Page 1

Kontra Serangan Koalisi

WASPADA Demi Kebenaran Dan Keadilan

SELASA, Wage, 22 Maret 2011/16 Rabiul Akhir 1432 H

No: 23453 Tahun Ke-65

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman (A1-12, B1-8, C1-8)

Harga Eceran: Rp2.500,-




WARGA Libya yang pro Khadafi memegang poster pemimpin Libya Moammar Khadafi selama demonstrasi di Roma (kiri). Di Karachi, Pakistan, partai kelompok agama membakar bendera AS (tengah). Di Athena, Yunani, mahasiswa juga membakar bendera negara-negara koalisi, Senin (21/3). Mereka semua mengutuk pemboman terhadap Libya.

Keberadaan Khadafi Tak Diketahui Tanggapan Parpol Berbasis Islam MEDAN (Waspada): Kecaman terhadap serangan Amerika Serikat (AS) dan sekutunya ke Libya semakin besar dilakukan oleh partai politik (Parpol) Islam atau Parpol berbasis umat Islam. Mereka menyebut serangan itu merupakan pembantaian terhadap umat Islam. Senin (21/3), Waspada mewawancarai beberapa anggota DPRD Sumut, dari Partai Keadilan Sejahtera (PKS), Partai Amanat Nasional (PAN), dan anggota dewan dari Partai Demokrat yang juga Wakil Ketua Pengurus Wilayah (PW) Nahdhatul Ulama (NU) Sumut. Ketua FPKS Hidayatullah, Wakil Ketua PAN Sumut Muslim Simbolon dan anggota FPD dan Wakil Ketua PW NU Marahalim Harahap, mengecam tindakan AS dan pasukan koalisi yang membombardir Libya. Hidayatullah tidak dapat menerima penyerangan yang dilakukan AS dan sekutunya kepada Libya. Menurutnya, Lanjut ke hal A2 kol. 3

Komentar Lewat Internet Banyak komentar yang menanggapi serangan AS dan koalisinya ke Lybia yang disiarkan situs CNN, dan tak sedikit yang menentang serangan tentara asing ke negara tersebut. Berikut beberapa komentar diantaranya: Parkmore: Bodoh dan koalisi yang bodoh. Koalisi harusnya dihadapkan ke Mahkamah Internasional karena pembunuhan rakyat tak bersalah. GerarardoG: Saya mengerti bahwa melindungi warga sipil adalah hal baik, namun saya heran, tidak pernahkah kita melihat sekutu melindungi ribuan orang yang dibantai oleh diktator kejam di Selatan Sahara? Guest: Obama minum darah orang tak bersalah. Pistonsfan: Tiga perang dalam kurun waktu kurang dari 10 tahun... Simpatico4u: Setiap negara yang ingin membatalkan program nuklir seperti yang dilakukan Libya - kini harusnya berpikir kembali bahwa mereka nantinya akan diserang oleh AS, meski banyak janji tentang bergabung kembali dengan dunia internasional. Masih sangat banyak kejahatan yang terjadi di negara-negara yang negaranya menembaki para demonstran - Saya berpikir, apakah kini AS akan mulai membom mereka? SickofBS74: 8000 warga Libya telah tewas hingga kini, dan ini bedanya dengan Libya dan negara lain yang warga pernah terbunuh oleh gejolak. Saya yakin ini akan mendatangkan konsekuensi besar bagi AS. Ini nampaknya perang untuk mendapatkan minyak, karena perang kami (ASred) sebelumnya pernah di Timur Tengah. Secara pribadi saya pikir kita harus menghindari ini semua. Namun saya juga bukan orang Libya yang tengah menghadapi gejolak. Ini merupakan kekacauan besar! Saya rasa tidak ada seorang pun saat ini yang ingin jadi presiden. (rizal)


Teror ‘Bil Kitabah’ Oleh: H.Syarifuddin Elhayat DALAM mengembangkan da’wah, ada tiga hal yang dilakukan ,yakni da’wah billisan (berdakwah dengan ucapan) dilakukan para muballigh dan ustadz, da’wah bil hal (berdakwah dengan perbuatan) dilakukan para aghniya ,-orang yang berkemampuan dengan hartanya dan da’wah bil kitaabah (berdakwah lewat tulisan) dilakukan para penulis. Ketiga-tiga metode ini bagaikan tiga ‘tungku sajarangan’ yang tidak terpisahkan antara satu dengan yang lainnya. Itulah metode yang lazim dilakukan untuk mengembangkan ‘sayap’ agama dan dengan metode itu ummat Lanjut ke hal A2 kol. 6

TRIPOLI, Libya (Waspada): Satu bangunan tertutup dekat tempat berlindung Moammar Khadafi di Tripoli porak-poranda, Senin (21/3), ketika pasukan Amerika Serikat dan sekutu melanjutkan misi mereka untuk melucuti kekuatan pemimpin Libya itu. Namun di mana Khadafi masih belum diketahui. Seorang pejabat militer koalisi menyatakan bukan Khadafi dan kediamannya yang sengaja jadi sasaran

pengeboman Minggu malam. Namun pejabat tersebut yang tidak ingin diungkapkan jatidirinya mengatakan kompleks

itu menjadi sasaran karena berisi kemampuan untuk melaksanakan komando dan pengendalian pasukan Libya. “Kami bukan memburu Khadafi,” kata Laksamana Muda AS Bill Gortney dalam satu temu pers di Pentagon. “Pasukan rezim itu lebih tertekan dan tidak bebas bergerak.” Ketika ditanya mengenai laporan asap yang mengepul dari istana Khadafi, Gortney

mengatakan , “Kami tidak menargetkan kediamannya.” Wartawan Barat, termasuk dari CNN, telah dibawa ke dalam kompleks oleh para pejabat Libya yang melakukan survei atas kerusakan yang di-alami. CNN melaporkan satu bangunan bertingkat empat mengalami kerusakan berat, kemungkinan akibat gempuran misil jelajah. Lanjut ke hal A2 kol. 1

Pelajar SMP Galang Simpati Untuk Jepang BANDA ACEH (Waspada): Ratusan pelajar SMP 11 Lamjabat, Banda Aceh menggelar aksi simpati untuk masyarakat Jepang, di aula sekolah, Senin (21/3). Dalam aksi yang diga-gas Yayasan Kanaheiwa itu, para pelajar juga menulis surat dukungan moral kepada warga Jepang yang tertimpa musibah.

Ketua Yayasan Kanaheiwa Muzailin Affan, kepada wartawan seusai acara mengatakan, para pelajar secara emosional dan historis memiliki ikatan batin yang kuat. “Sekolah ini juga dibangun oleh bantuan masyarakat Jepang,” sebut mahasiswa S3 Tohoku University ini. Dia menyebutkan, para

pelajar kebanyakan korban tsunami, sehingga simpati yang muncul bisa lebih kentara. Karena itu, pihaknya ingin melakukan sesuatu berupa menggalang simpati kepada warga negeri Sakura itu. Dalam aksi Aceh Pray for Japan itu, para siswa SMP 11 menuliskan pesan-pesan semangat, pembacaan puisi, doa

bersama, serta penggalangan dana solidariti. “Acara ini mendapat dukungan penuh TDMRC (Tsunami & Disaster Mitigation Research Center),” ujarnya. Menurut Dosen Fakultas Teknik Universitas Syiah Kuala ini, semua hasil karya siswa Lanjut ke hal A2 kol. 1

Waspada/Surya Efendi

WARGA berusaha menggeser satu unit mobil Toyota Innova yang ditimpa pohon tumbang di Jl. Iskandar Muda Medan, Senin (22/3), akibat angin kencang sebelum hujan deras mengguyur Kota Medan.

Pemprovsu Diminta Ambilalih Pelaksanaan CPNS Batubara MEDAN (Waspada): Puluhan peserta Calon Pegawai Negeri Sipil (CPNS) di Pemkab Batubara, berunjukrasa di halaman Kantor Gubsu dan Badan Kepegawaian Negara (BKN) Regional VI Jl. TB Simatupang , Senin (21/3), minta Pemprovsu mengambilalih pelaksanaan CPNS. Lanjut ke hal A2 kol. 3


SEJUMLAH peserta CPNS Kab. Batubara mendatangi BKD Sumut di Medan, Senin (21/3), menyampaikan aspirasi karena merasa dicurangi dalam rekrutmen CPNS.

Pohon Tumbang Timpa Mobil Dan Betor, 3 Luka MEDAN (Waspada): Satu unit mobil Toyota Innova BK1938 IW warna silver dan satu unit becak bermotor (betor) rusak akibat ditimpa pohon yang tiba-tiba tumbang hingga menutupi ruas Jalan Iskandar Muda Medan, Senin (21/3) sekira pukul 16:30. Peristiwa ini mengakibatkan, tiga warga luka tertimpa batang pohon dan jalan menjadi macet. Edi Hendrik Sinaga, pengemudi betor yang menderita luka kepada wartawan di TKP mengatakan dirinya beruntung bisa menghindar dan hanya menderita luka lecet. Namun betor miliknya rusak. ‘’Peristiwa ini berlangsung cepat dan tiba-tiba,’’ tuturnya. Lanjut ke hal A2 kol. 2

Picu Harga Minyak MEDAN (Waspada): Dua pengamat ekonomi di Medan sepakat serangan sekutu yang dikomandoi AS, Perancis, Inggeris dan beberapa negar alain ke Libya hanya akan menaikkan harga minyak. Dekan Fakultas Ekonomi Universitas Sumatera Utara Jhon Tafbu Ritonga dan praktisi bisnis Vincent Wijaya berbicara kepada Waspada di Medan, Senin (21/3). Statement mereka terbukti benar. Seperti dilaporkan Associated Press harga minyak meloncat mendekati 103 dolar AS per barel dalam perdagangan Senin di Asia apalagi setelah pimpinan Libya Moammar Khadafi menyatakan perang dalam jangka waktu lama setelah serangan sekutu. Masih dari AP dilaporkan, benchmark harga minyak untuk ketibaan April naik 1,89 dolar AS menjadi 102,96 dolar AS (mendekati 103 dolar AS) per barel dalam perdagangan elektronik, Senin (21/3), yang mengacu pada New York Mercantile Exchange. Sebenarnya kontrak harga minyak sudah turun 35 sen ke level 101,07 dolar AS per barel Jumat lalu. Namun serangan tentara koalisi seperti dikutip dari AP menyebabkan harga minyak melonjak lagi. Lanjut ke hal A2 kol. 6

RI: Akhiri Kekerasan JAKARTA (Antara): Pemerintah Indonesia menyerukan pentingnya perlindungan warga sipil dan mengakhiri tindak kekerasan di Libya. “Sejak awal perkembangan situasi di Libya, Pemerintah Indonesia secara konsisten menyerukan agar masyarakat internasional memberikan perlindungan kepada penduduk sipil yang tidak berdosa,” kata Menteri Luar Negeri Marty Natalegawa dalam siaran pers dari Kemlu yang diterima Senin (21/3). Ia mengatakan, langkah-langkah perlindungan tersebut harus tetap sesuai dengan prinsip hukum internasional serta Piagam PBB. “Resolusi Dewan Keamanan PBB nomor 1973 yang disahkan pada 17 Maret 2011, jika ditetapkan secara ketat dan seutuhnya, membuka peluang bagi upaya perlindungan penduduk sipil,” tambahnya. Pemerintah Indonesia menekankan, perlu diciptakan kondisi kondusif bagi proses politik yang demokratis dan damai di Libya, agar terhindar dari terjadinya lingkaran kekerasan dan konflik, dan agar rakyat Libya dapat menentukan masa depannya sendiri secara demokratis, kata Menlu. Kuba mengutuk Sehubungan dengan serangan pasukan koalisi terhadap rezim Libya, Pemerintah Kuba mengutuk keras tindakan tersebut. Seperti di kutip kantor berita Xinhua, Minggu (20/3) malam, Pemerintah Kuba mengecam intervensi militer asing dalam konflik dalam negeri Libya. Pemerintah Kuba juga mendorong dialog dan negosiasi dan mendukung “hak yang tidak dapat dicabut warga Libya guna memutuskan nasib sendiri tanpa intervensi asing.” Lanjut ke hal A2 kol. 2

Syamsul Mengaku Diancam Anak Buah JAKARTA (Wasapada) : Gubernur Sumatera Utara Syamsul Arifin mengungkapkan, persoalan hukum terhadap dirinya merupakan ancaman yang disampaikan Buyung Ritonga mantan bendahara Kas Daerah Kab. Langkat yang

tidak senang terhadap dirinya. Selanjutnya, dibeberkan dalam bentuk data, diberikan kepada penyidik Komisi Pemberantasan Korupsi (KPK) yang menangani kasus dugaan korupsi APBD tahun 2000-2007 saat dirinya menjabat sebagai

bupati Langkat. “Tidak ada pertanyaan yang mulia, tapi pada saat konfrontir antara saksi Surya Djahisa dengan Buyung saja nanti saya tanyakan. Daripada begaduh kami. Tapi ada yang disimpan saksi yang mulia, yaitu tentang ancaman Buyung yang pernah disampaikan kepada saksi,” kata Syamsul

Lanjut ke hal A2 kol. 4

erampang Seramp ang Antara

SYAMSUL Arifin bersiap mengikuti sidang pemeriksaan saksi di Pengadilan Tindak Pidana Korupsi, Jakarta, Senin (21/3).

- Hilang syoor awak nengok Obama - He...he...he...

Medan 24-32 C

P.Sidimpuan 20-29 C

R.Prapat 24-32 0C

Penyabungan 20-29 0C

Berastagi 18-27 0C


Sibolga 22-32 0C Hujan guntur


WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca 0

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

SELASA, Wage, 22 Maret 2011/17 Rabiul Akhir 1432 H  z No: 23453 * Tahun Ke-65

Terbit 28 Halaman (A1-12, B1-8, C1-8)  z Harga Eceran: Rp 2.500,-

RI Serukan Perlindungan Bagi Warga Sipil Libya


SEORANG pejuang pemberontak mengarahkan senapannya ke seorang tersangka pendukung Khadafi ketika para pemberontak lainnya berusaha melindungi para tersangka pendukung pemimpin Libya, di satu jalan antara Benghazi dan Ajdabiyah, dekat Ajdabiyah, Senin (21/3).

JAKARTA (Antara): Pemerintah Indonesia menyerukan pentingnya perlindungan warga sipil dan mengakhiri tindak kekerasan di Libya. “Sejak awal perkembangan situasi di Libya, Pemerintah Indonesia secara konsisten menyerukan agar masyarakat internasional memberikan perlindungan kepada penduduk sipil yang tidak berdosa,” kata Menteri Luar Negeri Marty Natalegawa dalam siaran pers dari Kemlu yang diterima Senin (21/3). Ia mengatakan, langkah-langkah perlindungan tersebut harus tetap sesuai dengan prinsip hukum internasional serta Piagam PBB. Lanjut ke hal A2 kol 2


TENTARA Libya meneliti kerusakan atas satu gedung administratif yang terkena serangan misil Minggu malam di jantung kompleks Moammar Khadafi di Bab Al Azizia, Tripoli, Libya, Senin (21/ 3) ketika mereka bergambar dalam satu peninjauan yang diorganisir oleh penguasa Libya.

Kompleks Rumah Khadafi Dirudal Kejagung Sudah Terima Berkas Cirus Sinaga JAKARTA (Antara): Kejaksaan Agung (Kejagung) mengaku telah menerima berkas Jaksa Cirus Sinaga dari Mabes Polri dalam kasus dugaan penghilangan pasal korupsi dan pencucian uang untuk perkara yang melibatkan Gayus HP Tambunan. “Kasie II Direktorat Penuntutan pada Jaksa Agung Muda Tindak Pidana Khusus (Jampidsus), telah menerima penyerahan berkas perkara tahap pertama atas nama Cirus Sinaga,” kata Kepala Pusat Penerangan Hukum (Kapuspenkum) Kejagung, Noor Rachmad di Jakarta, Senin (21/3).. Selanjutnya, kata dia, berkas Jaksa Cirus Sinaga itu akan dipelajari oleh jaksa peneliti atau jaksa P16. Ditambahkan, di dalam

berkas itu ada Pasal 12, Pasal 21 dan Pasal 5 Undang-Undang (UU) Tindak Pidana Korupsi. “Intinya itu, menghalang-halangi proses penyidikan, penuntutan perkara korupsi atau kemudian melakukan penyalahgunaan kewenangan,” katanya. Ia menambahkan jaksa peneliti dalam waktu satu minggu harus bekerja meneliti berkas tersebut untuk menentukan sikap apakah berkas itu sudah lengkap atau belum lengkap. Dikatakan, alat bukti dari keterangan saksi ada 20. “Tapi, kalau barang bukti ada dokumen, surat-surat dan hasil laboratorium forensik mengenai komunikasi melalui telepon seluler Jaksa Cirus Sinaga dengan Haposan,” katanya.

Jangan Ada Pungutan Urus Administrasi Kependudukan SIBOLGA (Waspada): Walikota Sibolga HM Syarfi Hutauruk meminta semua pihak agar tidak melakukan pungutan biaya kepada masyarakat yang mengurus administrasi kependudukan, jika ada yang melanggar peraturan akan diberikan sanksi sesuai aturan yang berlaku. Hal itu disampaikan Walikota Sibolga pada peresmian tempat perekaman data kependudukan di Kecamatan Sibolga Utara, Senin (21/3). Dia meminta seluruh Camat, Lurah, Kepling untuk mensukseskan program 100 hari Walikota dan Wakil Walikota Sibolga tentang pelayanan publik pengelolaan administrasi kependudukan, khu-

susnya KTP, KK dan akte kelahiran dengan tidak mengutif biaya. Dikatakan Walikota, sesuai amanat UU nomor 23 tahun 2006 dimana administrasi kependudukan rangkaian kegiatan penataan dan penertiban dokumen dan data kependudukan melalui pendaftaran penduduk. Kadis Kependudukan dan Capil Sulhan Sitompul mengatakan, kegiatan peresmian rekaman data kependudukan merupakan lanjutan program sebelumnya di kantor Camat Sibolga Kota dan akan berakhir pada April 2011 di dua Kecamatan yakni Sambas dan Selatan. (a24)

Jubir Khadafi: Serangan Barbar

TRIPOLI (Waspada): Sebuah rudal menghancurkan gedung administrasi kependudukan pemerintahan Libya pimpinan Moammar Khadafi. Bangunan itu hanya berjarak sekitar 50 meter dari rumah Khadafi.

Seperti dilansir Channel News Asia, Senin (21/3), rudal itu jatuh begitu dekat dengan tenda tempat Khadafi menerima tamu di Tripoli. Juru bicara pemerintahan Khadafi, Moussa Ibrahim mengecam serangan itu. “Ini adalah pengeboman barbar yang bisa melukai ratusan warga sipil,” kata Moussa yang

Waspada/Abdul Mukthi Hasan

AIYUB (pakai selendang batik) yang diamankan bersama tujuh anggotanya di Mapolres Bireuen, memberi keterangan kepada Waka Polres, Kompol Armaini, saat berada di Meunasah Mapolres, Senin (21/3).

Lanjut ke hal A2 kol 6

Waspada/Abdul Mukthi Hasan

SATU balai yang diduga dijadikan sebagai tempat belajar di samping rumah Sulaiman, Desa Lhok Mane, Pandrah, Bireuen, Minggu (21/3) malam ludes dibakar massa.

Syamsul Mengaku Diancam Anak Buah JAKARTA ( Wasapada): Gubernur Sumatera Utara Syamsul Arifin mengungkapkan, persoalan hukum terhadap dirinya merupakan ancaman yang disampaikan Buyung Ritonga mantan bendahara Kas Daerah Kabupaten Langkat yang tidak senang terhadap dirinya. Selanjutnya, dibeberkan dalam bentuk data, diberikan kepada penyidik Komisi Pemberantasan Korupsi (KPK) yang menangani kasus dugaan korupsi APBD tahun 2000-2007 saat dirinya menjabat sebagai bupati Langkat. “Tidak ada pertanyaan yang mulia, tapi pada saat konfrontir antara saksi Surya Djahisa dengan Buyung saja nanti saya tanyakan. Daripada

BIREUEN (Waspada): Ratusan warga dari sejumlah kecamatan di Bireuen, Senin (21/3) dinihari menyerbu kelompok pengikut aliran sesat.Dalam aksi itu, warga membakar satu mobil, tiga sepedamotor dan balai serta satu genset. Delapan warga diduga pengikut aliran sesat, diamankan di Mapolres Bireuen. Menurut keterangan, Senin (21/3), penyerbuan itu terjadi saat perangkat desa datang ke satu balai pengajian, dimana para pengikut aliran sesat berkumpul untuk menanyakan tamu mereka yang tidak melapor. Namun para pengikut aliran yang belum jelas namanya malah menantang, dan mengancam perangkat desa dengan parang serta benda tumpul lainnya. Warga yang mengetahui hal itu, langsung mendatangi

lokasi. Tanpa dikomando warga menyerang, membakar balai dan satu sepedamotor. Keterangan lainnya, amuk massa juga terjadi di Desa Jambo Dalam Kec. Plimbang dan Desa Lhok Mane, Kec. Pandrah Bireuen, Minggu dan Senin (21/3) dinihari, dengan tuduhan yang sama.Peristiwa itu mengakibatkan tiga sepedamotor, satu kendaraan roda empat, dua balai pengajian hangus dibakar massa. Selain itu, massa juga melempari dan merusak dua rumah yang berada di desa dan kecamatan berbeda. Bahkan, massa sempat bergerak ke Peudada sekitar pukul 04:00 dinihari, namun orang yang dicari tidak ada, sehingga massa akhirnya bubar. Lanjut ke hal A2 kol 3

JAKARTA (Waspada): Salah satu pendiri Partai Keadilan Sejahtera (PKS) Yusuf Supendi (foto) mendatangi kantor Komisi Pemberantasan Korupsi (KPK) Senin (21/3) siangi. Ditemani seorang rekannya,

Kasus Penggorokan Dua Remaja Masih Misteri

Oleh: H. Ameer Hamzah

BLANGPIDIE (Waspada): Jajaran Polres Aceh Barat Daya (Abdya) mengamankan ganja kering seberat 205 kg yang akan diselundupkan ke Medan dan Kabanjahe, Sumut.

TAPAKTUAN (Waspada): Kasus penggorokan dua remaja di Kab. Aceh Selatan mengakibatkan Yulizar F, 22, tewas di tempat dan temannya Jardi Kasman, 17, kritis, hingga Senin kemarin masih misteri. Baik pelaku maupun motifnya, sejauh ini belum terungkap. Pa s a l n y a , p o l i s i mengalami kesulitan memperoleh keterangan dari Jardi, satusatunya saksi kunci dalam kasus penganiayaan dan pembunuhan tersebut. Karena kondisinya kritis dan kini masih dirawat intensif di RSUD

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 1

Akhirnya ia mengucapkan selamat tinggal kepada hiruk pikuk dunia Dia memilih uzlah ke sebuah desa yang sepi Di sana ia bermujahadah, menyatu diri dengan dunia sufi. (Ibnu al-Jauzi) Waspada/Sudarmansyah

KASAT Narkoba Polres Abdya Ipda T Zia Fahlevie beserta barang bukti 12,5 goni besar ganja kering (205 kg) yang gagal diselundupkan dua pengedar yakni JM, warga Gayo Lues dan MD, warga Blangkejeren, Senin (21/3).

Polisi Abdya Amankan 2 Orang Pemilik 205 Kg Ganja

begaduh kami. Tapi ada yang disimpan saksi yang mulia, yaitu tentang ancaman Buyung yang pernah disampaikan kepada saksi,” kata Syamsul kepada majelis hakim pada sidang kedua terdakwa di Pengadilan Negeri Jakarta Pusat pada Pengadilan Tindak Pidana Korupsi (Tipikor), di Jakarta, Senin (21/3). Ancaman tersebut diungkapkan Syamsul Arifin kepada Majelis Hakim dipimpin ketuanya Tjokorda Rai Suamba ketika mempersilakan Syamsul Arifin untuk bertanya kepada saksi Surya Djahisa (kini Sekda Kabupaten Langkat) dalam kesaksiannya pada sidang lanjutan terdakwa. Lanjut ke hal A2 kol 1

Yusuf Laporkan Petinggi PKS Ke KPK

Mobil, Sepedamotor Dan Balai Dibakar Delapan Pengikut Diamankan Polisi

Hakikat Dunia

Lanjut ke hal A2 kol 2

Khadafi. Dalam suatu kesempatan langka berkunjung ke basis kekuatan rahasia Moammar Khadafi, pejabat Libya membawa wartawan asing ke dalam kompleks yang dijaga ketat itu, Senin (21/3), untuk menunjukkan sebuah gedung

Pengikut Aliran Sesat Diserbu Warga

Al Bayan

HUJJATUL Islam Imam Ghazali (450 —505 H) adalah ulama besar dan profesor ilmu-ilmu agama dan filsafat. Ia sangat dihormati oleh ulama dan khalifah. Ibnu AlJauzi menyebutnya; Pembela Islam yang gigih. Beliau

berada di kediaman Khadafi, yang berjarak sekitar 400 meter dari lokasi pengeboman. Menur ut Moussa, serangan dari koalisi (sekutu) itu justru bukan untuk melindungi warga sipil. Tripoli diguncang ledakan sejak Minggu malam. Salah satu lokasi yang menjadi sasaran rudal adalah area-area dekat kediaman


Direktur Narkoba Polda Metro Jaya Kombes Pol Anjan Pramuka Putra (kiri) bersama Kepala Bidang Humas Polda Metro Kombes Pol Baharudin Djafar (kanan) menunjukkan barang bukti narkotika jenis ekstasi dan sabu-sabu saat gelar barang bukti di Markas Kepolisian Daerah Metro Jaya, Jakarta, Senin (21/3).

AKBP ES Bukan Pengawal Keluarga Cendara JAKARTA (Antara): Kepala Badan Reserse Kriminal Mabes Polri Komjen Pol Ito Sumardi di Jakarta, Senin (21/3), menyatakan oknum berinisial AKBP ES bukan pengawal dari keluarga Cendana. Lanjut ke hal A2 kol 1

Yusuf datang melaporkan tiga petinggi PKS, yakni Presiden PKS Luthfi Hasan, Sekjen PKS Anis Matta dan Wakil Sekjen PKS Mahfudz Siddiq. Yusuf menuduh ketiganya terkait dengan dugaan dana asing dari Timur Tengah yang masuk ke kas PKS. “Saya juga akan melaporkan penggelapan 10 miliar rupiah dalam pilkada DKI Jakarta,” kata Yusuf sebelum masuk ke gedung KPK. Apa motivasi Yusuf melaporkan kasus ini ke KPK? “Ya, kalau tidak bisa diselesaikan secara internal, ya saya laporkan ke KPK.” Yusuf membawa semua dokumen beramplop cokelat. Dokumen itu, katanya, terkait dengan materi yang dilaporkannya. Juru bicara KPK, Johan Budi SP menegaskan bahwa KPK terbuka menerima aduan apapun dari masyarakat. “Nanti, kami lihat, apakah pengaduan itu masuk domain KPK atau tidak,” kata Johan. Johan pun belum bisa menanggapi apakah elit politik yang dilaporkan Yusuf itu masuk kategori penyelenggara negara atau bukan sesuai syarat Undang-undang Pemberantasan Tindak Pidana Korupsi. “Kami telaah dulu,” kata Johan. Wakil Sekjen PKS Fahri Hamzah, menganggap semua tuduhan itu dirancang oleh sekelompok orang yang Lanjut ke hal A2 kol 6

Serampang - Rakyat sipil juga jadi korban ... - He.... he....he....

Berita Utama

A2 Kasus ....

dr.Yulidin Away Tapaktuan. Kapolres Aceh Selatan AKBP Bambang Syafrianto, S.Ik melalui Kasat Reskrim Iptu Novi Edyanto, Senin (21/3) sore membenarkan pihaknya masih kesulitan mengungkap kasus tersebut, karena saksi kunci, Jardi belum dapat diminta keterangan. Begitu pun, pihaknya terus berupaya mengusut kasus tersebut berdasarkan imformasi yang diperoleh di TKP serta keterangan pihak keluarga korban dan lainnya.

AKBP ES ....

