik Indonesia (NKRI)”, di Medan, Sabtu (8/9). Menurut dia, Melanchton Siregar merupakan seseorang yang telah banyak memberikan pengabdian kepada bangsa. Pengabdian Melanchton tidak hanya di bidang politik sebagai Ketua Partai Kristen Indonesia (Parkindo) saja, melainkan juga di bidang pendidikan. “Melanchton Siregar tipe orang yang

suka mengorganisir. Kendati Melanchton dulu juga bekerja buat partai politik, namun beliau tak pernah melepaskan perhatiannya bagi dunia pendidikan di negeri ini,” ujarnya. Melani mengaku, dirinya akan memberikan dukungan penuh terhadap pemberian gelar pahlawan nasional kepada Melanchton Siregar. Sebab figurnya sudah lama dikenal. Beliau juga merupakan pendidik, politisi sekaligus pejuang kemerdekaan. Melanchton tidak pernah lelah mendidik masyarakat Sumut saat itu. Sementara itu, Sejarawan USU Dr Suprayitno M.Hum, dalam pembahasannya mengatakan, pendidikan menjadi alat perjuangan Melanchton Siregar dalam mempertahankan kemerdekaan Indonesia dari serbuan militer Belanda. Beliau adalah seorang pejuang kemerdekaan yang visioner serta

berpandangan jauh kedepan. “Dengan pendidikan, beliau bangun karakter murid-murid dan masyarakat sebagai pemuda yang tangguh, berwibawa, dan setia kepada NKRI. Melanchton Siregar mengutamakan penguatan motivasi dan etos kerja anak didik untuk pengembangan diri dimasa depan,” sebutnya. Kata dia, Melanchton Siregar telah melahirkan gagasan atau pemikiran besar yang dapat mendatangkan kesejahteraan masyarakat luas atau meningkatkan harkat dan masrtabat bangsa. Perjuangan yang dilakukannya mempunyai jangkauan luas dan berskala nasional, sehingga pantas diusulkan menjadi pahlawan nasional dari Sumatera Utara. Dosen UPH Jakarta Dr Victor Silaen MA, yang juga menjadi narasumber pada seminar tersebut menambahkan, Melanchton Siregar merupakan

contoh konkret bahwa menjadi politikus andal tidak cukup hanya bermodalkan intelektualitas saja, tapi juga pengalaman panjang berorganisasi. “Dalam hal ini, posisi Melanchton Siregar sangat jelas yaitu politikus Kristen yang nonsektarian. Tak heran kalau pemikirannya fokus pada Pancasila, persatuan, pembangunan dan demokrasi,” ujarnya. Sebelumnya, Ketua Panitia Seminar Dr Januari Siregar SH, M.Hum mengatakan, seminar nasional tersebut adalah upaya untuk mengenang jasa Melanchton Siregar sebagai putra Sumut, yang memiliki jasa yang luar biasa bagi Sumut. Pada kesempatan itu, Ny. Melanchton Siregar Setiawan Br Siburian, istri Melanchton Siregar mengungkapkan terima kasihnya atas upaya mengusung Melanchton Siregar dari seluruh penjuru Indonesia, khususnya masyarakat Humbahas

serta Sumut untuk menggolkan menjadi pahlawan nasional. Melanchton Siregar lahir 7 Agustus 1912 di Pea Arung, Humbang, Tapanuli Utara. Ia mengawali karir sebagai seorang guru pada Christelijke HIS Narumodnda (1938-1939). Kemudian menjadi anggota DPR Sumatera Timur, Sumatera Utara, dan sempat menjadi anggota Komite Nasional Indonesia Pusat (KNIP) 1947 hingga bubar. Dia juga menjadi anggota DPR RI hasil pemilihan umum pertama (1956-1960) dan menjadiWakil Ketua MPRS tahun 1966-1971. Melanchton Siregar menjadi anggota Dewan Pertimbangan Agung 1973 hingga meninggal dunia pada 24 Februari 1975. Dia pernah meraih tanda jasa seperti Satya Lencana Peringatan Perjuangan Kemerdekaan 20 Mei 1961 dan Bintang Mahaputera Adipradana kelas II pada 21 Mei 1973.(cdu)


REKTOR USU Prof Dr dr Syahril Pasaribu, DTM&H, MSc(CTM), SpA(K) didampingi Ketua Panitia Dies Natalis ke-60 USU tahun 2012 H. Nurdin Lubis, SH, MM dan Ketua Panitia Gala Dinner Nurlisa Ginting, foto bersama perwakilan PT Waskita Karya, PTPN IV, PTPN III, Bank Mandiri dan Bank BNI usai menerima penghargaan, Sabtu (8/9) malam.

Gala Dinner Momentun Membangkitkan Kecintaan Alumni Untuk Memajukan USU MEDAN (Waspada): Pelaksanaan Gala Dinner Dies ke-60 Natalis USU tahun 2012 berlangsung sukses. Gala Dinner ini diharapkan menjadi momentum membangkitkan kecintaan para alumni untuk membantu pengembangan dan memajukan USU menjadi lebih baik di masa mendatang. Demikian dikatakan Ketua Panitia Dies Natalis ke-60 USU tahun 2012 H Nurdin Lubis, SH, MM di hadapan Rektor USU Prof Dr dr Syahril Pasaribu, DTM&H, MSc(CTM), SpA(K), Forum Komunikasi Pimpinan Daerah, alumni, staf pengajar, civitas akademik, pejabat daerah dan nasional, pimpinan perusahaan BUMN/BUMD dan perusahan swasta nasional, mitra kerja USU, tokoh masyarakat serta para undangan di Santika Dyandra Convention Medan, Sabtu (8/9) malam. Menurut Nurdin Lubis, Gala Dinner juga bertujuan untuk menjalin silaturahmi para alumni Universitas Sumatera Utara, tokoh masyarakat serta pemerhati pendidikan bersama almamater USU. Selain itu, untuk menggalang dukungan alumni dan seluruh potensi masyarakat yang peduli pendidikan untuk membangun USU yang lebih baik di masa mendatang, memberi penghargaan dan apresiasi kepada tokoh, institusi dan pihak lainnya yang telah mendukung program-program pendidikan di USU dan juga rangkaian Dies Natalis ke-60 tahun 2012. Gala Dinner ini, kata Nurdin, sebagai ajang media komunikasi dan promosi potensi

mahasiswa dan almamater USU di bidang kesenian dan kebudayaan. Menurutnya, serangkaian kegiatan Dies Natalis ke-60 USU tahun 2012 sudah digelar sejak dibentuknya kepanitiaan pada Februari 2012. Diantaranya bidang pendidikan seperti seminar, kuliah umum dan lain-lain. Di bidang kesehatan meliputi pengobatan gratis, donor darah dan sebagainya. Selain itu, digelar pameran lingkungan hidup dan CSR Expo. Puncak Dies Natalis USU dijadwalkan akan menghadirkan Presiden Susilo Bambang Yudhoyono sekaligus peresmian Rumah Sakit USU. Sementara itu, Rektor USU, Prof Dr dr Syahril Pasaribu, DTM&H, MSc (CTM), SpA(K) mengatakan, Gala Dinner sekaligus temu kangen para alumni USU ini menjadi momentum penting untuk kemajuan USU mendatang. Apalagi, kata Syahril, keberadaan kampus USU yang memiliki luas sekitar 100 hektare sudah kurang representatif untuk menampung mahasiswa USU yang berjumlah 42.000 orang. Mengingat jumlah mahasiswa USU akan bertambah tahun ini menjadi 62.000 orang. “Pengembangan kampus USU di kawasan Kuala Bekala di Pancurbatu sudah harus dilakukan. Karena lahannya yang sudah disediakan 300 hektare dan diharapkan pada tahun 2020 pembangunan sudah dapat diselesaikan. Ini perlu dukungan pemerintah dan para alumni USU guna merealisasikan hal itu,” ujarnya.(m25)

Komunitas Intelijen Jangan Berpihak Di Pilgubsu MEDAN (Waspada): Komunitas intelijen dalam berkiprah harus benar-benar netral dan objektif agar suasana kondusif di berbagai bidang tetap terjamin, termasuk tidak berpihak dalam pemilihan Gubsu dan Wagubsu (Pilgubsu) 2013. Demikian salah satu kesimpulan rapat Komunitas Intelijen Daerah (Kominda) Provinsi Sumut dengan Pemprovsu dipimpin Kepala Badan Kesbangpol Linmas Sumut Drs H Eddy Syofian MAP, mewakiliki Plt Gubsu H Gatot Pujo Nugroho ST, selaku Ketua Kominda Sumut, di Hotel Grand Kanaya Medan, Rabu (5/9). Rapat yang dihadiri Ketua Pelaksana Harian (Kalakhar) Kominda Sumut Laksmana Pertama Djajeng Soedarsono yang juga Kepala Badan Intelijen Negara (BIN) Daerah Sumut menegaskan, komunitas intelijen tidak boleh ikut bermain dalam Pilgubsu 2013. ”Tidak boleh ada peran intelijen negara yang berpihak pada kepentingan politik tertentu, melainkan harus netral,” kata Djajeng sesaat penutupan Raker yang juga dihadiri Asisten Ketataprajaan Setdaprovsu Hasiholan Silaen. Beberapa peserta rapat menjawab wartawan sependapat, peran intelijen harus netral khususnya dalam menyikapi suasana perkembangan perpolitikan Sumut menjelang Pilgubsu periode 2013 - 2018 yang dijadwalkan Maret mendatang. Sebagaimana diberitakan media massa, suhu politik Sumut dirasakan mulai menggeliat terutama sejak telah mencuatnya beberapa nama yang disebut-sebut akan maju sebagai bakal calon Gubsu antara lain H Gatot Pujo Nugroho, H Gus Irawan, Letjen TNI (Purn) AY Nasution, Irjen Pol Wisjnu Amat Sastro, H Amri Tambunan, DR RE Nainggolan dan lainnya. Eddy Syofian berharap, semua komponen strategis masyarakat dan pemangku amanah politik daerah ini tetap komit agar Pilgubsu ber-

langsung aman dan kondusif. Secara umum suasana Kesbangpollinmas Sumut tetap harmonis dan sejuk. Kabid Pembinaan Kewaspadaan Nasional Badan Kesbangpol Provsu Zulkarnain R mengemukakan, rapat ini guna menghimpun informasi dan mengoordinasikan berbagai potensi kerawanan dengan meminta masukan dari berbagai simpul strategis yang dapat memberikan solusi antisipasi potensi kerawanan dimaksud. Selain dihadiri komunitas intelijen, rapat ini juga menghadirkan narasumber yakni Ketua Forum Kerukunan Umat Beragama (FKUB) Sumut DR H Maratua Simanjuntak, Ketua Forum Kewaspadaan Dini Masyarakat (FKDM) Nurdin Soelistyo, Ketua Forum Pembauran Kebangsaan (FPK) Bahri Damanik dan Ketua Majelis Ulama Indonesia (MUI) Sumut Prof Dr H Fakhruddin, MA. Pada rapat ini juga disimpulkan perlunya lebih diintensifkan dialog antar agama atau internal agama, guna lebih meningkatkan pemahaman nilai-nilai ajaran agama bagi masing-masing pemeluknya, yang sekaligus berguna untuk menangkal atau mengantisipasi munculnya sempalan aliran kepercayaan. Juga direkomendasikan agar diperkuat keberadaan organisasi keagamaan untuk memberikan pemahaman lebih baik kepada masing-masing umat serta diperkuat juga sistem pembelajaran agama di sekolah-sekolah sehingga pola fikir yang menjurus kepada sempalan aliran kepercayaan dapat diantisipasi. Rapat ini juga membahas rencana aksi buruh 14 September 2012 yang memperjuangkan kenaikan upah dan penghapusan outsorching. Juga direkomendasikan perubahan paradigma antara majikan dan pekerja menjadi hubungan saling bertanggungjawab, saling melindungi dan merupakan bagian dari kegiatan perusahaan.(m28)

112 Mahasiswa Nisel Dapat Beasiswa Kuliah Di Akbid Helvetia MEDAN (Waspada): Sebanyak 112 mahasiswa baru asal Nias Selatan (Nisel) tiba di Kota Medan, Sabtu (8/9). Mereka mendapat Beasiswa Penuh Ikatan Dinas dari Pemerintah Kabupaten Nias Selatan untuk kuliah di Akademi Kebidanan dan Keperawatan Helvetia Medan tahun akademik 2012/2013. Rombongan mahasiswa yang dipimpin langsung oleh Kepala Dinas Kesehatan Nisel Murniati Dachi SKM, MM tiba di Bandara Polonia Medan, dalam tiga tahap dengan menggunakan tiga pesawat.KedatanganrombonganditerimapihakYayasan RSU Helvetia Medan Darma Satria dan Hanifah. Para mahasiswa/i yang berjumlah 112 orang tersebut terdiri dari 67 mahasiswa baru Akbid dan 45 mahasiswa Akper itu akan dikuliahkan secara gratis karena mendapat Beasiswa Penuh Ikatan Dinas dari Pemkab Nisel.

Setelah tamat para mahasiswa itu akan mendarmabaktikan kemampuan sebagai tenaga kesehatan di Kabupaten Nias Selatan. Program Beasiswa Penuh Ikatan Dinas tersebut merupakan program unggulan Bupati Nisel Drs Idealisman Dachi dalam upaya meningkatkan kualitas SDM kesehatan di Kabupaten Nias. Ini sejalan dengan visi misi Nias Selatan “Pendidikan dan Kesehatan Gratis”. Sementara itu, Kadis Kesehatan Nisel Murniati Dachi mengatakan, pemilihan Akademi Kebidanan dan Akademi Keperawatan Helvetia Medan sebagai tempat kuliah mahasiswa baru program beasiswa ini, dikarenakan Akbid dan Akper tersebut merupakan satu-satunya di Sumatera Utara yang terakreditasi BAN-PT Peringkat B dan diakui kualitasnya di dalam negeri maupun di luar negeri. (cwan)


ROMBONGAN mahasiswa baru Akbid dan Akper Helvetia Medan asal Nias Selatan, dipimpin Kadis Kesehatan Nisel Murniati Dachi SKM, MM, foto bersama setiba di Bandara Polonia Medan.

Medan Metropolitan

WASPADA Senin 10 September 2012


Soal Perubuhan Sejumlah Masjid Di Medan

Ada Ketidakberesan Mengatasnamakan MUI MEDAN (Waspada): Direktur Lembaga Bantuan Hukum (LBH) Aljamiatulwashliyah Kota Medan Ibeng Syafrudin Rani, SH menilai, terjadinya pemukulan terhadap pengurus MUI di PN Medan, karena ada kausalitas (sebab – akibat). Dalam hal ini, masyarakat marah terhadap seseorang yang notabene pengurus Majelis Ulama Indonesia Kota Medan karena diduga terlibat dalam kasus perubuhan Masjid At-Thoyyibah.

Ibeng mengemukakan pendapat dan penilaiannya kepada Waspada di Kantor Hukum Kamaluddin Jln. Airlangga Medan, Jumat (7/9). Seharusnya, menurut Ibeng, dengan adanya kasus tersebut, MUI Kota Medan segera introspeksi diri dan koreksi (ibda’ bi nafsih). Apakah program yang mereka laksanakan mengatasnamakan MUI Kota Medan, benar-benar demi kepentingan dan kemaslahatan umat Islam. ‘’Namun, tindakan pemukulan itu tidak bisa ditolerir. Sebab, apa yang dilakukan orang

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.20 08.45 10.30 11.55 14.10 15.55 17.55 18.45 19.55 09.45 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 12.25 17.55


CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam

QG-831 QG-833 QG-835 QG-880 QG-882

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 8 Kuala Lumpur 9. Baangkook 10 Bandung 11 Surabaya 12 Bandung

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981

06.05 11.20 08.00 17.25 104.10 18.30 21.25 17.00 08.25 11.35 17.10

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

yang dipukul tersebut, tidak serta-merta dizalimi seolaholah dia paling bersalah. Padahal dia bagian kecil dari lembaga tersebut,’’ujar Ibeng. Masih terkait dengan perubuhan masjid, Ibeng melihat ada ketidakberesan yang dilakukan oknum-oknum mengatasnamakan MUI Kota Medan untuk kepentingan kelompok tertentu sehingga mengabaikan kemaslahatan umat. “Kalau hal itu terus dibiarkan, maka masyarakat khususnya umat Islam tidak akan percaya lagi terhadap kepengurusan MUI. Karena itu, saya berharap ulama-ulama yang ada di ormas Islam melakukan muzakarah dan menentukan sikap atas kasus-kasus perubuhan masjid di Kota Medan, termasuk tentang pola sikap, pola tindak dan perilaku pengurus MUI Kota Medan itu sendiri,” sebutnya. Ibeng melihat kepengurusan atau orang-orang yang ada di tubuh MUI Kota Medan bersikap mendua dalam hal menentukan fatwa untuk kemaslahatan umat, terutama tentang kasus perubuhan masjid. “Jika alasannya tidak ada warga di sekitar masjid sehingga dilakukan perubuhan, maka saya tidak sependapat. Namun saya sependapat dengan apa yang disampaikan DR Hashim Purba MA yakni kalau alasan perubuhan masjid karena tidak ada warga di sekitar masjid tidak tepat,” ujarnya. Hashim Purba menyontohkan Masjid Istiqlal Jakarta, tidak ada warga bermukim di sekitar-

nya. Makanya, MUI Kota Medan harus belajar banyak dari kasuskasus dan kondisi umat Islam masa lalu dan masa kini, agar umat Islam lebih bermartabat di masa datang. Berpihak Sementara itu, Korps Alumni Mahasiswa Islam (KAHMI) Medan mengakui ada oknum ulama cenderung berpihak pada kepentingan sekelompok atau golongan tertentu dan tidak berpihak kepada umat Islam. Ketua harian KAHMI Medan Drg M Sahbana didampingi sekum Singgih Permono, wakil sekretaris Ir Ferdinansyah Thamrin, Dhanny Damanik, Chairul Azhar dan Psikolog Rahmadani Hidayatin mengatakan kepada Waspada, Rabu (5/9), menanggapi munculnya ulama Syuk (jahat) akhir-akhir ini. Sahbana mencontohkan kasus perubuhan Masjid AtThoyyibah di Jln. Multatuli, Kel. Madras . Disitu secara gamblang terpapar ada sebuah konspirasi oleh sebagian oknum ulama dengan tujuan untuk memindahkan Masjid At- Thoyyibah. Padahal, jelas masyarakat setempat menolak perubuhan masjid tersebut dan kejadian ini sangat memilukan dan menyedihkan. Sebagai lembaga pendidikan intelektual, KAHMI sangat mengapresiasi adanya rencana pembangunan Masjid Raya Kota Medan yang akan dibangun Pemko Medan. Namun perlu ditegaskan, hal ini jangan sampai mengaburkan fakta atau

mempeti-eskan kasus-kasus perubuhan masjid di Kota Medan. Diimbau kepada umat Islam di Sumatera Utara dalam Pilkada nanti, dapat memilih pemimpin yang benar-benar berpihak pada kepentingan umat Islam dan mengambil langkah kongkrit dalam bentuk penyelesaian persoalan yang ada di tengah-tengah umat Islam. Sedangkan Sekretaris Majelis Dakwah Alwashliyah Sumut Fahrurrozi Pulungan didampingi wakil sekretaris Majelis Pendidikan Alwashliyah Sumut Zainal Abidin menegaskan, ulama sebagai pewaris Nabi, maka tindak tanduknya harus sesuai dengan sabda Rasul. Kata Pulungan, seharusnya ulama dan ustadz jangan mendatangi pemerintah, karena akan menjatuhkan marwahnya (wibawa) sebagai ulama dan ustadz. Kalau umara (pemerintah) merasa penting untuk memutuskan suatu perkara tentang pemerintahan yang menyangkut kepada kemaslahatan umat, baik dalam bentuk kehidupan maupun ibadah, tidak meminta orang per orang. Karena di Indonesia memiliki lembaga bernama MUI atau ormas Islam seperti Alwashliyah, Muhammmadiyah, Nahdlatul Ulama dan lain-lain. Dengan demikian, keputusannya legal dan tidak keputusan pribadi yang ‘menjual’ organisasi atau lembaga. Inilah yang menyebabkan timbulnya ketidakpercayaan umat kepada ulama atau ustadz.(m34/m24)

Mayat Wanita Terapung Di Sungai Denai dong mendatangi rumahnya. “Ayah saya menjadi stres dan tidak bekerja lagi sejak ditinggal ibu sekitar dua bulan lalu. Ibu saya sekarang tinggal di kawasan Marelan,” kata Junaidi kepada petugas Polsek Medan Timur yang datang ke lokasi bersama Tim Identifikasi Polresta Medan melakukan olah TKP. Usai melakukan olah TKP, petugas menyarankan untuk membuat surat visum ke Rumah Sakit Pirngadi Medan, namun pihak keluarga M Saman keberatan untuk divisum sehingga membuat surat pernyataan dengan disaksikan Kepling XIV Khairul Dalimunthe. Kapolsek Medan Timur Kompol Patar Silalahi melalui Kanit Reskrim AKP Ridwan SH menjelaskan, korban ditemukan dengan posisi leher terikat kain sarung, lidah tidak menjulur keluar, kaki tak cecah ke tanah, dan kemaluan mengeluarkan sperma. “Tim Identifikasi sudah melakukan olah TKP. Tidak ada ditemukan tanda-tanda penganiayaan di tubuh korban. Pihak keluarga korban juga keberatan membuat surat visum sehingga membuat surat pernyataan dengan disaksikan Kepling,” ujar Ridwan.(h04)

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284

10.55 18.25

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283

09.55 17.40

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Batam

Y6-594 Y6-596 7P-568

16.00 18.15 12.25

Jakarta Jakarta Batam

Y6-593 Y6-595 YP-567

13.00 15.15 10.30

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

MEDAN (Waspada): Warga Jalan Pelikan Raya Lingkungan Kenangan, Perumnas Mandala. Kec. Percut Seituan, dihebohkan dengan penemuan sosok mayat wanita muda tanpa identitas mengapung di aliran Sungai Denai, Sabtu (8/9) sekira pukul 15:00 WIB. Mayat wanita berambut hitam panjang ini pertama kali ditemukan oleh R Silitonga, 60, yang sedang mengumpulkan plastik bekas di aliran sungai Denai. Dia melihat sesosok mayat mengapung, kemudian menepikannya dengan menggunakan tali timba miliknya. Setelah itu, Silitonga langsung memberitahukan kepada warga sekitar tentang penemuan mayat tersebut. Petugas Polsek Percut Seituan langsung turun ke lokasi kejadian. Sejumlah warga yang mengetahui kejadian itu, langsung berdatangan ke lokasi melihat mayat tersebut, namun tak satu di antara mereka mengetahui identitas mayat wanita tersebut. Ketika ditemukan mayat wanita itu mengenakan pakaian kaos kerah berwarna merah dan mengenakan celana jeans berwana biru. “Identitas mayat belum diketahui sedangkan mayat sudah

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

Pemko Pinjam Rp77 M Bangun Tiga Pasar

MANDALA AIRLINE 1 Jakarta 2 Singapura 3. Jakarta 4 Jakarta (5.7)

RI-092 RI-861 RI-096 RI-096

06.40 11.00 18.50 16.40

Singapura Jakarta Jakarta Jakarta (5.7)

RI-862 RI-093 RI-097 RI-097

07.20 11.30 19.20 20.55

Jadwal Perjalanan Kereta Api No KA

Nama KA

U.2 Sri Bilah U.4 Sri Bilah U.6 Sri Bilah U.8 Sri Bilah U.1 Sri Bilah U.3 Sri Bilah U.5 Sri Bilah U.7 Sri Bilah U.10 Sri Bilah U.12 Sri Bilah U.9 Sri Bilah U.11 Sri Bilah U.14 Putri Deli U.16 Putri Deli U.18 Putri Deli U.13 Putri Deli U.15 Putri Deli U.17 Putri Deli U.22 Siantar Ekspres U.21 Siantar Ekspres PLB 7000 Sri Lelawangsa PLB 7002 Sri Lelawangsa PLB 7004 Sri Lelawangsa PLB 7008 Sri Lelawangsa PLB 7010 Sri Lelawangsa PLB 7012 Sri Lelawangsa PLB 7001 Sri Lelawangsa PLB 7003 Sri Lelawangsa PLB 700 Sri Lelawangsa PLB 7009 Sri Lelawangsa PLB 7011 Sri Lelawangsa PLB 7012 Sri Lelawangsa


Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi



Berangkat Datang

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan

08.00 10.30 15.00 22.50 08.05 14.35 16.55 23.25 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 05.00 09.50 12.15 14.40 05.20 08.55 06.30 11.00 13.30 15.50

13.16 15.31 20.18 03.34 13.12 19.49 21.50 04.21 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.22 05.52 10.42 13.07 15.32 07.22 09.47 07.22 11.52 14.22 16.42


MEDAN (Waspada): Pemko Medan mendapat kepercayaan untuk mengelola pinjaman investasi daerah dari Pusat Investasi Pemerintah (PIP) Kementrian Keuangan Republik Indonesia sebesar Rp77.454.148. 000. Pinjaman ini akan digunakan untuk revitalisasi tiga pasar tradisional yakni Pasar Marelan, Pasar Jawa Belawan dan Pasar Kampung Lalang. Dengan revitalisasi ini diharapkan ketiga pasar tradisional itu menjadi pasar yang memiliki daya tarik besar bagi pembeli dan menambah keteraturan kota, sekaligus memberikan kontribusi terhadap kemampuan fiskal daerah. Hal ini terungkap dalam acara penandantanganan perjanjian pinjaman untuk revitalisasi tiga pasar tradisional di Kota Medan antara PIP Kementrian Keuangan Republik Indonesia dengan Pemko Medan di City Hall Grand Aston Hotel Medan, Kamis (6/9). Penandatanganan dilakukanWali Kota Medan Rahudman Harahap dengan Ketua PIP Kementrian Keuangan RI Saritaon Siregar disaksikan Syamsurizul A Bispo selaku notaris. “Pinjaman ini kita gunakan untuk merevitalisasi tiga pasar tradisional yakni Pasar Marelan, Pasar Jawa di Belawan, dan Pasar Kampung Lalang. Pem-

dievakuasi ke RSU Dr Pirngadi Medan,” kata Kapolsek Percut Seituan Kompol Maringan Simanjuntak. Gantung diri Di tempat terpisah, M Saman alias M Amin, 62, ditemukan tewas gantung diri di rumah anaknya Jalan Madio Santoso, Lingkungan XIV, Kel. Pulo Brayan Darat I, Kec. Medan Timur, Sabtu (8/9) sekira pukul 05:30 WIB. Belum diketahui secara pasti apa penyebab M Saman nekad mengakhiri hidupnya dengan cara seperti itu, namun beredar kabar sejak dua bulan lalu korban telah pisah ranjang dengan istrinya. Informasi yang diperoleh di kepolisian, jasad M Saman pertama kali diketahui oleh anaknya Junaidi, 40. Saat itu, Junaidi keluar dari kamarnya hendak melaksanakan shalat Subuh. Ketika hendak mengambil air wudhuk,dia melihat orangtuanya itu sudah tergantung di plafon dapur dengan menggunakan kain sarung. Melihat ayahnya gantung diri, spontan Junaidi berteriak minta tolong. Sejumlah warga yang mendengar teriakan Junaidi, segera berbondong-bon-

bangunan ketiga pasar tradisional ini telah melalui studi kelayakan yang diperlukan dan dipersyaratkan,” kata Rahudman. Menurut Wali Kota, peminjaman ini dilakukan karena besaran dan tata cara pembayaran pinjaman dipastikan tidak akan memberatkan Pemko Medan, terutama menyangkut anggaran daerah. Artinya, pinjaman ini tidak akan mengganggu pembangunan sektor-sektor vital dan strategis lainnya. “Pinjaman ini diberikan dalam jangka waktu 5 tahun dengan masa tenggang pembayaran pokok 12 bulan, sedangkan bunga pinjaman 7,75 persen,” sebutnya. Rahudman menjelaskan, revitalisasi ketiga pasar tradisional sudah akan dimulai tahun ini bersifat multi years dan direncanakan siap pada 2013. Dengan revitalisasi ini diharapkan ketiga pasar tradisional itu dapat dikelola menjadi pasar tradisional modern dengan citra baru. Maksudnya, pasar dengan lingkungan tertata, aman dan nyaman. Serta memberikan suasana sejuk bagi konsumen yang datang berbelanja. Selain pinjaman dari PIP, Wali Kota juga ingin Kementerian Perdagangan Republik Indonesia untuk membangun pasar-pasar tradisional lainnya. Dijelaskannya, jumlah pasar

tradisional yang ada di Kota Medan sebanyak 52 pasar yang pengelolaannya di bawah Perusahaan Daerah (PD) Pasar Kota Medan. Keseluruhan pasar tradisional ini merupakan salah satu asset untuk mendukung perekonomian kota. Sementara itu, Ketua PIP Kementrian Keuangan RI Soritaon Siregar mengatakan, sebagai Badan Layanan Umum di bawah Kementrian Keuangan, PIP berusaha menjalankan perannya sebagai katalis dalam percepatan pembangunan infrastruktur sehingga memberikan manfaat ekonomi, sosial serta manfaat lainnya bagi masyarakat. Itu sebabnya PIP sangat proaktif mendukung pembangunan infrastruktur daerah dengan membiayai proyek-proyek yang dapat dinikmati langsung oleh rakyat, salah satunya pembangunan pasar. Untuk memberikan pinjaman, termasuk kepada Pemko Medan, Saritaon menjelaskan prosesnya melalui analisa kelayakan terhadap kemampuan keuangan dan proyek itu sendiri. “Kondisi keuangan Pemko Medan tidak diragukan. Apalagi baru-baru ini mendapat penilai WajarTanpaPengecualian(WTP). Di samping itu kondisi pasar yang akan direvitalisasi juga menjanjikan,” sebutnya.(m50)

Waspada/Surya Efendi

MASJID THOYYIBAH: Sejumlah warga berjalan memasuki Masjid At Thoyyibah Jln. Multatuli Medan, Jumat (7/9), guna menunaikan shalat Jumat. Masjid ini merupakan pengganti masjid yang telah dirubuhkan guna kepentingan pembangunan Komplek Ruko Multatuli Indah.

Negara Ini Hancur Jika Honor Guru, Ustadz ‘Disunat’ 8MEDAN (Waspada): Rusaknya negara ini disebabkan tidak sesuainya kata dan perbuatan, bahkan negeri ini akan hancur jika honor para guru dan ustadz ‘disunat’. “Orang Islam itu satu kata dan perbuatan. Yang bikin rusak negara ini karena kata dan perbuatannya tidak sesuai,” kata Ketua Umum DPP BKPRMI Ali Mukhtar Ngabalin ketika memberikan tausiyah pada kegiatan halal bi halal Perguruan Bina Santri di Jln. Pasar III, Kec. Medan Perjuangan, Selasa (4/9). Kegiatan tersebut dirangkaikan penepungtawasaran jamaah calon haji (calhaj) berasal dari kawasan Kecamatan Medan Perjuangan. Mantan anggota DPR RI ini mengungkapkan, tidaksesuainya kata dan perbuatan tersebut bisa dilihat dari APBN Indonesia saat ini sebesar Rp2. 014 trilun mengalami kebocoran hingga 35 persen. Padahal, menurutnya, kebocoran tersebut sangat besar dan seharusnya tidak perlu terjadi. Penyebabnya banyak para pemimpin yang melanggar peraturan perundang-undangan yang ada.

Kata dia, Islam tidak mentolerir jika kata dan perbuatannya tidak sama sebab telah melanggar dan bertentangan dengan hukum-hukum Allah. Sedangkan terkait halal bi halal, Ali Mukhtar menuturkan, khasanah dari kegiatan halal bi halal sangat luar biasa untuk referensi umat Islam. “Khasanah halal bi halal sangat luar biasa, tidak ada agenda lain diluar halal bi halal selain silaturahim,”sebutnya. Sementara itu, KetuaYayasan Perguruan Bina Santri Drs H Sotar Nasution MH mengatakan, wujud halal bi halal ini adalah upaya terus membina silaturahim sesama umat Islam. Halal bi halal ini digelar bekerjasama dengan Keluarga Besar BKPRMI. “Ini upaya membangun kehersamaan sesama umat Islam agar makna halal bi halal dapat terwujud dengan baik,” ujarnya. Turut hadir pada kegiatan itu perwakilan Plt Gubsu, KH Zulfikar Hajar LC, Camat Medan Perjuangan, para kader BKPRMI, orangtua wali murid Perguruan Bina Santri, dan para tokoh agama, tokoh masyarakat setempat.(m26)

Warga Bongkar Bangunan Pagar Di Tanah Wakaf Betawi MEDAN (Waspada): Pengurus Badan Kenaziran Tanah Wakaf Muslim Warga Betawi Jalan Yos Sudarso Lingkungan XI, Kel. Glugur Kota, Kec. Medan Barat, dan seratusan warga membongkar bangunan pagar dan plang yang dipasang oleh keluarga ahli waris Abdul Somad di areal tanah wakaf tersebut, Jumat (7/9) sekira pukul 14:00. Sejumlah petugas dari Polresta Medan mengamankan aksi pembongkaran bangunan pagar tanpa IMB dan plang dari kelompok ahli waris Abdul Somad. Dalam aksi pembongkaran itu tidak terlihat adanya perlawanan dari kelompok ahli waris yang sebelumnya mengklaim lahan tersebut merupakan warisan dari almarhum Abdul Somad. Akibat pembongkaran itu, arus lalulintas di Jalan Yos Sudarso sempat macat. Ketua Badan Kenaziran Tanah Wakaf Muslim Betawi H Ghazali Lubis menyebutkan, badan kenaziran hanya mengurus dan menjaga tanah wakaf. Pembongkaran ini merupakan yang kedua kalinya. Pembongkaran dilakukan karena areal tersebut merupakan tanah wakaf dan bukan milik ahli waris Abdul Somad. Untuk melaksanakan perubuhan dan pembongkaran pagar, pihaknya sudah menyuratiWali Kota Medan karena bangunan pagar tembok tidak memiliki izin mendirikan bangunan (IMB). “Jadi, karena Pemko Medan tidak bertindak, maka warga dan pengurus dan kenaziran membongkar sendiri dengan meminta bantuan keamanan dari aparat kepolisian,” sebut Gazali. Kata dia, konflik tanah wakaf tersebut terjadi sejak 1988 dan pada 1992 Badan Pertanahan Nasional (BPN) Kota Medan, telah menerbitkan sertifikat tanah wakaf No 262. Pihak ahli waris Abdul Somad sudah dua kali menggugat di Peng-

adilan Negeri Medan namun gugatan tersebut kandas. “Sudah dua kali kami digugat oleh ahli waris Abdul Somad namun kami menang di PN Medan,” ujarnya. Sementara itu, Direktur Lembaga Advokasi Umat Islam Majelis Ulama Indonesia (MUI) Sumut H Hamdani Harahap SH, MHum, selaku kuasa hukum Badan KenaziranTanahWakaf Muslim Betawi menjelaskan, tanah wakaf tersebut sudah bersertifikat tanah wakaf yang dikeluarkan oleh instansi pemerintah. “Pembangunan pagar tembok dan plang di atas tanah wakaf yang sudah bersertifikat tanah wakaf No. 262 yang diterbitkan oleh Kepala Kantor Badan Pertanahan Kota Medan pada Mei 1992 dan terdaftar pada data Lembaga Wakaf Kota Medan 2005-2006, jelas bertentangan dengan hukum,” katanya. Menurut Hamdani, alas hukum tanah wakaf tersebut telah sempurna secara hukum, namun ahli waris dari almarhum Abdul Somad masih berusaha menguasai tanah wakaf tersebut, memindahkan plang merek dari depan ke belakang serta membangun pagar beton keliling. “Klien kami sudah berusaha melarangnya namun tidak berhasil, apalagi pembangunan pagar beton itu tidak memiliki izin bangunan sehingga terangterangan melawan hukum. Karena tidak ada ketegasan dari Wali Kota Medan maka kami terpaksa membongkar bangunan pagar tembok dan plang tersebut,” tegasnya. Pengurus Badan Kenaziran TanahWakaf Muslim Betawi, lanjut dia, juga telah melaporkan pemakaian tanah tanpa izin itu ke Polresta Medan pada 6 Agustus 2012 berdasarkan surat laporan pengaduan :STTLP/2124/K/VIII/2012/Resta Medan yang dilaporkan oleh Burhanuddin. (h04)

Waspada/Andi Aria Tirtayasa

SEJUMLAH warga Jalan Yos Sudarso, Lingkungan XI, Kel Glugur Kota, Kec Medan Barat, memasang plang tanah wakaf kaum muslim Betawi di aeral tanah wakaf tersebut di Jalan Yos Sudarso, Jumat (7/9), setelah merubuhkan plang milik ahli waris Abdul Somad.

Politik & Hukum


Minta Masyarakat Batubara Jadikan Pencuri Uang Negara Musuh Bersama MEDAN (Waspada): Pimpinan Ponpes (Pondok Pesantren) Tahfiz Alquran Al Mukhlisin Batubara H. M. Nasir, Lc, MA minta masyarakat Batubara memberanikan diri menjadikan pencuri uang negara, ketidakadilan, kazaliman dan tidak amanah sebagai musuh bersama. Nasir (foto) menegaskan itu dalam pertemuan para tokoh masyarakat dan cendikiawan, para ulama dan tuan-tuan guru Batubara di Medan, Sabtu (8/ 9) menyusul akan digelarnya pilkada di daerah tersebut. Pertemuan dihadiri antara lain Ketua HIKBAR (Himpunan Ikatan Keluarga Besar Batubara) H. Iliyas Zaili, SH, Ketua Komus (Komunitas Masyarakat Ujung Kubu Sekitar) Rasidin Hafiz, Ketua Simbara (Senteral Informasi Batubara) Khairul Muslim, cendikiawan Batubara Drs. Syufri Basrah, MAP. Menurut Nasir, jika sudah menyatukan tekat bahwa pencuri uang negara, ketidakadilan, kezaliman dan tidak amanah menjadi musuh bersama harus menjadi lawan bersama pula. Mengingat hal itu merupakan musuh bersama, lanjut alumni Timur Tengah ini, secara bersama-sama pula masyarakat Batubara harus mengawal ketat dan jangan sampai kecolongan bahwa setiap calon pemimpin Batubara yang akan bertarung pada Oktober 2013 jangan terlibat pencuri uang negara baik langsung maupun tidak. Jika ada calon pemimpin Batubara yang terlibatmencuriuangnegarayangsesungguhnyaadalah uangrakyatdanikutbertarungdalampilkada, harus diabaikan untuk tidak dipilih dan siapa memilihnya ia termasuk bersubahat terhadap tindakan dan pebuatannya calon bersangkutan. Nasir menegaskan, menjadikan pencuri uang negara, ketidakadilan, kazaliman dan tidak amanah sebagai musuh bersama adalah merupakan perintah Allah Swt dalam menegakkan amar ma’ruf nahi mungkar. Masyarakat Batubara yang dikenal taat dengan ajaran agama Islam wajib melaksanakan amar ma’ruf nahi mungkar tanpa kecuali. Sedang Ketua HIKBAR H. Iliyas Zaili, SH

menilai, saat ini ada kesan bawah anggota DPRD Batubara seperti sudah terbius oleh eksekutif, sehingga tidak mampu lagi menjalankan fungsi sesungguhnya sebagai pengawas jalannya roda pemerintahan. Berbagai pengaduan masyarakat seperti perbaikan infrastruktur yang asal jadi tak pernah ditindaklanjuti secara sungguh-sungguh. Kemudian kebijakan pembangunan yang tidak berbasis pada skala prioritas dan kepentingan masyarakat seperti penataan pulau Salanamo luput dari perhatian anggota dewan. Padahal ada yang lebih penting lagi yakni pengoperasian kembali pelabuhan internasional Tanjungtiram-Port Klang, Malaysia. Melihat sikap anggota DPRD seperti itu, Zaili menilai perlu digelar secara teratur parlemen masyarakat . Artinya, masyarakat diberi ruang dan kesempatan untuk menyampaikan aspirasinya dalam berbagai hal pada satu pertemuan terbuka. “Negara melindungi setiap warga negara menyampaikan aspirasi dan pendapat ,” tegas mantan pengacara ini. Menyahuti gagasan Zaili, Nasir akan menggelar halal bi halal di pesantren yang dipimpinnya pada Sabtu (15/9) dengan mengundang lima tokoh dari setiap kecamatan di Batubara. Dalam halal bi halal dan silaturrahim itu, lanjutnya, akan didengar suara para tokoh tentang kebijakan dan pembangunan Batubara. Dalam pertemuan itu, Ketua Komus Rasidin Hafiz menjelaskan, saat ini ada dua nama balon (bakal calon) bupati Batubara yang sedang popular disebut-sebut masyarakat yakni Dr. H. Asren Nasution, MA dan Ir. Zahir, MAP di samping nama lain seperti A. Gani, Ir. H. Yahdi Chair Harahap, Drs. H. M. Syafi’I, Msi, Azwar Hamid. Menurut Hafiz, sambutan semakin hangat dan menjadi pembicaraan berbagai elemen dan tokoh di setiap pertemuan menyusul keinginan para tokoh agar Asren dan Zahir menyatukan kekuatan dalam menghadapi sukses pada Pilkada 2013. Cendikiawan Batubara Syufri Bashrah membenarkan kondisi itu.(m26).

WASPADA Senin 10 September 2012

Analisis Sementara KAPPI’66

Chairuman Posisi Tertinggi Balon Gubsu MEDAN (Waspada): Kesatuan Aksi Pemuda Pelajar Angkatan (KAPPI)’66 melakukan analisa sementara figur bakal calon (Balon) Gubsu periode 2013-2018. Hasilnya, nama Chairuman Harahap (foto) berada diposisi teringgi. Berikutnya Gus Irawan Pasaribu, RE Nainggolan, AY Nasution dan Gatot Pujo Nugroho. Ketua KAPPI ’66 Sumut Azwir A Husin mengatakan itu kepada wartawan di Medan, Sabtu (8/9). Dia didampingi Sekretaris HM Masri Riza Sofnar, Bendahara M. Iqmal Balga Pasaribu danWakil Sekretaris Asmar Surya. Menurut Azwir A Husin, selama bulan Agustus 2012, KAPPI ’66 melakukan analisa dengan mengunjungi beberapa daerah di Sumut dan laporan dari seluruh DPC Forum Keluarga Besar (FKB) KAPPI6 se-Sumut. “Masyarakat memberi penilaian terhadap kelima balon Gubsu itu berdaarkan aktivitas dan kinerja, serta kedekatan mereka selama ini dengan masyarakat,” ujarnya. Azwir menyebutkan, masyarakat menilai Chairuman Harahap sangat memahami karakter masyarakat Sumut, karena pernah menjadi Kepala Kejatisu dan Ketua Komisi II DPR-RI. Jika

terpilih jadi Gubsu, masyarakat berharap Chairuman dapat memberantas segala bentuk KKN selama ini bergentayangan di Sumut. Sosok Gus Irawan, kata Azwir, dipilih masyarakat karena berhasil mengangkat ekonomi kerakyatan di Sumut melaluin jalur perbankan ketika menjabat Dirut Bank Sumut. Sangat diyakini, jika terpilih jadi Gubsu, Gus Irawan, akan dapat memperbaiki ekonomi masyarakat, terutama ekonomi lemah. Dari sosok RE Nainggolan, lanjut Azwir lagi, masyarakat berharap dapat memperbaiki sistem birokrasi di Pemprovsu yang selama ini sangat bobrok. RE Nainggolan, pernah menjadi birokrasi murni meniti karir dari bawah, sehingga sangat paham seluk beluk birokrasi di Pemprovsu. AY Nasution, kata Azwir,

diyakini sangat paham tentang Ilmu politik sosial budaya pertahanan dan keamanan rakyat semesta (Ipoleksosbud Hankamrata). Jika terpilih menjadi Gubsu, diyakini mantan Pangkostrad itu dapat fokus terhadap kondusifnya Sumut dan memperhatikan pertahanan di perbatasan dan pulau-pulau kecil di Sumut. Sedangkan Gatot Pujo Nugroho, ungkanya, sangat paham dengan sistem pemerintahan Sumut. Dari pengalaman empat tahun sebagai Wagubsu dan Plt Gubsu, menjadi modal utamanya mencalonkan diri menjadi calon Gubsu. Jika terpilih lagi, Gatot dapat membawa angin segar, dalam keharmonisan keberagaman suku, etnis, agama di Sumut. Untuk itu, tambah Azwir, analisis yang dibuat BPD FKB KAPPI’66 Sumut tidak memiliki maksud-maksud tertentu. Tapi akan menjadi sumbangan bagi masyarakat dan dorongan bagi balon Gubsu lain yang tidak masuk dalam peringkat 1-5 hasil analisis KAPPI’66 Sumut sementara ini.“Kita berharap siapa pun yang terpilih, dapat menjadi Gubsu yang baik, jujur, perduli dengan rakyat, serta membaktikan diri untuk kemajuan Sumut. Juga jangan sampai berurusan dengan KPK,” ujar Azwir.

Pendidikan Bakal calon Gubernur Sumatera Utara (Balon Gubsu) Dr H Chairuman Harahap, SH, MH meminta kepada seluruh mahasiswa Yayasan Indah Medan untuk berlomba mengejar pendidikan yang berkualitas, karena hal itu menjadi kunci keberhasilan bangsa. “Saat ini, kita lihat masih banyak masalah yang dihadapi bangsa kita, yang nantinya harus diatasi dengan mutu pendidikan yang baik,” kata Dr Chairuman Harahap pada pidato inagurasi dan halal bi halal bersama keluarga besar di kampus AkbidYayasan Indah Medan, Jalan Jaya II/Jalan Saudara No.24, Simpang Limun, Medan, Minggu siang (9/9). Hadir dalam acara yang dirangkai dengan perkenalan para mahasiswa dari akademi farmasi, perawatan dan kebidanan ini, Ketua Yayasan Indah Medan, H Abdul Harris Sy Hasibuan SE, Direktris Akbid Yayasan Indah Eni Yusriani SST, Direktur Akademi Farmasi Yayasan Indah Drs H Mustafa Ridwan MSi Apt, DirutAkperHambaliAzwarSKep, dan para pengurus lainnya. Kehadiran Dr H Chairuman bersama istri, Hj.Ratna Sari Lubis dan rombongan menambah semangat para mahasiswa Yayasan Indah Medan, karena

di sela kesibukannya yang padat, anggota dewan itu menyempatkan diri berbaur ke tengah-tengah insan akademis. Menurut anggota Komisi VI DPR RI ini, pihaknya prihatin, karena Sumatera Utara yang kaya dengan potensi alam yang melimpah ruah, keanekaragaman etnis dan budaya, dan wilayah yang luas, serta jumlah penduduk yang banyak, tetapi tidak mampu memecahkan masalah yang ada dewasa ini. Hal itu disebabkan karena SDM Indonesia belum mampu mengatur dan mengelola negara dengan baik, yakni terjadinya kekacauan sisitem ketatanegaraan dan pemerintahan, serta KKN (Korupsi, Kolusi, dan Nepotisme) yang tak kunjung habis terberantas. Selain itu, dalam aspek sosial budaya, yakni minimnya rasa ikatan kebangsaan dan degradasi moral. Solusi dari masalah tersebut yaitu dengan meningkatkan kualitas SDM Indonesia melalui pendidikan. “Karenanya, saya berharap lulusanmahasiswaYayasanIndah Medannantinyadapatmenjawab tantangan itu, dengan mempersembahkan keilmuan profesional, kreasi dari bidang keilmuan yang diperoleh ke tengah masyarakat,” sebut mantan Kejatisu ini.(m12/m07/rel)

PKBIB Daftar Ke KPU Bersamaan HUT Gus Dur MEDAN (Waspada): Ketua Umum Dewan Pimpinan Nasional Partai Kedaulatan Bangsa IndonesiaBaru(DPNPKBIB)Zannuba Arifah Chafsoh atauYenny Wahid resmi mendaftarkan partainya ke Komisi Pemilihan Umum(KPU)pusat,Jumat(7/10). Pendaftaran ke KPU tersebut berbarengan dengan ulang tahun Gus Dur. Pendaftaran Partai PKBIB oleh Yenny Wahid didampingiWakil Ketua Umum Idayani Usman, Sekjen Imron Rosadi Hamid dan lain-lain, termasuk yang ke-36 dari partai yang mendaftar. Dalam siaran pers PKBIB yang diterima Waspada Sabtu (8/9), Yenni Wahid dalam keterangannya pada wartawan di kantor KPU Jl. Imam Bonjol Ja-

karta Pusat menegaskan PKBIB yang dipimpinnya optimis akan lolos parliament threshold (PT) sebesar 3,5 persen sebagaimana ditentukan undang-undang. Malah dia sangat yakin bisa melampau PT tersebut karena PKBIB merupakan partai gabungan dua kekuatan, yaitu Partai Kedaulatan Bangsa Nusantara (PKBN), dan Partai Perjuangan Indonesia Baru (PIB) dengan mengusung tokoh alm. KH. Abdurrahman Wahid (Gus Dur) dan Dr .Sjahrir. Namun demikian Yenny Wahid tidak berambisi untuk nyapres, melainkan ingin menjadikan PKBIB ini sebagai partai yang mampu memperjuangkan aspirasi rakyat, mensejahterakan rakyat, dan menjadikan

negara ini berdaulat. Karena itu masalah capres-cawapres, PKBIB terbuka untuk semua tokoh nasional yang mempunyai kapabilitas, integritas dan komitmen berbangsa dan bernegara. “Soal nama bisa Ibu Ani Yudhoyono, Joko Suyanto, Prabowo, Sri Mulyani, Dahlan Iskan, Jusuf Kalla dan lainlain,”tambah putri Gus Dur ini. Yang pasti lanjut Yenny Wahid, PKBIB ini tidak akan menjadi tempat untuk politik transaksional dan pragmatisme politik. Sebab, selama ini partai politik justru sering mencederai rakyat dan demokrasi itu sendiri akibat menghalalkan segala cara, korupsi,danpolitikuangatau money politics.“Kita harapkan PKBIB ini menjadi partai terbuka dan

menjadi harapan dan membawa perubahan untuk kesejahteraan rakyat,” ujar Yenny. PKBIB menurutYenny akan membuat tradisi politik baru, yaitu partai yang tidak mengejar jabatan dan kekuasaan, melainkan mengabdi untuk rakyat, bangsa dan negara. “Kita bukan mengejar jabatan dan posisi, tapi untuk kesejahteran masyarakat. Untuk itu, tokoh-tokoh semacam itulah yang akan PKBIB akomodir untuk memimpin negeri ini,” tambahnya. Yenny sendiri mengaku dirinya tidak mempunyai ambisi untuk nyapres 2014, karena untuk melanjutkan perjuangan Gus Dur, cukup dengan memiliki partai dan lolos PT 3,5 persen. Selain itu, dirinya masih ber-

tanggung jawab terhadap kedua putrinya yang masih kecil-kecil bahkan yang kedua, Amira masih menyusui ASI. “Jadi, saya belum berpikir nyapres. Silakan tokoh-tokoh nasional tersebut jika berkehendak masuk PKBIB,”tegas Yenny lagi. Dengan berkas yang lengkap yaitu 100 % di 33 provinsi, 75 % kabupaten/kota, 50 % lebih kecamatan, dan 30 % perempuan dan berkas lainnya yang disyaratkan oleh KPU sudah dipenuhi. “PKBIB sudah memenuhi semua persyaratan yang ditentukan KPU dan UU Parpol. Selain kami optimis lolos verifikasi KPU, lolos PT, dan juga optimis target 50 kursi DPR dan DPRD seluruh Indonesia,” ungkap Yenny. (m22)


Yennis bersama pengurus PKBIB lainnya mengusung poster almarhum Gur Dur (Abdurrahman Wahid) usai mendaftarkan partainya ke KPU Pusat Jumat lalu di Jakarta. PKBIB merupakan gabungan dua parpol yang menurut ketuanya yakin lolos varifikasi.

Korupsi Penyaluran Migor

Mantan Kabid Disperindag Batubara Dihukum Satu Tahun

Waspada/Amir Syarifuddin

KETUA TP PKK Sumut Hj Sutias Handayani Gatot Pujo Nugroho menyerahkan buku tabungan kepada seorang anak di acara peringatan Hari Anak Nasional di Kantor Dinas Kesejahteraan dan Sosial Provsu.

Anak Pewaris Negeri Tentukan Maju Mundurnya Bangsa MEDAN (Waspada): Suara tawa dan keceriaan mewarnai pagi yang diguyur hujan di halaman kantor Dinas Kesejahteraan dan Sosial Provinsi Sumatera Utara Jln. Ayahanda Medan, Kamis (6/9). Ratusan anak dengan penuh semangat mengikuti beragam kegiatan One Day For Children (Sehari Bersama Anak) sebagai bagian peringatan Hari Anak Nasional. Ketua Badan Koordinasi Kegiatan Kesejahteraan Sosial (BK3S) Provinsi Sumatera Utara Hj Sutias Handayani Gatot Pujo Nugroho menuturkan, One Day For Children merupakan bentuk kepedulian terhadap anak Indonesia. Lewat kegiatan ini anak Indonesia diharap memiliki karakteristik yang khas dan lebih kuat. Mendidik anak dengan karakter yang kuat dan bermartabat merupakan salah satu investasi sosial untuk keberlanjutan pembangunan bangsa. ”Anak adalah pewaris negeri, merekalah yang akan menentukan maju mundurnya bangsa ini di masa mendatang. Karenanya, jika kita gagal memberikan perlindungan terhadap anak di masa kini maka hakekatnya menjadi kegagalan bangsa Indonesia mempersiapkan masa mendatang yang lebih baik,” kata Sutias. Memperingati hari anak nasional, Sutias yang juga Ketua Tim Penggerak PKK Sumut mengingatkan keluarga Sumatera Utara pada tiga hal. Pertama keluarga harus memberikan perlindungan kepada anak, kedua keluarga harus terus mendidik anak-anak dan ketiga yang tidak pentingnya keluarga harus senantiasa memberikan kasih sayang kepada mereka semua.

Lewat kegiatan One Day For Children, Pemerintah Provinsi Sumatera Utara ingin mempertegas komitmen dan perhatian terhadap anakanak Indonesia. Karenanya kegiatan tersebut dikreasikan sebagai kombinasi seremonial plus aksi nyata menggugah kepedulian serta kesadaran tentang pemenuhan dan perlindungan hak-hak anak Indonesia khususnya dan anak anak di wilayah Provinsi Sumatera Utara. Kepala Dinas Kesejahteraan dan Sosial Provsu Alexius Purba menambahkan, sebagai tunas bangsa, anak menjadi bagian penting dari proses pembangunan nasional. Anak adalah investasi human capital. ”Investasi tersebut diwujudkan dengan menjamin anak-anak dapat tumbuh kembang secara optimal dalam lingkungan sosial yang mendukung pemenuhan hak-hak anak,” sebutnya. Acara yang mengambil tema Bersatu Mewujudkan Indonesia Ramah Anak dengan subtema Saya Anak Indonesia Beriman, Jujur, Cerdas, Sehat, Berakhlak Mulia dan Berprestasi ini juga dimeriahkan oleh penampilan berbagai atraksi anak-anak. Mulai penampilan marching band, tari-tarian dan lantunan lagu yang dinyanyikan anak-anak tuna netra. Acara ini ditandai dengan pengguntingan dan pelepasan balon udara oleh Ketua BK3KS Hj Sutias Handayani Gatot Pujo Nugroho dan dilanjutkan dengan dialog langsung oleh perwakilan anak-anak kepada Sutias tentang hak mereka untuk dilindungi dan mendapat perlindungan. (m28)

MEDAN (Waspada): Mantan Kabid di Dinas Perindustrian, Perdagangan dan Koperasi Kabupaten Batubara menangis divonis satu tahun penjara oleh majelis hakim yang diketuai Jonner Manik SH didalam sidang putusan pelaksanaan penyaluran minyak goreng (migor) bersubsidi, di Pengadilan Tipikor PN Medan, Kamis (6/9). Terdakwa Syaiful Margolang selaku Ketua Pelaksana Kegiatan Penyaluran Subsidi Minyak Goreng Kabupaten Batubara, selain divonis satu tahun penjara juga dikenakan denda Rp50 juta dengan subsidair satu bulan kurungan. Sedangkan terdakwa lainnya Yadi Suprayogi alias Gareng selaku Ketua Koperasi Kelapa Sawit Rakyat Bina Sejahtera yang merupakan penyalur migor bersubsidi tahap I juga dihukum selama satu tahun dan pidana denda Rp50 juta subsidair 1 bulan kurungan. Selain itu, pidana tambahan membayar uang pengganti Rp15.719. 000, subsidair 1 bulan kurungan.

Terdakwa terbukti bersalah melanggar Pasal 3 jo Pasal 18 UU No. 31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi jo Pasal 55 ayat (1) ke1 KUHP jo pasal 64 ayat (1) KUHP. Kedua terdakwa bersalah dalam penyaluran minyak goreng bersubsidi di Kabupaten Batubara tahun 2008 senilai Rp847 juta, yang mengeluarkan berita acara pencairan dana tanpa adanya verifikasi oleh tim verifikasi mengenai kebenaran penyaluran migor tahap I di Kabupaten Batubara. Sebelumnya Jaksa Penuntut Umum ( JPU) Netty Silaen menuntut masing-masing terdakwa Yadi Suprayogi dan Syaiful Margolang (berkas terpisah) hukuman selama 18 bulan penjara, denda Rp50 juta dan subsider 3 bulan penjara. Sebagaimana diketahui, dalam dakwaan JPU menyebutkan, Syaiful Margolang selaku Ketua Pelaksana Penyaluran Migor telah menyiapkan Berita Acara (BA) Verifikasi sebagai kelengkapan pengajuan dana

Cabuli Pacar Ditangkap MEDAN (Waspada): Seorang pekerja pabrik alumunium berinisial OS, 22, warga Jalan Pasar VII Tembung Gg Bangau, ditangkap petugas Reskrim Polsek Delitua, Jumat (7/ 9), karena mencabuli pacarnya yang masih dibawah umur. Menurut informasi di Mapolsek Delitua, tersangka diamankan petugas dari sekitar lokasi tempatnya bekerja di kawasan Tembung, tidak jauh dari kediamannya. Tersangka mencabuli korban Layu, 18, (bukan nama sebenarnya), warga Jalan Denai Medan, di salah satu hotel kelas melati Jalan Jamin Ginting, dua pekan lalu. Menurut orangtua korban, sebelumnya tersangka OS menjemput korban yang bekerja di salah satu lokasi perbelanjaan di Medan, dengan sepedamotor

seusai pulang kerja sore hari. Tersangka kemudian mengajak korban makan dan minum di dekat pusat perbelanjaan tempatnya bekerja. Namun, usai minum air putih yang disuguhkan tersangka, kepala korban pening dan minta diantarkan pulang. Ternyata korban yang tidak mengetahui apa-apa lagi dibawa ke salah satu hotel kelas melati di Jalan Jamin Ginting. Korban begitu sadar mengetahui dirinya telah berada di dalam kamar hotel dan telah dicabuli. Kapolsek Delitua Kompol SP Sinulingga melalui Kanit Reskrim AKP S Sembiring membenarkan tersangka OS telah diamankan petugas. Menurutnya, tersangka sedang men jalani pemeriksaan di ruang penyidik.(m40)

subsidi migor. BA tersebut kemudian ditandatangani Iswandi dan Anwar Marpaung, selaku anggota tim verifikasi dan selanjutnya diajukan kepada mantan Kadisperindagkop Batubara Mangadar Marpaung (sudah divonis), selaku Ketua Tim Verifikasi untuk ditandatangani. Namun, BA Verifikasi tersebut ditandatangani tanpa dilakukannya verifikasi oleh tim verifikasi mengenai kebenaran penyaluran migor tahap I yang dilakukan terdakwa Yadi Suprayogi. Dalam BA itu menyatakan terdakwa Yadi Suprayogi telah selesai menyalurkan migor bersubsidi kepada masyarakat sebanyak 130.870 liter atau senilai Rp327.175.000. Sehingga terdakwa Yadi Suprayogi mengajukan permohonan pencairan dana subsidi migor dan menerima pembayaran sebesar Rp327,1 juta. Tapi nyatanya Yadi Suprayogi hanya menyalurkan 11.979 liter senilai Rp29.947.500 atau terdapat selisih 118.891 liter senilai Rp297.227.500. Sementara penyaluran tahap II dan III dilaksanakan Sumardi (sudah divonis) selaku Direktur UD Sahabat Sejati, juga telah menyiapkan BA Verifikasi Penyaluran Migor sebelum migor disalurkan ke masyarakat, yakni masing-masing sebanyak 130.870 liter senilai Rp327,1 juta. Pada tahap II Sumardi hanya menyalurkan 20.031 liter senilai Rp50.077.500. Sehingga terdapat selisih 110.839 liter senilai Rp227.097.000. Sedangkan tahap III, Sumardi hanya menyalurkan 21.602 liter senilai Rp54.005.000, sehingga terdapat selisih 109.268 liter senilai Rp273.170.000. Jaksa mengatakan, dengan tidak disalurkannya sebagian dana subsidi migor tahap I, II dan III tersebut, negara mengalami kerugian sebesar Rp 847.495.000. Hal ini berdasarkan laporan hasil audit Badan Pengawasan Keuangan dan Pembangunan (BPKP) Sumut. (m38)

Sopir Angkot Dianiaya Penumpang MEDAN (Waspada): Hanya gara-gara menaikkan penumpang di tengah jalan, sopir bus angkutan kota (angkot) Kenari trayek Terminal Aksara Jalan Pancing-Percut Gustaf Hutasoit, 30, warga Pasar III Lorong Permadi, Desa Saentis, babak belur dianiaya oleh dua penumpangnya, Minggu (9/9) sekira pukul 12:00. Saat membuat laporan pengaduan di Polsek Percut Seituan, Gustaf menceritakan, kejadiannya berawal saat dia baru keluar dari Terminal Bus Aksara Jalan Pancing, dengan membawa sarat penumpang di dalam angkotnya. Namun, baru beberapa meter melaju, korban berhenti dan menaikkan dua panumpang lagi, sehingga penumpang di dalam angkot saling berdesakan. Salah seorang penumpang yang diketahui sebagai pelaku mengatakan, agar korban menaikkan lagi penumpangnya. Selanjutnya pelaku mengancam korban akan memecahkan kepalanya jika menaikan penumpang lagi. “Naikkan lagi penumpang. Kau naikkan lagi kupecahkan kepala kau,” ujar korban menirukan ucapan pelaku. Mendengar hal itu, korban langsung menjawab. “Jangan main pecah-pecahkan kepala aja la bang,” kata korban. Mendengar jawaban korban, pelaku emosi. Setibanya di Jalan Wiliem Iskandar simpang Sampali, pelaku menyuruh sopir berhenti dan dia langsung turun memukuli korban hingga berkali-kali. “Pas sampai simpang Sampali, pelaku langsung memukulku.Yang satu lagi menjambak rambut dan mengantukkan kepala ku ke pintu angkot,” sebutnya. Usai memukuli korban hingga babak belur, kedua pelaku pergi begitu saja. Sedangkan korban terus melanjutkan perjalanan mengantar penumpangnya hingga sampai ke Desa Bagan Percut. “Setelah mengantar sewa, aku langsung datang ke Polsek Percut Seituan buat laporan,” sebut Hutasoit. Sementara itu, Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan menjelaskan, korban sudah membuat laporan dan visum, sedangkan pelaku penganiayaan masih dalam penyelidikan. (h04)

Rumah, Sepedamotor Terbakar BELAWAN (Waspada): Diduga akibat hubungan arus pendek listrik, dapur rumah Hermansyah, 60, warga Jalan Platina Raya Gg Tanjung, Lingk. IV, Kel. Titipapan, Kec. Medan Deli, dan satu unit sepedamotornya Yamaha Mio, terbakar, Jumat (7/9) pukul 10:30. Tidak ada korban jiwa dalam peristiwa kebakaran itu. Sedangkan kerugian ditaksir puluhan juta rupiah. Api dapat dipadamkan setelah beberapa unit mobil pemadam kebakaran Pemko Medan datang ke lokasi memberi bantuan. Informasi dihimpun di lokasi kejadian menyebutkan, warga dihebohkan dengan api berkobar dari dapur rumah milik Hermansyah. Warga berusaha memadamkan api dan membantu mengeluarkan barang-barang berharga milik korban. Akibat api semakin membesar menyambar tabung gas 3 kilogram yang berada di dapur itu sehingga menimbulkan suara ledakan. Api yang berkobar kemudian melalap sepedamotor Yamaha Mio milik Hermansyah. Api baru dapat dipadamkan setelah petugas pemadam kebakaran datang ke lokasi memberi bantuan, sehingga hanya menghanguskan dapur rumah tersebut. Lurah Titi Papan Tamrin Lubis mengatakan, api diduga berasal dari hubungan arus pendek. “Untung warga kita cepat menyiram ramai - ramai, kalau tidak banyak rumah yang terbakar. Apalagi kawasan itu padat pemukiman,” katanya. Jalan menuju kawasan itu sempat macat, namun dapat diatasi setelah petugas Dinas Perhubungan yang dikoordinir B Ginting selaku Korlap Dishub Medan Utara, mengatur arus lalulintas. (h03)


WASPADA Senin 10 September 2012


Demokrasi Kita Belum Dewasa

Unsur Primodial Masih Menjadi Pertimbangan JAKARTA (Waspada): Pengamat politik dari Universitas Indonesia, Iberamsjah mengatakan, semua partai politik dalam menentukan calon yang akan diusungnya sebagai pimpinan nasional, maupun daerah tentunya mempertimbangkan berbagai hal.


KUNJUNGAN DUBES: Ketua Badan Pengusahaan Batam Mustofa Widjaja (depan tengah) memperkenalkan Batam sebagai daerah Perdagangan Bebas atau Free Trade Zone kepada 32 Duta Besar dari berbagai negara di Batam, Kepri, Minggu (9/9). Kunjungan 32 Duta Besa dari bebagai negara ke Batam untuk melihat langsung sistem pengurusan perijinan perusahaan yang ada di Batam.

Kemenag Kaji Sistem Pengelolaan Dana Haji JAKARTA (Waspada): Kementrian Agama RI sedang mengkaji sistem pengelolaan dana haji yang efektif. Hal ini guna mengantisipasi lonjakan jumlah jamaah haji pada tahun-tahun mendatang. ”Sekarang misalnya yang kita kelola dana setoran haji itu Rp 44 triliun dengan waktu tunggu rata-rata 9 tahun. Nah kalau rakyat Indonesia semakin mampu, tentu makin banyak nanti yang menyetorkan setoran awal, sehingga dana yang dikelola Kemenag semakin banyak. Nilai manfaat pengelolaan dana itu yang dikembalikan ke

jamaah semakin banyak. Nah pertanyaannya mampu ngak kita mengelola dana misalnya jika mencapai Rp200 triliun dan waktu tunggu semaki lama,” ujar Dirjen Penyelenggaraan Ibadah Haji dan Umrah Kemenag, Anggito Abimanyu dalam acara Pembekalan Petugas Me-dia Center Haji 1433 di, Bekasi, Jawa Barat, Jumat (6/9) malam. Anggito memaparkan tahun 2009 BPIH sebesar US$3423 ditambah dengan US$347 dana optimalisasi setoran para jamaah atau biasa disebut inderect cost.

Waktu itu jelasnya, waktu tunggu hanya 5 tahun.Tahun 2012 BPIH US$3617 dan inderect costnya US$1057. “Kita lihat inderect cost yang berasal dari dana optimalisasi setoran jamaah semakin me-ningkat kalau kita bandingkan tahun 2009 dan 2012. Artinya jamaah mendapatkan pengembalian dana optimalisasi itu lebih banyak. Ini disebabkan karena waktu tunggu yang semakin lama dan jamaah yang mendaftar semakin banyak. Untuk itulah diperlukan sistem pengelolaan dana setoran

awal, karena semakin banyak nanti akan semakin rumit,” tandasnya. Pada pertemuan itu Anggito Abimanyu mengakui pihaknya pun akan melakukan sosialisasi “Cukup Satu Kali Berhaji”. Kebijakan ini sebagai upaya untuk memangkas waktu tunggu jamaah haji yang setiap tahunnya semakin lama. Sosialisasi haji cukup satu kali, menurutnya, bukan untuk membatasi umat Islam melaksanakan hal itu, tapi karena memang kewajibannya cuma satu kali.(aya)

Selain pertimbangan politik, pertimbangan lainnyapun, seperti primodial jadi pertimbangan utama. “ Unsur primodial masih menjadi pertimbangan para pemilih. Demokrasi kita memang belum dewasa,” ujar Iberamsjah kepada wartawan di Jakarta, Minggu (9/9). Partai Demokrat dan partaipartai pendukung pasangan Fauzi Bowo (Foke)-Nachrowi Ramli (Nara) pada Pilkada DKI Jakarta, jelas pertimbangan politik dan primodial karena latar belakang mereka yang keturunan etnis Betawi. Begitu juga PDIP dan Gerindra dalam mendukung Jokowi-Ahok juga menggunakan unsur primodialisme,” ujar Iberamsjah . ”Ini secara sadar pasti mereka perhitungkan dengan

harapan, orang akan lebih memilih etnis Betawi karena orang Betawi lah yang paling memahami Jakarta,” jelasnya. PDIP pun demikian memilih Jokowi, karena faktor keJawaannya diharapkan masyarakat Jawa yang ada di Jakarta memilih Jokowi. ”Jadi bukan karena track rekord Jokowi, tapi jelas karena faktor ke-Jawaannya saja yang diharapkan dapat meraih suara warga Jakarta yang beretnis Jawa,”tambahnya. Soal pertimbangan track rekord dinilainya tidak dilakukan dalam mendukung Jokowi. Kemungkinan juga kalau di Jakarta, maka citra Jokowi akan lebih mudah dikemas karena warga Jakarta tidak mengetahui banyak mengenai Jokowi. Menurutnya, jika Jokowi dianggap berhasil di Solo, sejatinya PDIP mendorongnya untuk maju di Jawa Tengah dan bukan Jakarta. “Jadi terasa aneh ketika PDIP justru menganggap Jokowi orang yang paling baik untuk Jakarta. Memangnya permasalahan di Jawa Tengah

lebih sulit dari Jakarta?Bukannya justru Jakarta harusnya dipilih orang yang terbaik? Jadi bisa saja ini seperti perjudian, menang syukur tidak menang juga tidak apa-apa buat PDIP,” tuturnya. Sedangkan Partai Gerindra yang mengusung Ahok sebagai Cawagub pasangan Jokowi, Iberamsjah melihat pertimbangan utama Ketua Dewan Pembina Partai Gerindra, Prabowo Subianto untuk mengesankan dia pro minoritas, pro etnis Tionghoa. Dan nampaknya test yang dilakukannya berhasil, utamanya masyarakat keturunan Tionghoa pada akhirnya memilih Ahok karena etnisnya . Prabowo menyadari dirinya salah satu calon kuat untuk maju dalam pilpres 2014 nanti dari hasil survei . Berbagai survei yang menempatkan Prabowo sebagai calon kuat nampaknya tidak begitu dipercaya, dia tetap ingin bukti dan pembuktian bisa dilakukan dalam pilkada DKI. ”Prabowo dalam melihat survei nampaknya lebih realistis,

16.605 Personel Amankan Pilkada DKI

Penambahan Kuota Belum Dapat Jawaban JAKARTA (Waspada): Permohonan penambahan kuota jamaah haji yang diusulkan Menteri Agama kepada Kerajaan Arab Saudi belum mendapat jawaban. Sekretaris Jenderal (Sekjen) Kementerian Agama (Kemenag) Bahrul Hayat mengatakan, Menteri Agama RI sudah dua kali mengajukan permohonan penambahan kuota haji. Saat ini, Kerajaan Arab Saudi sedang membahas dan mempertimbangkan permohonan penambahan kuota itu. ‘’Kita mengajukan permohonan penambahan kuota jamaah sebanyak 30 ribu, kalau pun disetujui sebanyak 10 ribu

kita sudah bersyukur,’’ ujar Bahrul seusai membuka Pembekalan Petugas Media Center Haji (MCH) 1433 H/2012, Jumat (7/9). Menurut dia, Menteri Agama sudah bertemu dengan Wakil Menteri Haji Kerajaan Arab Saudi untuk membicarakan permohonan itu. Pihaknya berharap agar Kerajaan Arab Saudi bisa memberika jawaban secepatnya. ‘’Kita harapkan pekan ini sudah ada jawaban, karena kloter pertama jamaah haji Indonesia sudah akan mulai diterbangkan ke Tanah Suci pada 21 September 2012. Sementara Direktur Pe-

nyelenggara Haji Kemenag, Sri Ilham Lubis melihat pemerintah Arab Saudi mengalami dilema karena kondisi penginapan saat ini berkurang di Makkah akibat adanya perluasan Masjidil Haram. Sementara kita juga meminta agar pemondokkan jamaah haji Indonesia bisa lebih didekatkan dengan masjidil haram,” tegasnya. Dirjen PHU, Anggito Abimanyu mengatakan tahun ini resiko kesehatan jamaah haji bisa semakin tinggi karena jumlah lansia yang semakin banyak. ”Jumlah lansia semakin banyak karena semakin panjangnya daftar tunggu. Saat

ini rata-rata waktu tunggu 8 tahun dan yang paling lama itu Kabupaten Wajo, Sulawesi Selatan yang waktu tunggunya sampai 19 tahun,” tegasnya. Dirinya berjanji untuk memperbaiki pelayanan dan sistem haji.”Masih banyak kekurangan yang harus kami perbaiki. Survei kepuasaan yang dilakukan BPS bahwa sebagian besar jamaah pun diragukannya. ”Survei itu dilakukan kepada jamaah yang sedang menunaikan haji. Tentunya mereka akan bilang puas,karena mereka sedang berhaji tidak boleh bicara buruk-buruk,” tandasnya.(aya)

Kepala BNP2TKI Harapkan APEC Ubah Rezim Imigrasi Konservatif JAKARTA (Waspada): Kepala Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI) Moh Jumhur Hidayat mengharapkan forum pertemuan tingkat tinggi para pemimpin APEC (Asia Pasific Economic Cooperation) di Vladivostok, Rusia pada 8-9 September, dapat menyentuh kesepakatan penting untuk mengubah kebijakan rezim imigrasi konservatif di negara-negara maju khususnya Eropa, agar membuka diri menerima konsep migrasi tenaga kerja asing (TKA) sebagai keniscayaan internasional tak terbantahkan saat ini. “Negara-negara di Eropa masih banyak yang menerapkan pola dan semangat rezim imigrasi konservatif, dengan menolak masuknya TKA dari luar Eropa guna bekerja di

kawasan tersebut,” ujar Jumhur, saat menyampaikan “Pidato Kebangsaan” dalam halal bihalal dan silaturahmi kepemudaan yang diadakan Perhimpunan Organisasi Kepemudaan Nasional (POKNAS) di Jakarta, Jumat (7/9) malam. Acara itu dibuka Menteri Pemuda dan Olahraga Andi Mallarangeng, serta dihadiri sejumlah ormas kepemudaan tingkat pusat dan perwakilan Badan Eksekutif Mahasiswa yang ada di Jakarta. Menurutnya, sikap konservatif imigrasi yang dianut negara-negara Eropa dalam mempersulit kehadiran TKA itu, akan memperlambat arah peningkatan ekonomi secara lebih produktif di negaranya sendiri. “Tingkat pertumbuhan orangtua yang cukup lama usianya dan terus membesar angka-

nya di negara-negara Eropa, otomatis berakibat lambannya mesin-mesin produksi bekerja karena ketersediaan basis tenaga kerja produktif yang tidak memadai, sehingga menjadi penghalang kemajuan ekonomi pada negara-negara Eropa,” jelasnya. Padahal, menurut Jumhur, dengan tingginya jumlah lanjut usia dan perlunya mesinmesin industri negara maju dikerjakan oleh para TKA, tentu membawa dampak keberkahan untuk masyarakat dan negara yang mempekerjakan TKA. Sementara bagi yang berciri progresif terhadap kehadiran TKA pada sejumlah negara Asia termasuk Amerika Serikat, dipastikan pertumbuhan ekonominya jauh melenggang pesat akibat pilihan ketersediaan tenaga kerja yang beragam serta

mencukupi. “Karena itu, pertemuan APEC menjadi tidak valid tanpa mengangkat ketidakadilan hambatan migrasi ketenagakerjaan asing ke negara-negara Eropa,” tegas Jumhur. Apalagi, tambahnya, dengan asumsi memperkuat kemajuan dan kesejahteraan negaranegara di Asia Pasifik, maka penghapusan hambatan itu dirasakan mutlak. Diakui Jumhur, produktivitas agregat dunia bisa terjadi bila halangan dalam migrasi tenaga kerja internasional dihilangkan secara bertahap, dengan memberlakukan rezim imigrasi yang progresif. “Sebaliknya, dunia akan merugi secara agregat pula karena terjadi stagnasi ekonomi di banyak negara atas berkembangnya kebijakan menghalangi TKA,” ujarnya.(J07)

Hatta Ingin Bandara Banyuwangi Diperluas Dukung Penyelengaraan APEC 2013 JAKARTA (Waspada): Menteri Koordinator Perekonomian Hatta Rajasa menginginkan Bandara Banyuwangi segera diperluas untuk mendukung kegiatan berskala internasional seperti mendukung penyelenggaraan APEC (AsiaPacific Economic Cooperation) di Bali pada November 2013. Hatta mengatakan hal tersebut usai berkunjung ke Pondok Pesantren Darussalam Blok Agung, Banyuwangi di Jawa Timur, pekan kemarin. “Bandara Banyuwangi diharapkan bisa menjadi pendukung penyelenggaraan APEC pada tahun depan,” katanya. Bandara Banyuwangi rencananya akan dijadikan tempat parkir pesawat-pesawat peserta APEC. “Saat ini, Bandara Banyuwangi sudah melayani penerbangan komersial dan cukup diminati. “Selain itu,

bandara Banyuwangi dekat dengan Bali,” ujar Hatta. Menko menyampaikan, Banyuwangi akan dikembangkan menjadi kawasan ekonomi khusus (KEK) untuk industri khusus. Rencananya, pemerintah juga akan memperluas dan dermaga pelabuhan Banyuwangi, sehingga kapal-kapal besar bisa bersandar. Bupati Banyuwangi Abdullah Azwar Anas sangat menyambut rencana pemerintah tersebut, dan diharapkan bisa menjadi penyangga ekonomi untuk kawasan timur Indonesia. “Pengembangan industri di Banyuwangi akan kami dorong dengan berbasis pada kebijakan pemberdayaan lokal,” kata Anas. Bupati Anas menegaskan, lokal yang dimaksud di sini berarti memanfaatkan potensi sumberdaya manusia lokal,

sumberdaya kelembagaan lokal, sumberdaya fisik lokal, dan sumberdaya alam lokal. Pendekatan ini memberi titik penekanan pada pemberian prakarsa lokal untuk mendorong gerakan ekonomi lokal lebih insentif. “Dengan demikian lapangan pekerjaan baru terbuka. Daya saing ekonomi lokal juga terangkat,” tambahnya. Sementara itu mengenai pembangunan jalur ganda Banten Banyuwangi, Hatta Rajasa menegaskan, proyek pembangunan double track rel kereta api dan tol Jawa harus sudah beroperasi di tahun 2014. Hatta menjelaskan program pembangunan double track rel kereta api di Jawa bukan hanya untuk lintasan BantenSurabaya saja. Tapi pembangunan dua jalur kereta api itu akan menghubungkan Banten hingga Banyuwangi.

“Untuk double track sudah berjalan prosesnya, tahun 2013 diharapkan Banten-Surabaya selesai. Lalu di tahun 2014 Banten-Banyuwangi selesai,” jelas Hatta. Menko tidak memungkiri masih banyak kendala yang dihadapi untuk mewujudkan proyek ini. Meski demikian ia menilai masalah pembebasan lahan untuk pembangunan double track relatif lebih mudah. “Lokasi di sepanjang rel kereta api sebenarnya semua milik PT Kereta Api dan sudah siap digunakan untuk double track, tapi memang tetap perlu disiapkan untuk dana pemaslahatan,” tambah Hatta. Dia memastikan mengenai anggaran dana untuk realisasi proyek double track tersebut sudah tersedia. Nilai anggaran yang disiapkan sekitar Rp 8 triliun. (j03)

dia tidak percaya begitu saja dengan hasil survei karena survei apapun bisa dipesan. Dia mau membuktikan hal itu sebelum dirinya maju, dan ingin membuktikan apakah dukungannya terhadap Ahok bisa memberikan kemenangan. Kalau ini terjadi maka dia semakin fit maju capres,” tegasnya. Analisa itu, menurutnya, didukung oleh fakta ketika Ahok yang bukan kader ataupun pengurus Partai Gerindra tibatiba saja dipilih untuk menjadi calon wakil gubernur. Untungnya Gerindra yang dinilainya partai yang sangat tergantung pada tokohnya, sehingga apapun perintah Prabowo harus ditaati oleh seluruh kader-kadernya. ”Kalau Gerindra partai terbuka dan demokratis, hal ini pasti akan menimbulkan gejolak. Mereka yang selama ini bekerja untuk partai dan menjadi kader tidak ditunjuk oleh Prabowo maju dalam pilkada, malah orang luar yang selama ini tidak ada kontribusinya tibatiba bisa dijadikan cawagub, tutup Iberamsjah. (aya)


DEMO HMI: Puluhan massa yang tergabung dari Himpunan Mahasiwa Islam Indonesia (HMI) melakukan aksi Damai di Bundaran Hotel Indonesia, Jakarta Pusat, Minggu (9/9). Dalam aksinya mereka menuntut kepada seluruh relawan dan finalis Pilkada DKI agar tidak menzolimi ulama, setelah beberapa waktu lalu kasus nuansa SARA, H.Rhoma Irama dan kini ustad Yusuf Mansyur.

Konflik Laut China Selatan Batal Dibahas Pada Sidang AIPA Di Lombok JAKARTA (Waspada): Presiden ASEAN Inter Parliamentary Assembly (AIPA) Marzuki Alie mengungkapkan, permasalahan konflik di Laut China Selatan batal dibahas dalam sidang AIPA ke-33 yang akan digelar di Lombok 16 - 22, September 2012. Batalnya pembahasan konflik Laut China Selatan ini, karena parlemen dan pemerintah Kamboja meminta agar hal tersebut tidak dibahas lebih lanjut. PM Kamboja, katanya, mengingatkan agar sidang AIPA tidak membahas soal itu, karena persoalan di ASEAN masih banyak yang harus diselesaikan. “ Konflik Laut China Selatan ini memang jadi topik utama ketika saya dan Hun Sen bertemu. Intinya, Kamboja ingin meyakinkan Indonesia agar isu ini tidak dibicarakan di sidang

AIPA,” tutur Marzuki Alie melalui email yang diterima Waspada, Minggu (9/9) menjelaskan pertemuannya dengan PM Kamboja Hun Sen di Phonm Penh, Kamboja, akhir pekan kemarin. Dalam pertemuan tersebut, tambah Marzuki, Hun Sen memang tidak mengungkapkan alasan yang spesifik terkait permintaannya tersebut. Namun, Indonesia bisa memahami, jika setiap negara tentu memiliki kepentingan, apalagi bantuan China kepada Kamboja dalam hal ini bantuan langsung maupun investasi sangat besar. Oleh karena itu, kata Marzuki, Indonesia menilai suatu hal yang wajar jika Kamboja tidak ingin melukai hubungan baiknya dengan China hanya karena ikut membahas konflik Laut China Selatan di sidang AIPA ke-33.

Lebih lanjut Marzuki menyatakan, sebenarnya niat Indonesia mengusulkan pembahasan konflik Laut China Selatan dalam sidang AIPA ke33, bukan untuk mendukung salah satu pihak yang bertikai. Sebaliknya, untuk mencari penyelesaian secara damai melalui konsultasi dan dialog yang mengacu pada aturan hukum internasional berlaku. “Tapi, karena Kamboja meminta hal itu, dan sepanjang kawasan Laut China Selatan masih aman, maka permintaan Kamboja tersebut bisa kita terima. Selain itu, di internal AIPA juga tidak berlaku pengambilan keputusan secara voting. Jadi, kalau satu negara anggota tidak setuju terkait agenda yang akan dibahas, maka agenda itu tidak akan dibahas dalam sidang AIPA,” jelas Marzuki Alie.(aya)

Pakar Kejiwaan Dunia Bahas Penanganan Pasca Bencana JAKARTA (Waspada): Lebih dari 700 orang psikiater dari 36 negara di dunia akan berkumpul di Bali, 13-15 September mendatang. Mereka bersama-sama bertukar pengalaman guna mencari sistem yang lebih baik dalam menangani kesehatan jiwa setelah bencana. Acara yang digelar Perhimpunan Dokter Spesialis Kedokteran Jiwa Indonesia (PDSKJI) bekerja sama dengan World Psychiatric Association (WPA) berupa konferensi dengan kuliah berjudul Tantangan Bagi Psikiatri Menghadapi Situasi Bencana. Pembahas utamanya salah satunya adalah Prof Norman Sartorius, seorang psikiater terbaik dunia yang juga mantan Presiden WPA dan Direktur Kesehatan Jiwa WHO. Ketua Pengurus Pusat PDSKJI, Dr Tun Kurniasih Bastaman, Sp.K.J. (K) mengatakan, sebagai negara rawan bencana, potensi penderita gangguan kejiwaan akibat situasi bencana alam dan bencana sosial sangat tinggi. Terlebih, lanjut dia, secara umum kondisi masyarakat Indonesia memang rentan

mengalami gangguan kejiwaan. “Sebagian besar masyarakat kita mudah panik dan gampang terprovokasi. Di satu sisi, sifat alamiah itu membuat pikiran mudah terguncang akibat bencana,” kata Tun dalam jumpa pers di Jakarta, Jumat (7/9). Saat ini, kata Tun, jumlah penderita gangguan kejiwaan di Indonesia cukup tinggi. Mulai dari tingkatan ringan, sedang sampai berat. Jumlahnya tidak kurang dari 19 juta jiwa. “Sebagian dari jumlah penderita gangguan kejiwaan itu adalah orang-orang, khususnya anak-anak yang pernah mengalami bencana sosial maupun bencana alam,” tandas Tun. Indonesia sendiri, kata Tun, sudah berpengalaman dalam berbagai kejadian bencana, seperti seperti tsunami di Aceh, gempa di Padang, Yogyakarta dan berbagai kejadian bencana lainnya. Namun bencana seperti Sampang yang baru-baru ini terjadi memang memerlukan banyak pihak untuk penanganannya. “Perlu ada kewenangan dari Kementerian Kesehatan dulu

baru kita bisa bergerak menangani”, katanya. Dr Albert Maramis, SpKJ(K), salah satu ahli kejiwaan yang akan melakukan presentasi di pertemuan tersebut mengatakan, walau Indonesia kerap rutin terjadi bencana namun belum terlihat ada mekanisme bencana yang sesuai standar. “Celakanya, kita ini reaktif bukan proaktif. Artinya ribut kalau sudah terjadi bencana, tapi tidak memikirkan bagaimana caranya supaya terhindar dari bencana,” kata Albert. Lain halnya Jepang dimana negara tersebut lebih piawai dalam penanganan bencana dan didukung media yang tidak terlalu mengekspos kesusahan orang-orang yang mengalami bencana. “Itu sebabnya diajang inilah akan ada saling tukar pengalaman dalam menangani bencana. Tentu saja, satu negara dengan negara lainnya akan beda standar operasionalnya dalam penanganan bencana,” kata Albert yang aktif menangani korban kejiwaan bencana tsunami di Aceh.(dianw)

JAKARTA (Waspada): Sebanyak 16.605 personel anggota Polda Metro Jaya diterjunkan mengamankan jalannya Pilkada Gubernur DKI putaran kedua yang akan berlangung pada 20 September 2012. Demikian diungkapkan Kepala Bidang Humas Polda Metro Jaya, Kombes Pol Rikwanto kepada wartawan di Mapolda Metro Jaya, Jumat (7/9). Menurut Rikwanto, sebelumnya personel yang dikerahkan sebanyak 11.755 personel, namun akhirnya ditambah menjadi 16.605 personel gabungan. “Personel pengamanan diarahkan menjelang pemilukada putaran kedua sebanyak 16.605 personel keamanan, ini terjadi penambhan dari prediksi sebelumnya hanya 11.755 personil,” kata Rikwanto. Untuk menjaga pilkada Gubernur DKI, kata Rikwanto, Polda juga menggelar operasi Mantap Praja yang dilakukan selama 100 hari ke depan hingga bulan November 2012 mendatang. Hal ini untuk memberikan pengamanan hingga hari pencoblosan sampai penghitungan dan penetapan suara. “16.605 personel tersebut terdiri atas Satgas Polda sebanyak 4.427 personel, Satgas Polres 7.397 personel, BKO Brimob dan Polri sebanyak 2.100 personel, BKO gabungan staf mabes Polri 505 personel dan BKO TNI Kodam Jaya sebanyak personel yang dikerahkan,” tambah Rikwanto.(j02)

Ketua DPR: Tingkatkan Standar Keamanan JAKARTA (Waspada): Ketua DPR Marzuki Alie meminta aparat keamanan meningkatkan standar keamanan di lingkungan DPR setelah Badan Nasional Penanggulangan Anti Teror (BNPT) melansir bahwa DPR merupakan salah satu target tindakan terorisme. Menurutnya, meskipun standar pengamanan yang selama ini berlaku di DPR dianggap cukup, namun masuknya lingkungan DPR sebagai salah satu target teroris harus diantisipasi dengan peningkatan standar keamanan oleh aparat. “Kita percayakan hal itu pada aparat keamanan yang sudah ahli.Tapi, untuk di internal Kesekjenan, perlu perbaikan dalam sistem perekrutan petugas Pengamanan Dalam (Pamdal) DPR yang selama ini dilakukan secara outsourching yang justru membuka peluang masuknya penyusup jika mekanismenya tidak benar,” ujar Marzuki menjawab wartawan dari Bangkok, kemarin. Dia mengakui, penerapan standar keamanan di lingkungan DPR selama ini masih cukup longgar, sebab DPR sebagai rumah rakyat. Oleh karena itu,Wakil Ketua Dewan Pembina Partai Demokrat tersebut berharap agar masyarakat tidak resisten terhadap rencana pembangunan rumah aspirasi di daerah. (aya)


A8 07.30 Dahsyat 10.00 Intan 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14.30 Kabar Kabari 15.00 Silet 16.00 Target Operasi 16.30 Seputar Indonesia 17.00 Layar Drama Indonesia Hanya Kamu 18.00 Layar Drama Indonesia Puteri Bidadari 19.00 Yang Masih DI Bawah Umur 20.00 Mega Sinetron : Tukang Bubur Naik Haji 21.30 Dalam Mihrab CInta 23.00 Mega Sinema RCTI 00.00 Seputar Indonesia Malam


07.00 Inbox 09.00 Halo Selebriti 10.00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 Liputan 6 Siang 12.30 SCTV FTV 14:00 Liputan 6 Terkini 14:30 Status Selebriti 15.00 Cinta Dan Uya Sama Sama Kuya 17.00 Liputan 6 Petang 17.30 Abunawas & Paman Jin 18.00 Sinteron 19.00 SCTV Sinetron : Putih Abu Abu 21.00 Biang Kerok 22.30 Liputan 6 Terkini 22.31 SCTV FTV Utama

07:30 Serial Pilihan 09:00 Serial Pilihan 1 10:30 Kisah Unggulan 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Diantara Kita 15:30 Lintas Petang 16:00 Aksi Didi Tikus 16:30 Animasi Spesial : Shaun The Sheep 17:00 Animasi Spesial : Chaplin And Co 17:30 Animasi Spesial : Leon 18:00 Tendangan Si Madun Season 2 19:00 Aladdin 20:00 Dewi Bintari 21:00 Raden Kian Santang 22:00 Dia Ayu 23:00 Intermezzo 00:00 Premier Highlights 00:30 Sidik 01:00 Lintas Malam

07:30 Fenomania 08:00 Fresh & Fun 08:30 Friends 09:00 Seleb @ Seleb 10:00 Glory Jane 11:30 Topik Siang 12:00 Klik ! 13:00 Tom & Jerry 13:30 Little Krishna 14:00 Tom & Jerry 14:30 Chotta Bheem 15:00 Ghost Gang 15:30 Mr. Bean Animation 16:30 Suka-Suka Nizam 17:30 Topik Petang 18:00 Pesbukers 19:30 Catatan Si Olga 20:30 Drama Korea : Boys Before Flowers 21:30 Mel's Update 22:30 Black In News 23:00 World's Most Amazing Videos

07:00 KISS Pagi 08:00 Sinema TV Pagi 10:00 Sinema Tv Spesial: Jihan 12:00 Patroli 12:30 Drama Asia (Korea): Pasta 14:00 Drama Asia (Korea): Thank You 15:00 KISS Sore 16:00 Fokus 16:30 Drama Asia: Can You Hear My Heart 18:00 Miniseri Spesial: Ku Tunggu Ibu Di Stasiun 19:00 Miniseri Spesial: 20:00 Sinetron Unggulan: Tutur Tinular 22:00 Buaya Show 23:00 X-raligy 23:30 Mega Asia

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 15.30 Public Corner 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Prime Interview 21.05 Top Nine News 22.05 Economic Challenges 23.05 Metro Realitas 23.00 Metro Sports

WASPADA Senin 10 September 2012

07:30 Ranking 1 08:30 Semangat Pagi 09:30 Fun Cooking 10:00 Bosan Jadi Pegawai 10:30 Insert Siang 11:30 Jelang Siang 12:00 Reportase Siang 12:30 Jika Aku Menjadi 13:15 Jail 14:00 Magic Comedy 14:30 Digital Clip 15:00 Sketsa 16:00 Show Imah 17:00 Reportase Sore 17:30 Inside 18:15 Comedy Project 19:15 Tahan Tawa 20:15 Canda Bule 20:45 Bioskop Trans TV 22:45 Bioskop Trans TV

09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Apa Kabar Indonesia Siang 15:30 Live News Kabar Pasar 16:00 Live News Kabar Petang 19:00 Kabar Utama 20:00 Apa Kabar Indonesia Malam 21:00 Live NewsKabar Malam 22:00 Menyingkap Tabir 22:30 Kabar Arena 23:00 Radio Show

08:00 Avatar : The Legend Of Aang 08:30 Awas Ada Sule 09:30 Hot Spot 10:00 Dapoer Cobek 10:30 Obsesi 11:30 Buletin Indonesia Siang 12:00 Indonesia Bicara 13:00 Doo Bee Doo 14:00 Cagur On The Street 14:30 100% Ampuh 16:00 Fokus Selebriti 16:30 Oggy and The Cockroaches 17:00 Kungfu Panda 17:30 Transformers Prime 18:00 Naik Enak, Turun Ogah 19:00 Mantu-Mantu Morotin Mertua 20:00 The Brave One 22:30 Clear and Present Danger

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:30 Selebrita Pagi 08:15 Ga Nyangka 08:45 Ups Salah 09:15 RNB 09:45 Spotlite 10:45 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Jejak Petualang 14:00 Dunia Binatang 14:30 Koki Cilik 15:00 Brownies 15:30 Tau Ga Sih 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Indonesiaku 17:30 Orang Pinggiran 18:00 Hitam Putih 19:15 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Jam Malam


One Direction Raih Tiga Piala MTV Boyband asal Inggris One Direction berhasil meraih tiga penghargaan dalam MTV Video Music Awards.

Kristen Stewart/

Kristen Stewart Gamang Dengan Popularitasnya KRISTEN Stewart mengakui merasa gamang dengan popularitas ia capai saat ini. Bintang film ‘Twilight’ ini mengatakan seolah ia tak percaya dengan keberadaannya sekarang. Kendati demikian, Stewart tidak melupakan jasa-jasa orang mendukung keberhasilannya. Namun tak dapat dipungkiri gadis berusia 22 tahun ini senang bekerjasama dengan Robert Pattinson, pasangan mainnya dalam film Twilight sekaligus

mantan kekasihnya dan sutradara Sanders, begitu kata Stewart dalam majalah Vogue edisi terbaru. “Saya ingin berakting menjadi wanita yang berkarakter lembut. Terkadang saya berfikir jika menjadi orang terkenal, sulit mengendalikan diri sendiri di hadapan publik. Saya harus melepas kebebasan saya karena segala sesuatu saya lakukan akan menjadi sorotan publik,” aku Stewart. Aktris ini berperan sebagai

Marylou masih berusia 16 tahun dalam film On The Road. Dalam film itu dikisahkan Marylou mengadakan perjalanan dengan suaminya yang sudah tua bernama Dean Moriarty dan seorang lelaki dipanggil Sal ditemui pasangan ini dalam perjalanan mereka. Tidak seperti Stewart berperan sebagai wanita baik-baik Bella Swan dalam film Twilight, Marylou merupakan karakter seorang wanita bebas. Film On The Road diangkat

dari novel karya Jack Kerouac berjudul sama pertama kali diputar di festival film Cannes beberapa waktu lalu dimana cewek ini didampingi Robert Pattinson. Stewart pernah membintangi film The Snow White dan The Huntsman. Garrett Hedlund berperan sebagai Dean Moriarty, sementara Sam Riley berlakon sebagai Sal. Viggo Mortensen dan Kirsten Dunts juga terlibat dalam film On The Road. Nur/

Album ArtPop Lady Gaga Pengalaman Multimedia Lady Gaga mengonfirmasi bahwa album barunya yang berjudul ArtPop akan menjadi pengalaman multimedia. Dalam tulisan Gaga di jejaring sosialnya, Little Monsters, dia mengajak penggemarnya untuk melibatkan diri dalam proyek album akan rilis musim semi 2013 tersebut. “Saya sangat tidak sabar untuk bilang kepada kalian bahwa album ArtPop ini akan menjadi pengalaman multimedia dengan berbagai bentuk,” tulisnya seperti dikutip “C a r a p a l i n g m u d a h u n t u k membenamkan diri adalah melalui aplikasi,” katanya. ArtPop akan dirilis di iPad, iPhone, serta aplikasi yang bisa digunakan di telepon selular dan komputer (WORLD). ArtPop akan interaktif dengan kemampuan chat, film di setiap lagu, musik tambahan, konten tambahan, permainan yang terinspirasi dari GaGa, info terbaru

mengenai fesyen, majalah, serta banyak lagi. GaGa menjelaskan bahwa dia bisa mengunggah apapun ke aplikasi tersebut kapan saja, : “Kalian (Fans) menginspirasi saya untuk menciptakan sesuatu yang komunikatif dengan gambar, karena kalian, berkomunikasi dengan saya maupun antar kalian lewat gifts dan gambar, karya seni, grafis, setiap hari. Kalian adalah generasi ArtPop. Saya harap kalian bisa terus berkembang dan tetap terhubung melalui kreatifitas kalian,” katanya. Dia berjanji bahwa rekaman tersebut juga akan dirilis dalam versi digital konvensional dan fisik, yang menurut GaGa akan berbeda dan unik dibandingLady Gaga/ kan aplikasinya. Artis Bjork juga pernah merilis labum barunya Biophilia tahun lalu dengan sebuah aplikasi terhubung dengan konten multimedia.(ant)

Grup beranggotakan lima pemuda ini meraih penghargaan dalam kategori Artis Pendatang Baru Terbaik, Video Pop Terbaik, danVideo Paling Sering Dibagi. Niall Horan, Liam Payne, Louis Tomlinson, Harry Styles, dan Zayn Malik juga membawakan lagu terbaru mereka berjudul “One Thing” saat upacara penganugerahan di Los Angeles. “Terima kasih banyak! Kami menonton acara ini waktu kecil dan mendapatkan penghargaan-penghargaan ini luar biasa,” kata Niall Horan, seperti dikutip dari BBC. Manager band dikenal dengan sebutan 1D, Simon Cowell melalui akun Twitternya mengatakan “Selamat 1D. Saya sangat bangga akan kalian. Rayakan!” Sementara penyanyi Rihan-na masuk lima nominasi dan membawa satu piala untuk

One Direction dari kiri ke kanan Niall Horan, Louis Tomlinson, Harry Styles, Zayn Malik dan Liam Payne saat menerima penghargaan MTV Video Music Awards 2012 di Los Angeles/AP Video Tahun Ini. “Saya cinta kalian! ini luar biasa,” kata Rihanna saat menerima piala. Setelah mengambil hadiah, ia diberi selamat mantan kekasihnya Chris Brown, dinyatakan bersalah karena menyerang

Rihanna sebelum Grammy tahun 2009. Vokalis Greenday Billie Joe Armstrong juga tampil di acara itu. Ia dikerubungi penggemar yang diundangnya ke naik panggung.

Ia terlihat sehat setelah dilarikan ke rumah sakit awal pekan ini. Penampilan Alicia Keys dipanggung dimeriahkan pesenam Olimpiade Gabby Ross saat membawakan lagu Girl On Fire. (ant)

Chicago Konser Di Jakarta Band asal Chicago, Illinois, Chicago akan menggelar konsernya bertajuk ‘Chicago Live in Concert 2012’ di Plenary Hall Jakarta Convention Center pada 27 Oktober 2012. Band dibentuk sejak tahun 1967 ini menjadi salah satu dari 13 band paling bersejarah di dunia versi majalah Billboard, dan Indonesia berkesempatan melihat langsung penampilan band digawangi Robert Lamm, Lee Loughnane, James Pankow, Walt Parazaider, Lou Pardini, Jason Scheff, Tris Imboden, dan Keith Howland. Selama berkarir, Chicago sudah membuat rekor penjualan sebanyak 38 juta copy di Amerika, mendapat 22 penghargaan gold, 18 platinum dan 8 multiplatinum. Mereka juga sudah menghasilkan lima album bertengger di posisi puncak dan 21 single berhasil duduk di posisi 10 besar. Karir bermusik mereka dimulai dengan nama The Big Thing yang sering membawakan lagu dari penyanyi lain. Kemudian berganti menjadi Chicago Transit Authority atau disingkat menjadi Chicago. Album pertama Chicago

Chicago/ muncul pada tahun 1969 berhasil terjual lebih dari satu juta copy dan mendapat penghargaan platinum untuk lagu-lagunya, seperti Does Anybody Know What Time It Is?, Beginnings dan Questions 67 and 68. Chicago berhasil menyabet penghargaan Grammy untuk

kategori Penampilan Lagu Pop Terbaik Duo atau Grup lewat lagu If You Leave Me Now dari album Chicago X di tahun 1976. Karir mereka sempat menurun manakala sang vokalis saat itu, Terry Kath mengalami kecelakaan dan diganti Donnie Dacus. Namun keadaan sema-

kin membaik terutama sejak David Foster ikut mengembangkan karir Chicago. Kini di tahun 2000-an Chicago yang bernaung dibawah label Rhino Record, berhasil menelurkan album The Best of Chicago: 40th Anniversary Edition dan Stone of Sisyphus.(ant)

Luar Negeri

WASPADA Senin 10 September 2012


Pengadilan Irak Jatuhi Hukuman Mati In Absentia Atas Wapres Sunni

Seputar ASEAN

BAGHDAD (AP): Satu pengadilan Irak mendapati wakil presiden negeri itu dari kelompok Sunni bersalah ketika memimpin regu algojo hukuman mati terhadap pasukan keamanan dan warga Syiah dan dia telah dijatuhi hukuman mati secara in absentia. Pengadilan kriminal di Baghdad menjatuhkan hukuman mati terhadap Wapres Tariq al-Hashemi Minggu (9/9). Pemerintah Irak yang dipimpin kaum Syiah mengumumkan tuduhan terhadap wapres Desember lalu ketika Amerika Serikat menarik pasukannya dari negeri itu. Sejak itu Al-Hashemi berada di pengasingan. Sesuai dengan hukum Irak, dia dapat menerima satu peradilan ulang jika dia kembali ke Irak untuk menghadapi tuduhan yang diajukan kepadanya. Al-Hashemi telah membantah semua tuduhan yang dihadapkan padanya, dengan mengatakan tuduhan itu merupakan bagian dari balas dendam politik terhadap dirinya. Dia merupakan salah seorang pejabat ranking tertinggi Sunni di Irak yang menghadapi hukuman itu. (m10)

Tentara Filipina Tewas Dalam Bentrokan Di Tapaz ILOILO CITY (Antara/PNA-OANA): Seorang polisi militer Filipina tewas dalam satu bentrokan dengan sekelompok pemberontak Tentara Rakyat Baru (NPA) di Desa Tacayan, Tapaz, Provinsi Capiz. Mayor Enrico Gil Lieto, petugas informasi publik Divisi Infanteri (ujung tombak) ke-tiga, mengatakan Sabtu (8/9) satu peleton tentara dari Batalyon (Pemburu) ke61 (61IB) menanggapi laporan tentang kehadiran kelompok bersenjata ketika mereka kemudian bentrok dengan pemberontak NPA bersenjata. Senjata api dipastikan mengakibatkan kematian seorang tentara yang identitasnya masih menunggu pemberitahuan dari pihak keluarganya. Letkol Christopher Sab-it, komandan 61IB, mengatakan “insiden tersebut adalah signifikan dalam kampanye kami untuk keamanan di Tapaz”. Dia juga mengatakan bahwa pihaknya menghargai bantuan dari penduduk setempat atas dukungan dan kerja sama dengan penguasa militer, dengan melaporkan keberadaan kelompok bersenjata di wilayah mereka. “Medan yang sulit dan sejumlah kecil kelompok bersenjata selalu menjadi tantangan bagi tentara kami dalam misi perdamaian menjaga pedesaan,” kata Sab-it.

Pemimpin Militan Jordania Peringatkan Serangan Di Syria AMMAN (AP): Seorang pemimpin militan Jordania yang punya hubungan dengan al-Qaida memperingatkan bahwa kelompok ekstrimisnya akan melancarkan ‘serangan maut’ di tetangganya di Syria untuk menggulingkan Presiden Bashar Assad. Mohammad al-Shalabi, yang lebih dikenal sebagai Abu Sayyaf, mengatakan serangan-serangan itu merupakan respon terhadap ‘kejahatan’ yang dilakukan kelompok minoritas Alawiyah Assad yang berkuasa terhadap kelompok mayoritas Muslim Sunni di Syria. Dia menyampaikan pidatonya di depan rapat umum protes di luar Kantor PM di ibukota Amman Minggu (9/9). Peringatan itu diungkapkan setelah pasukan Syria membombardir sebuah distrik di Damaskus dan menewaskan 10 orang di antaranya. Lokasi yang dibom itu, diketahui dipenuhi oleh pengungsi asal Palestina yang berdiam di Syria. Tindakan yang dilakukan pasukan Syria itu berlangsung di distrik Yarmouk. Seorang saksimata mengatakan, sekira 11 roket dilesakkan ke wilayah yang dipenuhi warga Palestina itu.Tampak asap berwarna abu-abu terlihat di lokasi serangan itu. “Sekitar 10 orang tewas dan 15 lainnya terluka sejak mereka (pasukan Syria) meneruskan serangan. Beberapa dari korban tewas tampak menderita luka bakar parah, tidak ada yang yakin berapa jumlah korban tewas dalam kejadian ini,” ujar seorang saksi mata, seperti dikutip Gulf News, Sabtu. Sementara warga di sekitar kota mendengar beberapa ledakan dan tembakan sporasi sejak Jumat pagi waktu setempat. Beberapa aktivis mengatakan, tank dan prajurit sepertinya dikerahkan oleh Pemerintah Suriah dalam serangan ini. Sementara lima pasukan keamanan dilaporkan tewas dalam ledakan bom yang dipasang di sebuah sepeda motor di Distrik Rukn Al Din. Bom juga meledak di jalanan antara kantor Kementerian Informasi dan Pengadilan Damaskus. Tidak jelas apakah ada korban tewas dalam insiden tersebut. (m10)

Niger Bantah Izinkan Putra Khadafi Pergi Ke Negara Lain NIAMEY (Antara/Reuters): Niger membantah laporan pihaknya mengizinkan Saadi Khadafii, putra mantan pemimpin Libya Moammar Khadafi meninggalkan negara itu, di mana dia berada dalam tahanan rumah setelah melarikan diri dari Libya tahun lalu. Pengacaranya, Nick Kaufman, sebelumnya mengemukakan kepada stasiun televisi France 24 bahwa Niger telah setuju mengizinkan kliennya meninggalkan negara itu dan dia telah mengajukan sejumlah permohonan suaka ke negara-negara lain. Pengusaha berusia 39 tahun itu dan juga mantan pemain sepakbola profesional tidak dicari oleh Pengadilan Pidana Internasional (ICC) tetapi oleh Libya yang menginginkan dia diadili atas tuduhan melakukan penggelapan properti-properti melalui pemaksaandanmelakukanintimidasibersenjataketikaiamemimpinFederasi Sepakbola Libya. Atas permintaan Libya, Interpol tahun lalu mengeluarkan satu “perintah penangkapan” yang meminta negara-negara anggota menangkap dan mengekstradisi Saadi — tetapi Niger memberikan beberapa alasan untuk tidak mengekstradisi dia. Kaufman, pengacaranya mengemukakan kepada stasiun televisi France 24 bahwa‘bukan rahasia’ lagi bahwa Niger setuju mengizinkan Saadi pergi. Tanpa mengutip sumber-sumber, stasiun televisi itu mengatakan Afrika Selatan adalah salah satu negara yang mempertimbangkan permohonannya. Tetapi Marou Amadou, juru bicara pemerintah Niger mengemukakan kepada Reuters melalui telepon Sabtu tidak ada keputusan dibuat untuk mengizinkan Saadi pergi. “Kami tidak pernah membuat satu keputusan seperti ini dan saya tidak tahu dari mana pengacaranya memperoleh kabar mengenai hal ini,” katanya Sabtu (8/9). Clayson Monyela, juru bicara Departemen Hubungan Internasional dan Kerja Sama Afrika Selatan juga membantah bahwa negaranya menerima permohonan suaka dari Saadi. “Kami tidak menerima satu permintaan suaka seperti itu,” katanya dan membantah rumor-rumor bahwa Saadi telah memasuki Afrika Selatan atau sedang dalam perjalanannya ke sana itu “sama sekali tidak benar”. Berdasarkan satu resolusi Dewan Keamanan PBB Saadi dilarang bepergian dan asset-assetnya dibekukan.Saudara kandungnya Saif al-Islam, menurut rencana akan diadili di Libya akhir tahun ini atas tuduhan kejahatan perang dan juga dicari oleh ICC.

Myanmar Untuk Pertama Kalinya Tunjuk Menteri Perempuan The Associated Press

PASUKAN keamanan memeriksa lokasi serangan satu bom mobil di Basra, 550 km di tenggara Baghdad, Irak, Minggu (9/9). Dalam

rangkaian kekerasan itu, yang terjadi di sekurang-kurangnya 10 kota di seluruh Irak. Para pemberontak membunuh sekurangkurangnya 44 orang dalam gelombang serangan terhadap pasukan keamanan Irak Minggu, dengan menembak mati para prajurit di satu pos tentara dan mengebom rekrutan polisi, kata para pejabat.

Gelombang Serangan Renggut 44 Jiwa Di Irak BAGHDAD (AP): Para pemberontak membunuh sekurang-kurangnya 44 orang dalam satu gelombang serangan terhadap pasukan keamanan Irak Minggu (9/9), dengan menembak mati sejumlah prajurit di satu pos tentara dan mengebom rekrutan polisi yang menunggu dalam satu antrean untuk mengajukan permohonan kerja, demikian menurut sejumlah pejabat. Tindakan kekerasan itu, yang melanda sekurang-kurangnya 11 kota, juga mencederai 240 orang orang lainnya, merupakan usaha kelompok militan untuk merusak stabilitas di negeri itu dan bertujuan menggoyahkan pemerintahan. Belum ada kelompok yang menyatakan bertanggungjawab atas serangan tersebut namun pasukankeamananbiasanyamerupakan satu sasaran utama dalam serangan oleh al Qaida cabang Irak, yang telah bersumpah untuk merebut kembali daerahdaerah yang pernah dikuasainya sebelum pasukan AS menarik diri dari negeri itu tahun lalu. Dalam serangan mematikan Minggu, kelompok bersenjata menyerbusatuposluarkecilmilik

AD Irak di kota Dujail sebelum fajar, yang menewaskan sekurang-kurangnya 10 tentara dan mencederai delapan lainnya, demikian menurut polisi dan para pejabat rumah sakit di Balad, satu kota terdekat dari Dujail, yang terletak kira-kira 80 km di utara Baghdad. Beberapa jam kemudian, satu mobil bermuatan bom meledak dekat rekrutan polisi yang menunggu dalam antrean untuk mengajukan permohonan kerja di Northern Oil Co. di luar kota Kirkuk di utara Irak. Komandang polisi kota Brigjend. Sarhad Qadir mengatakantujuhorangrekrutan tewas dan 17 lainnya cedera. Dia mengatakansemuarekrutanadalah warga Sunni dan mempersalahkan serangan dinihari itu

Taliban Ancam Akan Culik Pangeran Harry KABUL (AP): Pangeran Harry kembali bertugas ke Afghanistan selama empat bulan, mendengar laporan itu Komandan Senior Taliban mengatakan, mereka akan berupaya sekuat tenaga untuk menculik ataupun membunuh pangeran yang dikenal bandel itu.Taliban mengatakan, akan menggunakanwargaAfghanistan yang direkrut sebagai pasukan keamanan. “Ini menjadi berita bagus untuk kami (kedatangan Pangeran Harry), karena kami selalu mencari incaran yang bagus. Sudah menjadi prioritas kami untuk menculiknyadengancaraapapun,” ujarKomandanTalibanMaulviAhmadullahAhmadyar,sepertidikutip Reuters, Sabtu (8/9). “Kami memiliki informan di pangkalan militer yang digunakan oleh pasukan Inggris di Hel-

mand. Bila tidak berhasil menculiknya, kami akan membunuhnya melalui rekan kami yang bekerja dengan pasukan Inggris,” imbuhnya. Ahmadyar mengaku, pihaknya mengetahui cara perekrutan wargaAfghanistandidalampasukan keamanan Afghanistan, agar dapatdigunakanuntukmenyerang targetasing.SementaraKomandan TalibanlainnyaMullaBurjanturut mengeluarkan ancaman serupa. Dirinya mengancam akan menembakihelikopteryangdigunakan olehPangeranHarrydenganroket. “Kami akan senang menerimanya di sini, ketika mendengarnyaakanmenerbanganhelikopter Apache. Akan lebih menyenangkanlagimenembakhelikopternya dengan RPG (peluncur roket),” tutur Burjan. Pangeran Harry dikabarkan

Helikopter Tempur Jatuh Di Dagestan

The Associated Press

RUMAH KORBAN PEMBUNUHAN. Rumah Saad al-Hilli, di Claygate, Inggris, yang ditembak mati Rabu lalu bersama tiga orang lainnya yang sedang berlibur di Alpen Prancis, terus dikawal oleh Polisi Surrey, yang dibantu polisi Prancis, Minggu (9/9). Anakanak dari keluarga al-Hilli selamat dari pembunuhan itu, ketika putrinya Zeena yang berusia 4 tahun selamat tertimpa di bawah mayat ibunya dan Zaina, yang berusia 7 tahun tertembak di bahunya dan mengalami pukulan oleh para penyerangnya.

pada al Qaida, namun tidak ada rincian lebih lanjut. Serangan maut itu bahkan melebar ke sebelah selatan Irak, di mana beberapa bom meledak di dua lapangan parkir mobil di Nasiriyah, 320 km di tenggara Baghdad, kota yang didominasi Syiah. Ledakan terjadi dekat konsulat Prancis dan satu hotel lokal dikotaitu,meskikonsulatitutidak tampak sebagai sasaran dalam pengeboman tersebut. Deputi direktur kesehatan lokal Dr. Adnan al-Musharifawi mengatakanduaorangtewasdan tiga lainnya cedera dalam serangan di hotel dan seorang polisi Irak cedera di konsulat Prancis. Al-Musharifawi mengatakan tidak ada diplomat Prancis di antara korban ledakan. Sejauh ini belum ada pihakpihakyangmengakubertanggung jawab atas serangkaian serangan terbaru di Irak. Sebelumnya kelompok-kelompok perlawanan yang diduga mempunyai hubungan dengan jaringan al-Qaida dituding berada di balik sebagian besar aksi kekerasan baru-baru ini. Kekerasan hari ini terjadi hanyabeberapaharisetelahdelapan

MOSKOW (Antara/RIA Novosti-OANA): Empat orang tewas ketika satu helikopter tempur Mi-35 jatuh di sebuah gunung di Republik Dagestan Kaukasus Utara, kata sumber penegak hukum. “Empat orang ditemukan tewas di tempat kejadian,” kata sumber itu. Helikopter tempur itu menabrak gunung sementara terbang di atas dalam kondisi cuaca buruk Sebelumnya Departemen Pertahanan melaporkan bahwa ada tiga orang di dalam pesawat naas itu. Kementerian Pertahanan kini menangguhkan penerbangan Mi-35 sebagai akibat dari insiden tersebut. Menurut sumber keempat orang itu bukan anggota kru. Dia menambahkan bahwa tidak ada korban yang cedera atau kerusakan di darat. “Nama-nama tiga anggota awak yang berada di helikopter dikenali. Tapi ada kemungkinan satu atau dua orang berada di dalam pesawar tersebut. Jumlah pasti korban tewas dalam kecelakaan itu tidak diketahui dengan jelas, kata sumber itu. “Menurut laporan, helikopter bukan jatuh ditembak, kondisi cuaca buruk adalah penyebab kecelakaan itu,” kata juru bicara Kementerian Pertahanan Rusia.

tiba di Camp Bastion di Helmand Sabtu pagi ini waktu setempat. Ini adalah penugasannya yang kedua oleh Kementerian Pertahanan. Pada penugasan kedua, tidak ada penutupan dilakukan oleh media yang biasanya ditujukan untuk melindungi anggota keluarga Kerajaan Inggris itu. Pengebom remaja Taliban Sementara itu, seorang remaja pengebom bunuhdiri meledakkan bomnya di luar markasbesar NATO di Kabul Sabtu, yang menewaskan sekurang-kurangnya enam orang dalam satu serangan yang ditujukan ke jantung operasi militer pimpinan AS di Afghanistan, demikian menurut sejumlah pejabat. Talibanmenyatakanbertanggungjawab atas ledakan itu, yang merupakantindakanterakhirdari serangkaian serangan para pemberontak di ibukota Afghanistan yang dijaga ketat. Serangan itu bertujuan untuk mengganggu kampanye sebulan oleh pasukan kaolisi pimpinan AS untuk meningkatkanpengamanandiKabul sebelum penarikan secara signifikanpasukanasingdarinegaraitu. Pengebombunuhdiriitumeledakkanbomnyasebelumtengah hari Sabtu di luar markasbesar koalisiNATOpimpinanAS,disatu jalanan yang berhubungan dengan markasbesar aliansi itu ke kedutaanbesar AS dan Italia di dekatnya, satu pangkalan militer besar AS dan Kementerian Pertahanan Afghanistan. NATOdanpolisimengatakan semua korban tewas adalah warga Afghanistan dan Kementerian Dalam Negeri menambahkan di antara korban adalah anak jalanan. Polisi Kabul mengatakan dalam satu pernyataan bahwa pengebom berusia 14 tahun.(ok/ m10)

orang tewas dalam serangan di beberapa tempat suci Syiah di Kirkuk. Meski secara umum kekerasan di Irak menurun dibanding puncaknya pada 2006 dan 2007, serangan kembali meningkat setelah pasukan Amerika Serikat ditarik dari Irak pada Desember 2011 dan di tengah ketegangan politik dan sektarian. DiHusseiniyah,satukawasan SyiahditimurBaghdad,beberapa ledakan bom menewaskan seorang polisi dan pejalan kaki, kata pasukan keamanan dan petugas kesehatan.Delapanoranglainnya — termasuk empat prajurit— cedera, kata para pejabat. Ledakan lain terjadi di Basra yang menewaskan tiga orang dan mencederai 24 lainnya, sementarabomlainnyadiTalAfarmenewaskanduapejalankakidanmencederai tujuh lainnya, kata para pejabat. Sepasang bom di provinsi selatan Maysan menewaskan lima orang dan mencederai 40 lainnya di luar tempat suci Syiah, Imam Ail al-Sharqi, kata direktur tempat suci itu Ammar Abdullah. Masih banyak lagi bom lainnya di beberapa kota, di Taji, menyebabkan dua orang tewas dan 11 cedera dan ledakan di kota Sunni of Baghdad, Hawija dan Ar Riyad. Di Tuz Khormato dekat Kirkuk, satu bom mobil meledak di luar satu pasar yang menewaskanempatorangdanmencederai 41lainnya,katadirekturkesehatan provinsi Salahuddin, Raeed Ibrahim. (m10)

YANGON (Waspada): Pemerintah Myanmar kembali menunjukkan gebrakan baru dalam reformasi politik di negaranya. Pemerintahan Presiden Thein Sein itu menunjuk seorang menteri perempuan pertama. Myat Myat Ohn Khin ditunjuk sebagai perempuan pertama yang masuk dalam jajaran anggota kabinet Myanmar. Perempuan bergelar doktor itu, menjabat sebagai Menteri Kesejahteraan Sosial,BantuanKemanusiaandanPemukimanMyanmar.Demikian diberitakan AFP, Sabtu (8/7). Ohn Khin merupakan salah satu dari 10 orang menteri yang akan mengisi lowongan menteri yang kosong sejak dilakukannya perubahan dalam tubuh kabinet Myanmar. Tentunya hal ini memberikan nafas segar dalam kondisi politik di Myanmar. Presiden Thein Sein sepertinya terus berusaha untuk menarik dunia internasional dengan segala macam bentuk reformasi yang dilakukannya.Denganreformasidanketerbukaanyangberlangsung di Myanmar, membuat negara-negara Barat perlahan-lahan mengendorkan isolasi terhadap Myanmar.(ok)

Para Korban Gempa Bumi China Menanti Pasokan Bantuan BEIJING(AP):Parakorbanselamatgempabumi—yangmenewaskan 81orangdanmencede-railebihdari800lainnyadikawasanpegunungan di baratdaya China — merasa putus asa menunggu bantuan Minggu (9/9) ketika gempa susulan terus mengundang kekhawatiran mereka dan upaya penyelamatan terhalang. Korban terakhir gempa bumi sedang itu adalah seorang anak berusia 2 tahun yang tertimpa dinding yang runtuh ketika terjadi guncangan gempa susulan Sabtu malam, demikian menurut kantor berita resmi Xinhua. Gempa bumi pertama terjadi Jumat di satu kawasan perkebunan dan pertambangan kecil dekat perbatasan antara provinsi Guizhou danYunnan, di mana sebagian warga miskin China tinggal. Gempa tersebutmenumbangkanribuanrumahdanmenyebabkanterjadinya longsoran batu-batu besar yang berserakan di jalanan dan pihak berwenang telah mengevakuasi lebih dari 200.000 warga desa. Kawasan itu masih terus diguncang gempa susulan Minggu, sehingga meningkatkan kecemasan akan jatuhnya korban jiwa dan korban cedera yang baru. Lebih dari 11.000 tenda, 6.000 pakaian dan pasok lainnya, termasuk air dalam botol dan beras telah dikirimkan keYiliang — daerah paling parah dan banyak jatuh korban jiwa dalam bencana itu — dan banyak lagi yang masih berada dalam perjalanan, kata Xinhua. (m10)

Hongkong Batal Terapkan Kurikulum ‘Cuci Otak’ HONGKONG (Waspada): Hongkong akhirnya memutuskan batal mengadopsi kurikulum yang hendak diterapkan pemerintah China. Keputusan ini menyusul aksi protes puluhanribu warga Hongkong yang menyebut kurikulum untuk sekolah dasar dan menengah itu seperti pelajaran cuci otak. Ini mungkin salah satu demo terbesar dalam sejarah Hongkong. Menurut laporan pers, Sabtu (8/9), aksi protes keras itu datang dari orangtua, guru, dan siswa selama satu minggu penuh. Demonstran menilai, kurikulum itu merupakan propaganda partai komunis di China. Bahkan, demonstran menyebut itu merupakan sisi gelap pemerintahan China.(vn/r-m10)

Tornado Sapu Pemukiman Di Pantai New York NEWYORK (Antara/XinhuaOANA): Tornado menyapu satu pemukiman pantai di Queens, NewYork,sehinggamelemparkan puing ke udara, serta membuat pasokan listrik terhenti, jalan tergenang air dan turnamen tenis US Open ditunda. Namun sejauh ini tak ada laporan mengenai korban cedera, kata media setempat. US NationalWeather Service (NWS) mengkonfirmasiTornado

EFO memasuki wilayah Breezy Point, Queens, Sabtu (8/9) pagi. Pusaranangindanairterekamoleh puluhanorangmelaluikameratelepon genggam mereka dan langsung diposting di Internet. Tornadotersebutmengamuk hanyabeberapamenit,katabeberapa saksi mata, tapi cukup lama untuk merobek tembok, menerbangkan atap rumah dan membuat berantakan kabel listrik saat

angin kencang itu menerjang Rockaways, dekat Breezy Point. KomisarisPolisiNewYorkCity Raymond W. Kelly tiba di Breezy Point pada Sabtu sore untuk menilaikerusakan,demikianlaporan media sebagaimana dikutip Xinhua. NWS mengeluarkan peringatan tornado untuk wilayah Queens dan Brooklyn saat topanbadaikuatbergerakmelewatikota itu, tambah laporan tersebut.