AKBP ES tertangkap bersama cicit mantan Presiden Soeharto, PA saat mengkonsumsi narkoba. “Bukan pengawal,” kata Ito. Selain itu, belum diketahui juga apakah ES adalah pemain baru atau lama dalam penyalahgunaan narkoba. “Selain pidana dikenakan juga disiplin kode etik,” katanya. ES, GN dan PA ditangkap polisi saat menggunakan sabu

Syamsul Mengaku ....

“Surya (saksi, red) sendiri yang bilang, biar tahu aja dia (Syamsul, red),” ungkap Syamsul mengenai ancaman dari Buyung Ritonga (ketika itu bendahara kas Pemkab Langkat saat Syamsul Arifin menjabat sebagai Bupati) kepada saksi Surya yang kemudian oleh saksi menyampaikan ancaman itu kepada Syamsul Arifin. Oleh Ketua Majelis Hakim mempertanyakan ancaman anak buah terdakwa itu kepada saksi, dan saksi mengatakan, dirinya tidak menjelaskan hal itu karena tidak ada pertanyaan menyangkut ancaman tersebut. “Benar yang mulia, seperti itu (yang disampaikan Syamsul, red). Tadi tidak saya sampaikan karena tidak ada pertanyaan tentang itu,” kata Surya yang pernah menjabat sebagai Kepala Badan Keuangan dan Kadis PU dalam pemerintahan Syamsul Arifin di Kabupaten Langkat. Menurut Syamsul Arifin, ancaman Buyung Ritonga itu karena dia pernah menegur Buyung Ritonga sebagai bawahannya, dan ancaman tersebutlah kemudian Buyung membuat data-data yang dikelola oleh Buyung sendiri tanpa sepengetahuan saksi Sur ya sebagai Kabag Keuangan Pemkab Langkat. Surya Djahisa dihadirkan sebagai saksi oleh Jaksa Penuntut Umum ( JPU) KPK selaku Kabag Keuangan dan Kadis PU yang anggaran dananya pernah dikeluarkan dan diduga diberikan kepada terdakwa yang tidak memiliki mata anggaran pada APBD Kabupaten Langkat. Dalam keterangannya di persidangan, Surya Djahisa mengakui, data-data mata anggaran yang diperlihatkan oleh penyidik KPK berdasarkan data yang diberikan Buyung Ritonga, kemudian diakuinya sebagai pengeluaran yang tidak memiliki mata anggaran pada APBD. “Hanya butuh waktu sehari untuk mengakui semua data-data yang diperlihatkan penyidik,” kata Surya menjawab pertanyaan penasehat hukum terdakwa, Abdul Hakim Siagian pada kesempatan bertanya pada saksi.

Jawaban Problem Catur, TTS Dan Sudoku

6 4 2 8 5 7 1 3 9

9 1 3 6 4 2 8 7 5

7 5 8 3 1 9 4 6 2

4 2 9 5 6 3 7 1 8

1 8 5 7 9 4 3 2 6

3 7 6 1 2 8 5 9 4

8 3 4 2 7 6 9 5 1

2 9 1 4 3 5 6 8 7

5 6 7 9 8 1 2 4 3


JEMBATAN Pining yang menghubungkan Pintu Rime-Pining lenyap disapu banjir Jumat (18/ 3) sekira pukul 00.00 wib dinihari. Ribuan jiwa masyarakat Pining terisolasi. laporkan permintaan beberapa anggota DPRD itu untuk dibelikan mobil Panther dengan membandingkan dewan di Asahan dan Deliserdang bisa mendapatkan fasilitas seperti itu,” kata Surya. Tetapi, entah bagaimana Buyung Ritonga telah mengeluarkan anggaran dana lebih dari Rp2 miliar untuk pembelian mobil Panther tersebut. “Saya tidak tahu, tibatiba sudah ada anggaran yang diambil dari beberapa pos untuk membeli beberapa mobil Panther,” terang Surya. Ketua Majelis Hakim menekankan, kenapa tidak dibuat saja mata anggarannya ke dalam APBD. “Kan panitia anggaran ada dari kalangan legislatif dan eksekutif,” kata Tjokorda Rai Suamba. “Saya tidak tahu yang mulia, tiba-tiba saja sudah ada uang untuk beli mobil itu yang diambil Buyung dari beberapa pos anggaran,” terang Surya. Bagaimana untuk menutupi uang kas daerah yang tidak ada mata anggarannya, tanya ketua majelis hakim. “Kami melakukan pemotongan dari SKPD termasuk honorer kami,” kata Surya. Sedangkan Abdul Hakim Siagian meminta saksi Surya menjelaskan arti kata ‘selesaikan’ yang diucapkan Bupati kepada dirinya ketika mela-

porkan adanya pihak-pihak ketiga yang datang termasuk dari Pusat (Jakarta) seperti BPK pusat dan Perwakilan BPK Sumut. “Saya minta ke Buyung untuk menyelesaikan itu dengan memberi uang,” kata Surya mengasumsikan ‘selesaikan’ itu merupakan pemberian uang terhadap pihak ketiga. Abdul Hakim juga mempertanyakan, kata ‘diselesaikan’ ini dimaksudkan tidak lain dengan membayar atau profesional dengan tidak melanggar aturan atau hukum? “Berdasarkan kemampuan saya untuk membayar,” kata Surya mengatakan, pengeluaran kas daerah banyak tersedot dan diberikan kepada pimpinan dan anggota DPRD Langkat dan hal itu pula yang menjadikan Laporan Pertanggungjawaban (LPJ) Bupati Langkat Syamsul Arifin selama dua per i o d e s e l a l u d i t e r ima dengan baik oleh DPRD. Ketua majelis juga mempertanyakan apakah dalam setiap pemberian uang termasuk uang sebesar Rp4 miliar kepada terdakwa setiap diberikan dikonfirmasi ke terdakwa? Saksi Surya mengatakan, uang tersebut disampaikan melalui ajudan Bupati, Tukiman. “Ada juga, tapi tidak selalu. Pak sudah pak, itu yang saya ucapkan. Tapi tidak ada

Delapan orang yang diduga penganut aliran sesat berhasil diselamatkan tim Polres Bireuen setelah berjibaku mencegah aksi anarkis. Polisi sempat melepaskan tembakan ke udara. Sementara Sekdes Jambo Dalam, Syarifuddin kepada Waspada, Senin (21/3) mengatakan, perangkat desa telah mengeluarkan surat keterangan dan pemberitahuan tentang aktivitas Aiyub selama ini. “Kemarin malam kami datang mengingatkan untuk mematuhi beberapa larangan, malahan kami dicaci maki, lalu kami laporkan mereka ke polisi dan terjadilah tindakan yang sama-sama tidak kita inginkan ini,” kata Syafruddin. Diamankan Delapan orang yang diduga menjadi anggota aliran sesat dan sudah diamankan polisi, adalah Aiyub, 43, dan Nabhani, keduanya warga Desa

Pengikut Aliran ....

Jambo Dalam, Fauzi warga Peusangan, Bukhari warga luar Pandrah. Ishaq dan Zulkifl, Sulaiman, 55, warga Lhok Mane, Pandrah, Murhaban warga Cureh Baroh. Tiga sepeda motor yang dibakar yaitu Supra X milik Zulkifli dan Suprat X milik Bukhari, mobil pick-up milik Fauzi. Sementara sepedamotor Suzuki Smash yang dibakar milik Murhaban. Difitnah Aiyub dan pengikutnya yang ditemui Waspada di mushalla Mapolres Bireuen, Senin (21/3) mengatakan, ia dituduh menyebarkan aliran sesat dan dituduh menginjak-injak AlQuran. Selain itu dituduh memiliki air nasrani, shalat hanya tiga waktu dan mendapat gaji Rp18 juta per bulan dari Amerika Serikat, serta tidak melaksanakan shalat Jumat dan tuduhan lainnya. “Tuduhan mereka tidak mendasar dan saya siap bersumpah di pengadilan nanti,”

kilahnya membela diri. Hal sama disebutkan Nurfatriah, 25, anak Sulaiman didampingi ibunya Hafnidar, 50. Menurut mereka, semua itu fitnah dari orang-orang yang tidak bertanggungjawab. “Abu kami dituduh menganut aliran sesat, padahal setahu kami Abu tidak seperti yang mereka tuduhkan.Itu semua fitnah,” kata Nurfatriah sambil terisak.Dia menambahkan, orangtuanya melaksanakan shalat sebagaimana orang lain, begitu juga shalat Jumat tidak ada perbedaan. “Keluarga kami difitnah dan kami semua menderita dan sengsara, sekarang gara-gara difitnah seperti ini,” tambah Nurfatriah. Sementara Kapolres Bireuen, AKBP HR Dadik Junaidi melalui Wakapolres Bireuen, Kompol Armani. S.SIk mengatakan, pihaknya sudah mengamankan delapan orang yang diduga menganut aliran sesat. (amh)

Polisi Abdya ....

Kec . B a b a h R o t m e n u j u Trangon untuk melakukan penghadangan. Sesampainya di tikungan PT Juya Aceh Mining yang berada di km 4, personel Sat Norkoba yang mengendarai mobil Escudo berpapasan dengan mobil Kijang Innova yang dicurigai itu. Polisi langsung memerintahkan mobil yang dihadang itu berhenti tetapi sopir tetap melaju. Personel Sat Narkoba pun melakukan pengejaran sambil melepaskan tembakan peringatan ke udara sebanyak tiga kali, dilepaskan Kasat Narkoba Ipda T Zia Fahlevie. Tapi tak dihiraukan, bahkanmereka makin tancap gas sehingga kejar-kejaran terjadi. Setelah dikejar dalam jarak dekat, Sat Norkoba Polres Abdya memutuskan menembak ban kanan bagian bela-

kang mobil hingga meledak. Namun, mobil tak juga berhenti. “Mobil itu baru berhenti tepat di depan rumah makan Citra Ayu dekat Mapolsek Babah Rot. Di situlah kita berhasil menyergapnya, sekitar jam 12:30,” kata Zia. “Saat pertama kita buka pintu mobil, nampak 12 goni besar berisi ganja dana satu tersangka yang tidak lain adalah sopir mobil itu,” ujarnya. Saat berlangsungnya interogasi di Tempat Kejadian Perkara (TKP) terhadap tersangka berinisial JM, warga Kab. Gayo Lues, diketahui kalau ada tersangka lain yang sengaja diturunkan di tengah jalan, sebab mengetahui upaya mereka sudah tercium pihak berwajib. “Kemudian kita perintahkan anggota menjemput ter-

sangka berinisial MD, dengan menumpang mobil L 300 agar tersangka tidak curiga. Tersangka kita tangkap tepat di depan PT Waja Niaga sekitar jam 13:00,” jelasnya. Tersangka JM, warga Kab. Gayo Lues dan MD, warga Blangkejeren berikut barang bukti 12,5 goni besar ganja kering (205 Kg) serta mobil kijang Innova BK 1002 JS, plus sebilah senjata tajam jenis golok panjang, diamankan di Mapolres Abdya guna pengusutan lebih lanjut. “Dari pengakuan ke dua tersangka ini adalah kali ke tiga mereka menyelundupkan ganja kering ke Medan dan Kabanjahe. Dua kali lolos lewat jalur Kutacane, kali ke tiga karena alasan longsor mereka lewat jalur Abdya dan berhasil kita gagalkan,” tegas Zia. (sdp)

Hakikat Dunia ....

jamaah. Tetapi akhir hayatnya i a k e m b a l i k e Ko t a Tu s , Naishabur. Beliau meninggal di sana. Sebagai ilmuan besar di zamannya, Al-Ghazali mendapat rezeki yang begitu mudah. Beliau mendapat rezeki kiri kanan karena dihargai ilmunya. Ia merasa sudah sangat kaya raya sehingga hartanya berupa uang dan hadiah-hadiah sudah membuatnya tidak senang. Ia memutuskan untuk membagibagikan hartanya kepada fakir miskin di kota Baghdad. setelah itu ia pergi menga-

singkan diri dengan kesibukan dunia. Mengenai dunia, Imam Ghazali menyebutkan; Ketahuilah bahwa sesungguhnya dunia itu adalah musuh Allah SWT, musuh para wali-Nya, dan musuh para musuh-Nya. Dunia menjadi musuh Allah karena ia memotong jalan bagi wali-Nya. Karena itu Allah tidak memandangnya sejak ia diciptakan-Nya. Adapun dunia sebagai musuh para wali Allah, karena ia menampakkan keindahan pada mereka dan meliputi mereka dengan bunga dan kein-

dahannya, sehingga mereka meminum kepahitan kesabaran dalam memutuskan hubungan dirinya dengan dunia. Dunia ini juga musuh bagi musuh-musuh Allah, sebab dunia ini mengangkat mereka dari satu derajat ke derajat berikutnya dengan penipuannya dan menangkap mereka dengan jalannya, sehingga mereka percaya kepada dunia dan berpegang kepadanya. Lalu dunia ini menelantarkan mereka pada saat mereka sangat memerlukannya. ** ** **

RI Serukan ....

“Resolusi Dewan Keamanan PBB nomor 1973 yang disahkan pada 17 Maret 2011, jika ditetapkan secara ketat dan seutuhnya, membuka peluang bagi upaya perlindungan penduduk sipil,” tambahnya. Pemerintah Indonesia menekankan, perlu diciptakan kondisi kondusif bagi proses politik yang demokratis dan damai di Libya, agar terhindar dari terjadinya lingkaran kekerasan dan konflik, dan agar rakyat Libya dapat menentukan masa depannya sendiri secara demokratis, kata Menlu.

Kapolres Abdya AKBP Subakti melalui Kasat Narkoba Ipda T Zia Fahlevie, Senin (21/ 3) mengatakan, ganja kering Jawaban Problem Catur: tersebut berasal dari Kabupaten Gayo Lues dibawa mela1. ......, Bh4. lui jalur darat lintasan Abdya. Dikatakan Zia, informasi 2. b4, Bxb4. awal tentang adanya kasus 3. Rxh2, Bh4+mat. penyelundupan itu diterima dari personel Polsek Trangon Kab. Gayo Lues yang melakuJawaban TTS: kan razia-21. Menurut mereka, TTS Topik Politik & Hukum ada mobil Kijang Innova hitam A B O R S I D E A D L O C K BK 1002 JS menerobos pemeriksaan polisi dan melaju kenD E A O cang ke wilayah Polres Abdya. P S K A R M A V Setelah menerima laporan P L U T O K R A T L O itu, Satuan Narkoba Polres I P I I Abdya terdiri dari lima persoK D U P L I K S nel yaitu Syarif Amri, SinarudA N G K E T E O I din, Hulwan Miranto, Remon T B P B E S L A H dan Sofyan dipimpin Kasat, meluncur ke jalan lintas D A R U R A T E K B E A R M O N O P O L I Abdya-Gayo Lues, yakni di

Jawaban Sudoku:

Khusus Pining-Lukup Dan Pining-Pulo Tiga Tamiang, Satu Jembatan Hanyut

berikan jawaban. “Selesaikan,” kata Surya menirukan ucapan Bupati. Menurut Sur ya, pihak ketiga yang menerima uang dari kas daerah di luar mata anggaran APBD seperti pimpinan dan anggota DPRD Kabupaten Langkat. “Kalau tidak diselesaikan RAPBD kami sering berlarut-larut, dan rapatpun berpindah-pindah sampai ke hotel-hotel di Medan,” terang saksi. Karena tidak jelasnya RAPBD sebelum ada kejelasan pada anggota DPRD, saya merasa ini dapat mengganggu pekerjaan Bupati, sehingga saya memerintahkan Buyung Ritonga untuk menyelesaikannya. Termasuk soal pengadaan mobil Panther yang kini menjadi Panthergate itu, saat rapat membahas RAPBD dengan beberapa anggota DPRD di salah satu hotel di Medan, entah darimana pembicaraan pembahasan RAPBD, tiba-tiba anggota DPRD itu meminta mobil Panther. “Tidak semua anggota DPRD mendapat mobil itu. Tapi memang tidak ada dalam APBD,” kata Surya. Permintaan mobil Panther oleh DPRD Langkat, saya laporkan ke Bupati dan oleh bupati marah besar adanya permintaan itu. “Pak Bupati sangat marah waktu saya

Selanjutnya, Abdul Hakim Siagian mempertanyakan, apakah saksi selaku Kabag Keuangan dari tahun 2000-2003 pernah membuat data pengeluaran keuangan kas daerah kemudian melaporkannya kepada terdakwa?, oleh saksi Sur ya mengatakan tidak pernah. “Saya tidak pernah buat data pengeluaran, semuanya dikerjakan Buyung Ritonga,” kata Surya seraya menambahkan, seluruh data pengeluaran kas daerah merupakan catatan Buyung Ritonga yang diberikan pada penyidik (sebagaimana dalam dakwaan JPU catatan pengeluaran itu terdapat dalam buku agenda Buyung Ritonga). Syamsul Marah Selain tidak pernah melaporkan secara keseluruhan, baik pengeluaran kas daerah yang tidak terdapat mata anggaran APBD karena semua pengeluaran dilakukan oleh Buyung Ritonga termasuk pengeluaran melalui cek maupun giro, Syamsul Arifin juga pernah marah besar. “Cek dan giro hanya ditandatangani berdua, yakni Buyung Ritonga dan Bupati. Tadinya ada berlima setiap pengeluaran uang kas daerah, tetapi entah inisiatif siapa akhirnya hanya ditandatangani berdua saja,” kata Surya ketika JPU dan majelis hakim mempertanyakan inisiatif siapa pengeluaran uang kas daerah diubah dari lima orang menjadi dua orang. Namun demikian saksi mengatakan, setiap ada keperluan maupun permasalahan anggaran baik itu adanya permintaan pihak ketiga, dia hanya menyampaikan kepada bupati dan oleh bupati mem-

Dari Halaman Sport.


Jalan Gayo Lues Rawan Tanaman Ganja

Keterangan yang dihimpun, Yulizar F, warga Gampong Hilir Kec. Tapaktuan dan Jardi Kasman, warga Gampong Malaka Menggamat, Kec. Kluet Tengah, ditemukan warga tergeletak di pinggiran jalan Kotafajar-Menggamat, dalam kondisi mengenaskan, Sabtu (20/3) sekira pukul 00:10. Kedua korban mengalami luka gorok di leher dan diduga dibantai OTK. Namun Yulizar ditemukan dalam keadaan tak bernyawa, sedangkan Jardi dalam kondisi koma dan kritis. (b19) di Hotel MHR, Jumat (18/3) dan menyita barang bukti sabu seberat 0,88 gram saat menangkap ES, GN dan PA. Penangkapan pengguna narkoba tersebut berawal saat petugas menciduk JS di Plaza Semanggi, Jakarta Selatan, Kamis (27/3). Berdasarkan keterangan JS, polisi mengembangkan jaringan narkoba berinisial GN yang memasok barang kepada JS.

mengarang 98 kitab. Salah satu yang terbesar adalah Kitab Ihya Ulumuddin yang lagendaris. Ihya Ulumuddin telah diterjemahkan dalam 60 bahasa di dunia, termasuk bahasa Indonesia. Al-Ghazali menganut Mazhab Syafi’i, pernah tinggal di Mekkah, Madinah, Mesir, Baghdad dan Damaskus. Setelah berkarir sebagai dosen di Baghdad, ia memutuskan untuk uzlah ke sebuah desa di Damaskus (Suriah). Di sana dia tinggal di menara masjid untuk menjaga waktu shalat

WASPADA Selasa 22 Maret 2011

MEDAN (Waspada): Sekitar kawasan Jalan Pining-Lukup dan Pining-Pulo Tiga Aceh Tamiang, rawan tanaman ganja, demikian Bupati Gayo Lues H. Ibnu Hasim mengatakan. Berbicara di Medan kepada Waspada, Senin (21/3), Ibnu mengungkapkan, sudah berpuluh tahun pemberantasan tanaman ganja di sekitar kawasan jalan Pining-Lukup (Aceh Timur) dan Pining-Pulo Tiga (Aceh Tamiang) tak kunjung selesai. Padahal telah digelar berbagai jenis operasi baik oleh tim pusat, Polda Aceh maupun Polres Gayo Lues. “Tak hanya itu, pemerintah sendiri sudah berupaya melakukan pencegahan tanaman ini dengan memberikan jawaban pak Bupati,” kata Surya. Mengenai pengeluaran Rp8 miliar juga hakim menanyakan, apakah saksi turut menikmati uang diberikan kebeberapa orang pihak ketiga? “Ada sekadar buat makanmakan kami,” kata Surya yang disambut tawa para pengunjung sidang. Begitu juga pemotongan dana Pimpro saat saksi Surya Djahisa menjabat sebagai Kadis PU Langkat, mengatakan, pemotongan itu dihimpunnya karena sudah ada sejak dia belum menjadi Kadis PU. Usai sidang, Abdul Hakim kepada Waspada mengatakan, saksi hanya berdasarkan asumsinya atas perkataan ‘selesaikan’ dengan membayar. “Itukan asumsinya saksi, kenapa tidak diselesaikan secara profesional tanpa melanggar aturan. Inikan tidak pernah dipertanyakan pada Bupati,” kata Abdul Hakim. (j02)

Yusuf Laporkan ....

pernah berada didalam PKS, kemudian keluar dan kini mereka senang dengan kemajuan partai ini. Apakah petinggi partai itu resah dengan manuver Yusuf ini? “Tidak ada yang kami khawatirkan, ini hanya cara sekelompok orang yang tidak suka dengan PKS. Segala cara dihalalkan,” Ungkap Fahri Hamzah. (vvn)

Kompleks Rumah ....

yang kata mereka hancur akibat serangan rudal sekutu. Berjalan kaki sebentar dari sebuah tenda mencolok di mana Khadafi biasa menerima tamu-tamunya, terdapat bangunan tiga lantai yang runtuh dan lubang bulat terlihat pada bagian depannya. Para wartawan Reuters di Tripoli melaporkan, mereka mendengar ledakan pada malam hari sebelumnya dan melihat asap membubung dari arah kompleks Khadafi yang luas, yang menjadi tempat bagi rumah-rumah pribadinya serta barak militer dan instalasi lainnya. Namun, tidak ada asap yang mengepul dari gedung yang ditunjukkan itu pada Senin pagi, meskipun puing-puing dan lempengan beton berserakan. Para pejabat mengatakan, bagunan tersebut terkena rudal pada Minggu malam dan menuduh kekuatan Barat

penyuluhan dan bantuan program ekonomi, namun tanaman ini tetap masih ada,” ujar Ibnu. Teranyar, menurut Ibnu, dua hari lalu Polres Gayo Lues, berhasil menemukan ladang ganja di sekitar kawasan rawan tanaman haram itu seluas 7 hektar. “Saya sudah memberitahukan temuan ini ke bupati. Hanya saya ingatkan kendala di lapangan bahwa jalan di daerah rawan tanaman ganja ini sudah tidak bisa dilalui sama sekali,” sebut Kapolres Gayo Lues AKBP Eddy Junaidi SIK via telefon selular menguatkan keterangan bupati kepada harian ini kemarin. Menurut Eddy, dari Polsek Pining ke Desa Air Putih saja harus melewati jalan yang sulit. “Selain itu jembatan hanya satu itu pun sudah bergeser. Pokoknya kondisi yang harus dilalui menjadi kendala besar memberantas tanaman haram ini,” kata Kapolres singkat. Pernyataan Kapolres ditimpali bupati, “Kedua ruas jalan ini memang rawan terhadap tanaman ganja sulitnya pengawasan oleh aparat karena akses jalan kedua ruas ini belum dapat difungsikan kembali,” sebutnya. Ibnu mengaku kondisi ini sudah dilaporkan ke Kepala Dinas Bina Marga Cipta Karya, Ir. Muhyan Yunan MSc. “Pak Muhyan berjanji akan segera memperbaiki jembatan yang bergeser (jetty dibangun sekitar 2006 lalu dihantam banjir dua hari lalu-red) bersama jalan yang sama sekali tak berfungsi tersebut,” jelas bupati. Begitu pun menurut Ibnu, Kadis BMCK berharap agar kucuran anggaran ke Gayo Lues berlebih. “Ya mudahmudahan,” sebut bupati. Perlu dicatat, di kedua ruas jalan ini selain rawan tanaman ganja juga ditumbuhi hasil perkebunan warga. “Jadi pekebun, coklat, cabai, pinag dan kopi sudah pasti kesulitan memasarkan hasil perkebunannya. Seperti penuturan Aman Jarum salah satu warga asli di sana,” kata bupati. Saat kedatangan gubernur dan Pangdam Iskandar Muda

beberapa waktu lalu, Aman Jarum membeberkan kondisi kedua jalan yang rawan tanaman ganja tersebut. “Saya bilang sabar,” ungkap bupati. Mengakhiri keterangannya Ibnu Hasim berharap semua pihak terkait segera berupaya mengatasi kendala tersebut yang sudah jelas merupakan biang tanamanharam itu masih tumbuh subur di Gayo Lues dan menyebabkan ribuan warga di sana terisolasi. Satu Jembatan Lenyap Sementara kemarin di tempat terpisah Jemalul Hakim, salah satu pegiat LSM FAPPAR-RI menyebutkan akibat bencana nbanjir ribuan jiwa terisolasi karena jembatan penghubung antara Pintu Rime-Pining Lukup sepanjang 50 meter putus dihantam luapan Sungai Pining, Jumat pekan lalu. Banjir yang disebabkan hujan yang terus menerus melanda Kecamatan Pining, Kabupaten Gayo Lues itu, membuat masyarakat di sana terisolasi selama 3 hari. “Keadaan di Pining kritis akibat susahnya sembako masuk kedaerah itu, sementara masyarakat membekali diri apa adanya,” jelasnya. Menur ut Bupati Ibnu Hasim, Sekda sudah turun ke lokasi memberikan bantuan darurat dan beberapa alat berat PU setempat sudah diturunkan. Begitu pun bupati tidak membantah kondisi di sana. “Bantuan terkendala karena harus melewati jembatan sementara. Saya ingatkan jembatan yang baru harus lebih permanen karena jika tanggung air akan melimpah ke kiri dan kanan yang merupakan wilayah pemukiman,” pintanya mengingatkan. Pantauan Waspada Senin (21/3) puluhan kenderaan pribadi dan pengangkut sembako masyarakat terjebak di Kecamatan Pining dan tidak bisa lewat, masyarakat setempat membuat jembatan penyeberangan dari bambu di bawah reruntuhan Jembatan rangka baja yang ambruk dan sebagian masih tertinggal, sehingga masyarakat bisa menyeberang satu persatu. (m16/b35)

berusaha untuk membunuh Khadafi. “Ini bertentangan dengan pernyataan Amerika dan Barat ... bahwa tempat ini bukan target serangan mereka.” Ibrahim mengatakan, tidak ada orang yang terluka dalam serangan itu. Dia menolak untuk mengatakan apakah Khadafi masih berada di dalam kompleks tersebut. Di dekat kompleks, banyak loyalis Khadafi, yang diizinkan masuk kompleks sebagai perisai manusia terhadap kemungkinan serangan udara. Mereka meneriakkan slogan anti-Barat, termasuk “Obama harus dipenggal”. Di dalam kompleks, seorang prajur it tampak mengoperasikan senjata antipesawat terbang yang dipasang di sebuah truk pick-up dan sedang memperhatikan langit dengan saksama. Tentara dan milisi berkumpul di sepanjang kompleks besar berdinding hijau tersebut, beberapa menari dan menun-

jukkan tanda-tanda “V”, simbol kemenangan. Orang-orang menari dan lagu-lagu patriotik menggelegar dari pengeras suara di luar rumah yang han-cur dalam pemboman tahun 1986 terhadap kompkes itu oleh jet tempur AS. Rumah yang hancur sengaja dibiarkan sebagai sebuah situs simbolik anti-Barat bagi pendukung Khadafi. Beberapa orang, termasuk perempuan yang menggendong bayi, duduk di kasur yang digelar di atas rumput dan siap untuk berkemah hingga malam. Salah satu dari anak-anak itu memegang senapan mainan dengan laras berkedip. Banyak dari mereka mengatakan, mereka siap mati demi Khadafy. “Saya mencintai Khadafi. Dia ayah kami. Saya akan mati baginya,” kata Muatas, insinyur 45 tahun, saat ia melambaikan bendera hijau Libya. “Saya tidak takut, bah-kan jika sebuah roket jatuh dari langit saat ini.”(AFP/Reuters)

Berita Utama


Bawa Sabu Dari Malaysia Ditangkap Di T. Balai TANJUNGBALAI (Waspada) : Petugas pelabuhan penumpang Teluknibung, Tanjungbalai-Asahan, menangkap seorang ibu beranak dua berinisial C, 53, (foto) warga Ds. Jangka Alue, Kec. Jangka, Kab. Bireuen. Provinsi Aceh, dalam kasus membawa 200 gram narkotika jenis sabu, Senin (21/3) sekira pukul 19.00. Informasi dihimpun Waspada, tersangka yang berprofesi sebagai pebisnis barang impor, bertolak dari Pelabuhan Port Klang, Malaysia menumpang ferry Pacific Jet Star. Seperti biasa ketika akan keluar dari pelabuhan seluruh penumpang harus melewati pemeriksaan. Saat koper tersangka melewati alat deteksi (X-Ray) terlihat benda mencurigakan di layar komputer. Ketika diperiksa, di antara rongga koper tersimpan sabu dibungkus kertas aluminium foil.Selanjutnya, barang tersebut dibawa ke kantor berikut pemilikinya untuk dimintai keterangan sekaligus melakukan

pengujian terhadap benda kristalputihitudenganalat narcotest. Saat dimintai keterangan, tersangka mengaku tidak tahu menahu tentang sabu tersebut. Dia berdalih hanya dimintai tolong oleh temannya Edi juga warga Aceh yang tinggal di Malaysia untuk membawa koper dan akan diambil di Langsa beberapa hari mendatang dengan imbalan 50 ringgit atau sekitar Rp125 ribu. “Saya tidak tahu tentang benda itu, karena Edi hanya menitipkan barangnya saja. Selama sepulun tahun bekerja, baru kali ini saya lihat bentuk sabu, dan tidak pernah dijebak seperti ini,” ujar tersangka yang tetap membantah kepemilikan barang haram itu. Kepala Bea dan Cukai pelabuhan Teluknibung melalui Plh. Kasi P2 Edi W mengatakan, setelah melakukan tes laboratorium (narcotest), bubuk kristal itu positif narkotika jenis sabu (methamphetamine) dan diperkirakan total harganya men-

Waspada/Rasudin Sihotang

capai Rp500 juta. Sepekan sebelumnya, HC, 35, seorang wanita warga Kel. Batee Liek, Kec. Samalanga, Kab. Bireuen, ditangkap petugas karena membawa 118 gram narkotika jenis sabu, Senin (14/3) sekira pukul 19.30. Tersangka yang menyembunyikan barang haram itu di dalam celana juga mengaku tidak tahu barang yang dibawanya itu. (a32)

Pelajar SMP ... untuk menyemangati warga Jepang akan diserahkan kepada Kedutaan Besar Jepang di Jakarta. “Pesan-pesan tersebut akan kami serahkan. Insya Allah, Kamis nanti sudah diagendakan bertemu Dubes,” katanya. Rekan Muzailin, Zahrul Fuadi, juga dosen Unsyiah yang sedang mengikuti program doktoral di Tohoku University, Sendai, Miyagi ini menceritakan pengalamannya kepada para siswa. “Gempa di Jepang itu sudah biasa. Tapi warga Jepang sangat siap menghadapi keadaan bencana,” urainya. Para siswa seperti Muhammad Mukhtamar, Zulfami, Hesti Hartinah, serta Widi dan Suhela menyanyikan lagu serta membacakan puisi. Mereka juga berpesan, supaya warga Jepang, terutama Sendai di Pre-

Keberadaan Khadafi ... Seorang pejabat pemerintah Libya mengatakan gedung itu selama ini digunakan oleh para pejabat Khadafi. Namun tidak ada korban dalam serangan ke gedung tersebut. Gedung itu hanya 100 meter dari satu patung kepalan tangan emas yang meremukkan satu model pesawat, satu monumen bagi pengeboman Amerika ke Libya tahun 1986. Inggris mungkin bidik Khadafi Menteri Pertahanan Inggris Liam Fox mengatakan Khadafi mungkin menjadi target resmi dari aksi militer internasional yang dimulai Sabtu untuk memaksa gencatan senjata sesuai putusan Perserikatan Bangsa-Bangsa dan zona larangan terbang demi melindungi warga sipil. “Saya pikir adalah hal yang penting bila kita bergerak dalam mandat resolusi Dewan Keamanan PBB,” katanya kepada wartawan dalam penerbangan ke Rusia.Dia mengatakan intervensi militer didukung oleh “koalisi yang beragam” . Berakhir dengan cepat Intervensi militer internasional di Libya nampaknya akan berakhir ‘dalam tempo singkat (awhile). Tank-tank yang hangus terbakar dan kendaraan angkut militer terkapar di salah satu jalan utama gurun pasir yang menuju ke ibukotaTripoli. Satu pembangkit listrik yang terkena dalam serangan gelombang kedua masih

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Bh4. 2. b4, Bxb4. 3. Rxh2, Bh4+mat.

Jawaban TTS: TTS Topik


Politik & Hukum




Jawaban Sudoku:

6 4 2 8 5 7 1 3 9

9 1 3 6 4 2 8 7 5

7 5 8 3 1 9 4 6 2

4 2 9 5 6 3 7 1 8

1 8 5 7 9 4 3 2 6

3 7 6 1 2 8 5 9 4

8 3 4 2 7 6 9 5 1

2 9 1 4 3 5 6 8 7

5 6 7 9 8 1 2 4 3

Waspada/Munawardi Ismail

SUHELA dan Widi, dua siswi SMP 11 Lamjabat, Banda Aceh membacakan puisi dalam acara “Aceh Pray for Japan” Senin (21/3) di aula sekolah tersebut. fektur Miyagi tabah menghadapi cobaan tersebut. “Pesan kami, agar warga Jepang tabah menghadapinya seperti kami dalam keadaan terbakar. Sementara itu harga minyak berada di atas AS$102 per barel setelah gelombang kedua serangan sekutu atas negara anggota OPEC itu. Henri Guaino, seorang penasehat senior Presiden Prancis Nicolas Sarkozy mengatakan pengeboman selama dua malam berturut-turut dan serangan misil telah melumpuhkan pertahanan udara Libya, melumpuhkan pasukan Khadafi, namun serangan dihentikan karena khawatir akan mengenai warga sipil. Suatu perubahan dramatis terlihat di Libya, selama 10 hari, pasukan Khadafi telah mencatat rangkaian serangan kemenangan terhadap pemberontak di timur, mengusir para pejuang oposisi dari kota-kota penting dengan keunggulan pasukannya, seperti tank, artileri, pesawat tempur dan kapal perang. Mohammed Abdul-Mullah, seorang insinyur sipil berusia 38 tahun dari Benghazi, yang berperang dengan pasukan pemberontak, mengatakan pasukan pemerintah menghentikan semua perlawanan setelah kampanye internasional dimulai. (ap/cnn/bbc/ant/afp/rtr/m10)

RI: Akhiri ... Kementerian Luar Negeri Kuba menuduh negara Barat “atas terciptanya kondisi kondusif untuk agresi militer itu.” Pihak berwenang Kuba mengatakan, intervensi tersebut “berarti manipulasi bersama dari Piagam PBB dan kewenangan Dewan Keamanan PBB, dan menunjukkan“standar ganda yang sesuai dengan tingkah lakunya.” “Resolusi PBB 1973 yang diterapkan Kamis lalu oleh Dewan Keamanan tidak memberi wewenang apa pun dalam banyak serangan di wilayah Libya, yang berarti pelanggaran hukum internasional,” katanya. Dewan Keamanan PBB pada Kamis (17/3) bersepakat untuk membolehkan serangan udara guna menghentikan serangan pasukan Muamar Gaddafi terhadap pasukan pemberontak di Libya, menurut laporan AFP.

Pohon Tumbang ... Katanya, peristiwa itu juga menimpa Sri Palupi Ningsih, warga Jl. Karya Bersama olonia. Ningsih yang melintas mengayuh sepeda menderita luka serius di bagian kepala. Sri dievakuasi polisi ke RS Brimobdasu untuk mendapatkan pengobatan.Sedangkan, Mike, pengendara mobil Innova, juga menderita luka lecet. Petugas Dinas Pertamanan Pemko Medan yang mendengar informasi adanya pohon umbang dan memakan korban, langsung menurunkan anggota dan dibantu warga untuk melakukan pemotongan untuk menyingkirkan pohon tumbang tersebut. Akibat tumbangnya pohon itu, ruas Jl. Iskandar Muda macet total dan sejumlah Polentas turun mengatur arus lalulintas. Beberapa saat peristiwa pohon tumbang itu, Kota Medan diguyur hujan deras dan angin kencang. (m46)

dulu. Mereka harus tetap semangat dan meniti hidup yang lebih baik ke depan. Gambare,” ujar Nila, seorang siswa. Kepala SMP 11 Lamjabat, Dra. Hj. Liesyani, M.Pd yang ditemani Rukayah, S.Pd, menyambut baik simpati anak didiknya untuk warga Jepang. “Secara emosional, apa yang dirasakan anak-anak di Jepang, juga pernah dialami anak-anak di sini. Apalagi sekolah ini juga dibangun pemerintah Jepang,” katanya.(b05)

Pemprovsu Diminta ... Mereka yang mengaku menjadi korban kecurangan seleksi CPNS di Batubara, mendesak Pemprovsu mengambilalih pelaksanaan CPNS, dengan alasan mereka mencurigai ada indikasi kecurangan dan minta dilakukan kembali scanning terhadap Lembar Jawaban Komputer (LJK) peserta. “Kami adalah korban kecurangan seleksi CPNS di Batubara, kami berharap Gubsu merespon keinginan kami untuk melakukan scanning ulang dan tidak mengeluarkan NIP (Nomor Induk Pegawai-red) CPNS Batubara penerimaan tahun 2010,” tegas Koordinator Aksi Irwan Manik dalam orasinya. Dalam pernyataan sikap, mereka menilai telah terjadi pembodohan terhadap publik dengan melakukan scanning ulang tanpa melibatkan peserta ujian yang sudah berkali-kali protes dalam bentuk unjuk rasa. Padahal, ujar Irwan, dalam kesepakatan sebelumnya scanning ulang yang dilakukan pihak Universitas Indonesia (UI) sebagai mitra Pemkab Batubara dalam seleksi CPNS dilaksanakan dengan melibatkan peserta CPNS. Menanggapi hal ini, Kabid

Tanggapan Parpol ... Libya adalah negara yang berdaulat yang harus dihormati. Penyerangan ke Libya jelas terkait dengan kepentingan AS. ‘’Saya tidak percaya dengan demokrasi yang didengungdengungkan AS,’’ katanya. Hidayatullah, mengatakan Libya sekarang sedang mengalami konflik internal. ‘’Boleh saja internasionalmembantumenyelesaikan konflik itu. Tapi caranya bukan membombardir seperti yang dilakukan AS,’’ katanya. Peristiwa yang terjadi sekarang, kata Hidayatullah, jelas merupakan pembantaian terhadap umat Islam. Ini bisa berakibat buruk bagi perdamaian dunia. Karena dapat menimbulkan radikalisme pada umat Islam. ‘’Harusnya PBB (Perserika-tan Bangsa-Bangsa) mengutus negara-negara Islam untuk membantu menyelesaikan konflik Libya,’’ ujarnya. Kecaman terhadap AS juga disebutkan Wakil Ketua DPW PAN Sumut Muslim Simbolon. Dia bilang pengeboman terhadap Libya merupakan bentuk baru dari penjajahan negara-negara Barat. Muslim Simbolon, menyebutkan bohong besar bila AS dan sekutunya menyebut serangan yang dilakukan untuk menegakkan demokrasi. Malah sebaliknya, AS melakukan standar ganda tentang demokrasi. Wakil Ketua Pemuda Muhammadiyah ini mengatakan, cukuplah Irak dan Iran yang menjadi contoh dari prilaku tidak baik AS dan sekutunya.

kepadamajelishakimpadasidang kedua terdakwa di Pengadilan Negeri Jakarta Pusat pada Pengadilan Tindak Pidana Korupsi (Tipikor), di Jakarta, Senin (21/3). Ancaman tersebut diungkapkan Syamsul Arifin kepada Majelis Hakim dipimpin ketuanya Tjokorda Rai Suamba ketika mempersilakan Syamsul Arifin untuk bertanya kepada saksi Surya Djahisa (kini Sekda Kab. Langkat) dalam kesaksiannya pada sidang lanjutan terdakwa. “Surya (saksi, red) sendiri yang bilang, biar tahu aja dia (Syamsul, red),” ungkap Syamsul mengenai ancaman dari Buyung Ritonga (ketika itu bendahara kas Pemkab Langkat saat Syamsul Arifin menjabat sebagai Bupati) kepada saksi Surya yang kemudian oleh saksi menyampaikan ancaman itu kepada Syamsul Arifin. Oleh Ketua Majelis Hakim mempertanyakan ancaman anak buah terdakwa itu kepada saksi, dan saksi mengatakan, dirinya tidak menjelaskan hal itu karena tidak ada pertanyaan menyangkut ancaman tersebut. “Benar yang mulia, seperti itu (yang disampaikan Syamsul, red). Tadi tidak saya sampaikan karena tidak ada pertanyaan tentang itu,” kata Surya yang pernah menjabat sebagai Kepala Badan Keuangan dan Kadis PU dalam pemerintahan Syamsul Arifin di Kabupaten Langkat. Menurut Syamsul Arifin, ancaman Buyung Ritonga itu karena dia pernah menegur Buyung Ritonga sebagai bawahannya, dan ancaman tersebutlah kemudian Buyung membuat data-data yang dikelola oleh Buyung sendiri tanpa sepengetahuan saksi Surya sebagai Kabag Keuangan Pemkab Langkat. Surya Djahisa dihadirkan sebagai saksi oleh Jaksa Penuntut Umum (JPU) KPK selaku Kabag Keuangan dan Kadis PU yang anggaran dananya pernah dikeluarkan dan diduga diberikan kepada terdakwa yang tidak memiliki mata anggaran pada APBD Kabupaten Langkat. Dalam keterangannya di persidangan, Surya Djahisa mengakui, data-data mata anggaran yang diperlihatkan oleh penyidik KPK berdasarkan data yang diberikan Buyung Ritonga, kemudian diakuinya sebagai pengeluaran yang tidak memiliki mata anggaran pada APBD. “Hanya butuh waktu sehari untuk me-

ngakui semua data-data yang diperlihatkan penyidik,” kata Surya menjawab pertanyaan penasehat hukum terdakwa, Abdul Hakim Siagian pada kesempatan bertanya pada saksi. Selanjutnya, Abdul Hakim Siagian mempertanyakan, apakah saksi selaku Kabag Keuangan dari tahun 2000-2003 pernah membuat data pengeluaran keuangan kas daerah kemudian melaporkannya kepada terdakwa?, oleh saksi Surya mengatakan tidak pernah. “Saya tidak pernah buat data pengeluaran, semuanya dikerjakan Buyung Ritonga,” kata Surya seraya menambahkan, seluruh data pengeluaran kas daerah merupakan catatan Buyung Ritonga yang diberikan pada penyidik (sebagaimana dalam dakwaan JPU catatan pengeluaran itu terdapat dalam buku agenda Buyung Ritonga). Sebelumnya JPU KPK mengajukan dua saksi yang telah diambil sumpahnya sebelum sidang dimulai yakni, Sekada Kabupaten Langkat Surya Djahisa (saat Syamsul menjabat Bupati Surya pernah menjabat sebagai Kabag Keuangan dan Kadis PU Langkat, dan saksi Kabag Kepegawaian Kabupaten Langkat Amril), namun Amril tidak sempat didengar keterangan saksinya, karena kemarin, majelis hakim memiliki keperluan dan sidang akan dilanjutkan pada Senin (28/3) dengan menghadirkan saksi JPU yakni Amril dan empat saksi lainnya. Syamsul Marah Selain tidak pernah melaporkan secara keseluruhan, baik pengeluaran kas daerah yang tidak terdapat mata anggaran APBD karena semua pengeluaran dilakukan oleh Buyung Ritonga termasuk pengeluaran melalui cek maupun giro, Syamsul Arifin juga pernah marah besar. “Cek dan giro hanya ditandatangani berdua, yakni Buyung Ritonga dan Bupati. Tadinya ada berlima setiap pengeluaran uang kas daerah, tetapi entah inisiatif siapa akhirnya hanya ditandatangani berdua saja,” kata Surya ketika JPU dan majelis hakim mempertanyakan inisiatif siapa pengeluaran uang kas daerah diubah dari lima orang menjadi dua orang. Namun demikian saksi mengatakan, setiap ada keperluan maupun permasalahan anggaran baik itu adanya permintaan pihak ketiga, dia hanya menyampaikan kepada bupati dan

Pembinaan dan Pengadaan BKD Sumut Pandapotan Siregar menjelaskan, tidak ada aturan yang membenarkan Gubsu mengambil alih seleksi penerimaanCPNS di kabupaten/ kota. Selaku pihak yang ditunjuk sebagai koordinator penyelenggaraan CPNS di provinsi, Pemprovsu dalam hal ini Gubsu hanya bisa menyampaikan aspirasi tersebut kepada pemerintah pusat, baik itu kepada Badan Kepegawaian Nasional (BKN) maupun Kementerian Pemberdayaan Aparatur Negara dan Reformasi Birokrasi (Kemenpan RB). “ Yang berhak menentukan kelulusan seleksi CPNS adalah pembina kepegawaian di Pemda masing-masing, dalam hal ini gubernur untuk provinsi dan bupati/walikota untuk kabupaten/kota,’’ katanya. Kewenangan yang dimiliki Gubsu hanya sebatas koordinasi terkait tahapan dan jadwal pelaksanaan CPNS, merujuk peraturan Kepala BKN Nomor 30 Tahun 2010 tentang pelaksanaan seleksi CPNS. Terkait tuntutan tidak dikeluarkan NIP untuk CPNS Batubara, Pandapotan mengatakan, itu merupakan instruksi Menpan kepada BKN Regional

VI. Hal ini, katanya, merupakan kesimpulan dari hasil tinjauan tim yang terdiri dari Kemenpan dan BKN terkait permasalahan CPNS di Batubara. Datangi BKN Usai dari kantor Gubsu, puluhan peserta seleksi CPNS tersebut mendatangi Kantor Badan Kepegawaian Negara (BKN) Regional VI Jalan TB Simatupang. Mereka mempertanyakan dugaan manipulasi dan kecurangan rekrutmen CPNS. Ketika menyampaikan tuntutan mereka, para pengunjuk rasa sempat bersitengang dengan Kepala BKN Regional VI, karena dinilai tidak respons dengan nasib mereka. Para CPNS itu meminta BKN Regional VI segera mengusut indikasi kecurangan, salah satunya dalam penerimaan CPNS dan tidak mengeluarkan nomor induk pegawai atau NIP karena adanya indikasi kecurangan yang diduga dilakukan bupati. Setelah berorasi, Kepala BKN Regional VI menerima pendemo dan menyatakan pihaknya tidak pernah memutuskan atau menerbitkan NIP karena bukan kewenangan BKN RegionalVI melainkan BKN Pusat di Jakarta. (m28)

Dengan alasan demokrasi dan pelanggaran HAM, AS membombardir Irak dengan alasan negara itu menyimpan senjata pemusnah masal. Hal yang hampir sama juga terjadi untuk Iran. ‘’Buktinya sampai sekarang tidak terbukti,’’ kata Simbolon. Wakil Ketua PW NU Marahalim Harahap, juga tidak dapat menerima cara-cara yang dilakukan AS dan sekutunya terhadap Libya. ‘’ NU tidak pernah setuju dengan kekeran untuk menyelesaikan masalah,’’. Kata Marahalim, benar di Libya sekarang ini telah terjadi gejolak dan sangat diharapkan penyelesaian segera. ‘’Tapi bukan dengan cara-cara kekerasan,’’ katanya. OKI bersikap Untuk menghentikan serangan AS, ketiga anggota DPRD Sumut ini meminta negaranegara Islam tergabung dalam Organisasi Negara Islam (OKI) untuk bersikap. Yakni dengan mengeluarkan pernyataan mengecam tindakan pemboman dan melakukan dialog dengan Libya untuk menghentikan konflik yang terjadi. Ketua FPKS Hidayatullah, menyebutkan, OKI jangan diam saja seperti sekarang ini. Itu malah meyakinkan AS dan sekutunya kalau negara-nega Islam itu benar-benar lemah. Kecaman Alumni Libya Alumni Libya asal Sumut juga mengutarakan kecamannya terhadap tindakan pasukan koalisi yang dipimpin Amerika Serikat dengan melakukan peyerangan militer terhadap Libya, negara tempat alumni Libya menimba ilmu.

Ketua Kesatuan Keluarga Alumni Libya Sumut, Fazar Hasan melakukan aksi solidaritas dengan mengirimkan pesan singkat kepada anggota-anggotanya di Sumut dan Indonesia untuk melakukan sesuatu bagi para korban Libya, khususnya saudara-saudara mereka warga Libya yang pernah menyambut dan menerima mereka disana. Sementara itu, Sekretaris Kesatuan Keluarga Alumni Universitas Call College Libya, Munawwir, mengungkapkan, serangan pasukan koalisi terhada Libya yang dipimpin oleh Amerika Serikat hanyalah alasan untuk menghentikan Khadafi. Faktanya hal itu sudah menjadi rahasia umum karena ingin merebut minyak di negara itu .’’ Semua tahu bahwa Libya sangat kaya hasil minyaknya, dan negara Barat khususnya Amerika sangat ingin menguasainya,’’ katanya. Dia menambahkan, seharusnya Israel yang jelas-jelas melakukan pelanggaran hak azasi manusia tapi tidak ditindaklanjuti dengan penyerangan seperti di Libya, “Ini tentulah tamparan bagi islam dan bukti kalau Obama juga sama dengan pemimpin Amerika sebelumnya,” tambahnya. Terkait tindakan Khadafi yang menembaki para pemberontak, Afriansyah, mahasiswa Libya yang baru dievakuasi minggu kemarin mengungkapkan, tindakan Khadafi adalah keputusan yang terpaksa dilakukannya karena penyerangan dan penembakan dari Barat yang memprovokatori bentrok di Libya. (m12/csf)

Syamsul Mengaku ...

WASPADA Selasa 22 Maret 2011

oleh bupati memberikan jawaban. “Selesaikan,” kata Surya menirukan ucapan Bupati. Menurut Surya, pihak ketiga yang menerima uang dari kas daerah di luar mata anggaran APBD seperti pimpinan dan anggota DPRD Kabupaten Langkat. “Kalau tidak diselesaikan RAPBD kami sering berlarut-larut, dan rapatpun berpindah-pindah sampai ke hotelhotel di Medan,” terang saksi. Karena tidak jelasnya RAPBD sebelum ada kejelasan pada anggota DPRD, saya merasa ini dapat mengganggu pekerjaan Bupati, sehingga saya memerintahkan Buyung Ritonga untuk menyelesaikannya. Termasuk soal pengadaan mobil Panther yang kini menjadi Panthergate itu, saat rapat membahas RAPBD dengan beberapa anggota DPRD di salah satu hotel di Medan, entah darimana pembicaraan pembahasan RAPBD, tiba-tiba anggota DPRD itu meminta mobil Panther. “Tidak semua anggota DPRD mendapat mobil itu. Tapi memang tidak ada dalam APBD,” kata Surya. Permintaan mobil Panther oleh DPRD Langkat, saya laporkan ke Bupati dan oleh bupati marah besar adanya permintaan itu. “Pak Bupati sangat marah waktu saya laporkan permintaan beberapa anggota DPRD itu untuk dibelikan mobil Panther dengan membandingkan dewan di Asahan dan Deliserdang bisa mendapatkan fasilitas seperti itu,” kata Surya. Tetapi, entah bagaimana Buyung Ritonga telah mengelu-

arkan anggaran dana lebih dari Rp2 miliar untuk pembelian mobil Panther tersebut. “Saya tidak tahu, tiba-tiba sudah ada anggaran yang diambil dari beberapa pos untuk membeli beberapa mobil Panther,” terang Surya. Ketua Majelis Hakim menekankan, kenapa tidak dibuat saja mata anggarannya ke dalam APBD. “Kan panitia anggaran ada dari kalangan legislatif dan eksekutif,” kata Tjokorda Rai Suamba. “Saya tidak tahu yang mulia, tiba-tiba saja sudah ada uang untuk beli mobil itu yang diambil Buyung dari beberapa pos anggaran,” terang Surya. Bagaimana untuk menutupi uang kas daerah yang tidak ada mata anggarannya, tanya ketua majelis hakim. “Kami melakukan pemotongan dari SKPD termasuk honorer kami,” kata Surya. Sedangkan Abdul Hakim Siagian meminta saksi Surya menjelaskan arti kata‘selesaikan’ yang diucapkan Bupati kepada dirinya ketika melaporkan adanya pihak-pihak ketiga yang datang termasuk dari Pusat (Jakarta) seperti BPK pusat dan Perwakilan BPK Sumut. “Saya minta ke Buyung untuk menyelesaikan itu dengan memberi uang,” kata Surya mengasumsikan ‘selesaikan’ itu merupakan pemberian uang terhadap pihak ketiga. Abdul Hakim juga mempertanyakan, kata ‘diselesaikan’ ini dimaksudkan tidak lain dengan membayar atau profesional dengan tidak melanggar aturan atau hukum? “Berdasarkan kemampuan saya untuk memba-

yar,” kata Surya mengatakan, pengeluaran kas daerah banyak tersedot dan diberikan kepada pimpinan dan anggota DPRD Langkat dan hal itu pula yang menjadikan Laporan Pertanggungjawaban (LPJ) Bupati Langkat Syamsul Arifin selama dua periode selalu diterima dengan baik oleh DPRD. Ketua majelis juga mempertanyakan apakah dalam setiap pemberian uang termasuk uang sebesar Rp4 miliar kepada terdakwa setiap diberikan dikonfirmasi ke terdakwa? Saksi Surya mengatakan, uang tersebut disampaikan melalui ajudan Bupati,Tukiman.“Adajuga,tapitidak selalu. Pak sudah pak, itu yang saya ucapkan. Tapi tidak ada jawaban pak Bupati,” kata Surya. Mengenai pengeluaran Rp8 miliar juga hakim menanyakan, apakah saksi turut menikmati uang diberikan kebeberapa orang pihak ketiga? “Ada sekadar buat makan-makan kami,” kata Surya yang disambut tawa para pengunjung sidang. Begitu juga pemotongan dana Pimpro saat saksi Surya Djahisa menjabat sebagai Kadis PU Langkat, mengatakan, pemotongan itu dihimpunnya karena sudah ada sejak dia belum menjadi Kadis PU. Usai sidang, Abdul Hakim kepada Waspada mengatakan, saksi hanya berdasarkan asumsinya atas perkataan ‘selesaikan’ dengan membayar. “Itukan asumsinya saksi, kenapa tidak diselesaikan secara profesional tanpa melanggar aturan. Inikan tidak pernah dipertanyakan pada Bupati,” kata Abdul Hakim. (j02)

Picu Harga ...

ga membuat subsidi bahan bakar minyak melonjak dan menjadi ancaman dalam APBN 2011,” tuturnya. Kalau kondisinya begitu, Jhon Tafbu yakin AS untung tapi malah merugikan Indonesia. “Saya cuma tidak setuju Libya dijadikan ladang perang karena AS mau minyaknya. Perang hanya menguntungkan negara maju yang memproduksi senjata. Jika alasan menurunkan Khadafi karena demokrasi maka demokrasi tidak menjamin kemajuan ekonomi,” jelasnya. Pendapat senada juga muncul dari Vincent Wijaya. Pada prinsipnyadiamengatakanharga minyakakanterangkatolehperang di Libya. “Faktanya adalah para fund manager memanfaatkan itu sebagai ajang spekulasi saja. Kalau kita tarik ke persoalan demand dan supply itu sesuatu yang tidak mungkin.” Katakanlah Libya memasok minyak 1,6 juta barel atau sekarang menurun karena perang, jelasnya. “Mereka bukan kontributor utama pemasok minyak. Kalau pun negara mereka bergolak sebenarnya tidak akan terlalu banyak mempengaruhi stok minyak di negara-negara