The Associated Press

WARGA memeriksa kerusakan pada Breezy Point Surf Club setelah kemungkinan serangan tornado pada saat cuaca buruk di New York, Sabtu (8/9). Tornado mulai melakukan sapuan dari laut dan menghantam kawasan pantai di New York City, yang memporakporandakan sejumlah bangunan, memutuskan aliran listrik. Regu pemadam kebakaran masih terus mempelajari kerugian akibat tornado itu dan tidak ada korban cedera parah yang ditimbulkannya.



WASPADA Senin 10 September 2012

JADWAL RABU (12/9) GRUP A: Serbia vs Wales Skotlandia vs Macedonia Belgia vs Kroasia

GRUP E: Siprus vs Islandia Norwegia vs Slovenia Swiss vs Albania

GRUP B: Bulgaria vs Armenia Italia vs Malta

GRUP F: Irlandia Utara vs Luxemburg Israel vs Rusia Portugal vs Azerbaijan

GRUP C: Austria vs Jerman Swedia vs Kazakhstan

Villa Bahagia Luar Biasa

GRUP D: Rumania vs Andorra Turki vs Estonia Hungaria vs Belanda


BOMBER Timnas Spanyol, David Villa, sumringah karena berhasil mencetak gol bagi El Matador setelah absen panjang karena cedera. Villa absen merumput sejak Desember 2011 lalu akibat cedera patah tulang kering kala memperkuat Barcelona di ajang Piala Dunia Antarklub. Villa sebenarnya diharapkan bisa tampil memperkuat Spanyol di ajang Euro 2012. Namun, proses penyembuhannya berjalan lebih lambat. Di laga persahabatan melawan Arab Saudi di Stadion Pasaron, Sabtu (8/9), Villa sukses melesakkan gol di menit 63 melalui titik putih dan mengantar La Furia Roja menang 5-0. “Saya sangat bahagia kembali memperkuat Timnas Spanyol dan mencetak gol. Saya mengalami masa sulit ketika cedera,” ujar penyerang Barcelona itu, Minggu (9/9). “Saya sangat merindukan Timnas Spanyol, bertanding, dan melakukan latihan bersama teman-teman. Tapi, saya takkan menoleh ke belakang lagi,” tegas Villa.


SKUAD Gli Azzurri (biru) kesulitan meladeni Bulgaria dalam laga kualifikasi Grup B Piala Dunia 2014 di Vassil Levski Stadium, Sofia, Sabtu (8/9).


PELATIH Prancis, Didier Deschamps, menyebut sosok Abou Diaby sebagai gelandang yang lengkap. Deschamps nampaknya terkesan dengan penampilan pemain Arsenal itu saat Les Bleus mengalahkan Finlandia 1-0 di laga kualifikasi Piala Dunia 2014, Sabtu (8/9). Usai menerima sodoran bola dari Karim Benzema di menit 20, Diaby mencetak gol. Penampilan gemilang dari gelandang berusia 26 tahun ini pun langsung mendapat apresiasi dari Deschamps. “Saya tidak perlu diyakinkan oleh Diaby. Saya sudah melihatnya bermain untuk Arsenal, dia adalah sosok gelandang yang komplit, bisa melakukan banyak hal, termasuk mencetak gol,” ucap Deschamps, Minggu (9/9). Diaby sendiri juga merasa puas dengan kemenangan Prancis atas Finlandia. Ia juga berharap bisa konsisten tampil setelah rentetancederayangmembuatnyaabsenpanjang.Setelahsembuh cedera panjang, Diaby mengaku bahagia dan menatap masa depan.


Lampard Buktikan Bisa Bertandem Gerrard MESKI banyak pihak menyebut Frank Lampard tak bisa dipasangkan bersama Steven Gerrard, hal itu tak tampak kala Inggris melumat Moldova 5-0, Sabtu (8/9) lalu. Di sini, bintang Chelsea itu mencetak dua gol bagi Three Lions di babak pertama. Kedua golnya itu membawa Lampard total mengoleksi 25 gol untuk skuad St George’s Cross. Lebih bahagia lagi, Lampard bisa membuktikan kritik bahwa dirinya dan Gerrard tak cocok tampil bersama, terutama dengan assist sang kapten pada gol keduanya. “Sungguh menyenangkan untuk saya dan Stevie (Gerrard) bekerjasama untuk gol kedua. Anda harus terus menjawab para kritikus. Itu umpan yang bagus, tapi selalu menyenangkan bermain bersama Stevie karena ia pemain top,” ucap gelandang berusia 34 tahun itu, Minggu (9/9). “Tim kami penuh dengan kecepatan pemain muda dan itu membuat kami bisa memenangi permainan dengan nyaman. Kini saya memainkan peran sedikit lebih disiplin, gol saya mungkin bakal sedikit dan lebih jarang,” akunya.


Tango Menang, Messi Senang KEMENANGAN yang diraih Argentina membanggakan hati Lionel Messi. Menurutnya, berada di puncak klasemen sangat baik untuk meningkatkan kepercayaan diri tim Tango. Berbekal dukunganpenuhpubliknyayangmemadatiStadionMarioKempes, Cordoba, Sabtu (8/9), Argentina memetik kemenangan 3-1 atas Paraguay. Angel Di Maria membuka gol Argentina kala pertandingan baru menginjak menit kedua. Namun, Paraguay menyamakan kedudukan melalu penalti Jonathan Fabbro. Gonzalo Higuain kembali bawaTimTango memimpin sebelum Messi memastikan Argentina untuk meraih poin maksimal di menit 63. Kemenangan ini tak hanya menaikkan skuad Alejandro Sabella ke posisi puncak klasemen sementara, tapi sekaligus mencetak enam kemenangan beruntun baik di ajang kompetitif maupun laga ujicoba. “Berada di puncak Grup adalah aspek terpenting. Itu merupakan kunci sukses untuk meraih kepercayaan diri sebagai satu kesatuan tim. Kemenangan ini sangatlah berharga. Kini, kamiakanmelawatkePeru,timyangsangatsulituntukdikalahkan,” ujar Messi, Minggu (9/9). (m33/goal/ini/sun)

GRUP H: San Marino vs Montenegro Polandia vs Moldova Inggris vs Ukraina GRUP I: Georgia vs Spanyol Prancis vs Belarus

Italia Kehilangan Identitas SOFIA (Waspada): Pelatih Italia, Cesare Prandelli, mengatakan kepada skuad Gli Azzurri agar penampilan saat melawan Bulgaria tak lagi terulang kala menjamu Malta dalam lanjutan kualifikasi Piala Dunia 2014, Rabu (12/9) dinihari. Pada Sabtu (8/9), Italia diimbangi Bulgaria 2-2 dan Prandelli

Diaby Pilihan Pas Deschamps

GRUP G: Bosnia-Herzegovina vs Latvia Slovakia vs Liechtenstein Yunani vs Lithuania

menyebut timnya layak meraih hasil imbang tersebut karena

Bulgaria dinilai bermain bagus danmenekanpertahanantitamu. Namun, sejumlah kalangan menyebutkan Italia justru beruntung tidak tumbang. “Saya menyaksikan pertandingan tersebut berulang kali dan harus melakukan analisis yang kritis,” kata Prandelli, seperti dilansir Football Italia, Minggu (9/9). “Kami berada dalam tekanan Bulgaria dan hal itu tidak boleh terulang lagi. Kami harus menga-

nalisis semuanya dan menemukan identitas kami yang hilang saat lawan Malta. Kami tidak punya banyak waktu, tapi kami harus terus berusaha,” paparnya. “Kami adalah Italia dan harus tampil berkarakter.Tim ini membutuhkan pendekatan yang berbeda. Kami yakin bisa meraih poin penuh lawan Malta,” tandas Prandelli lagi. Melawan Bulgaria, Gli Azzurri beruntung memanggil striker AS Roma, Pablo Osvaldo.

Pasalnya, dua gol Osvaldo menyelamatkan muka Italia setelah Bulgaria mencetak gol dari Stanislav Manolev dan Georgi Milanov. Kendati sukses menahan finalisEuro2012tersebutimbang, pelatih Luboslav Penev belum puas. Sebaliknya, Penev berpendapat timnya pantas mengalahkan Gli Azzurri melihat seringnya tuan rumah menekan dan menguasai serangan. “Saya hanya bisa bangga

denganpenampilankami,namun tidak puas dengan hasilnya. Saya pikir kami bermain lebih baik dan pantas menang,” kata Penev. Untuk sementara, Italia berada di posisi ketiga klasemen sementara Grup B. Azzurri berada di bawah Armenia yang sukses meraih tiga poin saat menundukkanMalta1-0.Sementara Bulgaria bertengger di posisi keduadengannilaisamalayaknya Italia. (m33/uefa/goal)

Pujian Selangit Buat Cleverley Ceko Redam Dinamit Denmark LONDON (Waspada): Pujian dilayangkan Frank Lampard dan pelatih Roy Hodgson kepada dua gelandang muda Timnas Inggris, Tom Cleverley dan Alex OxladeChamberlain. Keduanya tampil apik membela Inggris menghadapi Moldova di laga kualifikasi Piala Dunia 2014 di Sofia, Sabtu (8/9). Saat ini, Chamberlain tercatat lima kali memiliki caps membela timnas senior. Di lain pihak, Cleverley baru mengantongi dua caps bersama Three Lions. Melawan Moldova, Inggris menang telak lima gol tanpa balas. Lampard menjadi bintang kemenangan Inggris berkat dua gol ditambah sumbangan dari Jermaine Defoe, James Milner, dan Leighton Baines. Kepada pers, Lampard menyebut bahwa keberhasilan Inggris di pertandingan ini tak lepas dari peran Cleverley dan Chamberlain. Selain itu, wakil kapten timnas Inggris tersebut juga mengakui penampilan keduanya tidak tampak seperti pemain muda sekaligus berhasil memadukan lini tengah Inggris. “Cleverley tampil brilian di lini tengah. Sangat menyenangkan bermain bersamanya. Dengan usia yang masih relatif muda, dia akan mengisi lini tengahInggrisuntukjangkawaktu yang panjang,” puji Lampard, Minggu (9/9).


AKSI gemilang Tom Cleverley (kanan) bersama Three Lions mendapat pujian selangit dari Frank Lampard (kiri) dan pelatih Roy Hodgson. “Chamberlain juga brilian. Dia mengangkat moral tim di babakpertamamelaluikecepatan berlarinya sambil membawa bola. Sangat menyenangkan rasanya bisa melihat pemain muda bermain seperti itu untuk Timnas Ingris,” lanjut Lampard. Pelatih Inggris, Roy Hodgson, juga percaya Cleverley bisa menjadi “Cesc Fabregas”-nya Inggris. Sang pelatih percaya Cleverley mampu menjadi pemain kunci Inggris seperti FabregasditimSpanyolsaatmemenangi Piala Dunia dan Euro 2012. Di Polandia-Ukraina, Fabregas merupakan kunci permainan El Matador kala mantan pemain

Arsenal tersebut menempati posisi “False-9” dalam strategi pelatih Vicente Del Bosque. Melihat penampilan apik Cleverley sebagai penopang Jermaine Defoe, Hodgson berkeyakinan itulah posisi ideal gelandang muda binaan Manchester United tersebut di masa mendatang. “Tom Cleverley mampu mengambil tanggung jawab untuk lebih dekat dengan Defoe sehingga memungkinkan Steven Gerrard dan Frank Lampard memenangkanboladiposisiyang lebih dalam di mana mereka merasanyaman,”tuturnya.(m33/ ini/goal)

KOPENHAGEN (Waspada): Republik Ceko mendapat satu poin ketika bermain imbang 00 dengan tuan rumah Denmark pada pertandingan pertama laga kualifikasi Piala Dunia 2014, Minggu (9/9). Denmark menciptakan sejumlahpeluang,namunkurang tajamtanpakehadiranpenyerang Nicklas Bendtner yang menjalani larangan bermain, karena memperlihatkan logo perusahaan judi di celana dalamnya pada Euro 2012. Peluang terbaik tim tuan rumahterjadidimenit-menitawal melalui Michael Krohn-Dehli, yang sepakannya melebari setelah menyambut umpan silang dari sisi kanan. Tak lama kemudian, upaya Dennis Romedahl masih melebar ketika menanduk operan Krohn-Dehli, sehingga bola masih diamankan kiper Republik Ceko, Petr Cech. Denmark terus menekan padababakkedua,dimanabeberapa kali pemain sayap, Rommedahl, mengancam pertahanan Ceko dengan serangkaian dribel, umpan silang, dan tembakan. Cech menggunakan ujung kakinya untuk menggagalkan tendangan bebas Christian Eriksen, dan dari tendangan sudut, Andreas Cornelius, nyaris menandai debut timnasnya dengan gol. Denmark sempat protes tidak mendapat penalti


KIPER Republik Ceko Petr Cech (kanan) dan Tomas Sivok berjibaku dengan bek Denmark Daniel Agger (atas) saat kedua tim beradu pada laga kualifikasi Piala Dunia 2014 di Copenhagen, Minggu (9/9). ketika DanielWass dijatuhkan di area terlarang. Kendati begitu, wasit Wolfgang Stark (Jerman), tetap pada pendiriannya. DiGrupA,Skotlandiadantim muda Serbia bertanding imbang tanpa gol di Hampden Park. Meski demikian, kedua tim diperkirakan masing-masing berpeluangmelangkahkeputaran final di Brazil. Skotlandia lebih mengusai

permainan dalam pertandingan itu dan lebih punya peluang mencetak gol, namun mereka selalu terganjal oleh kekuatan lini belakang Serbia. Tim tamu sendiri nyaris meraih angka penuh pada menit 90 ketika Dusan Tadic mendapat peluang emas. Beruntung, kiper Skotlandia Allan McGregor mampu menyelamatkan gawangnya. (m33/ant/rtr)


WASPADA Senin 10 September 2012

A11 Bonus Kamal Menanti Koto Cs

Waspada/Jonny Ramadhan Silalahi

PARA pemain Sumut tetap berlatih di halaman Kuantan Hotel, Minggu (9/9) pagi, setelah malam harinya dengan 10 pemain kerja keras menahan Jawa Barat 0-0.

Rudi Terpaksa Ubah Formasi Sepakbola Sumut Vs Jatim Sore Ini KUANSING, Riau (Waspada): Pelatih Tim Sepakbola Sumut, Rudi Saari, terpaksa mengubah formasi pasukannya untuk menghadapi Jawa Timur di Stadion Sport Centre, Teluk Kuantan, Senin (10/9) ini. “Terpaksa begitu. Dua pemain inti tidak bisa tampil karena kena hukuman,” ungkap Rudi, didampingi asistennya Mardianto dan Budiono di Kuantan Hotel, Kabupaten Kuansing, Riau, Minggu (9/9). Pemain Sumut yang absen melawan Jatim pada partai pamungkas babak penyisihan Grup B PON 2012 nanti adalah winger kiri Muhammad Irfan dan playmaker Aidun Sastra Utami. Irfan diganjar kartu merah langsung menit 53 saat Sumut

bermain 0-0 dengan Jawa Barat, Sabtu (8/9) malam, sedangkan Aidun kena hukuman akumulasi dua kartu kuning. “Irfan mesti absen tiga pertandingan, Aidun hanya satu partai. Karena pertandingan nanti ibaratkan final bagi kita, maka kehilangan mereka akan sangat memengaruhi permainan tim,” papar Rudi. Menyusul kemenangan 6-1 Jawa Timur atas Gorontalo, Sumut memang tak boleh kalah dalam laga nanti. Apalagi menurut Rudi, Jabar bakal mampu mengatasi Gorontalo pada penampilan terakhirnya di Grup B. “Hasil seri memang sudah cukupuntukmemastikanlangkah ke babak 6 Besar. Tapi kita tetap akan bermain ngotot untuk

Pebalap Sumut Antusias

Constantin menambahkan panpel berencana membatasi jumlah peserta. “Karena balapan hanya digelar satu hari, kita harus mengantisipasi segala kemungkinan termasuk soal jumlah peserta,” tambahnya sembari tak lupa berterima kasih kepada semua pihak dan spontor yang mendukung, termasuk Ketua Pengprov IMI Sumut Ijeck dan Gus Irawan Pasaribu. Constantin menyatakan optimis dragster andal seperti Rossi G (Rantauprapat), Azharudin (KNPI Djaparis Medan), Ricci, Joey Sergei, Hildan S, dan Wahyudi yang menuai sukses di kejurnas tahun lalu bakal kembali turun. Dikatakan, informasi dan pendaftaran di Star FM Jl Sei Batangserangan No 35 Medan atau contact person Nandar di (081260572939). KelasKejurnasDragbikeyang diperlombakan adalah Matic 200cc, Sport 4T 200cc, Sport 2T 155cc, Bebek 4T 155cc, Bebek 2T 130cc, dan Bebek 4 Tak 130cc, dengan kelas tambahan Bebek 4T Std 115cc Open, Matic Std 125cc Open, sport 2 Tak TU 135 cc open serta kelas FFA 300cc. Untuk arena drag race memperlombakan kelas Sedan 1.400cc, Sedan 1.500cc. sedan 1.700cc, minibus 2.000cc, khusus sedan non VTEC 1.500 cc serta kelas city car 1.500cc. (m47)

Problem Catur Jawaban di halaman A2








1 A





PEKANBARU, Riau (Waspada): Atlet atetik putri Sumut, Nyai Prima Agita, dan tiga putra Edy Herianto, Arjun, serta Mari Yusuf Gulo akan mulai berburu medalipadaPONXVIII/2012Riau di Stadion Madya Rumbai, Pekanbaru, Senin (10/9) ini. Nyai langsung tampil di nomor final lari 5.000 m. Begitu juga dengan MariYusuf Gulo dan Arjun yang turt tampil di nomor final 5.000 m. Sedangkan Edy Herianto bertanding di babak penyisihan lari 800 m. Pelatih Atletik Sumut, Suryati, menyebutkan Sumut berkekuatan 11 atlet, masing-masing untuk putra, Arjun (5.000 m), Zulham Effendi (lontar martil), Edi Herianto (1.500 m/800 m), MRidwan(lontarmartil),MHusni Zamzami (tolak peluru), Dimas Arif Sumantri (tolak peluru/



mengaku sangat berat melangkah dan menendang,” beber Bambang, setelah Jatim menggasak Gorontalo 6-1, Sabtu (8/9). Sedangkan Pelatih Jatim, DanurDara,mengklaimskuadnya siap untuk mendulang kemenangan saat menghadapi Sapri Koto cs. “Kita mesti menang untuk memastikan lolos. Saya yakin anak-anak dapat mewujudkan-nya,” optimisme Danur. (m15)

Prakiraan Formasi Pemain Sumut 4-3-1-2: 33-Abdul Rohim; 12-M Hadi June Pratomo, 25-Agung Prasetyo, 3-Hardiantono, 6-Ronny Syahputra; 8Muhammad Solih, 24-Edy Syahputra, 23-Deni Setiawan; 7Saddam Rizal Nasution; 9-Sapri Koto, 10-Zulkifli Pelatih: Rudi Saari Jatim 4-2-3-1: Angga Saputro; 15-M Nur Sasmito, 23-Aris Adi Saputra, 21-Dani Saputra, 13-Achmad Abdul Basid; 4-Bima Ragil Satria, 6-Evan Dimas Darmono; 8-Agus Wahedi, 19-Dicky Prayoga, 22-Fandi Eko Utomo; 17-Wage Dwi Aryo Pelatih: Danur Dara


lempar cakram), Yogi Triono (3.000 m halang ringtang/1.500 m), Mari Yusuf Gulo (10.000 m/ maraton), Zulkarnaen Purba (400m gawang). Untuk putri, Elfi Alfriani (20 km jalan cepat), dan Nyai Prima Agita (5.000 m/3.000 m halang rintang). “Kita berharap Nyai dapat membuat kejutan. Andalan dia adalah nomor lari halang rintang 3.000 m. Pada PON XVII/2008, Nyai memperoleh medali perunggu,” ujar Suryati. “DemikianpuladenganMari Yusuf Gulo. Nomor spesialis Gulo lari maraton. Gulo yang berlatih di Guangzhou diharapkan meraih prestasi yang menggembirakan,” tambah Suryati sembari menambahkan pada PON 2008, Gulo memperoleh perunggu. Hari ini, perburuan medali juga akan dimulai dua karateka

Kalsel- Sumut Berbagi Angka MEDAN (Waspada):Tim futsal Sumut harus puas dengan raihan satu angka setelah ditahan Kalimantan Selatan (Kalsel) 0-0 pada penyisihan Grup B PON XVIII/2012 di GOR Tembilahan, Minggu (9/9). Hasil imbang ini membuat Sumut berada di peringkat kedua klasemen sementara dengan empat poin. Puncak klasemen dipegang Jabar yang unggul selisih gol dari Sumut. Kalsel sendiri berada di urutan ketiga dengan dua poin dan tuan Riau menghuni posisi juri kunci. “Banyak pelanggaran dilakukan pemain lawan diabaikan wasit. Hal ini sangat merugikan tim kami. Tapi anak-anak harus tetap optimis menghadapi Jabar pada laga besok (hari ini-red) untuk meraih hasil maksimal,” ujar Pelatih Tim Futsal Sumut, Alpinus. Laga antara Sumut dan Kalsel yang berlangsung pukul 17.00 WIB itu sempat terhenti akibat hujan lebat di Tembilahan. Atap GOR yang bocor mengakibatkan air hujan masuk ke lapangan. Alhasil, pertandingan babak kedua harus ditunda sekira satu jam. Pertandingan lainnya, Jawa Barat taklukkan Riau 8-5, Papua kalahkan Sumsel 6-5, dan Jateng menang tipis atas Gorontalo 43. (m42)


Putih melangkah, mematikan lawannya lima langkah. Jawaban di halaman A2.

untuk mengatasi setiap masalah teknis,” ujar Kamal. SedangkanManajerTimJawa Timur, Bambang P, mengatakan situasi menjalani laga hidup atau mati mesti dilakoni timnya pada partai pamungkas, akibat kekalahan mengejutkan 1-2 atas Jabar pada pertandingan perdana Grup B. “Hari ini anak-anak mainnya sangat bagus. Heran juga Mas. Waktu melawan Jabar, mereka

Atletik, Karate Sumut Mulai Buru Medali

Sambut Kejurnas Drag Bike MEDAN(Waspada):Antusias dragster Sumut dalam menghadapi event seri ketiga Kejurnas Drag Bike 2012 yang digelar di lintasan Apron Kelapa Sawit, Lanud Polonia, Medan, Minggu (16/9) nanti, sangat membanggakan. Ketua Panpel, Constantin Pasaribu, mengatakan calon peserta sejak sepekan terakhir terus berdatangan dan menghubungi sekretariat panpel untuk mendaftar atau mencari informasi tentang perlombaan. “Kita sangat gembira dengan animo para dragster, tapi hal ini memang sudah diprediksi mengingat gengsi event berlabel kejurnas yang tentu menarik minat peserta,”ucapConstantindidampingiKetuaCraneClubIndonesia (CCI) Chandra, Minggu (9/9). Constantin menyebutkan event bergengsi memperebutkan Piala Gus Irawan Pasaribu ini memperlombakan 10 kelas dragbike dengan enam di antaranya merupakan kelas kejurnas. Sementara kelompok drag race memperlombakan enam kelas. “Dengan level kejurnas, tentu pebalap-pebalap terbaik bakal datang, tidak hanya dari Sumut, tetapi juga provinsi lain di Sumatera. Bahkan, beberapa dragster asal Pulau Jawa rencananya juga akan tampil sekaligus membuat persaingan makin ketat,” ungkap

memburu kemenangan,” tekad mantan pelatih PSMS Medan tersebut. Rudi pun bakal mengubah formasi 1-4-4-2 yang selama ini diterapkannya menjadi 1-4-31-2. Posisi Irfan akan diisi Saddam Rizal Nasution, peran Aidun akan digantikan Deni Setiawan. Baik Saddam maupun Deni mengaku siap untuk mengemban tugas dimaksud. Setelah menjadi pemanis bangku cadangan dalam dua laga sebelumnya, Saddam dan Deni bahkan bertekad tampil maksimal untuk menjawab kepercayaan pelatih. Terpisah, Manajer Tim H Kamaluddin Harahap mengaku percaya trio pelatih Rudi Saari, Mardianto, dan Budiono punya kemampuan untuk menutupi absennyamotorlapangantengah Irfan dan Aidun. “Mereka sudah dua tahun lebih melatih anak-anak ini. Mereka pasti tahu solusinya dan memilikibanyakalternatifstrategi


Sumut pada nomor kumite di di GOR Tirta Buana Pekanbaru. Kedua karateka itu adalah M Helza Akbar (-84 kg putra) dan Charles Napitupuluh (+kg putra). Pelatih Tim Karate Sumut, Delfinus Rumahorbo, mengaku dua karatekanya sudah siap mengawali pertarungan. Menurutnya, M Helza dan Charles sudah menyatakan tekad untuk memberikan yang terbaik bagi Sumut. Di kelas -84 kg putra ini, kata Delfinus, saingan berat datang dari karateka Hendro (Sulsel). Kemudian Charles Napitupulu mendapattantangandarikarateka DKI Jakarta, Caisar Hutagalung. Kendati begitu, dia optimis dua anak didiknya bisa mencapai babak final. “Sekarang persaingan cukup ketat, tapi kita harus optimis. Apalagi kedua karateka kita ini sudah melakukan persiapan.” ujarnya. Pada PON XVIII Riau 2012 ini, Sumut berusaha mempertahankan tradisi medali emas karena kualitas karatekanya sudah teruji pada tiga kali penyelenggaraan PON sebelumnya. Sumut juga selalu unggul dalam event karate bergengsi Piala Kasad, dan Doni Dharmawan pernah menunjukkan prestasi membanggakan merebut Piala Kasad dengan mengalahkan karateka terbaik Indonesia, Umar Syarif. Tim karate Sumut terdiri atas Jintar Simanjuntak, Donny Dharmawan, Dedi Irwansyah, Dodi, M Helza Akbar, Charles, Srunita, Nova Sinaga, Tantri Widyasari, Indah Mogia Angkat, dan Halimah. (m18) MENDATAR 1. Keluarga; Dinasti. 5. Benda atau cairan untuk mewangikan. 6. Kain yang bergambar-gambar indah, bercorak biru atau kuning pada dasar merah. 10. Pohon yang bijinya mengandung lemak nabati sebagai minyak goreng (dipterocarpaceae). 12. Keturunan raja; Keluarga raja; Bangsa. 13. Pesan (amat) gaib. 16. Lihat dengan mata batin; Melamun. 17. Dua tiang yang berpalang sebagai tempat sasaran memasukkan bola. 18. Perahu besar untuk di lautan buatan negeri China; Jung. 19. Alat yang terbuat dari bambu atau kayu, digunakan untuk meletakkan kain (mori) yang akan dibatik (Jawa).

KUANSING, Riau (Waspada): Manajer Tim Sepakbola Sumut, H Kamaluddin Harahap (foto), menjanjikan bonus langsung kepada Sapri Koto cs jika mampu melewati hadangan Jawa Timur pada partai pamungkas babak penyisihan Grup B PON 2012 di Riau. “Jelas ada bonusnya. Saya sangat menghargai perjuangan yang telah diperlihatkan tim kita sejak dari masa pelatihan sampai memasuki arena PON ini,” kata Kamal di Teluk Kuantan, Kabupaten Kuantan Singingi, Minggu (9/9). Apalagi menurutnya, laga Sumut kontra Jatim di Stadion Sport Centre, Senin (10/9) sore ini, ibaratkan final bagi kedua tim petarung. Juara bertahan Jatim mesti menang untuk memastikan tiket lolos ke babak 6 Besar. Sumut besutan trio pelatih Rudi Saari, Mardianto, dan Budiono, hanya membutuhkan hasil seri untuk mengamankan langkah ke Pekanbaru. “Kalaumenangbonusnya20jutarupiah,imbang 10 juta rupiah. Kita harapkan Sapri Koto dan kawankawan bisa menang, supaya menjadi juara Grup B,” tutur Kamal. Wakil Ketua DPRD Sumut itu juga berjanji menurunkan sekaligus memfasilitasi ratusan suporter Sumut, guna mengangkat semangat juang Hardiantono cs. Fasilitas tersebut di antaranya kaus dan konsumsi bagi pendukung yang datang ke stadion. “Karena laga nanti sangat menentukan, pasti akan ada perang suporter. Pendukung Jatim dari dua partai sebelumnya kelihatan sangat militan, kita harapkan pendukung Sumut dapat mengimbangi mereka,” ucap politisi PAN tersebut. Bahkan menurut Kamal, Ketua DPRD Sumut H Saleh Bangun, Sekretaris Dewan H Randiman

Waspada/Jonny Ramadhan Silalahi Jadwal Senin (10/9): Sumut vs Jawa Timur Jabar vs Gorontalo

16:00 16:00

Klasemen Grup B Sumut Jabar Jatim Gorontalo

2 2 2 2

1 1 1 0

1 1 0 0

0 0 1 2

(2-1) (2-1) (6-1) (2-8)

4 4 3 0

Tarigan beserta beberapa pengurus KONI Sumut serta KONI Medan, segera datang keTeluk Kuantan untuk mendukung perjuangan pasukan Rudi Saari. (m15)

Pebiliar Sumut Tembus 8 Besar PEKANBARU (Waspada): Pebiliar Sumut, Jaka Kurniawan Ginting, yang turun pada divisi snooker nomor english billiard single putra melaju ke babak 8 Besar, setelah meraih dua kemenangan pada hari pertama cabang biliar PON XVIII di Biliar Center Pekanbaru, Minggu (9/9). Di pertandingan pertama, Jaka mengalahkan Haris Fadillah (Kalsel) 2-0 (100-50, 100-35). Di laga kedua menaklukkan Sumarno (Jateng) 2-1 (10059, 57-100, 100-63). Pebiliar andalan Sumut lainnya yang bertanding di divisi pool nomor 8 ball single putra, M Fadli, lolos melaju ke babak 32 Besar. Fadli sempat kalah di pertandingan pertama saat menghadapi Iwan Saga (Aceh) 5-7. Beruntung sistem pertandingan menggunakan double elimination sehingga Fadli memiliki kesempatan untuk kembali bermain. Laga kedua, Fadli menunjukkan tajinya dengan mengalahkan pebiliarYogyakarta, Dedi Handoko, dengan skor telak 7-0, sebelum akhirnya menaklukkan Yosi Prakos (Maluku) 7-6 pada laga ketiga. Atlet biliar Sumut lainnya tampil di hari pertama adalah Stanza Purba yang harus tersingir dengan menelan dua kekalahan. Pada laga pertama Stanza kalah atas Rahmatsyah (Kalsel) 6-7 dan ditaklukkan Imron (Kepri) dengan skor yang sama pada game keduanya. Di bagian putri, Lionie AmanaWattimena yang juga tampil di 8 ball single melaju ke babak 16 Besar seusai mengalahkan peraih medali emas Kejurnas Pra PON 2011 di Medan, Sukma (Jateng), 5-4. Di pertandingan pertama, Oni mendapat bye. Di lain pihak, Rini Nasution harus mengakui keunggulan pebiliar putri nomor satu Indonesia, Angeline. Melawan atlet DKI Jakarta itu, Rini

Waspada/Arianda Tanjung

PEBILIAR Sumut, M Fadli, berhasil mengalahkan Dedi Handoko (Yogyakarta) sekaligus melaju ke babak 23 Besar PON XVIII/2012 di Pekanbaru, Minggu (9/9). tumbang 2-5. Sebelumnya, Rini menang atas Enda (Yogyakarta) 5-4. (m18)

Sumut Belum Ada Kejutan PEKANBARU ( Waspada): Menjelang pembukaan PON XVIII/2012, Selasa (11/9) besok, sejumlah cabang olahraga sudah mempertandingkan nomor final. Namun sayangnya atlet-atlet Sumut belum ada yang membuat kejutan. Begitupun, peluang Sumut mendulang medali masih terbuka lebar. Sebab nomor-nomor andalan Sumut khususnya pada olahraga bela diri belum bertanding. Demikian laporan yang dihimpun wartawan Waspada Setia Budi Siregar dari Pekanbaru, Minggu (9/9). Beberapa cabang olahraga masih babak kualifikasi. Begitu juga cabang-cabang olahraga unggulan belum bertanding. Dari cabang renang yang berlangsung di Kompleks Olahraga Rumbai, Minggu,atletrenangputriAnnesEnjeltaPutriSiregar yang tampil di nomor 200 m gaya punggung hanya berada di posisi keenam. Annes masih bertanding pada nomor 100 m gaya punggung, 400 m gaya bebas, dan 800 m gaya bebas. Cabang renang Sumut mengirimkan lima atlet termasuk perenang andalan Indra Gunawan pada nomor 100 m gaya dada, 200 m gaya dada, 200 m gaya ganti perorangan, dan 400 m gaya bebas. Bulutangkis Di GOR Gelanggang Remaja, regu bulutangkis putri Sumut gagal ke semifinal setelah mengalami dua kali kekalahan. Pada pertandingan pertama, tim beregu putri Sumut menelan kekalahan 14atasJawaTengahdandipertandingankeduatakluk MENURUN 1. Pedang pendek yang bilahnya makin ke ujung makin lebar. 2. Kediaman raja; Istana; Bukan uang. 3. Awang-awang; Sarang labalaba; Kotoran di langit-langit rumah; Tumbuhan untuk obat kurap (cordyline fruticosa). 4. Bangsa utama (mulia). 5. Orang yang mempunyai keahlian dengan ilmu gaib, misalnya penjinak ular dan penolak hujan. 7. Empat unsur gabungan badan pemerintah meliputi kepolisian, kejaksaan, kehakiman dan Bakorstanas. 8. Berbau sedap; Harum. 9. Tumbuhan paku atau pakis (gleichemia linearis). 11. Pintu (gerbang); Pohon (cinnamomum); Ikan darat (pangasius micronemus). 14. Kerabu; Subang kecil; Siput mutiara. 15. Oleng (tentang perahu); Tidak tetap; Rawak; Rambang.

dari Jawa Barat 0-5. Satu pertandingan sisa melawan tim Kepri yang akan dimainkan Senin (10/9) ini sudah tidak menentukan lagi bagi Sumut. Menghadapi Jawa Tengah, Sumut menurunkan Milicent, Arindah Sari,YuliaYosephine Susanto (tunggal) dan Anneke Feinya Agustine/Rizky Amalia, Afni Fadilah/Rini Andriani (ganda). Tunggal putri pertama Sumut Milicent kalah 17-21, 21-19, 15-21 atas Maria Febe Kusumastuti. Sumut sendiri sempat menyamakan kedudukan 1-1 melalui ganda Anneke Feinya Agustine/Rizky Amalia yang mengalahkan ganda Jateng Debby Susanto-Melati Deava Octaviani (21-12, 21-13). Namun kembali Sumut ketinggalan 2-1 setelah tunggal kedua Arindah Sari kalah dari Anna Rovita 12-21,12-21.DemikianjugagandakeduaputriSumut Afni Fadilah/Rini Andriani, kalah atas ganda putri Jateng Annisa Saufika/Gloria Emmanuella 12-21, 7-21. Demikian juga dengan tungga ketiga putri Sumut, Yulia Yosephine Susanto, gagal mempersembahkanpoinsetelahdikalahkanRosaria Yusfin 12-21, 10-21. Ketua Harian PBSI Sumut, Muktar Aritonang, yang turut menyaksikan pertandingan tersebut, mengatakan sulit mengalahkan dominasi pebulutangkis Jawa seperti Jawa Tengah dan Jawa Barat. Meski demikian, Sumutsendiritidaklangsung menyerah begitu saja. Buktinya melawan Jateng, Sumut sempat mencuri poin dari pasangan Anneke/Rizky Amalia. (m18)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sangat mudah (**), bisa diselesaikan dalam waktu tak sampai tujuh menit. Jawabannya lihat di halaman A2 kolom 1.


4 6 1


5 4 2 4 1 7 1 2 3 6 2 6 7 4 7

7 6 8 6 9 2 5 3 7 9 4 8 5 6 8

9 7


3 4 7 2 3 1 4 *206



WASPADA Senin 10 September 2012


SEORANG kru televisi berlari mencari tempat berteduh dari badai hujan yang melanda New York, sehingga mengganggu jadwal AS Terbuka, Minggu (9/9).

Tiga Laga Final Mundur


Pembuktian Hamilton MONZA, Italia (Waspada): Driver tim McLaren-Mercedes, Lewis Hamilton (foto), berhasil memanfaatkan posisi pole untuk merebut gelar juara balap mobil Formula 1 GP Italia di Sirkuit Monza, Minggu (9/9) malam Hamilton menyelesaikan balapan 53 putaran dengan catatan waktu 1 jam 19 menit 41,221 detik. Gelar juara di Monza adalahyangpertamadalamkarier pebalap Inggris itu sekaligus membuka peluang dalam perebutan gelar juara dunia, di mana dirinya kini hanya terpaut 47 poin dari Fernando Alonso (Ferrari) yang finish ketiga. Sergio Perez dari tim Sauber tampil impresif dengan merebut posisi runner-up dengan waktu terpaut 4,3 detik, disusul andalan Alonso. Felippe Massa, juga dari

Ferrari, finish keempat diikuti Kimi Raikkonen (Lotus). Sebastian Vettel harus gagal finish saat balapan tinggal menyisakan lima putaran lagi ketika berada di posisi keenam. Sementara, balapan juga hanya berlangsung 33 putaran bagi Jenson Button, pemenang seri sebelumnya di GP Belgia pekan lalu. Di Monza, Button harus memarkirkanmobilnyadisisitrek karena bermasalah pada sistem bahan bakar. Bersama keduanya, MarkWebber(RedBull)jugagagal finish sehingga melengkapi

penderitaan Red Bull. Hamilton berhasil mempertahankan posisinya selepas start, dengan Massa naik satu tingkat ke urutan kedua menggeser Button. Alonso, start dariposisi 10, secara perlahan berhasil memperbaikiposisinyadansudah masuk 5 Besar. Hamilton pun membalap dengan sempurna untuk mempertahankan jarak hingga garis finish memastikan kemenangan keduanya musim ini. Selepas GP Italia, Alonso masih memimpin peringkat kejuaraan dunia dengan total raihan179angkadisusulHamilton (142) yang naik ke urutan kedua. Raikkonen, finish kelima, juga naik ke posisi tiga dengan raihan 141 poin. Di belakang mereka ada Vettel(140)danWebber(133)yang harus puas gagal menambah angka. (m47/ap)

Pasang Iklan Telp. 4528431 HP. 081370328259 Email: Waspada/Yuslan Kisra

Pimpinan Tim Dumasari INK SS Honda PF One-ORCA, Aldi Bosar Harahap (tengah pakai topi), didampingi kroser andalannya Agi Agasi bersama kru dan lainnya tetap optimis raih gelar juara nasional.

Kroser Sumut Podium Di Tegal TEGAL (Waspada): Ambisi kroser tim Dumasari INK SS Honda PF One-ORCA, Agi Agasi, untuk naik podium di seri keempat terpenuhi, setelah finish ketiga pada race pertama nomor bergengsi MX-2 Nasional, IRC Motorcross International Championship Round 4-2012 di Sirkuit Martoloyo, Tegal, Minggu (9/9). Tampilmeyakinkansejakawal lomba, kroser andalan tim yang berbasis di Padangsidimpuan, Sumut tersebut mampu menunjukkan kelasnya sebagai pebalap papanatasnasional.Meskisempat tercecer di posisi kelima, Agi yang mengenakan motor Honda mampu mengejar hingga akhirnya menempati posisi ketiga, di belakang Aldi Lazaroni (Yogyakarta) dan Alexander Wiguna (Sulut)yangakhirnya menempati posisi pertama. Pada race kedua, Agi gagal mengulang sukses menyusul insidenyangdialaminyaditikungan pertama beberapa saat lepas dari garis star. Agi tidak mampu menghindari senggolan yang membuat ia terjatuh bersama empat kroser lain. Parahnya, karena motor andalan Dumasari ini tertindih di posisi bawah, sehingga ia pun tertinggaldanmeneruskanlomba dariposisijurukunci.Meskibegitu, ia masih bisa menyelesaikan lomba dengan finish di urutan kelima. “Bad day buat saya. Mestinya saya masih bisa kembali naik podium. Tapi insiden di tikungan pertama membuat saya kesulitan mengejar,” ujar Agi kepada Waspada di Pedok Dumasari seusai lomba. “Saya berharap bisa memperbaikinya pada seri berikut.

Dengan begitu, harapan meraih gelar juara nasional bisa terpenuhi,” lanjut Agi. Saat ini, Agi menempati peringkat ketiga bersama Farhan Hendro (DKI Jakarta) karena sama-sama mengemas 36 poin. Tempat kedua diduduki Andre Sondakh yang sudah membukukan 43 poin dan Aldi Lazaroni (Yogyakarta) di peringkat pertama dengan 44 poin. (yuslan)

Hasil GP Italia: Lewis Hamilton Sergio Perez Fernando Alonso Felipe Massa Kimi Raikkonen Michael Schumacher Nico Rosberg Paul di Resta Kamui Kobayashi Bruno Senna Pastor Maldonado Daniel Ricciardo Jerome d’Ambrosio Heikki Kovalainen Vitaly Petrov Charles Pic Timo Glock Pedro de la Rosa Narain Karthikeyan

(Inggris/McLaren) 1:19:41.221 (Mexico/Sauber) + 04.3 detik (Spanyol/Ferrari) 20.5 (Brazil/Ferrari) 29.6 (Finlandia/Lotus) 0:30.8 (Jerman/Mercedes) 31.2 (Jerman/Mercedes) 33.5 (Inggris/Force India) 41.0 (Jepang/Sauber) 43.8 (Brazil/Williams) 0:48.1 (Venezuela/Williams) 0:48.6 (Australia/Toro Rosso) 0:50.3 (Belgia/Lotus) 1:15.8 (Finlandia/Caterham) 1 lap (Rusia/Caterham) 1 lap (Prancis/Marussia) 1 lap (Jerman/Marussia) 1 lap (Spanyol/HRT) 1 lap (India/HRT) 1 lap

NEWYORK, AS (Waspada): Panitia ASTerbuka 2012 memutuskan unuk menggeser jadwal tiga laga final terkait badai yang menghantam New York. Final tunggal dan ganda putri yang sedianya dihelat Minggu (9/9) diundur dan final tunggal putra dijadwalkan berlangsung Senin (10/9). Final tunggal putri sendiri akan mempertemukan Victoria Azarenka (Belarus) dengan petenis tuan rumah, Serena Williams. Di ganda putri, partai puncak akan memainkan laga antara Andrea Hlavackova/ Lucie Hradecka (Rep Ceko) dengan Sara Errani/ Roberta Vinci (Italia). Di tunggal putra saat ini baru Andy Murray yang meraih tiket partai puncak. Juara Olimpiade 2012 asal Inggris Raya itu menaklukkan Tomas Berdych (Rep Ceko) 5-7, 6-2, 6-1, 9-7, Minggu (9/9). Partai semifinal tunggal putra lainnya Novak Djokovic (Serbia) kontra David Ferrer (Spanyol). Tapi duel keduanya terpaksa dihentikan ditengah jalan karena cuaca buruk dan akan dimainkan kembali saat berita ini diturunkan. Sebelum dihentikan, Ferrer sudah unggul 5-2 atas Djokovic

di set pembuka. Murray melangkah ke final sekaligus memperbesar peluang merebut trofi jawara dengan menyudahi perlawanan sengit Berdych. Sebelumnya, pertandingan juga sempat tertunda sekitar satu jam karena badai. Bahkan saat laga dimainkan kedua petenis dibuat kesulitan menaklukkan laju angin. “Bola bergerak lalu berhenti sementara sejumlah kursi melayang. Sangat sulit karena di saat bersamaan saya harus fokus,” kata Murray. Murray, peraih medali emas Olimpiade 2012 di London, tengah berusaha menjadi pemain asal Inggris Raya pertama yang meraih gelar juara grand slam setelah terakhir kali Fred Perry melakukannya pada 1936 silam. Peluang Murray untuk menjadi juara di Flushing Meadows pun cukup terbuka. Menghadapi Ferrer, Murray memiliki rekor kemenangan 6-5 dan Djokovic tertinggal 6-8. Namun grafik permainan Murray tahun ini menunjukkan peningkatan yang signifikan, sedangkanDjokovictidaktampilcemerlangseperti tahun lalu. (m33/ap)

Derita Kedua Garuda Muda JAKARTA (Waspada):Tim nasional U-22 harus mengalami kekalahan 0-1 dari Malaysia U-22 dalam ajang SCTV Cup 2012 di Stadion Utama Gelora Bung Karno Senayan, Jakarta, Minggu (9/9). Gol tunggal kemenangan Malaysia dicetak Reuben Thayaparan. Garuda Muda sebenarnya sempat memiliki beberapapeluang.Namuntidaktenangnyapemain depan dan penyelesaian akhir yang kurang bak membuat tim besutan Aji Santoso gagal menciptakan gol. Malaysia sendiri sukses memecah kebuntuan di menit 42 kala tendangan keras jarak jauh Reuben Thayaparan gagal diantisipasi oleh Aji Saka. Indonesiaberusahamembalasdansempatmendapat

peluang di menit 50. Namun kemelut di depan kotak terlarang gagal dimanfaatkan oleh Hendra Bayauw. Empat menit kemudian, Agung Supriyanto membuang peluang emas di depan gawang. Salah satu peluang emas terbaik adalah tendangan bebas Fastabiqul Khoirot jelang laga berakhir. Sayang, eksekusi Khoirot masih terlalu tinggi di atas mistar gawang Malaysia. Hingga akhir laga, tidak ada gol tercipta dan skor 1-0 bertahan untuk keunggulan Malaysia. Alhasil, skuad Harimau Muda pun berhak atas trofi SCTV Cup. Hasil ini merupakan kekalahan kedua Timnas U-22 dari Malaysia. Sebelumnya, Garuda Muda dicukur enam gol tanpa balas dalam laga persahabatan pada 27 Juli lalu. (m33/ini)

Sumatera Utara

WASPADA Senin 10 September 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:26 12:39 12:26 12:33 12:33 12:30 12:26 12:22 12:29 12:28

‘Ashar 15:32 15:42 15:33 15:37 15:38 15:39 15:33 15:29 15:35 15:33

Magrib 18:31 18:46 18:32 18:40 18:39 18:34 18:32 18:27 18:34 18:34



Shubuh Syuruq


19:40 19:55 19:41 19:49 19:48 19:43 19:40 19:36 19:43 19:43

04:53 05:05 04:54 05:00 05:00 04:58 04:54 04:50 04:56 04:55

05:03 05:15 05:04 05:10 05:10 05:08 05:04 05:00 05:06 05:05

L.Seumawe 12:32 L. Pakam 12:25 Sei Rampah12:24 Meulaboh 12:36 P.Sidimpuan12:23 P. Siantar 12:24 Balige 12:24 R. Prapat 12:21 Sabang 12:39 Pandan 12:25

06:18 06:30 06:18 06:25 06:25 06:23 06:19 06:14 06:21 06:20

Zhuhur ‘Ashar 15:35 15:31 15:30 15:41 15:33 15:31 15:32 15:29 15:41 15:34





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:38 18:31 18:30 18:42 18:28 18:29 18:29 18:26 18:46 18:30

19:47 19:39 19:38 19:50 19:36 19:38 19:38 19:34 19:55 19:39

04:58 04:52 04:51 05:03 04:52 04:52 04:52 04:49 05:05 04:53

05:08 05:02 05:01 05:13 05:02 05:02 05:02 04:59 05:15 05:03

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:25 12:27 12:36 12:29 12:26 12:33 12:21 12:31 12:24 12:24

18:30 18:32 18:43 18:34 18:32 18:39 18:27 18:37 18:29 18:29

19:39 19:41 19:52 19:43 19:41 19:48 19:35 19:46 19:38 19:38

04:53 04:54 05:03 04:57 04:53 05:00 04:49 04:59 04:53 04:51

05:03 05:04 05:13 05:07 05:03 05:10 04:59 05:09 05:03 04:01

Panyabungan 12:22 Teluk Dalam12:29 Salak 12:27 Limapuluh 12:23 Parapat 12:24 GunungTua 12:22 Sibuhuan 12:21 Lhoksukon 12:31 D.Sanggul 12:25 Kotapinang 12:20 AekKanopan 12:22

06:23 06:17 06:16 06:27 06:16 06:16 06:17 06:14 06:30 06:18

15:34 15:34 15:40 15:37 15:32 15:38 15:29 15:38 15:33 15:30

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:18 06:19 06:28 06:22 06:18 06:24 06:14 06:24 06:17 06:16

Zhuhur ‘Ashar 15:32 15:40 15:35 15:29 15:32 15:31 15:31 15:35 15:34 15:29 15:29




Shubuh Syuruq

18:26 18:33 18:32 18:28 18:30 18:26 18:26 18:38 18:30 18:25 18:27

19:35 19:42 19:41 19:37 19:38 19:35 19:34 19:46 19:39 19:33 19:35

04:51 05:58 04:55 04:50 04:52 04:50 04:50 04:58 04:53 04:48 04:49

05:01 05:08 05:05 05:00 05:02 05:00 05:00 05:08 05:03 04:58 04:59

06:15 06:22 06:19 06:15 06:17 06:15 06:15 06:22 06:18 06:13 06:14

Perampok Bersenpi Bobol Kantor BPN Sergai SEIRAMPAH (Waspada): Tujuh kawanan perampok bersenjata api jenis pistol dan golok (parang) membobol dan menyatroni kantor Badan Pertanahan Nasional, Kab. Serdang Bedagai (BPN Sergai) di jalan negara, Dusun XV, Desa Firdaus, Kec. Sei Rampah, Minggu (9/9) dinihari sekira pukul 02:00. Setelah membobol pintu kawanan perampok langsung menyekap seorang penjaga kantor, namun dari aksi yang berlangsung hampir satu jam itu kawanan penjahat ini tidak mengambil atau pun membawa barangmaupunberkasberharga,

walau pun hampir seluruh ruangan kantor BPN Sergai diacakacak. Pelaku hanya mengambil handphone dan dompet penjaga yang berisi STNK sepedamotor dan uang tunai Rp800 ribu. Penjaga malam kantor BPN Sergai, Paiman, 55, yang tinggal

di samping kantor menuturkan kepada Waspada di Mapolres Sergaisaatmembuatpengaduan, sebelum peristiwa terjadi dia tengah berada di ruang belakang kantor.“Tiba-tiba ada suara pintu depan dibuka paksa. Setelah saya ke ruang depan, 7 orang tak dikenal sudah berada di dalam langsungmenghampirisembarimengancam saya,” ungkap Paiman. Dua pelaku mengancam menggunakan pistol dan dua lagi menggunakan parang, setelah itu menutup mulut hingga matanya dengan lakban. Begitu juga tangan dan kaki, selain

dilakban juga diikat dengan kain sarung yang dipakainya. Selanjutnya pelaku mengobrakabrikruangan,tapisebelum pergi salah seorang pelaku mengambil handphone dan dompet berisi uang Rp800 ribu berikut STNK sepedamotor miliknya. Paimin yang berhasil membuka ikatan kakinya berlari ke luar kantor dan minta pertolongan istrinya, Siti Fatmah, 46, untuk membukakan lakban yang membekap mulut dan mengikat tangannya, kemudian melaporkan peristiwa itu ke Mapolres

Sergai. KTU BPN Sergai, Rosdiana mendampingi penjaga kantor Paimin ketika dikonfirmasi mengatakan, walau sebagian besar rauangan kantor diacak-acak, namuntidakadabarangmaupun berkas berharga yang hilang. Sementara Kapolres Sergai, AKBP Arif Budiman, S.Ik, MH melalui Wakapolres Sergai, Kompol Zahrie membenarkan peristiwa perampokan itu, Tengah dilakukan penyelidikan perkara, termasuk melakukan olah TKP dan minta keterangan saksi. (c03)

Isu Penumbangan Sawit, PTPN 2 Amankan Emplasmen Kualanamu DELISERDANG (Waspada): Pihak PTPN 2 Tanjungmorawa melalui tim gabungan mengamankan kebun emplasmen Kualanamumenyusuladanya isu penumbangan tanaman sawit di lahan perkebunan wilayah, Kec. Beringin, Deliserdang. PantauanWaspada, Minggu (9/9), iringan dua truk colt diesel putih, satu patroli Samapta Polres Deliserdang dan satu mobil double cabin milik kesatuan TNI serta dua double cabin milik petinggi PTPN 2 kebun Tanjunggarbus merapat di pasar 2 Desa Emplasmen Kualanamu, Kec. Beringin, tepatnya di Jalan Protokol Lubukpakam-Pantailabu. Puluhanorangbaikdaripihak PTPN2danaparattampakduduk di dua gubuk yang di atas lahan perkebunan tersebut. “Kami hanya menjalankan perintah atasan untuk mengamankan areal perkebunan sawit ini. Selain itu kami tidak tahu, ya untuk menjaga hal yang tak diinginkan,” ujar salah satu security PTPN 2 berpakaian dinas. Namun, Syarif, warga Emplasmen Kualanamu menyebutkan, tim gabungan PTPN 2 berada di lahan itu untuk mencegah adanya isu penumbangan sawit di lahan tersebut. “Kabarnya ada kelompok penggarap dari luar

akan menumbangkan sawit di sini. Nah, saya sebagai pensiunan amat menyayangkan isu ini,” kata mantanKepalaDesaEmplasmen Kualanamu ini didampingi rekannya Pairun. Menurut Syarif, kondisi ini tercipta karena belum tuntasnya nota kesepahaman (Memorandum of Understanding/MoU) antara pihak PTPN 2 dengan Forum Rakyat Bersatu (FRB) Sumut, 14 Agustus lalu. “Saya mohon pihak terkait harus bersinergi dan kembali duduk bersama untuk menuntaskan sengketa lahan ini sesuai kesepakatan yang sudah ada,” sebutnya menyarankan. Syarif khawatir, jika dibiarkan berlarut akan terjadi chaos (konflik) antar penggarap. “Kita lihat berbagai kasus yang terjadi belakangan ini, antar penggarap bentrok.Nah,jangansampaimerembet dengan ketidakpercayaan masyarakat kepada pemerintah, khususnya pihak terkait, dan bahayanyapihakketigayangakan memanfaatkannya,” sebutnya. Syarif menambahkan, pihak PTPN 2 jelas melarang penumbangan sawit di atas lahannya sesuai kesepakatan. “Namun mereka tidak melarang warga atau penggarap memanfaatkan lahan PTPN 2, asal tak merusak

Warga Sei Bilah P. Brandan Pertanyakan CSR Perusahaan P.BRANDAN (Waspada):Warga Sei Bilah Kec. Sei Lepan, Pangkalan Brandan, Kab. Langkat mempertanyakan Corporate Social Responsibility (CSR) perusahaan minyak dan gas yang beroperasi beberapa tahun belakangan. Hal tersebut dikatakan H. Ibrahim Azmi, Ucok Spy dan Budi Hermanto Nas mewakili warga, Minggu (9/9). Ucok yang juga menjabat LPM di Kelurahan Sei Bilah menyebutkan, beroperasinya beberapa perusahaan asing, swasta dan BUMN seharusnya memberikan nilai plus. Sudah bukan rahasia, penyaluran bantuan program CSR masih bersifat seremoni. “Ini berbahaya kalau tidak segera ditangani, bisa memicu kemarahan masyarakat,” ujar Ucok. Sebab menimbulkan kecemburuan sosial. Pemuka masyarakat Pangkalan Brandan, H. Ibrahim Azmi dan Pemerhati Migas Wilayah Teluk Aru, Budi Hermanto Nas, menilai manajemen perusahaan yang beroperasional harus berperan aktif “menstimulasi” peluang usaha melalui kegiatan eksplorasi, mempersembahkan berbagai program peduli dengan memprioritaskan tenaga kerja lokal, membangun fasilitas kesehatan terjangkau, dan menanamkan pendidikan yang berbudaya. Budi Hermanto Nas yang juga Humas KONI, Sei Lepan, Pangkalan Brandan meminta keberadaan operasional perusahaan dalam penyaluran program CSR yang merupakan tanggungjawab sosial setiap perusahaan kepada warga Sei Bilah, harusnya dapat disalurkan untuk dimanfaatkan masyarakat sekitar perusahaan.(a04/c01)

Warga Sunggal Kritis Dihakimi Massa Di Binjai BINJAI (Waspada): YHYL, 45, warga Jalan Pelita Timur Tanjung Rejo Medan Sunggal, kritis dihakimi massa di daerah Danau Lau Tawar Lk IV Kelurahan Sumber Mulio Rejo. Sementara temannya meloloskan diri dari kepungan warga. Keterangan dikumpulkan ,YHYL bersama temannya H mengintip rumah Daurma, 30, yang kebetulan terbangun. Dia pun mengintip dari dalam rumah dan dilihatnya kedua tersangka sedang mengintip bagian samping rumahnya. Karena curiga ia ke luar. Keduatersangkayangmerasaterperogoklangsungmemukulkepala korban dengan linggis. Korban pun berteriak minta tolong sehingga mengundang perhatian warga. AkhirnyaYHYL ditangkap dan diikat dipohonkelapa,laludihakimihinggakritis.Sedangkantemannyakabur. Kanit Polsek Binjai Timur Ipda Rudi Lapian ketika dikomirmasi membenarkan kejadian itu.(a05)

tanaman sawit,” ujar Syarif yang menyarankan pihak terkait agar mensosialisasikan kesepakatan tersebut kepada penggarap. Menurut referensiWaspada peroleh kemarin, MoU sengketa lahan antara PTPN 2 dan FRB Sumut berlaku enam bulan dilengkapi 10 pasal. Kesepakatan bernomor II.0/MoU/04/VIIII/2012 dan No/B/DPP FRB-SU/VIII/ 2012 itu lahir untuk menyelesaikan sengketa pertanahan di lahanHakGunaUsaha(HGU)dan bekasHGUPTPN2yang lamatak juga tuntas sesuai pasal 2. Dalam Pasal 7 jelas berbunyi lahan yang dikuasai pihak PTPN 2 tidak boleh diduduki oleh pihak kedua (FRB), sebaliknya lahan yang diduduki pihak kedua tidak

boleh diokupsi pihak pertama (PTPN 2). FRB dalam MoU tersebut terdiri atas kelompok tani berasal dari kebun Deliserdang, Langkat dan Binjai. Rincinya, di Deliserdang 60 Koptan, Langkat 40 Koptan dan Binjai 5 Koptan. Jual Patok Pairun, warga Emplasmen Kualanamu lainnya mengaku beberapa hari terakhir ada orang tak dikenal menjajakan patok untuklahantanah.“NilainyaRp50 ribu per patok,” ungkap Pairun yang menolak membeli. Pairun, pensiunan karyawan PTPN 2 ini dengan polos mengatakan hanya mengikuti aturan sesuai kesepakatan. “Saya selalu mengikuti perkembangan soal pelepasan lahan ini, ya sebagai

PKB, PDS, PPRN, PPN, PKBIB, PPP dan ditutup Partai Barnas. Namun, ada pula parpol yang memiliki wakil di DPRD kota Tebingtinggi, tidak mendaftar . Misalnya, Partai Republikan Ditambahkan, proses pendaftaran ke KPUD Kota Tebingtinggi saat ini sangat mudah. Parpol cukup memasukkan berkas kartu tanda anggota (KTA) dengan persentase seperseribu dari total jumlah penduduk yang ada. “Kalau di Tebingtinggi jumlahnya hanya 157 KTA saja, itu sudah bisa,” terang dia Setelah terdaftar, berikutnya akan dilakukan verifikasi faktual atas Parpol yang mendaftar. Proses itu sedikit agak lebih rumit, misalnya verifikasi status sekretariat Parpol, rekening Parpol,

pensiunan saya jelas mengikuti aturanyangadapadapihakPTPN 2 dengan pihak terkait lainnya. Mudah-mudahan nasib perkebunan di sini tidak seperti di tempat lain,” sebutnya. Langsung Bertindak Kepala Urusan Hubungan Masyarakat (Kaur Humas) PTPN 2, Rahmuddin yang dihubungi lewat telefon selular kemarin sore mengaku belum mendapat informasi soal turunnya pengaman dari pihaknya di kebun Emplasmen Kualanamu. “Begitupunsayapastikantim keamanan PTPN 2 selalu cepat bertindak jika ada kejadian atau mencegah sebelum kejadian. Pokoknya langsung bertindak,” tegasnya Rahmuddin. (m16)

kepengurusandikecamatanserta persentase kepengurusan yang ada. “Hal penting soal keterwakilan 30 persen kaum perempuan. Harus ada 30 persen perempuan dalam struktur Parpol di semua jenjang,” tegas Ketua KPUD. Terkait itu, beberapa anggota DPRDmengatakankebingungan soal pendaftaran itu. Ketua PDK Ir. Alensudin Purba, mengaku belum tahu mendaftar atau tidak, karena belum ada petunjuk dari pimpinan di atasnya. Hal sama terjadi pula pada Partai Republikan yang di DPRD diwakiliMurliPurba,S.Fil.“Semua serba belum jelas apa yang mau dilakukan,” ujar keduanya, kemarin, di gedung Dewan.(a09)

Siswi DS Raih Perunggu OSN Di Jakarta DEAN Pintauli Siringoringo, siswa kelas XII, IPS 3, SMA Negeri 2 Lubukpakam, Kab. Deliserdang meraih medali perunggu dari 32 provinsi yang turut ambil bagian pada Olimpiade Sains Nasional (OSN) bidang studi Matematika kategori tunanetra, di Jakarta, Senin (3/9) hingga Kamis (6/9). DitemuiWaspada di sekolahnya, Jumat (7/9), didampingi Kepala SMAN 2 Lubukpakam Drs. Ramlan Lubis, MPd dan guru pendamping Hanifah, perasaan bahagia tergambar dari mimik Dean yang merupakan siswa berke-

butuhan khusus. Menurut anak ke lima pasangan Ramses Siringo-ringo dan Nurmawati Br Manurung, keberhasilannya meraih juara ketiga pada kejuaraan pelajar tingkat nasional tersebut tidak terlepas dari bekal yang diberikan sekolah. “Keberhasilan ini tidak terlepas dari besarnya peran sekolah dalam mendidik anak berkebutuhan khusus seperti saya. Kerja keras sekolah sudah membuahkan hasil,” katanya sembari mengungkapkansebelummengikuti OSN, sekolah memberi bimbingan khusus selama enam bulan dengan materi mata pelajaran yang di UN kan dan sebulan

KPUD Sergai Gelar Sosialisasi Pendaftaran Parpol Peserta Pemilu PANTAICERMIN (Waspada): Komisi Pemilihan Umum Daerah Kab. Serdang Bedagai (KPUD Sergai) bersama KPU Provinsi Sumatera Utara, menggelar sosialisasi penyuluhan dan pendaftaran partai politik (Parpol) peserta Pemilu 2014, baru-baru ini di aula Theme Park, Pantai Cermin. Sosialisasi dihadiri Wakil Bupati Sergai H. Soekirman, Ketua DPRD Sergai, H. Azmi Y Sitorus, Kabag Ops Polres Sergai, Kompol B Aritonang, Kajari Sei Rampah, Erwin Panjaitan, SH, Pasi Intel Kodim 0204/DS, Kapten Inf Sukari, Kakan Kesbang Linmas Pemkab Sergai, Drs. Ramses Tambunan, 19 pengurus Parpol diwakili ketua dan sekretaris tingkat kabupaten. Ketua KPUD Sumut, Irham Buana Nasution, SH didampingi Nurlela Djohan dan Ketua KPUD Sergai, Syahrianto, SH menegaskan sebagai persyaratan setiap parpol harus menyiapkan Kartu Tanda Anggota (KTA) sebagai bukti keanggotaan kepengurusan partai paling lambat 7 September.(c03)

Disiplin Pemko T. Tinggi

22 Dari 43 Parpol T. Tinggi Mendaftar Ke KPUD TEBINGTINGGI (Waspada): 22 partai politik dari 43 Parpol yang ada dan ikut Pemilu 2009 di KotaTebingtinggitelahmendaftar di hari terakhir, Jumat (7/9). Sedangkan selebihnya tidak mendaftar hingga jam terakhir pada pukul 16.00 ditutup oleh pendaftaran Partai Barisan Nasional. Hal itu disampaikan Ketua KPUD kota Tebingtinggi Wal Ashri, SP, MM. Pada hari terakhir, 15 Parpol mendaftar secara bersamaan, sehingga membuat kesibukan di Sekretariat KPUD Jalan TC Sosial. Disampaikan, ke 22 Parpol yang mendaftar yakni, Partai Nasional Demokrat, PKPB, PKPI, PAN, PKS, Partai Demokrat, Partai Hanura, Partai Golkar, Gerindra, PDP, Patriot, PBB, Nasrep, PDIP,

Waspada/Andi Nasution

DEAN Pintauli Siringo-ringo memperlihatkan medali perunggu OSN bidang studi Matematika kategori tunanetra, didampingi Kepala SMAN 2 Lubukpakam Drs. Ramlan Lubis, MPd.

Waspada/Edi Saputra

SEORANG warga menunjukkan pintu depan kantor BPN Sergai yang dibobol kawanan perampok bersenpi di jalan negara, Dusun XV, Desa Firdaus, Kec. Sei Rampah.

penuh khusus bidang studi Matematika saja. Dikatakan siswa yang terkenaloptimisdilingkungan sekolahnya itu, medali perunggu bukan predikat juara, melainkan medali emas sebagai lambang juara. “Di kesempatanyangakandatang, saya akan berusaha meraih prestasi yang lebih baik,” tekad Dean yang sudah beberapa kali meraih prestasi di tingkat nasional,antaralainmenjuarai tenis meja tunanetra dan lari jarak 100 meter dengan waktu tercepat 16 detik pada OlimpiadeOlahragaSiswaNasional (O2SN) tahun 2007. Kepala SMAN 2 Drs Ramlan Lubis, MPd mengatakan, bila pemerintah serius memperhatikan anak berkebutuhan khusus dengan memberi bantuan alat-alat pembelajaran, sangat besar manfaatnya. “Tahun lalu kita pernah menerima sebagian bantuan danwaktuitupemerintahjuga berjanji memberi bantuan pembelajarankhusus,namun hingga kini belum terealisasi,” sesal Ramlan. Keberhasilan Dean di OSN, lanjut Ramlan, membuktikanmeskipuntunanetra tapimampumembawanama baik Kab. Deliserdang maupun Provinsi Sumatera Utara di tingkat nasional. “Ke depan kita akan lebih meningkatkan lagi pembelajaran bagi siswa berkebutuhan khusus,” janji Ramlan. * Andi Nasution

Pejabat Terabaikan, Bawahan Dapat Tekanan TEBINGTINGGI (Waspada): Penerapan disiplin di kalangan Pegawai Negeri Sipil (PNS) di PemkoTebingtinggi, ternyata sarat diskriminasi, sehingga memunculkan perasaan diperlakukan tidak adil. Puluhan tenaga honorer di Sekretariat Pemko ternyata wajib hadir pagi hari dan menandatangani absen atau honor mereka dipotong, sedangkan pejabat yang absen tak mendapat sanksi apa pun. Sejumlah tenaga honorer di Pemko Tebingtinggi di bawah koordinasi Bagian Umum, mengaku kecewa atas kebijakan baru terkait kehadiran. Kabag Umum Gumuruh Harahap, S.Sos, MAP memberlakukan ketentuan kepada sekira 70 tenaga honorer, wajib apel setiap hari kerja pukul 07:30. Selanjutnya, bila absen tanpa pemberitahuan, honor mereka dipotong Rp10 ribu/absen. “Agak kecewa juga, sudahlah honor kecil, malah terancam dipotong hanya karena tak apel,” keluh seorang honorer. PemkoTebingtinggi, sejak lama menetapkan standard honor tenaga outsourching di bawah upah minimum kota, yakni Rp600 ribu per bulan. Padahal, standard upah sesuai UMK di kota Tebingtinggi mencapai Rp1.1 juta per bulan. Kabag Umum Gumuruh Harahap, S.Sos, MAP saat dikonfirmasi mengatakan, pembuatan

ketentuan baru itu bertujuan untuk menegakkan disiplin terhadap tenagahonor.“Merekakanpunya harapan untuk jadi PNS, jadi harus dilatih untuk bekerja dengan disiplin,” tegas dia. Diakui, upaya penegakan disiplin itu baru diberlakukan bulan berjalan dan belum ada yang terkena sanksi. Namun tidak disangkal jika nantinya terjadi pemotongan honor, jika ketentuan itu diabaikan. Perlakuan berbeda justru terlihat pada pejabat di lingkungan Sekretariat Pemko Tebingtinggi. Selama ini banyak pejabat tidak ikut apel pagi mau pun siang, namun tak ada sanksi apa pun. Misalnya, pada apel pulang sekira pukul 11:30 di halaman Sekretariat Pemko Jalan Sutomo, sebagian besar pejabat eksekutif mau pun legislatif di pusat kekuasaan kota itu, tak ikut apel. Hanya empat pejabat yang apel, yakni Asisten II Drs. H. Agussalim Purba (pimpinan apel pulang), Kabag Adm. Ekonomi Ir. Joko Susilo, Kabag Umum Gumuruh Harahap, S.Sos, MAP dan Kabag Adm. Aset dan Barang Hj. Nurliza Kartika, SE, M.Si. Pejabat selebihnya tak hadir. Parahnya, tak satu pun pejabat di lingkungan DPRD kota Tebingtinggi hadir pada apel pulang hari itu. Mulai dari Sekretaris DPRD, Kasubbag hingga Kasi yang selama ini mengurusi lembaga legislatif itu. (a09)

Halal Bi Halal Keluarga Besar PPP Langkat STABAT (Waspada): Ketua DPW PPP (Partai Persatuan Pembangunan)SumutH.Fadli Nurzal, S.Ag mengemukakan berbagai program bidang keagamaan yang menjadikan Langkat di bawah kepemimpinanH.Ngogesasangatkental dengannuansareligi,demikian pula program pemberdayaan masyarakat untuk dapat lebih sejahtera. “Karena itu para kader dan simpatisan partai di daerah ini diharapkan mendukung sepenuhnya program dan kebijakan Pemkab Langkat,” kata Waspada/Ibnu Kasir Fadli Nurzal pada halal bi halal KETUA DPC PPP Langkat, Nurul Azhar Lubis berbincang keluarga besar PPP Langkat bersama Bupati Langkat H. Ngogesa Sitepu, SH disaksikan Ketua di Stabat, Rabu (5/9). Sebelumnya Ketua DPC DPW PPP Sumut, Fadli Nurzal pada halal bi halal Keluarga Besar PPPLangkatNurulAzharLubis PPP Langkat di Stabat. mengajak dan menyatakan partai yang dipim- partai berlambang Kabah senantiasa menjaga pinnya tersebut siap mendukung Bupati H. Ngo- kondusifwilayahyangselamainiterpeliharadengan gesa Sitepu dalam menjalankan segala program baikdanmemperkokohsilaturahmigunamemperdan kegiatan pemerintahan yang dinilai sangat kuatjalinanpersaudaraan,bersinergidalammewumenyentuh masyarakat, khususnya kebijakan- judkankeberhasilanpenyelenggaraanpembangunan kebijakan yang dapat memberikan kesejahteraan di daerah ini. “Dengan kebersamaan, kita jaga martabatLangkatsebagaibumireligius,”ujarNgogesa. bagi rakyat kecil. Sementara itu Ustadz Syamsul Bahri dalam “Kami tertarik dengan visi religius H. Ngogesa,” kataNurulyangjugaanggotaDPRDSumutitusembari tausyiahnya menjelaskan kedudukan manusia mengatakan,kepedulianbupatiterhadappembinaan sebagai khalifah di muka bumi yang diperintahkan agama khususnya Islam sangat sejalan dengan visi Allah untuk mengolah, memanfaatkan dan menjaga empat unsur bumi dengan baik yakni partai yang bernapaskan syariat Islam itu. Dalam kesempatan itu, Bupati Langkat H. air, api , angin dan tanah, agar kesemuanya berjalan Ngogesa Sitepu, SH mengajak para simpatisan seimbang.(a01/a03)

Jumlah Penyuluh Pertanian Minim MEDAN (Waspada): Anggota DPRD Sumut Palar Nainggolan menyarankan Plt Gubsu menambah petugas Pegawai Penyuluh Tenaga Bantu (PPLTB), serta memberikan kesejahteraan yang layak dengan fasilitas memadai. Ini, kata politisi Partai Demokrat itu, untuk menunjang produktivitas dan pelayanan maksimal PPLTB kepada masyarakat petani di lapangan. “Jumlah tenaga penyuluh saat ini belum seimbang dengan besarnya wilayah serta banyaknya desa di Sumut. Idealnya, di setiap desa ada dua petugas PPLTB untuk memberikan penyuluhuhan kepada petani,” katanya di Medan, Rabu (5/9). Selain petugas PPLTB di Sumut sangat minim, dia juga menerima masukan saat reses bahwa saranadanfasilitaspetugaspenyuluhmasihkurang layak, artinya kurang diperhatikan. Sehingga, kata anggota Komisi B itu, langkah penambahan PPLTB dan memerhatikan kesejahteraanpetugasdilapanganperlusecepatnyadisikapidemimendongkrakhasilpertanian,peternakan, perikanandanperkebunanmasyarakat.“Sehingga

kesedian pangan kita membaik, ini juga program Gubsu yang diatur pada Pergub nomor 25 tahun 2009,” katanya menjelaskan. Dia juga mengingatkan agar Pemprovsu menyediakan anggaran yang cukup untuk ketersediaan alih teknologi pertanian, peternakan serta perhatian pemerintah daerah dalam pengendalian pupuk bersubsidi dan pinjaman lunak, atau semacam Binmas Inmas buat petani agar memperoleh mutu lebih maksimal. Menyinggung kesejahteraan petugas PPLTB, dia menyarankan, untuk efisiensi dan mengurangi kebocoran anggaran sebaiknya Badan Koordinasi Penyuluh (Bakorluh) ditiadakan dan pengendalian masing-masing PPLTB dimaksimalkan kembali ke masing-masing dinas, sehingga program masing-masing dinas selaku pelaksana teknis berjalan lebih baik. Palar mengatakan, masyarakat Sumut tidak butuh piagam penghargaan, yang dibutuhkan surplus pangan, baik padi, palawija, daging dan ikan. “Sumut harus berpacu atas ketertinggalan dan meraih kembali sebutan daerah swasembada pangan seperti kejayaan lalu,” katanya. (m27)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Hajrul Azhari Ritonga, Arianda Tanjung. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

16 Parpol Daftar Ke KPUD Labusel KOTAPINANG (Waspada): Sejumlah pengurus Partai Politik (Parpol) di Labusel mendaftarkan partainya sebagai peserta Pemilu 2014 di Komisi Pemilihan Umum (KPU) Kab. Labusel, Jumat (7/ 9). Hingga batas akhir pendaftaran, KPU menerima berkas dari 16 parpol nasional yang ada di Labusel. Ketua Partai Indonesia Sejahtera Labusel, Rustam Efendy Hasibuan yang ditemui Waspada saat mendaftarkan partainya di KPU mengatakan, pihaknya menyerahkan 40 KartuTanda Anggota (KTA) kepada KPU dari 304 KTA yang disyaratkan untuk diverifikasi. Rustam yakin, partainya akan lolos verifikasi sebagai peserta Pemilu. “Kita sudah buat berkasnya sebaik mungkin,” katanya. Sementara Ketua KPU Labusel, Imran Husaini Siregar mengatakan,hinggapenutupanpendaftaran,pihaknyatelahmenerima berkas dari 16 Parpol. Partai yang telah menyerahkan KTA itu yakni Partai Nasdem, Damai Sejahtera, Gerindra, Karya Peduli Bangsa, Demokrat, Keadilan Sejahtera, PDIP, PPP, Hanura, PIS, Golkar, PBB, PAN, PPI, PPRN, dan PKB. Jumlah tersebut menurun jika dibandingkan dengan peserta Pemilu 2009 lalu yakni 34 parpol nasional. “Tadi pukul 16.00 WIB kita sudah menutup pendaftaran parpol sebagai peserta Pemilu Legislatif,” katanya. Menurutnya, tidak ada perpanjangan waktu pendaftaran. Namun untuk dokumen yang masih bermasalah masih ada masa perbaikan hingga 29 September 2012. Sedangkan verifikasi faktual akan dilakukan pihaknya pada Oktober mendatang. “Tidak ada perpanjangan lagi. Oktober mendatang sudah akan dilakukan verifikasi,” kata Imran. (c18)

WASPADA Senin 10 September 2012

Penderita Gizi Buruk Meninggal Dunia KOTAPINANG (Waspada): Rizky Torang Mulia Girsang, 6, bocah belia yang diduga penderita gizi buruk, warga Jl. Kalapane, Kel. Kotapinang, Kec. Kotapinang, Kab. Labusel akhirnya meninggal dunia, Jumat (7/9) malam. Rizky meninggal dunia di rumah duka yang berjarak lebih kurang 600 meter dari rumah dinas Bupati Labusel dan 100 meter dari rumah Wakil Bupati. Menurut Lisma Hanum, ibu Rizky, Minggu (9/9), selama sebulan terakhir putranya itu terpaksa dirawat jalan karena ketiadaan biaya untuk berobat. Disebutkan, almarhum sebelumnya sempat dirawat di RSUD Kotapinang dan Rantauprapat, hanya saja pihaknya memilih keluar karena rencananyaRizkyakandirawatkeMedan. Namun karena ketiadaan biaya niat tersebut urung dilakukan. Selama di rumah kata dia,

Rizky hanya dibawa sesekali ke dokter dan berobat alternatif. Dalam waktu sebulan itu, kondisi kesehatan Rizky terus menurun hinggaakhirnyamenghembus-kan nafas terakhirnya, Jumat malam. Sabtu (8/9) siang, Jenazah Rizky kemudian dikebumikan Pemakaman Umum Lobu yang berjarak sekira 400 meter dari rumah duka. “Niatnya kemarin, saya mau jual tanah untuk biaya perobatan, karena kata dokter

biaya perobatan Rizky hingga sembuh itu mencapai Rp10 juta. Namun Rizky meninggal dunia sebelumtanahitudijual,”katanya. Diberitakan Waspada sebelumnya,akibatpenyakititu,tubuh Rizky kian ringkih tinggal tulang berbalut kulit. Selain tidak dapat beraktifitas normal, Rizky pun lumpuh. Penyakit ini bermula dari demamyangdialamainyabeberapa bulan silam. Ketika itu, Rizky hanya diobati secara tradisional oleh orangtuanya. KepalaBidangBinaPelayanan KesehatanDinasKesehatanPemkab Labusel, dr. Ahmad Ridwan sebelumnya menepis bahwa bocah itu menderita gizi buruk. MenurutnyaRizkyhanyamengalami masalah gizi. Hal itu disebabkan infeksi yang dialaminya karena penyakit tersebut. (c18)

Masyarakat Pertanyakan Prosedur Pengurusan Paspor TANJUNGBALAI (Waspada): Sejumlah masyarakat mendatangi Kantor Imigrasi Tanjungbalai-Asahan mempertanyakan prosedur pengurusan paspor, Kamis (6/9). “Kami mendapat laporan, pengurusan paspor di sini sangat ribet. Kami minta penjelasan Kepala Kantor,” ungkap salah seorang masyarakat. Menjawab hal itu, Kepala Kantor Imigrasi Tanjungbalai, Yanizur menegaskan, pihaknya tidak pernah mempersulit pengurusan paspor. Dikatakan, bagi siapa yang akan mengurus paspor, akan dilayani sesuai dengan prosedur. “Tak ada untungnya kita mempersulitpengurusanpaspor. Semuaadaaturannya,tinggalikuti saja,” kata Yanizur yang didampingi Kasi Lantaskim Gelora Aidil Ginting dan KasiWasdakim, Jejen

Zainuddin, menjawab wartawan usaiberdiskusidenganmasyarakat yang mempertanyakan hal itu. Terkait biaya pengurusan paspor terangYanizur, ketentuannyaditetapkansebesarRp255ribu dan itu telah disosialisasikan kepada masyarakat luas.Yanizur mengatakan, kalaupun ada kelebihan pembayaran kemungkinan calon pengurus paspor berhubungan dengan pihak luar tanpa sepengetahuan petugas Imigrasi. Disebutkan,adalimabirojasa yang terdaftar di Kantor Imigrasi yakni PT Sasanindo, Esran Jaya, Kuda Putih, Indah Karunia, dan Satria Mandiri. Karyawan biro jasa menyetor ke pihak Imigrasi sebesar Rp255 ribu per orang. “Kalau ada katanya biaya pembuatan paspor sebesar Rp700, kemungkinan besar dia

mengurus kepada biro jasa yang mengambilkeuntungan.Padahal, telahkamiimbauagarmasyarakat langsung mendaftar, jangan melalui perantara,” tegasYanizur. Sebelumnya, masyarakat meminta agar pihak Imigrasi KotaTanjungbalai tidak memberi ruang gerak kepada calo untuk melakukan pengutipan liar. Menurut Bela, salah seorang yang turut datang ke Imigrasi, calon pengurus paspor yang menggunakan jasa orang lain, terpaksa mengeluarkan dana sebesar Rp600 ribu hingga Rp1 juta. Bela mengimbau agar Imigrasi Tanjungbalai tidak mengabaikan UU No 14 tahun 2008 tentangketerbukaaninformasipublik dan transparan soal biaya pengurusan paspor, yang menurut ketentuanhanyadikenakanbiaya Rp255 ribu/paspor. (a32)

Narapidana Kabur Dari LP T. Balai TANJUNGBALAI (Waspada): Seorang narapidana kasus pencurian Pasal 362 KUHP, kabur dari Lembaga Pemasyarakatan (LP) Kelas-II B, KotaTanjungbalai. “Benar, seorang narapidana bernama Ramadi alias Madi warga Dusun IV, Desa Aekledong, Kec. Aekledong, Kab. Asahan, melarikandiribaru-baru ini,” kata Kepala LP Bambang Basuki melalui Kasi Register, Madong Gorat, dikonfirmasi Waspada, Minggu (9/9). Menurut Gorat, kejadian itu telah dilaporkan ke Kanwil Hukum dan HAM Sumatera Utara, dan juga kepada Direktorat JenderalPemasyarakatan.Dikatakan, pihaknya juga sedang melakukan pencarian dengan berkoordinasi dengan aparat Kepolisian. Diterangkan Gorat, kejadian ituberawalpada24Februari2012,

pihaknya menerima seorang tahanan Polsek Pulau Raja bernama Ramadi alias Madi kasus pencurian dengan administrasi penahanlengkap.Lalu,4Juli2012, Madi dijatuhi hukuman 11 bulan penjara oleh Majelis Hakim Pengadilan Negeri Kota Tanjungbalai. Kemudian 22 Juli, pihak LP melaksanakan putusan itu. Setelah menjalani setengah masa pidana, pada 14 Agustus 2012, narapidanatersebutdipekerjakan di luar tembok perkebunan sawit milik LP. Putusan itu berdasarkan sidang Tim Pengamat Pemasyarakatan ( TPP) dengan No. W2.E14.PK.01.05.03.-491/2012 tanggal 10 Agustus 2012. Selanjutnya 27 Agustus 2012 sekira pukul 09.00, Madi bekerja di kebun sawit seperti biasa dengan

pengawalan dari petugas. Sekitar pukul 10:00, petugas pengawal mengadakan pengontrolan warga binaan pemasyarakatan (WBP) yang bekerja di luar tembok LP dan semuanya masih dalam keadaan lengkap. Namunpadapukul11:00,petugas kembali melakukan pengontrolan dan ternyata seorangWBP atas nama Ramadi tidak ditemukan di kebun sawit. Petugas lalu melakukan pencarian di sekitar LP namun belum membuahkan hasil lalu melaporkannya kepada Kepala Pengamanan Lembaga Pemasyarakatan (KPLP). KPLP lalu melaporkan kepada Kepala LP dan selanjutnya dibentuk tim untuk melakukan pencarian narapidana. “Kita masih melakukan pencarian,” tegas Gorat. (a32)

Wabup L. Batu Sampaikan Nota Jawaban RANTAUPRAPAT (Waspada):Wakil Bupati (Wabup) Labuhanbatu, Suhari Pane SIP menyampaikannotajawabanbupati atas pandangan umum fraksifraksi Dewan Perwakilan Rakyat Daerah (DPRD) Kab. Labuhanbatu pada sidang paripurna di gedung DPRD, Kamis (6/9). Dalam penyampaian nota jawaban itu Suhari Pane didampingi oleh Plt Sekdakab H. Ali Usman Harahap SH, Asisten Administrasi Pemerintahan Drs. H. Sarbaini, Asisten Administrasi Umum Elfin Riswan, Kepala SKPD, Kabag dan Kabid. Rapat paripurna yang dipimpin langsung oleh Ketua DPRD Hj. Ellya Rossa Siregar SPd itu juga dihadiri lebih dari setengah jumlah anggota dewan. Tampak juga para Wakil Ketua Ir. Aminuddin

Manurung dan Syawaluddin Hasibuan, SE. Menjawab tanggapan Fraksi Golongan Karya (Golkar) mengenai investasi non permanen yang tidak memperoleh manfaat ekonomidijelaskanolehwakilbupati, bahwainvestasidimaksudadalah pembangunan kolam renang di Desa Simatahari, Kec. Sei Kanan. Pembangunan tersebut telah diserahkanpengelolaannyakepadaPemkabLabuhanbatuSelatan, sedangkan dokumen administrasi penyerahan kepemilikan investasi masih dalam tahap prosespenyelesaianyangdiharapkan pada tahun anggaran 2012 dapat direalisasikan, sehingga investasi non permanen dimaksud tidak lagi disajikan dalam laporan keuanganPemkabLabuhanbatu. Mengenaidendaketerlamba-

tan atas pekerjaan fisik yang melampauibataskontraksebesar Rp547.747.180, dijelaskan, bahwa pembayaran atas keterlambatan pada dua SKPD tersebut belum seluruhnya disetorkan ke rekening kas umum daerah, namun pemerintah daerah tetap berupaya agar denda tersebut dapat diselesaikan seluruhnya. Mengenai realisasi anggaran sebesar Rp683.724.731.932 pada TA. 2011 terhadap penurunan kemiskinan dapat dijelaskan bahwa realisasianggarandimaksudtelah memberikan kontribusi pertumbuhan ekonomi di Labuhanbatu, seperti dampak pembangunan jalan di wilayah pantai yang dapat meningkatkan akses transportasi barang dan jasa sehingga meningkatkan harga jual hasil pertanian rakyat. (c07)

Halal Bi Halal Dinkes Batu Bara LIMAPULUH (Waspada): Angka kematian ibu melahirkan dan bayi serta balita kurang gizi dinilaimasihtinggi,menjadisalah satu masalah kesehatan di Batu Bara, diharapkan dapat di bantu mengatasi. “Kita harapkan bidan desa mampu mengatasi, setidaknya

membantu mengurangi permasalahan ini,” tukas Bupati H. OK Arya Zulkarnain, SH, MM pada acarahalalbihalalDinasKesehatan (Dinkes)Kab.BatuBaradilapangan sepak bola Kec. Limapuluh, barubaru ini. Bidandesa,katanya,merupakan ujung tombak pemerintah

di bidang kesehatan, khususnya bagi kaum ibu. Halal bi halal mengambil tajuk Dinas Kesehatan bersama OK Arya itu dihadiri Ketua DPRD Selamat Arifin SE, MSi, Sekdakab,T. Erwin SE, Ketua Tim Penggerak PKK, Hj. Khadijah Arya Zulkarnain, tokoh masyarakat dan undangan. (a13)

Waspada/Iwan Has

BUPATI H. OK Arya Zulkarnain, SH, MM dan Ketua TP PKK, Hj. Khadijah Arya foto bersama bidan desa pada halal bi halal Dinas Kesehatan Batubara di Kec. Limapuluh.

Waspada/Budi Surya Hasibuan

BUPATI Tigor Panusunan Siregar menyematkan tanda jabatan kepada Camat Bilah Hilir Drs Irwan Saleh Siregar.

Bupati L. Batu Lantik Pejabat Eselon III Dan IV RANTAUPRAPAT( Waspada): Bupati Labuhanbatu dr H Tigor Panusunan Siregar SpPD melantik 65 orang pejabat eselon III dan IV di jajaran Pemkab Labuhanbatu terdiri dari 18 orang pejabat eselon III dan 47 orang pejabat eselon IV. Pelantikan berlangsung di ruang data dan karya kantorbupatiRantauprapat,Jumat(8/9),dilakukan untuk mengisi jabatan kosong dan refreshing jabatan, agar peningkatan kinerja dapat terwujud. Di antara mereka yang dilantik pada hari itu antaralainCamatBilahHilirDrsIrwanSalehSiregar yang sebelumnya menjabat sebagai Sekretaris pada kantor Camat Bilah Hulu, dan Camat Panai Tengah Agus Salim BA sebelumnya sebagai Kepala Kelurahan Bakaranbatu.

Dalam amanatnya Bupati Tigor Panusunan Siregar meminta para pejabat yang baru dilantik agar secepatnya melakukan penyesuaian diri lingkungan kerja yang baru. “Dimanapun ditempatkan, berniatlah untuk beribadah, mengabdikan diri kepada pemerintah dan masyarakat, agar Labuhanbatu menjadi lebih maju dan sejahtera,” pinta Tigor. Khusus kepada camat yang dilantik pada pagi itu, Tigor dengan tegas meminta agar senantiasa berbaur dengan berbagai lapisan masyarakat di wilayah kerjanya masing-masing. Lakukan pendekatan kepada masyarakat, kata Tigor, sampaikan apa yang akan, sedang dan telah dilaksanakan oleh pemerintah saat ini. (c07/a18)

Warga Tanjung Medan Ancam Blokir Jalan Lagi KAMPUNGRAKYAT (Waspada): Warga yang bermukim di sepanjang Jalan Lintas Tanjung Medan,DesaTanjungMedan,Kec.Kampungrakyat, Kab. Labusel mengancam kembali memblokir jalan. Pasalnya, pihak perusahaan kelapa sawit didaerahitutelahmengingkarikesepakatandengan masyarakat. Aktifis Aliansi Pemuda dan Mahasiswa Peduli Labusel,AndiSyahputradanQusoyTambakkepada Waspada, Minggu (9/9) mengatakan, pemblokiran badan jalan itu akan dilakukan pihaknya pekan depan. “Kami sudah koordinasi dengan seluruh warga, kita akan segera surati pihak Kepolisian untuk aksi ini,” kata Andi. Dijelaskan, perusahaan di hadapan Muspika Kec. Kampungrakyat sebelumnya sepakat menjaga dan menanggulangi dampak kerusakan jalan yang sebagian besar disebabkan melintasnya truk perusahaan yang melebihi kapasitas jalan serta menyalurkan dana CSR kepada warga di desa itu. Namun sampai kini kesepakatan itu tak terealisasi. Menurutnya, perusahaan tidak melakukan penyiraman tiga kali sehari di Jalan Tolan-Tanjung Medan yang rusak dan berabu dan tidak memperbaiki badan jalan yang berlubang. Perusahaan juga tidak memberdayakan pemuda setempat untuk bekerja dan mencairkan dana CSR. “Ini

namanya pembohongan. Kami akan memblokir permanen jalan ini. Mau melintas gunakan truk berkapasitas 8 ton sesuai kelas jalan III C,” kata Andi. Qusoy mengatakan, kondisi jalan yang rusak menyebabkan warga harus menghirup udara terpolusi debu berterbangan, terlebih saat kenderaan roda empat melintas. Kerusakan itu, kata dia, disebabkan banyaknya truk melebihi tonase melintas setiap hari. Kondisi itu diperparah karena terbengkalainya pengerjaan proyek pelebaran jalan senilai Rp10,4 miliar oleh PT. Aba Jaya Utama pada 2011 lalu. Disebutkan, selama hampir 24 jam warga harus menghirup udara yang berdebu akibat badanjalanyangbelumdiaspal.“Untukmengatasi debu terkadang warga di sini menyiram ruas jalan. Makanya warga sepakat kembali memblokir jalansampaiperusahaanmerealisasikanjanjinya,” katanya. Pada mediasi yang dipimpin oleh Camat KampungrakyatMarasakti14Junilalu,perusahaan yang dihadiri antara lain PT. Nubika Jaya, PT. Herfinta, PT. ATM, dan agen pengumpul TBS menyatakan kesanggupannya memenuhi tuntutan warga. Namun sampai kini kesepakatan itu tidak pernah terealisasi. (c18)

Sat Narkoba Asahan Bekuk Pengedar SS KISARAN ( Waspada): Seorang diduga pengedar sabu-sabu (SS) sebanyak 11 paket kecil dibekuk Sat Narkoba Polres Asahan, dan hingga saat ini masih dilakukan pengembangan untuk meringkus tersangka lainnya. Kapolres Asahan AKBP Yustan Alpiani dikonfirmasi Waspada melalui Kasubag Humas AKP R.Berutu didampingi Kasat Narkoba AKP Napsanto, Minggu (9/9) menuturkan tersangka, AS, 28, warga Lingkungan V Kelurahan Bunut, Kisaran, diamankan Polres Asahan Kamis (6/9)

siang di kediamannya. Sebelumnya, tersangka telah dicurigai dan berkat informasi warga, akhirnya dilakukan penyergapan dan saat pemeriksaan di rumah tersangka ditemukan 11 paket kecil SS, dua unit timbangan digital, satu gulung aluminium foil. “Kita telah mengamankan tersangka beserta barang bukti, dan hingga saat ini kita masih melakukan penyelidikan dari mana asal barang haram itu, dan siapa saja yang terlibat dalam masalah ini,” ujar Berutu. (a15)

18 Partai Politik Daftar KPU Batubara LIMAPULUH (Waspada): Hingga hari terakhir masapendaftaranpartaipolitikditingkatkabupaten, hanya 18 parpol yang telah menyerahkan syarat pendaftaran partai politik ke KPU Kab. Batubara. Demikian disampaikan Ketua KPU Kab. Batubara Khairil Anwar, SH. MSi, Jumat (7/9) di KPU Kab. Batubara, Limapuluh. Turut mendampingi penerimaan pendaftaran partai politik, anggota KPU Kabupaten Batubara DivisiTehnisPenyelenggaraDonniHuseinHarahap, Divisi Logistik dan Organisasi Drs. Azhar Tanjung, DivisiSosialisasiAbdulMasriPurbaS.Sos,DivisiHumas danHubunganAntarLembagaTaufikAbdiHidayat, S.Sos, Sekretaris KPU Kabupaten Lukman, SH dan Kasubbag Teknis Abbas Sitorus. Menurut Khairil Anwar, pasca putusan Mahkamah Konstitusi (MK) yang membatalkan

sejumlah pasal pada Undang - Undang RI nomor 08 tahun 2012 tentang pemilu anggota DPR, DPD dan DPRD 2012, telah dikeluarkannya perubahan PeraturanKPUNomor7Tahun2012diubahmenjadi PeraturanKPUnomor11Tahun2012tentangtahapan pemilu DPR, DPD, DPRD Tahun 2014. “Jadwal pendaftaran partai politik pada 7 September 2012 telah berakhir, dan masa perpanjangpenyerahanadministrasikeanggotaan (KTA) ditingkat KPU kabupaten digelar 8-29 September 2012,” ujarnya. Partai politik yang telah mendaftar ke KPU Kab. Batubara yakni Partai Nasdem, PDI-P, Golkar, PAN, Gerindra, PKB, PDP, Demokrat, PPP, PDS, PDK, PKS, Partai Kedaulatan Bangsa Indonesia Baru, Partai Nasional Republik, Partai HANURA, PPRN, PBB, PKPI. (c05)

Bukti Administrasi Pemerintahan Amburadul Kasus PNS Bodong LIMAPULUH(Waspada): Mencuatnya kasus PNS bodong yang bertugas di Batubara adalah bukti amburadulnya sistem administrasi pemerintahan, kinerjanya layak mafia saja. Demikian disampaikan Ketua DPC PDIP Batubara Zahir menanggapi situasi pemerintahan Batubara yang diisi oleh PNS Bodong. Kepada Waspada, Kamis (6/9) Zahir mengutarakan DPC PDIP Batubara melalui perwakilanya di dewan akan membahas masalah ini. Agar birokrat yang ada dapat bertugas dengan nyamantanparasadihantuiolehsistemadministrasi pemerintahan itu sendiri. “Kasus PNS bodong harus dibersihkan di Batubara, aparat hukum harus menangkap otak pelaku dan jamah - jamaahnya, karena kasus ini telahmerusaktatanankepegawaiandanmerugikan negara dengan modus pemalsuan dokumen negara untuk mendapatkan keuntungan secara pribadi,” kata Zahir. Seperti diberitakan Waspada, Kamis (6/9)

sebelumnya, satu orang PNS HLS yang bertugas di Kantor BKD Batubara dinyatakan oleh Kementerian Pendidikan NIP yang dipakainya adalah NIP milik seorang PNS bernama Ramlah yang bertugas di Kab. Sidrep. HLS sendiri adalah CPNS pindahan dari Kab. Rokan Hulu, Prop Riau yang telah masuk ke Batubara pada tahun 2008 yang lalu. Terungkapnya kasus ini setelah BKN menerapkan konfersi NIP dari NIP berdigit sembilan menjadi 18 digit sejak Oktober tahun 2008. Karena NIP konfersinya tidak keluar HLS diminta untuk menyerahkan SK pengangkatannya, namun hingga jawaban BKN dan kementerian keluar yang bersangkutan tidak mampu menunjukkan SK aslinya. SelainHLSadaenamoranglagiyangkasusnya mirip dan juga pindahan dari Riau dan Aceh, hingga saat ini menurut Kepala BKD Batubara SautSiahaaninstansiyangmengeluarkanSKpengangkatan mereka belum membalas surat pertanyaan BKD tentang keberadaannya. (c05)


WASPADA Senin 10 September 2012



Membangun Batu Bara Untuk Negeri Sejahtera Berjaya S

ALAH satu unsur terpenting dalam membangun suatu daerah tersedianya fasilitas infrastruktur yang memadai baik jalan, jembatan, pelabuhan, sarana transportasi, ditunjang sarana pendidikan dan kesehatan, di samping unsur-unsur lain yang bersifat pelayanan kepada masyarakat. Keseriusan pemerintah dalam membangun infrastruktur bukan saja diwujudkan balam bentuk pembangunan yang diberikan melalui pembangunan dana APBN, APBD Provinsi mau pun APBD Kabupaten/Kota. Namun untuk memenuhi kebutuhan infrastruktur menyeluruh serta menopang Percepatan dan Perluasan Pembangunan baik di pusat mau pun di daerah, maka diluncurkan Masterplan Percepatan, Perluasan Pembangunan Ekonomi Indonesia (MP3EI) 2011 dan 2025. Penetapan MP3EI yang pelaksanaan sosialisasinya dilakukandiSemarang,12Agustus2011, telah membuka mata kita semua bahwa potensi yang dimiliki Kabupaten Batu Bara sangat besar baik dibidang kepelabuhan, sarana transportasi, pertanian yang telahmembukamatapemerintah pusat untuk menetapkan Kabupaten Batu Bara sebagai pusat pelabuhan internasional, serta ditopang Kawasan Industri Sei Mangke (KISM), akan menjadikan Kabupaten Batu Bara salah satu wilayah penyangga industri khususnya sarana transportasi darat ke KISM. Kabupaten Batu Bara telah menjadi penggerak pengembanganekonomiSumateraUtara, seperti kita ketahui keberadaan PT. INALUM yang akan berakhir 2013 dan komitmen KementerianPerindustrianakanmengembangkanIndustriAluminiumdari hulu hingga hilir pengolahan Aluminium di Kabupaten Batu Bara. Ini akan melahirkan industri berbasis aluminium khususnya produk-produk rumahtangga, suku cadang mesin, peralatan perumahan dan produk-produk lain berbahan dasar aluminium. Kabupaten Batu Bara juga akan menjadi pemasok kebutuhan bahan baku sawit di KISM. Kabupaten Batu Bara menyediakan sarana transportasi Kereta ApidariKISMmenujuPelabuhan Kuala Tanjung yang secara bertahap, pembangunannya dilakukan 2012 hingga 2025 menjadi Global Hub. Di Kabupaten Batu Bara akan bernaung ribuan tenaga kerja KISM yang sudah barang tentumemerlukanribuanrumah,

rumah makan, restoran, warnet, salon, bank, minimarket, toko kelontong, dealer sepeda motor, mobil bahkan ribuan pedagang kaki lima untuk memenuhi kebutuhanribuanbahkanratusan ribu tenaga kerja KISM. Panjang pantai Kabupaten Batu Bara + 62 km, menawarkan pemandangan yang eksotik, ditunjang keberadaan Pulau Pandang dan Pulau Salah Nama, merupakan daya tarik bagi investasi pariwisata. Hal ini akan terwujud dalam waktu dekat dan kebimbangan untuk membangun Batu Bara harus dihapus karena Batu Bara tanah bertuah yang memiliki potensi bukan saja diakui masyarakat Batu Bara, namun dibuktikan oleh pemerintah pusat dengan memfokuskan pengembangan, percepatan ekonomi Koridor Sumatera di Kabupaten Batu Bara. Aspek Pelayanan Umum Pencapaian kinerja pada aspek layanan umum baik dalam bentuk barang publik mau pun jasa publik yang menjadi tanggungjawab pemerintah daerah provinsi, dalam upaya pemenuhan kebutuhan masyarakat terdiri dari layanan urusan wajib: pendidikan,kesehatan,pekerjaan umum (pembangunan jalan dan pengairan), perumahan, penataan ruang, perencanaan pembangunan, perhubungan, lingkungan hidup, pertanahan, pemberdayaan perempuan dan perlindungananak,keluargaberencana dan keluarga sejahtera, sosial, ketenagakerjaan, koperasi dan UMKM, penanaman modal daerah, kebudayaan, pariwisata, kesatuan bangsa dan politik dalam negeri, penegakan perda, ketahanan pangan, komunikasi dan informatika. Potensi Ekonomi Kabupaten Batu Bara Ukuran agregat perekonomian Kabupaten Batu Bara dapat dinyatakan dengan Produk DomestikRegionalBruto(PDRB). PDRB menunjukkan jumlah produksi dan nilai tambah yang dihasilkan oleh berbagai sektor kehidupan masyarakat. PDRB atas dasar harga berlaku (ADHB) Kabupaten Batu Bara kurun waktu 2002-2007, mengalami kenaikan sebesar

Rp5.090,33 miliar yaitu dari Rp6.278,38 miliar pada 2002 menjadi Rp11.368,71 miliar pada tahun2007.SedangkanPDRBatas dasar harga konstan tahun 2000 (ADHK 2000) kurun waktu yang sama mengalami kenaikan sebesar Rp1.080,89 miliar, yaitu dari Rp5.405,86 miliar pada 2002 menjadi Rp6.486,75 miliar pada 2007. Hal tersebut dapat dilihat pada tabel berikut. (Tabel 2) Selama lima tahun terakhir Kabupaten Batu Bara rata-rata mampu tumbuh sebesar 3,77% per tahun atas dasar harga konstan dan atas dasar harga berlaku. Laju Pertumbuhan Ekonomi Pertumbuhan ekonomi merupakan salah satu ukuran dari hasil pembangunan yang dilaksanakan khususnya dalam bidang ekonomi. Pertumbuhan tersebut merupakan rangkuman laju pertumbuhan dari berbagai sektor ekonomi yang menggambarkantingkatperubahanekonomi yang terjadi. Untuk melihat fluktuasi pertumbuhan ekonomi tersebut secara riil dari tahun ke tahun, disajikan melalui PDRB atas dasar harga konstan menurutlapanganusahasecaraberkala. Pertumbuhan yang positif menunjukkan adanya peningkatan perekonomian, sebaliknya apabila negatif menunjukkan terjadinya penurunan. Kegiatan perekonomian di Kabupaten Batu Bara yang ditunjukkan dengan PDRB atas dasar harga konstan tahun 2000, pada 2002 menunjukkan peningkatan sebesar 4,05%. Angka ini menunjukkan bahwa dibanding tahunsebelumnyatejadikenaikan angka PDRB sebesar 4,05% denganmenganggaphargakonstan pada 2000. Kenaikan tertinggi terjadi pada 2003 yaitu 4,57%. Pada2004dan2005pertumbuhan ekonomi cenderung melambat dari 3,97% menjadi 2,30%. Ini sangat dipengaruhi adanya penebangan/penggantian tanamantanamanperkebunandibeberapa wilayah. Struktur Ekonomi Struktur ekonomi suatu daerah sangat ditentukan oleh besarnya peranan sektor-sektor ekonomi dalam memproduksi barang dan jasa. Struktur yang terbentuk dari nilai tambah yang diciptakanmasing-masingsektor, menggambarkanketergantungan suatu daerah terhadap kemampuan berproduksi dari masingmasing sektor. Struktur perekonomian Kabupaten Batu Bara

didominasisektorindustripengolahan. Hal ini berkaitan dengan adanya perusahaan pengolahan biji aluminium, serta pengolahan hasil-hasil perkebunan seperti pengolahan minyak kelapa sawit dan karet (Crumb Rubber). Konstribusi per sektor terhadap total nilai PDRB Kabupaten Batu Bara berturut-turut sebagai berikut: industri pengolahan; pertanian; perdagangan, hotel danrestoran;jasa-jasa;bangunan; pengangkutan dan komunikasi; keuangan, persewaan dan jasa perusahaan; listrik, gas dan air minum serta penggalian. Kontribusi sektor primer selama kurun waktu 2004 hingga 2006 cenderung terus mengalami penurunan yaitu dari 20,02% pada tahun 2004 menjadi 16,06% pada tahun 2006, namun mengalami peningkatan kembali pada 2007 sebesar 17,46%. Untuk kontribusi sektor sekunder cenderungmengalamikenaikanselama 2002 hingga 2006, yaitu sebesar 50,83% menjadi 54,49%, namun mengalami penurunan pada 2007 yaitu dari 54,49% pada 2006 menjadi53,18%pada2007.Untuk kontribusi sektor tersier juga cenderung mengalami kenaikan selama 2002 hingga 2003, yaitu dari 29,69% menjadi 29,58%, sedangkanpada2004mengalami penurunandari29,58%pada2003 menjadi 28,96%, dan mengalami kenaikan dari 28,96% menjadi 29,36% pada 2007. Perdagangan dan Jasa Menurut tanda daftar perusahaan yang diterbitkan Dinas Perindag dan Penanaman Modal Kabupaten Asahan di wilayah Kabupaten Batu Bara, sampai 2007 terdapat 163 perusahaan yang sebagian besar (56 persen) berbadan hukum PO dan bergerak di sektor perdagangan besar, eceran, rumah makan, hotel dan penginapan sebesar 76 perusahaan.Sedangkanpasarataupekan yang ada di Kabupaten Batu Bara pada 2007 berjumlah 24 buah, dengan luas total mencapai 2,3 ha danjumlahpedagang2.001orang. Potensi Wisata Potensi wisata di Kabupaten Batu Bara antara lain Danau Laut Tador,PantaiSejarah.PantaiKuala Sipare. Pantai Bunga, Istana Lima Laras dan lain-lain. Sebagian besar potensi wisata yang ada masih belum dikelola dengan baik, sehingga belum memberi kontribusi bagi pendapatan daerah. Industri Di Indonesia industri pengolahan dibagi menurut jumlah

Pembangunan Jalan Kereta Api Bandar Tinggi Menuju Kuala Tanjung KEMENTERIAN Perhubungan RI melalui PT KAI dan Pemerintah Kabupaten Batu Bara akan membangun jalan kereta api yang pelaksanaannya akhir 2011 yang direncanakan tahap awal pembangunan badan jalan sepanjang 2 km. Pembangunan jalan kereta api Kuala Tanjung menuju Bandar Tinggi dan Kawasan Industri Sei Mangke ditujukan sebagai sarana pendukung transportasi KISM menuju pelabuhan Kuala Tanjung secara bertahap akan dijadikan pelabuhan Gobal Hub. Halinibarangtentuakanmeningkatkan aktivitas Pelabuhan serta meningkatkan efisiensi transportasi di KISM, meningkatkan minat investasi dan menurunkan biaya transportasi yang sangat mahal. Pemerintah Kabupaten Batu Bara telah berkoordinasi dengan pemerintah pusat manpun PT KAI dan PTPN 3. Ini bertujuan mempercepatpelaksanaanpembangunan jalan kereta api serta untuk mendorong percepatan dan perluasan pembangan ekonomi di Kabupaten Batu Bara sehinggaakanmempercepatproses peningkatantarafhidupmasyarakat Batu Bara menjadi masyarakat sejahtera dan berjaya. Langkah-langkahdanKebijakan yang akan dilakukan Pemerintah Kabupaten Batu Bara di antaranya memperkuat pemahaman kepada Aparatur Pemerintah Daerah dan Dunia Usaha (swasta dan BUMD) melalui sosialisasi dan diseminasi informasi tentangsubtansikebijakanMP3EI. Membentuk Sekretaris Tim Kerja Pemerintah Kabupaten Batu Bara. Menjamin Pelayanan perijinan yang tidak menghambat investasi melalui Pelayanan Terpadu Satu Pintu (PTSP), serta mengeluakan izin dengan tenggang waktu seminimal mungkin. Memfasilitasi penyediaan lahan sesuai kebutuhan duniausaha.Menciptakankondisi ekonomi, politik, hukum dan sosial yang kondusif. Langkah-langkah dan Kebijakan yang telah dilakukan antara lainmengadakankunjungankerja ke PT Newmont Nusa Tenggara (NNT) di Kabupaten Sumbawa Barat, Nusa Tenggara Barat pada

BUPATI Batubara H OK Arya Zulkarnain SH MM bersama pejabat dari Kementerian Perhubungan diabadikan seusai meresmikan dimulainya pembangunan jalur rel kereta api menuju Kuala Tanjung tanggal 9 s/d 12 Maret 2010 guna mendapatkan informasi dan mempelajari sistem kerjasama antara Pemerintah Provinsi Nusa Tenggara Barat (NTB), Kabupaten Sumbawa Barat dan Sumbawa serta divestasi saham PT Newmont Nusa Tenggara kepada Konsorsium perusahaan daerah tersebut. Mengadakan kunjungan ke 9 Kabupaten/Kota di Sumatera Utara, 29 Maret s/ d 1 April 2010 dilanjutkan ke Kabupaten Asahan dan Tanjung Balai serta Simalungun pada 5 s/d6April2010,gunamenggalang solidaritas dan soliditas daerah 10 Kabupaten/Kota di lingkup PT Inalum menyongsong berakhir perjanjian induk PT Inalum 2013. Melakukan kunjungan konsultasikeKementerianDalam Negeri, Kementerian BUMN, Kementerian Perindustrian dan Kementerian Keuangan. Mengadakan Rapat Koordinasi 10 Kabupaten/Kota dihadiri 10 Bupati/Wali kota. Mengadakan kunjungan koordinasi ke 9 Kabupaten/Kota lingkup PT Inalum dan lain-lain. Penutup Masterplan Percepatan dan Perluasan Pembangunan EkonomiIndonesia(MP3EI),langkah awal mendorong Indonesia menjadi negara maju dan ter-

masuk 10 negara besar di dunia pada 2025 melalui pertumbuhan ekonomi tinggi yang inklusif, berkeadilan dan berkelanjutan. Untuk mencapai hal itu, diharapkan pertumbuhan ekonomi riil rata-rata sekitar 7-9 persen per tahun secara berkelanjutan. PengembanganMP3EIdilakukan dengan pendekatan breakthrough didasari semangat “Not Business As Usual”, melalui perubahan pola pikir bahwa keberhasilan pembangunan ekonomi tidak hanya tergantung pada pemerintah, melainkanmerupakan kolaborasi bersama antara Pemerintah Pusat, Pemerintah Daerah, BUMN, BUMD dan Swasta. Pihak swasta akan diberi peran utama dan penting dalam pembangunan ekonomi terutama dalam peningkatan investasi dan penciptaan lapangan kerja, sedangkan pihak pemerintah akan berfungsi sebagai regulator, fasilitator dan katalisator. Dari sisi regulasi, pemerintah akan melakukan deregulasi (debottlenecking) terhadap regulasi yang menghambat pelaksanaan investasi. Fasilitasi dan katalisasi akan diberikan pemerintah melalui penyediaan infrastrukturmaupunpemberian insentif fiskal dan non fiskal. Pelaksanaan MP3EI dilakukan

untuk mempercepat dan memperluas pembangunan ekonomi melalui pengembangan 8 program utama terdiri dari 22 kegiatan ekonomi utama. Strategi pelaksanaan MP3EI dilakukan dengan mengintegrasikan 3 elemen utama yaitu: (1) mengembangkanpotensiekonomiwilayah di 6 Koridor Ekonomi Indonesia, yaitu: Koridor Ekonomi Sumatera, Koridor Ekonomi Jawa, Koridor Ekonomi Kalimantan, Koridor Ekonomi Sulawesi, Koridor Ekonomi Bali–Nusa Tenggara, dan Koridor Ekonomi Papua–Kepulauan Maluku; (2) memperkuat konektivitas nasional yang terintegrasi secara lokal dan terhubung secara global (locally integrated, globally connected); (3) memperkuat kemampuan SDM dan IPTEK nasional untuk mendukung pengembangan program utama di setiap koridor ekonomi. Penyusunan MP3EI dimaksudkan bukan untuk mengganti dokumen perencanaan pembangunan yang telah ada seperti RPJPN dan RPJMN, namun akan menjadi dokumen yang terintegrasi dan komplementer, serta penting dan khusus untuk melakukan percepatan dan perluasan pembangunan ekonomi Indonesia.

tenaga kerjanya yaitu berskala besar, sedang, kecil dan rumah tangga. Data industri besar dan sedang dikumpulkan BPS, sedangkan data industri kecil dan rumah tangga diperoleh dari dinas Kopperindag dan Penanaman Modal Kabupaten. Pada 2007 jumlah perusahaan industri besar sedang di Batu Bara berjumlah 49 perusahaan. Semua tersebar di kecamatan kecuali Sei Balai yang tidak mempunyai IndustriBesardanSedang.Sedangkan jumlah industri kecil dan kerajinanrumahtanggapadatahun yang sama berjumlah 467 unit. Implementasi Mp3ei Di Kabupaten Batu Bara Masterplan Percepatan dan PerluasanPembangunanEkonomi Indonesia (MP3EI) merupakan langkah awal untuk mendorong Indonesia menjadi negara maju dan termasuk 10 (sepuluh) negara besar di dunia pada tahun 2025, melalui pertumbuhan ekonomi tinggi yang inklusif, berkeadilan dan berkelanjutan. Untuk mencapai hal tersebut, diharapkan pertumbuhan ekonomi riil rata-rata sekitar 7-9 persenpertahunsecaraberkelanjutan. Pelaksanaan MP3EI dilakukan untuk mempercepat dan memperluas pembangunan ekonomimelaluipengembangan 8(delapan)programutamaterdiri dari 22 (dua puluh dua) kegiatan ekonomi utama. Strategi pelaksanaan MP3EI dilakukan dengan mengintegrasikan 3 (tiga) elemen utama,yaitu:(1)pengembangkan potensi ekonomi wilayah di 6 (enam) Koridor Ekonomi Indonesia, yaitu: Koridor Ekonomi Sumatera, Koridor Ekonomi Jawa, Koridor Ekonomi Kalimantan, Koridor Ekonomi Sulawesi, Koridor Ekonomi Bali–Nusa Tenggara, dan Koridor Ekonomi Papua–Kepulauan Maluku; (2) memperkuat konektivitas nasional yang terintegrasi secara lokal dan terhubung secara global (locally integrated, globally connected); (3) memperkuat kemampuan SDM dan IPTEK nasional untuk mendukung pengembangan program utama di setiap koridor ekonomi. Pelabuhan Hub Internasional Gerbang Barat Indonesia Koridor Ekonomi Sumatera sudah diindikasikan investasi galangan kapal yang memanfaatkan SLoC dan Selat Sunda sebagai ALKI-1. Dalam jangka panjang pengembangan galangan kapal khususnya untuk reparasi akan dikembangkan mendekati pelabuhan besar seperti di Kepulauan Karimun – Provinsi KepulauanRiau(mendekatiSingapura), Pelabuhan Belawan, dan Kuala

PERTEMUAN Bupati Batu Bara di rumah dinas Menko Perekonomian Hatta Rajasa sehubungan berakhirnya perjanjian induk PT Inalum 2013, di mana dalam pertemuan tersebut disampaikan bahwa Pemerintah Kabupaten Batu Bara menyambut baik langkah-langkah yang dilakukan pemerintah pusat, khususnya dalam meningkatkan kesejahteraan masyarakat 10 kabupaten/ kota serta Pemerintah Kabupaten Batu Bara meminta Kementerian Perindustrian melakukan pengembangan industri berbasis aluminium di Kuala Tanjung, mengingat Kabupaten Batu Bara siap dengan prasarana pendukung baik pelabuhan, bahan baku alumina yang diproduksi PT Inalum. Pertemuan tersebut merupakan cikal bakal komitmen Menko dan Menperin, bukan saja membangun industri berbasis aluminium tapi membangun pelabuhan internasional Kuala Tanjung yang terdiri dari pelabuhan multi purpose di samping dermaga PT Inalum dengan 3 dermaga dan pelabuhan internasional peti kemas di Desa Perupuk. Tanjung yang akan dikembangkan menjadi Alternatif Pelabuhan Hub Internasional di gerbang barat Indonesia. Sedangkan galangan untuk pembuatan kapal baru akan dilakukan di Dumai – Riau. Pengembangan industri galangan kapal di Koridor Ekonomi Sumatera diharapkan dapat menggantikan peranKoridorEkonomiJawayang lebihmembatasipengembangan industri-industriberatdan“kotor”. Wilayah Kuala Tanjung di Kabupaten Batu Bara merupakan lokasi Pelabuhan yang sangat tepat dijadikan Pelabuhan karena berada langsung di laut lepas dan tidak memiliki alur sungai yang mengakibatkan pendangkalan. Sebab itu Kuala Tanjung tidak perlu dilakukan pengerukan. Atas dasar pertimbangan tersebut maka Pembangunan Pelabuhan Internasional Kuala Tanjung menjadi prioritas untuk Hub Global di sisi Barat Indonesia. Pengembangan Sei Mangke Salah satu langkah produktifitas industri sawit dilakukan pengembangan pengelolaan sawit dari hulu hingga hilir, dengan di motori oleh PTPN 3 pengembangan pengelolaan sawit dilaku-

kandikawasanindustriSeiMangke, yang berada di Kabupaten Simalungun. Kawasan Industri pengolahan sawit merupakan industri terintegrasi yang pada saat awal ditujukan pada pengolahan 38 turunan sawit dari lebih 70 macam turunan baik produk konsumsi, kecantikan dan produk kimia lainnya. Pengembangan kawasan Sei Mangke tidak berdiri sendiri dikarenakan perlu dukungan sarana prasarana pelabuhan dan transportasi mobilisasi sarana produksi mau pun hasil produksi. Pemerintah melalui MP3EI telah menentukan pilihan yang sangat tepat dikarenakan kawasan Sei Mangke didukung oleh PTPN 3 yang memiliki pengalaman yang sangatluasdibidangindustrisawit sertakeberadaanKabupatenBatu Barasebagaipenyediasaranapendukung khususnya pelabuhan. Proyek-Proyek MP3EI di Kabupaten Batu Bara Kabupaten Batu Bara sebagai salah satu Kabupaten termuda yang pada saat ini usianya telah memasuki tahun ke-3, namuntelahmendapatperhatian pemerintahpusat.Inidisebabkan keberadaanwilayahTimurKabupaten Batu Bara sebagai calon

lokasi pelabuhan yang terbaik bukan sajakarenaberadadiSelat Malaka, namun memiliki kedalaman dari 13 hingga 28 m dari permukaanairlautsertatidakpernah mengalami pendangkalan. Hal ini juga tidak terlepas dari dukunganbesarpemerintahpusatatas langkah-langkah yang telah dilakukan Bupati Batu Bara, dalam menjual potensi yang dimiliki. Masterplan Percepatan Perluasan Pembangunan Ekonomi Indonesia (MP3EI) dalam koridor Sumatera telah menetapkan pembanguan fisik dalam mendukung Lokus yang akan dilakukan berupa pembangunan proyek di beberapa tempat. Khusus di Kabupaten Batu Bara MP3EI menempatkan 5 proyek yang sedang dan akan dimulai. Ke lima proyek saling ketergantungan dengan Kawasan Industri Sei Mangkei di mana Kabupaten Batu Bara sebagai penyedia akses transportasi dan pelabuhan, sedangkan penyelesaian proyek ini sejalan dengan daya dukung dan operasional KISM sehingga keberadaan akan menopang operasional transportasi baik barang maupun tenaga kerja yang akan bekerja di KISM.