OPEC (eksportir minyak). Hanya karena fund manager memanfaatkannya untuk ajang spekulasi. Wajar kalau kemudian minyak naik,” jelasnya. Selain ituVincent pun sepakat dengan yang disampaikan Jhon Tafbu soal demokrasi. “Di Libya itu secara ekonomi sudah baik. Rakyatnya hidup lebih makmur. Di sana yang kurang hanya kebebasan berpendapat (demokrasi).” Dia berasumsi sebenarnya tidak masalah demokrasi kurang berjalan asal ekonomi terpenuhi. “Bayangkan kalau nanti Khadafi jatuh lalu pemerintahan diambilalih dengan demokrasi dan kebebasan bersuara lebih terbuka. Tetapi kemudian ekonomi dan kesejahteraan masyarakat merosot,” tuturnya. Irak saja yang sudah begitu lama selesai perang sampai sekarang belum stabil, jadi seharusnya kalau ekonomi baik tidak perlu terlalu banyak menuntut agar keran demokrasi dibuka lebar, kata dia. “Itu hanya akan dimanfaatkan Barat menyerang danmenguasaiminyakLibya.Jadi lebih baik ekonomi sejahtera daripada demokrasi berjalan tapi perut tak terisi,” tuturnya.(m06)

Analisis ekonomi versi AP menyebutkan kalau perang berkepanjangan, harga minyak bisa naik di atas 140 dolar AS per barel seperti yang terjadi di 2008. Apalagi Khadafi sudah mengisyaratkan kekuatan barat tidak akan pernah mendapatkan minyak Libya dan menyarankan tentaranya untuk menyabotase instalasi minyak. Para pedagang mengkhawatirkan statement Khadafi tersebut. Kondisi yang terjadi atas harga minyak dibenarkan Jhon Tafbu. Dia mengatakan AS sebenarnya mengharapkan serangan ke Libya sebagai stimulus bagi perekonomiannya. “Biasanya ekonomi AS akan tumbuh karena perang. Itu seperti perang Vietnam dan perang merekadiTimurTengahera1970an. Cuma perang di Irak beberapa waktu lalu membuat AS rugi karena terlalu lama,” jelasnya. Dengan ikut memerangi Libya ekonomi AS membaik dan mendorong mitra negaranya tumbuh lebih tinggi seperti Indonesia, jelasnya. “Masalahnya perang Libya dapat memicu kenaikan harga minyak sehing-

Teror ‘Bil Kitabah’ ... menjadi tenang, dapat memahami dan menjalankan ajaran agamanya dengan baik dan benar. Tapi dalam beberapa waktu kebelakangan ini, menurut yang ambe amat-amati,——sekadar meng amati saja tuan—-, metode dakwah ini ‘dipinjam’ sementara orang untuk memecah belah ketekunan dan ketenangan masyarakat dan umat, mengusik kerukunan dalam bermu’amalah dan beragama. Orangpun melakukan teror. Dalam mengembangkan ‘misinya’ ada orang mengembangkan terornya melalui teror ‘ billisan’ dengan melakukan provokasi, intimidasi, hasud dan fitnah dan al istghol bi ‘uyubin naas, mencari-cari kesalahan orang lain. Kemudian mengembang lagi menjadi teror ‘bilhal’ yakni melakukan kegoncangan dengan perbuatan tangannya melalui pencederaan bom yang kadang hingga merenggut nyawa. Dalam kurun waktu-waktu terakhir ini tuan, ‘metode’ itu meningkat lagi menjadi teror ‘bilkitaabah” yakni teror bom melalui buku-buku. Ini trend baru dan benar-benar baru. Masya Allah tuan, sudah segitunya sikap orang untuk menghancurkan dan memecah

belah sesame anak bangsa ini ,hingga buku yang tak berdosapun ikut jadi korban. Bagi ana tuan, ada hal yang menjadi efek panjang dari sebuah teror ‘bilkitabah’ ini, antara lain, bahwa dengan peristiwa ini orang diprovokasi agar ‘alergi’ terhadap buku-buku yang berkonotasi agama yang akhirnya- orangpun takut ketika melihat kitab-kitab yang bernuansa religi. Akhirnya jauh dan jahillah generasi kita dari pengetahuan karena kita tak lagi mau membaca. Jadilah generasi kita generasi ‘dungu’. Ujung-ujungnya tuan, umat kita yang punya ‘rapor’ tapi orang lain yang mengisinya. Ncek fahamkan?. Itulah yang paling kita khawatirkan. Afwan tuan kalau ana salah-salah amati. Ah—tudia nama hita,— kemanalah kita lagi—kata Allah,Fa aina tadzhabuun,-Ndak kemana lagi kalian pergi (bergerak),— bagi kita tidak ada kata lain, selain mengikut titahNya, Inni dzaahibun ila robbi sayahdiin, bahwa sesungguhnya tak ada tempat aku pergi kecuali menuju Tuhanku yang memberi petunjuk. Allah-Allah sejuk hati kita dengan membaca kitab Allah itu bukan menjadi takut karena terror bil kitabah.Membaca jugalah sohib, “Mulailah dari Alif untuk kemudian tidak behenti pada Ya,” begitu kata orang pandai.

Medan Metropolitan

WASPADA Selasa 22 Maret 2011


Pemko Akan Terbitkan Perwal Larangan Ahmadiyah MEDAN (Waspada): Pemko Medan segera menerbitkan peraturan walikota (Perwal) tentang larangan aktivitas Ahmadiyah di kota ini. Penegasan itu disampaikan Walikota Medan Rahudman Harahap setelah melakukan pertemuan Muspida Plus di Balai Kota, Senin (21/2). Hadir dalam pertemuan itu Walikota Medan Rahudman Harahap,WakilWalikota Dzulmi Eldin, Sekda Syaiful Bahri, Ketua UmumMUIMedan Mohd Hatta, Ketua Komisi Dakwah MUI Medan Zulfiqar Hajar, Kapolresta Medan Kombes Tagam Sinaga, Dandim 020/BS Medan Letkol Inf Haryanto, Kajari Medan Raja Nafrizal, Ketua DPRD Medan Amiruddin, Kajari Belawan dan KP3 Belawan. “Larangan Ahmadiyah sudah diatur dalam SKB Tiga Menteri. Untuk itu Pemko akan membuat Perwal tentang Pelarangan Ahmadiyah di Medan. Perwal ini sendiri berdasarkan hasil rekomendasi MUI dan Ormasormas Islam,” kata walikota dalam pertemuan itu.

Menurut Rahudman, ada beberapa pasal dan aturan sanksi sesuai saran Muspida Plus dalam pertemuan akan disiapkan dalam Perwal. Katanya, Pemko secara konsisten akan mengundang lagi Pimpinan Ahmadiyah Kota Medan untuk membahas Perwal ini agar semuanya bisa berjalan dengan baik. Sebelumnya, dalam pertemuan itu, pimpinan Ahmadiyah tidak hadir sehingga penerbitan Perwal ditunda sampai dilakukan pertemuan kembali. Hal ini bagian dari saran Kapolresta Medan. Menistakan Islam Seusai pertemuan, Ketua Komisi Dakwah MUI Medan KH Zulfiqar Hajar mengatakan aliran Ahmadiyah menistakan dan melencengkan agama Is-

lam. Untuk itu, jemaat Ahmadiyah diberikan tiga opsi yakni kembali pada ajaran Islam yang benar, membentuk agama baru diluar agama Islam, dibubarkan saja. Menurutnya, Ahmadiyah itu sudah jelas sangat menyesatkan dan melakukan penistaan agama Islam. Ahmadiyah harus dibubarkan, bukan dilarang menyebarkan. Tapi harus dibubarkan dari Kota Medan ini. Pimpinan Majelis Taklim Jabal Noor ini mengungkapkan jangan main-main dengan masalah Ahmadiyah, dan ini harus dibubarkan. Apapun ceritanya, ini bukan masalah kepercayaan, karena ini merupakan masalah penistaan dan penodahan agama Islam. “Apakah agama lain juga setuju kalau hal ini juga memperolok agama mereka. Tidak pastinya. Tapi kalau seandainya ini dianggap keyakinannya silahkan saja tapi jangan bawabawa agama Islam atau agama lain. Kalau mengaku Tuhannya

air pun tidak apa-apa, tapi jangan bawa-bawa Islam,” ungkapnya. Dia juga mempersilakan jemaat Ahmadiyah di Medan saat ini sekitar 400-an orang di Medan untuk membuat agama baru di luar agama Islam, namun tidak mengganggu agama lain. Untuk itu, pihaknya memberikan tiga opsi pada jemaat Ahmadiyah untuk bertobat kembali pada ajaran Islam yang benar, bentuk ajaran agama baru di luar Islam atau bubarkan Ahmadiyah. “Pak Rahudman sebagai walikota harus membuat aturan ini secara jelas. Nantinya akan kita dukung seperti pertemuan ini dengan unsur Muspida Plus. Kita akan meminta ini agar dibubarkan karena menyesatkan. Dalam aturannya nanti juga harus jelas dan tegas,” katanya. Masih beraktivitas Sementara itu, Ketua MUI Medan Mohd Hatta menilai ajaran agama Ahmadiyah dilarang beraktifitas di Medan. Karena menurut laporan kegiatan-ke-

giatannya masih berjalan yang ditandai dengan kegiatan-kegiatan pengajian yang dilakukannya dengan mendatangkan guru-guru dari tempat lain. “Kemudian, masih saja melaksanakan kegiatan-kegiatan di masjidnya dengan melanggar SKB tiga menteri yang kita lihat berpotensi menimbulkan konflik di Kota Medan. Oleh sebab itula, kami merekomendasikan agar Kota Medan ini dilakukan pelarangan secara resmi oleh pihak pemerintah,” ungkapnya. Selain itu, Dandim 0201/ BS Medan Letkol Inf Haryanto juga menyarankan agar produk hukum berupa Perwal nantinya yang diterbitkan harus mengatur secara jelas sanksi dan pasal-pasalnya. Selain itu, tambahnya, dalam aturan hukum yang dibuat juga harus dipertimbangkan action atau bentuk konkrit dari aplikasi di lapangan dengan mengatur jelas siapa dan apa memiliki tugas nantinya. (m50)

CBD Dinyatakan Tak Salahi Aturan MEDAN (Waspada): Setelah berpolemik sekian lama, akhirnya pernyataan mengejutkan tentang keberadaan Central Business District (CBD) keluar juga dari sejumlah instansi terkait, yakni kehadiran ratusan bangunan di eks Lapangan Golf Polonia tidak menyalahi aturan. DPRD Sumut pun tidak mampu lagi bersuara lantang. Kemarin, Komisi D DPRD Sumut kembali melakukan rapat dengar pendapat membahas masalah CBD. Rapat yang dipimpin Ketua Komisi D Maratua Siregar hari itu sangat lengkap. Semua pihak yang diundang, hadir. Termasuk pihak CBD, yang pada beberapa kali rapat sebelumnya tidak mau datang. Anggota dewan yang hadirpun hampir lengkap. Pihak PT Angkasa Pura II yang hadir hari itu Yohannes Gafar. Ada juga Kepala Lingkungan Hidup Sumut Hidayati, Kepala Badan Lingkungan Hidup Medan Purnama Dewi, Administrator Bandara (Adban) Polonia Razali Abubakar, Dinas Tata Ruang dan Tata Bangunan ( TRTB) Medan Jhon Elise.

Sedangkan pihak CBD, hadir langsung Direktur Jhon Herry. Semua pihak pada pertemuan itu mengatakan kehadiran CBD tidak menyalahi aturan. Pihak TRTB misalnya, mengatakan bahwa mereka telah menerbitkan Surat Izin Mendirikan Bangunan (SIMB) untuk 738 unit bangunan di tanah seluas 33 hektare lebih. Prosesnya juga sudah benar. Salah satunya, sudah ada izin perubahan peruntukkan dari DPRD Medan. Kepala Badan Lingkungan Hidup Medan Purnama Dewi, juga mengatakan hal yang sama. Singkatnya, dia bilang bahwa CBD dinyatakan layak dari segi penataan ruang. Dari segi Kawasan Keselamatan Operasional Penerbangan (KKOP), dijelaskan pihak Adban Polonia Razali Abubakar, juga tidak mengganggu. Katanya, ada dua hal yang sangat penting dari keberadaan CBD terhadap keselematan penerbangan. Jarak lokasi CBD dari landasan pacu dan ketinggian bangunan. Dijelasakan Razali Abubakar, keberadaan CBD saat ini

tidak mengganggu karena letaknya lebih 150 meter dari landasan pacu. Sedangkan untuk ketinggian, tidak boleh lebih tinggi dari radar yang ada di sekitar Bandara. Yakni lebih dari 15 meter. Sementara tinggi bangunan CBD tidak sampai 14 meter. Yang lebih mengejutkan lagi adalah pernyataan pihak PT Angkasa Pura II. Pada pertemuan sebelumnya, instansi inilah yang paling ‘ngotot’ menyebutkan kalau keberadaan CBD mengganggu. Tidak saja keselamatan penerbangan, tapi juga dari segi keamanan. Sampaisampai mereka mencemasnya adanya penembak jitu dari gedung CBD. Tapi, pada pertemuan kali ini, pihak Angkasa PuraYohanes Gafar melunak. Dia malah bilang, kalau pihaknya tidak mempunyai kaitan langsung dengan semua hal yang akan timbul. Apakah menyangkut keamanan, maupun keselamatan penerbangan. Pihak Angkasa Pura hanya mengajukan pertanyaan yang sangat ringan, yakni siapa yang bertanggungjawab bila terjadi

masalah. Misalnya ada pihak yang melompat pagar CBD atau adanya penembak jitu dari kawasan CBD yang diarahkan ke Polonia.‘’Karena jaraknya masih memungkinkan,’’ kata Yohanes Gafar. Mendengar penjelasan seperti itu, personil Komisi D DPRD tidak bisa bereaksi keras. Malah seorang anggota Budiman Nadapdap, mengatakan kalau rapat hari itu berbeda dengan rapat sebelumnya. Katanya, dalam rapat dengar pendapat selama ini hampir semua yang hadir menyerang CBD. ‘’Tapi setelah pihak CBD datang, masalahmenjaditerang,’’katanya. Anggota dewan lainnya pun mengatakan hal yang sama. Malah seorang anggota Komisi D Jhon Hugo Silalahi menyesalkan sikap pihak-pihak yang selama ini ‘menyerang’ CBD yang tidak melanggar prosedur. Sementara bangunan yang jelas-jelas masuk dalam KKOP dibiarkan terus berdiri. ‘’Itu, Hotel JW. Marriott dan Cambridge. Tetap saja berdiri,’’ katanya. PT AP ‘cuci tangan’ Setelah dapat memaklumi

Vierra Band Semarakkan Malam Pesona Bank Sumut Di PRSU MEDAN (Waspada): Vierra Band yang tampil memukau di Malam Pesona Bank Sumut sukses menyemarakkan PRSU (Pekan Raya Sumatera Utara) ke-40, Sabtu malam (19/3). PenampilanWidi Cs melantunkan tembang-tembang hitsnya menjadi daya tarik puluhan ribu pengunjung yang memadati panggung utama PRSU. Malam itu, Widi cs tampil all out menghibur para fans dan pengunjung PRSU. Pengunjung tak henti-henti bergoyang dan bernyanyi bersama mengikuti lirik lagu yang dibawakan Widi.

Tak heran jika antusiasme pengunjung yang dipadati kawula muda metropolis dan pengunjung yang membawa keluarga ‘terbayar lunas’ saat Vierra Band melantunkan tembang diantaranya, Rasa Ini, Perih dan Seandainya. Pada Malam Pesona Bank Sumut dihadiri beberapa pejabat teras Bank Sumut diantaranya, Kepala Divisi Syariah Bank Sumut Didi Duharsyah, Pimpinan Bank Sumut Cabang Medan, Kepala Cabang Bank Sumut Syariah dan Ketua PRSU Panusunan Pasaribu. Bank

Sumut juga menggelar berbagai games kepada pengunjung PRSU dengan beragam souvenir menarik. Menurut salah seorang pengunjung PRSU Santi didampingi Syaifullah, penampilan Vierra Band di Malam Pesona Bank Sumut membuat suasana semakin semarak dan kemeriahan pelaksanaan PRSU yang di buka Menteri Perikanan dan Kelautan RI Fadel Muhammad tersebut. Mengingat artis ibu kota yang ditampilkan Bank Sumut sudah sangat populer dan tembang-tembang hitsnya su-


PENONTON antusias menyaksikan penampilan Vierra Band di panggung utama PRSU pada Malam Pesona Bank Sumut, Sabtu (19/3) malam.

dah sangat awam sehingga tak asing lagi di telingan masyarakat. “Malam ini benar-benar spesial dan semaraklah. Jadi pengunjung merasa puas meskipun penuh sesak untuk dapat menyaksikan langsung Vierra Band. Apalagi, saat Widi naik di atas pentas dan menyapa masyarakat Medan yang sudah tak sabar mendengarkan lagu-lagu yang mereka bawakan,” kata Santi. Spesialnya Malam Pesona Bank Sumut itu juga tak terlepas dari dukungan yang diberikan Pemerintah Propinsi Sumut, Pemko Medan, PRSU dan aparat keamanan yang turut mensukseskan terlaksananya dengan tertib penampilan Vierra Band. Vierra Band merupakan band papan atas ibukota yang digawangi Widi (vocal), Trian (drum), Kevin (kibord), dan Raka (gitar). Kehadiran artis ibukotaVierra Band tak terlepas dari apreasiasi Bank Sumut sebagai sponsor utama untuk menyuguhkan hiburan yang spesial bagi masyarakat dan pengunjung PRSU. Tahun sebelumnya, Bank Sumut yang digawangi Direktur Utama Gus Irawan ini juga menghadirkan sejumlah artis papan atas ibukota di PRSU. (cwan)

Sutias Handayani Gatot:

Saya Harus Siap Dengan Segala Situasi MENJELANG naiknya posisi Wakil Gubernur Sumut Gatot Pujonugroho menjadi Penjabat (Pj) Gubernur Sumut selalu saja ada yang ingin ditelisik wartawan. Termasuk persiapan sang istri, Sutias Handayani Gatot. “Jangan ditanya saya siap atau nggak siap dong. Memangnya kalau saya nggak siap, Bapak harus cari istri yang sudah siap? ujar Sutias seraya tertawa saat berbincang dengan sejumlah wartawan di kediamannya, Sabtu (19/3). Dalam perbincangannya dengan para wartawan tersebut, Sutias meminta agar pertanyaan diganti dengan bagaimana persiapan dirinya dan keluarga menjelang Wagub menjadi Pj Gubernur Sumut. Ibu 5 putri ini menuturkan sama sekali tak ada persiapan khusus. Karena selaku istri seorang politisi, dia harus siap dengan segala situasi, baik situasi naik ataupun menurun. Sebagai istri politisi, lanjut Sutias, dia selalu menekankan kepada lima anak-anaknya agar siap dengan segala kesibukan Abi (ayah-red). Efeknya, sejak menjadi Wakil Gubernur Sumut, seluruh anak-anaknya bisa memahami jika pimpinan keluarga tak punya banyak waktu di rumah, karena harus memimpin orang banyak. “Dulu kita bisa sering makan bersama, tapi sekarang jadwal makan bersama bisa dihitung dalam sepekan. Saya selalu tekankan kepada anak-anak bahwa Abi kita bukan milik kita lagi seutuhnya,

tetapi milik orang se Sumatera Utara. Saat makan saya sering ingatkan anak-anak, nasi kita ini bukan Abi yang kasih. Tapi rakyat yang kasi. Jadi, kita harus rela. Kalau rakyat minta Abi kita, ya kita harus siap,” ujarnya. Selain bisa mengatasi persoalan anak-anak, sambung Sutias, seorang istri juga dituntut untuk mampu membantu mengatasi persoalan suami. Termasuk dalam hal mengatur pertemuan berkualitas bagi keluarga. “Sekarang kan sudah banyak alat komunikasi. Ada handphone dan banyak lagi pilihan komunikasi. Jadi, tidak terlalu sulitlah untuk mengatur kualitas pertemuan dan komunikasi,” katanya lagi. Saat disinggung tentang besarnya peranan istri dalam mempengaruhi suami untuk melakukan korupsi, mantan anggota DPRD Deli Serdang ini membantah. Karena menurutnya hal tersebut sangat ditentukan oleh kualitas pribadi dan kualitas keimanan masing-masing. Terpenting menurut Sutias, adalah bagaimana bisa memberikan pengaruh dan pembelajaran untuk menjaga kualitas keimanan. Karena ketika keimanan dijaga, maka kualitas diri juga terjaga. Untuk itu keluarganya biasa belajar antara satu dengan yang lain. Ada kalanya istri belajar dari suami, ada kalanya mengambil pembelajarandarianak-anakbahkanadakalanyabisaikutmemberipembelajaran kepada suami dengan cara yang tidak sombong. (m28)

penjelasan pihak-pihak terkait, serangan dewan hari itu tidak lagi kepada pengelola CBD, tapi dialihkan ke PT Angkasa Pura II. Anggota Komisi D Analisman Zalokho menyebutkan, PT Angkasa Pura ‘cuci tangan’ dalam masalah ini. Kata Analisman Zalokho, dalam beberapa kali pertemuan dengan dewan, PT Angkasa Pura yang sangat ngotot menyebutkan keberadaa CBD membahayakan. Sampai-sampai Komisi D melakukan kunjungan ke lapangan. Tapi, katanya, pada hari ini pernyataan pihak Angkasa Pura berbeda. ‘’Maaf, saya menyebut, Angkasa Pura cuci tangan,’’ katanya. Tentang kemungkinan kerawanan munculnya dari kawasan CBD, rapat dengar pendapat hari itumemintapihakCBDmemagar lokasinya dan menempatkan petugas keamanan. (m12)

Waspada/Anum Saskia

KABID Dikmenjur Dinas Pendidikan Kota Medan Marasutan Siregar didampingi Kasi Teknis SMA/SMK Sugerno berbincang dengan Wakil Kordinator Perguruan Eria Rukzaidan, Kepala SMA Eria Khoiruddin DAN Pengawas Sekolah Hotnasari Nasution saat meninjau pelaksanaan UAS.

UAS SMA/SMK Eria Lancar MEDAN (Waspada): Pelaksanaan Ujian Akhir Sekolah (UAS) siswa SMA/SMK, Senin (21/3), berjalan lancar. Kegiatan ujian yang ditinjau langsung oleh Kepala Dinas Pendidikan Kota Medan Hasan Basri diwakili Kabid Dikmenjur Marasutan Siregar dan Kasi Teknis SMA/ SMK, Sugerno, Pengawas Hotnasari Nasution didampingi Kordinator Perguruan Eria Rukzaidan dan Kepala SMA Eria Khoiruddin. Khoiruddin menyebutkan pelaksanaan UAS di sekolah ini sengaja dilaksanakan menjelang bulan April untuk lebih memberi kesempatan pada siswa agar mudah beradaptasi dengan situasi ujian. Karena, setelah UAS beberapa minggu lagi akan berlangsung Ujian Nasional (UN). Dengan begitu, para siswa bisa fokus pada seluruh bidang studi yang akan diujikan karena tenggang waktu pelaksanaan ujian hanya berselang beberapa minggu saja. “Jadwal pelaksanaan ujian sudah kami atur demikian rupa, agar siswa punya persiapan yang mapan. Disamping itu, sebagai bentuk antisipasi kepada siswa, agar mereka tidak merasa tugas-tugasnya selesai setelah melewati masa UAS dengan ca-

kupan nilainya yang 60 persen. Pihak sekolah berharap, setelah UAS ini, para siswa semakin meningkatkan kemampuan dirinya untuk Ujian Nasional yang tidak lama lagi akan berlangsung,” kata Khoiruddin yang menyebutkan ada 281 siswa yang ujian menggunakan 15 ruangan. Wakil Kordinator Perguruan Eria Rukzaidan mengatakan, seusai kegiatan ujian, para siswa akan tetap hadir kesekolah untuk persiapan khusus jelang UN. Pihak sekolah sengaja membuat format ujian sekolah tidak terlalu jauh dari pelaksanaan UN, agar siswa tetap konsentrasi dan para guru akan terus memberikan bimbingan pada mereka. Bimbingan untuk bidang studi, bimbingan dan arahan agar menjaga kesehatan dan mengingatkan mereka tidak terpengaruh dengan issu jawaban soal. Ini selalu kami sampaikan. Kabid Dikmenjur Dinas Pendidikan Kota Medan Marasutan Siregar mengingatkan pihak sekolah untuk terus mengingatkan kemampuan siswa serta persiapan fisik dan mental menjelang berlangsugnya UN. Persiapan ini, kata Marasutan sangat penting agar

kesertaan siswa dalam UN berjalan dengan baik. Te r h a d a p p e n g a w a s , Marasutan berharap agar dalam pengawasan di sekolah tetap membuat laporan tertulis terkait program yang mendukung proses pembelajaran dari berbagai aspek. Utamanya, tentang keberhasilan sekolah yang diawasi dalam berbagai bidang. Dengan begitu, setiap laporang yang dikirim ke dinas pendidikan, akan ada data tentang kelebihan dan kekurangan masingmasing sekolah. Pengawas sekolah adalah perwakilan dinas pendidikan. Karena itu, laporan secara tertulis yang mereka sampaikan kepada dinas pendidikan terhadap sekolah-sekolah yang mereka awasi, akan dijadikan bahan kajian atau evaluasi terhadap sekolah tersebut. Misalnya di sekolah Eria ini, apa kegiatan unggulan, berapa jumlah siswa yang lulus mendaftar di Perguruan Tinggi Negeri (PTN) maupun Perguruan Tinggi Swasta (PTS).“Jika ada keunggulan akan diapresiasi, jika ada kekurangan akan dicarikan solusi bersama. Namanya lembaga pendidikan, kita berbuat untuk kemajuan dalam berbagai bidang,” kata Marasutan. (m37)

Medan Metropolitan A4 Baru 7 Pemda Cairkan BOS MEDAN (Waspada): Keterlambatan penyaluran dana Bantuan Operasional Sekolah (BOS) di kabupaten/kota akan dikenakan sanksi dan evaluasi oleh Menteri Pendidikan Nasional (Mendiknas), bahkan dana bantuan tersebut bisa distop bagi Pemda yang tidak komit terhadap penyaluran dana BOS. Hal tersebut disampaikan Kepala Dinas Pendidikan Provinsi Sumut (Kadisdiksu) Syaiful Syafri kepada Waspada, Senin (21/3), menindaklanjuti imbauan Gubernur Sumatera Utara melalui Wagubsu Gatot Pujonugroho yang menyatakan penyaluran dana BOS harus sudah dilakukan pada 21 Maret 2011. Syaiful menyebutkan, sampai saat ini baru tujuh kabupaten/kota yang sudah menyalurkan dana BOS tersebut ke sekolah-sekolah. Ketujuh daerah tersebut yakni, Mandailing Natal, Tebingtinggi, Labuhanbatu Utara, Serdang Bedagai, Toba

Samosir, Binjai dan Medan. “Informasi tersebut saya terima langsung dari bupati dan walikota daerah tersebut,” jelasnya. Bagi daerah kabupaten/ kota lainnya, lanjut Syaiful, diharapkan dapat segera menyalurkan dana BOS tersebut secepatnya, karena Gubsu melalui Wagub kembali membuat surat susulan No.900/2912 agar seluruh kabupaten/kota memahami dan melaksanakan percepatan pencairan dana BOS selambatnya hari ini Selasa (22/3). “Kita sangat prihatin, apabila akibat keterlambatan kita menyalurkan dana BOS ke ma-

Parsadaan Simatupang Muslim Terbentuk MEDAN (Waspada): Untuk lebih mengembangkan fungsi dan tugas Parsadaan Simatupang Muslim Boru Dohot Berena Medan telah membentuk susunan kepengurusan masa bhakti 2011-2013 diketuai Regen Syafruddin Simatupang, Wakil Ketua Salamuddin Simatupang dan Sekretaris Aman Muskhsin Simatupang. Menurut Syafruddin, Minggu (20/3), tujuan pembentukan kepengurusan agar Parsadaan Simatupang Muslim yang tersebar di Kota Medan untuk kesejahteraan dan kemajuan parsadaan. “Parsadaan Simatupang Muslim Boru Dohot Berena merupakan wadah empat berkumpulnya anggota yang bersatu serta ampuh dan dapat menangkal merebaknya arus budaya globalisasi yang menyimpang dari ajaran agama serta adat istiadat ketimuran,” ujarnya. Menurut Syafruddin, sesuai AD/ART Parsadaan ini berasaskan kekeluargaan, kebersamaan yang dijiwai oleh musyawarah dan mufakat, saling asuh, asih, asah dalam menjalankan cita-cita dan tujuan Persadaan yaitu masyarakat yang beradat serta melaksanakan ibadah seuai dengan ajaran Al-Quran dan Al-Hadits. Susunan pengurus Parsadaan Simatupang Muslim Boru Dohot Berena Sekota Medan masa bakti 2011-2013, Pembina H.Ismail Efendi Simatupang, hatobangon H.Ismail Efendi Simatupang, Ah.Abdulgani Siregar, H.Sinar Mulia Simatupang dan H.Hottob Harahap. (m24)