Kuala Tanjung, Pelabuhan Internasional SELAIN MP3EI, Kabupaten Batubara juga menjadi lokasi dari program pembangunan nasional yang lain. Presiden RI melalui Peraturan Presiden (Perpres) No. 26 tahun 2012 tentang cetak biru pengembangan sistem logistik nasional, menetapkan Kuala Tanjung Kecamatan Sei Suka Batubara sebagai Pelabuhan Internasional. Hanya dua pelabuhan Internasional di Indonesia nantinya. Satu lagi adalah pelabuhan Bitung di Sulawesi. Program pembangunan Kuala Tanjung International Hub Port (KTIHP) akan dilakukan bertahap, 2012 hingga 2030. Mengapa Kuala Tanjung. Indonesia belum memanfaatkan keunggulan geostrategis untuk membangun daya angkat dan daya dorong pada perekonomiannya. Selama ini Indonesia terjebak pada pola teknokrasi ekonomi negara tetangga dalam mengelola aset dan akses dalam wilayah. Hal mana membuat posisi daya saing ekonomi Indonesia termarginalisasi dan berpotensi membahayakan integritas nasional. Selat Malaka merupakan jalur logistik pelayaran dan perdagangan dunia. Sekitar 120 ribu vektor pelayaran dunia yang melalui Selat tersebut mengangkut 30-35 persen volume perdagangan dunia. Indonesia lost terlalu besar terhadap strategi ekonomi negara tetangga. Pada 2009, Indonesia membayar biaya transshipment tak kurang dari US$ 3 billion. Nilai tersebut tidak termasuk Feeder shipping cost yang mencapai sekitar Rp100Trilyun. Hampir mustahil bagi Indonesia untuk membangun kemandirian, daya saing dan yang terpenting Integritas Ekonomi Nasional di pasar global. Tentu berdasarkan kajian, perairan Kuala Tanjung memiliki berbagai keunggulan. Di antaranya, * Direct access ke Selat Malaka . Geo posisi dan aset memberdayakan ekonomi nasional. * By Destination dan Origin: Melayani Ekspor dan Impor Nasional ke dan dari: Eropa , Timur Tengah , Afrika, Asia Selatan dan Asia Timur. Melayani Pelabuhan Feeder di Tanah Air.

* Memperoleh manfaat besar dari asset terbangun (port, energi, infrastruktur). * Modalitas fisik dan ekologi mudah dikembangkan menjadi pelabuhan hub internasional. * Modalitas strategis dan lokomotif daya saing ekonomi nasional. * Cut off ketergantungan kronis transhipment dan feeder logistik ekonomi negara tetangga, dan meningkatnya daya saing ekonomi Indonesia di pasar global. * Memperbaiki posisi/leverage diplomasi indonesia dengan negara tetangga di semua lini. Kemudian Kuala Tanjung memiliki daya dukung inti dan sumber daya bagi KTIHP, yaitu: leverage global Pantai Timur Sumatera Utara. “Tiada lokus di wilayah Indonesia yang berkeunggulan Geostrategis seperti Sumut”. 1. Berhadapan Langsung Dengan Selat Malaka (Jalur Utama Perdagangan Dunia) yang membuat Sumut mempunyai Direct Access kepada Pasar 3,9 Miliar jiwa (China-asia Timur, IndiaAsia Selatan) 2. Kemampuan Adaptasi Terhadap Climate Change (Arable Land Status To Climate Change Moderate) 3. Cadangan Air Permukaan per kapita sangat besar (sekitar 17 Persen Cadangan Air Permukaan Nasional). 4. Access Large Marine Ecosystem (Wilayah Perikanan Global)) 5. Mempunyai Daya Dukung Energi Bersih) (Hydro, Geothermal, dll) 6. Mempunyai Pilar Industri Berbasis PanganYang Kuat (Global Food Security Demand) 7. New International Hub Airport Kuala Namu, (2025) Kapasitas 10 Juta Passengers Per Year * Feeder Ports: Palembang, Dumai, Tanjung Priok, Panjang, Pontianak, Pangkalan Bun, Tanjung Mas, Tanjung Perak, Bojonegara, Cirebon, Makassar, Benoa, Banjarmasin, Mataram, dll.

RENCANA Pembangunan Kuala Tanjung International Hub Port

Warga Mandailing Julu Harapkan Damkar PANYABUNGAN(Waspada): Warga kawasan Mandailing Julu khususnya Kec. Kotanopan mengharapkan kepada Pemkab Madina agar mobil pemadam kebakaran (damkar) dapat distand bay-kan di daerah itu. Usulan masyarakat ini mencuatmengingatpelaksanaan penanggulangan bencana kebakaran di daerah itu kendalanya mobil kebakaran yang jarak tempuhnya cukup jauh dari ibu kota Panyabungan. Keinginanitudikatakantokoh

1 CM 2 CM

Rp. 12.000 Rp. 24.000



Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


pemuda Kotanopan Harun Arrasyid Lubis kepada Waspada, Jumat (7/9). “Kita berharap Pemkab Madina memberikan satu mobil pemadam kebakaran untuk stand bay di daerah Kotanopan, sehingga jika terjadi kebakaran dapat ditangani dengan cepat, jangan habis terbakar dulu baru mobil pemadam datang, seperti kejadian kebakaran salah satu rumah penduduk di Desa Usor Tolang dua hari lalu,” ujarnya. Kita dapat membayangkan,

3 CM Rp. 36.000 4 CM Rp. 48.000

Informasi Pembaca : Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

PROMO DAIHATSU BARU ! Xenia DP 18Jt. Terios DP 22 Jt Pick Up DP 9 Jt. Extra Discount ! Hub. 0821 6156 3900

SEPT. CERIA XENIA 18 JT GMax 9Jt, Terios, Luxio, Cicil Mulai 90 Rb/Hari. Hub. 0813 60333 609/ 77387369 PAKET CERIA SEPTEMBER DAIHATSU

Xenia DP 19 Jt-an Angs. 3 Jt-an Pick Up DP 9 Jt-an Angs. 2 Jt-an Terios DP 212Jt-an Angs. 5 Jt-an Luxio DP Murah. Full Disc, Ready Stock H u b : IRNANDA 0813 7580 2895 / 0821 6761 2659


- All New Xenia DP 20 Jt-an..... Angs. 3Jt-an - Pick Up Gran Max DP 10 Jt-an..Angs.2Jt-an Hub. TEDDY Capella 0812 6325 656 / 77884663


Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 4 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067 Xenia, Terios, Luxio, Sirion Granmax MB. PU + Bonus Proses Cepat Data dijemput Hub. Lenny 0813 7052 4546


# DAIHATSU PROMO # Dapatkan Potongan Khusus Di bulan ini!!! Ready Stock: Xenia, Terios, Granmax MB & Pick Up Luxio. DP Murah, Angsuran Ringan, Proses Cepat. Hub. FERRY 0821 6736 3637

PROMO DAIHATSU BARU XENIA DP MULAI 20 Jt-An, Terios DP Mulai 30 Jt-an. Pick - Up DP Mulai 11 Jt-an Hub: HASIBUAN ASTRA 0812 6362 4634 PROMO ASTRA DAIHATSU

All New Xenia DP 14 Jt-an, Terios DP 17 Jt-an Pick Up DP 12 Jt-an, Luxio DP 16 Jt-an Hub. 0813 6100 7907 / 0812 69434327 (Terima Tukar Tambah)


5 CM 6 CM

katanya,jaraktempuhyangcukup jauhdariibukotakabupatenyaitu Panyabungan ke Kotanopan yang bisa makan waktu satu jam. Artinya, sulit bagi petugas pemadam kebakaran untuk mengejar kejadian. Lokot Husda Lubis sebagai tokoh masyarakat di daerah itu mengungkapkan, yang menjadi kendala salama ini dalam penanganan bencana memang lebih banyak karena faktor geografis. Terkait dengan ini, dia meminta agar dibentuk Unit Pelaksana

7 CM 8 CM

Rp. 91.000 Rp. 104.000



3 Jam Cair, Tanpa usaha, Black list bank, Jaminan: SHMN, SK Camat, HGB, Pabrik, Projet, BPKB mobil, Spd motor, Mobil kredit, Pencairan 3 Jt - 500 Milyar Hub: Bpk. Roy 0813 7044 6633 - 0813 7044 6668

BUTUH DANA CEPAT Syarat BPKB dan Surat Tanah. Hub. 0813 7059 0264





Power QSC 1 PW. 850 Beta 3 2000W (2,5) 660 W (1.8) 1.600 (3.2) Sound Standard 2000W (3.0) 3600 (4.5) 2000 W (4.0) BMB Data 1, 2, 11, 21, 55 Hitam. Spk BMB 10, 12, Terima Visa 0%. Jl. Indragiri 25 Dkt. Asia 061-734 5487





Rp. 900.000 Rp. 1.000.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.400.000 Rp. 1.600.000


Dua unit tinggi 105cm dan 145cm, Lain Lemari, Filing cabinet, Msn tik, Facsimil, Printer LX300/2180 Hub. 0852 9631 1464 TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

* TOYOTA BARU 2012 * All New Avanza...........Angs. 3.446.000,Kijang Innova...............Angs. 4.553.000,New Yaris......................Angs. 4.412.000,New Fortuner...............Angs. 9.809.000,New Rush......................Angs. 4.559.000,Tersedia Toyota tipe lainnya Proses Mudah & Cepat H u b : 0852 7515 0363 (Dealer Resmi Toyota)


Innova, Avanza, Rush, Fortuner, Yaris, Altis, Hilux, Dyna, Bisa Tukar Tambah Dgn Mobil Bekas Anda Cash & Credit, data dijemput. Hub. 0812 6064 9479 (Benny Nadeak)


READY STOCK: Avanza, Innova, Rush, Fortuner, Yaris, Hi-Lux, Vios, Camry, Kredit s/d 5 thn, Bunga 0% (1 Thn). Souvenir, Full Discount Pasti...!!! Hub: 0853 5939 7782 / 061-6966 8484


Avanza, Innova, Fortuner PURBA: 0813 9736 0333






Surat Keterangan Tanah Jl. Balai Desa Gg. Imam No. 20 D Kelurahan Medan Polonia. Atas Nama Hotma Marbun dan Martuasa Marbun.





HP. 0813 7035 7291 Ada Garansi



0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi



SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188



Anda Butuh Perabot Jepara Asli?

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243



1 meter s/d 10 meter, ada berupa uang Rp50.000 s/d Rp2 juta,” ujar H. Muin mengakui infaq baru terkumpul Rp120 juta dari 354 orang yang berinfaq dan masih kurang Rp80 juta lagi. Karena itu pulalah, dia mengharapkan para dermawan/putra daerah Labuhanruku dan Batubara yang berada di luar daerah seperti di Medan, Sibolga, Malaysia, Jakarta dapat membantu mengirimkan infaqnya ke alamat H. Muin Ketua BKM. (a12)

Senin, 10 September 2012

FAX.4561347 Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput



Perusahaan kami yang bergerak dibidang Perkebunan & Pengeloaan Kelapa Sawit, membutuhkan tenaga kerja ahli dan profesional untuk ditempatkan pada posisi:


Requirements: 1. Pria, berusia maksimal 35 tahun 2. Pendidikan minimal : S1 Akuntansi 3. Memiliki pengalaman sebagai Budget Control 4. Computer skills: Ms Office 5. Memahami dan mengetahui proses Operasional Kebun dan Pabrik serta pelaporannya 6. Mampu mengkoordinir perumusan strategi jangka panjang sebagai dasar perumusan Rencana Kerja dan Anggaran Perusahaan (RKAP) 7. Dapat mengkoordinir dalam penyusunan rencana kerja dan anggaran unit kerja serta mengontrol pelaksanaannya untuk memastikan pencapaian kinerja sesuai dengan Rencana Kerja & Anggaran Perusahaan 8. M e m i l i k i k e m a m p u a n d a l a m M e n y u s u n a n g g a r a n b i a y a perusahaan dan menjaga agar kegiatan operasional perusahaan dapat berjalan dengan efisien dan efektif sesuai anggaran yang telah dialokasikan 9. Kemampuan untuk membangun hubungan kerja yang baik 10. Bersedia melakukan perjalanan dinas ke Kebun dan PMKS secara periodic 11. Penempatan di Kantor Medan Surat lamaran lengkap dan foto copy ijazah terakhir, CV, Foto copy KTP, pas photo terbaru 4x6: 2 lembar dan referensi kerja dikirim ke:

TK. Pangkas yg berpengalaman Jaminan Rp. 60.000/perhari Hub. Pangkas Simpati Jl. Jamin Ginting dan Pegawai Mie Aceh HP. 0813 9740 4040


Kami perusahaan yang bergerak dibidang Telekomunikasi, membutuhkan beberapa karyawan/ Teknisi sbb: - Pria (muslim) 18 - 22 tahun - Min. (SMU/ SMK/ sederajat) - Memiliki kendaraan + SIM C - Pengalaman kerja tidak diutamakan Lamaran diantar langsung ke: Jl. Pukat II No. 77 Medan, jam kerja (1 minggu)

PECI MAHKOTA BKB NURUL FIKRI MEDAN MENJUALPECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA



Pedoman Tata Cara Membaca AlQur’an dengan baik dan benar untuk anak-anak dan dewasa Bersedia mengajar ke rumah Call: H.JALALUDDIN HP. 0853 6007 4112




MULAI BELAJAR: Gelombang 1: Senin, 03 September 2012 Gelombang 2: Senin, 10 September 2012 Daftarkan Segera Juga Di Lokasi Belajar BT/BS MEDICA Jl. Bantam No. 12 Medan, Telp. (061) 4578058 Jl. Iskandar Muda No. 19B Medan Telp. (061) 415 9280 Atau Hubungi/SMS ke: - Jonris M, S.Pd (085279556481) - Basri Ginting, S.T. (0812 6396209) - Ir. Tagor Silalahi (08126493252) Pendaftaran sudah dibuka ... !!



Minggu(9/9),selamaenambulan BKM berhasil mengumpul infaq masyarakat sebanyak Rp120 juta dan masih kurang Rp80 juta lagi melunaskanhargatanahtersebut. Untuk membayar harga tanah ukuran85x14,30meter(luas1215 m2) itu ditentukan/diperhitungkanhargatanahRp165.000/meter. Berdasarkan itu diharapkan kepada para dermawan/masyarakat yang mau berinfaq bisa menghubungiBKM.“Alhamdulillah yang berinfaq bervariasi ada yang

Jl. Kapten Maulana Lubis No. 9 Medan




LABUHANRUKU (Waspada):Untukmenambahperluasan komplek Masjid Ar-Rahman Labuhanruku, Talawi, Batubara dibutuhkan dana Rp200 juta “Melalui rapat BKM disepakati mencari dana untuk perluasankomplekmasjidmembelitanah di samping sebelah kiri masjid denganhargaRp200juta,”kataKetua BKM Ar-Rahman Labuhanruku H. Muin didampingi Bendahara H. Zaiyat, Minggu (9/9). Menurut H. Muin sampai



- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954

# ISUZU 100% BARU #

HARI INI # NISSAN #NewTERMURAH All Nissan Evalia, G. Livina, Juke, March, Xtrail Diskon Serta hadiah menarik dalam minggu ini BARU Dapatkan Hub. LAMASI PAKPAHAN 0853 5980 3295 - 0821 6158 1118

Pelanggan Yang Terhormat



Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

Komplek Masjid Ar-Rahman Labuhan Ruku Diperluas

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000



Panther Pick Up Turbo................DP. 19 Jt-an Panther LM, LV, LS, Touring........DP. 50 Jt-an Hub. Suprapto 061-77860168 / 0813 75070088

11 CM Rp. 165.000 12 CM Rp. 180.000

Apabila anda mencurigai sesuatu, silahkan hubungi kami di

Ready Stock Potongan Khusus Terios DP 30 Jt-an. Xenia DP 20 Jt-an Pick Up DP 11 Jt-an. Jamin OK. Data dijemput. Hub. PAIREN 0812 6305 0708

MERCY 230 E Abu- Abu Met Thn. 91, BK 2 angka Sgt orisinil, mewah sekali, mesin sehat, AC Dingin, mobil simpanan, Hrg. 55 Jt. Nego. Abis. Hub. 0823 6635 9858

9 CM Rp. 126.000 10 CM Rp. 140.000


1 jt s/d 10M Jaminan SHM, SK Camat, Proses Bank/Non Bank. BPKB Mobil masih kredit jg bisa. Hub. Maya 0853 6262 2303


Kecamatan Kotanopan mengakibatkan satu unit rumah milik Lolotan Lubis, ludes dan rata dengan tanah. “Kalau saja bantuan tidak ada dari warga tetangga, kemungkinan banyak rumah warga yang terbakar. Kemudian rumah Lolotan diperkirakan tidak akan ludes, jika saja mobil pemadam ada di Kotanopan, mengingat waktu tempuh ke lokasi hanya beberapa menit saja,” jelas salah seorang penduduk desa itu. (a28)

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab



Teknis di setiap wilayah di daerah itu. Dikatakannya,sudahsaatnya mobilpemadamkebakaranstand bay di Mandailing Julu khusunya di Kec. Kotanopan. “Keinginan warga ini tidak bisa ditawar-tawar lagi,karenanyaCamatKotanopan harus segera menyampaikan persoalaninikePemkabMadina,” ujarnya. Berdasarkan infomasi dihimpun, pada Senin ( 3/9) lalu sekira pukul 12:30, sijago merah mengamuk di Desa Usor Tolang


Rp. 65.000 Rp. 78.000




Sumatera Utara

WASPADA, Senin 10 September 2012


Butuh cepat P/W (17-35thn) sebagai “MITRA KERJA” di kantor (100% bukan Sales), syarat: - Pend. min SMU sederajat/pengalaman tdk diutamakan - Bawa foto copy KTP 1 lbr - Bawa guntingan iklan utk interview yg lain menyusul Penghasilan Rp. 1.200.000-Rp. 2.000.000/ bln + Harian Hub: Bpk. Riko/ Ibu Widya HP. 0821 6621 2934 - 0813 7512 6435 Alamat: Jl. Orion No. 55 (disamping Medan Plaza) Medan NB: 15 orang pelamar pertama langsung diterima, terbuka bagi mahasiswa/i

LOWONGAN KERJA Dibutuhkan beberapa orang tenaga kerja untuk ditempatkan pada posisi: a. Reception b. Room Boy c. Waiter/es d. Gardener Syarat-syarat: 1. Pria/ wanita 2. Berpenampilan menarik 3. Pendidikan min. SMU sederajat 4. Usia max. 25 thn Lamaran ditujukan ke: Jl. Hayam Wuruk No. 11B Dengan kode “HTL” Paling lambat 7 hari setelah iklan diterbitkan



Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik


Rumah 1½ LT, Type 45, 2 KT, 1 KM, Villa Setia Budi Makmur Blok F-1, Jl. Setia Budi Simp. Selayang Hub HP: 0821 78597 597/ TP


Komplek Perumahan Darma Deli. Pasar I Saentis Jl. Manduda Block B No. 161. 1 Km. Dibelakang KIM 2. LB. 7x10M LT. 10x20 M. 2 K. Tidur - Full keramik - Sertifikat Rp. 160Jt. Bisa Bantu KPR. 0812 6019 1709






Kembalikan kesehatan N tingkatkan kekebalan tubuh Hub: P’De Anto: 0853 6280 3792



Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR


Perusahaan MALAYSIA MARINE AND HEAVY ENGINEERING HOLDING SDN BHD (anak cabang Petronas) yang berada di Johor, Malaysia, memerlukan pekerja Laki-laki sebagai tenaga ahli. Dengan persyaratan sebagai berikut: 1. Laki-laki berumur antara 20 - 35 tahun 2. Pendidikan minimal SMU, STM/ sederajat 3. Kontrak kerja 2 tahun 4. Mendapat izin dari orang tua/ keluarga Fasilitas dan gaji: 1. Gaji pokok RM 1000 2. Gaji tidak termasuk lembur 3. Asrama dan transport disediakan gratis 4. Dilindungi oleh asuransi selama bekerja Jika berminat segera mendaftar dengan membawafotocopyIjazah,KTPdanpasphoto masing-masing 2 lembar, Curiculum vitae (Daftar Riwayat Hidup) dan refrensi pengalaman kerja dapat diikirim melalui atau diantar langsung ke alamat berikut:


Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333






Bakoel Ubud mencari wajah-wajah baru untuk ditempatkan sebagai: I. WAITER, dengan syarat-syarat sebagai berikut: 1. Pria/ wanita usia maksimal 25 tahun 2. Tinggi badan minimal 168cm (pria) dan 160cm (wanita) 3. Tamatan SMU, SMIP atau sederajat 4. Berpenampilan menarik, sopan dan ramah 5. Rajin, jujur dan dapat berkomunikasi dengan baik 7. Harus menguasai Bahasa Inggris minimal pasif 8. Berbadan sehat dan berkelakuan baik II.CASHIER , dengan syarat-syarat sebagai berikut: 1. Wanita, usia maksimal 25 tahun 2. Tinggi badan minimal 160cm 3. Tamatan SMU atau sederajat 4. Berpenampilan menarik, sopan dan ramah 5. Teliti, rajin, jujur dan bertanggung jawab 6. Menguasai bahasa Inggris minimal pasif 7. Berbadan sehat dan berkelakuan baik III. KITCHEN STAFF, dengan syarat sebagai berikut: 1. Pria, usia maksimal 25 tahun 2. Tamatan SMU, SMIP atau sederajat 3. Sopan, ramah dan dapat berkomunikasi dengan baik 4. Rajin dan jujur 5. Kreatif dan suka bidang kuliner 6. Berbadan sehat dan berkelakuan baik Bagi yang berminat dan memenuhi syarat, silakan membawa surat lamaran Anda lengkap pas photo 1 lembar, foto seluruh badan 1 lembar Daftar Riwayat Hidup, Fotocopy KTP dan Ijazah serta cantumkan No. HP/ telp yang dapat dihubungi Lamaran diantar langsung ke:

(Untuk reumatik & asam urat)


Setiap hari dari jam 11.00 wib s/d 18.00 wib Selambat-lambatnya 10 (sepuluh) hari dari tanggal iklan ini diterbitkan Lamaran tidak perlu menggunakan materai dan hanya pelamar yang kami nilai memenuhi syarat yang akan dipanggil untuk wawancara.

Ingin Promosikan Produk Anda Harian


Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887

Media yang Tepat untuk Iklan Anda

Sumatera Utara


WASPADA Senin 10 September 2012

Arena Judi Pasar Horas Makin Marak Kapoldasu Diminta Sidak Ke P. Siantar PEMATANGSIANTAR (Waspada): Permainan judi dengan menggunakan sarana biliar dan kartu digelar di lantai tiga Pasar Horas kota Pematangsiantar tampak semakin marak, bahkan para siswa yang sengaja bolos dari sekolahnya semakin mendominasi di arena perjudian tersebut, Sabtu (8/9). Walau keluhan dari anggota masyarakat di Pematangsiantar semakin kencang disuarakan, namun pihak aparat kepolisian masih belum turun tangan untuk bertindakmenghentikanaktivitas permainan judi tersebut. “Kami tidak yakin polisi tidak mengetahui permainan judi di

lantai tiga Pasar Horas ini,” kata pedagang yang membuka usaha penjualan emas di lantai dua, tepat di bawah arena perjudian itu, kemarin. Dia malah mengaku pesimis, permainan judi itu dapat ditertibkan petugas di daerah ini. Dia meminta Kapoldasu turun untuk

Santer, Sekda Madina Segera Diganti PANYABUNGAN(Waspada):SekretarisDaerah(Sekda)Mandailing Natal M. Daud Batubara akan segera diganti. Benarkah? Ternyata, informasi ini demikian santer terdengar di berbagai kalangan di Madina, termasuk di kalangan birokrasi bahkan sudah merebak sampai di tingkat masyarakat. Bahkan dikabarkan, pengusulanpergantiaanSekdaMadinasudahsampaikemejaGubernur Sumatera Utara, namun sampai sekarang belum turun. SaatWaspada mencoba menjumpai beberapa narasumber yang berkompotenterkaitdenganisupengusulanpergantianSekdaini,kemarin, semuamengatakanhanyamendengarsaja.Soalkepastianapakahsuratnya sudah diusulkan atau tidak, belum ada yang bisa memastikan. Sedangkan Ketua Peradi Tabagsel H. Ridwan Rangkuti, SH, MH yang dimintai tanggapannya terhadap isu pengusulan pergantian Sekda Madina ini mengatakan, kalau isu itu benar, maka kita menyambut baik langkah Bupati Madina mengganti Sekda. Dia juga menilai, Sekda Madina tidak mampu menjadi perekat hubunganbupatidenganwakilbupati,malahanyangterjadisebaliknya, kehadiran Sekda yang nota bene dari keluarga bupati justru cenderung memperuncing keharmonisan bupati dan wakil bupati. Kabag Humas dan Protokoler Pemkab Madina M. Haposan yang dikonfirmasi terkait kebenaran isu belum berani memberikan keterangan kebenaran isu itu. “Saya juga mendengar isu itu, namun belum tahu kebenaran informasinya,” katanya. (c15)

Halal Bi Halal INNA Parapat PARAPAT (Waspada): Keluaga Besar INNA Parapat mengadakan silaturahmi dan halal bi halal di Simalungun Restaurant INNA Parapat, Jumat (6/9). Diawali dengan makan malam dan pembacaan ayat suci Alquran oleh Namira Siregar dan Mira Prapti Ningsih. Acara tersebut juga dihadiri Direktur Utama PT. Hotel Indonesia Natour, tokoh masyarakat, pemuka agama, karyawan karyawati, Muspika, pensiunan INNA Parapat dan undangan. Dalam sambutannya General Manager INNA Parapat Efi Leliani, SE mengatakan, acara ini untuk meningkatkan silaturahmi sekaligus saling memaafkan sekaligus merajut kebersamaan untuk mencapai keberhasilan. GeneralManagerINNAParapatmemberikancenderamataberupa ulos kepada Direktur Utama PT. HotelIndonesia Natour, IntanAbdams Katoppo dan cenderamata kepada para pensiunan dan dilanjutkan pandangan umum oleh KUA Kec. Girsang Sipangan Bolon. (crn)

Penulis Judi Ditangkap PEMATANGSIANTAR (Waspada): Seorang petani diduga penulis perjudian jenis judi Hongkong, AS, 42, alias Pak Andi, warga Dusun Baru, Desa Dolok Marlawan, Kec. Siantar, Kab. Simalungun ditangkap Polsek Bangun, Polres Simalungun. Turut disita dari AS barang bukti diduga uang hasil penjualan judi Hongkong Rp1.954.000, satu unit HP berisi angka-angka tebakan judi Hongkong dan dua pulpen. Penangkapan terhadap AS dilakukan Polsek Bangun di dalam warung milik Yanti Manurung di Dusun Mulia Tani, Desa Dolok Marlawan, Kec. Siantar, Simalungun, Kamis (6/9) pukul 21:00. Penangkapan terhadap AS dilakukan pihak Polsek Bangun sesudah mendapat informasi dari masyarakat yang menyebutkan di dalam satu warung sedang berlangsung perjudian jenis judi Hongkong. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi Sabtu (8/9) menyebutkan kasus perjudian jenis judi Hongkong itu masih dalam proses penyelidikan dan pengembangan terhadap tersangka bandar judi Hongkong itu. (a30)

melihat langsung permainan itu ke kota ini. Hal itu kata pedagang seperti yang dilakukan Kapoldasu melakukan sidak ke Batubara beberapa waktu lalu yang akhirnya mencopot jabatan Kapolres di daerah itu karena dinilai tidak mampu berbuat banyak untuk daerahnya. Pantauan Waspada di lantai tiga Pasar Horas itu, Sabtu sekira pukul 09:30, permainan judi

dengan taruhan uang mulai dari Rp5 ribu sampai puluhan ribu rupiah dimainkan para pengunjung berseragam sekolah baju putih dan celana abu-abu, yang datang dari berbagai sekolah di kota itu. Hal itu terlihat dari tanda pengenal yang mereka kenakan. Dari kalangan pengelola permainan judi di lantai tiga Pasar Horas tersebut, diperoleh keterangan, kalau usaha mereka

diketahuipimpinandanstafdiDinas Pasar Kota Pematangsiantar. Sebelumnya, sebut salah seorangpengelola,merekameminta izin agar usaha taruhan yang mereka buka letaknya tepat di belakang kantor Dinas Pasar di lantai tigapasaritu.NamunpihakDinas Pasar mengarahkan agar permainan itu dibuka sedikit jauh di belakang kantor dinas. “Makanya dibuka di lokasi ini,” ujarnya. (c16)

Abang Tikam Adik Dan Ipar PAKPAK BHARAT (Waspada): Dituding ikut campur urusan rumah tangga, LS, 34, warga Dusun Lae Leam, Desa Surung Mersada, Kec. Kerajaan, Kab. Pakpak Bharat menikam ipar dan adik kandungnya sendiri dengan menggunakan sebilah belati. Anto Manik, 35, dan Martua Sinaga, 32, yang menjadi korban, keduanya warga Dusun Lae Leam,DesaSurungMersada,Kec. Kerajaan. Informasi dihimpun Waspada

kemarin sekira pukul 09:30, LS merasaipardanadiknyamerupakan otak di balik larinya sang istri dari rumahnya. Merasa tidak senang dengan tindakan kedua saudara dekatnya itu, LS secara membabibuta menikam Anto iparnyadanmengalamilukatusukansebanyakduakalidibagianperut. Sementara Martua, adik kandung tersangka mengalami luka tusuk tiga kali di bagian tangan, dada, dan lehernya. Karena luka yang diderita korban terbilang parah kedua korban langsung

dilarikan ke RSUD Sidikalang, Kab. Dairi untuk mendapatkan perawatan lebih intensif. Menurut T. Sinaga salah seorang saksi yang juga masih famili tersangka, istri LS pergi meninggalkanrumahakibattidak tahan dengan perlakuan kasar yang kerap diterimanya. “SiLSitukalaumemukuliistrinya seperti kerasukan, dia memukuli istrinyasepertimemukuliseorang musuh, padahal mereka sudah memiliki tujuh anak yang masih kecil-kecil,” ujarnya. (csb)

Jalan Menuju Aek Marian Masih Jalan Setapak PANYABUNGAN(Waspada): Jalan kabupaten menuju Desa Aek Marian Simandolam, Kec. Kotanopan sampai saat ini kondisinya memprihatinkan. Betapa tidak, di tengah era kemajuan zaman ini, jalan ke desa ini masih jalan setapak. Akibat masih minimnya sarana jalan ke desa ini, sehari-hari warga terpaksa berjalan kaki 3 km. PantauanWaspadadilapangan, Minggu (9/9), jalan ini seperti tidak ada yang mengurusnya. Rute jalan tersebut rusak total dansangatsulitdilintasikendaraan rodadua.Masyarakatpejalankaki juga terpaksa bergelut dengan badan jalan berlumpur. Di titik jalan berlumpur, terlihat anak-anak sekolah melintas dengan penuh perjuangan ekstra dan terpaksa jalan kaki akibat banyaknya terdapat kubangan air dan lumpur dengan kedalaman 40 hingga 50 cm. Tampak, kerusakan jalan ini mulaidarisimpangMuaraPangkase sampaikeDesaAekMarian.Selain jalan setapak di badan jalan juga dipenuhi batu-batu besar dan lubang-lubang yang d genangi air sertailalangsetinggilutut.Akibatnya, sangatmenyulitkanbagimasyarakat pengguna jalan. Kondisi ini juga sangat mempengaruhi terhadap perekonomian warga, sebab Desa Aek Marian selama ini terkenal dengan

penghasil sayuran dan perkebunan, namun karena kendala sarana transportasi hasil pertanian dan perkebunan itu sulit untuk dipasarkan ke pasar terdekat. KepalaDesaAekMarianAlpin saat dijumpai mengatakan, kondisi jalan ini sudah berlangsung enam tahun lebih. Jalan ke desaitudulunyapernahdibangun dengan onderlak dan kenderaan roda empat saat itu sempat masuk sampai ke desa. Namun karena bencana gempa empat tahun lalu, badan jalan menjadi longsor dan tertimbun tanah, sehingga badan jalan menjadi setapak dan ditumbuhi rerumputan setinggi lutut. Ia mengungkapkan, saat ini kenderaan roda empat sama sekali tidak bisa masuk ke desa tersebut. “ Kalaau mau kemari harus berjalan kaki, kalau mau naik sepedamotor memang bisa, tapi harus hati-hati mengingat sempitnya badan jalan ditambah lagi di kiri kanan jalan terdapat jurangyangdalam.Selainitu,batubatu besar juga berserakan di badanjalanditambahlagidengan kondisi badan jalan yang masih tanah ,” ucapnya baru-baru ini. Menurutnya, kerusakan ini sangat menganggu masyarakat, terutama bagi warga yang mau membawa hasil alam dan kerajinan rumah tangganya ke Pasar Kotanopan.Selamatigatahunini,

parawargaterpaksamemikul hasil panensayurandanrumahtangganya ke Simpang Muara Pangkase. Biasanyasayurdankerajinanrumah tangga berupa sapu ijuk, dulang danlesungdarisinikeluarhariSelasa, Kamis dan Sabtu. Agar jangan terlambat, warga biasanya berjalan kaki pagi-pagi sekali sekira pukul 04:00 dengan menggunakan lampu teplok atau obor dengan melewati belantara. Dapat kita bayangkan berapa banyaklah sayuran yang bisa dibawa dengan tenaga manusia. “Sebagai desa terpencil, desa kami yang berpenduduk sekira 300 jiwa lebih ini belum juga menikmati lampu penerangan listrik.Warga setiap malam hanya mengandalkan lampu teplok kemana-mana. Ketiadaan penerangan inijugasangatmenganggu kami, apalagi anak-anak usia sekolah terkendala dalam belajar. Kita merasa desa ini seperti dianaktirikan, sebab kita sudah puluhan tahun merdeka, namun kami belum meningkmati jalan yang lumayan,” terangnya. Dia berharap Pemkab Madina memperhatikan nasib desa ini.“UsulanbaikmelaluiMusrembang dan reses sudah sering kita sampaikan, namun sampai sekarang belum pernah ada realisasinya. Saat ini kita sangat mengharapkan perbaikan jalan dan penerangan,” jelasnya. (a28)

Pemkab Harus Serius Tangani Perubahan Status Hutan PAKPAK BHARAT (Waspada): Pemerintah Kabupaten Pakpak Bharat diminta serius dalam menangani pengajuan perubahan status hutan Kab. Pakpak Bharat yang mencapai 83 % dari luas seluruh Kab. Pakpak Bharat. DemikianJaniferBoangmanalu,PemerhatiPembangunanPakpak Bharat, Sabtu (8/9). “Sekarang, sulit untuk mendapatkan lahan untuk dikelola investor,” ujar Boangmanalu. KendatipunsejakpemekaranKabupatenPakpakBharatperubahan status tersebut sudah diajukan, namun upaya tersebut hingga saat ini belum signifikan. Pemerintah pusat selaku penguasa penuh atas izintersebuthinggasaatiniterlihatbelummenunjukkankeseriusannya dalam membantu Pakpak Bharat terkait perubahan tersebut. Selainsulitnyauntukpengembanganwilayahpertanian,kinimenurut JaniferhargalahandikabupatenPakpakBharatterusmeningkat.“Kenaikan itu wajar karena setiap wilayah yang hendak dibuka kendalanya selalu kawasan hutan lindung” pungkasnya. (csb)

Waspada/Munir Lubis

WARGA Desa Aek Marian terpaksa memikul hasil kerajinan rumah tangga maupun pertaniannya ke pasar terdekat, karena kondisi jalan ke desa itu masih setapak dan tidak pernah mendapat perhatian dari pemerintah.

Tour Media Bersama TPL (1)

Melihat Teknik Cloning Eukaliptus Porsea PERJALANAN dari Medan menuju Porsea berjalanlancar,setelahsebelumnya diramaikan dengan tradisi mudik lebaran yang memacetkan arus lalulintas. Bus rombongan Tour Media terdiri dari tujuh Pemred/ ketua LKBN Antara Sumut, tigaWapemred/redaktur, dan seorang reporter Suratkabar diMedandipimpinKetuaPWI Sumut Drs M. Syahrir, Senin (3/9) siang itu membelok ke kanan sebelum memasuki Kota Parapat. Kami pun berhenti sejenakdikawasan hutan eukaliptus (eucalyptus) milik PTToba Pulp Lestari (PT TPL) di Aek Nauli. Di tengah kawasan Hutan Tanaman Industri (HTI) jenis eukaliptus, bahan baku pabrik kertas yang dulu bernama Indorayon, Direktur PT TPL Juanda Panjaitan yang akrab dipanggil Pak JP menjelaskan sejarah pohon eukaliptus dulu dan sekarang tumbuh teratur. Kalau dulu dihasilkan dari

pembibitanbijiagakmerepotkan, susah dan hanya sedikit menghasilkan bibit, tapi kini berkat usaha percobaan yang dilakukan pihaknya masalah bibit sudah dapat dipecahkan. ‘’Dengan sistem cloning, tidak saja memudahkan proses pembibitannya, tapi juga kualitas pohonnya lebihbaik,danbiayanyajauhlebih murah,’’ ujar JP. Pohoneukaliptussendiri,jelas JP,merupakanpohonyangpintar. Artinya, akar pohon ini mampu menyimpan air di musim penghujan,dandiwaktumusimpanas bisatetaphidupdenganmenggugurkan sebagian daunnya. ‘’Coba anda lihat di sebelah kanan ini, sebagian cabang dan daunnya kekeringan (berguguran). Saat musim kemarau berlalu pohon ini akan kembali tumbuh subur, menjulang tinggi. Rata-rata eukaliptus dipanen (tebang) di usia 5 tahunan,’’ ujarnya. Saat menjawab pertanyaan Ketua PWI Sumut M. Syahrir dan Pemred Analisa Soffjan seputar polatanam,berapajarakantarpohonnya, mengapa tidak dipanen

hinggausia7-10tahunsajakarena diameter batang pohon akan semakin besar dan tinggi, Pak JP selaku Direktur PT TPL menjelaskan, kualitas serat yang dihasilkannya akan berkurang jika ditanam terlalu dekat — idealnya berjarak antara 2-3 meter. Begitu juga kalau usia tanamnya ditambah produksinya malah semakin menurun. Saat meninjau areal pembibitan di dalam areal kompleks TPL(Porsea)terlihatpemandangan indah hijaunya bukit-bukit sekitarnya, ditumbuhi bibit eukaliptus anakan usia 1-3 bulan. Di kawasan itu pula terlihat bangunan green house yang dirancang khusus oleh PT TPL tempat sejumlah kaum ibu bekerja, mulai memotong (stek) pucuk (cloning) dari sumber pohonindukyangtingginyasekira 50 centimeter saja. Terlihat sejumlah pekerja wanita sibuk menurunkan potongan pucuk eukaliptus dari mobil pick up dalam wadah keranjang plastik. Puluhan keranjang berisi pucuk calon bibit itu pun disortir lagi,

lalu dipotongi sejumlah cabang dan daunnya, baru dimasukkan ke dalam tempat (polyback) khusus terbuat dari plastik (tabung) sebesar jari telunjuk tangan orang dewasa. Wadahnya sudah diisi dengan serbuk kelapa dan campuran pupuk dan pasir guna merangsang pertumbuhan akar. Di green house ini para pekerja –mayoritas wanita— melakukan proses cloning bibit eukaliptus, kemudian disirami sepanjang hari setiap lima menit di siang hari agar kelembaban dan suhunya terjaga. Setelah sebulan baru dipindahkan ke wadah berikut yang lebih besar di luar green house, sampai usia bibit 3 bulan. Setelah akar padat dan batang pohonnya sekira 50 cm baru bisa ditanam ke areal kebunsesuaiplanningdanjadwal program tanam. Dari omong-omong dengan para pekerja di rumah pembibitan, mereka mengatakan bukan karyawan PT TPL, tapi hanya karyawan lepas perusahaan swasta atau mitra yang memperoleh pekerjaan dari TPL. ‘’Jadi

yang menggaji kami bukan TPL. Tapi lumayanlah gajinya untuk menghidupi keluarga. Apalagi kalau bisa diangkat menjadi pegawai TPL, tentu kami sangat senang,’’ ujar seorangpekerjawanitadiareal pembibitan. Soalmitrakerjaini,Juanda punya cerita menarik. Awalnya di tahun-tahun pertama PT TPL beroperasi dengan paradigm barunya, sulit sekali mencarimitrakerja.Pekerjaan kita banyak mitra yang datang sedikit.Tapi setelah memasuki tahunketigajumlahpekerjaan dengan mitra yang datang sudah seimbang. Setelah itu, jumlah mitra kerja bertambah banyak sehingga dilakukan seleksi. ‘’Pusing juga kami membaginya. Pernah digunakan sistem tender, tetaps saja ada masalah. Banyak juga, teramasuk tokoh masyarakat, yang datang dan marahmarah,’’ ungkap JP. * Sofyan Hrp

Waspada/ Mulia Siregar

SEKELOMPOK siswa berseragam putih abu-abu dari berbagai sekolah sedang bermain judi di lantai tiga Pasar Horas Pematangsiantar saat siswa lainnya belajar di sekolah.

Gema Paluta Desak Tutup PT SPP Portibi Plantation GUNUNGTUA ( Waspada): Gerakan Mahasiwa Padanglawas Utara (Gema Paluta) mendesakpemerintahmencabutizinoperasional PT PT SPP PMKS Portibi Plantation, karena perusahaan ini dinilai hanya ingin menguntungkan diri sendiri bukan mensejahterakan masyarakat ataupun memberikan kontibusi kepada daerah. Pernyataan ini disampaikan Ketua Umum Gerakan Mahasiwa Padanglawas Utara (GEMA PALUTA) Anwarsyah Siregar kepada Waspada, Minggu (9/9), terkait PKS PT SPP PMKS Portibi Plantation mengabaikan panggilan pimpinan DPRDKabupatenPadanglawasUtarauntukrapat dengar pendapat bersama DPRD, Rabu (5/9). “PihakDPRDjugadimintaseharusnyamengambil tindakan tegas terhadap pihak perusahaan PT SPP PMKS Portibi Plantation yang telah mengabaikan panggilan DPRD,” jelasnya. Senada diungkapkan Habarol, diharapkan agar Pemkab memberikan sanksi tegas kepada pihak PT SPP PMKS Portibi Plantation karena

telah meresahkan masyarakat akibat antrean panjang TBS masyarakat, sehingga TBS mengalami restan yang cukup besar bahkan membusuk akibat antrean yang beberapa hari tersebut dan mengakibatkan kerugian besar bagi pemilik TBS. Ketua Komisi II DPRD Paluta Gusman Ependi Siregar, mengatakan pimpinan DPRD Kabupaten Padanglawas Utara sudah melayangkan surat undangan kepada pihak PT SPP PMKS Portibi melalui nomor surat 170/481/2012 pada 3 September 2012 dengan tujuan untuk dapat hadir pada rapat dengar pendapat, ternyata ti¬dak dihiraukan oleh perusahaan. “Saya sangat menyesalkan sikap perusahaan yang tidak dapat bekerjasama dengan pemerintah untukmenyelesaikanpermasalahanyangdihadapi masyarakat Paluta. Sikap perkebunan SPP Plantationsudahmencorengwibawalembagalegislatif. Pemerintah daerah maupun pemerintah provinsi agar meninjau ulang izin perusahaan ini. Bila perlu cabutizinberoperasinya,karenatidakberpihakkepadakesejahteraanmasyarakat,”jelas Gusman. (a35)

21 Parpol Mendaftar Di KPU Simalungun SIMALUNGUN(Waspada):KetuaDPDPartai Amanat Nasional (PAN) Kab. Simalungun, Salbin Damanik,SHdidampingiunsurpenguruslainnya menyerahkanberkaspersyaratanuntukmendapat verifikasi dari KPU (Komisi Pemilihan Umum) Simalungun, Jumat (7/9).Tercatat, 21 partai politik (parpol) mendaftar di KPU Simalungun. Penyerahan berkas berlangsung sekira pukul 10:00 di kantor KPU Simalungun, Jalan Sangnaualuh, diterima Ketua KPU Simalungun HM Nurdin Sinaga didampingi Sekertaris KPU Drs Arsyad Siregar dan staf KPU. HM Nurdin Sinaga mengatakan penyerahan berkas partai kepada KPU merupakan kewajiban setiappartaipolitik,sekaligus memenuhiUndangUndangpendaftaranParpolyangakanikutPemilu Legislatf pada 2014. Sedangkan, Ketua DPD PAN Simalungun,

SalbinDamanik,didampingiWakilSekertarisIlham Lubis, Posma Saragih dan Syafrinaf Tanjung, usai menyampaikan berkas kepada Waspada mengatakanbahwapihaknyasiapdiverifikasiKPU. “Kita sudah siap diverifikasi,” ujarnya singkat. Sementara,hinggapukul16:00sesuaiinformasi dari Sekretaris KPU Simalungun, Arsyad Siregar menjelaskan partai politik yang sudah mendaftar dan menyerahkan berkas sudah 21 partai. Namun dia tidak menjelaskan partai-partai apa saja yang sudah mendaftar. “Maaf, saya lagi sibuk tidak sempat mencatat data satu per satu partai yang telah mendaftar,” tukasnya, seraya mengatakan pihaknya siap bekerja sampai tengah malam jika masih ada parpol yang akan mendaftar. Sedangkan partai yang telah mendaftar hingga pukul 11:00 antara lain, Partai Nasdem, Partai Demokrat, PKS, PAN dan Gerindra. (a29)

Partai Demokrat P. Sidimpuan Dan Madina Mendaftar Di KPU P. SIDIMPUAN (Waspada): DPC Partai Demokrat Kota Padangsidimpuan dan Madina mendaftar ke Komisi Pemilihan Umum (KPU) setempat sebagai peserta Pemilu Legislatif 2014 mendatang, Rabu (5/9). Ketua DPC Partai Demokrat Madina, Hidayat Batubara mengatakan, pendaftaran dan penyerahan berkas dilakukan sesuai instruksi DewanPimpinanPusatPartaiDemokrat,dimana dalam waktu yang bersamaan, seluruh pengurus Partai Demokrat secara serentak di seluruh Indonesia melakukan pendaftaran dan penyerahan berkas di KPU. Pendftaran ulang partai politik dilakukan untuk memenuhi persyaratan verifikasi sebagai calonpesertaPemilu2014,dantuntutanperaturan KomisiPemilihanUmum(KPU)No.8tahun2012. Berkas DPC Partai Demokrat Madina diantar ke KPU Madina oleh Ketua DPC Partai Demokrat Hidayat Batubara, SE bersama Sekretaris Safaruddin Ansari aliasTodonk, dan seluruh pengurus inti DPC Partai Demokrat Madina antara lain ArminsyahBatubara,IrwanNasution,Darto,Boby, Tan Gozali, Himsar, Ade, dan pengurus lainnya. Kedatangan Partai Demokrat langsung disambut Ketua KPU Madina Jefri Antoni dan anggota KPU lainnya seperti Sobir Lubis, Rohimah, Hollad Daulay, dan Sekretaris KPU Dahlan Harahap. Ketua KPU Jefri Antoni mengatakan, sangat mengapresiasikan kedatangan DPC Partai Demokrat karena diantar langsung oleh Ketua DPC Partai Demokrat yang juga Bupati Madina. Katanya, Partai Demokrat merupakan partai kedua setelah Nasdem yang telah mendaftar. Kemudian, peraturan tentang keharusan melakukan pendaftaran dan penyerahan berkas bagi partai yang akan mengikuti pemilu legislatif

2014 ke KPUD, jangan diasumsi sebagai cara KPU untuk mempersulit setiap partai, tetapi hal tersebut dilakukan karena tuntutan dari peraturan KPU Nomor 8 Tahun 2012 yang baru diberlakukan. Berkas DPC Partai Demokrat sebagai persyaratan verifikasi peserta Pemilu yang diserahkan oleh sekretaris antara lain foto copy KTA sebanyak 623 orang atau 1/1000 dari jumlah penduduk, struktur kepengurusan dari semua tingkatan, legalitas kantor, pajak, dan persayaratan lainnya yang dituntut undang-undang pemilu. Di P. Sidimpuan Sedangkan Ketua DPC Demokrat, H. Khoiruddin Nasution, SE menyerahkan berkas administrasi dan kelengkapan persyaratan kepada Ketua KPU Kota Padangsidimpuan, Arbanur Rasyid,didampingiduakomisioner,AhmadEfendi Nasution, dan Mohot Lubis. Kedatangan Khoiruddin Nasution didampingi Wakil Ketua I,Yul Asmara Pane, Bendahara, Samuil Nasution, bersama pengurus lainnya seperti Aswar Syamsi, Rika Hannum Nasution, Darwin Harahap, Muda, dan Namora Bayo Angin Harahap. “Hari ini kita resmi mendafatar verifikasi ke KPU, dan ini dilakukan secara serentak di seluruh Indonesia sesuai kesepakatan dan instruksi Dewan Pimpinan Pusat (DPP) Partai Demokrat,” katanya. Khoiruddin yang juga Ketua Fraksi Demokrat danKetuaKomisiIIIDPRDKotaPadangsidimpuan menyebutkan, dalam berkas pendaftaran tersebut pihaknya menyertakan salinan 1.400 kartu anggota sebagai salah satu bentuk persyaratan. Selain itu juga turut diserahkan SK Pengurus DPC Partai Demokrat, SK Pengurus Dewan Pimpinan Anak Cabang (DPAC), Surat Keterangan domisili kantor DPC PD, daftar nama-nama anggota Partai Demokrat Kota Padangsidimpuan, dan copy referensi bank. (c14/a27)

Waspada/Sukri Falah Harahap

ANGGOTA KPU Kota Padangsidimpuan, Mohot Lubis, disaksikan Ahmad Efendi Nasution dan Arbanurrasyid menyerahkan bukti tanda terima pendaftaran verifikasi partai politik kepada Ketua DPC Partai Demokrat, H. Khoiruddin Nasution.