Nenek Warga Sari Rejo Hilang MEDAN (Waspada): Seorang nenek RA Nurhayati, 82, warga Jalan Cinta Karya Gg. Seram Kel. Sari Rejo Kec. Medan Polonia dilaporkan hilang oleh anaknya di Redaksi Harian Waspada, Sabtu (19/3) kemarin. Nurhayati yang sudah mengalami pikun (lupa ingatan) pergi dari rumahnya sejak, Senin (14/3) lalu. Anaknya M. Ideal menuturkan, Senin (14/3) pukul 18.00, seorang tukang becak mengantarkan orang tuanya ke rumahnya Jl. Cinta Karya Gg. Seram Kel. Sari Rejo Kec. Medan Polonia. Namun, karena tidak ada satupun orang yang di rumah,orang tuanya tersebut pergi keluar lagi entah kemana. “Kata tukang becak itu, ibu saya ini dari Kampung Baru. Dia nggak tinggal sama saya, tapi sama adik saya, waktu dia pulang itu, kebetulan nggak ada pula adik saya di rumah, saya juga sudah keliling-keliling cari ibu saya ini,” kata M. Ideal yang mengaku juga sebagai penarik bettor. Saat keluar dari rumah, lanjutnya, orang tuanya memakai baju putih liris-liris merah serta jilbab warna hitam. “Ciri-cirinya ibu saya ini agak bungkuk. Suah pikun. Saya mohon, bagi warga yang menemukan harap menghubungi saya di 085262643263.”harapnya.(h02)

Ustazah Di Medan Belum Memadai MEDAN (Waspada): Komisi Pemberdayaan Perempuan Majelis Ulama Indonesia (MUI) Kota Medan prihatin menyusul jumlah ustazah di Kota Medan tidak berimbang dengan pertumbuhan majelis taklim. Demikian disampaikan Ketua Komisi Pemberdayaan Perempuan MUI Kota Medan Rosmaini pada Pelatihan Peningkatan Kualitas Mubaligah dan Daiyah Kota Medan di Garuda Plaza Hotel Medan, Jumat (18/3). Pelatihan dilaksanakan sampai 20 Maret dan dibuka Ketua MUI Kota Medan Mohd. Hatta diikuti 43 peserta dari utusan MUI kecamatan se Kota Medan, majelis taklim, pengajian perempuan, BKMT dan organisasi kewanitaan Islam lainnya. Menurut Rosmaini, karena belum maksimalnya peran mubalig wanita itu, sehingga cukup banyak persoalan rumah tangga yang tidak mendapatkan jalan keluar terbaiknya sesuai tuntunan ajaran Islam. Rosmaini didampingi Burhan dan Julkarnain Sitanggang menyampaikan dengan pelatihan ini diharapkan persoalan terhadap mubalig perempuan untuk lebih aktif menyampaikan dakwahnya itu bisa meningkat secara kualitatif maupun kuantitatif. Pelatihan dengan tema “Dengan Peran Serta Daiyah dan Mubaligah Kita Tingkatkan Kualitas Dakwah di Kota Medan” diisi narasumber Ketua MUI Kota Medan. Mohd. Hatta, Sukirman, Syukur Kholil, Masri Sitanggang, Basyaruddin dan pemateri dari Jakarta Muhammad Nur. (m26)

sing-masing sekolah anggaran pendidikan di masing-masing kabupaten/kota diadakan evaluasi oleh Mendiknas. Bahkan besar kemungkinan bagi kepala daerah kabupaten/kota yang tidak komit terhadap penyaluran tersebut, bantuan BOS ke depan bisa distop oleh pusat,” tegasnya. Menurut Syafri, tidak ada alasan bagi Pemda tidak menyalurkan dana tersebut, karena sudah ada surat edaran serta petunjuk pelaksanaan (Juklak) maupun petunjuk teknis (Juknis) atau petunjuk operasional penyaluran dana BOS dari Kemendiknas. Katanya, dana tersebut sudah ditransfer dari rekening kas negara ke rekening kas daerah kab/kota pada 21 Januari 2011 lalu. Pemko telah teken Sekda Kota Medan Syaiful Bahri ketika dikonfirmasi terkait persiapan penyaluran dana BOS untuk sekolah di Medan mengatakan, pihaknya telah

menandatangani semua berkas soal dana penyaluran BOS untuk semua sekolah. Bahkan untuk sekolah negeri sudah disalurkan mulai hari ini (kemarin-red). Tapi kalau untuk sekolah swasta masih dalam proses, karena pihak sekolah belum melengkapi semua berkasnya. “Kalau untuk semua sekolah negeri sudah disalurkan. Sedangkan untuk sekolah swasta masih dalam proses. Pokoknya minggu ini semuanya tuntas,” ujarnya. Ada permainan Sementara itu, Ketua Komisi E DPRD Sumut Brilian Moktar saat diminta tanggapannya mengenai keterlambatan penyaluran dana BOS tersebut menyatakan, penyaluran dana BOS merupakan kewajiban bagi pemerintah kabupaten/kota kepada sekolah masing-masing. Oleh karena itu pemko/pemkab harus segera menyalurkan dana BOS tersebut, yang seharusnya

pada awal Maret ini sudah selesai. Harus tegas Brilian menegaskan, pemerintah kabupaten/kota harus tegas menyikapi surat edaran bersama Mendagri dan Mendiknas serta imbauah dari Gubernur untuk segera menyalurkan dana BOS tersebut ke rekening masing-masing sekolah pada Maret ini. “Apabila mereka belum juga menyalurkan, diminta kepada BPK maupun penegak hukum untuk memproses pejabat-pejabat terkait di daerah yang tidak mengindahkan perintah Mendagri maupun Gubernur Sumut,” tegas Brilian. Brilian menilai, keterlambatan penyaluran dana BOS ini diduga adanya ‘permainan’ Dinas-dinas Pendidikan kabupaten/kota yang terlambat menyampaikan berkas-berkas ke kabupaten/kota dengan alasan-alasan tertentu seperti perubahan nomor rekening dan sebagainya. (m41/m50)

Kasus CPNS Pemko Medan

Majelis Hakim Berikan Waktu 14 Hari Mediasi MEDAN (Waspada): Sidang perkara CPNS Pemko Medan kembali digelar Senin (21/3). Majelis Hakim Pengadilan Negeri (PN) Medan memberikan kesempatan kepada penggugat dan tergugat melakukan mediasi. “Kami berikan kesempatan 14 hari kepada para pihak melakukan mediasi,” kata Ketua Majelis Hakim Subiharta. Menurut Hakim, upaya mediasi merupakan bagian dari tahapan harus ditempuh para pihak dalam proses penyelesaian perkara perdata.“Upaya ini merupakan bagian ketentuan UU,” tegasnya. Menunggu hasil mediasi, majelis hakim menunda sidang hingga 11 April 2011. “Para pihak diminta hadir pada tanggal dan jam yang sudah disepakati, khususnya tergugat (Pemko Medan-red) agar hadir tepat waktu,” kata Subiharta mempertegas. Sebelum sidang ditutup, kuasa hukum penggugat dari LembagaBantuanHukum(LBH) Medan Irwandi Lubis, S.Munthe dan Suryadinata memohon kepada majelis hakim agar memerintahkan tergugat hadir lebih awal. Permohonan penggugat diterima mejelis dan meminta

agar kuasa hukum Pemko Medan Doni dkk hadir lebih cepat agar persidangan bisa digelar lebih cepat. “Saudara tergugat agar hadir tidak lewat pukul 10:00 Wib,” tegas majelis hakim sebelum menutup persidangan yang dihadiri puluhan korban kasus CPNS. Di luar persidangan, penggugat dan tergugat sepakat hari ini, Selasa (22/3) pukul 09:00, upaya mediasi dilakukan.“Tadi, di hadapan ibu panitera, kami para pihak sudah sepakat. Hari ini mediasi dimulai,” tegas Irwandi Lubis dan Suryadinata kepada Waspada. Seusai persidangan, Irwandi didampingi korban kecurangan rekrutmen CPNS mengatakan, dalam tahap mediasi pihaknya akan meminta Pemko Medan mengakomodir 17 orang korban CPNS, dimana pada awalnya dinyatakan lulus dan beberapa jam kemudian dinyatakan gagal.“Kami juga meminta perbaikan penyeleggaraan penerimaan CPNS yang transparan dan bebas dari permaianan uang, “ ungkapnya. Dikatakannya, jika Pemko tidak mengakomodir 17 korban CPNS tersebut, mereka akan mendesak agar Pemko dan Uni-

versitas Sumatera Utara (USU) untuk memperlihatkan dan membuka hasil perankingan ujian CPNS. “Jika memang ranking mereka menyatakan tidak lulus, maka kami akan terima. Tapi harus terbuka. Umumkan hasil perankingan itu,” ungkapnya. Salah seorang korban CPNS, Mardayanta Sembiring mengharapkan masalah CPNS ini diselesaiakan dengan cepat. Dirinya merasa yakin dengan hasil ujian yang diperolehnya. “Saya yakin dan pengumuman kelulusan itu sah, tapi kok esoknya tak masuk di koran,” ungkap wanita sedang hamil 8 bulan tersebut. Gugatan Citizen Lawsuit diajukan para korban melalui LBH karena adanya kebijakan pemerintah yang dianggap merugikan masyarakat. Dimana, 17 pelamar merasa dirugikan atas kebijakan Pemko pada 22 Desember 2010 yang mengumumkan hasil ujian CPNS. Dalam website resmi PemkoMedanyangdiumumkanpada mulai pukul 00.01, 17 peserta ini dinyatakan lulus. Namun, pada saat pagi harinya, nama mereka tidak tercantum baik di website maupun media massa. (m49)

Elektrik KTP Diluncurkan Juni MEDAN (Waspada): Pemerintah Kota Medan akan segera meluncurkan e-KTP pada bulan Juni mendatang di Medan. Untuk blanko KTP lama yang saat ini sudah dimiliki seluruh warga Kota Medan akan ditarik oleh perangkat kecamatan dan dinyatakan tidak berlaku lagi. “Kita sedang dalam persiapan untuk peluncuran e-KTP itu. Pada tahun 2011 hampir seluruh daerah kabupaten/kota di Sumut dan Indonesia wajib melaksanakannya. Saat ini sudah sebagian besar dari kabupaten/kota di Indonesia melaksanakannya dan kita akan memulainya di bulan Juni ini,” kata Kepala Dinas Kependudukan dan Catatan Sipil (Kadisdukcapil) Kota Medan Darussalam Pohan kepada Waspada, Minggu (20/3). Mantan Kepala Dinas Pemberdayaan Perempuan dan Keluarga Berencana (PPKB) Medan ini menjelaskan, e-KTP nantinya akan beroperasi penuh sejak Juni dengan ditandai peluncuran pertama. Untuk blanko KTP lama akan dinyatakan tidak

berlaku lagi dan akan ditarik oleh perangkat kecamatan setelah dikeluarkan e-KTP yang baru. “Teknisnya, e-KTP akan dibuat lebih baik dengan membuat satu Nomor Induk Kependudukan (NIK) untuk satu warga Medan saja. Artinya, jika dia sudah memiliki e-KTP Medan, maka tidak akan bisa lagi memiliki KTP ganda di daerah lain. Perbedaannya, KTP lama dapat dimiliki lebih dari dua untuk satu penduduk, namun e-KTP hanya dapat dimiliki satu kartu per satu penduduk. Semua penduduk Medan wajib memiliki e-KTP dan KTP lama akan ditarik,” ujarnya. Sebab, lanjutnya, e-KTP akan langsung terkoneksi dengan database (pusat data) kependudukan secara nasional dengan satu nomor kepemilikan NIK. NIK itu nantinya yang akan menjadi dasar utama KTP seorang tidak bisa digandakan lagi. Secara teknis, pembuatan e-KTP nantinya penduduk akan menjalani tahapan foto dan scaning sidik jari dengan

komputerisasi. Saat ditanya mengenai adanya sentilanWalikota Medan Rahudman Harahap pada peluncuran Kartu JPKMS, di Kantor Camat Medan Marelan, Jumat (11/3) lalu. Sentilan itu diungkapkan Rahudman, disela-sela pidatonya karena sejak Kadisdukcapil baru dilantik sebulan silam, belum melihat terobosan yang dilakukan Disduk dalam peningkatan pelayanan publik untuk pengurusan KTP. Menanggapi hal itu, Darussalam sedikit terlupa. Dia menilai wajar kalau pimpinan (Walikota) mengeluarkan statemen tersebut dan sebagai motivasi baginya untuk melakukan terobosan lebih baik dalam pelayanan KTP. Mengenai anggaran, dia mengaku sepenuhnya merupakan dari pemerintah pusat termasuk dalam hal pengadaan barang yang dibutuhkan. “Kalau jumlahnya gak tau adinda. Tapi semuanya disiapkan pusat, kita hanya mengajukan apa saja yang kita perlukan,” tegasnya. (m50)

UMA Jajaki Kerjasama Dengan Afrika Selatan MEDAN (Waspada): Dalam upaya meningkatkan mutu lulusan, Universitas Medan Area (UMA) akan menjajaki kerjasama dengan Republik Afrika Selatan meliputi bidang kemahasiswaan, pendidikan, budaya, ekonomi dan perdagangan. Upaya tersebut diawali dengan temu ramah kunjungan Duta Besar Republik Afrika Selatan untuk Indonesia, H E DR. Noel N Lehoko dengan Rektor UMA A Ya’kub Matondang bersama sivitas akademika UMA, di program pascasarjana UMA, Jl Sei Serayu Medan, Jumat (18/3). Hadir pada pertemuan tersebut diantaranya, Wakil Rektor II Hj Ir Mardiana, Wakil Rektor III Zulhery Noer MP, Wakil Direktur Pascasarjana UMA Ir Erwin Pane MS, Dekan Fakultas Hukum Syafaruddin, Ketua Program Studi Magister Ilmu Hukum Pascasarjana Mirza Nasution dan Arif Nasution. Dalam temu ramah yang berlangsung penuh kekeluargaan itu, Noel Lehoko terharu atas penyambutan atraksi kesenian Gordang Sambilan yang berasal dari etnis Mandailing yang disuguhkan di awal penerimaan tamu kehormatan di UMA. “Saya kagum atas hiburan Gordang Sambilan di UMA yang mengingatkan bahwa di Indonesia pada umumnya dan di Provinsi Sumut pada khususnya memiliki multi etnis dan merasa bangga telah menjadi tamu kehormatan di UMA,” jelasnya. Rektor UMA Prof AYa’kub Matondang menjelaskan, kunjungan Duta Besar Afrika Selatan ini akan diimplementasikan dalam bentuk nota kesepakatan memorandum of understanding (MoU) yang akan ditindaklanjuti secara positif untuk pengembangan mahasiswa ke depan, sehingga eksistensi kerjasama itu nantinya akan saling menguntungkan kedua pihak. Pertemuan ramah tamah diakhiri dengan pemberian ulos khas Mandailing kepada Duta Besar Afrika Selatan Noel N Lehoko yang diserahkan oleh Rektor UMA A Ya’kub Matondang disaksikan pimpinan universitas, pascasarjana, dosen, mahasiswa dan sivitas akademika UMA. (m41)

WASPADA Selasa 22 Maret 2011


REKTOR UMSU Drs Agussani, MAP menyerahkan cenderamata kepada Ketua Mahkamah Konstitusi Mohd Mahfud MD dalam acara kuliah umum di Kampus UMSU Jalan Mukhtar Basri Medan, Sabtu (19/3).

IKA UII Bantu KPK Berantas Korupsi Mahfud MD Hadiri Temu Reuni MEDAN (Waspada): Ketua Pusat Ikatan Keluarga Akademis Universitas Islam Indonesia (IKA UII) Mahfud MD didampingi Ketua Harian Provinsi Sumatera Utara Saleh Idoan Siregar membuka temu reuni alumni UII ke-8 di Hotel Garuda Plaza Medan, Minggu (19/3). Menurut Mahfud yang juga Ketua Mahkamah Konstitusi RI, sebaiknya untuk menciptakan keadilan didalam memimpin apakah itu negara maupun organisasi, sebaiknya acuan itu lahir dari kebenaran. Karena kalau kebenaran itu sudah muncul menurut hati kita akan mudah menciptakan keadilan yang hakiki. “Artinya adil bagi anda benar bagi orang lain dan untuk menciptakan kedua kondisi ini diperlukan hati yang bersih, jujur dan dapat dipertanggungjawabkan,” sebutnya. Dalam kesempatan itu, Ketua Pelaksana Harian IKA UII Sumut Saleh Idoan Siregar melaporkan alumni UII sudah melaksanakan banyak kegiatan yang bersifat sosial. “Bahkan untuk kedepan IKA UII sudah mempunyai

program seminar tentang pemberantasan korupsi dan mendeteksi pelaku korupsi alias koruptor yang saat ini lagi tren-trennya dikalangan pejabat dan anggota dewan serta masyarakat,” ujar mantan Kadis Perhubungan Deliserdang ini. Program IKA UII Sumut, nantinya kita setting dapat membantu kinerja KPK yang berketepatan Ketua KPK Busyro Muqoddas adalah alumni UII. “Dalam acara ini Pak Busyro tidak dapat hadir berhubung ada urusan kenegaraan yang sangat penting. Namun, beliau sempat berpesan melalui telepon selular kepada saya, semoga program IKA UII dengan tema mengentaskan kinerja koruptor melalui seminar tentang pemberantasan korupsi dan membuka tabir koruptor sangat didukung,” kata Saleh. Dalam temu reuni ini juga dihadiri Wakil Bupati Tapteng Ir MA Pendi Pohan serta Kadis Dispenda Pemprovsu H Sjafaruddin salah satu calon Sekdaprovsu (keduanya alumni UII). (cwan)

PKS Rekrut Hampir 5.000 Kader Baru MEDAN (Waspada): Target rekrutmen kader Partai Keadilan Sejahtera (PKS) di Sumatera Utara sepanjang 2011 tercapai. Dari total 5.128 yang ditetapkan Dewan Pimpinan Pusat (DPP) PKS hingga pertengahan Maret, telah berhasil dicapai 4.848 atau sekitar 96 persen. Hal tersebut disampaikan Ketua Bidang Kaderisasi Dewan Pengurus Wilayah (DPW) PKS Sumut Mahmud Shaleh, Minggu (20/3), menjelang penutupan Rapat Kordinasi PKS Wilayah Sumatera Bagian Utara di Hotel Arya Duta Medan. Mahmud Shaleh mengatakan, sebagai partai kader maka mesin partai bernomor 8 tersebut terletak pada pembinaan kader. Untuk itu, bidang kaderisasi partai terus bergerak melakukan perekrutan sebanyak-banyaknya kader untuk pertumbuhan partai. “Alhamdulillah di Sumut target rekrutmen kader sejak Desember 2010 hingga Maret 2011 mampu dicapai dan dapat melebihi target,” tegasnya. Selain melakukan perekrutan, lanjutnya, kaderisasi PKS tetap melakukan pembinaan kepada seluruh kader di berbagai level, baik

dalam bentuk pembinaan penguatan keimanan, pemikiran, mental, spiritual maupun pembinaan fisik dan intelektualitas. “Target kuantitatif dan kualitatif harus tetap berbanding lurus. Ketika dicanangkan perekrutan dalam jumlah yang besar, maka harus dibarengi dengan nilai-nilai pendidikan dan keilmuan. Mulai dari pengokohan iman, pemikiran, akhlak, moralitas dan juga semangat bekerja untuk kepentingan umat,” paparnya. Dari 33 kabupaten/kota yang ada di Sumatera Utara, tambah Mahmud, jumlah kader terbanyak yang berhasil direkrut selama 3 bulan terakhir berasal dari Kota Medan dan Deli Serdang. Melalui berbagai peran pendekatan yang dilakukan para kader secara personal, struktur dan lembaga-lembaga di luar struktur kepartaian. Ketua DPP PKS Bidang Wilayah Dakwah Sumatera, Idris Lutfi, MSci mengatakan, secara keseluruhan wilayah Sumatera pada 2011 ditargetkan mengalami penambahan kader sebesar 80 ribu kader terbina. Sementara Sumut ditargetkan mampu menambah kader terbina pada tahun ini sebanyak 6.500 kader.(m28)

Sumut Siapkan Dua Rehabilitasi Narkoba MEDAN (Waspada): Dua lokasi yakni kawasan Berastagi, Kabupaten Karo dan Bahorok di Kabupaten Langkat akan disiapkan Pemprovsu sebagai tempat dibangunnya Pusat Rehabilitasi Penderita Narkoba. Komitmen Pemprovsu untuk penyediaan lahan sebagai lokasi pembangunan fasilitas tersebut akan segera diwujudkan, apabila Badan Narkotika Nasional (BNN) Pusat menyediakan dana pembangunannya. Menurut Wagubsu Gatot Pujonugroho seusai menerima kunjungan kerja BNN Provinsi Kalimantan Timur yang dipimpin Wakil Gubernur Farid Wadjoy di Kantor Gubsu, Rabu (16/ 3), kendala dana masih menjadi ganjalan untuk membangun fasilitas dimaksud. “2010 Lalu, pihak BNN Pusat menyatakan kesediaan untuk mengucurkan dana ke daerah apabila daerah menyediakan lahan untuk tempat dibangunnya Pusat Rehabilitasi Penderita Narkoba,” ucapnya. Kesanggupan BNN mengucurkan dana itu, menurut Gatot, belum diketahui kelanjutannya apakah masih berlaku di tahun 2011 atau tidak. “Bagaimana kelanjutannya di 2011 itu yang akan ditindaklanjuti lagi,” sebutnya.

Kesediaan BNN Pusat mengucurkan dana ke daerah, diakui Gatot terungkap ketika dirinya bersama sejumlah direktur dari BNN Pusat mensosialisasikan UU Nomor 35 Tahun 2010 tentang BNN sebagai instansi vertikal. Menyangkut upaya yang akan ditempuh Pemprov untuk menindaklanjuti hal tersebut di 2011, Gatot mengatakan, akan mengutus Kepala Pelaksana Harian Badan Narkotika Provinsi (BNP) Aguswan yang kini menjadi Ketua BNN Sumut. “Kita akan titipkan kejelasan pengucuran dana tersebut kepada Ketua BNN Sumut untuk mengonfirmasikannya kembali ke BNN Pusat,” katanya. Untuk diketahui, hingga akhir 2010, Kota Medan menduduki peringkat ketiga terbesar dalam hal jumlah kasus dan penderita narkoba setelah DKI Jakarta dan Surabaya Jawa Timur. Hingga 2009, Direktorat Narkoba Polda Sumut mencatat dana yang dibelanjakan untuk membeli narkoba mencapai Rp167 miliar. Sedangkan data dari 2004-Mei 2010 menyebutkan, jumlah kasus yang berhasil diungkap sebanyak 16.154 kasus dengan 22.604 orang tersangka.(m28)

SMAN 8 Juara Festival Seni APP Darma Agung


DUTA Besar Republik Afrika Selatan untuk Indonesia H E DR. Noel N Lehoko bersama Rektor UMA AYa’kub Matondang (tengah),Wakil Rektor III Zulhery Noer MP dan Dekan FH UMA Syafaruddin menyaksikan tarian dari Mandailing Natal diiringi dengan Gordang Sambilan.

MEDAN (Waspada): SMA Negeri 8 berhasil menyabet juara I pada Festival Paduan Suara dan Vokal Solo tingkat Sekolah Menengah Atas sederajat se-Sumatera Utara, yang digelar Akademi Parawisata dan Perhotelan (APP) Darma Agung, di Hermina Hall Medan kampus Universitas Darma Agung, Jl. TD Pardede, Sabtu (19/3). Tampil dengan membawakan lagu wajib dari Tapanuli Utara “Sigulempong”, personil SMA Negeri 8 dengan kekuatan 30 peserta berhasil memukau penonton yang memadati gedung dan tiga dewan juri memberikan nilai tertinggi hingga menyisihkan para peserta lainnya. Pada Festival yang dibuka secara resmi oleh Rektor UDA Prof Dr Binsar Panjaitan yang mewakili Ketua Umum Yayasan UDA/ISTP/APPDA Ny Sariaty PR Siregar br Pardede, merupakan festival yang keempat kalinya digelar, sebagai rangkaian menyemarakkan ulang tahun Ny Sariaty PR Siregar br Pardede yang ke 73 tahun. Sementara SMA Negeri I yang menjadi juara pertama sebanyak dua kali berturut-turut dalam kurun waktu dua tahun, harus mengakui keunggulan lawannya dan harus puas menduduki

posisi ke-II. Sehingga secara otomatis piala bergilir yang dua tahun dipegang harus berpindah tangan kepada SMAN 8 Medan. Posisi juara III diraih SMA Negeri 4 Medan disusul juara Harapan diraih SMA Negeri 3 Medan. Pada festival yang diikuti sembilan SMA Negeri dan swasta, diantaranya SMA Negeri 8, SMA Negeri 1, SMA Negeri 4, SMA Negeri 3, SMA swasta katolik ST Thomas, SMA swasta Methodist 7, SMAN 5, SMAN 7 dan SMAN 9. Kesemua peserta menampilkan performa yang terbaik, hingga dalam penentuan juara, para juri harus bersidang dengan waktu yang cukup lama. Para juara, mendapatkan piala tetap dan piagam serta uang pembinaan yang diserahkan langsung oleh Rektor UDA Prof. Dr. Binsar Panjaitan. Direktur APP-DA Joe Nasroen menyebutkan, selain dalam rangka menyambut hari ulang tahun Ketua Umum Yayasan UDA/ISTP/APPDA Ny Sariaty PR Siregar br Pardede ke 73, festival yang digelar tersebut secara akademik merupakan implementasi dari Tri Dharma Pergurun Tinggi yang salah satunya sebagai pengabdian kepada masyarakat dalam bidang seni. (m41)

Medan Metropolitan

WASPADA Selasa 22 Maret 2011


Antisipasi Teror Bom

Pamobsus Jaga Obyek Vital MEDAN (Waspada): Kapolresta Medan Kombes Pol Tagam Sinaga, SH menegaskan, pihaknya telah menugaskan sejumlah petugas dari Satuan Pengamanan Obyek Khusus (Pamobsus) sebelum dan sesuah isu teror bom melanda Jakarta. “Sudah kita tugaskan Satuan Pamobsus menjaga di setiap obyek vital seperti bank, rumah konsul, pusat perbelanjaan dan lainnya,” jelas Tagam Sinaga (foto) ketika dihubungi Waspada melalui telefon, Senin (21/3), terkait maraknya teror bom di Jakarta dan antisipasinya di Medan. Selain itu, lanjut Tagam, petugas jasa pos dan titip kilat

diimbau agar selalu waspada jika menerima titipan barang yang mencurigakan. “Bila perlu tempat jasa penitipan barang memasang kamera CCTV sehingga bisa diketahui identitas si pengirim barang,” jelasnya seraya menambahkan, pemasangan kamera CCTV perlu juga dilakukan para pengusaha di Medan. Petugas keamanan di kom-

Kasat Lantas:

DilarangLakukan Tilang Di Dalam Warung MEDAN (Waspada): Kasat Lantas Polresta Medan Kompol I Made Ary Pradana menegaskan, anggota Sat Lantas dilarang melakukan penilangan dengan membawa si pelanggar lalu lintas ke dalam warung. “Tidak diperbolehkan menilang pelanggar lalu lintas di dalam warung,” tegas Kasat Lantas melalui Waka Sat Lantas Polresta Medan AKP Deny kepada wartawan, Jumat (18/3) malam. Deny menjelaskan, tidak ada aturan dalam undang-undang dilarang melakukan tilang di warung. “Ini merupakan kebijakan pimpinan saja dan menjaga imej di masyarakat,” jelasnya. Menurut Deny, penulisan tilang bisa dilakukan di atas kendaraan anggota atau diatas kap mobil jika petugas membawa mobil patroli. Sedangkan penulisan tilang di dalam pos diperbolehkan dalam kondisi tertentu, seperti hujan. “Jika tidak, anggota diperintahkan menindak di luar pos agar terlihat oleh masyarakat dan mengeliminir tindak penyimpangan baik yang dilakukan oleh petugas atau pelanggar,” jelasnya. Jikaadaanggotayangmelanggarketentuantersebut,akandiberikan sanksi.“Sanksinya tergantung dari pelanggaran yang dilakukan mulai dari teguran lisan, tertulis dan bisa diajukan untuk sidang disiplin dengan jenis hukuman sesuai tingkat kesalahan,” jelasnya. Kepada para pengendara, Sat Lantas Polresta Medan mengimbau agar selalu mentaati peraturan lalu lintas secara aktif, hormati sesama pengguna jalan, demi menjaga citra Kota Medan. “Karena tingkat disiplin dan kepatuhan suatu kota tercermin dari perilaku berkendaraan di jalan,” demikian Deny. (m39)

plek perumahan harus mewaspadai orang-orang tidak dikenal yang membawa bendabenda mencurigakan. Segera

laporkan ke polisi terdekat bila menemukan benda yang mencurigakan. Kemudian, Tagam telah menginstruksikan seluruh Kapolsekta di jajaran Polresta Medan agar melakukan pendataan terhadap perusahaan jasa penitipan barang serta kantor pos, terkait imbauan pemasangan kamera CCTV. “Saya sudah mengintruksikan seluruh Kapolsekta di wilayah hukum Polresta Medan agar mendata semua perusahaan jasa penitipan barang dan mengimbaunya guna memasang kamera CCTV serta meningkatkan pengamanan,” jelasnya. Selaku pimpinan Polresta

Medan, Tagam segera merespon setiap isu teror bom yang ada wilayah hukumnya. Karena itu, seluruh Polsekta harus mengawasi dan mengantisipasi peredaran paket buku yang mencurigakan. “Kita akan terus mengawasi semua peredaran paket buku yang dikirim. Jika ditemukan paket buku yang mencurigakan, segera laporkan ke kantor polisi terdekat dan akan diteruskan ke tim degana,” tegasnya. Tagam menambahkan, jajaran intel kepolisian dan intel kodim terus bekerjasama guna meningkatkan peran intelijennya dalam menanggulangi teror bom di Medan. (m39)

Mahasiswa Demo Kantor Suratkabar TNI AL Siagakan Lima Kapal Patroli Di Selat Malaka

MEDAN (Waspada): Belasan mahasiswa Universitas Muhammadiyah Sumatera Utara (UMSU) menggelar unjukrasa di depan kantor Harian Tribun Medan Jln. Gatot Subroto, Senin (21/3). Dalam unjukrasa tersebut, personel Intel Polsekta Medan Baru menggagalkan aksi pembakaran puluhan eksemplar surat kabar Tribun Medan yang hendak dilakukan para mahasiswa. Para pengunjukrasa mendatangi kantor suratkabar tersebut dengan mengendarai sepedamotor. Setibanya di depan kantor Harian Tribun Medan, para pengunjukrasa membentang spanduk bertuliskan “Singkirkan Redaktur dan Wartawan Bayaran Tribun”. Saat itu, seorang pengunjukrasa berupaya membakar puluhan eksemplar suratkabar Tribun Medan edisi 8 Maret

2011. Namun usaha itu berhasil digagalkan personel Intel Polsekta Medan Baru dan menyita botol air mineral berisi bensin. Kemudian, perwakilan pengunjukrasa melakukan pertemuan dengan pihak Harian Tribun Medan. Dalam pertemuan itu, Budi Dharman dari PT. ACK mengatakan, aksi ini tanpa melibatkan perusahaan dan dibantu mahasiswa UMSU. Saat ini, perusahaannya sedang melakukan pembangunan lahan eks PJKA di Jln. Timor/Jln. Jawa, Kelurahan Gang Buntu Medan. Menurut Budi, Harian Tribun Medan sering memberitakan PT. ACK menyangkut kepemilikan ruko antas nama mantan Walikota Medan Abdillah. Pemberitaan itu tidak pernah dibantah dan pihak PT. ACK tidak menggunakan hak jawabnya. Namun dalam

pemberitaan tersebut tertulis PT. ACK sulit dikonfirmasi. Belakangan, ada tiga oknum wartawan Harian Tribun Medan yang melakukan konfirmasi dengan Budi. Namun pada kenyataannya, hasil konfirmasi tersebut telah ‘diplintir’. Padahal sudah ada kesepakatan antara PT. ACK dengan oknum wartawan Tribun Medan untuk pemuatan klarifikasi berita, namun hasilnya tidak sesuai dengan yang diharapkan. Budi juga meminta agar pimpinan Harian Tribun Medan segera menindak oknum wartawan di harian tersebut. Sementara itu, Perdata Ginting dari Harian Tribun Medan yang dikonfirmasi Waspada melalui telefon, Senin (21/3) malam sekira pukul 19:20 mengatakan, pihaknya akan mempelajari berita yang menurut pengunjuk rasa ‘diplintir’. (m36)

Hafsah Saleh Pemilik Ruko Jln. Kereta Api MEDAN (Waspada): Pengadilan Negeri (PN) Medan memenangkan gugatan Hafsah Baswel alias Ny. Hafsah Saleh Baswel, 65, dan Abdullah Baswel, 32, keduanya penduduk Jln. Samba, Kecamatan Johar Baru, Jakarta Pusat, atas obyek perkara berupa rumah dan pertapakannya di Jln. Kereta Api No 18-B, Medan. Hasan Lumban Raja, SH dan Frien Jones IH Tambun, SH dari kantor pengacara Law Office Boni F Sianipar, SH, MHum & Partners mengatakan kepada wartawan, Minggu (20/3), perkara kliennya tersebut telah diputus oleh majelis hakim Jhonny Sitohang SH, MH dan H Muhammad SH, MH pada 15 Maret 2011. Dalam amar putusan perkara No. 370/Pdt.G/2010/PN.Mdn dinyatakan, penggugat (Hafsah Saleh Baswel dan Abdullah Baswelred) sebagai pemilik sah dan pemegang satu-satunya alas hak yang sah atas rumah dan tanah pertapakannya di Jl Kereta Api No 18-B Medan. Selanjutnya putusan itu menyatakan tergugat I (Hafsah Salim Baswel-red) dan tergugat II (Aisyah Binti Salim Baswel dkk-red) telah melakukan perbuatan melawan hukum. Serta menyatakan cacat hukum dan tidak berkekuatan hukum penetapan PN Medan Nomor 19/Eks/2008/481/Pdt.G/2002/PN-Mdn bertanggal 30 April 2010 dan berita acara eksekusi pengosongan nomor 19/Eks/2008/ 481/Pdt.G/2002/PN-MDN bertanggal 22 Juli 2010. Selain itu menyatakan perikatan yang dilakukan tergugat I maupun pihak ketiga yang berkenaan dengan rumah dan tanah pertapakannya di Jln. Kereta Api No 18-B Medan batal dan tidak memiliki kekuatan hukum. Menghukum tergugat I maupun pihak ketiga lainnya yang memperoleh hak dari tergugat I agar menyerahkan rumah dan tanah pertapakankepadapenggugat.MenghukumtergugatIagarmembayar ganti rugi kepada penggugat. (m49)

Perampok Bacok Kepling Rengas Pulau BELAWAN (Waspada): Tiga perampok membacok Ahui, 42, Kepala Lingkungan 22, Kelurahan Rengas Pulau, Kecamatan Medan Marelan, saat menintas di Jalan Datuk Bariah, Senin (21/3) siang sekitar pukul 14.00. Keterangan di Polsekta Medan Labuhan menyebutkan, aksi perampok yang menggunakan senjata tajam itu dilakukan tiga orang pengendara dua sepedamotor tanpa menggunakan no plat polisi. Peristiwaituberawalsaatkorbanyangbarumengutipuangtagihan dari beberapa temannya berniat melanjutkan perjalanan menuju Belawan dengan mengendarai sepedamotor Yamaha Mio. Diperjalanan korban diikuti para pelaku dan ketika berada di perempatan jalan, kepling itu dihadang dan memaksanya berhenti. Korban berusaha memberikan perlawanan kepada ketiga perampok yang berbadan tegap itu. Namun, pelaku mengambil sebilah kelewang dan mengayunkan ke arah lengan kanan korban. Akibatnya, lengan korban terluka kena sabetan senjata tajam. Selanjutnya, para perampok yang berhasil melumpuhkan kepling itu mengambil paksa barang berharga milik korban berupa sepedamotor, tas berisi uang Rp10 juta, HP beserta surat penting lainya. Atas peristiwa itu, korban telah membuat pengaduan ke Polsekta Medan Labuhan. Kanit Reskrim Polsekta Medan Labuhan AKP M Octavianus S mengatakan, telah menurunkan tim untuk menyelidiki dan memburu pelaku yang dikabarkan lari menuju arah Kelurahan Sei Mati, Kecamatan Labuhan. (h03)

Waspada/Ismanto Ismail

PARA pengunjuk rasa membentang spanduk saat melakukan aksi unjuk rasa di depan kantor surat kabar Harian Tribun Medan, Jln. Gatot Subroto, Senin (21/3).

Masalah Hukum Ketua DPD Hanura Jangan Dipolitisasi 29 DPC Tetap Solid MEDAN (Waspada): Wakil Ketua DPD Partai Hati Nurani Rakyat (Hanura) Sumut Abdul Muluk Siregar mengingatkan agar persoalan hukum yang dialami Ketua DPD Hanura Sumut tidak dipolitisasi. “Masalah ini jangan dipolitisasi, serahkan saja penanganannya kepada pihak berwajib sehingga diketahui siapa yang benar dan salah dalam kasus tersebut,” ujarnya di Medan, Senin (21/3). Abdul Muluk yang juga juru bicara DPD Hanura Sumut mengatakan hal itu terkait persoalan hukum yang dialami Ketua DPD Hanura Sumut Zulkifli Efendi Siregar beberapa waktu lalu dan kini sedang ditangani penyidik Polresta Pematangsiantar. Abdul Muluk mengatakan, Ketua DPD Hanura sudah melaporkan balik kasus pencemaran nama baiknya itu. Bahkan, Ketua DPD Hanura mempunyai bukti bahwa kasus itu sengaja diciptakan oleh orang dalam (kader Hanura) sendiri. “Alat bukti berupa percakapan melalui ponsel dan pengakuan pe-

nyerahan uang untuk membayar pelaku. Kini, alat bukti itu sudah berada di tangan pihak kepolisian,” tambahnya. Menurut Abdul Muluk, mayoritas kader dan pengurus di tingkat DPC tidak mempercayai kasus pelecehan seksual itu dan menganggapnya sebagai politik pembusukan. Karena itu, 29 dari 32 DPC di Sumut telah melakukan pertemuan internal dan menyatakan solid mendukung Ketua DPD Hanura. “Dalam konsolidasi itu, kita satukan pandangan politiknya menyikapi persoalan yang dituduhkan kepada Ketua DPD Hanura. Alhamdulillah, semua solid mendukung proses hukum. Selain itu, tim pencari fakta yang dibentuk sudah bekerja. Jika nantinya diketahui siapa yang terlibat dalam kasus itu, akan diberi sanksi, baik di kelembagaan maupun di legislatif. Guna menguatkan kesolidan itu, 29 DPC juga membuat pernyataan sikap bersama bahwa permasalahan yang sedang dihadapi Ketua DPD Hanura Sumut adalah permasalahan

hukum biasa. Semestinya, permasalahan itu ditanggapi dengan pendekatan asas praduga tidak bersalah, bukan disikapi dengan langkah politisasi yang cenderung mengarah pada upaya pembunuhan karakter. Kemudian, memberi dukungan moril secara penuh kepada Ketua DPD Hanura agar tetap tenang dan tegar, serta tidak terpancing pada intrikintrik politik dari pihak yang ingin menghancurkan kewibawaan partai. Mendorong tim pencari fakta internal partai secepatnya menuntaskan permasalahan, mengimbau para kader partai tetap tenang dan berhati-hati serta fokus pada kegiatan pembesaran partai, serta mendukung sepenuhnya kepemimpinan Zulkifli Efendi Siregar. Abdul Muluk menambahkan, jika dalam proses hukum yang masih berjalan itu nantinya tidak membuktikan apa yang dituduhkan kepada Ketua DPD Hanura, maka mereka meminta nama baiknya segera direhabilitas.(m27)

Tewas Diligas Truk MEDAN (Waspada): Muhamad Rizky, 4, warga Perumahan Nelayan Indah Blok E, Belawan tewas dengan kondisi mengenaskan setelah digilas truk di ruas Jln. Djamin Ginting kawasan Desa Bintang Meriah, Kecamatan Pancurbatu, Minggu (20/3). Sebelumnya, Rizky yang berboncengan naik sepedamotor bersama ibunya dan seorang pria, terlebih dahulu ditabrak dari arah belakang oleh mobil angkutan kota (angkot) yang ditumpangi rombongan keluarga korban sendiri. Informasi yang diperoleh Waspada di lapangan, siang itu korban bersama ibunya,Sumi Astuti, 25, berencana pergi ke obyek wisata Sembahe di Sibolangit. Dalam perjalanan itu, ibu korban dibonceng seorang pria berinisial B, 31, warga Jln. Beliton, Belawan dengan mengendarai sepedamotor tanpa nomor polisi. Setibanya di lokasi kejadian, sepedamotor yang ditumpangi korban ditabrak angkot dari arah belakang. Angkot yang ditumpangi sejumlah keluarga korban ini, juga hendak menuju Sembahe. Akibatnya, korban terjatuh ke tengah jalan. Sedangkan B dan ibu korban terjatuh ke pinggir jalan. Pada saat bersamaan, sebuah truk melintas dari arah berlawanan dan menggilas tubuh korban hingga tewas di tempat. Kanit Lantas Polsek Pancurbatu AKP Toni Simanjuntak,SH yang dikonfirmasiWaspada membenarkan adanya kecelakaan lalulintas itu. Saat ini, kasus tersebut masih dalam penyidikan. (m40)

Waspada/ Rustam Effendi

NORMANSYAH, 56, warga Lorong Melati Kelurahan Belawan I Kecamatan Medan Belawan (kanan), memberikan keterangan kepada petugas Dipolairdasu (kiri) dihadapan Keua HNSI Kota Medan Zulfahri Siagian (tengah), tetang perampokan oleh tentara Diraja Mayasia yang dialaminya, Senin (21/3).

Waspada/gito ap

KETUA Dewan Pimpinan Cabang (PDC) Hanura se-Sumut usai memberi dukungan moril kepada Ketua DPD Hanura Sumut Zulkifli Efendi di kantor DPD Hanura Sumut Jln. Sei Besitang, Senin (21/3).

BELAWAN (Waspada): Terkait semakin banyaknya kasus kekerasan terhadap nelayan RI, TNI AL mensiagakan lima kapal patroli untuk berjaga-jaga di Selat Malaka atau seputaran perairan perbatasan Indonesia-Malaysia. Hal itu disampaikan Komandan Satkamla TNI Angkatan Laut Mayor Asep saat memberi pengarahan kepada sejumlah nelayan Belawan, Sabtu (19/3). Selain itu, Mayor Asep meminta nelayan menjauh dari perbatasan sebelum ada keputusan dari Departemen Luar Negeri mengenai tapal batas kedua negara. “Masalah mengenai tapal batas laut ini sedang dibahas karena Malaysia masih mengklaim wilayah sesuai peta mereka sendiri,” katanya. Asep mengaku belum dapat melakukan tidakan tegas jika kejadian kekerasan terulang karena akan menimbulkan masalah antar negara. Namun, dia menegaskan akan meneruskan ke Pengadilan Internasional bila nota protes ke Malaysia tidak ditanggapi. Dijelaskannya, batas maritim antara Indonesia dengan Malaysia di Selat Malaka telah ditetapkan oleh kedua negara dengan melakukan perjanjian batas landas kontinen yang ditandatangani pada 27 Oktober 1969. Perjanjian tersebut masih berdasarkan ketentuan-ketentuan hasil konferensi Hukum Laut PBB I tahun 1958. Dimana hasil konfe-rensi itu masih belum memuat ketentuan tentang batas zona ekonomi. “Sebagai implementasi lahirnya UNCLOS’82, Indonesia berupaya untuk menetapkanbatasmaritimdenganMalaysiaterutamabatas laut ZEE di perairan Selat Malaka,” ucap Asep. Kembali dirampok Sementara itu, empat nelayan Belawan yakni Normansyah, 56, nakhoda dan tiga ABKnya Anto, 33, Dedek, 28 dan Agus Salim, warga Lorong Melati Kelurahan Belawan I, kembali dirampok tentara Diraja Malaysia saat melaut di perairan Selat Malaka atau sekitar 40 mil arah utara dari Belawan, Sabtu (19/3) sore. Tidak ada korban jiwa dalam peristiwa yang terjadi untuk kedua kalinya dalam Maret 2011. Namun sebanyak 400 kg ikan tongkol hasil tangkapan dirampok dan seluruh tangkap berupa pancing milik korban dirusak dan dibuang ke laut oleh tetara negara jiran itu. Saat mengadukan nasibnya di kantor DPC HNSI Kota Medan Normansyah mengatakan berangkat melaut dengan menggunakan kapal tunda pancing KM Agus 1 GT 3, Selasa (15/3), dari dermaga Ujang di Lorong Melati Kelurahan Belawan I Kecamatan Medan Belawan.

Setelah empat hari di laut, mereka didatangi satu unit kapal patrol Diraja Malaysia bernomor lambung 14 warna abu-abu yang memerintahkan nakhoda kapal, Normansyah naik ke kapal patroli untuk ditanyai tentang lokasi mereka mencari ikan. “Aku naik dan diperiksa pakai alat detektor. Ketika itu aku terdesak sehingga aku terpaksa mengakui kalau perairan tempata kami mencari ikan adalah perairan Malaysia. Padahal berdasarkan kebiasaan lokasi itu masih wilayah laut Indonesia,” katanya, Senin (21/ 3), tidak lama setelah tiba di Belawan. Mendengar jawaban itu, petugas Malaysia itu memberi dua pilihan kepada Norman, yakni ditangkap atau dibawa ke Malaysia untuk diproses atau dipulangkan setelah seluruh hasil tangkapannya diambil. Norman memilih opsi kedua dan merelakan beberapa tentara Malaysia yang ketika itu berpakaian putih- ptuih turun ke kapal korban untuk mengambil semua hasil tangkapan dan merusak alat tangkap milik korban.“Kamidirampoknamunkamitidakmampu berbuat apa- apa selain merelakan ikan kami dijarah mereka. Apalagi mereka kulihat menggunakan senjata laras panjang,” jelas Norman. Setelah aksi perompakan itu, Norman bersama tiga ABKnya pulang dan tiba di dermaga Lorong Melati Kelurahan Belawan I, Senin (21/ 3) pagi sekitar pukul 06.00. “Kapal yang kami gunakan kapal bekas bantuan Diskanla Kota Medan, KM Mina 14 yang dibeli toke dari Ahyat beberapa bulan lalu,” pungkasnya. Menanggapi hal itu, Ketua HNSI Kota Medan Zulfahri Siagian mengaku kecewa dengan pemerintah Malaysia yang terkesan tidak beritikad baik untuk menyelesaikan masalah nelayan tersebut. Kemarin kami sudah bertemu dengan Konsul Malaysia dan dia berjanji akan menyelesaikan masalah pemukulan yang kemarin sekaligus berjanji kejadian serupa tidak terulang lagi. Nyatanya belum beberapa hari, terjadi lagi. Selanjutnya, Zulfahri meminta pemerintah Malaysia dan Indonesia segera bertindak melindungi nelayan. Sebab jika hal itu terus berlanjut bisa memancing emosi nealayan. “Mungkin ada baiknya kami akan berunjuk rasa di kantor konsul Malaysia. Agar mereka tahu apa yang terjadi,” tegasnya. Sebelumnya, empat nelayan yang sedang melaut di sekitar 45 mil dari lampu satu perairan Belawan dirampok dan dipukuli tentara Diraja Malaysia sekaligus menjarah selruh muatan danalat tangkap kapal ikan Sri Muara GT3, Rabu (16/3). (h03)

Simulasi Penanggulangan Teror Di BRI

Enam Perampok Bersenjata Api Diringkus MEDAN (Waspada): Enam pria bersenjata api merampok Kantor Bank Rakyat Indonesia (BRI) Cabang Medan di Jln Putri Hijau, Sabtu (19/3). Namun polisi berhasil meringkus para perampok sebelum mereka melarikan diri membawa hasil kejahatan. Kecepatan aparat kepolisian tiba di lokasi kejadian karena bank tersebut memiliki kamera pengawas CCTV dan terkoneksi dengan kantor polisi terdekat. Dengan demikian, petugas lebih cepat merespon dan segera tiba di lokasi kejadian. Aksi kejahatan itu mewarnai simulasi penanggulangan teror dan perampokan yang digelar Polda Sumut di kantor bank tersebut. Simulasi diawali dari dua anggota perampok mengendarai sepedamotor masuk dan memantau gedung BRI Cabang Medan yang akan dijadikan target perampokan. Setelah situasi dianggap aman, dua kawanan perampok itu memanggil rekan-rekannya yang datang mengendarai dua sepedamotor. Kemudian, tiga pelaku memasuki gedung guna mengambil uang. Sedangkan tiga lainnya telah bersiap-siap dengan sepedamotornya guna melarikan diri. Aksi perampokan itu langsung menimbulkan kepanikan para karyawan dan nasabah bank. Apalagi saat pelaku tiba di lokasi, aktivitas bank terlihat lengang. Tanpa perlawanan pelaku menyandera satpam dan menguras seluruh uang di bank. Tanpa disadari, aksi kawanan perampok bersenjata api itu terpantau kamera CCTV yang terhubung ke Polresta Medan. Lalu, petugas dengan cepat mendatangi lokasi kejadian dan berusaha menggagalkan aksi perampokan itu. Proses penangkapan yang ditangani langsung Brimob Poldasu bekerjasama dengan Sabhara Polresta Medan itu, membuat suasana makin mencekam. Sebab, pelaku yang berjumlah enam orang itu membawa senjata api. Berselang dua menit, sejumlah anggota Sabhara Polresta Medan datang menyergap tiga anggota kawanan perampok yang berada di pelataran parkir sepedamotor. Guna menangkap tiga kawanan perampok yang masih berada di dalam gedung BRI, pihak kepolisian mengerahkan tim Antireror Satuan Brimob Polda Sumut yang menggunakan senjata lengkap. Karena terkepung, tiga anggota perampok itu berupaya melindungi diri dengan menyandera pegawai dan pengunjung bank tersebut. Kemudian petugas mencoba bernegosiasi

sambil mengimbau kawanan perampok agar menyerahkan diri. “Kepada pelaku, sebaiknya menyerah,” teriak seorang polisi memberi abaaba seraya memegang senjata, agar pelaku segera menyerahkan diri. “Tidak mau, bila menyerah nanti kami ditembak. Tidak ada jaminan,” bantah seorang perampok yang membawa senjata api jenis FN dari balik pintu gedung dan tetap bertahan tidak ingin menyerah. “Sebaiknya menyerah. Kami berjanji keselamatan akan terjaga bila menyerah dan mengikuti perintah,” teriak petugas mencoba untuk bernegosiasi menghindarkan aksi tembak menembak. Tidak lama kemudian, satu persatu kawanan perampok menyerah. Petugas yang melihat pelaku keluar, dengan kondisi siaga memegang senjata laras panjang, meminta pelaku untuk mengangkat baju dan tangan ke atas. Petugas juga meminta kawanan perampok agar mengeluarkan senjata api yang terselip di pinggang dan diletakkan di lantai. Kemudian, kawanan perampok itu disergap dan digiring masuk ke dalam mobil. Setelah mengamankan tiga perampok, pihak kepolisian menurunkan tim penjinak bahan peledak (Jihandak) dari Satuan Brimob Polda Sumut guna menyisir benda-benda berbahaya yang mungkin ditinggalkan kawanan penjahat tersebut. Setelah itu, tim medis dari Bidang Kedokteran dan Kesehatan (Biddokkes) memasuki gedung tersebut guna melihat kemungkinan adanya pegawai atau nasabah BRI yang terluka atau mengalami trauma atas kejadian itu. Sedangkan langkah terakhir mengirimkan unit olah TKP guna mendapatkan bukti atas peristiwa perampokan tersebut. Usai latihan, Kapolda Sumut Irjen Pol Oegroseno mengatakan, simulasi ini sebagai wujud percobaan alat CCTV Police yang berfungsi memantau pergerakan kawanan penjahat. Sebagai contoh perampokan terjadi di Bank BRI. Prosedur yang dilaksanakan dalam latihan itu perlu disempurnakan lagi, meski dinilai cukup baik. “Harus berlatih terus, berulang-ulang,” katanya. Untuk kepentingan jangka panjang, lanjut Oegroseno, pengamanan gedung seperti perkantoran dan bank harus menggunakan teknologi, khususnya kamera pengawas yang terkoneksi dengan kantor polisi terdekat sehingga petugas dapat bertindak lebih cepat jika terjadi hal-hal yang tidak diinginkan. (m39)



WASPADA Selasa 22 Maret 2011

Lagi Teror Bom Di Bali DENPASAR (Antara): Tas warna hitam yang ditemukan di depan toko yang berhadapan dengan kantor Lembaga Pemasyarakatan Denpasar di Kerobokan, Kec. Kuta, Kab. Badung, Senin (21/3), ternyata berisi bedak untuk gatal-gatal, celana renang dan barang lainnya. Kabid Humas Polda Bali Kombes Pol Gde Sugianyar, menjelaskan, barang tersebut telah dibongkar isinya dan ditemukan sebuah identitas pemilik tas

Di Bogor ransel dan tas laptop tersebut yang dari namanya diduga kuat berkewarganegaraan asing. “Setelah dibawa ke Mako Brimob Polda Bali, kedua tas tersebut telah dibongkar dan ternyata isinya bedak, celana renang, CD case, kaos kaki, kunci, kacamata, kain pantai, sebuah kitab suci, handuk kecil, dan sabun,” katanya. Dalam tas tersebut juga terdapat beberapa identitas pemilik, seperti SIM dan fotokopi paspor atas nama Craig David Mc Cledon.

“Sementara masih akan kita cek pemiliknya, apakah tas tersebut ketinggalan atau sengaja, masih kami cari tahu,” ujarnya. Sugianyar mengimbau kepada masyarakat agar ti dak terlalu panik jika menemukan sesuatu yang mencurigakan. “Adanya penemuan seperti ini jangan dianggap sesuatu yang menakutkan dan meresahkan. Polisi akan melakukan tugasnya secara benar. Bila memang ada sesuatu yang mencurigakan, warga langsung melapor saja,” katanya.

JAKARTA ( Waspada): Warga Bogor kembali digemparkan dengan penemuan benda mencurigakan yang diletakkan di depan Masjid Raya Bogor, Kecamatan Bogor Tengah, Kota Bogor. Benda mencurigakan itu pertama kali ditemukan seorang pedagang batu akik, Engkus, sekitar pukul 10:00, Senin (21/3). Menurutnya, saat itu dia melihat seorang laki-laki setinggi 170 cm me-

lintas di depan Masjid Raya. “Tiba-tiba, dia menaruh sebuah kardus berwarna kuning yang diikat tali rafia dan di atasnya terdapat amplop putih,” kata Engkus, di lokasi kejadian. Namun, ketika ditanya, laki-laki yang mengenakan baju warna abu-abu, memakai jaket kuning dan berambut lurus, itu langsung melarikan diri. Karena merasa curiga, Engkus langsung melaporkan penemuan benda

mencurigakan kepada Polsek Bogor Tengah. Saat ini, lokasi kejadian sudah diberi garis polisi oleh Polres Kota Bogor. Dan warga yang ingin menyaksikan tidak boleh mendekat dalam radius 50 meter. Benda yang dicurigai berisi bom itu pun masih didiamkan di halaman masjid sambil menunggu kedatangan Tim Gegana. (vvn)

DPR: Teror Bom Ulah Orang Kecewa JAKARTA (Waspada): Sejumlah paket bom yang terbungkus buku meneror sejumlah warga Ibukota Jakarta. Wakil Ketua Komisi I TB Hasanudin menilai upaya teror bom yang belakangan marak terjadi merupakan ulah orang-orang yang kecewa. “Kecewa terhadap pemerintah,” kata Hasanudin di Gedung DPR, Jakarta Senin (21/3). Oleh karena itu, Hasanudin meminta kepolisian segera mengungkap kasus ini dan segera menangkap

pelaku serta dalang di balik teror yang selama ini terjadi. “Kalau dibiarkan saya khawatir akan berkembang pada opini pengalihan isu,” kata legislator asal Fraksi PDI Perjuangan ini. Meski demikian, dia pun tidak menampik jika intelijen berada di balik aksi teror ini. “Jika memang teror selama ini dijadikan sebagai pengalihan dari isu-isu strategis, sangat mungkin ini dilakukan oleh intelijen.”