Pemerintah (Jangan) Plintat-Plintut Bikin & Langgar Moratorium CPNS


enteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (Menpan) Azwar Abubakar beberapa bulan lalu sudah menegaskan pelaksanaan moratorium pegawai negeri sipil (PNS) hanya berlaku sampai akhir tahun 2012. Tahun depannya (2013) tidak ada lagi moratorium, sudah selesai. Seperti diketahui, moratorium penerimaan CPNS telah ditetapkan untuk dilaksanakan pada 1 September 2011 hingga 31 Desember 2012. Dengan kata lain, penghentian penerimaan CPNS akan berjalan selama satu tahun empat bulan. Dasar melaksanakan moratorium CPNS untuk melakukan efisiensi dan membangun sistem rekrutmen yang jujur sehingga mereka yang diterima bukan semata-mata karena menyogok, keluarga pejabat, lewat calo dengan bayaran ratusan juta rupiah. Tapi, yang dibutuhkan adalah CPNS yang memiliki komitmen dan kompetensi, mau mengabdi dan melayani masyarakat. Bukan CPNS yang malas masuk kantor tapi rajin mencari sumber uang dengan cara korupsi. Sayangnya, komitmen pemerintah untuk menjalankan moratorium CPNS malah dilanggar sendiri oleh pemerintah sehingga kesannya pemerintah kita ‘plintat-plintut’ alias tidak tegas dengan sikap dan kebijakan yang diambil dan dibuatnya sendiri. Yang membikin kesepakatan moratorium pemerintah dan yang melakukan pelanggaran juga pemerintah. Terbukti Sabtu (8/9) di berbagai departemen dan daerah berlangsung ujian CPNS. Anehnya, Menteri Pemberdayaan Aparatur Negara dan Reformasi Birokrasi (Menpan-RB) Azwar Abubakar juga yang mengatakannya bahwa ia memperkirakan lowongan sekitar 50.000 hingga 65.000 calon Pegawai Negeri Sipil (CPNS) seluruh Indonesia tahun 2012 ini. Gayung pun bersambut. Sejumlah kementerian langsung mengajukan tambahan calon pegawainya. Namun pemerintah memastikan, penerimaan CPNS kali ini dibuat berdasarkan analisis beban kerja dan kebutuhan kementerian yang diajukan tahun lalu. Adalah Menteri Keuangan Agus Martowardojo yang membenarkan kalau instansinya membutuhkan pegawai baru, setelah sejumlah pegawai pajak ketahuan korupsi. Harusnya Depkeu membersihkan Intisari instansinya dari Gayus-Gayus yang lain, meningkatkan kinerja pegawainya, bukan minta tambahan PNS baru. Alasan Penerimaan CPNS harus malah Menkeu menerima pegawai baru karena jujur dan terbuka,bebas kebutuhan setelah melakukan analisis kerja dan kebutuhan pegawai di 2011 KKN sejalan dengan tun- beban perlu diselidiki kebenarannya. Jangan-jatutan reformasi birokrasi ngan hanya alasan untuk memasukkan anak-anak dari kalangan koleganya. Sudah menjadi tradisi di banyak daerah, termasuk di kabupaten-kota Sumut setiap musim penerimaan CPNS dijadikan ajang korupsi berjamaah di kalangan elite politik. Pasaran kursi CPNS begitu tinggi, menggiurkan, sehingga kejujuran menjadi terabaikan. Jangan harap bisa lulus tes CPNS jika tidak punya backing orang penting. Kalaupun ada yang lulus tanpa bayaran jumlahnya sedikit sekali, tak sampai 10 persen. Sebab, jumlah orang yang mau membayar mahal asalkan anaknya diterima sebagai CPNS jumlahnya melebihi kuota CPNS. Bagi banyak kepala daerah penerimaan CPNS merupakan ajang mengaut uang sebanyak mungkin untuk menutupi biaya saat mencalonkan diri maju dalam Pilkada. Sebab, dana yang dikeluarkan masing-masing pejabat mencapai ratusan miliar rupiah sehingga secara otomatis ketika terpilih dan menduduki kursi orang nomor satu di daerahnya semua potensi sumber uang dari proyek pembangunan dijadikan tabungan agar modal kembali. Belum cukup dari ‘’komisi’’ dana APBD banyak kepala daerah yang rajin melakukan rotasi jabatan pejabat eselon II, III dan IV. Sumber duit lainnya tentu saja saat penerimaan CPNS seperti saat ini. Justru itu kita harapkan Komisi Pemberantasan Korupsi (KPK) jangan diam dan menganggap enteng panggung korupsi berjamaah di saat musim penerimaan CPNS. Tidak sulit membuktikannya. Apalagi banyak calo yang mudah ditemui untuk dijebak dan ditangkap. Dengan sedikit k melakukan penyadapan (investigasi)—tentunya jika KPK mau— mayoritas oknum kepala daerah bisa diciduk KPK karena melakukan rekayasa untuk meluluskan calon-calon CPNS yang berani membayar mahal. Jadi, tidak cukup bagi KPK hanya menggertak sambal para pejabat agar melaksanakan ujian CPNS dengan jujur dan transparan. Sebab, ‘aba-aba’ atau ‘warning’ seperti itu sudah tidak mampu menurunkan nafsu setan ber-KKN-ria karena tumpukan uang sudah di depan mata. Biasanya, para pejabat sudah semakin pintar menghindari jebakan, sehingga mereka tidak menggunakan alat komunikasi telefon. Hanya sesekali saja, kalau situasinya dirasakan benar-benar aman dan rajin mengganti nomor telefon agar sulit dilacak KPK. Harapan kita, pemerintah konsekuen menjalankan moratoriumnya sehingga terhindar dari tuntutan hukum. Kalaupun ujian CPNS tetap dilakukan, harus ada perubahan mendasar dalam reformasi birokrasi sehingga penerimaan CPNS tahun ini bebas dari KKN. Artinya, hanya orang-orang yang pintar dan berintegritas, jujur, dan disiplin berhak menjadi abdi negara.+


Faks 061 4510025

Facebook Smswaspada

+628126572613 Saya sangat setuju terhadap apa yg dikatakan sdr no hp +6282364780893 sebaiknya sdr Arifin S Siregar “menulis dan ceramah ttg penyakit kulit dan bgmn mengobatinya” disesuaikan dikaitkan dalil dalil syar’i khususnya al qur’n dan sunnah, Insya Allah masyarakat akan kagum kpd saudara. Selama ini berkutat seputar yg khilafiyah berakibat tulisan sdr semakin tdk jelas. Tks. +6282161886831 Yth. Bapak Kapolresta Medan dan Ketua Perparkiran Kota Medan. Saya dari Provos TNI memohon agar tukang parkir perempuan yang di jalan Nibung diberhentikan, karena membuat terjadi yang tidak diinginkan, bukan sekali dua kali hampir tiap hari. Terima Kasih. +6282165293457 Umat islam tidak pantas berpecah-belah karena mazhab-mazhab (sangat fanatik memegang salah satu mazhab). Atau krena hawa-nafsu.manusia dijadikan berbeda akal fikiran dan pendapatnya, itulah sunnah Allah karena itu terjadi perselisian. akal fikiran dan amal perbuatan manusia itulah yg menentukan bahagia atau sengsaranya. segala sesuatu hendaklah dikembalikan kepada kitabullah dan sunnah rasul-nya.maka tidak ada jalan lain selain dari pada menjaga persatuan dan kesatuan +6281361660895 Di saat Sumut terancam banjir,di wilayah indonesia lainnya justru terancam kekeringan.untuk paranormal/pawang hujan,yg konon katanya bisa memindahkan hujan. disinilah peran anda di butuhkan.pindahkan hujannya. bantuan anda sangat dibutuhkan masyarakat dan pemerintah. +6285270210000 Harga Sawit turun, Mengapa? Karena : Adanya permainan Pengusaha & Perusahaan di seluruh PKS, Amerika mengkurangi pasokan CPO dari Indonesia, Lemahnya Pengawasan dari Pemerintah soal harga dan Mutu kadar CPO yg via Expor maupun dalam Negri, Gagalnya penemuan untuk BBM bersumber dari Sawit, Taman Nasional di Indonesia berangsur-angsur menjadi Tanaman Nasionalisasi Sawit. +6285296341455 Wspd yth, cerpen dgn judul, Aku Sarjana Mak kiranya mohon diterbit ulang pada koran minggu depan, mksh pembaca setiamu di Medan. +6282367842352 Putaran ke 2 Pilkada AcehTamiang tgl 12 September 2012, sebelum pilkada dilaksanakan sdh ada insiden dibebarapa tempat seperti membakar mobil dan posko. +6285277254638 Pak Gub. Aceh yth. Sebaiknya Dana Pembangunan KA di Aceh jgn bp alihkan ke pembangunan pelabuhan, tapi bp bangunlah KA Aceh kembali, dgn ada KA kerusakan jalan nasional, kecelakaan di jalan akan berkurang, jadi untuk pembangunan pelabuhan bp ajukan dana tersendiri untuk pelabuhan dgn demikian Lokomotip dan Gerbong KA yg sudah ada di Krueng Geukuh bisa beroperasi dan pembangunan di Aceh berlanjut walaupun Gubernur berganti, moga bp Gubernur Aceh membangun kembali KA Aceh.

WASPADA Senin 10 September 2012

100 Tahun Melanchton Siregar Oleh Prof. Usman Pelly, Ph.D Setelah kemerdekaan,rating peranan itu lebih menonjol, umpamanya dalam jumlah penempatan orang Batak di dalam kabinet dan pejabat tinggi lainnya. Mereka bukan orang kelima (sesuai dengan jumlah penduduk), tetapi kedua atau ketiga.


aufik Abdullah (2012) adalah seorang sejarawan terkemuka yang berani memancangkan maklumat apa yang dapat dilakukan oleh seorang sejarawan. Katanya : “Sejarah tidak mengenal pahlawan, sejarah hanya mengakui peranan para aktor yang bermain di atas pentas [kehidupan]-nya.” Menurut beliau, masyarakatlah yang membe-rikan penilaian terhadap peranan orang itu. Memang demikianlah secara definitif tugas dan wewenang yang diatur dalam pembidangan setiap ilmu, dia memiliki otoritas akademik tertentu dan tidak boleh semaunya merambah dan memasuki kewenangan bidang keilmuan lainnya. Namun, sebelum masyarakat itu memberikan penilaian terhadap peranan yang dilakukan oleh seorang sejarawan, sebaiknya mereka mendengar apa yang diungkapkan bidang keilmuan lain seperti antropologi, sebab: “seorang antropolog mengungkapkan secara jelas makna (arti) peranan itu dalam kontek sosial-budaya, tidak hanya pada ranah lokal-paguyuban (dalam jaringan kelompok etnik, agama atau kelembagaan) seseorang, dimana dia menjadi anggota, tetapi juga pada kontek nasional atau internasional secara menyeluruh (holistik).” Sejarawan memberikan penjelasan (explanation), sedang antropolog menjelaskan makna (interpretation) peranan seorang aktor yang telah bergumul dalam kehidupannya. Demikianlah Melanchton Siregar seorang anak Batak Toba yang lahir 1912 di Pearung, sebuah desa di dataran tinggi Humbang, di bibir tebing dinding Danau Toba Sumatera Utara (Bangun 2012:3). Kakek Buyut Melanchton adalah seorang pembuka kampung (huta), merangkap peran sebagai seorang ahli pengobatan tradisional (datu). Dengan kata lain Melanchton Siregar adalah anak keturunan seorang “local genuine” (asli) Tanah Batak. Penegasan Identitas Terdapat kecendrungan sebuah kelompok etnis-agama, berusaha mempertegas identitas dan peran mereka dalam masyarakat plural terus bergolak, seperti kelompok etnis Batak Toba. Setelah kemerdekaan, rating peranan itu dapat dilihat lebih menonjol, umpamanya dalam jumlah penempatan orang Batak di dalam kabinet dan pejabat-pejabat tinggi lainnya. Mereka

bukan orang kelima (sesuai dengan jumlah penduduk), tetapi kedua atau ketiga. Penampilan peran kelompok-kelompok etnik-agama ini tidak selalu“terbuka’ memakai nama etnis dan agama, tetapi selalu memakai baju kelembagaan partai politik, sehingga penampilan itu terasa lebih etis dan memenuhi kategori konstitusi dan keadaban dunia modern. Melanchton Siregar, tampil dalam pentas politiknasional,sebagaiKetuaUmumDPP Partai Kristen Indonesia (Parkindo). Peranannya dalam jabatan kepartaian tersebut lebih “pas” dalam sistem ketatanegaraan (konstitusi) Indonesia sebagai sebuah negara demokrasi modern. Merebut Peran Strategis Salah satu bentuk ekspresi etnisitas ialah merebut peran strategis agar dapat menempatkan diri pada posisi yang setara dan tidak dalam posisi sub-ordinasi dari kelompok etnis dan agama lain. Gerakan emansipatoris ini sangat menonjol pada momen-momensituasipolitikyangsangat kritis.Sejatinyasituasipolitikyangmenguntungkan itu sifatnya “enmalig” (hanya muncul sekali). Kalau tidak dimanfaatkan, maka situasi itu tidak akan berulang kembali, maka dia harus segera dimanfaatkan. Proses suksesi politik (pengalihan kekuasaan) dari Orde Lama ke Orde Baru (19651968), membuka kesempatan strategis itu bagipartaikecilsepertiParkindodanpartai Katolik untuk mengambil peranan besar yang sangat signifikan dan bersejarah. Seperti juga diungkapkan oleh Harry Tjan Silalahi dalam satu tulisan memoar untuk Melanchton Siregar (1987), betapa kritis situasi suksesi kepemimpinan nasional dari tangan Orde Lama (Soekarno) ketangan Orde Baru (Soeharto) dan kemudian pergulatan dalam kubu Orde Baru pasca G30-S/PKI antara kekuatan Jenderal Nasution dan Jenderal Soeharto. Secara global dapat dilihat dua gelombang pertarungan itu. Pertarungan Pertama : antara ORLA dan ORBA yaitu antara: (1) Kubu Istana : Bung Karno, Kekuatankekuatan politik terutama dari PNI AliSurachman,kesatuan-kesatuandanunsur ABRI yang sangat loyal pada Bung Karno, dan kekuatan-kekuatan masyarakat simpatisan PKI. (2) Kubu Angkatan Darat: dalam kubu Angkatan Darat ini, berhimpun kekuatan Partai-Partai Islam, Sosialis dan Nasional yang pro demokrasi, Pancasila dan Konstitusi, serta (3) Kubu Kesatuan Aksi, yang terdiri dari Kesatuan Aksi Mahasiswa (KAMI),

Pelajar (KAPPI), Pemuda dan kesatuankesatuan aksi lainnya sampai kepada kesatuan AksiTani dan Buruh yang mendapat dukungan penuh dari rakyat anti komunis, pecinta demokrasi dan konstitusi. Kelompok ketiga ini, sejak 2 Oktober 1965 telah melakukan demontrasi besarbesaran di seluruh Indonesia dengan semboyan Tritura : Bubarkan PKI, Turunkan Harga, dan Resufle Kabinet Dwikora. Dimana posisi Parkindo dan Partai Katolik? Parkindo yang dipimpin oleh Melanchton Siregar, berada di ketiga kubu di atas. Parkindo (dhi, Leimena) sangat dekat dengan Bung Karno (dalam situasi apapun). Begitu juga dengan Angkatan Darat (Jendral AH.Nasution dan Jenderal Soeharto). Sementara pada kubu ketiga sayap Parkindo dan Partai Katolik, GMKI (Gerakan Mahasiswa Kristen Indonesia) dan PMKRI (Gerakan Mahasiswa Katolik Republik Indonesia) sangat dekat dengan HMI (Himpunan Mahasiswa Indonesia), “leading actor” dari Kesatuan-Kesatuan Aksi masyarakat (kami sendiri sebagai salah seorang Ketua Presidium KAMI Sumatera Utara, merasakan bagaimana kedekatan antara HMI. GMKI dan PMKRI (1965-1968). Terutama dalam penyusunan strategi dan aksi bersama dalam menghancurkan PKI dan menegakkan Pancasila/Konstitusi di Sumatera Utara dan Indonesia. Dari posisi Parkindo yang sangat strategis di atas, dapat dimaklumi betapa penting peran Melanchton Siregar dalam mempersatukan dan mengamankan : (1) proses pengucilan dan pelengseran Bung Karno, Presiden RI dan Pemimpin Besar Repolusi dari “mainstream” politik nasional dan internasional. Tokoh Melanchton Siregar bersama Leimena, dengan berbagai dalih dan kebijakan meyakinkan Bung Karno agar mempercayai Jenderal Soeharto sebagai pemegang Supersemar, sehingga tidak terjadi tabrakan fatal yang dapat mencetuskan perang saudara. Bung Karno, sampai akhir hayatnya tidak pernah berkeinginan untuk menyerahkan jabatan presiden tersebut kepada siapapun sampai beliau dimakzulkan dalam Sidang Istimewa MPRS (1967). Dalam sidang itu pertanggungjawaban beliau sebagai Presiden (Nawaksara) ditolak dan beliau dianggap terlibat dan bertanggungjawab terhadap G-30-S/PKI. Pada Sidang Istimewa MPRS (1967) yang diketuai Jendral AH.Nasution, Bung Karno diberhentikan dan Jenderal Soeharto ditetapkan sebagai Pejabat Presiden RI. Sampai terlaksananya Sidang Umum MPRS. (2) Proses pengangkatan dari Pejabat Presiden Suharto, kejabatan Presiden dalam Sidang Umum MPRS (1968) berjalan mulus. Tetapi, benturan-benturan ideologis yang terjadi baik dalam sidang istrimewa dan Sidang Umum MPRS itu menunjukkan betapa beraga-

mnya aliran dan ideologi yang dipertarungkan dalan sidang-sidang itu. Pertarungan Kedua : Perang dingin yang melelahkan. ?Ketidakharmonisan antara kedua tokoh ini secara simbolik tampak, sehari setelah Jenderal Soeharto dilantik sebagai Presiden RI oleh Sidang Umum MPRS. Kendatipun, pimpinan MPRS menyatakan bahwa kehadiran Presiden pada hari-hari pertama itu sangat diperlukan untuk menyelesaian berbagai persoalan kenegaraan yang penting. Waktu itu, publik hanya dapat mereka-reka apa yang akan terjadi terhadap MPRS. Pimpinan MPRS (19661972) yang terdiri dari Jendral AH.Nasution (TNI), Subchan (Islam), Melanchton Siregar (Kristen-Katolik), Osa Maliki (Nasionalis) dan Mashudi (Daerah), tetap kompak menghadapi perang dingin ini. Badan Pekerja MPRS, dengan berakhirnya Sidang Umum tersebut menerima beban yang berat untuk memformat dan menjabarkan semua keputusan-keputusan MPR. Tentu saja, pekerjaan berat ini hanya dapat terselenggara apabila semua fraksi di MPR dan pemerintah sebagai lembaga ekskutif memberikan dukungan penuh, terutama terkait dengan dukungan finansial. “Perang dingin” antara kedua tokoh nasional mengakibatkan fraksi TNI dan Karya di MPRS mengundurkan diri dari Badan Pekerja yang seharusnya bertugas sampai terbentuknya MPR hasil Pemilihan Umum (1973). Melanchton Siregar, terpaksa pulang pergi seperti dipimpong antara MPRS dan Kabinet. MPRS terpaksa berjalan dengan terseot-seot, tetapi tidak membubarkan diri, yang dapat menimbulkan keributan politis dan konflik sosial terbuka antara berbagai kekuatan yang telah siap bertarung kembali. Penutup Problem-problem akut di atas sejatinya telah menantang seorang tokoh yang berasal dari daerah terpencil, seorang putra Batak Melanchton Siregar. Memang, ketika itu dia berkedudukan sebagai Ketua Parkindo danWakil Ketua MPR. Suatu kedudukan yang dapat digunakan sebagai “jubah suci” dalam pergulatannya di antara karang-karang terjal mendamaikan tokoh-tokoh republik ini. Seperti julukan yang diberikan oleh Jendral Nasution bahwa beliau adalah seorang Demokrat Pancasila, seorang “trouble-shooter” dalam soal-soal peka dan pelik yang tidak mungkin digantikan oleh tokoh-tokoh lainnya. Tetapi lebih dari itu semua, beliau telah tampil sebagai penyelamat RI dalam saat-saat kritis, terutama dalam suksesi kepemimpinan RI, dari presiden Soekarno ke presiden Soeharto dan sidang-sidang MPRS yang sangat pelik dan komplek, sehingga RI tetap berjalan secara konstisional dan terhindar dari perpecahan. Penulis adalah Antropolog Unimed, UISU.

Sewindu Munir Mencari Keadilan Oleh Supriadi Purba Munir meninggal akibat banyak yang tidak senang terhadap jejaknya yang sudah melakukan perjuangan melawan kemunafikan di negeri ini.


iapa yang tidak kenal dengan Munir, seorang anak manusia yang memperjuangkan hak asasi manusia (HAM) dengan segala cara walau risikonya sangat tinggi. Dunia mengakui kegigihannya, tetapi sangat disayangkan negara mengabaikan nilainilai perjuangannya. Sampai detik ini masih kabur tanggung jawab negara untuk keadilan bagi dia.Walau demikian Munir sedang meminta keadilan bagi Yang Kuasa untuk mengadili para pengacau di negeri ini. Pembunuhan terhadap Munir bukan berarti akhir dari segalanya. Kematian Munir justru dijadikan sebagai senjata ampuh dalam melawan segala tirani kekuasaan di Indonesia. Pernyataan itu disampaikan oleh Usman Hamid mantan Koordinator KontraS pada tahun 2011 lalu. Pernyataan tersebut menunjukkan bahwa setelah peristiwa meninggalnya Munir pada tahun 2004, tanggung jawab itu semakin besar dalam rangka membuka tabir kasus HAM masa lalu yang telah mengabaikan prinsip hak asasi manusia. Hal lain adalah kaitan dengan semangat perjuangan orang-orang yang memiliki kepedulian terhadap HAM agar semakin gigih dalam memperjuangkan kebenaran dan keadilan. Bahkan di Jakarta Komite Aksi Solidaritas Untuk Munir (KASUM) mendesak Presiden SBY untuk segera menuntaskan penyidikan kasus meninggalnya aktivis HAM, Munir Said Talib. Tepat 7 September tahun ini, sudah 8 tahun Munir dibunuh. Sewindu kepergiannya masih menyisakan tanda tanya. “Kami menagih janji SBY untuk menuntaskan kasus Munir,” kata koordinator KASUM, Choirul Anam. Menurut Choirul, Presiden SBY sampai saat ini masih ragu-ragu memimpin penyelesaian kasus kematian Munir. Presiden SBY bahkan dinilai hanya melakukan pencitraan dengan menggunakan kasus Munir. KASUM pernah secara tegas dan langsung meminta SBY memerintahkan Jaksa Agung untuk melakukan peninjauan kembali atas putusan bebas terdakwa mantan Danjen Kopassus, Jenderal Muchdi P.R. “Itu pun belum dilakukan SBY,” kata Anam yang juga Direktur Human Rights Working Group ini. Anam menegaskan, pengungkapan kasus pembunuhan Munir bukan hanya

penegakan keadilan bagi keluarga dan sahabat-sahabat Munir, melainkan buat seluruh bangsa Indonesia. “Keadilan bagi Munir adalah keadilan bagi bangsa Indonesia,” ujarnya. Munir Said Thalib, yang lahir pada 8 Desember 1965, merupakan pendiri dan koordinator Komisi untuk Orang Hilang dan Korban Kekerasan (Kontras). Selama hidupnya, pria lulusan Fakultas Hukum Universitas Brawijaya ini aktif memperjuangkan HAM. Terakhir dia menjabat sebagai Direktur Eksekutif Lembaga Pemantau Hak Asasi Manusia Indonesia Imparsial. Munir meninggal 7 September 2004 karena dibunuh dengan racun arsenik saat penerbangan menuju Belanda. Sampai kali ini, baru satu pelaku, Pollycarpus Budihari Prijanto, yang sudah ditangkap dan dinyatakan bersalah. Ketika dibunuh, Munir menumpang pesawat Garuda Indonesia. Almarhum dimakamkan di Tempat Pemakaman Umum Sisir, Kota Batu. Munir Dan Penegakan HAM Indonesia Satu hal yang harus diketahui adalah bahwa Munir meninggal akibat banyak yang tidak senang terhadap jejaknya yang sudah melakukan perjuangan melawan kemunafikandinegeriini.Banyakternyata orang-orang yang merasa dirugikan denganperjuangannyayangsetengahhati tanpa pamrih, perjuangan yang tulus, berani ambil resiko dan tanpa kenal kompromi. Mungkin tidak ada duanya sosok Munir di negeri ini yang meninggal hanya karena banyak yang merasa terancam karena kehadirannya. Kaitan dengan perjuangannya yang banyak memperjuangkan keadilan dan menuntut kebenaran adalah bagian dari kerinduannya dalam melihat negeri ini mengalamikemajuandalambidangHAM. Sejak sebagai sosok fenomenal di KontraS sudah sangat banyak kasus yang diangkatnya kepermukaan, membuat banyak tokoh sentral para pelaku pelanggaran HAM terusik dan merasa terancam. Apalagi para tokoh-tokoh tersebut merupakan para militer yang terlibat dalam kasus pelanggaran HAM masa lalu. Sementara banyak yang merasa terancamdengankahadirannyayangmembela para korban dan menuntut keadilan baginegara.Duniainternasionalmemberikan apresiasi pada nilai-nilai perjuangnya,

bahkan sampai hari ini juga setelah kematiannya banyak lembaga internasional yang terus mendesak pemerintah untuk membuka tabir siapa dalang di balik terbunuhnya Munir. Bahkan dewan HAM PBB-pun mendesak negara menyelesikan kasus pembunuhannya yang melibatkan militer dan intelijen di dalamnya. Satu hal yang harus diketahui adalah bahwa meninggalnya Munir bukan akhir dari perjuangan dalam rangka penegakan hak asasi manusia. Melainkan awal dalam rangka semakin mendesak negara untuk memberikan perhatian serius terhadap dorongan penegakan HAM di republik ini. Apalagi demokrasi yang digaunggaungkan oleh negara diklaim sebagai keberhasilan tetapi sejatinya jikalau tidak seiring dorongan memajukan HAM maka itu adalah sia-sia. Selanjutnya adalah kaitan dengan keterlibatan intelijen dan militer di belakang peristiwaterbunuhnyamunirharusdiungkap. Polycarpus yang sudah dinyatakan bersalah tidak lantas membuat negara puas, masih ada otak di belakangnya yang bertanggungjawab atas segala tindak tanduk terhadap pembunuhan Aktivis HAM Munir. Muchdi PR yang sempat ditangkap dan kemudian dilepaskan adalah sebuah kemajuan yang luar biasa, karena seorang bekasMayjenditangkapdandipenjarakan walau akhirnya bebas.Tetapi satu hal yang harus diapresiasi adalah perjuangan para relawan yang setia memperjuangkan keadilan Munir. Karena keadilan bagi Munir adalah keadilan bagi negara. Penulis adalah Koordinator Solidarity For Human Rights (SA-HAM), Bekerja Di Komisi Untuk Orang Hilang Dan Korban Tindak Kekerasan (KontraS) Sumatera Utara.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pem-baca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/ tidak diterbitkan di Media manapun. Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Di Tanah Suci, Pemko Medan tanggung biaya makan - Alhamdulillah! * Rahudman minta pelayanan kesehatan ditingkatkan - Maksudnya biar tak salah resep obat * BPH Migas akan batasi pembelian BBM - Alamak, main jatah pulak!


D Wak


WASPADA Senin 10 September 2012


Nikah Massal Atau Itsbat Nikah? Konflik Sampang Pertama kali saya baca di koran ini tentang tragedi yang terjadi di Sampang, membuat saya sedih melihat agama Islam yang terpecah-belah akibat perbedaan paham atau mahzab. Sebenarnya kalau kita sesama umat Muslim saling memahami arti perbedaan yang terjadi mungkin peristiwa Sampang itu tidak akan terjadi. Kemana perginya UKHUWAH ISLAMIYAH yang selama ini kita bangga-banggakan sebagai umat Islam dan bukankah islam itu RAHMATAN LIL ALAMIN. Siapa yang harus disalahkan atas terjadinya tragedi di Sampang? Pengikut aliran sunni atau syiah ? Dan kalau menurut saya aliran sunni ataupun syiah itu sama-sama ajaran Islam yang benar jadi ya tidak ada yang salah atau benar dalam tragedi di Sampang itu karena yang benar hanya milik ALLAH SWT tidak yang lain dan kalau saya salah mohon dikoreksi oleh para ALIM ULAMA. Syiah atau dalam bahasa disebut pengikut mahzab ALI RA, mereka percaya bahwa Islam yang benar adalah yang diajarkan oleh para imam AHLUL BAIT yaitu asli keturunan dari baginda RASULULLAH SAW dan tidak mengakui kepemimpinan para khalifah yang tiga (3) yaitu ABU BAKAR RA, UMAR BIN KHATTAB RA dan USMAN BIN AFFAN RA. Tapi kalau dilihat para kaum syiah tetap Islam dan tidak sesat seprti yang dibahas selama ini bahwa syiah itu sesat, kenapa saya mengatakan syiah itu tidak sesat dan benar-benar masih Islam : 1. Aliran syiah masih percaya dan yakin kepada rukun IMAN yang 6 perkara. 2. Aliran syiah masih menjalankan rukun ISLAM yang 5 perkara. 3. Aliran syiah tetap mengakui bahwa RASULULLAH MUHAMMAD SAW adalah nabi terakhir dan tidak ada nabi sesudahNYA. 4. Aliran syiah masih berpegang kepada ALQURAN dan SUNNAH RASUL. Jadi jelas syiah itu bukanlah aliran sesat seperti yang diperbincangkan selama ini, syiah adalah tetap agama Islam yang benar dan sama seperti sunni (ahlus-sunnah wal jama’ah) dan hanya berbeda mahzab saja, seperti Imam seperti , Imam Syafii, Hambali, Imam Maliki dan Imam Hanafi seperti sekarang ini. Ajaran syiah berbeda dengan ajaran Ahmadiyah, dan kalau ajaran Ahmadiyah itu memang dan benar-benar sesat—karena mereka tidak mengakui RASULULLAH MUHAMMAD SAW sebagai nabi terakhir dan malah mengangakat seorang MIRZA GULAM AHMAD sebagai nabi meraka dan tidak melaksanakan haji ke MAKKAH melainkan ke tempat dimana MIRZA GULAM AHMAD dilahirkan yaitu di India. Puji syukur kehadirat ALLAH SWT bahwa tragedi yang terjadi di Sampang itu bukan karena konflik agama tapi karena konflik asmara dalam keluarga antar saudara ustad ROIS dan ustad TAJUl MULUK. Walaupun begitu kita harus waspada karena mungkin inilah tanda-tanda kiamat sudah semakin dekat dan tanpa kita sadari bahwa dajjal sudah datang dan merusak akhlak dan akidah kita umat ISLAM dan kita hanya menunggu kapan tibanya IMAM MAHDI dan ISA AL-MASIH yang akan memperbaiki akhlak dan akidah kita bersama sebelum terompet sangkakala ditiup oleh malaikat Israfil tanda bahwa kiamat akan terjadi. Wira Yuda Wibowo Stabat, Langkat


Dedi Sahputra

Kekerasan Atas Nama... Cukup banyak yang disampaikan penceramah malam rutinitas tahunan itu, halal bi halal. Tapi ada satu yang cukup kuingat. Itulah kisah masa lalu sang ustadz di kampungnya sana. “Waktu itu orang Jawa dikatai “Jakon/Jawa Kontrak” oleh orang Mandailing. Orang Jawa membalas dengan menyebut “Manipol/Mandailing Polit”,” cerita sang ustadz dengan jenaka. Ada senandung syair lama, ada dangdutan, ada pula petatah-petitih Melayu. Sang ustadz kelihatan cukup komplit membawakan materi silaturahim itu. Para undangan pun tampak tertawa-tawa. Tapiii.., sambung sang ustadz. Masalah orang Mandailing dengan orang Jawa itu sudah selesai di tahun 1985-an. “Sudah tuntas,” katanya. Pasalnya, karena pada saat itu ramai digalakkan pertemuan-pertemuan bersama. Sebutlah pengajian akbar, pasar bersama, tempat semua suku berbaur bersama. “Apalagi sudah semakin banyak Pariyem yang kawin sama si Sangkot,” katanya lagi. Saat ini, di semua sektor umum, sudah berbeda dengan masa lalu. Orang bisa lebih menerima perbedaan latar belakang orang lain. “Karena dosa terbesar adalah menghukum suatu kaum (suku) karena kesalahan satu dua orang,” katanya. Dan diapun bersenandung lagi: Kalaulah dahan lapuk sebatang, janganlah pohon ditebang serumpun. Apa yang disebut sang ustadz inilah yang dikenal dengan stigmatisasi atau pelabelan (lihat Foliopini: Stigma). Ini tabiat warisan penjajah. Anda tentu kenal dengan istilah-istilah ini: ekstrimis, inlander, fundamentalis, teroris. *** Berebut surga. Ini kata ganti yang sering digunakan untuk memberi label kepada orang yang disebut “berbuat kekerasan atas nama agama”. Betapa surga di sana, katanya, diperebutkan di sini dengan cara mengafirkan, menyesatkan, bahkan saling membunuh. Tautan kalimat ini adalah peristiwa Sampang tentunya—yang masih hangat-hangat kuku. Ini membaca sejarah. Ada perang Ali

ra dengan Muawwiyah, dengan Khawarij. Ada juga inkuisisi di masa Muktazilah. Sebutlah satu persatu, tentu saja akan ada sederet panjang daftar. Maka seolah semakin sah-lah kesimpulan mu itu: “kekerasan atas nama agama”. Saya bukan orang suka dengan kekerasan. Saya juga bukan orang yang setuju dengan kekerasan yang terjadi di Sampang, atau di manapun. Tapi menyimpulkannya sebagai “kekerasan atas nama agama”, saya merasa sudah pasti ada yang salah karena beberapa hal. Pertama, ada makna tendensi yang rasanya punya maksud yang diragukan kebaikannya. Lha, kekerasan itukan banyak musababnya, tapi kok gak pernah disebut “kekerasan atas nama kapitalisme”, “kekerasan atas nama cinta”, “kekerasan atas nama perut”. Hayooo, kenapa..? Kalau semua kekerasan itu bertentangan dengan nilai-nilaimu, lantas mengapa engkau hanya menyebut “kekerasan atas nama agama”. Maka sadarilah kelatahanmu itu. Kedua, kalimat itu menyimpulkan dengan sangat ekstrem dua kutub—yang pada batasbatas tertentu san g a t b e rb e d a — itulah “kek e r a s a n” dan “agama”. Bagi saya, ini sangat terang benderang sebagai sebuah upaya untuk memberi kesan bahwa “ada sesuatu yang salah di dalam agama”. Padahal Aristoteles juga sadar bahwa konsep negara yang paling ideal adalah dengan teokrasi sebagai dasarnya. Lantas Anda kok berani-beraninya memaketkan agama dengan kekerasan? *** Untuk surga yang seluas langit dan bumi itu, engkau katakan terlalu lebar kalau hanya diisi oleh mereka yang sering mengafirkan orang—yang kemudian engkau sebut sebagai orang yang merasa yakin masuk surga. Aku sih setuju-setuju saja, kalau engkau menganggap salah pelaku kekerasan itu. Tapi tafsirmu tentang kekerasan atas nama agama itu jelas keliru. Karena ia tidak cuma dengan semena-mena menebang pohon serumpun karena dahan lapuk sebatang, tapi yang menyakitkanku, karena ia telah memperalat keluguanmu.(Vol.344, 10/9/ 2012)

Kolom foliopini dapat juga diakses melalui

Oleh Dr Suhrawardi K Lubis, SH,SpN, MH Kedudukan hukum anak luar kawin yang disahkan sama dengan kedudukan anak sah yang dilahirkan setelah perkawinan resmi.


alam pemberitaan media massa sering dikabarkan, perusahaan-perusahaan besar sering melakukankan penyaluran dana Corporate Social Responsibility (CSR) dengan melaksanakan nikah massal untuk masyarakat—yang sebelumnya telah melangsungkan nikah di bawah tangan (nikah siri). Seperti diberitakan media elektronik dan cetak, beberapa waktu lalu di Tanggerang, PT.Angkasa Pura II bekerja sama dengan Kantor Urusan Agama (KUA) setempat melaksanakan nikah massal yang diikuti ratusan pasangan nikah siri. Banyak dari mereka sudah mempunyai anak keturunan, bahkan sering diberitakan, ada pasangan yang sudah punya cucu. Nikah massal ini bukan hanya terjadi di Tangerang, tetapi juga di berbagai daerah lainnya di Indonesia. Bahkan, menurut informasi yang layak dipercaya, aktivitas nikah massal tersebut menjadi program kerja atau setidaknya bekerjasama dengan instansi pemerintah, yaitu Kementerian Agama. Bahkan diduga, ada biaya khusus yang dianggarkan di Kementerian Agama Provinsi maupun kabupaten/ kota untuk membiayai pelaksanaan prosesi nikah massal tersebut—tentunya termasuk biaya publikasi di media. Dari sisi hukum timbul pertanyaan, apakah nikah massal merupakan solusi terbaik untuk pasangan nikah siri? Bagaimana status hukum keturunan mereka yang dilahirkan sebelum nikah massal? Apakah anakanak dari pasangan nikah siri yang mengikuti perkawinan massal tersebut statusnya ikut disahkan? Pertanyaan-pertanyaan di atas menimbulkan keraguan tentang kemanfaatan nikah massal yang sering dilakukan di tengah masyarakat. Status Anak Sebelum membicarakan status anak, terlebih dahulu perlu diuraikan secara singkat pengertian perkawinan, perkawinan siri dan perkawinan massal. Perkawinan sebagaimana ketentuan pasal 1 UU Perkawinan No.1 Tahun 1974 adalah ikatan lahir batin di antara seorang pria dan seorang wanita sebagai suami istri dengan tujuan membentuk keluarga atau rumah tangga yang bahagia dan kekal berdasarkan Ketuhanan Yang Maha Esa. Pasal 2 ayat (2): suatu perkawinan sah apabila perkawinan tersebut dicatatkan menurut peraturan perundangundangan yang berlaku. Ketentuan tersebut kemudian dipertegas dengan Peraturan Pemerintah (PP) No.9 Tahun 1975 Pasal 10 ayat (3) berbunyi: Dengan mengindahkan tatacara perkawinan menurut masingmasing hukum agamanya dan kepercayaannya itu, perkawinan dilaksanakan dihadapan Pegawai Pencatat

dan dihadiri oleh dua orang saksi. Sedangkan Pasal 11 menegaskan (1) Sesaat setelah dilangsungkan perkawinan sesuai dengan ketentuan-ketentuan Pasal 10 Peraturan Pemerintah ini, kedua mempelai menandatangani akta perkawinan yang telah disiapkan oleh Pegawai Pencatat berdasarkan ketentuan yang berlaku. (2) Akta perkawinan yang telah ditandatangani oleh kedua mempelai itu, selanjutnya ditandatangani pula oleh kedua saksi dan Pegawai Pencatat yang menghadiri perkawinan dan bagi yang melangsungkan perkawinan menurut agama Islam, ditandatangani pula oleh wali nikah atau yang mewakilinya. (3) Dengan menandatangani akta perkawinan, maka perkawinan telah tercatat secara resmi. Kemudian, yang disebut dengan perkawinan siri adalah perkawinan yang sesuai dengan ketentuan hukum Islam, artinya memenuhi syarat dan rukun perkawinan, akan tetapi tidak dihadiri pegawai pencatat nikah dan secara otomatis tidak tercatat di KUA. Sedangkan perkawinan massal adalah perkawinan yang dikoordinir suatu institusi tertentu dan peserta nikah minimal tiga pasangan calon pengantin yang dilaksanakan sesuai ketentuan perundang-undangan yang berlaku dan lazimnya peserta adalah pasangan yang sebelumnya telah melakukan nikah siri. Selanjutnya timbul pertanyaan, bagaimana dengan status anak yang dilahirkan sebelum dilaksanakan nikah massal? Untuk menentukan status hukum seorang anak selalu dipergunakan Akta Kelahiran yang dikeluarkan oleh Dinas Kependudukan dan Catatan Sipil (dahulu Kantor Catatan Sipil). Mengurus Akta Kelahiran anak, selalu disyaratkan untuk melampirkan Akta Nikah kedua orang tuanya. Apabila kedua orang tua tidak memiliki Akta Nikah, dalam Akta Kelahiran akan dicatat bahwa anak tersebut adalah anak dari ibunya saja. Artinya anak tersebut dikategorikan sebagai anak luar kawin alias anak tidak sah. Dalam Kitab Undang-Undang Hukum Perdata, seperti dipraktekkan sebahagian komunitas masyarakat China (yang mengenal kawin Tamasya, lazim dilakukan sebelum perkawinan resmi), bahwa anak luar kawin dapat disahkan sebagai anak sah apabila kedua orang tua biologisnya kemudian melangsungkan perkawinan secara resmi. Pengesahan itu dilakukan pada saat perkawinan dilangsungkan, dalam akta nikah sekaligus disebutkan mengesahkan anak luar kawin. Pengesahan anak, mengakibatkan anak luar kawin memperoleh status anak yang disahkan. Artinya, kedudukan hukum anak luar kawin yang disahkan sama dengan kedudukan anak sah yang

dilahirkan setelah perkawinan resmi. Sedangkan UU Perkawinan Nomor 1 Tahun 1974, tidak mengenal lembaga pengesahan anak seperti yang ada dalam ketentuan Kitab Undang-Undang Hukum Perdata. Oleh karena itu, nikah massal yang sering diberitakan dilaksanakan di berbagai daerah di Indonesia, hanya menyelesaikan masalah dengan masalah. Kenapa demikian? Sebab, anak yang lahir sebelum perkawinan massal dilangsungkan tidak dilegitimasi dengan adanya nikah massal tersebut. Pertanyaan berikutnya, apakah tidak ada solusi hukum untuk mengatasi masalah tersebut? Jawabnya, tentu ada. Yaitu, apa yang dikenal dengan Itsbat Nikah. Itsbat nikah adalah permohon pengesahan perkawinan ke Pengadilan Agama. Itsbat Nikah Dalam praktek, itsbat nikah dilaksanakan apabila pasangan nikah di bawah tangan (siri) hendak mengajukan permohonan atau gugatan perceraian ke Pengadilan Agama. Sebab Pengadilan Agama dapat menyelesaiakan permohonan atau gugatan perceraian apabila perkawinan yang dilangsungkan dilaksanakan sesuai dengan ketentuan perundang-undangan yang berlaku dan dapat dibuktikan dengan akta pernikahan. Adanya permohonan itsbat nikah yang diajukan, kemudian Pengadilan Agama mengabulkan permohonan itsbat tersebut, maka secara hukum hubungan hukum antara suami-isteri (yang sebelumnya nikah siri) menjadi sah. Setelah perkawinan siri tersebut diitsbat oleh Pengadilan Agama, kemudian dilanjutkan dengan persidangan perceraian. Dengan demikian itsbat nikah atau pengesahan perkawinan itu hanya dipergunakan semata-mata untuk kepentingan perceraian. Penggunaan itsbat nikah seperti yang dikemukakan di atas sesungguhnya bertentangan dengan tujuan hukum. Sebab tujuan adanya hukum adalah untuk menciptakan kemasla-

hatan kepada masyarakat. Dalam hal perkawinan, tujuan hukum (termasuk itsbat nikah) mestinya untuk kemaslahatan rumah tangga. Namun demikian tidak apalah, karena dengan itsbat nikah seperti di atas dikandung maksud untuk menciptakan ketertiban perkawinan yang dilakukan masyarakat. Akan tetapi hendaknya itsbat nikah itu dapat juga dimanfaatkan untuk kemaslahatan perkawinan, yaitu adanya kepastian hubungan antara suami-isteri yang nikah di bawah tangan. Selain adanya kepastian hukum hubungan suami istri, itsbat nikah juga dapat melahirkan kepastian hukum terhadap anak yang lahir sebelum perkawinan diitsbat. Sebab dengan itsbat nikah, hubungan hukum perkawinan itu dilegitimasi terhitung semenjak pasangan suami-istri melangsungkan nikah siri. Pengadilan Agama yang ada di wilayah hukum Sumatera Barat, sering menerima permohonan dan mengabulkan permohonan itsbat nikah yang tujuannya bukan untuk perceraian. Itsbat nikah di sana bertujuan untuk kelanggengan dan kepastian hukum perkawinan pasangan yang nikah siri. Bahkan, ada Pemerintah Kabupaten/ kota di Provinsi Sumatera Barat menganggarkan dalam APBD untuk membantu biaya itsbat nikah warganya yang terlanjur melaksanakan nikah siri. Dengan cara itsbat nikah untuk kemaslahatan, kelanggengan dan kepastian hukum hubungan hukum antara suami-istri, otomatis anakanak yang lahir sebelum itsbat nikah turut dilegitimasi. Artinya dengan itsbat nikah, permasalahan perkawinan benar-benar dapat diselesaikan dengan baik. Kenapa terselesaikan dengan baik? Karena hubungan hukum suami-istri disahkan terhitung mulai tanggal dilaksanakannya nikah siri dan anak yang lahir dari nikah siri itupun ikut disahkan. Penulis adalah Wakil Ketua PWM-SU dan Pengajar MKn UMSU Medan.

Panggilan Agama Dalam Pembangunan Oleh Warjio Peranan agama dalam pembangunan, pada hakikatnya turut melakukan transformasi sosial ke arah masyarakat yang lebih dewasa,lebih demokratis,lebih berkecukupan dalam pemenuhan kebutuhannya, dan lebih mampu mengangkat derjat kemanusiaan.


aya yakin dan percaya, bahwa kita manusia, seharusnya memiliki peran yang lebih terhormat dalam pembangunan. Namun kenyataannya, banyak di antara kita belum ditempatkan pada posisi itu. Selama 2 hari, 29-30 Agustus 2012, saya merasa beruntung diundang sebagai Sesion Chair (moderator) dalam satu seminar internasional, Islamic Management of Human Development 2012 oleh Centre for Islamic Development Management Studies (ISDEV), Universiti Sains Malaysia (USM), Pulau Pinang, Malaysia. Yang menarik seminar ini bukan hanya membicarakan kedudukan manusia dari segi keislaman ansich, tetapi juga dari berbagai sudut pandang, sosial, ekonomi dan juga politik dan pengalaman dari berbagai negara. Bagi saya pembicaraan manusia dari berbagai perspektif ini penting untuk mengetahui kedudukan manusia secara total. Bagaimana Islam mengatur sumber daya manusia? Peran Islam dalam membangun Sumber Daya Manusia (SDM), menjadi isu yang banyak diperbincangkan pada belakangan hari ini. Mengapa? Sebab dalam konteks pembangunan sekarang, kedudukan peran manusia dalam pembangunan sering diketepikan. Islam sebagai agama rahmatan lilalamin sesungguhnya menempatkan manusia dalam posisi terhormat dalam pembangunan. Prof Dr Muhammad Syukri Salleh, Direktur ISDEV USM, sebagai keynotespeaker, menjelaskan bahwa kedudukan manusia dalam pembangunan selama ini sering hanya dijadikan social capital

dan human capital tanpa dilihat kedudukan dan hubungannya dengan Tuhan. Profesor alumni Oxford University (Inggris) bidang pembangunan Islam ini lebih lanjut menjelaskan bahwa “kehilangan roh” manusia terhadap Tuhannya dalam konteks pembangunan menjadikan kedudukan manusia “rendah” dan pengaruhnya pembangunan hanya beroritentasi fisik saja tanpa memberi kedudukan dan keuntungan kepada manusia dunia dan akhirat. Akibatnya ada banyak ketimpangan dalam pembangunan, adanya ketidakadilan dalam pemerataan pembangunan, kerusakan alam, korupsi dan sebagainya. Sesungguhnya Islam menempatkan kedudukan manusia bukan hanya dalam konteks social capital ataupun human capital tetapi juga hubungan manusia dan Tuhannya dalam pembangunan Sayangnya, tidak banyak praktek pembangunan baik yang dilakukan negara, lembaga dan individu yang menjalankan pembangunan, belum menyentuh persoalan ini. Di satu sisi banyak praktisi dan para pakar justru masih berpegang pada paradigma lama (Barat ) dalam idea dan implementasi pembangunan. Karenanya Syukri Salleh mengajak para praktisi pembangunan, peneliti dan pakar pembangunan menilai kembali pandangan seperti ini dan menjadikan agama (Islam) menjadi rujukan dalam pembangunan. Panggilan Agama Dalam Pembangunan Saya menggarisbawahi bahwa ajakan Syukri Salleh dalam seminar

ini, menjadi seruan bersama sekaligus panggilan untuk kembali dalam agama—dalam kaitan ini Islam dalam pembangunan. Di sinilah pemikiran Abdurrahman Wahid menurut saya, perlu menjadi perhatian kita. Menurut Abdurrahman Wahid (1994) bahwa spiritualitas dalam bidang pembangunan sangat diperlukan. Menurut Abdurahman Wahid spiritualitas yang diperlukan adalah rasa keagamaan yang terkait sepenuhnya dengan masalah-masalah dasar pembangunan, bukannya justru yang bereaksi terhadap proses pembangunan itu sendiri. Peranan agama dalam pembangunan lanjutnya, pada hakikatnya turut melakukan transformasi sosial ke arah masyarakat yang lebih dewasa, lebih demokratis, lebih berkecukupan dalam pemenuhan kebutuhannya, dan lebih mampu mengangkat derjat kemanusiaan para warganya. Transformasi sosial seperti ini, agar tidak menyengsarakan masyarakat melalui kesenjangan sosial lebih besar di masa depan, haruslah dilandasi visi keadilan sosial yang jelas dan utuh. Di sinilah letak sumbangan agama dalam menyuarakan hati nurani bangsa dalam mewujudkan keadilan sosial dan menjamin persamaaan derajat dan hak mereka di hadapan undang undang dan sistem pemerintahan. Dalam konteks ini—dalam analisis yang lebih riil memahami kontekstualitas pembangunan, menurut Syukri Salleh (2002), pembangunan dan politik pembangunan yang lazim sekarang ini perlu dinilai kembali apakah memberi keberkesanan kepada manusia dan boleh dipertangungjawabkan kepada Allah SWT atau manusia hanya jadi korban dari pembangunan dan politik pembangunan itu. Syukri Salleh (2000:184) juga menilai politik pembangunan yang dikaitkan dengan insitusi Islam mestilah memiliki Rencana Induk Pembangunan yang Islami. Secara Islam pula, menjadi satu pertanyaan apakah sebuah institusi

Islam telah mendasarkan pemikiran pembangunannya benar secara Islam atau ia hanya sekedar jadi pengikut pemikiran lazim (Syukri Salleh, 2002, Choudury, 2011, Fadzila Azni Ahmad, 2011,Warjio, 2011, Bustanuddin Agus, 2007, Lainatus Sifah, 2008). Karena itu, pendekatan Islam perlu dilakukan dalam menilai kembali pembangunan (Kurshid Ahmad, 2000:5, Syukri Salleh, 2002, Choudury, 2011). Tentunya, dalam seminar ini juga, pengalaman para pembicara lain dari berbagai negara dalam memberikan penilaian, mengenai kedudukan manusia sebagai sumberdaya yang diciptakan Tuhan. Sebagaimana yang disampaikan Dr Aliyu Dahiru Muhammad dari Nigeria, dia bahwa pengalaman negaranya, salah satu persoalan dalam pembangunan di adalah rendahnya moralitas dalam pembangunan. Islam lebih banyak diperkatakan dalam pembangunan ketimbang dipraktekkan dalam pembangunan. Ini mengakibatkan adanya banyak ketimpangan dalam pembangunan. Saya teringat kembali isu yang muncul dalam seminar internasional Pascasarjana UMA (RIDEV 1) beberapa bulan lalu yang memberi konsentrasi pada perlunya religiusitas dalam pembangunan dan dakwah perlu dilakukan karenanya. Kesimpulan seperti ini, menjadi tantangan bagi saya untuk menjelaskan dalam paper saya di seminar ini bagaimana politik dakwah oleh partai politik dapat berperanan. Saya yakin dan percaya, Indonesia yang kita cintai ini, masih memerlukan agama dalam pembangunan dan manusia ditempatkan dalam posisi yang terhormat. Suara ISDEV dalam seminar ini saya kira akan memberikan kontribusi untuk itu. Wallahualam. Penulis adalah Dosen S3 Studi Pembangunan USU, Ketua MAP UMA, Peneliti RUT ISDEV USM.

Ekonomi & Bisnis

B8 Tinjauan Ekonomi

WASPADA Senin 10 September 2012

Jhon Tafbu Ritonga Pengamat Ekonomi

Jadi Gubsu Mau Lakukan Apa ? (1) Ad a pes a n singkat kawan lama (wartawan) dari daerah. Isinya tentang harapan di balik kesibukan putranya membantu seorang Bakal Calon (Balon) Gubsu 2013-2018. “Tlg bpk igtkn spy cpt ljt ke S3”. Dia ingin anaknya lebih matang menjadi seorang ekonom mumpuni. Saya senang karena sejak mahasiswa cita-cita putranya menjalani karir sebagai wartawan dan ekonom sudah menunjukkan pertanda sukses. Belakangan ini saya dengar sebagai wartawan yang juga dosen putra sulungnya ikut sibuk menyongsong Pilgubsu 2013. Untuk apa sibuk ke sana ke mari, diskusi hingga larut malam, bisik sana bisik sini, dan bolak balik Medan-Jakarta? Apakah hubungan citra yang hebat dengan kemampuan membangun? Saya berharap para pembaca kolom ini sedikit tercerahkan. Bangsa kita sekarang makin terjebak dalam mitos demokrasi, dan mitos peran KDH. Makin kita sibuk tak menentu, kian terjebak dalam lingkaran masalah. Kepada teman lama itu saya harus berterus terang menyampaikan pendapat. Putranya jangan berharap dibantu si Balon jika kelak nanti terpilih menjadi Gubsu 2013-2018. Toh dia mau sekolah S3 ke luar negeri (kalau di dalam negeri sudah mampu S1 dan S2). Bukan menjadi pemborong proyek APBD. Sekarang saja justru anaknya yang membantu si Balon menuju Pilgubsu 2013. Seperti dalam hal pencitraan dan ghost writer. Mungkin ada imbalan, tapi pasti kecil jika dihitung dengan prinsip opportunity cost. Biasanya tidak menambah daftar aset. Saya ingin mengungkap pengalaman ketika menjadi wartawan. Sejak muda (1982-2002) sudah diminta Kepala Daerah (KDH) membuat liputan kinerja pembangunan hingga membantu penyusunan paparan visi-misi dan Renstra. Pengalaman yang langka bagi kebanyakan dosen. Saya merasakan kesempatan yang dibutuhkan KDH itu sebagai “bantuan” bernilai untuk memperluas cakrawala mengenai pembangunan ekonomi. Tapi yang membiayai pendidikan lanjut saya bukan KDH, melainkan ADB yang bermarkas di Manila. Rezeki membangun rumah, beli mobil, haji dan umrah serta menyekolahkan dan mengawinkan anak semua ialah dari Tuhan melalui usaha profesional. Tidak ada imbalan yang diberikan KDH. Pengalaman selama tiga dasawarsa (19822012) menunjukkan para KDH yang sungguhsungguh ingin membangun ekonomi rakyat biasanya tak segan meminta pendapat dan bahkan menerima kritik. Mereka umumnya menunjukkan kesadaran bahwa wartawan, dan apalagi sebagai ekonom, dibutuhkan perannya untuk membangun ekonomi daerah. Bahkan secara nasional, otoritas fiskal dan moneterbank membutuhkan peran ahli ekonomi dari daerah. Gubernur Bank Indonesia, Menteri dan CEO Bank Nasional biasanya menaruh respek yang tinggi kepada ekonom dari daerah. Saya menikmati nilai tambah pengalaman menjadi wartawan yang menjadi ekonom. Pengalaman ikut dalam manajemen perguruan tinggi hampir dua dekade (1995-

2012) pun menunjukkan bahwa kebanyakan KDH membutuhkan peran tugas tambahan akademisi. Mulai proses seleksi penerimaan dan masa kuliah hingga masuk lapangan kerja. Termasuk ingin menjadi PNS atau kerja di Bank. Jadi, pertolongan yang dibutuhkan anak kawan saya itu, S3 ke luar negeri (kalau di Medan anaknya pun sudah lama mampu) ialah hanya dari Tuhan. Bukan Balon Gubsu, bahkan tidak Kepala Daerah (kecuali kemudian visi-misi hidupnya berubah). “Perkiraan saya terbalik ya Pak”, tulisnya dalam sms penutup. Dari cerita di atas muncul pertanyaan, apakah yang bisa dilakukan oleh seorang gubernur? Betulkah gubernur berfungsi dalam pembangunan ekonomi daerah? Bisa ada atau tidak ada, dan berfungsi atau tidak berfungsi. Fakta sejak reformasi? Bisa disimak melalui beritaberita kegiatan gubernur di surat kabar lokal. Misalnya pidato ini dan itu, mengatakan ini harus begitu. Kecewa pada kinerja SKPD dsb. Ada foto di poster dan baleho supaya membayar pajak. Ditangkap KPK dan dijatuhi tipikor. Sudah amat jarang berita dan foto meresmikan proyek ini di kabupaten sana, dan groundbreaking proyek raksasa XYZ. Sebelum Pilgub 2008 saya keliling di beberapa kabupaten baik bersama kolega maupun pejabat Pemda. Dari kunjungan ke Madina via Padang bersama Sekda Muhyan Tambuse dan Edward Simanjuntak kami rasa dan saksikan jalan lintas Sumatera di Madina buruk sekali. Ketika dilapor kepada Gubsu, Rudolf M. Pardede segera memerintahkan Sekda menelpon Kadis PU. Beberapa bulan berikutnya dalam satu kunjungan ulang jalan sudah mulus. Saya pernah mengobservasi kesan rakyat terhadap kepemimpinan Rudolf. Seorang muslim spontan berkata “Alhamdulillah” karena anaknya lulus CPNS tanpa deking. Gubsu Rudolf memang perah minta Rektor USU Chairuddin P. Lubis memimpin seleksi CPNS seobjektif mungkin. Seperti ujian masuk USU, siapa saja bisa masuk asalkan pintar, jelas Chairuddin mengulangi haraan Rudolf. Proses seleksi pun dilakukan Pusat Komputer USU secara otonom dan independen. Hasilnya masyarakat merasa puas. Dari hasil observasi di masyarakat tentang kesan kepemimpinannya setelah menggantikan Tengku Rizal dan gagal mencalon Pilgubsu 2008 Rodolf, kami (saya, Muhyan, Edward) menyarankan supaya ikut Pemilu 2009 untuk DPD. Hasilnya seperti diketahui bersama Rudolf mendapat suara melampaui suara yang diperoleh calon lain. Kemenangan yang menunjukkan rakyat tahu dan merasakan apaapa yang dilakukannya selama menjadi Gubsu. Satu bukti rasionalitas pemilih. Masih banyak best practice dan role model dapat diceritakan untuk menjawab judul di atas. Jadi Gubsu mau melakukan apa? Kolom ini akan mengupasnya dalam beberapa edisi dengan maksud menginspirasi para Balon Gubsu dkk. Sekiranya kalimat-kalimat yang dipilih seperti “menyindir” saya harap dimanfaatkan untuk perbaikan. Penguatan niat dan visi-misi dan renstra. Horas.


BEBERAPA pelaku usaha mikro dan kecil sedang mengikuti pelatihan peningkatan kapasitas nasabah yang digelar BTPN Cabang Kapten Muslim di Jl. Gatot Subroto, Komplek Tomang Elok Medan, Jumat (7/9).