Paket bom yang dibungkus dengan buku mencuat Selasa lalu. Empat paket bom dikirim seseorang ke sejumlah tempat, yakni kantor Komunitas Utan Kayu, Badan Narkotika Nasional, kediaman Ketua Umum Pemuda Pancasila, Japto S Soerjosoemarno, dan kediaman musisi Ahmad Dhani. Bom di Utan Kayu meledak saat dijinakkan aparat kepolisian. Tiga polisi menderita luka dan dilarikan ke rumah sakit. (vvn)

Ketua MK: Pilkada Ulang T. Tinggi Tetap Diikuti Lima Pasangan MEDAN (Waspada): Ketua Mahkamah Konstitusi (MK) Prof DR Moh Mahfud MD menegaskan partai pengusung HM Syafri Chap yang sempat unggul pada Pilkada Kota Tebingtinggi yang lalu, namun dibatalkan oleh MK terkait permasalahan hukum, dapat segera menetapkan penggantinya untuk ikut pada Pilkada ulang kota itu. “Itu artinya Pilkada ulang Tebingtinggi tetap lima pasangan calon. Namun partai pengusung yang pasangan calonnya sempat menang namun salah seorang diantaranya dibatalkan,

harus mencarikan penggantinya, guna dipasangkan dengan calon lainnya yang sebelumnya ikut itu,” tegasnya menjawab wartawan di Hotel Garuda Plaza Medan, Sabtu (19/3) malam. Hal ini ditanyakan wartawan sehubungan masih berpolemiknya Pilkada ulang kota lemang tersebut apakah dengan empat atau lima pasangan calon sebagaimana Pilkada sebelumnya, yang dimenangkan pasangan calon walikota HM Syafri Chap dan wakilnya Ir H Hafas Fadillah, MAP, MSi yang diusung Partai Golkar, namun dibatalkan MK karena calon walikotanya terkait masalah hukum.

Mahfud menegaskan, terkait Pilkada ulang ini sebenarnya sudah jelas bahwa calon walikota yang menang itulah yang dibatalkan oleh MK, namun pasangannya (H Hafas Fadillah) boleh maju kembali setelah dicarikan pasangan barunya oleh partai pengusung. “Jadi calon wakilnya yang dulu menang namun pasangan mereka itu dibatalkan MK boleh maju lagi tapi diajukan kembali oleh partai pengusung setelah dicarikan pasangannya yang lain oleh partai pengusung bersangkutan,” tegasnya seraya mengisyaratkan hal ini tidak perlu menjadi polemik karena

sudah jelas. Pada kesempatan itu Mahfud secara umum mengimbau agar pelaksanaan Pilkada ulang sebagai konsekuensi dari keputusan MK yang dalam waktu dekat di Sumut digelar di dua daerah, yakni Kota Tebingtinggi dan Kabupaten Mandailing Natal, agar dilaksanakan secara baik, konstitusional dan mematuhi kaedah hukum berlaku. “Harap dilaksanakan dengan baik. Artinya, masing-masing KPUD setempat hendaklah benar-benar netral, begitu juga Panwasnya melakukan pengawasan dengan benar. Sebab, kalau KPU tidak benar, dapat

dibawa ke pengadilan. Tetapi kalau semuanya berjalan benar kan diharapkan tidak akan ada masalah,” ujarnya. Begitu juga kepada seluruh pasangan calon maupun partai pengusung dan para pendukungnya, Mahfud juga mengimbau hendaklah berjiwa besar dan sportif sepanjang prosesnya sudah benar. “Jadi kalau sudah kalah, tidak perlu lah memaksakan diri untuk berperkara, karena kalau tidak ada bukti kecurangan yang tidak signifikan, sistematis, massif dan terstruktur, tidak akan pernah menang di MK. Oleh sebab itu kalau sudah

kalah dan tidak punya bukti kuat, tidak usahlah memaksakan diri. Tidak ada orang yang menang karena memaksakan diri di MK, kecuali KPU yang curang,” tegasnya. Sementara itu tentang munculnya wacana bahwa penyelesaian sengketa Pilkada yang sejak 2008 ditangani oleh MK diserahkan kembali penangannya kepada Pengadilan Tinggi, Mahfud menegaskan tidak ada masalah dan cukup masuk akal. “Jadi saya tidak keberatan. Lagipula, jika begitu kan tidak perlu jauh-jauh ke Jakarta jika ada sengketa Pilkada di daerah,” ujarnya. (m08)

JAKARTA (Waspada): Pasangan Bupati- wakil bupati Tapanuli Tengah Bonaran Situmeang-Syukran Tanjung yang memenangkan Pilkada Sabtu lalu dengan perolehan suara 62,1 persen suara, diharapkan tidak menyia-nyiakan kepercayaan yang diberikan masyarakat Tapteng . “ Pemenang Pilkada Tapteng, setelah dilantik nantinya jadi kepala daerah harus membangun Tapteng untuk kemajuan dan kesejahteraan rakyat, serta tidak membeda-bedakan rakyat yang memilih atau bukan memilihnya. Seluruh rakyat Tapteg harus dibela, sebab mereka sudah menjadi pemimpin rakyat Tapteng, dan bukan pemimpih sekelompok rakyat, “ tegas putra daerah Tapteng Pirton Roul Hutagalung, menjawab Waspada, Senin (21/3) di Jakarta. Politisi muda ini sangat bersyukur sebab dalam pelaksanaan Pemilukada Tapteg , masyarakat dapat memberikan pilihannya dengan tenang, lancar dan sukses lalu. Dia yakin, kedewasan rakyat Tapteng dalam melaksanakan pesta demokrasi, sudah makin matang serta bisa dijadikan sebagai percontohan. “Saya bangga sebagai putra Tapteng, sebab masyarakat di sana sudah makin dewasa dalam berpolitik, dan mengedepankan hati nurani dalam menentukan pilihannya. Saya lebih bangga lagi, sebab Pemilukada tanpa keributan, “ tukasnya. Pirton berharap, kepercayaan rakyat jangan sampai disiasiakan pasangan Bonaran-Syukran dengan cara memberikan yang terbaik bagi Tapteng “ Bangun dan majukan Tapteng sehingga masyarakat merasakan kehadiran pemimpin yang mereka inginkan,” katanya.(aya)

JAKARTA (Waspada): Ketua Fraksi Partai Kebangkitan Bangsa ( FPKB), Marwan Ja’far mengakui telah ada beberapa kesepakatan baru di kalangan partai-partai anggota koalisi. Salah satu diantaranya untuk tidak saling serang antar anggota setgab koalisi, termasuk isu mengenai pergantian ketua harian setgab Aburizal Bakrie, ysng juga Ketua Umum Partai Golkar. “Kita sepakat untuk melakukan moratorium politik sehingga diharapkan kekompakkan koalisi akan terjaga gua terciptanya pemerintahan yang stabil,”ujar Marwan , Senin, (21/3), di Jakarta. Para anggota koalisi, terutama elit-elitnya, diharapkan dapat mengarahkan kader-kadernya untuk tunduk dengan apa yang telah menjadi kesepakatan. Selain itu, juga dibentuk lima kelompok kerja (pokja) meliputi bidang politik, energi, hankam, dan hukum. Dalam koalisi , juga memformulakan tiga level rapat, yakni rapat pimpinan fraksi dengan ketua harian Setgab dan sekretaris Setgab, rapat antara ketua-ketua umum dengan ketua harian setgab dan sekretaris setgab, dan rapat semua unsur setgab dan Presiden Susilo Bambang Yudhoyono. Marwan menjelaskan, dalam koalisi juga telah membreak down 11 kontrak politik. “Kita akan tegaskan kembali bahwa koalisi itu ada di pemerintahan dan di parlemen. Jadi tidak ada lagi yang bilang bahwa koalisi hanya dengan SBY. Tantang Lily dan Gus Coi Pada sisi lain Marwan Ja’far menantang dua kader PKB yang baru saja dipecat, Lily Wahid dan Effendy Choirie untuk bukabukaan daripada terus menyebar fitnah kepada PKB. “Selama ini kita (PKB) sudah sangat bersabar atas kiprah kedua mantan kadernya itu . Dari pada nama baik partai terus dicemarkan, tidak ada jalan lain selain memecat keduanya, tegas Marwan. Marwan menjelaskan berbagai upaya yang dilakukan PKB mulai dari mediasi, penawaran posisi untuk keduanya sampai meminta tolong kepada kerabat terdekat mereka, tidak mendapatkan sambutan. “Diinternal kami sudah membentuk tim fasilitator yang diketuai oleh senior PKB Ali Maschan Moesa. Tak kurang Ketua Umum Muhaimin Iskandar pun turun menawarkan berbagai hal sampai meminta tolong kepada anak-anaknya,” kata Marwan. (aya)

Ba’asyir Bantah Berikan Uang Ke Ubaid JAKARTA (Waspada): Terdakwa kasus terorisme Abu Bakar Ba’asyir membantah kesaksian Luthfi Haidaroh alias Ubaid, yang mengatakan Ba’asyir pernah memberikan uang untuk biaya pelatihan militer di pegunungan Jalin Jantho, Aceh. “Saya tidak pernah memberi uang satu sen pun kepada Ubaid,” kata Ba’asyir dalam lanjutan persidangan di Pengadilan Negeri Jakarta Selatan, Senin, 21 Maret 2011. Semua keterangan yang disampaikan Ubaid dalam sidang 14 Maret lalu, dianggap Ba’asyir tidak benar. Bahkan, menurut Ba’asyir, Ubaid telah mengundurkan diri dari Jamaah Anshorut Tauhid, jamaah yang dipimpin Ba’asyir, jauh sebelum Ubaid mengurus soal pelatihan di Aceh. Selain kesaksian Ubaid, dalam sidang ini Ba’asyir juga menanggapi kesaksian yang disampaikan Andriansyah, Udbah, Abu Yusuf, dan Muksin. Ba’asyir mengaku tidak tahu mengenai kesaksian yang diberikan, baik mengenai aliran dana terorisme maupun aktivitas yang mereka lakukan. “Saya tidak tahu soal ini. Masalah keuangan, saya juga tidak tahu,” ujar Ba’asyir. Selain itu, Ba’asyir juga membantah keterangan Abu Tholut yang menyebutnya sebagai Amir Jamaah Islamiah.(vvn)

Saksi Ba’asyir Tak Mau Disumpah

Bupati Terpilih Jangan Sia-siakan Kepercayaan Rakyat Tapteng

Koalisi Sepakat Tidak Saling Serang


TERDAKWA kasus terorisme Abu Bakar Ba’asyir memasuki ruang persidangan sebelum berlangsungnya sidang dengan di PN Jakarta Selatan, Senin (21/3). Jaksa Penuntut Umum (JPU) menghadirkan 6 saksi tetapi terdakwa dan tim Kuasa Hukumnya tidak mengikuti sidang karena menolak sistem mendengarkan saksi dengan teleconference.


DANA BOS: Dua murid Sekolah Dasar membawa sepatunya ketika berjalan di pematang sawah menuju sekolah di daerah Jorong Koto Tuo, Nagari Balai Gurah, Kec. Ampek Angkek, Sumbar, Senin (21/30). Kementerian Dalam Negeri bersama Kementerian Pendidikan Nasional akan menyiapkan sanksi bagi pihak yang terlambat mengucurkan dana bantuan operasional sekolah (BOS).

Peranan Mr Syafruddin Prawiranegara Perjuangkan Keuangan Daerah JAKARTA (Waspada): Jika memetik hikmah dari sejarah peranan Mr Syafruddin Prawiranegara tentang perimbangan pembangunan nasional dan daerah, tidak akan terjadi keluhan seperti yang disampaikan Presiden Susilo Bambang Yudhoyono mengenai kinerja pemerintah daerah menunjukkan belum terjalinnya kesatupaduan antara pusat dan daerah. Demikian sebagian kesimpulan yang tercermin dalam Seminar Pembangunan Nasional sebagai Totalitas Pembangunan Daerah (Menarik Hikmah dari Pergolakan daerah PRRI dan Permesta) sebagai rangkaian peringatan Satu Abad Mr Syafruddin Prawiranegara (19112011) di Gedung DPD RI Jakarta, Kamis (17/3). Ketua DPD RI Irman Gusman mengatakan, seminar ini merupakan kerjasama DPD RI dengan panitia Satu Abad Syafruddin Prawiranegara dalam mengenang perjuangannya sebagai salah satu tokoh nasional yang memiliki peranan yang besar dalam mewujudkan kemerdekaan dan mewujudkan cita-cita perjuangan daerah. Syafruddin Prawiranegara,

kata Irman, adalah pejuang di masa kemerdekaan, juga pernah menjabat sebagai Ketua Pemerintahan Darurat Republik Indonesia (PDRI) dan berdasarkan mandat dari Presiden Soekarno dan Wapres Hatta, secara de jure dan de facto Panglima Besar APRI ketika itu, Jenderal Soedirman berada dibawah komando PDRI. “Sayangnya bangsa Indonesia begitu melupakan peran Syafruddin Prawiranegara sebagai Presiden RI yang kedua dan kita seolah melupakan sosok tersebut dalam sejarah bangsa,”ungkap Irman. Irman Gusman tidak membantah Pemerintah Revolusioner Republik Indonesia (PRRI) dan Permesta adalah sejarah perjuangan bangsa yang sampai saat ini masih menyisakan pro dan kontra. “Apakah perjuangan PRRI dan Permesta merupakan bagian perjuangan menegakkan keadilan terhadap pembangunan dan kesejahteraan rakyat di daerah ataukah sebuah pemberontakan daerah sebagai akumulasi kekecewaan masyarakat daerah terhadap lemahnya kepemimpinan pusat ketika itu,”kata Irman.

DPD RI, ujar Irman lagi, berkeyakinan dalam menjalankan fungsinya memerlukan kawalan dari daerah dari seluruh provinsi Indonesia. “Perjuangan untuk memajukan daerah pada masa lampau pernah dilakukan melalui konfrontasi di daerah dan dianggap pemberontah dan sparatis. kini telah berganti perjuangan kepentingan daerah di parlemen sebagai lembaga politikdialamdemokrasiyangpenuh dengan peradaban,” tegasnya. Seminar di DPD RI dihadiri ratusan peserta yang memenuhi ruangan Nusantara IV Gedung Parlemen dan menghadirkan pembicara, Profesor Mestika Zed, Profesor Dr Nina Lubis dan Pakar Sejarah Universitas Sam Ratulangi Manado, Dr Raymond. Sekretaris Panitia Satu Abad Syafruddin Prawiranegara, Lukman Hakiem menyatakan, kesediaan DPD RI menyelenggarakan seminar ini merupakan yang pertama kali dilakukan oleh sebuah lembaga negara yang resmi. “Ini momen menggembirakan untuk meluruskan sejarah, seperti sasaran yang ingin capai agar bangsa kita berdamai dengan sejarah,” ujarnya.

Dengan seminar tersebut diharapkan DPD RI menjernihkan posisi PRRI yang sementara ini dinilai negatif oleh sebagian yang tidak kenal sejarahnya. “Kalaupun dinilai PRRI pemberontakan, langkah itu dulu adalah alternatif dan tujuannya untuk menguasai Jakarta bukan menguasai Indonesia dan jelasnya PRRI adalah konflik intern,”kata Lukman. Panitia menyerahkan seminar kepada lembaga DPD RI, karena kiprah perjuangan Mr Syafruddin Prawiranegara disuarakan oleh PRRI. “Perjuangan PRRI ketika itu salah satunya adalah perimbangan keuangan pusat dan daerah dan terbentuknya lembaga seperti yang sekarang disebut DPD. Ini tidak pernah terungkap da m sejarah. Ada lagi tokoh yang sudah dilupakan oleh sejarah ialah Mr Subardjo. Beliau penadatangan Piagam Jakarta yang sekarang menjadi pembukaan dalam UUD, mantan Menlu, tetapi belum mendapat gelar pahlawan nasional,”kata Lukman Hakiem. Rangkaian seminar Peranan Syafruddin Prawiranegara masih akan berlangsung di sejumlah kota besar. (j07)

JAKARTA (Waspada): Jaksa Penuntut Umum kembali menghadirkan saksi untuk terdakwa terorisme, Abu Bakar Ba’asyir secara telekonferensi. Salah satu saksi yang diperiksa hari ini menolak disumpah. Abu Yusuf mengaku tak masalah bersaksi namun dia menolak bersumpah dengan cara menaruh Al Quran di atas kepalanya. “Karena di agama saya tidak ada sumpah seperti itu,” kata saksi Abu Yusuf saat bersaksi telekonferensi di Pengadilan Negeri Jakarta Selatan, Senin (21/3). Salah satu hakim anggota, Hari Juantoro berupaya membujuk Abu Yusuf dengan memaparkan dasar hukum sumpah, termasuk sanksi jika tidak melakukannya. Sanksi tersebut berupa sandera selama 14 hari di rumah tahanan. Namun, Yusuf tetap bersikukuh pada pendiriannya. Jaksa Andi M Taufik pun meminta agar untuk sementara keterangan Abu Yusuf ditunda, diganti dengan saksi lainnya bernama Muksin. “Saya minta kepada Majelis Hakim agar saksi diganti Muksin,” kata Andi. Majelis Hakim perkara ini pun mengijinkan agar saksi Abu Yusuf ditangguhkan sementara dan diganti oleh Muksin yang juga seorang anggota Jama’ah Anshorut Tauhid (JAT). Dalam kesaksiannya, Muksin mengaku kenal dengan Ba’asyir yang juga Amir JAT. Dia pun mengaku pernah menerima uang Rp100 juta sebagai sumbangan untuk upaya jihad dari Haryadi Usman. Jaksa menuntut Ba’asyir dengan tuduhan merencanakan dan menggerakkan orang lain untuk melakukan tindak pidana terorisme. Menurut jaksa, Ba’asyir diduga merencanakan perbuatan itu sejak Februari 2009 hingga Maret 2010. “Diantaranya pelatihan kelompok bersenjata di Aceh dan Hamparan Perak,” tambah Jaksa. Setelah kesaksian Muksin ini, Yusuf lantas menyatakan bersedia disumpah. Dalam kesaksiannya, Yusuf mengaku tidak kenal dengan Abu Bakar Ba’asyir. “Saya pun bukan anggota JAT.” (vvn)

Abu Tholut: Rp100 Juta Untuk Beli Senjata JAKARTA (Waspada): Tersangka teroris, Imron Baihaqi alias Abu Tholut alias Musthofa, mengakui menerima uang bantuan total Rp 140 juta untuk pelatihan di Aceh. Uang itu sebagian besar digunakan untuk membeli persenjataan. Abu Tholut menyatakan hal tersebut saat bersaksi untuk terdakwa teroris, Abu Bakar Ba’asyir, melalui teleconference di Pengadilan Negeri Jakarta Selatan, Senin (21/3). “Saya tidak pernah meminta bantuan, tapi menerima uang. Yang pertama Rp40 juta dari Ubaid dan kedua Rp100 juta dari Abdul Haris,” kata Abu Tholut. Abu Tholut menjelakan, uang sebesar Rp40 juta dibagikan kepada Dulmatin sebesar Rp20 juta dan ke Abdullah Sonata Rp10 juta. “Yang Rp10 juta untuk keperluan saya untuk survei di Pulogadung dan Kampung Melayu mencari beberapa ihwan. Di Kampung Melayu saya ditelepon Dulmatin untuk ketemu orang yang ternyata Abdullah Sonata.” Menurut Abu Tholut, uang yang diberikan kepada Abdullah Sonata kemudian dipakai untuk membeli pistol. Pistol itu kemudian dititipkan ke rekannya, Wardi. Sedangkan untuk uang Rp100 juta, lanjut Dia, digunakan untuk berbagai kebutuhan. Misalnya, Rp22,5 juta untuk pembayaran satu pucuk senjata api AR-15 beserta pelurunya. Rp15 juta digunakan untuk pembayaran satu pucuk pistol automatis buatan Belgia. Sedangkan Rp 10 juta untuk membayar kontrakan selama berada di Tegal, dan Rp20 juta untuk uang muka pembelian mobil Xenia. “Sisanya untuk keperluan kontrakan di Bekasi,” ujarnya. Menurutnya, mobil Xenia itu kemudian digunakan untuk disewakan kepada orang lain. “Atas usulan Puji supaya mendapatkan dana, mobil direntalkan,” ujarnya. Meski demikian, Abu Tholut mengaku tidak pernah secara langsung melaporkan kegiatannya atau bertemu dengan terdakwa Abu Bakar Ba’asyir. “Saya bukan [dari] Ngruki dan tidak pernah bicara secara spesifik,” ujarnya.(vvn)


WASPADA Selasa 22 Maret 2011


Pabrik Nissan Buka Lagi Setelah lebih dari seminggu ditutup akibat gempa bumi yang disertai tsunami, perlahan industri otomotif Jepang mulai menggeliat. Nissan pun siap kembali membuka pabrik yang sebelumnya ditutup akibat bencana itu. Mulai Senin (21/3), Nissan Motor Co akan kembali membuka enam pabrik mereka yang berada di Jepang. Untuk langkah awal, Nissan akan memprioritaskan produksi suku cadang untuk mobilmobil di Jepang dan seluruh dunia.

Setelah itu, pada Kamis mendatang, Nissan akan mulai merakit kendaraan di lima dari enam pabrik mereka itu. Masalahnya, salah satu pabrik Nissan berada di kota Iwaki di Fukushima, dekat dengan pembangkit listrik tenaga nuklir yang bocor dan menyebabkan radiasi. Pabrik di Iwaki itu memproduksi komponen mesin V6. Karena itulah, Nissan kini mulai memperketat standar kualitas mereka untuk membebaskan produk-produknya dari bahaya radiasi nuklir.

“Ke depan, kami akan terus menerapkan semua langkah yang layak untuk meyakinkan masyarakat bahwa semua produk dari perusahaan kami tetap dalam standar keselamatan yang berlaku secara global,” ungkap Nissan dalam sebuah pernyataan singkat Minggu (20/3). “Dan sampai kami yakin bahwa setiap risiko kontaminasi benar-benar dihapus,” pungkas produsen otomotif Jepang ini. Sebelumnya pabrik Nissan di Jepang lumpuh akibat bencana gempa disertai tsu-


Colorado, yang diproduksi salah satu pabrik Chevrolet di Shreveport di Louisiana, AS.

nami yang melanda negeri matahari terbit itu. Bahkan akibat tsunami yang melanda, 2.300 mobil Nissan yang sudah siap dikirim sampai hanyut terbawa arus tsunami. Selain Nissan, Toyota juga sudah membuka pabrik yang membuat suku cadang pengganti pada 17 Maret 2011. Namun pabrik yang memproduksi mobil baru tetap ditutup sampai 22 Maret 2011. Sementara Mitsubishi sudah membuka kembali pabriknya pada 16 Maret. Tapi Ho n d a , b a r u b e re n c a n a membuka pabrik mereka pada tanggal 23 Maret mendatang. Pasokan Suku Cadang Bukan hanya pabrikan Jepang saja yang terpengaruh dengan gempa dan tsunami di Jepang, pabrikan negeri lain ikut terkena dampak tsunami. Pabrikan AS General Motors menghentikan sementara operasional satu pabriknya di AS. Seperti dilansir situs resmi GM, Senin (21/3) penghentian pabrik perakitan Shreveport di Louisiana selama seminggu ini terjadi karena kurangnya pasokan suku cadang sebagai dampak dari krisis di Jepang.

Pabrik berumur 30 tahun itu merupakan tempat bernaung sekitar 923 pekerja GM. Pabrik ini menghasilkan Chevrolet Colorado dan GMC Canyon. “Seperti produsen mobil global lainnya, kami akan mengikuti perkembangan di Jepang agar bisa menghitung dampak terhadap bisnis,” demikian pernyataan GM. Penghentian produksi ini membuktikan kekhawatiran para analis kalau penghentian produksi di Jepang akan menyebabkan minimnya pasokan suku cadang di dunia. Namun GM meyakinkan kalau pabrik tersebut akan segera beroperasi kembali. Seperti dilansir AFP, selain mobil, Jepang juga memproduksi suku cadang bagi pabrikan AS dan Eropa. Sementara itu, pabrikan mobil Opel juga menunda operasi pabrik di Spanyol karena kekurangan suku cadang elektronik. Asosiasi Opel memperkirakan 2.400 mobil tidak akan diproduksi. Sedankan Renault akan memotong hasil produksi hampir 20 persen di pabriknya di Busan, Korea Selatan. (dn/do/m47)

Dana besar dari pemerintah Thailand, untuk meningkatkan standard mobil.