BTPN Tingkatkan Kapasitas Pengusaha Mikro Di Medan MEDAN ( Waspada): PT Bank Tabungan Pensiunan Nasional (BTPN) menggelar program pemberdayaan yang disebut ‘Daya’. Peserta kegiatan ini adalah para pelaku usaha mikro, di Kantor BTPN Cabang Kapten Muslim, KomplekTomang Elok, Medan, Jumat (7/9). “Daya, merupakan program pemberdayaan mass market yang berkelanjutan dan terukur, guna meningkatkan kapasitas nasabah pensiunan, Usaha Mikro dan Kecil (UMK), serta komunitas pra-sejahtera produktif,’’ kata Regional Business Leader UMKWilayah Sumatera Bagian Utara Ade Koes Djafri, di sela-sela pelatihan tersebut. Ade, menyebutkan, BTPN mengembangkan program Daya berlandaskan model bisnis yang mengintegrasikan misi sosial dan misi bisnis atau yang disebut dengan ‘Peluang Sekaligus Panggilan’. ‘’Kami meyakini, keterlibatan BTPN dalam membangun lingkungan nasabah akan berdampak positif terhadap pertumbuhan kapasitas nasabah sekaligus meningkatkan pertumbuhan kinerja BTPN,” ujarnya. Didampingi External Communications Ainul Yaqin, Ade mengatakan, untuk meningkatkan kapasitas nasabah, program pemberdayaan Daya

terdiri dari tiga pilar yaitu Daya Sehat Sejahtera, Daya Tumbuh Usaha, serta Daya Tumbuh Komunitas. Pelatihan yang sedang dilakukan tersebut, katanya, Daya Tumbuh Usaha yaitu pelatihan pengembangan usaha dan modal bagi pelaku usaha mikro dan kecil (UMK). Menurutnya, pelatihan dilakukan secara sederhana dengan modul yang berisi kiatkiat praktis. Saat ini BPTN telah memiliki beberapa kiat praktis seperti kiat praktis meningkatkan pendapatan dan membuat pembeli menjadi setia, kiat praktis membangun dan mengembangkan merek, kiat praktis mengelola keuangan dan kiat praktis menata barang dagangan. “Secara nasional dalam periode satu tahun program daya telah menjangkau 948.269 penerima manfaat, atau meningkat 61 persen dibandingkan tahun sebelumnya tercatat 588.540 nasabah. Penerima manfaat merupakan nasabah mass market yaitu pelaku usaha mikro dan kecil, pensiunan, serta komunitas pra-sejahtera produktif,” ujarnya. Dia menyebutkan, program pemberdayaan yang dilaksanakan BTPN selama ini mendapat tanggapan sangat positif dari nasabah. Berdasarkan pengu-

kuran hasil evaluasi kegiatan, rata-rata tingkat kepuasan nasabah mencapai 90 persen.“Melalui program Daya Tumbuh Usaha, kami berharap dapat meningkatkan kapasitas nasabah BTPN utamanya para pelaku usaha mikro agar dapat bertumbuh dengan lebih baik lagi,” pungkas Ade. Sementara itu, salah seorang nasabah BPTN Siti Aminah, warga Jl. Kapten Muslim yang membuka usaha menjual sembako di Pasar Sei Kambing Medan mengaku puas dengan pelayanan diberikan BTPN, karena selain diberikan pinjaman juga dilakukan pendampingan dengan berbagai pelatihan untuk memajukan usaha. “Banyak manfaat yang telah diberikan BTPN terutama pelatihan Daya, terutama dalam pengaturan keuangan. Kita diajarkan untuk menyisihkan dana-dana untuk keperluan yang lebih penting baru untuk kepentingan lainnya, sehingga pada saat barang sudah habis dan perlu membeli lagi, dana sudah tersedia. Begitu juga untuk pembayaran kredit ke bank, bila sudah jatuh tempo uang sudah tersedia,” ujar Siti Aminah yang sudah kembali menambah modal pinjaman untuk kedua kalinya. (m41)


PANEN KEDUA Seorang petani memanen padi untuk panen kedua tahun 2012 di Desa Vatunonju, Sigi Brimaru, Sigi, Sulawesi Tengah, Minggu (9/9). Target pengadaan beras Bulog Sulteng dari panen lokal belum mencapai target sebesar 15,000 ton sehingga pengadaan dari provinsi tetangga terpaksa dilakukan. Harga beras di tingkat petani saat ini berkisar Rp.7.300 - Rp.7.500 per kilogram.

Kuota BBM Bersubsidi Sumut Terancam Habis MEDAN (Waspada): Meskipun ancaman kelangkaan bahan bakar minyak (BBM) sudah di depan mata, tingginya konsumsi membuat kuota BBM terancam habis pada Oktober atau November nanti.

PT Pertamina wilayah Sumatera Utara pun mengupayakan kuota BBM bersubsidi akan bisa mencapai akhir tahun. Asisten Manager External Reletion Pertamina Region-I Fitri Erika menyampaikan hal itu di Pertamina Region-I Sup-

Harga TBS Kembali Anjlok Jadi Rp800 Per Kg SIMALUNGUN (Waspada): Kalangan petani kelapa sawit di beberapa kecamatan di Kab. Simalungun akhir-akhir ini masih terus dihantui rasa gelisah dan resah. Pasalnya, harga kelapa sawit atau Tandan Buah Segar (TBS) produk petani hingga saat ini tak kunjung stabil, bahkan cenderung merosot. Kegelisahan petani kelapa sawit ini diungkapkan kepada Waspada, Minggu (9/9), menanggapi anjloknya harga jual kelapa sawit petani yang berlangsung sejak lebaran hingga sekarang tinggal Rp 800 per kilogram. Petani menyebutkan, merosotnya harga kelapa sawit dari sebelumnya (Ramadhan lalured) sangat memukul perekonomian mereka. Dikatakan, pada putaran minggu terakhir Ramadhan lalu harga jual kelapa sawit petani kepada agen masih terbilang lumayan mencapai Rp 1.200 per kilogram. Namun anehnya, memasuki minggu kedua setelah lebaran, tiba-tiba harga penjualan sawit anjlok rata-rata Rp 300 per kilogram, atau harga penjualan

petani tinggal Rp 900 per kilogram. “ Gawat, hanya dalam tempo dua pekan harga jatuh rata-rata Rp 300 setiap kilogramnya,” cetus John Sinaga, petani di Bandar Huluan. Tidak cukup hanya disitu, memasuki minggu ketiga setelah lebaran harga malah bertambah anjlok, dari sebelumnya Rp 900 per kilogram, kini tercatat tinggal Rp 800 per kilogram. “ Kita tidak tau ini permainan siapa, agen kah, atau pihak PKS (Pabrik Kelapa Sawit), tetapi yang pasti kami sebagai petani resah dan gelisah melihat harga yang hampir setiap hari mengalami penurunan yang cukup tajam,” timpal Segar, warga Bandar Huluan. Jangan Tutup Mata Petani juga sangat menyayangkan, meskipun penurunan harga kelapa sawit sudah sampai kepada tingkat meresahkan, namun pihak pemerintah tidak berupaya melakukan langkahlangkah guna mengatasi ketidakstabilan harga komoditi kwalitas eksport tersebut. Demikian halnya pihak

BUMN (Badan Usaha Milik Negara) terutama yang mengelola tanaman kelapa sawit sekaligus pengelola PKS juga terkesan diam, malah sepertinya suka melihat petani sawit resah akibat anjloknya harga kelapa sawit dimaksud. “ Petani memang tidak bisa berbuat apa-apa. Pemerintah seharusnya tidak tutup mata. Jika pemerintah mau dan bekerjasama dengan pihak BUMN, kita yakin harga kelapa sawit akan terangkat dan bisa stabil,” jelas S Damanik, petani di Kec. Pematangbandar. Akhirnya, petani senada berharap pemerintah dan pihak BUMN yang mengelola tanaman kelapa sawit dan pemilik PKS dapat bekerjasama guna mengatasi masalah ini. Hingga kini, petani meyakini, turunnya harga kelapa sawit bukan karena faktor penurunan harga CPO di luar negeri. Tetapi kita yakin, merosotnya harga kelapa sawit petani, akibat ulah dan akal-akalan agen sawit dan para spekulan, termasuk para pengelola PKS swasta, ujar petani.(a29)

Pemerintah Harus Dukung MP3EI MEDAN (Waspada): Pemerintah kabupaten/kota seSumatera Utara harus serius mendukung program Masterplan Percepatan dan Perluasan Pembangunan Ekonomi Indonesia (MP3EI). Yakni dengan memfasilitasi pengembangan Kawasan Industri Sei Mangke (KISM) sebagai kluster industri hilir kelapa sawit dan karet. Wakil Walikota Tanjung Balai Rolel Harahap, mengatakan usai menghadiri halal bil halal Persatuan Nelayan Tradisional Indonesia (PNTI) di Kec. Pantailabu, Kab. Deliserdang, belum lama ini. Disebutkan Rolel Harahap, keseriusan Pemkab/Pemko, sangat penting dalam mewujudkan program ini. Bila itu terwujud, maka akan menimbulkan multiplayer effect terhadap peningkatan ekonomi di provinsi ini. Katanya, Sumut pasti rugi

bila program ini tidak terlaksana. Apalagi pemerintah pusat sudah memberi kesempatan. Seharusnya Pemkab/Pemko mendukung sepenuhnya. Pemko Tanjungbalai, kata Rolel, sudah mempersiapkan diri dengan lima peran. Yanki, melakukan pembenahan pelabuhan laut guna melayani produk turunan sawit/karet yang ingin diangkut dengan cepat (mobile tinggi). Kemudian, katanya, Tanjungbalai masuk pada kawasan industrialisasi menengah-kecil. Bahan baku turunan dari KISM diolah menjadi bahan jadi di Kawasan Industri Tanjungbalai (KIT). Pihaknya saat ini sudah menyediakan lahan 300 hektare di Kec. Sungai Tualang Raso. Bila dibutuhkan, lahan tersebut dapat dikembangkan menjadi 500 hektare ke arah Air Joman Kab. Asahan. Transportasi yang digunakan lewat jalur perairan

pelabuhan Teluk Nibung hanya berjarak 4 km dari KIT. Persiapan lainnya yang tengah dilakukan, Tanjungbalai dapat dijadikan pintu masuk jalur wisata khususnya ke Danau Toba. Ini memungkinkan karena Tanjungbalai sudah masuk dalam kawasan Lake Toba Regional Manajemen (LTRM). Keempat, Tanjungbalai telah memiliki perguruan tinggi Politeknik dan telah bersinergi dengan pelaku industri. Politeknik Tanjungbalai (Poltan) telah mempersiapkan sumber daya manusia terampil, memiliki kompetensi dan skill melalui program pendidikan D1, D2 dan D3. Ditambah lagi lulusan SMK yang siap bersaing di dunia industri. ‘’Yang terakhir, Tanjungbalai bersiap diri mensuplay kebutuhan pangan para pekerja di KSIM. Terutama jenis ikan dan hasil laut lainnya,’’ kata Rolel Harahap.(m24)

Ducati Jajaki Pasar Medan MEDAN (Waspada): Setelah membuka dealernya di kotakota besar di Indonesia seperti Surabaya, Bandung, Makasar, Bali, Yogyakarta, Banjarmasin, Balikpapan, dan Semarang, Ducati Indonesia mulai menjajaki pasar Medan dengan melaunching Dealer Ducati Medan di Jalan Setiabudi Medan, Sabtu (8/9). Hal ini dilakukan untuk menegaskan komitmen Ducati untuk mendekatkan dirinya pada pecinta motor gede (Moge) di tanah air. Direktur Ducati MedanYose

Ferdian didampingi Doddy Hasanudin yang juga owner Ducati Medan mengatakan, Medan cukup potensial dalam melakukan pemasaran sepedamotor Ducati. Selain faktor sosial ekonominya yang cukup bagus, di Medan juga banyak komunitas pecinta Moge. “Kita lihat potensinya sangat besar untuk pemasaran motor besar Ducati ini, karena sangat banyak masyarakat pecinta dunia otomotif khususnya sepedamotor yang sangat responsip perkembangan dunia otomotif, sehingga sangat besar peluang-

nya bagi Ducati di pasar Medan,” ujar Yose Ferdian. Sebagai dealer resmi Ducati, pihaknya akan menampilkan berbagai varian motor seperti Ducati Monster, Street Fighter, Superbike, Diavel Hypermotard, dan Multistrada. Untuk tahun pertama 2012 ini, kata Yose, pihaknya menyediakan sebanyak 40 unit motor Ducati dengan berbagai varian. Para pecinta Moge dimanjakan dengan berbagai pilihan Moge Ducati sesuai dengan karakter dan kebutuhan masing-masing. (m41)

ply & Distribution Terminal BBM Medan Group, Jalan Komodor Laut Yos Sudarso KM 20 Labuhan Deli, Kecamatan Medan Labuhan, Medan, Sumatera Utara, Minggu (9/9). Dikatakannya, Pertamina selaku salah satu badan usaha penyedia BBM bersubsidi di Wilayah Sumatera Utara (Sumut), melaksanakan tugas distribusi, harus menyesuaikan dengan jumlah yang ditetapkan kouta oleh pemerintah, dalam hal ini BP Migas Menurut Fitri, sampai perjalanan tiga bulan hingga Agustus lalu, memang kenaikan

peningkatan konsumen BBM Solar dan Premium di wilayah Sumut mengalami peningkatan mencapai 10 persen, akan hal ini diasumsikan karena pertumbuhan ekonomi dan pertumbuhan kendaraan bermotor. Oleh karena itu, Pertamina harus melakukan upaya agar kuota tersebut bisa sampai akhir 2012, dengan upaya menambah outlet pilihan selain premium menambah SPBU pertamax 88 SPBU di wilayah Sumut dan untuk solar bersubsidi menambah lima SPBU untuk wilayah Sumut, agar bisa mencukupi untuk wilayah Sumut.(okz)

Penyaluran Kredit UMKM Sebaiknya Melalui BPR Dan BPRS MEDAN (Waspada): Penyaluran kredit kepada Usaha Mikro Kecil Menengah (UMKM) sebaiknya disalurkan melalui Bank Perkreditan Rak-yat (BPR) dan Bank Perkreditan Rakyat Syariah (BPRS) serta keuangan mikro lainnya, karena dinilai lebih mengenal UMKM dan dapat dilakukan tepat sasaran. Hal itu disampaikan Penasehat Forum Pengembangan BPR/ BPRS (Forbest) Sumut yang juga DPD RI asal Sumut Parlindungan Purba saat menerima pengurus For-best Sumut, Kamis (6/9). Alasan penunjukan BPR, BPRS dan keuangan mikro lainnya sebagai penyaluran kredit kepada UMKM, Par-lindungan menilai, BPR, BPRS lebih mengenal UMKM se-hingga penyaluran kredit yang dilakukan dapat tepat sasaran. Selama ini BPR, BPRS dan lembaga mikro lainnya lebih terfokus pada penyaluran kredit kepada UMKM. Selain menya-lurkan kredit selama ini keuangan mikro lainnya juga turut membina UMKM dalam mengembangkan usaha. Keberhasilan UMKM dalam mengem-bang-kan usaha berarti keberhasilan dalam penyalurkan kredit. “Saya berusaha agar penya-luran kredit yang dilakukan pemerintah kepada UMKM dapat melibatkan BPR, BPRS dan keuangan mikro lainnya. Saya berharap program pemerintah dalam meningkatkan UMKM dapat berhasil. Salah satu indikasi keberhasilan apabila penyaluran kredit untuk UMKM tepat sasaran dengan ditandai adanya pe-ning-katan UMKM baik dari kualitas dan kuantitas,” ung-kapnya. Ketua Forbest Sumut Syafruddin Siregar SH mengatakan, terbentuknya Forbest Sumut mengembang misi mewujudkan Forbest Sumut yang aspiratif, bermanfaat serta mampu menjadi mitra strategis bagi semua pihak dalam memperjuangkan industri UMKM serta lembaga keuangan lainnya. Misi yang diemban meningkatkan kebersamaan untuk menciptakan nilai tambah bagi para anggota Forbest Sumut, meningkatkan kemitraan dengan pihak otoritas keuangan dan industri terkait dalam mendorong pertumbuhan BPR dan BPRS khususnya dan UMKM serta lembaga keuangan lainnya. “Sesuai dengan instruksi penasehat Forbest Sumut Bapak Parlindungan Purba meminta agar Forbest dapat menyusun langkah-langkah apa yang dilakukan kepada pemerintah. Dengan wadah ini kita berharap dapat menfasilitasi dengan memberikan konsultasi kepada UMKM, membantu dalam hal membuat neraca dan pendampingan lainnya,” jelasnya. Pengukuhan Forbest Sumut juga sekaligus melakukan pelatihan kepada pengurus dan anggota mengenai Pengisian Penyisihan Aktiva Produktif (PPAP) dan Agunan yang diambil alih (Ayda) dengan mendatangkan pembicara Ketua Litbang DPP Perbarindo Pusat, Edi Poernomo Santoso. Adapun struktur Forbest Sumut penasehat dan pengawas Parlindungan Purba,Yan Juanda, Binsar Hutabarat, Hj. Nelly Nurlely, H. Amru Effendy Harahap. Ketua Syafruddin Siregar, Wakil Ketua HR. Bambang Risbagio, Sekretaris Mery Sulianty H Sitanggang, Wakil Sekretaris Rudy Chuward. (m41)

Harga Emas London Murni (LM) Emas 22 Karat (97%) Emas 17 Karat (70%) Suasa

520.000 504.000 364.000 270.000


Nilai Mata Uang Rupiah Terhadap Mata Uang Asing Mata Uang




Dolar AS Dolar Singapura Dolar Australia Euro Eropa Yen Jepang Dolar Hongkong Ringgit Malaysia Rial Saudi Arabia Poundsterling Inggris


9.585 7.705 9.870 12.107 122,25 1.235 3.065 2.550 15.265

9.600 7.725 9.890 12.130 122,50 1.240 3.085 2.565 15.295


*) Kurs dapat berubah sewaktu-waktu Sumber: PT Bank Mandiri (Persero)


WASPADA Senin 10 September 2012


Desain Sayap Kanan Irigasi Langkahan Final MADAT (Waspada): Pemerintah Aceh melalui Dinas Pengairan komit mengembangkan Irigasi Langkahan di Kec. Langkahan, Aceh Utara. Bahkan, saat ini desain pengembangan sayap kanan irigasi ini sudah final dan rencananya akan mulai dibangun 2013 mendatang. “Sayap kanan ini nantinya bisa mengairi sekitar 34.000 hektare sawah, mulai dari kawasan Langkahan hingga ke Idi, Aceh Timur,” kata Kadis Pengairan Aceh Slamet Eko Purwadi, saat mendampingi kunjungan kerja anggota DPD RI Tgk Abdurrahman BTM, di Madat, Aceh Timur, Kamis (6/9). Pemerintah Aceh Timur sendiri, sambung Eko, mendukung penuh pembangunan irigasi tersebut. “Baru-baru ini kami berkomunikasi intensif dengan Bupati Aceh Timur Pak Rocky. Beliau mendukung pro-

gram ini dan siap membantu proses pembebasan lahan,” tambahnya. Menurut Eko, pengembangan irigasi Langkahan juga tak terlepas dari program Gubernur Aceh yang baru, Zaini Abdullah, yang memprioritaskan pembangunan irigasi untuk ketahanan pangan dan kemakmuran rakyat. “Dengan dibangunnya sayap kanan irigasi Langkahan, luas panen sawah di Aceh, khususnya di wilayah pantai timur, semakin luas dan otomatis memacu laju pertumbuhan ekonomi dari sektor non migas,” kata Eko. Selain Eko, Tgk Abdurrahman BTM juga didampingi Kadis Pertanian Aceh Asrin MP, Kasi Hidrogeologi Dinas Pertambangan dan Energi Aceh, Dian Budi Dharma MT, Ketua DPRK Aceh Timur Tgk Alauddin, Kadis Pertanian Tanaman

Listrik ke SMPN-1 Bireuen Diputus BIREUEN (Waspada) : Pihak PLN Rayon Bireuen memutus arus listrik ke SMPN-1 Bireuen lantaran pihak SMPN-1 Bireuen sudah empat bulan menunggak belum membayar rekening listrik. Manager PLN Rayon Bireuen Ridwan Adam menjelaskan hal itu, Sabtu (8/9). Dikatakan, jika pihak SMPN-1 melunasi tunggakan rekening empat bulan arus listrik akan disambung kembali. Sementara di Kecamatan Kota Juang, Juli dan Kecamatan Jeumpa, pihak PLN juga sudah membongkar belasan meteran pelanggan yang menunggak rekening listrik tiga bulan lebih. Selain membongkar meteran bagi pelanggan menunggak rekening, kata Ridwan Adam, ada juga meteran pelanggan yang dibongkar lantaran menggunakan arus listrik tidak sesuai kapasitasnya sangat merugikan PLN. (b12)

Anggota DPR Kunjungi Korban Banjir Leuser KUTACANE (Waspada) : Dua anggota DPR RI, Teuke Riefky Harsya, dari komisi V dan Nova Irlansyah, komisi VII, Sabtu (8/9) mengunjungi korban musibah banjir bandang dan tanah longsor di Kecamatan Leuser, Aceh Tenggara yang berlokasi persis berbatasan dengan Kabupaten Dairi dan Karo, Sumut. Dalam perjalanan menempuh medan berat tersebut, kedua anggota DPR RI ini, didampingi mitra kerja mereka dari Pertamina Sumut – Aceh dan GM PLN Aceh, juga didampingi Plh Bupati Agara Hasanuddin Darjo, Dandim Letkol Inf Andi R, Kapolres AKBP Trisno R, wakil ketua DPRK Syahbuddin BP, ulama Agara Buhari Husni, dalam kunjungan itu juga turut serta PT Taspen menyalurkan bantuan bagi korban musibah banjir Leuser tersebut. Plh Bupati Agara Hasanuddin Darjo menmyampaikan, kunjungan T Riefky dan Nova melengkapi kepedulian pemimpin bagi rakyat korban musibah di Agara di mana sebelumnya di lokasi yang dikunjungi Desa Naga Timbul itu telah dikunjungi Pangdam Iskandar Muda Mayjen Zahari Siregar dan Gubernur Aceh Dr Zaini Abdullah. T Riefky, menyampaikan pesan Presiden secara khusus kepada masyarakat Leuser agar tabah dan tegar. T Riefky dalam kunjungan ke Agara juga melakukan aksi sosial menggelar khitanan sehat bagi 500 anak yatim dan duafa. (b25)

Pangan dan Hortikultura, Sugiarto dan anggota DPRK Aceh Timur dari fraksi PA, Sulaiman Hamzah alias Apa Leman. Sesampai di Madat, rombongan langsung meninjau sawah tadah hujan dan SMP yang rawan tergenang banjir di Desa Pantee Bayam, lalu melihat pintu air pasang surut di Desa Lueng Peut, dan terakhir berkunjung ke dayah Khairul Huda di Desa Lueng Sa. Khusus menyangkut sawah tadah hujan, tokoh masyarakat Madat, Murhaban alias Tgk Awe menjelaskan, total sawah tadah hujan di kawasan itu sekitar 250 ha. Sawah ini tersebar di lima desa, meliputi Desa Meunasah Asan, Pante Bayam, Meunasah Tingkeum, Lueng Dua, Matang Guru. “Selama ini, sawah-sawah ini lebih sering terlantar. Petani hanya bisa memanfaatkannya kala musim hujan. Itu pun ra-

wan gagal panen lantaran suplai air tak menentu. Petani sudah lama mengidam-idamkan irigasi agar sawah ini bisa digarap minimal dua kali setahun,” ujar Tgk Awe. Kadis Pengairan Aceh Slamet Eko Purwadi berjanji segera menurunkan tim teknis untuk proses desain detil. “Ada dua alternatif. Membuat talangan di Desa Luengsa atau bendungan di pintu pasang surut Desa Lueng Peut. Nanti kita evaluasi dulu mana yang lebih baik, itu yang kita pilih,” katanya. Anggota DPD RI Tgk Abdurrahman BTM menyatakan, kunjungan tersebut merupakan kegiatan rutin untuk menyerap aspirasi masyarakat. “Kita memang lebih sering di lapangan, ketimbang di Senayan. Para kadis terkait, sengaja kita bawa supaya keluhan masyarakat lebih terarah dan cepat teratasi,” tuturnya. (b19)


ANGGOTA DPD RI Tgk Abdurrahman BTM dan rombongan saat meninjau pintu air pasang surut di Desa Lueng Peut, Kec. Madat, Aceh Timur, Kamis (6/9).

Security Bandara SIM Tangkap Komplotan Penyelundup Ganja

Selain menangkap tersangka, petugas bandara juga menyita dua buah koper berisi 40 kilogram daun ganja kering yang akan diberangkatkan ke Jakarta. Keempat orang yang tangkap tersebut, Mun, karyawan PT Angkasa Pura II Cabang Bandara SIM,Yz, security Bandara SIM, Abd alias Pak Guru, warga Aceh Besar, penumpang pesawat Lion Air yang diduga pemilik ganja kering tersebut dan seorang lagi yang belum diketahui identitasnya. Kepala Security Bandara SIM Husaini, Minggu (9/9) membenarkan penangkapan tersebut. Husaini mengatakan, ke-

empat orang yang ditangkap petugas keamanan Bandara SIM dalam waktu yang berbeda itu telah diserahkan kepada pihak Kepolisian Resort Kota Banda Aceh, Minggu pagi termasuk barang bukti dua buah koper berisi ganja kering dan satu lembar tiket pesawat Lion Air atas nama Abd. Menurut Husaini, Abd alias Pak Guru sesuai tiket pesawat yang sudah dicek-in oleh Mun, akan berangkat menuju Jakarta pada Minggu sekira pukul 06:00 menggunakan Lion Air. Namun, karena terungkapnya rencana penyelundupan ganja kering tersebut, yang bersangkutan batal berangkat, bahkan sebaliknya harus berurusan dengan pihak berwajib. Husaini juga menjelaskan, keberhasilan security Bandara SIM menggagalkan rencana penyelundupan itu berawal dari kecurigaan anak buahnya terhadap isi dua buah koper yang dibawa Mun ke dalam Bandara SIM, Minggu dinihari, saat aktivitas bandara belum dimulai. Koper tersebut kemudian diambilYz, oknum security bandara untuk dibawa masuk ke dalam.

LHOKSUKON, (Waspada): Kasus istri mengajukan gugat cerai terhadap suami yang tidak bertanggungjawab menonjol di Mahkamah Syariyah Lhoksukon, Aceh Utara. “Perkara terbanyak dari Januari – 6 September 2012 yang kami tangani, yaitu istri mengajukan gugat cerai terhadap suaminya yang tidak bertang-

gungjawab terhadap biaya rumah tangga,” kata Panitera/ sekretaris Mahkamah Syariyah Lhoksukon, Irpanusir, di ruang kerjanya, Kamis (6/9) pekan lalu. Dalam kurun waktu hampir sembilan bulan terakhir di literatur Mahkamah Syariyah ini, kata dia, jumlah kasus istri gugat cerai suaminya dan kasus perselisihan serta pertengkaran, men-

BANDA ACEH (Waspada): Security Bandara Udara Internasional Sultan Iskandar Muda, Blang Bintang, Aceh Besar, menangkap empat orang yang hendak menyelundupkan ganja kering keluar Aceh. Dua orang di antaranya adalah orang dalam bandara sendiri.

“Saat itulah anggota kita melakukan penangkapan terhadap keduanya. Sedangkan Abd dan seorang temannya itu ditangkap saat sedang berada di cafe bandara beberapa saat menjelang keberangkatan,” ujarnya. Kepala Pengamanan Bandara Sultan Iskandar Muda, Blang Bintang, Aceh Besar mengaku, pihaknya sempat menerima beberapa kali ancaman dari penelepon gelap terkait penangkapan tersebut. Namun, pihaknya tetap menegakkan aturan dalam menjalankan fungsi dan tanggungjawab melakukan pengamanan bandara, termasuk mencegah kegiatan ilegal yang memanfaatkan dan menggunakan fasilitas bandara dan penerbangan. Dia juga mengungkapkan, dengan tertangkapnya dua ‘orang dalam’ yang diduga terlibat aksi kejahatan penyelundupan barang terlarang itu, setidaknya telah menjawab sebagian teka-teki siapa yang bermain selama ini. Kapolresta Banda Aceh Kombes Pol Moffan Mudji Kanti membenarkan pihaknya telah menerima penyerahaan keempat tersangka.(b05)

Kasus Istri Gugat Cerai Suami Meningkat Di Mahkamah Syariyah Lhoksukon

Waspada/Mahadi Pinem

T RIEFKY, anggota DPR (paling kanan), bersama Nova Iriansya, komisiVII DPR (dua dari kanan), Plh Bupati Agara Hasanuddin Darjo (tengah) dan Syahbuddin BP (paling kiri) ketika memberikan bantuan pada korban banjir bandang di Leuser, Agara, Sabtu (8/9).

Jalan Kebun Menuju Blang Kulam Ada Pengemis KUTAMAKMUR (Waspada): Jalan menuju ke tempat wisata Riam Blang Kulam yang dilingkupi hutan dan perkebunan sawit ini anehnya ada pengemis. Padahal jalan ini tidak terlalu ramai, selain didominasi kendaraan roda dua. Namun, kehadiran pengemis yang kesannya layak di tengah hutan di Desa Sido Mulyo, Kuta Makmur, Aceh Utara ini menimbulkan kesan yang aneh, seolah-olah jumlah orang miskin tambah banyak. Menurut Jamal, 26, yang merupakan pengunjung objek wisata tersebut, Minggu (9/9), lelaki pengemis itu sudah biasa duduk di pinggir jalan situ seraya mengharapkan mendapatkan derma dari orang-orang yang melintas, terutama mereka yang pergi bersenang-senang menikmati indahnya alam air terjun. Memang suasana libur dan santai, bercengkrama bersama teman-teman dan keluarga rasanya asyik. “Tapi tempat ini agak sepi, jarang betul orang yang berkunjung kemari. Lihat saja ada tempat usaha peternakan yang telah jadi hutan, dan tempat wisata ini tidak begitu terawat,” ujarnya. Riam Blang Kolam yang berjarak tempuh lebih dari 20 km dari Kota Lhokseumawe ini, menurut keterangan masyarakat setempat, masih belum tersentuh bantuan pemerintah alias terlantar. “Kalau sudah ada kucuran dana, tentunya akan lebih baik dan lebih diminati para pengunjung,” kata Malik, pengunjung lainnya. (b14)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


capai 289 kasus termasuk kasus oknum pengusaha sukses toko Hlm di Jalan Tgk Chik DiTunong Lhoksukon. “Kasus perselisihan dan pertengkaran dalam rumah tangga, tercatat pada urutan dua. Sementara perkara yang berlatarkan permohonan sampai September ini hanya 45 berkas,” tuturnya. (b13)

Khawatir Terjebak KDRT, Pengusaha Lhoksukon Kirim Mediator LHOKSUKON, (Waspada): Khawatir terjebak kasus KDRT, seorang pengusaha pemilik toko Hlm di Jalan Tgk Chik Di Tunong Lhoksukon, Aceh Utara, mengirim mediator, Jumat (7/ 9). Dua hari sebelumnya, Halim bin Latif, 45, warga Gampong Nga Matang Ubi, Kec. Lhoksukon, telah menggembok pintu rumah di Dusun Kuta, Desa Nga Matang Ubi, agar istrinya Sadriah binti Rasyid, 26, tidak bisa masuk ke rumah. Menurut Sadriah binti Rasyid, akibat penggembokan pintu rumah, ia bersama anak bayi hasil perkawinannya terpaksa mencari perlindungan ke rumah keuchik setempat, Chaidir Ismail. Kades bersama perangkat gampong merasa prihatin terhadap ulah oknum Halim bin Latif sehingga turun tangan untuk memediasi. Tujuannya sebelum keputusan hukum inkraft di Mahkamah Syariyah Lhoksukon, Hlm bin Ltf, dapat bertanggungjawab terhadap istrinya. Sebab, terkait kasus percekcokan rumah tangga ini, oleh Sadriah binti Rasyid (istri Halim bin Latif) telah mendaftarkan gugatan cerai, Kamis (6/9). Disinyalir untuk menghindari kasus Kekerasan Dalam Rumah Tangga (KDRT), Halim bin Latif akhirnya berlunak hati, lalu mengutuskan tim mediator ke Desa Nga Matang Ubi Lhoksukon, di bawah pimpinan Kades untuk menemui keluarga istrinya di Desa Buket Alue Puteh Pantonlabu, Tanah Jambo Aye, Jumat pekan lalu. Kehadiran tim mediator pasangan Halim bin Latif – Sadriah

binti Rasyid, mendapat sambutan baik dari keluarga penggugat (istri Halim bin Latif), bersama tim mediator dari kampung sang istri (Desa Buket Alue Puteh), kedua belah pihak berembuk hingga mencapai kesepakatan,Halim bin Latif bersedia memikul tanggungjawab membiaya istri dan anak bayinya yang belum mencapai usia dua bulan itu sebesar Rp40.000 per hari, terhitung sejak Jumat (7/9) sampai dengan adanya keputusan inkraft dari proses gugatan istrinya di Mahkamah Syariyah Lhoksukon. Pengusaha sukses toko Hlm Jl Tgk Chik Di Tunong Lhoksukon, membuat perjanjian lisan di depan mediator akan membayar biaya tanggungan tersebut sebesar Rp1 juta per 25 hari kalender terhitung, Jumat (7/9) secara terus menerus sam-

pai adanya keputusan inkraft proses peradilan, dengan realisasinya menjadi tanggungjawab Kades Desa Nga Matang Ubi Lhoksukon. Para mediator di pihak Halim bin Latif terdiri dari Kades Desa Nga Matang Ubi Lhoksukon, Imam Desa, Tgk Umar, Tuha Peut/perangkat gampong, Hamzani, Imam Masjid setempat, Tgk Hasyem dan daftar hadir mediator tersebut, ikut ditandatangani Halim bin Latif sendiri, bersama putranya Nanda Rizki. Sementara mediator dari pihak istri terdiri dari Kades Buket Alue Puteh, Ibrahim Saleh. Berikutnya Tuha Peut, MYusuf Budiman, Weskarnaini (wali si istri), M Jakfar (keluarga), Mustafa (keluarga) dan ikut ditandatangani istri Halim bin Latif, yaitu Sadriah binti Rasyid. (b13)

Waspada/M Jakfar Achmad

ISTRI pengusaha toko Hlm di Jalan Tgk Chik Di Tunong Lhoksukon, Sadriah bin Rasyid (kiri), didampingi Halim bin Latif pada majelis sidang mediasi di Balai Pengajian (BP) Babul Ma’arif di Desa Buket Alue Puteh, Tanah Jambo Aye Pantonlabu, Jumat (7/9).

Pekerja Doorsmeer Tewas PANTONLABU (Waspada): Rudi Salam, 17, pekerja doorsmeer, warga Desa Rawang Iteik, Kec. Tanah Jambo Aye, Aceh Utara, ditemukan tewas di saluran irigasi, persis di pintu air PTL6 Desa Rawang Iteik, Minggu (9/9) pukul 12:00. “Korban melompat untuk berenang, sekitar pukul11:00.Karenaarusairsangatderas,Iaterseret, lalu terjebak di celah pintu air,” kata Zakaria Sabon, 50, tokoh masyarakat Rawang Iteik. Zakaria menambahkan, sejumlah warga yang mengetahui insiden itu langsung menyelam untuk menolong korban. Namun upaya itu gagal karena arus air sangat deras dan korban terhimpit di celah pintu air. “Korban baru diangkat dalam kondisi tak

bernyawa sekitar satu jam kemudian, dan langsung dibawa ke Puskesmas Tanah Jambo Aye untuk visum. Sekarang sedang proses pemakaman,” tambah Zakaria, kemarin petang. Keuchik Rawang Iteik, Razali, secara terpisah mengatakan, saluran irigasi kawasan PTL6 memang sering merenggut korban jiwa. Tahun lalu, seorang bocah SD asal Desa Matang Drien, Tanah Jambo Aye, juga tewas di lokasi sama karena sebab serupa. “Maunya pemerintah melalui dinas terkait, mengantisipasi insiden rutin ini dengan memasang papan peringatan dan pagar pengaman sehingga korban tidak terus bertambah,” papar Razali. (b19)

Perubahan Harus Dimulai Dengan Penyadaran LHOKSEUMAWE (Waspada): Sejak perdamaian yang telah tujuh tahun lebih berlalu, secara umum belum membawa perubahan yang berartibagikehidupansosialdanekonomidiAceh. “Keadaannya biasa-biasa saja, tidak ada yang terlalu berubah selain tidak ada lagi jatuh korban jiwa. Tentunya, untuk sebuah perubahan harus timbul kesadaran bagi pemerintah dan masyarakat, harus berbuat dan belajar banyak,” ungkap Muhammad Abduh, seorang guru yang juga pemerhati sosial di Lhokseumawe, Minggu (9/9). Sejauh ini, tidak ada satupun gerakan ekonomi, semacam pembangunan industri ataupun upaya lain dalam membina keterampilan yang tepat sasaran dan menghasilkan sosoksosok yang mandiri di sejumlah bidang. Katanya, kepercayaan investor terhadap Aceh masih dihinggapi banyak prasangka. Kenyataan ini menyebabkan semakin banyaknya jumlah pengangguran dan jumlah penduduk miskin. “Selain berbuat, penduduk harus cerdas. Petani juga harus menguasai ilmu bertani, jika tidak selalu mendapatkan hasil yang tidak sesuai,” ujarnya. Adul Hadi, guru lainnya menegaskan, sebe-

tulnya kelemahan orang Aceh pasca konflik adalah tingkat ilmu pengetahuan yang minim. Orang yang tidak mau berbuat dan tidak mau belajar, sampai kapan pun hidupnya tidak akan pernah berubah. Jikapun tidak ada peluang kerja di Aceh, lanjut dia, setidaknya mahasiswa-mahasiswa yang mampu menggunakan bahasa asing bisa dengan mudah mendapatkan pekerjaan di luar daerah. “Kalau di tempat kita sulit lapangan pekerjaan, di negara-negara maju sangat kekurangan tenaga kerja,” kata Hadi. Memang untuk melakukan perubahan di bidang ekonomi, rakyat Aceh tidak bisa hanya berpangku tangan, tetapi juga peran aktif untuk meyakinkan para pemilik modal. Kata hadi, bagaimana mereka mau menanamkan modal jika baru datang melihat lokasi, sudah mintai uang ini-itu. Mereka tentunya akan kesal dan pergi tanpa mau kembali lagi. Sikap-sikap segelintir oknum inilah yang kerap menghambat terjadinya perubahan di Aceh, sela Abduh. “Bila kesadaran ini tidak tumbuh dan bersikap seenaknya sendiri tanpa usaha serta menghormati orang lain, maka perubahan sulit sekali terjadi,” paparnya. (b14)

Reni Nuryanti, Sang Penulis Dan Dosen Berprestasi Kopertis menerbitkan buku fenomenal, SETIAP tahun, DirekPerempuan Berselimut Konflik; torat Pendidikan Tinggi Perempuan Minangkabau (Dikti) menggelar perhelaMasa Dewan Banteng dan tan pemilihan dosen berPRRI. Buku ini menjadi konprestasi. Momen ini menjadi sumsi hangat kalangan akaajang bergengsi bagi para demisi dan sejarawan di Midosen untuk unjuk kemamnangkabau. Karena buku yang puan dalam bidangnya. dianggap ‘panas’ ini, Reni semModel pemilihan dilakukan pat diwawancarai di TVRI Namulai dari tingkat universisional pada Juni 2011. Di 2011, tas, baik swasta maupun Reni juga menerbitkan buku negeri. Bagi universitas berjudul, Duhai Perempuan swasta, kegiatan ini dipuMenulislah Agar Engkau Semasatkan di kopertis masingmasing. Bagi para juara akan Reni Nuryanti, MA kin Cantik. Sejak menjadi pengajar dikirim ke tingkat nasional untuk kembali berlaga memperebutkan sejarah di Unsam, Reni terus menelurkan karya ilmiah dalam Jurnal Universitas. Kemauan yang predikat juara pertama hingga ketiga. Meskipun dianggap bergengsi, namun keras untuk mengembangkan Unsam menjadi pemilihan dosen berprestasi belum menda- kampus riset, membawanya pada tanggungjapatkan perhatian bagi sebagian universitas wab sebagai Ketua Bidang Penelitian di LPPM. swasta. Universitas Samudra Langsa (UNSAM) Ia juga sekaligus menjadi editor utama dalam misalnya, baru mengambil kesempatan ini di setiap penerbitan jurnal yang diberi nama Samudra. Di tahun ini, ia juga diundang dalam tahun 2012. Salah satunya, Reni Nuryanti, MA, lulusan pertemuan LPPM se-Indonesia di UI Depok. Dengan ketekunannya itulah, Reni meraih S2 Ilmu Sejarah UGM yang baru dua setengah tahun menjadi dosen, pada akhirnya menjadi predikat sebagai juara I Pemilihan Dosen Bersosok yang mampu membanggakan Unsam. prestasi Kopertis Wilayah I (Aceh-Sumut). Pada Reni, demikian panggilan akrabnya, sudah awalnya, Reni tidak yakin akan meraih predikat meraih segudang prestasi, mulai dari tingkat itu. Dari ke-13 peserta terpilih, ia tergolong lokal hingga nasional. Di tahun 2008, ia terpilih paling muda. Bahkan para juri: Prof Nurhayati sebagai juara I tingkat nasional peneliti puda dan Prof Alisanti menganggapnya sebagai terbaik Lembaga Ilmu Pengetahuan Indonesia lulusan sarjana. Apalagi, pangkatnya sebagai dalam Bidang Sosial. Saat itu, ia diundang ke dosen baru pada tahap asisten ahli. Selain itu, Istana Negara dalam rangka HUT Teknologi sebagian peserta adalah doktor yang sudah lama mengajar. Reni saat itu hanya menganNasional, tepatnya 8 Agustus 2008. Semenjak mahasiswa, Reni sudah akrab dalkan buku, hasil penelitian terbaru, dan dengan dunia penulisan. Debutnya dimulai kemampuan berbahasa Inggris. Dalam akhir seleksi yang diselenggarakan saat ia menjadi kepala bidang pers di Himpunan Mahasiswa Pendidikan Sejarah Universitas 26-27 April, Reni akhirnya tercatat sebagai juara NegeriYogyakarta, tempat ia menimba sarjana. I. Juara II dan III masing-masing dipegang Dr Ia makin menekuni dunia menulis ilmiah lewat Alum Simbolon, dari Universitas Katholik Sanlembaga bernama Unit Kegiatan Mahasiswa tho Thomas dan Sri Misleni, dari STiKes RS Haji, Penelitian Universitas. Di sana, ia sempat menja- Medan. Pada 17 Agustus 2012, dalam upacara peringatan HUT RI di KopertisWilayah I Medan, bat sebagai ketua. Selesai sarjana di akhir 2006, Reni tidak Reni dan para juara lainnya menerima sertifikat langsung masuk jenjang S2. Selama hampir dua dan penghargaan yang diserahkan Koordinator tahun, ia menjadi kolumnis tetap di harian Kopertis, Prof Ir Moehammed Nawawiy Loebis. Semula, ketiga juara akan dikirim ke Jakarta Jurnal Nasional, Jakarta. Tulisannya tentang koran-koran kuno dan tokoh Indonesia, mena- untuk mengikuti upacara di Istana Negara, naburi halaman koran gemblengan Taufik Rahzen mun menurut panitia, tahun ini formatnya lain. tersebut. Tulisan-tulisan tersebut kemudian Para juara dikembalikan ke kopertis masingdibukukan oleh Indonesia Boekoe, di antaranya masing, namun sertifikat diberikan atas nama berjudul: Seabad Pers Nasional dan Tujuh Ibu Dikti. Prestasi demi prestasi yang diraih selama Bangsa. Sejak 2007, Reni juga tercatat sebagai penulis menjadi dosen di Unsam, semakin membukmuda. Karya pertamanya, Perempuan dalam tikan filosofi hidup yang Reni pegang, “Di Hidup Sukarno Biografi Inggit Garnasih, sempat manapun ditanam, tumbuhlah.” Sebagai meraih penghargaan sebagai biografi terlaris. perantau, ia sadar bahwa perjalanan karirnya Setelah itu, menyusul tulisan bertema Sukarno: di Unsam tidak mulus. Istri-Istri Sukarno dan Tragedi Sukarno dari KuDede Juliadi Rendra deta hingga Kematiannya. Di tahun 2011, Reni



DPRK Abdya Tolak Bahas LKPJ 2011 Dengan Qanun

Golkar Minta Kader Dukung Agus Salim BANDA ACEH (Waspada): Putaran kedua Pilkada Aceh Tamiang akan berlangsung 12 September nanti, pasangan Agus SalimAbdul Somad dan Hamdani Sati/Iskandar Zulkarnain akan bersaing ketat memperebutkan kursi Bupati danWakil Bupati Aceh Tamiang. Terkait dengan pilkada tersebut,Wakil Ketua DPD I Partai Golkar Provinsi Aceh T Heriwansyah,, Jumat (7/9) menyebutkan, pihaknya mendukung pasangan Agus Salim. “Kami sudah meminta kepada pimpinan kecamatan, pimpinan desa Partai Golkar se -Kabupaten Aceh Tamiang dan organisasi sayap, seluruh ormas yang mendirikan dan yang didirikan untuk mendukung pasangan Agus Salim,” katanya. Heriwansyah yang juga Koordinator Daerah XIII DPD I Partai Golkar Provinsi Aceh, menyebutkan, bagi kader Golkar wajib mendukung pasangan nomor urut 4 tersebut. (b07)

BLANGPIDIE (Waspada) : DPRK Aceh Barat Daya menyatakan menolak membahas Laporan Keterangan Pertanggungjawaban (LKPJ) tahun 2011 dengan qanun. Hal tersebut karena APBK dan APBK P tahun 2011 lalu itu ditetapkan dan disahkan mantan bupati Akmal Ibrahim melalui Peraturan bupati (Perbup), bukan lewat qanun. “APBK dan APBK-P tahun 2011 itu tidak dibahas bersama dengan DPRK. Kami minta kepada eksekutif agar LKPJ tahun 2011 tidak dibahas melalui qanun, akan tetapi dibahas melaluiperbup,”kataKetuaDPRKAbdyaMNasir. Pernyataan itu disampaikan M Nasir dalam sambutannya pada sidang paripurna pembukaan pembahasan LKPJ tahun anggaran 2011, KUA-PPAS APBK-P tahun 2012 di gedung DPRK setempat, Sabtu (8/9). Hadir pada acara tersebut, Bupati Abdya Jufri Hasanuddin, Wabup Tgk Yusrizal Razali, Kapolres Abdya AKBP Eko Budi Susilo, Kasdim 0110 Abdya Mayor Arm Kusdi YS, Sekdakab

Kucuran Kredit UKM Tak Capai Target BANDA ACEH (Waspada) : Perhatian pihak perbankan dalam mengucurkan kredit kepada pelaku Usaha Kecil Menengah (UKM) di Aceh belum mencapai target yang diharapkan pemerintah maupun masyarakat. “Tidak tercapainya target yang diharapkan terjadi karena pihak perbankan mempunyai koridor yang ditetapkan Bank Indonesia. “Jadin dalam ini, perbankan perlu membangun komunikasi dan mensosialisasikan adanya Kredit Usaha Rakyat (KUR),” kata Direktur UKM Center Unsyiah Darussalam, Banda Aceh Iskandar Madjid, Jumat (7/9). Menurut Iskandar Madjid, perhatian bank terhadap pelaku UKM yang masih sangat terbatas, kecuali untuk sebagian kecil diberikan bagi usaha menengah yang memiliki modal. Sedangkan terhadap pengusaha mikro tidak pernah diberikan perhatian oleh bank. Hal itu, kata dosen Fakultas Ekonomi Unsyiah itu, terbukti volume penyaluran kredit tidak mencapai target. Paling banter antara 20 hingga 30 persan. “Kepedulian bank kepada pelaku UKM terlihat sampai saat ini belum maksimal, bahkan masih sangat minim,” ujarnya. (b09)

PPP Dan PNA Serahkan Dokumen Ke KPU Bireuen BIREUEN (Waspada): Dewan Pimpinan Cabang Partai Persatuan Pembangunan (PPP) dan Dewan Pimpinan Wilayah Partai Nasional Aceh (PNA), Jumat (7/9) menyerahkan dokumen masingmasing partai guna dilakukan verifikasi oleh Komisi Pemilihan Umum (KPU) setempat sebagai peserta Pemilu legislatif tahun 2014. Penyerahan dokumen DPC PPP diserahkan ketuanya, Murdani Yusuf didampingi Wakil Ketua, . Nurbaiti dan beberapa pengurus lainnya diterima anggota KPU Bireuen Mukhtaruddin. Sedangkan, penyerahan dokumen partai DPW PNA Bireuen yang juga diterima Mukhtaruddin itu turut diantar seratusan orang anggota partai. Anggota KPU Bireuen Mukhtaruddin di sela-sela kegiatan tersebut menjelaskan, dokumen yang diserahkan pengurus partai politik tersebut berupa SK (Surat Keputusan) kepengurusan masing-masing partai dan fotocopy Karta Tanda Anggota (KTA). (b17)

Waspada / Sudarmansyah

SUASANA sidang paripurna DPRK Aceh Barat Daya, Sabtu (8/9) berlangsung ‘hangat’ setelah DPRK Abdya menolak membahas LKPJ 2011 dan mengembalikan ke pihak eksekutif.

Mortir Sisa Konflik Ditemukan Di Aceh Selatan TAPAKTUAN (Waspada): Sebuah mortir masih aktif diduga sisa konflik, ditemukan di kawasan Gunung Pulo, Gampong Baru, Kec. Samadua, Aceh Selatan. Bahan peledak berbentuk TP itu bernomor FRG-RFL40BT556 LOT6-MPA, ditemu-

kan di kebun Nurdin, 30, warga Gampong Ladang, Kasik Putih, kecamatan setempat, Jumat (7/ 9) sekira pukul 18:45. Kapolres Aceh Selatan AKBP Sigit Jatmiko kepada wartawan di Tapaktuan, Sabtu, kemarin, membenarkan temuan mortir tersebut. Berdasarkan pengakuan Nurdin, kata Kapolres, barang berbahaya itu ditemukan ketika ia sedang membersihkan kebunnya. Kemudian ia mela-

porkan kepada anggota Polri, Dedi Ardian, 28, dan Rian, 20, mahasiswa, warga Gampong Baru, kecamatan yang sama. Mereka kebetulan sedang menjaga durian di kebun milik Muri, 60, warga sekampung dengan Nurdin, tidak berapa jauh dari TKP. Ketiga penemu akhirnya melaporkan ke Polsek Samadua. Kini barang bukti itu telah diamankan di Kompi Brimob Trumon. (b30)

BSM Banda Aceh Himpun Dana DPK Rp600 Miliar BANDA ACEH (Waspada) : Hingga Juni 2012, pihak Bank Syariah Mandiri (BSM) Cabang Banda Aceh sudah menghimpun Dana Pihak Ketiga (DPK) sebanyak Rp600 miliar. Sementara kredit yang sudah disalurkan Rp500 miliar, dengan tingkat kredit macet (NPL) sebesar 3 persen. “Kredit yang disalurkan di tahun 2012 ini jauh lebih meningkat hingga 200 persen dibanding tahun 2011 lalu. Pada 2011, BSM Banda Aceh hanya menyalurkan kredit senilai Rp200 miliar. Sekitar 60 persen kami salurkan untuk membiayai sektor produktif,” kata Direktur Utama Bank Syariah Mandiri (BSM) Cabang Banda Aceh, Alfian Jailani, Jumat (7/9). Menurut Alfian, peningkatan ini sebagai jawaban dari publik terhadap komitmen BSM yang konsen membiayai sektor ekonomi produktif. “Karena dananya juga kita gunakan untuk pengembangan ekonomi masyarakat sehingga masyarakat semakin tertarik menempatkan dananya di sini,” katanya. Dari total dana itu, tidak semua disalurkan langsung untuk nasabah. Karena BSM juga menitipkan sebagian dananya di Baitul Qiradh (BQ). Sumber dana disalurkan, semua berasal dari dana yang dihimpun dari nasabah, jelas Alfian. (b09)

Waspada/Irwandi MN

Kecamatan Mutiara Diduga Pungut Biaya e-KTP SIGLI (Waspada): Masyarakat Kecamatan Mutiara, Kabupaten Pidie mengeluhkan pungutan biaya e-KTP senilai Rp5.000 per orang. Biaya tersebut dikutip melalui keuchik (kepala desa) masing-masing dengan dalih melunasi Pajak Bumi dan Bangunan (PBB). Menurut masyarakat, pengutipan uang tersebut dengan alasan untuk pelunasan PBB sangat tidak wajar, sebab pemungutan PBB dikutip per objek, sedangkan pemungutan biaya e-KTP dilakukan per orang. “Setahu kami pengambilan e-KTP tidak dipungut biaya. Tetapi kenapa dipungut, ini perlu kami pertanyakan,” kata beberapa warga Mutiara yang enggan namanya disebutkan, Sabtu (8/9). Kadis Kependudukan dan Pencatatan Sipil Pidie Adman, dengan tegas menyatakan pengambilan e-KTP tidak dibenarkan dipungut

biaya. “Kami jauh-jauh hari sudah memberitahukan kepada masyarakat. Bahwa pengambilan e-KTP tidak boleh dipungut biaya. Ini gratis,” tegas Adman, seraya menjelaskan bila ada kecamatan yang memungut biaya itu di luar tanggungjawab pihaknya. Camat Mutiara M Adam, Minggu (9/9) mengatakan, dirinya tidak pernah menginstruksikan para keuchik di kecamatan yang dipimpinnya untuk mengutip uang e-KTP. Bahkan ia dengan tegas menyatakan pengambilan e-KTP tidak boleh dipungut biaya. Namun dalam setiap pertemuan dengan para keuchik pihaknya sering mengingatkan untuk memungut PBB pada masyarakat. Sebab kesadaran masyarakat dalam melunaskan PBB sangat rendah di daerah itu. (b10)

Aliran Sesat Laduni Resahkan Warga Meulaboh Dan Nagan MEULABOH (Waspada) : Selama ini aliran sesat laduni di Kabupaten Nagan Raya dan Meulaboh, membuat warga resah, apalagi para penganut aliran sesat laduni sangat berbeda dengan aliran- aliran sesat lainnya. Sebelumnya para penganut tersebut sekarang dalam pembinaan di Mapolres Meulaboh, penganut yang diringkus polisi di Desa Blang Dalam, Kecamatan Beutong, Nagan Raya kemudian dibawa ke Mapolres Meulaboh, selain di Nagan Raya juga ditangkap di Masjid Peureumeu, Kec.Kaway XVI, Aceh Barat. Mereka berprinsip tidak wajib melaksanakan shalat fardhu lima waktu, bahkan shalat

Jumat. Shalat fardhu bagi mereka cukup Magrib, Isya, dan Subuh saja. Adapun shalat Zuhur dan Ashar sangat tergantung pada kesanggupan pengikutnya. Kalau sanggup boleh ditunaikan. Corak ajaran dan praktik ibadah yang seperti itu terungkap dalam pertemuan antara pengikut laduni dengan MPU setempat, tokohtokoh masyarakat di Masjid Peureumeu, Kecamatan Kaway XVI, Aceh Barat, Jumat pekan lalu. Kades Blang Dalam M Jabar mengaku baru ini tahu bahwa ada masuk orang menganut aliran itu, sebelumnya kami belum tahu bahkan ini baru kami dengar. (cb07)

WARGA melintas di Jalan Listrik, Desa Hagu Barat Laut, Kec.Banda Sakti, Minggu (9/9) yang dalam kondisi rusak parah dan berlubang tanpa ada upaya penanganan dari pemerintah daerah setempat.

BANDA ACEH (Waspada): Jenazah Almarhum Sidik Fahmi, anggota Komisi E DPRA dari Fraksi Partai Aceh Kolonel CHK (Purn) Sidik Fahami yang meninggal dunia di Komplek Kodam Daan Mogot, Jakarta, telah dimakamkan di tempat pemakaman keluarga di Gampong Surien, Kecamatan Meuraxa, Banda Aceh, Sabtu (8/9). Sebelum dimakamkan di lokasi yang tidak begitu jauh dari rumah duka, jenazah mantan perwira TNI yang pernah bertugas sebagai Kepala Hukum Kodam (Kakumdam) Iskandar Muda itu, terlebih dulu dishalatkan di Masjid Babunnajah dipimpin imam masjid tersebut Tgk Rusmiadi. Selain Gubernur Aceh Zaini Abdulllah, juga tampak melayat ke rumah duka Wakil Ketua DPRA Sulaima Abda, para anggota dewan dan sejumlah pejabat daerah setempat, sejumlah

Janji Pemerintah Kepada Warga Blang Lancang Belum Terealisasi

Budidaya Teh Dikembangkan Di Bener Meriah

Waspada/Zainuddin Abdullah

LHOKSEUMAWE (Waspada): 542 KK warga Blang Lancang, Muara Satu, Lhokseumawe yang dipindahkan dari lokasi kilang gas Arun sejak 38 tahun lalu, sampai sekarang belum mendapatkan lahan pengganti (resettlement) dari pemerintah pusat. Sekretaris Misi Konsultasi Masyarakat Tergusur Blang Lancang, M Zubir, Minggu (9/9) menjelaskan, DPR-RI telah mengusulkan alokasi anggaran kepada Menteri Keuangan RI pada 2011 melalui APBN-P, sebanyak Rp30 miliar. Namun sampai sekarang anggaran relokasi itu belum juga direalisasikan. Usulan alokasi anggaran,

tambahZubir,disampaikanWakil Ketua DPR-RI/Korpolkam Priyo Budi Santoso melaui surat nomor AG/3605/DPR RI/V/2011. Usulan pertama gagal, namun semangat warga tergusur dan pemerintah kota tidak kendur.Wali Kota Lhokseumawe ketika itu masih dijabat Munir Usman kemudian mengajukan usulan dana Rp30 miliar kepada Menteri Keuangan dua kali melalui APBN murni 2012 dan APBN-P 2012.“Inipun gagal tanpa ada jawaban alasanya,” tutur Zubir. Bahkan Wali Kota Lhokseumawe terpilih, Suaidi Yahya baru-baru ini juga melakukan mediasi ke Komisi-II DPR RI,

untuk mengusulkan anggaran pembebasan tanah aset Pertamina di Desa Ujong Pacu, Kec. Muara Satu, lewat dana APBN 2013. Marzuki Daud, anggota DPR RI asal Aceh, melalui telepon selulernya menjelaskan, anggaran itu akan diperjuangkan. Komisi II DPR RI akan memanggil Wali Kota Lhokseumawe SuaidiYahya dengan pembicaraan sekaligus pertemuan RDP (Rapat Dengan Pendapat). “Bila ini juga gagal rencana kedua adalah melalui tim pemantau desk Aceh akan meminta Menteri Keuangan mengalokasikan dana Rp30 miliar. Kita berharap akan berhasil,” jelas Marzuki Daud. (b15)

Pemda Hibahkan Tanah Bekas Puskesmas

Anto, pemilik ayam aneh sedang menunjukkan keunikan ayam peliharaannya yang tidak memiliki kuku jari.

Yufrizal S Umar, para asisten, kepala dinas, badan, kantor dan sejumlah pimpinan parpol dan Ormas. Pernyataan Ketua DPRK Abdya, M Nasir yang didampingi dua wakil ketua, Rusman Alian dan Elizar Lizam tentang tidak membahas LKPJ tahun anggaran 2011 itu mengundang perhatian para pejabat dan undangan yang hadir. Ruang sidang yang sebelumnya sedikit berisik mendadak hening meski hanya sesaat. Hal ini ditambah dengan pernyataan Bupati Jufri Hasanuddin yang dalam sambutannya mendukung dan menyatakan sepakat bahwa LKPJ tahun anggaran 2011 dibahas melalui perbup. Dukungan Bupati Jufri Hasanuddin itu disertai dengan permohonan kepada Sekdakab Yufrizal S Umar untuk segera membuat perbup tersebut. “Tidak ada unsur politik. Kalau dimulai dengan qanun maka tentu harus diakhiri dengan qanun. Bila dimulai dengan perbup juga diakhiri dengan perbup,” tegasnya. (cb05)

Jenazah Sidik Fahmi Dimakamkan

Unik, Jari Ayam Tak Berkuku TAKENGEN (Waspada): Unik, seekor ayam jago peliharaan milik petani di Kampung Belang Jorong, Kec.Celala, Aceh Tengah mempunyai kelainan dibanding hewan sejenisnya. Tujuh dari delapan jari kaki tak ditumbuhi kuku. “Dari 10 telur yang ditetaskan induknya, satu di antarnya sangat berbeda. Kuku jarinya mayoritas tidak ada,” papar Anto, pemilik ayam, Minggu (9/9) seraya menunjukan ayam berkaki ‘aneh’ ini. Meski sempat takjub, namun keberadaannya tidak diperlakukan secara berlebihan. Hanya saja karena ayam ini tak memiliki ceker (kuku jari) untuk alat mencari umpan, harus diberikan sedikit perhatian ekstra. “Ayam ini telah berusia empat bulan. Perkembangan tubuhnya normal. Hanya saja untuk umpan harus rutin dibe-rikan,” ucapnya. Hewan jenis unggas ini sebelumnya sempat menjadi perhatian warga dan para peternak ayam lainnya. Namun dia (Anto) tidak menjualnya meski ada masyarakat yang menawar dengan harga menjanjikan. (cb09)

WASPADA Senin 10 September 2012

TAKENGEN (Waspada) : Tanah bekas gedung Puskesmas dan rumah dinas dokter di Ratawali, Kec. Kute Panang, Aceh Tengah dihibahkan Pemkab setempat untuk pembangunan Kantor Urusan Agama (KUA). Dihibahkannya tanah berukuran 25 x 25 meter ini setelah mendapat persetujuan dari pihak eksekutif dan legislatif. Tercantum dalam dua surat kesepakatan yang ditandatangani Penjabat Bupati Aceh Tengah, Muhd Tanwier dan Ketua DPRK setempat, Zulkarnaen. Demikian ungkap Bardan Sahidi, anggota Komisi D DPRK Aceh Tengah, Minggu (9/9) di Takengen, sembari mengatakan, sebelumnya pihaknya

melakukan pengecekan ke lokasi tanah yang dihibahkan itu. “Tanah hibah ini adalah bekas lokasi dan gedung Puskesmas Ratawali. Sementara rumah dinas dokter juga selama tidak difungsikan lagi. Hal ini karena sebelumnya dua bangunan dimaksud telah dipindahkan,” jelasnya. Menurutnya, Puskesmas dan rumah dinas tersebut telah dipindahkan ke lokasi lainnya yakni di Kampung Pantan Sile. Menggunakan bantuan donor asing KFW dari Jerman. “Hasil kros cek tanah bekas tersebut layak untuk tempat berdirinya KUA,” katanya. “Sementara mengenai surat persetujuan pengalihan tanah

sebagai hibah telah disepakati bersama antara DPRK dan pihak Pemkab Aceh Tengah pada 8 September lalu. Dengan melalui berbagai pertimbangan. Mulai dari permohonan kepala KUA maupun telaah staf dari Kecamatan Kute Panang,” ujarnya. Selain itu, hibah tanah ini juga telah direkomendasi Dinas Kesehatan Aceh Tengah, sebagai penangungjawab aset sebelumnya. “Untuk tertib administrasi dan tata kelola aset daerah, tanah ini diserahkan kepada Kementerian Agama. Artinya ke depan jumlah aset yang sebelumnya kewenangan dinas kesehatan akan dialihkan ke Kemenang dan KUA Kecamatan Kute Panang,” paparnya. (cb09)

REDELONG (Waspada) : Himpunan Kerukunan Tani Indonesia (HKTI) akan mengembangkan tanaman teh di Kabupaten Bener Meriah. Sebelumnya, pada zaman kolonial Belanda tanaman teh di dataran tinggi Gayo sudah dikenal luas masyarakat. Ketua Harian HKTI Bener Meriah, Sucipto, kepada wartawan, Minggu (9/9) mengatakan bahwa saat ini tanaman teh tersebut sudah tidak ada lagi di Bener Meriah. Maka sejak 2012 ini mereka kembali mengembangkan program tersebut. “Untuk tahap awal program ini akan disosialisasikan kepada petani untuk menanam teh di pinggir tanaman kopi yang juga dimanfaatkan sebagai pagar perkebunan tanaman kopi, sedangkan untuk bibitnya akan diusahakan diambil dari perkebunan di Indonesia ,” ujarnya. Selain teh, HKTI juga akan mengembangkan tanaman tebu dan tanaman kopi, apalagi sekitar 80 persen masyarakat di Bener

perwira TNI dan Polri serta mantan petinggi GAM Malek Mahmud. Jenazah almarhum Sidik Fahmi yang meninggal dunia di Jakarta Sabtu pagi karena serangan jantung tiba di Bandara Sultan Iskandar Muda, Blang Bintang, Aceh Besar pada hari yang sama sekira pukul 22:45. Kedatangan jenazah almarhum disambut Gubernur Aceh Zaini Abdullah dan Malek Mahmud. serta sejumlah anggota DPR Aceh. Juru Bicara Partai Aceh Fachrul Razi mengatakan, pengurus serta seluruh kader Partai Aceh merasa sangat kehilangan atas berpulangnya Sidik Fahmi. “Saat sang khalik memanggilnya, almarhum sebenarnya sedang bertugas sebagai sekretaris Pansus Rancang Pinjaman dan Hibah. Tapi ternyata Allah berkehendak lain,” ujarnya. (b05)

Meriah adalah petani. Sehingga HKTI berupaya membantu petani dengan memanfaatkan lahan dari petani itu sendiri. Saat ini HKTI Bener Meriah sedang membentuk pengurus baru dan dilantik pada 22 September 2012 mendatang oleh Dewan Pembina HKTI Provinsi Aceh dan Bupati Bener Meriah Ruslan Abdul Gani sebagai Dewan Pembina HKTI Bener Meriah. Bupati Bener Meriah Ruslan Abdul Gani di hadapan pengurus HKTI Bener Meriah menyambut baik program positif yang dicanangkan HKTI Bener Meriah dan mendukung program tersebut karena mensejahterakan rakyat adalah salah satu visi misinya. Menurut Bupati Bener Meriah itu, di era kolonial Belanda komoditi tanaman teh menjadi primadona di Bener Meriah khususnya di Kecamatan Bandar, bahkan pada saat itu telah didirikan pabrik teh dengan lebel produksi Redelong Tea. (b33)

PT SSN Diingatkan Kompensasi Dan Tabur Benih RUNDENG (Waspada): Pihak PT Sumatera Sawit Nabati (SSN) di Desa Singgersing, Kecamatan Sultan Daulat, Subulussalam diingatkan membayar kompensasi dan tabur benih ikan. Pasalnya, pasca tumpahnya limbah perusahaan itu ke Sungai Singgersing, Batu-Batu dan Lae Souraya karena tanggul jebol berakibat musnah ribuan ikan dan udang, bahkan sejumlah nelayan kehilangan mata pencaharian. Pj Kepala Badan Lingkungan Hidup Kebersihan Pertamanan dan Pemadam Kebakaran Kota Subulussalam, Ibnu Hajar mendampingi Wakil Ketua DPRK Karlinus menengahi perseteruan PT SSN versus sejumlah warga Kecamatan Rundeng di aula Setcam Rundeng, Jumat (7/9), jika terindikasi mencemarkan ling-

kungan, sesuai UU No. 32/2009 tentang Perlindungan dan Pengelolaan Lingkungan Hidup, perusahaan wajib memulihkan status lingkungan termasuk masyarakat yang terkena dampaknya. Dikatakan, pemulihan melalui menyebar benih ikan dan penghijauan, lalu masyarakat berhak meminta kompensasi atau ganti karena kehilangan mata pencaharian. Masyarakat, kata dia, dapat menuntut secara hukum jika perusahaan mengabaikan. Seperti rapat Jumat pecan lalu, data warga yang terkena dampak pencemaran, besaran kompenasasi harus akurat dan PT SSN wajib tabur benih. “Senin dilanjutkan pertemuan untuk menyelesaikan persoalan ini,” tegas Karlinus menutup rapat. (b28)


WASPADA Senin 10 September 2012

Birokrasi Aceh Singkil Dituding Buruk

Kodim 0108 Agara Gelar Donor Darah

SINGKIL(Waspada): Kondisi birokrasi di Aceh Singkil terkesan semakin memburuk, Pemerintahan yang baik dan bersih hanya sebatas slogan. Demikian dikatakan Azwar Tanjung, Kamis (6/9) di Singkil, mengkritisi dugaan manipulasi identitas dalam pemilihan kepala desa (Pilkades) di Kampung Pertabas, Kecamatan Simpang Kanan. “Itu adalah satu contoh buruknya birokrasi di Aceh Singkil belakangan ini, kata Azwar sembari menambahkan masih banyak kebobrokan lain termasuk pengelolaan anggaran dan tender proyek yang sarat kolusi. Munculnya protes warga dengan menyurati bupati dan menembuskan surat tersebut kepada pihak kepolisian atas kasus Kades Pertabas terpilih berinisial BSW, lahir 2 Desember 1976 (bukan 1972) merupakan data dan identitas

KUTACANE (Waspada) : Sekitar 70 prajurit terdiri dari anggota Kodim 0108/Agara dan Kipan-A Yonif 114/Satria Musara melaksanakan kegiatan donor darah bertempat di RSU dr Sahuddin Kutacane, Jumat (7/9). Dandim 0108 Agara Letkol Inf R Andi Roediprijatna Wiradikoesoema, Jumat (7/9) melalui Pasimin Kodim 0108/ Agara Kapten Inf Maina Helmi, di RSU dr Sahuddin Kutacane mengatakan, kegiatan donor yang dilakukan segenap prajurit TNI yang berdinas di wilayah Agara ini merupakan respon TNI terhadap kesulitan yang dihadapi masyarakat Agara dalam hal kesehatan, khususnya untuk memperoleh stok darah siap pakai. Ketua PMI Agara Salim Fakhri mengatakan salut atas sikap dan solidaritas TNI di dalam melakukan donor darah. (b25)

Anggota TNI Ditemukan Tewas Tergantung KOTA JANTHO (Waspada): Praka Wahyudin Sudiro, 27, ang-gota Yonkav/Serbu yang bermarkas di Jantho, Aceh Besar, Sabtu (8/9) ditemukan tewas tergantung di bawah pohon kemiri dalam kebun milik korban, di Gampong Cucum, Kecamatan Jantho Baru, Aceh Besar. Korban diduga bunuh diri. Hingga berita ini dikirim malam tadi, belum diketahui penyebab korban melakukan perbuatan nekad itu. Namun, informasi yang Waspada peroleh, korban mengalami depreasi akibat persoalan keluarga yang dihadapinya. KepalaPeneranganKodamIskandarMudaKolonelArhSubagio Irianto yang Waspada hubungi belum dapat dikonfirmasi. Sementara sumber di Kota Jantho menyebutkan,Wahyudin Sudiro, anggota TNI dariYonkav/Serbu asal Bima, Nusa Tenggara Barat itu, diketahui tidak pulang ke rumahnya di Asrama Yonkav sejak Jumat (7/9). Setelah dilakukan pencarian oleh rekan dan pihak keluarga, Sabtu sekira pukul 16:00, korban ditemukan dalam keadaan tergantung di bawah pohon kemiri yang tumbuh di dalam kebun-nya. Kebun tersebut, letaknya berdampingan dengan kebun milik mantan Bupati Aceh Besar. (b05)

KIP Nagan Raya Terima Pendaftaran PNA NAGAN RAYA (Waspada) : Pengurus Partai Nasional Aceh (PNA) DPW Nagan Raya resmi melakukan pendaftaran partai lokal bentukan Irwandi Yusuf di Kantor Komisi Independen Pemilihan (KIP) Nagan Raya, yang diterima Sekretaris KIP setempat Abdul Karim Nur, (7/9). Pendaftaran yang dilakukan Ketua Umum DPW PNA Nagan Raya Teuku Cut Man bersama puluhan anggota yang datang itu berlangsung sukses setelah menyerahkan sejumlah dokumen yang diperlukan seperti fotokopi kartu tanda anggota (KTA) serta kepengurusan partai. Pelaksana Harian Kasubbag Humas dan Teknis KIP Nagan Raya, Ryan Kautsar Agustiar mengatakan, dengan pendaftaran yang dilakukan PNA itu, partai lokal itu dipastikan akan dilakukan verifikasi secara menyeluruh terhadap dokumen yang diserahkan bersamaan dengan partai lain yang sudah terlebih dahulu mendaftar. Hingga Jumat sebanyak 18 partai nasional dan lokal sudah mendaftarkan diri di KIP Nagan Raya, di antaranya Partai Nasdem, PKPB, Golkar, Gerindra, PAN, PDIP, PKB, Partai Aceh, Hanura, Demokrat, PPRN, PKS, SRI, PBB, PKPI, PDA, PDK, serta PNA. T Cut Man selaku Ketua DPW PNA Nagan Raya berharap dengan adanya pendaftaran partai lokal itu diharapkan pesta demokrasi pada pilihan legislatif tahun 2014 mendatang akan semakin lebih baik dan melahirkan anggota legislatif pilihan rakyat yang lebih baik. (cb07)

12 Parnas Dan 2 Parlok Serahkan Fotocopy KTA Ke KIP KOTA JANTHO (Waspada): Sebanyak 12 partai nasional dan dua partai lokal di Kabupaten Aceh Besar telah menyerahkan fotocopy Karta Tanda Anggota (KTA) partai kepada Komisi Independen Pemilihan (KIP) setempat. Penyerahan fotocopy KTA partai itu dimaksudkan untuk dilakukan verifikasi menjelang Pemilu Legislatif 2014. 12 Partai nasional yang telah menyerahkan fotocopy KTA kepada KIP Aceh Besar, Jumat (7/9), di antaranya, Partai Nasional Demokrat (Nasdem), PDI Perjuangan (PDI-P), Partai Amanat Nasional (PAN), Partai Golkar (PG), Partai Persatuan Pembangunan (PPP), Partai Demokrat (PD) dan Partai Keadilan Sejahtera (PKS). Sementara partai lokal yang menyerahkan fotocopy KTA anggotanya, selain Partai Aceh (PA), juga Partai Nasional Aceh (PNA). Penyerahan dokumen dari masing-masing pengurus partai itu diterima langsung Ketua Pokja Verifikasi KIP Aceh Besar Junaidi. Ketua KIP Aceh Besar Tharmizi membenarkan ada 12 partai nasional dan dua partai lokal yang telah menyerahkan berkas fotocopy KTA untuk diverifikasi. (b05)

Hentikan Aktivitas Pekat SUBULUSSALAM (Waspada): Semua aktivitas penyakit ma-syarakat (pekat) seperti minuman keras (miras), judi togel, perem-puan nakal dan jenis pekat lainnya minta dihentikan. Pemerintah dan instansi terkait diingatkan serius bertindak, bukan sekadar imbauan. Permintaan itu disampaikan sejumlah unsur masyarakat Subulussalam, menyusul kasus penganiayaan dua oknum Brimob, Selasa pekan silam terhadap Kades Penanggalan Abdul Haris Muda Bancin bersama dua warga, Tumirin dan Darismo. Oknum Brimob terkait saat melakukan penganiayaan disinyalir mabuk usai menenggak miras jenis tuak di salah satu warung di Barisan Toba (Barto), Desa Penanggalan, Subulussalam. Qaharuddin Kombih, Ketua MPU Kota Subulussalam Kamis (8/9) di Subulussalam menegaskan, pemerintah setempat sudah saatnya lebih serius bertindak. “Kita sudah sering imbau dan sosialisasi kepada masyarakat, pekat harus dibasmi dari daerah ini,” pungkas Qahar. Hal senada disampaikan Darmin Tinambunan, Sekdes Penanggalan, terpisah. “Tak ada lagi alasan toleransi terhadap warga penjual miras, sudah jelas efeknya,” tutur Darmin. (b28)

Pengurus Parpol Daftar Di KIP Agara KUTACANE (Waspada) : KIP Agara, Jumat (7/9), menerima pendaftran partai peserta pemilu tahun 2014. Hingga menjelang batas akhir pendaftaran telah masuk 11 parpol mendaftarkan partainya ke meja KIP Aceh Tenggara. Menurut Sekretaris KIP Agara Irwandi Ramud, batas terakhir KIP Agara menerima berkas pendaftaran partai yakni Jumat (7/8) malam pukul 00:00. Pembukaan pendaftaran parpol itu dimulai sejak Senin, 3 September lalu. Hingga jumat siang, ada sebelas partai politik yang telah membawa kelengkapan syarat pendaftaran. Parpol yang memasukkan syarat pendaftaran, yakni Partai Nasdem dan PKPI, selanjutnya Gerindra, PKNU, Hanura, PKPB, sedangkan hingga Jumat, siang yang masuk ke meja KIP Agara yakni PKS, Partai Sri, PPRN, PDP, PBB dan Partai Golkar. (b25)


Waspada/Mahadi Pinen

PRAJURIT TNI jajaran Kodim Aceh Tenggara, Jumat (7/9) melaksanakan aksi donor darah di RSU Sahuddin Kutacane.

OTK Rusak Pintu Gerbang Masjid Al-Ihsan Lhoksukon LHOKSUKON (Waspada): Gerbang Masjid Al-Ihsan, di Gampong Trieng, Kemukiman Matang Ubi, Lhoksukon, Aceh Utara dirusak orang tak dikenal (OTK). Diduga, perusakan gerbang masjid tersebut bagian dari aksi protes dari pihak tertentu, Minggu (9/9). OTK merusak pintu gerbang sisi kiri dan kanan. Selain itu, seseorang menulis di dinding gerbang berbunyi “‘Pintu wajib lima meter, ketua dan bendahara tanggungjawab.” Informasi dari panitia pembangunan masjid, pagar dan pintu gerbang dibangun dengan menggunakan dana hibah dari Pemerintah Aceh oleh Pj Gubernur Aceh Tarmizi A Karim senilai Rp350 juta. “Begitu tahu ada informasi perusakan pagar dan pintu gerbang masjid, kita langsung lakukan koordinasi, memberitahukan kepada masyarakat dan turun ke lokasi, serta melapor ke Mapolsek Lhoksukon. Tak lama berselang, beberapa petugas juga mendatangi lokasi dan mengamankan barang bukti,” kata Ihsan, kemarin. Ketua panitia mengatakan, kalau memang ada hal yang mau diprotes dari masyarakat terhadap pembangunan masjid tersebut dapat dibicarakan secara baik-baik, bukan dengan merusak. Masjid itu tempat

ibadah. Panitia mengutuk keras tindakan pelaku yang dinilai tidak bermoral. Karena itu polisi diminta untuk bertindak cepat. Iptu M Ridwan, Kapolsek Lhoksukon mengatakan, pihaknya telah turun ke lokasi perusakan dan mengamankan barang

bukti berupa pecahan tembok batu-bata yang belum diplaster. “Kita menduga itu perbuatan dilakukan oleh orangorang yang mau memprotes pembangunan masjid. Kita akan cara tahu siapa pelakunya,” kata Kapolsek. (b18)

Waspada/Maimun Asnawi

PANITIA Pembangunan Masjid Al-Ihsan, Minggu (9/9) memperlihatkan pintu gerbang yang dirusak orang tak dikenal

Ketua rombongan Herman HM yang juga menjabat sebagai Wakil Ketua DPRD Bangka Tengah mengatakan, kunjungan kerja tersebut dilakukan untuk mencari dan menimba ilmu tentang pengelolaan Pajak Bumi dan Bangunan serta mekanisme dan pelaksanaannya. Dikatakan, tim DPRD Bangka Tengah sangat tertarik mempelajari keuangan pada Pemerintah Kota Banda Aceh karena Pemko Banda Aceh telah 4 kali memperoleh predikatWTP dari BPK-RI.

Basri, Kabid Akuntansi dan Pelaporan DPKAD Kota Banda Aceh memaparkan dalam pengelolaan pajak dan retribusi daerah di Kota Banda Aceh, DPKAD Kota Banda Aceh menerapkan pola intensifikasi pajak. Kemudian dilakukan sosialisasi pada internal Pemko, masyarakat/wajib pajak, dan juga melakukan kerjasama yang baik dengan sejumlah instansi terkait seperti Kantor Pelayanan Pajak, Perbankan, Kantor Pertanahan dan Notaris atau PPAT. (b02)

Warga 21 Desa Minta YEL Tinggalkan Nagan Raya BANDA ACEH (Waspada): Warga 21 desa di Kecamatan Darul Makmur dan Tripa Makmur tepatnya di kawasan Rawa Tripa, meminta Lembaga Swadaya Masyarakat (LSM)Yayasan Ekosistem Lestari (YEL) untuk keluar dan tidak lagi bekerja di kawasan Rawa Tripa. “Berdasarkan fakta yang terjadi di lapangan, didugaYayasan Ekosistem Lestari (YEL) telah melakukan penipuan publik terhadap masyarakat sekitar Rawa Tripa selama enam tahun mulai dari 2006 sampai sekarang,” ujar Zainuddin, juru bicara petisi 21 gampong di Nagan Raya kepada wartawan, kemarin. Menurut Zainuddin, selama ini YEL sudah menjadikan masyarakat sebagai objek kampanye demi kepentingan lembaga. Awalnya YEL menjalankan program penanaman sawit organik di desa Lamie dan sampai hari ini masih berlangsung, yang kemudian disebut sebagai pilot project, kembali diduga project tersebut belum memberikan dampak luas bagi masyarakat setempat justru membangun konflik sosial karena letaknya di luar kawasan 21 gampong.

Hasil Pleno KIP Agara Ditengarai Latah KUTACANE (Waspada ) : Hasil pleno KIP Agara tentang Pilkada Bupati dan Wakil Bupati Agara 2012 yang melibatkan tiga personel KIP Aceh, ditengarai latah dan penuh tanda tanya. Pernyataan itu disampaikan Ketua FKPPI Agara Suprianto, Sabtu (8/9) menyikapi terbitnya surat keputusan KPU pusat dan di Pltkannya tiga personel KIP Aceh untuk memplenokan hasil perolehan suara pilkada Bupati dan Wakil Bupati Agara yang sebelumnya sempat menimbulkan polemik. “Tak satu pasal pun dalam UURI nomor 15 tahun 2011 yang mengatur dan membenarkan anggota KIP Aceh bisa mengambil keputusan tentang rapat pleno keputusan di KIP kabupaten/kota, apalagi masalah pleno perolehan suara pilkada Bupati dan Wakil Bupati Agara, lantas kenapa hal itu dilakukan KPU pusat dan KIP Aceh,” ujar tokoh muda yang akrap disapa Toto tersebut. Kendati ada surat dari KPU pusat Nomor 362/KPU/IX/2012 tanggal 3 September 2012 tentang permintaan 3 anggota KIP Aceh untuk mengambil langkah-langkah terkait tugas verifikasi parpol peserta Pemilu 2014 dan melaksanakan keputusan MK Nomor 56/PHPU.DIX/2012 tanggal 13 Agustus, namun tidak secara serta merta tiga komisioner Aceh boleh melakukan rapat pleno mengambil keputusan, terutama bila bertindak dan atas nama KIP Agara. Berdasarkan pasal 11 huruf g UURI Nomor 15/2011 tentang penyelenggaraan pemilu, setiap anggota KPU kabupaten/kota yang bersangkutan adalah warga kab/kota yang bersangkutan dan berdomisli di daerah setempat.

Kemudian, urai Suprianto, pada pasal 27 ayat (5) huruf c, kembali disebutkan, anggota KPU kab/kota digantikan oleh calon anggota KPU kab/kota urutan peringkat berikutnya dari hasil pemilihan yang dilakukan KPU provinsi. Lantas apa dasar hingga anggota KPU/KIP Aceh bisa Pltkan dan ikut mengambil keputusan pada rapat pleno yang digelar KIP Agara beberapa hari lalu terkait penetapan hasil pilkada Bupati dan Wakil Bupati Agara, padahal tiga komisioner KIP kabupaten setempat sejak Agustus lalu sudah diberhentikan DKPP (Dewan Kehormatan Penyelenggara Pemilu). Jadi, jelas rapat pleno KIP Agara yang digelar di Banda Aceh, 5 September lalu, kendati rapat pleno tentang rekapitulasi hasil pemungutan suara itu dihadiri dan ditandatangani Robbysyah Putra dan Zainal Abididn dari KPU/KIP Aceh, padahal berdasarkan pasal 32 ayat 1 UURI Nomor 15/2011 rapat tersebut tidak memenuhi quorum dan implikasinya jelas tidak sah. Seharusnya, sambung Suharto, Ketua DPC Partai Bulan Bintang Agara, agar rapat pleno KIP Agara itu sah dan tidak dinilai latah oleh berbagai kalangan, KIP Agara terlebih dahulu mengangkat calon anggota KIP yang masuk dalam daftar cadangan, dan bila masih kurang buka dan lakukan lagi penjaringan lewat komisi A DPRK, bukan malah membuka celah seluasluasnya agar KIP Aceh bisa melakukan intervensi terhadap independensi penyelenggara pemilu di kabupaten/kota. Ketua KIP Agara Dedi Mulyadi Selian hingga berita ini diturunkan belum berhasil dimintai tanggapannya. (b26)

Perbankan Didesak Tingkatkan Pembinaan Pengusaha Kecil

DPRD Bangka Tengah Pelajari Tata Kelola Keuangan Pemko Banda Aceh BANDA ACEH (Waspada): Sebanyak 9 orang rombongan dari DPRD Bangka Tengah, Sematera Selatan, Jumat (7/9), melakukan kunjungan kerja ke kantor Wali Kota Banda Aceh untuk menggali informasi tentang pola penerapan keuangan dan retribusi pada Pemko Banda Aceh. Rombongan tersebut diterima Wakil Wali Kota Banda Aceh Illiza Saaduddin Djamal, Sekda Kota, para staf ahli dan asisten di jajaran Pemko Banda Aceh.

yang digunakan untuk syarat Pilkades yang disinyalir mengarah ke ranah manipulasi identitas. Sementara sebelum proses pelaksanaan Pilkades, data dan identitas bersangkutan pada administrasi kependudukan di Kampung Pertabas, tercatat inisial EW, lahir 2 Desember 1979 sesuai data kartu keluarga (KK) bernomor 111 0022 1010 51229. Sekdakab Aceh Singkil melalui Kabag Pemerintahan Setdakab Aceh Singkil Azwir, Jumat (7/9) di ruang kerjanya terkait surat protes warga mengatakan, akan memproses surat warga tersebut. Namun ia menyesalkan bila semula ada protes warga terkait salah satu calon pilkades, kenapa pihak panitia pemilihan desa (P2D) dan panitia kecamatan tidak bertindak. (b27)

Zainuddin menambahkan, seluruh project YEL yang dilakukan semasa itu berbarengan dengan kampanye penyelamatan Rawa Tripa atau disebut Kampanye Bangga. Berdasarkan kampanye tersebut lahirlah enam poin petisi 21 gampong yang ada dalam kawasan Rawa Tripa. Keenam poin tersebut di antaranya Kembalikan Kawasan Ekosistem Leuser (KEL) Tripa yang tersisa, seluas sekurangkurangnya 20.000 Ha kepada fungsi semula. Menetapkan KEL Tripa yang tersisa menjadi kawasan lindung, meninjau kembali hak guna usaha perusahaan perusahaan yang terdapat dalam KEL Tripa. Selain itu, pengelolaan dan pengawasan KEL Tripa dimandatkan ke tingkat mukim dan pemerintah gampong. Lalu penghijauan di sepadan pantai KEL Tripa harus dilakukan dan meninggalkan hutan yang di pinggir sungai sekurang-kurangnya 1 Km dari kiri dan kanan. Namun belakangan iniYEL kembali membuat petisi kedua, menurut juru bicara petisi 21 gampong, petisi kedua ini tidaklah dibuat berdasarkan aspirasi

masyarakat dan tidak terbuka. Tidak hanya Zainuddin, Zakaria yang dipercayakan sebagai kelompok tani Tuha Sepakat di bawah binaan YEL juga merasa tertipu, pasalnya kelompoknya pernah dijanjikan pembibitan karet, mahoni dan tumbuhan keras lainnya, namun sampai sekarang tidak ada realisasi ke masyarakat sehingga ini menjadi kisruh dalam tubuh masyarakat. Zakaria menambahkan, yang lebih parah lagi, masyarakat Rawa Tripa merasa dipermainkan dan dimanfaatkan untuk kepentingan sepihak saja. Ia mengaku saat ini dirinya ditagih oleh masyarakat terkait bantuan yang telah dijanjikan YEL. “Setiap hari saya ditagih masyarakat, saya tidak tahu mau berbuat apalagi,” kata Zakaria. Koordinator Community Development YEL Harmaini yang lebih akrab disapa Robert yang dihubungi via phone mengatakan bahwa hubunganYEL dengan masyarakat sampai hari ini masih baik-baik saja, dan masih banyak yang belum ia ketahui karena ia baru bertugas di Nagan Raya. (cb01)

BIREUEN (Waspada): Pemkab Bireuen mendesak kalangan perbankan yang beroperasi di sana untuk terus melakukan peningkatan pembinaan dan pemberdayaan ekonomi bagi pengusaha kecil dan menengah. Bupati Bireuen Ruslan H Daud melalui Asisten Ekonomi dan Pembangunan Zulkifli, Sabtu (8/9), pada pameran produk kerajinan rakyat di Pesta Rakyat Simpedes BRI mengatakan, dengan adanya pembinaan dari perbankan pengusaha kecil dapat terus berkarya menghasilkan aneka produk kerajinan melalui industri rumah tangga (home industry). “Pemkab Bireuen mendukung pameran aneka produk kerajinan rakyat di Pesta Rakyat Simpedes BRI Bireuen seperti hari ini,” kata Zulkifli pada yang digelar di halaman Pante Pirak Pasaraya. Lebih lanjut dia mengatakan, melalui pameran ini masyarakat Bireuen tahu keberadaan aneka produksi barang kerajinan yang sebenarnya sudah ada di Bireuen yang selama ini kurang

terekspose secara meluas sehingga aneka produk itu malah didatangkan dari luar daerah. Pimpinan Cabang Bank Rakyat Indonesia (BRI) Bireuen, Abdul Rais mengatakan, minat menabung masyarakat Bireuen semakin meningkat, hal ini ditandai dengan meningkatnya jumlah nasabah termasuk di kantor cabang pembantu di kecamatan-kecamatan. Hingga Juni 2012, katanya, jumlah nasabah mencapai 32 ribu orang dengan jumlah dana yang terkumpul mencapai Rp112 miliar. “Dana yang terkumpul itu telah disalurkan kembali kepada debitur dari kalangan pengusaha kecil menengah hingga 90 persen dari dana tabungan nasabah,” jelas Muhammad Rais. Sebelum acara itu dimulai, hadiah Simpedes BRI Bireuen tahap pertama tahun 2012, satu unit Daihatsu Xenia dan dua sepedamotor diarak keliling kota Bireuen dan disemarakkan drumband SMP Negeri 1 berikut komunitas “Geutangen Awai Bireuen”. (b17)

Koramil 06 Darul Makmur Gelar Karya Bakti NAGAN RAYA (Waspada) : Untuk membantu pemerintah daerah dalam meningkatkan kesejahteraan masyarakat dan membantu mempercepat pembangunan di daerah serta terwujudnya sasaran Binaan Teritorial (Binter), Jumat (7/9), Koramil 06/Darul Makmur di bawah naungan Kodim 0116/Nagan Raya melaksanakan kegiatan karya bhakti gotong royong di Desa Pulo Kruet dan Sumber Bhakti di Kec. Darul Makmur, Nagan Raya. Kegiatan fisik yang dilaksanakan meliputi pembersihan kanan/kiri jalan sepanjang lebih kurang 600 meter. Pembersihan makam umum, pembersihan Balai Desa Pulo Kruet dan Sumber Bhakti dan pembersihan masjid serta penyuluhan/bimbingan dari Dinas Transmigrasi dan arahan tentang aliran sesat yang sedang berkembang oleh Danramil 06/Darul Makmur. Dalam arahannya Danramil 06/Darul Makmur, Kapten Inf Ahmad Subandi menyampaikan bahwa kegiatan ini bertujuan secara tidak langsung membantu pemerintah mempercepat proses rehabilitasi dan rekonstruksi daerah serta meningkatkan kemanunggalan

TNI dengan rakyat dalam wadah kegiatan gotong royong sehingga mendorong berlangsungnya mekanisme pembangunan di wilayah Kecamatan Darul Makmur umumnya dan masyarakat Desa Pulo Kruet dan Sumber Bhakti pada khususnya serta terwujudnya ketahanan wilayah yang tangguh. Danramil juga menyampaikan agar hasil kegiatan gotong royong ini dapat dirasakan manfaatnya oleh masyarakat Desa Sumber Bhakti dan Desa Pulokruet, bahkan ditingkatkan agar kelangsungan perekonomian di Desa Pulo Kruet dan Sumber Bhakti semakin meningkat. Kadis Sosial Tenaga Kerja dan Transmigrasi Nagan Raya melalui Kabid Transmigrasi, Rusianto menyampaikan ucapan terima kasih kepada Muspika Darul Makmur dan masyarakat atas dilaksanakannya kegiatan karya bhakti di Desa Pulo Kruet dan Sumber Bhakti, Kec. Darul Makmur oleh Koramil 06/Darul Makmur. Di mana kegiatan ini berjalan dengan lancar dan mendapat sambutan hangat dari masyarakat setempat. (cda)

Waspada/Didit Arjuna

DANramil 06/Darul Makmur, Kapten Inf Ahmad Subandi ketika menyampaikan arahan pada kegiatan gotong royong.



Terpidana Korupsi Jangan Jalani Hukuman Di Lapas

Truk Angkut Kelontong Terbalik PEUREULAKTIMUR (Waspada): Akibat badan jalan licin akibat guyuran hujan, truk tronton BL 9485 A yang mengangkut barang klontong dari Medan menuju Bireuen terbalik di Jalinsum Banda Aceh-Medan persisnya di kawasan Peureulak Timur, Aceh Timur, Sabtu (8/9) sekira pukul 11:45. Informasi yang diperoleh menyebutkan, truk yang dikendarai Mukhlis, 32, warga Bireuen melaju dari Medan, Sumatera Utara dengan tujuan Bireuen dan Pidie. Mukhlis hanya sebagai pengangkutan dengan cara sewa jasa. Sementara barang klontong adalah milik sejumlah pedagang dalam dua kabupaten yakni Bireun dan Pidie. Namun sesampai di lokasi, truk yang dikendarai Mukhlis oleng ke kanan badan jalan hingga ban belakang tergelincir ke parit jalan. Saat itu, Mukhlis mengakui cuaca kurang bersahabat. (b24)

LANGSA (Waspada): Forum Peduli Rakyat Miskin (FPRM) Langsa, Nasruddin, meminta agar bagi tahanan terpidana korupsi diminta jangan menjalani hukumannya di Lapas Pemasyarakatan (Lapas) di Aceh, lebih baik menjalani hukuman di rumah tahanan (Rutan) Nusakambangan karena kalao berada di lapas disinyalir dapat melakukan lobi-lobi mengenai fasilitasnya selama menjalani hukumannya. “Seperti yang diekspos, di mana seorang terpidana korupsi senilai Rp220 miliar, mantan Ketua Kadin Aceh Utara, Basri Yusuf, 53, warga Lhokseumawe, sebelumnya menjalani hukuman di Rutan Salemba setelah divonis Pengadilan Negeri Jakarta dipindahkan ke Lapas II B Langsa,” ujar Nasruddin kepada sejumlah wartawan, Minggu (9/9).

14 Parpol Lokal Dan Nasional Serahkan Dokumen LANGSA (Waspada): Sedikitnya 14 partai politik (Parpol) baik lokal maupun nasional tingkat cabang di Kota Langsa telah menyerahkan dokumen persyaratan partai kepada Komisi Independen Pemilihan (KIP) Kota Langsa untuk proses verifikasi menjelang Pemila Legislatif tahun 2014 mendatang, Sabtu (8/9). Ketua Divisi Partai Politik KIP Langsa Saed Mahdhar kepada wartawan mengatakan, penyerahan dokumen oleh partai di tingkat kabupaten/kota bukan pendaftaran partai politik. Melainkan untuk melengkapi persyaratan partai guna verifikasi tingkat kabupaten/kota nantinya. Lanjutnya, untuk saat ini memang baru 14 partai politik lokal dan nasional yang telah menyerahkan dokumen partai. Namun tidak menutup kemungkinan dalam batas waktu perpanjangan ini akan ada penambahan partai lain yang akan menyerahkan dokumen partai. (m43)

Lima Gampong Sebagai Pilot Project LANGSA (Waspada): Untuk terlaksananya Syariat Islam secara kaffah di Langsa, Dinas Syariat Islam setempat mengusulkan supaya lima gampong dijadikan Pilot Project pelaksanaannya secara utuh. Kadis Syariat Islam kota Langsa Ibrahim Latif, Minggu (9/ 9) mengatakan, usulan tersenut telah disampaikan kepada eksekutif dan legislatif. Bahkan, kata dia, kepada para keuchik, Tuha Peut, Imum Gampong, Imum Mukim, tokoh masyarakat dan Muspika pun telah disosialisasikan. Menurut Ibrahim Latif, pihaknya mengusulkan tiap kecamatan ditetapkan satu gampong sebagai percontohan. Sesuai dengan jumlah kecamatan di Langsa ada lima, maka jumlah gampong menjadi lima. Ada nama-nama gampong yang diusulkan, jelasnya, Gampong Teungoh untuk Kecamatan Langsa Kota, Gampong Matang Selimeng untuk Kecamatan Langsa Barat, Gampong Sungai Lueng untuk Kecamatan Langsa Timur, Gampong Asam Petek) untuk Kecamatan Langsa Lama dan Gampong Paya Bujok Selemak untuk Kecamatan Langsa Baro. Selain mengusulkan lima gampong sebagai percontohan, Ibrahim Latif juga mengharapkan dalam tahun 2012 ini semua gampong telah selesai membuat Reusam Gampong masingmang tentang pelaksanaan Syariat Islam. (b20)

Keberangkatan Lion Air Tertunda BANDAACEH (Waspada): Keberangkatan pesawat Lion Air dari Bandara Internasional Sultan Iskandar Muda, Blang Bintang, Aceh Besar, Jumat (7/9) sore, mengalami penundaan satu jam lebih. Penundaan keberangkatan pesawat komersil yang mengangkut seratus lebih penumpang dengan tujuan Bandara Polonia Medan dan Jakarta itu disebabkan lampu peringatan di kokpit menyala terus sehingga pilot menolak menerbangkan pesawat jenis Boeing 737-800 ER. Namun, setelah dilakukan pengecekan oleh teknisi pesawat dan dinyatakan aman, sekira pukul 17:55 pesawat yang dipiloti Ali take off menuju Bandara Polonia Medan. Menurut jadwal, pesawat Lion Air tujuan Bandara Polonia itu bertolak dari Bandara SIM pukul 16:45. Kepala Security Bandara SIM Husaini mengatakan, trouble yang dialami Lion Air itu diketahui saat pesawat sudah berada di landasan pacu dan sedang mengambil ancang-ancang untuk take off. “Karena lampu peringatan di ruang kokpit menyala terus, ya pilot menolak untuk terbang,” ujar Husaini. Sayangnya, sebagian penumpang yang trauma dengan kejadian itu menolak untuk berangkat dengan pesawat tersebut dan pindah penerbangan dengan pesawat Lion Air yang berangkat besok pagi (pagi ini-red). Namun sebagian lainnya tetap berangkat, di antaranya mantan Gubernur Aceh Irwandi Yusuf dan keluarganya, Sofyan Dawood dan sejumlah pejabat setempat. Manajer Lion Air Cabang Banda Aceh Taufik membenarkan ada sejumlah penumpang yang cancel keberangkatan sore kemarin dan pindah ke penerbangan Lion Air pagi ini. (b05)

Penghuni Rutan Bireuen Dominasi Kasus Narkoba BIREUEN (Waspada) : Pihak jajaran Polres Bireuen telah bekerja ektra keras dan mengamankan para tersangka pelaku pengedar dan pemakai narkoba di Kabupaten Bireuen yang diadili di PN setempat cukup menonjol dibanding kasus-kasus lainnya. Hasil pengamatan Waspada di Cabang Rutan Bireuen, penghuni Rutan Bireuen hingga Sabtu (8/9) didominasi kasus narkoba. Kacab Rutan Bireuen Irfan Riandi, Sabtu (8/9) membenarkan hal itu. Menurut Irfan Riandi, dari 287 warga binaan napi dan tahanan Rutan Bireuen sebanyak 204 napi dan tahanan terdiri dari 166 napi dan 38 bersatatus tahanan terlibat kasus narkoba. Sedangkan 83 kasus dari napi dan tahanan lainnya terlibat kasus pencurian, pemerkosaan, pembunuhan, perampokan, illegal logging dan beberapa kasus lainnya. (b12)

Waspada/Muhammad H Ishak

TRUK pengangkut barang klontong dari Medan menuju Bireuen terbalik di Jalinsum Banda Aceh – Medan, di kawasan Peureulak Timur, Aceh Timur, Sabtu (8/9).

Perusahaan Asing Kelola Gas Alam Blok Pase Di Luar Kontrak LHOKSUKON (Waspada): Sejumlah elemen masyarakat Aceh Timur menuding pengelolaan gas alam Blok Pase, Gampong Blang Seunong, Kec.Pante Bidari, Aceh Timur di luar kontrak. Kontrak peusahaan asal Australia, Triangle berakhir 24 Agustus 2012, namun sampai sekarang mereka masih melakukan aktivitas di kawasan perbatasan Aceh Timur dan Aceh Utara tersebut. Ketua DPRK Aceh Timur Tgk Alaudin di Lhoksukon, Sabtu (8/9) menjelaskan, dari pantauan pihaknya Triangel Pase masih melakukan produksi gas di kawasan pedalaman Blang Seunong. Padahal, sesuai dengan dokumen yang diterima Pemkab Aceh Timur, kontrak perusahaan dengan pemerintah berakhir 24 Agustus 2012. “Nah, berarti saat ini mereka bekerja di luar kontrak,” tegas Alau-

din yang didampingi Ketua LSM Forum Peduli Masyarakat Miskin (FPMM), Nasruddin serta sejumlah tokoh masyarakat Aceh Timur dan Aceh Utara di Lhoksukon. Politisi Partai Aceh (PA) ini juga menyebutkan, pengelolaan gas alam di Aceh Timur harus transparan agar tidak merugikan daerah. Menurutnya, kendati perusahan asing telah menguras gas di perut bumi Pante Bidari mulai 1998, namun tidak sedikit pun memberi manfaat untuk warga yang masih tinggal di gubuk kawasan Blang Seunong. “Inilah yang sangat kita sayangkan, gas dikuras masyarakat hidup menderita,” ungkapnya prihatin. Informasi dihimpun, sejak 1981, Blok Pase dikelola anak perusahaan ExxonMobil. Tahun 2006 blok ini ditutup, alasannya cadangan gas semakin menipis. Pada Juli 2009 EMOI menjual 100 persen sahamnya kepada Triangle Energy Global Limited. Di BP Migas perusahaan asing ini tercatat namanya sebagai Triangle Pase. Pada produksi perta-

bat eselon II ini merupakan putra asli Peureulak kelahiran 21 Agustus 1963. Setelah menamatkan SD tahun 1976 dan SMP 1980 di Peureulak, Agussalim melanjutkan pendidikan SMA di Medan, dan lulus tahun 1983. Anak dari pasangan HA. Salam Ismail – Hj Chatijah AR ini lalu melanjutkan ke Fakultas Hukum hingga lulus tahun 1988 di Medan serta meraih gelar Magister Hukum (MH) tahun 2002 di salah satu perguruan tinggi di Jakarta. Mengawali karirnya, anak dari seorang ayah yang berprofesi sebagai guru ini bekerja sebagai staf Kantor BupatiWilayah II Peureulak hingga 1991. Lalu dipercayakan sebagai Kasubbag Pengembangan Karir Pegawai Bagian Kepegawaian Setdakab Aceh Timur hingga 1993. Kemudian, latar pendidikannya di hukum Agussalim dilantik menjadi Kabag Hukum Setdakab Aceh Timur hingga 1999 dan selanjutnya dipercaya Kabag Kepegawaian Setdakab Aceh Timur hingga 2003 serta dilantik men-

ma tahun 2009, Triangle mampu menghasilkan gas sampai 3 MMCFD (3 juta kaki kubik gas per hari). Jumlah tersebut turun drastis ketika Blok Pase masih dikelola ExxonMobil sejak 1998 sampai 2006, yaitu antara 120 sampai 140 MMCFD. Sejak 23 Februari 2012, kontrak Triangle Pase berakhir. Namun BP Migas meminta perusahaan tetap beroperasi enam bulan ke depan, sampai ditentukan operator baru. Masa enam bulan itu, menurut ketua DPRK Aceh Timur, berakhir 24 Agustus 2012. Humas Triangle Pase, Razali Jafar yang dihubungi menjelaskan, masih beroperasinya perusahaan kendati sudah habis masa kontrak, merupakan keputusan BP-Migas. “Kami di sini tidak bisa menjelaskan. Mungkin lebih baik dihubungi langsung ke BPMigas,” jelas Razali. Dia juga mengakui, operasi Triangle Pase tetap sesuai undang-undang sehingga tidak akan merugikan negara dan daerah penghasil. (b15/b19)

Gubernur Minta Pusat Bangun Irigasi Dan Jalan Di Aceh BANDA ACEH (Waspada): Untuk mempercepat pelaksanaan pembangunan di Bumi Serambi Mekkah, Gubernur Aceh Zaini Abdullah terus melakukan berbagai upaya yang menyentuh langsung kepentingan masyarakat banyak. “Upaya yang tengah giat dilakukan Pemerintah Aceh yang baru itu dengan terus melobi pemerintah pusat terutama pembangunan di bidang infrastruktur jalan dan irigasi,” ungkap Gubernur Aceh Zaini Abdullah kepada wartawan usai pertemuan dengan jajaran SKPA di aula Serbaguna kantor gubernur setempat, Jumat (7/ 9). Sebagai perwujudan maksud itu, Zaini mengaku telah meminta Menteri Pekerjaan Umum Djoko Kirmanto memberi perhatian khusus untuk Aceh. Karena fasilitas yang ada di Aceh sekarang belum optimal dalam meningkatkan produksi pertanian termasuk memberi pelayanan pergerakan arus barang dan jasa.

Menurut Zaini, permintaan pembangunan infrastruktur jalan dan irigasi di Aceh, disampaikan dalam pertemuan dengan jajaran Kementerian PU, beberapa waktu lalu di Jakarta. Ditambahkan Zaini, apa yang disampaikan itu mendapat perhatian serius Menteri PU seraya menyatakan siap membantu Aceh agar mampu mewujudkan masa depan yang lebih baik. Menjawab wartawan, kenapa harus dilaporkan ke menteri, Zaini menyebutkan, karena daerah belum cukup dana untuk membangun semua infrastruktur itu sehingga mengakibatkan sarana dan prasarana pengairan Aceh belum optimal. Akibat kondisi irigasi belum memadai itu sehingga menyebabkan hasil produksi gabah belum optimal yang diperoleh para petani. “Seharusnya produksi padi di Aceh bisa mencapai 3 juta ton per tahun, namun gara-gara infrastruktur irigasi belum memadai produksi yang diperoleh hanya 1.772 juta

Demi Pendidikan Gunung Didaki, Sungai Diarungi BERTEPATAN dengan 2 September 2012 lalu, Hari Pendidikan Daerah (Hardikda) Aceh telah mencapai usia yang Ke53 tahun. Berbagai persoalan pendidikan di negeri bersyariat Islam ini terus bermunculan, tetapi seiring dengan perjalanan kemajuan pendidikan di Aceh kini berbagai persoalan itupun dapat diatasi dengan berbagai langkah yang ditempuh Pemerintah Aceh di bawah kendali Dinas Pendidikan, baik provinsi maupun kabupaten/kota. Semua pihak mengakui pendidikan di Aceh lebih terpuruk dibanding Sumut dan Jakarta. Kondisi itu terjadi bukan karena kurangnya perhatian dan kegagalan pemerintah di bawah Dinas Pendidikan, namun konflik berkepanjangan mencapai 32 tahun lebih menjadi faktor utama yang tak bisa dipungkiri semua pihak sehingga pendidikan Aceh anjlok hingga tahun 2005 silam. Beberapa tahun kemudian, Dinas Pendidikan Aceh Timur dijabat Agussalim. Sosok peja-

WASPADA Senin 10 September 2012

jadi Kepala Badan Kepegawaian Daerah (BKD) Aceh Timur hingga tahun 2008. Terhitung sejak 2008 Agussalim kembali dipercayakan sebagai Kadis Pendidikan Aceh Timur hingga sekarang. Perkembangan pendidikan di Aceh Timur tergolong cepat dibanding Aceh Utara. Agussalim yang kini sudah berada di Pangkat/Golongan IV/c itu membangun puluhan sekolah yang sempat dibakar saat konflik berkecamuk. Tak hanya itu, Agussalim juga membangun sekolah lain di sejumlah titik yang dinilai dibutuhkan masyarakat sesuai dengan permintaan masyarakat. “Prioritas kita di Dinas Pendidikan adalah kemajuan pendidikan yang harus dicapai di daerah terpencil,” kata Agussalim, Jumat (7/9) lalu di Idi. Kemajuan selama 4 tahun Agussalim di Disdik adalah jumlah sekolah dari berbagai jenjang sudah bertambah seperti SMK yang sebelumnya 3 kini sudah menjadi 12 titik termasuk

di Lokop dan Simpang Jernih. Begitu juga SMA yang sebelumnya 16 titik kini menjadi 24 titik. Sementara SMP yang sebelumnya 54 titik kini menjadi 73 titik. Sedangkan SD sebelum tahun 2008 sebanyak 262 titik kini menjadi 278 titik. Peningkatan jumlah gedung sekolah juga dirasakan Taman Kanak-kanak (TK) yang sebelumnya 52 titik kini sudah menjadi 65 titik serta Pendidikan Anak Usia Dini (PAUD) yang sebelumnya 46 titik kini meningkat menjadi 198 titik yang tersebar di seluruh Aceh Timur. Tidak hanya itu, Agussalim juga melakukan pemerataan guru hingga ke seluruh pelosok Aceh Timur. Komitmennya dalam memajukan pendidikan di wilayah bekas konflik terberat di Aceh itu terhadap anak putus sekolah di kawasan pedalaman dan pesisir sehingga lahir sekolah di Simpang Jernih seperti SMP Matahari dan SMP Merdeka. Muhammad H Ishak

ton. Total sawah beririgasi di Aceh saat ini 384.171 hektare,” ungkap gubernur. Namun, gubernur mengingatkan semua pihak yang terlibat dalam pelaksanaan pembangunan infrastruktur diu Aceh, agar lebih mengutamakan kualitas. “Seperti pembangunan jalan Banda AcehCalang, Aceh Jaya yang didanai USAID harus dijadikan standar,” papar Zaini. Sehingga apapun yang dibangun di Aceh harus berkualitas, jangan sampai jalan yang dibangun tiap tahun diperbaiki seperti yang terjadi pada kawasan Lintas Timur. (b09)

Menurutnya, meskipun pengakuan dari pihak lapas setempat, terpidana mendapatkan pengawalan ketika berada di luar, namun kondisi seperti ini disinyalir adanya lobi-lobi antara pejabat di lapas dengan terpidana Basri sehingga diberikan keringanan atau fasilitas ketika terpidana korupsi tersebut menjalani hukuman dan ditambah lagi, mobil pribadinya Nissan Grand Livina sering terparkir di lapas dimaksud. Karena pemindahan terpidana kasus korupsi antara para pejabat lapas bisa diindikasikan modus baru bagi para koruptor yang ingin menikmati udara bebas di luar tahanan. “Artinya, dalam hal ini pemerintah kita dinilai tidak serius menanggani pemberantasan korupsi,” tegasnya. (m43)

LSM FAKTA Minta Perlindungan Ke Mabes Polri IDI (Waspada): Menyusul pemberitaan aksi penyelundupan beras Patah asal Malaysia ke Aceh melalui perairan kuala ‘tikus’ di Birem Bayeun (Aceh Timur), Ketua Lembaga Swadaya Masyarakat (LSM) FAKTA, Rabono Wiranata kini melaporkan dan meminta perlindungan ke Markas Besar (Mabes) Polri di Jakarta. “Aksi bongkar muat beras Patah asal Malaysia di Kuala Ranto Panjang, Kecamatan Birem Bayeun, Aceh Timur kita duga ilegal hingga merugikan negara sehingga kita publikasikan ke media. Tapi sekarang saya mendapat teror dan ancaman dari sejumlah nomor handphone gelap,” kata Rabono W, Minggu (9/9). Dia mengaku, teror dan ancaman diterima

sejak aksi bongkar muat beras Patah asal Malaysia itu dipublikasi media cetak nasional dan lokal. Tak hanya sekadar mengancam, nada yang didengar Rabono Wiranata juga mengancam nyawanya sehingga Ketua LSM FAKTA itu meminta perlindungan ke Mabes Polri. “Kenapa kamu tulis di media kegiatan kemarin, kamu mau coba-coba dengan kami, memangnya siapa kamu?,” tutur RabonoW meniru kalimat yang didengar dari salah satu nomor telepon gelap ke HP-nya. Bahkan anehnya, lanjut Ketua LSM FAKTA, ketika ditelepon ulang nomor handphone gelap tersebut sudah tidak aktif lagi. (b24)


SEJUMLAH pekerja memikul beras yang dipasok dari luar negeri dengan menggunakan kapal barang di Kuala Ranto Panjang, Kec.Birem Bayeun, Aceh Timur, Minggu (2/9).

Calhaj Uzur Tertua 112 Tahun Asal Pidie IDI (Waspada): Terkait pelunasan BPIH 2012 tahap III yang diperuntukkan bagi 43 calon jamaah haji uzur dan 43 orang pendamping, Kakanwil Kementerian Agama Provinsi Aceh meminta semua jajaran pelaksana haji baik di provinsi maupun di kabupaten/kota untuk membantu kelancaran proses pelunasannya sehingga sisa kuota calhaj Aceh bisa terpenuhi. “Kita minta semua petugas haji di kabupaten/kota untuk mensosialisasikan siapa saja calhaj uzur yang berhak melunasi, dan membantu calhaj uzur sehingga proses pelunasan BPIH-nya berjalan lancar, termasuk juga pengurusan paspor dan dokumen lain di imigrasi,” kata Kepala Kantor Kementerian Agama Aceh Tgk Ibnu Sadan, Minggu (9/9). Namun demikian, dia juga berharap agar petugas di kabupaten/kota untuk melihat dan melaksanakan tugas dan tanggungjawab dengan berpedoman kepada aturan dan juknis

yang ada. “Calhaj uzur yang berhak melunasi BPIH 2012 di tahap III ini disortir berdasarkan umur tertua ke bawah, bukan berdasarkan urut kacang nomor porsi sebagaimana dua tahap sebelumnya,” papar Ibnu Sadan. Dia menyebutkan, calhaj uzur tertua adalah Kamil Hadi bin Abdullah Abubakar, 112, asal Kabupaten Pidie dengan nomor porsi 010006 6478. “Tertua kedua adalah Hamidah binti Marhaban dengan usia 102 tahun asal Kabupaten Aceh Tamiang dengan nomor porsi 01000 78098,” katanya. Kepala Kanwil Aceh menambahkan, setelah diurutkan ke bawah sampai berjumlah 43 orang, umur termuda yang masuk dalam list yang berhak melunasi adalah 87 tahun atas nama Siti Samidah binti Samsuddin asal Kabupaten Simeulue dengan nomor porsi 0100054 523. (b24)

‘Panas-Dingin’ Menjelang Diumumkan Kabinet Baru Pemko Langsa ISU mutasi dan pergantian pejabat pasca pelantikan Wali Kota danWakilWali Kota Langsa yang dilaksanakan 27 Agustus lalu, kini makin hangat sehingga merambah tajam ke segenap lini jajaran Pemerintah Kota Langsa. Isu yang berkembang tersebut menembus semua posisi penting pada jabatan struktural maupun fungsional termasuk di kalangan tenaga pendidik yang memimpin lembaga pendidikan (sekolah). Di antara posisi yang paling ramai dan hangat dibicarakan, adalah pergantian pejabat yang kini menduduki posisi eselonII sebagai kepala dinas atau kepala badan. Demikian pula posisi eselon-III yang juga tidak kalah pentingnya dalam penyelenggaraan birokrasi pemerintahan. Ekses dari kabar bakal adanya mutasi dan pergantian tersebut, menyebabkan telah menimbulkan suasana ‘panasdingin’ di jajaran Pemko Langsa. Dampak kepada pejabat bersangkutan juga terlihat, terutama mereka yang saat ini menduduki jabatan eselon-II dan bahkan eselon-III. Ekspresi dan tanggapan mereka beragam menghadapi kondisi masa transisi itu. Ada yang tidak menanggapi berlebihan karena masalah mutasi dan pergantian pejabat menjadi hak dan kewenangan atasan. Mereka sebagai

bawahan tetap manut saja di manapun bakal ditempatkan nanti. Yang terpenting baginya, mereka ada jabatan dan tidak dirugikan karena ini menyangkut dengan karier dan masa depan keluarganya. Yang lainnya, ada yang menanggapi serius rencana gebrakan mutasi yang akan dilakukan pejabat wali kota baru. Kelompok ini sepertinya radarada agak cemas menghadapi kondisi tersebut. Begitupun, mereka akan melihat dulu perkembangan akhir nanti. Sedangkan kelompok satu lagi, malah terlihat agak sibuk mencari berbagai informasi seputar rencana pergantian pejabat. Tgk Usman Abdullah bersama wakilnya arzuki Hamid telah dilantik sebagai Wali Kota dan Wakil Wali Kota Langsa periode 2012-2017. Seiring dengan dilantiknya kedua pejabat yang diusung Partai Aceh itu, maka seiring pula isu mutasi dan pergantian pejabat makin berkembang luas di jajaran Pemko Langsa. Begitupun, tidak ada satu sumberpun yang bisa menduga-duga apalagi menyebut jelas siapa saja pejabat yang akan mengisi kabinet Toke SeuUem nanti. Rencana mutasi dan pergantian pejabat Pemko Langsa kali ini memang sangat rahasia dan terkesan relatif tertutup

Waspada/Syahrul Karim

WALI Kota Langsa Tgk Usman Abdullah (paling kiri), Ketua DPRK Muhammad Zufri (pakai kopiah),WakilWali Kota Marzuki Hamid mengikuti acara peringatan Hari Pendidikan Daerah di Langsa, belum lama ini. sehingga tidak terpantau siapa saja yang bakal dijadikan stafnya oleh Toke Seu-Uem bersama Bang Mar, nama akrab kedua pejabat tertinggi Pemko Langsa itu. WakilWali Kota Langsa Marzuki Hamid yang pernah beberapa kali dikonfirmasi tentang personalia kabinet baru tersebut itu tetap mengelak dengan bahasa ysang sangat santun dan akademis. “Belum, bang,” katanya ramah. Usman Abdullah maupun Marzuki Hamid sudah mema-

hami tentang jatidiri dan kualitas pejabat Pemko Langsa terutama yang kini menduduki jabatan eselon-II. Sebab itu, kedua pemimpin Pemko tersebut tidak terlalu sulit untuk menempatkan mereka. Dalam apel perdana bersama PNS yang digelar di halaman kantor sekretariat belum lama ini, Toke Seu-Uem sudah mewanti-wanti bahwa dia menginginkan pejabat yang bekerja jujur dan ikhlas. Syahrul Karim

Waspada, Senin 10 September 2012  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you