Anggap Serius Indonesia Thailand Kucurkan Rp 1 T Kemunculan Indonesia yang ingin menjadi top manufaktur di kawasan ASEAN ditanggapi serius oleh Thailand. Tak heran, kini Negeri Gajah Putih itu gencar mengajak para perusahaan otomotif membuka pabrik perakitan. Pada tiga tahun ke depan, Thailand menargetkan peningkatan produksi kendaraan roda empat tiga kali lipat dibanding tahun ini. Pada 2011 ini produksi kendaraan Thailand mencapai 1,6 juta unit. Dalam keterangannya yang seperti dikutip Paultan, Senin (21/3), Pemerintah Thailand, melalui kabinetnya akan mengucurkan dana sebesar 3, 4 miliar baht atau hampir Rp1 triliun untuk mengembangkan industri automotif

Produksi Motor Honda Tetap Aman, Kawasaki Tak Terganggu Setelah bencana gempa 8,8 dan tsunami melanda Jepang, produksi dan pengiriman sepeda motor Honda untuk Indonesia tidak mengalami masalah. Bagaimana dengan pabrik di Jepang? “Walau pabrik Honda tidak terkena bencana, Ho n d a t e t a p m e n u t u p sementara pabriknya dari 15

hingga 20 Maret,” jawab Exekutive Vice President Director AHM, Johannes Loman, di Jakarta, pada satu acara di akhir pekan. Un t u k m e m b u k t i k a n amannya pasokan sepeda motor Honda, PT Astra Honda Motor (AHM) selaku Agen Tunggal Pemegang Merk (ATPM) sepeda motor Honda

XTrim Sumatera Expedition 2011:

kemarin tetap meluncurkan motor asal Jepang tersebut dengan dua tipe terbarunya New Honda Supra 125X dan Honda Absolte Revo Fit. “Masalah produksi tidak perlu khawatir 98 persen produksi Honda tetap berjalan dan masih tersedia, karena 2 persen hanya sebagian kecil dari bagian mesin,” jelas

Johannes Loman. Untuk penjualan model Honda terbaru, Johannes menargetkan New Supra X125 terjual 50.000 unit per bulan dan Honda Absolute Revo Fit mencapai 40.000 unit per bulan. Tak Terganggu Sementara, Kawasaki angkat bicara perihal kejadian gempa bumi dan tsunami

yang melanda Jepang . Sepeda motor Kawasaki yang memiliki fasilitas produksi utama yang terletak di Akashi dekat Kobe, Jepang tidak terpengaruh oleh guncangan dahsyat gempa. “Kami yakin, setiap kekurangan produksi dapat kembali mendapat pemasukanya bila kami bekerja keras selama

sisa satu bulan. Dan perusahaan akan melakukan yang terbaik untuk memenuhi kebutuhan dalam bisnis, namun mengenai kemanusian perusahaan memberikan perhatian terhadap korban bencana yang melanda Jepang,” jelas Kawasaki dalam sebuah pernyataanya yang di lansir Sabtu (19/3). (ae/oz/m47)

nasionalnya. Selama ini, Pemerintah Thailand mengaku mengalami kendala di bidang SDM yang terampil. Karena itu, produksi belum mampu memenuhi permintaan pasar yang semakin meningkat. Sebagian besar dari anggaran Rp 1 triliun, yakni sekira sekira Rp630 miliar akan digunakan untuk pelatihan dan pengembangan keterampilan tenaga kerja. Sisanya, Pemerintah Thailand akan menggunakannya untuk uji lapangan terpadu serta meningkatkan standard mobil dan suku cadang agar lebih dapat bersaing dengan negara lain. (pau/oz/m47)

XTrim Peduli Pendidikan Dan Lingkungan

Berkendara Di Atas Awan Bu p a t i S a m o s i r, M a ngindar Simbolon mengharapkan, mengharapkan peserta dapat menikmati kawasan Danau Toba, saat menjalani petualang XTrim Sumatera Expedition 2011, yang juga melintasi daerah yang dipimpinnya. “Selamat menikmati pemandangan Danau Toba. Anda nanti bisa mengendarai motor trail di atas awan, yang senantiasi menyelimuti perbukitan di Pulau Samosir,” ucap Bupati pada acara well come party di Hotel Toledo, Tuk-tuk Jumat (18/8) malam Mangindar selanjutnya mempersilahkan semuanya untuk mengeksplor keindahan Pulau Samosir dengan Danau Toba nya. “Silahkan nikmati, di sini ada tujuh jalur yang menantang, sementara yang akan dilalui tahun ini baru dua. Masih ada lima lagi yang dimiliki Samosir yang lebih potensial,” ucap Bupati. Dia tak menampik event touring menggunakan sepeda motor trail dapat merangsang minat wisatawan berkunjung ke Danau Toba, baik wisatawan lokal mau pun mancanegara. Mangindar juga mengharapkan, event trail diharapkan dapat merangsang tingkat kunjungan wisatawan ke Samosir karena lokasi wisata Pelepasan Peserta di Bukit, Beta, Tuk-tuk, Kab. Samosir Jumat (18/3). Gambar bawah, peserta harus melintasi sungai Deli di kawasan Pantai Nitra, Namorambe, sebagai rintangan alam terakhir, sebelum konvoi menuju garis finish di Medan, Minggu (20/5),

Paket Milyarder Yamaha Kejutan Untuk Konsumen Yamaha menjadi salah satu pabrikan sepeda motor yang gencar melancarkan paket promosi guna mendongkran penjualan mereka. Saat ini mereka sedang menggelar produk Milyarder Yamaha, dengan iming-iming hadiah utama untuk dua pemenang Rp dua milyar, yang terbagi Rp 1 milyar bagi pembeli Yamaha Non Matic type apa saja dan Rp 1 milyar lagi bagi pembeli matic. Uang satu miliar rupiah yang menjadi hadiah utama dalam undian Milyarder Yamaha Mio kini telah bertuah. Riki Syahputra menjadi konsumen Yamaha yang paling beruntung, setelah nomor undian miliknya, 116, keluar pada drawing di Jakarta, Sabtu, pekan lalu. Pemuda 22 tahun asal Jambi ini mengaku kaget, bahkan masih belum sepenuhnya menyadari kalau ia kini telah menjadi seorang milyarder. Sebanyak 126 konsumen yang berasal dari penjuru nusantara ini terpilih menjadi kontestannya. Yamaha sendiri tidak hanya menyediakan satu hadiah saja. Namun ada 25 paket umroh untuk konsumen yang beruntung, dan 100 batang emas untuk kontestan lainnya. Sementara itu, dari kawasan Sumut dan NAD yang berada di bawah naungan PT Alfa Scorpii

yang dimiliki Samosir tidak hanya Danau Toba semata, namun ada Danau Sidohoni, danau di atas danau. Danau Sidohoni terletak di Desa Ronggur Ni Huta, desa paling tinggi yang ada di Pulau Tomok. “Banyak lokasi wisata yang belum digarap secara maksimal. Semoga adanya event, dapat merangsang datangnya wisatawan. Tentu itu akan menyumbang PAD Samosir,” kata Bupati. Dukungan terhadap event, juga dilontarkan Walikota Medan Rahudman Harahap, ketika menyambut peserta di garis finish di halaman Istana Maimoon, Medan, Minggu (20/3), dalam acara yang dikemas meriah, yang disebutnya sebagai wujud dukungan Pemko Medan atas penyelenggaraan kegiatan. “Kita sengaja melakukan penyambutan ini secara meriah, karena kita Pemko Medan, ingin memperkenalkan wahana wisata dan budaya yang ada di Medan. Maka dari itu, acara finish kita adakan di Halaman Istana Maimoon dan menonjolkan kebudayaan yang ada di Medan. Seperti patung si galegale dan pagar ayu berbusana adat melayu,” kata Walikota. Dia juga menyakini, dengan penyambutan ini, para peserta yang datang dari bebagai daerah di Indonesia, khususnya dari luar Sumut dapat mengenal lebih dekat tentang Kota Medan. “Para peserta ini kan jumlahnya lebih kurang 350 orang dan 100 orang diantaranya datang dari luar, seperti Jakarta, Bandung, Kalimantan, Aceh dan daerah lainnya,” katanya. # Armansyah Th

Waspada/Armansyah Th

Ketua XTrim Doddy (tengah) didampingi Bupati Samosir Mangindar Simbolon, menanam bibit pohon di Pangururan, Kab. Samosir, Jumat (18/3). Trail mania peserta XTrim Sumatera Expedition 2011 ternyata tidak hanya “garang” dalam memacu kendaraaan di bukit terjal atau di medan berlumpur. Mereka juga peduli terhadap dunia pendidikan. Ini terbukti dengan penyerahan bantuan unit komputer kepada sekolahsekolah yang lokasi merekamenjadi pelintasan peserta. Di Sibolangit, Kab. Deli Serdang penyerahan komputer dilakukan secara simbolik oleh Ketua Umum XTrim Indonesia, Doddy kepa-da dua Kepala SD sesaat sebelum acara makan malam dan ramah tamah dengan pejabat Pemkab Karo yang digelar di Bumi Perkemahan Sibolangit, Sabtu (19/3) malam. Sebelumnya penyerahan komputer juga dilakukan di Pangururan, Kab. Samosir kepada empat sekolah di sana. Penyerahan komputer tersebut sebagai wujud dari komitmen klub XTrim yang peduli lingkungan dan pendi-



Calon milyarder Yamaha Mio asal Sumut dan Aceh diabadikan usai gelaran pengundian Milyarder Yamaha Mio.

diwakilkan tujuh konsumen. “Ini merupakan program milyarder pertama dari Yamaha. Kami memang ingin memberikan kejutan bagi para konsumen, dan kami berharap mereka dapat mewujudkan mimpi mereka, “ ujar GM Promotion and Motorsport PT Yamaha Motor Kencana Indonesia (YMKI), Paulus S Firmanto, sembari menambahkan program milyarder ini intinya adalah mewujudkan mimpi para konsumen menengah ke bawah. (m47)

HONDA: Revo 110 Jari-jari Revo 110 Racing Revo 110 Deluxe Scoopy Matic Supra X 125 Jari jari Supra X 125 CW Supra X 125 Injec R Vario Techno Std Blade 110 Blade 110 Repsol Mega Pro Jari-jari Mega Pro Racing Tiger Racing Revo Techno Matic CS 1

12.310.000 13.620.000 14.225.000 14.145.000 14.840.000 15.940.000 17.040.000 15.330.000 14.280.000 14.430.000 18.650.000 19.850.000 25.400.000 16.300.000 17.650.000

SUZUKI Shogun Axelo FL 125 SCD 14.700.000

Shogun Axelo FL 125 RCD 15.600.000 Shogun Axelo FL 125 RMCD 15.900.000 Satria FU 150CD 19.500.000 Spin UY 125S 12.275.000 Spin UY 125SC 13.000.000 Spin UY 125SCZ 13.350.000 Sky Drive UK 125SC 13.725.000 Thunder EN 125KS 15.950.000 Titan FW 115D 11.275.000 Titan FW 115SD 12.275.000 Titan FW 115 SCD 13.375.000 Shogun FL 125 SD 13.873.000 Shogun FL 125 RCD 15.055.000 Shogun FL 125 RCMD 15.275.000 Shogun FL 125 RCDZ 15.505.000 Sky Wave UW 125 SC 14.680.000 Sky Wave UW 125 SCZ 14.930.000

YAMAHA: Vega ZR Vega ZR-DB Mio Mio CW Mio Soul Mio CW SE Xeon Jupiter Z X 15 Jupiter Z X 15 CW Jupiter Z CW SE Jupiter MX CW Jupiter MX AT CW V-ixion V-ixion SE Byson Scorpio Z CW

12.068.000 12.597.500 12.225.000 13.053.000 14.006.000 14.045.000 16.125.000 14.434.500 15.199.000 15.673.500 16.997.000 16.272.000 21.446.500 23.594.500 20.258.000 23.906.000

* Sumber main dealer di Medan (m47)

dikan, dan selalu menjadi mata acara dalam rangkaian k e g i a t a n k l u b. S e b e l u m penyerahan komputer, di tempat yang sama juga sudah berlangsung acara penebaran 5.000 benih ikan ke Danau Toba, serta penanaman 1.000 pohon yang dipusatkan di Kab. Samosir, serta pelepasan burung-burung pada acara stard di Bukit Beta, Tuk-tuk. Dalam kesempatan itu, Bupati Samosir, Mangindar Simbolon mengatakan, pelepasan burung ke alam bebas sebagai simbol perdamaian dan menumbuhkan cinta lingkungan hidup. “Tidak hanya menyalurkan hobi mengendarai sepedamotor di lumpur, kegi-


atan touring juga diharapkan dapat menumbuhkan rasa cinta kepada lingkungan,” kata Simbolon. Ketua Xtrim Indonesia, Musa Idi Shah menyatakan, petualangan di lintasan lumpur tidak sekadar menyalurkan hobi, namun memupuk jiwa pantang menyerah dan saling menghargai, baik sesama manusia mau pun lingkungan sekitar. “Ini merupakan wujud kepedulian penggemar trail terhadap dunia pendidikan. Semoga bantuan ini dapat membantu siswa dalam proses belajar di sekolah, terutama menggali informasi lewat internet,” kata Doddy usai penyerahan. (m47)

Pakai Premium Saat Harga Pertamax Melonjak

Harga BBM non subsidi seperti Pertamax dan Shell semakin melonjak. Akibatnya banyak pemilik mobil yang tadinya sudah menggunakan Pertamax akhirnya memilih kembali menggunakan Premium. Memang ada kekuatiran, jika kembali menggunakan Premium, bisa berakibat fatal pada fuel pump Agar mobil tetap aman menggunakan Premium, Anda beberapa hal yang sebaiknya Anda lakukan: Pertama lakukanlah pengecekan secara rutin pada fuel pump kendaraan Anda. Minimal kelipatan jarak 20.000 km. Namun ini sesuai dengan pemakaian, daerah, dan jarak tempuh kendaraan tersebut. Kedua, kuraslah tangki bahan bakar secara berkala minimal 12 bulan pemakaian. Ketiga, bersihkan filter bensin setiap 15.000 km dan menggantinya setiap jarak 30.000 km. Keempat, bersihkanlah bagian injektor dengan Ultra Sonic Injector Cleaner secara berkala dengan memakan jarak 15.000 km. Kelima, jangan biarkan tangki bensin kosong terus. Jika sudah mencapai seperempat segera isi bensin. Keenam, pilih SPBU yang benar-benar terjamin kualitasnya. Anda yang ingin sedikit berimprovisasi bisa saja dengan menambahkan octane booster. Meski hanya akan membantu sedikit saja tetapi bisa membantu meningkatkan oktan bensin. Paling solusinya campur octane booster yang murni bukan yang include injector cleaner. Kalau ingin kerasa seperti Pertamax, dosisnya harus 2:1 alias 2 botol octane booster untuk 40 liter Premium. Namun tentunya jika mobil Anda tergolong mewah dan memiliki rasio kompresi mesin yang tinggi, bensin dengan oktan tinggi tetap harus dipakai. Minimal mobil akan menemui gejala knocking (ngelitik) terus menerus. (bbg sumber/m47))

Luar Negeri


WASPADA Selasa 22 Maret 2011

Jepang Alami Kerugian Ekonomi AS$235 M

Iran Usir Diplomat Bahrain Sebagai Tindakan Balasan

Akibat Gempa Bumi Dan Tsunami Yang Disusul Dengan Bencana Lain SINGAPURA (Antara/AFP): Gempa bumi dahsyat yang memicu tsunami Jumat diperkirakan merugikan ekonomi Jepang sebesar AS$235 miliar atau 4,0 persen dari produksi namun rekonstruksi akan memacu pemulihan pada 2011, kata Bank Dunia Senin (21/3). “Jika sejarah merupakan seluruh pemandu, pertumbuhan Produk Domestik Bruto (GDP) akan terpengaruh secara negatif melalui pertengahan 2011,” kata Bank Dunia dalam laporan terkini Ekonomi Pasifik dan Asia Timur. Perkiraan terendah Bank Dunia memperhitungkan dampak kerugian akibat kedua bencanasebesar122miliardolaryang setara dengan 2,5 persen GDP. Kepala Perekonomian Ka-

wasan Bank Dunia,Vikram Nehru mengatakan bencana tersebut juga akan mempengaruhi seluruh wilayah Asia namun dia juga menyatakan bahwa terlalu dini untuk memberikan perhitungan kerugian kawasan tersebut. “Dalam waktu dekat dampak terbesar akan dirasakan pada perdagangan dan keuangan,” kata Nehru. Bank Dunia mencatat bahwa setelah gempa bumi pada 1995 di Kobe, perdagangan Je-

pang melambat hanya dalam beberapa kuartal dengan bidang import pulih seluruhnya dalam satu tahun dan ekspor kembali pada tingkat 85 persen dari tingkat sebelum gempa bumi dalam periode yang sama. “Namun pada saat ini, gangguan terhadap jaringan produksi terutama dalam industri otomotif dan elektronik dapat terus menimbulkan masalah (lebih dari satu tahun),” kata pernyataan itu. Asap paksa pengungsian lagi Para pekerja untuk semen-

tara dievakuasi dari pembangkit listrik tenaga nuklir Fukushima yang terkena gempa di timurlaut Jepang, Senin (21/3), setelah kepulan asap tampak bergerak naik dari salah satu reaktor, menurut operator Tokyo Electric Power Co. “Karena masalah ini, operator untuk sementara me-narik para pekerja, dan memeriksa kondisi reaktor,” kata jurubicara itu. Pejabat lain TEPCO mengatakan, “kami telah mengevakuasi pekerja di dekat reaktor nomor tiga, bukan seluruh pembangkit

listrik tenaga nuklir Fukushima No 1.” Sementara pemadam kebakaran menyemprotkan air untuk membantu kolam reaktor mendinginkan balok bahan bakar. Sistem pendingin - yang dirancang untuk melindungi enam pabrik reaktor dari gempa berpotensi krisis - rusak akibat gempa bumi dan tsunami yang melanda pantai Pasifik di timurlaut Jepang 11 Maret. PM Naoto Kan sebelumnya mengatakan bahwa negara itu membuat kemajuan yang “lambat

tapi stabil” dalam upaya keras untuk mengendalikan situasi, menurut juru bicara pemerintah. Para ahli dari fasilitas yang rusak dan berlokasi 250 kilometer timur laut Tokyo tersebut saat ini harus memperbaiki sistem pendinginan yang tidak berfungsi dan membuatnya dapat beroperasi kembali sementara mobil pemadam kebakaran menyemprotkan air untuk membantu mendinginkan kolam penampungan batang bahan bakar reaktor.

Rakyat Mesir Setujui Perubahan Konstitusi

Tank Oposisi Dikerahkan Ke Jalanan Ibukota Yaman SANA’A, Yaman (AP): Tank-tank oposisi dikerahkan ke jalanan ibukota Sana’a, Yaman, Senin (21/3) setelah tiga panglima senior AD membelot ke satu gerakan yang menyerukan penggulingan Presiden Ali Abdullah Saleh yang didukung AS, yang menyebabkan dia hampir-hampir kehilangan dukungan di antara lembagalembaga paling kuat di negaranya. Mayjend. Ali Mohsen al-Ahmar, panglima Divisi Lapis Baja 1 di AD Yaman, merupakan komandan paling senior yang bergabung pada oposisi. Dia mengumumkan pembelotannya dalam satu pesan yang disampaikan oleh seorang pembantu terdekatnya untuk memprotes para pemimpinYaman di lapangan Sana’a yang menjadi pusat gerakan mereka. Sebagian dari tank dan kendaraan lapis baja yang dikerahkan ke lapangan Sana’a di mana para pemrotes berkemah untuk menyerukan pengunduran diri Saleh, yang pasukannya melepaskan tembakan dari atap-atap bangunan yang menewaskan lebih dari 40 demonstran. Dua panglima AD lainnnya juga dilaporkan telah mengundurkan diri. Pengumuman itu muncul sehari setelah presiden memberhentikan seluruh Kabinetnya yang nampaknya sebagai respon terhadap pemerintahannya. Dia meminta mereka agar tetap menjalankan tugasnya sebelum terbentuknya Kabinet baru. Sementara di utara, 20 orang tewas akibat pertempuran, demikian kata laporan. Bubarkan Kabinet Presiden Ali Abullah Saleh membubarkan para menteri kabinetnya, menurut Tareq Al-Shami, jubir partai berkuasa di negara itu, namun meminta para pejabat untuk tetap melaksanakan tugasnya sampai cabinet baru dilantik. Tindakan Minggu itu dilakukan menyusul pengunduran diri dua pejabat penting Yaman sebagai protes terhadap penindasan yang dilakukan pemerintah atas para pengunjukrasa yang menyebabkan 52 orang tewas minggu lalu. Berita tentang mundurnya Menteri HAM Huda al-Bann berasal dari seorang pejabat di kantornya. Seorang pejabat di kementrian luar negeri mengatakan kepada CNN tentang pengunduran diri Abdullah Al-Said, Dubes Yaman untuk PBB. Al Said digantikan oleh Abdullallah Yahya Alsalal, menurut kedutaan Yaman di AS. Pengunduran diri kedua pejabat itu menunjukkan terjadinya keretakan dalam dukungan bagi Saleh. Anggota senior partai berkuasa Mohammed Abulahoum mengatakan, Saleh ‘sebaiknya mempertimbangkan dengan serius strategi pengunduran diri yang baik dan aman’ guna ‘mempersiapkan dasar bagi pengalihan kekuasaan Yaman dari dirinya ke presiden berikutnya’. Abulahoum mengecam ‘keras’ kekerasan berdarah Jumat lalu, dan sebagai sikap protesnya, dia menarik rencana usulan mediasi antara sang presiden dan pihak oposisi. Para anggota suku pimpinan Saleh juga menyerunya untuk mundur, menurut sejumlah pejabat di partai berkuasa Yaman.(m23/m10)

KAIRO, Mesir (Antara/Reuters): Indikasi awal referendum menunjukkan bahwa mayoritas rakyat Mesir mendukung perubahan konstitusi yang akan memungkinkan militer segera melangkah ke arah pemilihan umum, kata satu sumber pengadilan. Pemungutan suara parlemen Minggu (20/3), jika hasil referendum itu dikonfirmasi, bisa dilaksanakan paling cepat September. Kelompok oposisi Ikhwanul Muslimin dan sisa-sisa partai berkuasa mantan Presiden Hosni Mubarak menyerukan suara ‘ya’ dalam referedum itu. Para analis mengatakan, mereka akan menjadi pihak-pihak yang paling diuntungkan jika pemilihan umum segera dilaksanakan. Reformis mendesak rakyat memberikan suara ‘tidak’ dengan alasan mereka menginginkan konstitusi disusun ulang. Buntut dari demonstrasi mematikan selama lebih dari dua pekan di Mesir, Presiden Hosni Mubarak mengundurkan diri Jumat (11/2) setelah berkuasa 30 tahun dan menyerahkan kekuasaan kepada Dewan Tertinggi Angkatan Bersenjata, sebuah badan yang mencakup sekitar 20 jendral yang sebagian besar tidak dikenal umum sebelum pemberontakan yang menjatuhkan pemimpin Mesir itu.

Bandit Serbu Bank Kamerun, Larikan Uang 400.000 Dolar The Associated Press

PARA PERWIRAYaman menunjukkan reaksinya ketika bergabung dengan pemrotes anti-pemerintah yang menuntut pengunduran diri Presiden Ali Abdullah Saleh, di Sana’a, Yaman, Senin (21/3). Tiga panglima tentara Yaman, termasuk seorang jenderal terkemuka, membelot kepada oposisi yang menyerukan diakhirinya kekuasaan Presiden Ali Abdullah Saleh, ketika tank tentara dan kendaraan lapis baja lainnya dikerahkan untuk mendukung ribuan pemrotes di ibukota Sana’a.

Liga Arab Kecam Serangan Ke Libya KAIRO, Mesir (Antara/AFP): Liga Arab mengecam serangan militer Barat terhadap Libya, sepekan setelah mereka mendesak PBB memberlakukan zona larangan terbang di negara Afrika Utara yang kaya minyak itu. “Apa yang terjadi di Libya berbeda dari tujuan penerapan zona larangan terbang dan yang kami inginkan adalah perlindungan warga sipil dan bukan pemboman warga sipil lain,” kata Sekjen Liga Arab Amr Mussa

kepada wartawan Minggu (20/ 3). Pesawat-pesawat tempur Prancis juga melancarkan serangan udara. Mussa mengatakan, persiapan sedang dilakukan untuk mengadakan sidang darurat Liga Arab yang beranggotakan 22 negara, dengan pembahasan utama mengenai Libya. Ratusan orang tewas dalam penumpasan brutal oleh pasukan pemerintah dan ribuan warga asing bergegas meninggalkan Libya

pada pekan pertama pemberontakan itu. Khadafi, 68, adalah pemimpin terlama di dunia Arab dan telah berkuasa selama empat dasawarsa. Khadafi bersikeras akan tetap berkuasa meski ia ditentang banyak pihak. Di Tunisia, demonstran juga menjatuhkan kekuasaan Presiden Tunisia Zine El Abidine Ben Ali pada Januari. Ben Ali meninggalkan negaranya pertengahan Januari

setelah berkuasa 23 tahun di tengah tuntutan yang meningkat agar dia mengundurkan diri meski dia telah menyatakan tidak akan mengupayakan perpanjangan masa jabatan setelah 2014. Dia dikabarkan berada di Arab Saudi. Dia dan istrinya serta anggota-anggota lain keluarganya kini menjadi buronan dan Tunisia telah meminta bantuan Interpol untuk menangkap mereka.

dianggap penting’ untuk memaksa Irak keluar dari Kuwait, jika Saddam Hussein mengabaikan batas waktu yang ditetapkan. Kesamaah itu tidak berakhir di situ. Koalisi yang telah menghimpun kekuatannya untuk mengusir Hussein keluar dari Kuwait, juga melibatkan pasukan yang luar biasa dari negaranegara Muslim seperti Arab Saudi dan Pakistan. Demikian juga terhadap Libya, zona larangan terbang akan dikenakan oleh Qatar bersama dengan kekuatan Barat seperti Prancis dan Inggris. Ini semua agak bertentangan dengan usaha yang tidak efektif GeorgeW. Bush untuk mengumpulkan dukungan internasional untuk melakukan invasi ke Irak tahun 2003. Tidak ada resolusi yang secara eksplisit menguasakan penggunaaan kekuatan militer terhadap Hus-

sein dan tidak ada negara Islam yang berpartisipasi dalam invasi Amerika dan pendudukan Irak. Memang, sebelum invasi Maret 2003 ke Irak, parlemen Turki memberikan suara menentang kemungkinan pasukan Amerika melintasi Turki untuk menyerang Irak Utara. Perasaan anti-Amerika di dunia Islam bangkit akibat Perang Irak nampaknya tidak akan menjadi pengulangan oleh aksi militer terhadap Libya, karena Khadafi secara luas dicerca di dunia Arab. Dan kenyataannya bahwa baik Liga Arab dan PBB telah menyetujui aksi militer terhadap Khadafi yang dengan kuat menegaskan bahwa intervensi ke Libya tidak akan menimbulkan satu gelombang baru anti-Amerika di dunia Islam. (cnn/mujo)

Mengapa Libya 2011 Bukan Irak 2003 SUATU kritikan terhadap campur tangan militer Amerika Serikat di Libya yang tak diragukan lagi akan menjadi kebiasaan di hari-hari mendatang. Bahwa pemerintahan (Presiden AS Barack) Obama telah membuat kesalahan besar karena memulai perang dengan negara Muslim ketiga. Dia seolah-olah ingin membalikkan momentum peperangan Moammar Khadafi melawan pemberontak yang akan memutarkan lagi cerita bencana pada perang melawan Saddam Hussein. Satu elemen yang lebih jauh lagi dari tinjauan ini bahwa — apapun hasil dari intervensi di Libya itu — adalah sikap AS di dunia Islam sekali lagi akan rusak parah karena serangan terhadap negara Islam lainnya Tentu saja, ada beberapa

persamaan yang nyata anta-ra Hussein dan Khadafi, sebagian nampak benar-benar mirip antara Hussein dan Khadafi — keduanya diktator kejam dan rezim kaya minyak yang suka berperang dengan tetangga mereka, brutal terhadap penduduk mereka sendiri dan berusaha mendapatkan senjata pemusnah massal serta sama tidak menarik bagi putra-putranya untuk diwarisi. Kualitas situasi yang tak menentu di Libya dapat membantu untuk menjelaskan jajak pendapat terbaru yang diambil sebelum intervensi yang menemukan bahwa Amerika terpecah dan ternyata sedikit sekali yang setuju untuk memaksakan zona larangan terbang di atas Libya. Hampir semua responden menentang aksi militer AS yang lebih kuat di Libya. Bahwa intervensi militer yang

TEHERAN, Iran (Antara/AFP): Iran meminta seorang diplomat Bahrain agar meninggalkan negara itu sebagai pembalasan atas pengusiran seorang diplomat republik Islam tersebut dari Manama, kantor berita resmi IRNA melaporkan. “Setelah tindakan pemerintah Bahrain yang tak logis dan tidak dapat dimengerti, khususnya mengusir salah seorang diplo-mat kami, sebagai pembalasan atase di kedutaanbesar Bahrain itu telah dipanggil dan diberitahu bahwa satu dari diplomat-diplomat kedutaan besar itu harus meninggalkan Iran,” kata jurubicara kementerian luar negeri Iran Ramin Mahman-parast Minggu (20/3). “Menanggapi permintaan sah penduduk menjamin stabilitas dan kekebalan pemerintah, sementara represi terhadap protes damai dan tindakan tak logis hanya memperburuk krisis dan memperdalam luka,” kata dia. Teheran menyatakan Manama telah membuat “kesalahan strategis” dengan meminta tentara Teluk untuk membantu memadamkan demonstrasi pro-demokrasi di kerajaan sangat kecil itu. Menteri Pertahanan AhmadVahidi mengatakan pada kantor berita resmi IRNA bahwa Bahrain yang mayoritas Syiah tapi diperintah oleh Muslim Sunni telah melakukan blunder “strategis dan politis” yang akan mengorbankan “keabsahan”nya. Sedikitnya tiga orang tewas Rabu ketika pasukan keamanan menembakkan gas air mata dan senapan menyerang kamp pro-demokrasi di persimpangan Lapangan Mutiara di pusat ibukota Bahrain itu. Ratusan orang terluka dalam kerusuhan itu, dan pe-merintah telah dituduh melakukan kejahatan terhadap hukum internasional karena menutup rumah sakit dan menyerang dokter yang berusaha untuk merawat orangorang yang terluka.

dikuasakan Presiden Obama terhadap Libya Sabtu — delapan tahun setelah Presiden GeorgeW. Bushmengumumkandimulainya Operasi Pembebasan Irak — adalah operasi yang sangat berbeda dari invasi Irak 2003. Ada perbedaan yang jelas bahwa Obama tidak memberikan wewenang bagi penggunaan pasukan darat AS di Libya dan beberapa perbedaan lain yang perlu dipertimbangkan: Pertama, pemerintah Obama telah memperoleh satu hadiah dari Liga Arab, yang dalam sejarahnya selama enam dasawarsa telah mengumpulkan reputasi baik yang diperoleh sebagai organisasi yang selalu bertindak lemah, tetapi seminggu lalu Liga Arab telah mengambil sikap yang tidak biasanya dengan memberikan persetujuan zona larangan terbang di atas Libya. Persetujuan itu membuat

Liga Arab berjalan di luar jalur, dengan memenuhi harapan pemerintahan Obama. Aksi tak terduga Liga Arab memberikan dorongan pada pemerintah AS untuk melakukan langkah diplomatik terselubung ke Dewan Keamanan PBB guna mengamankan resolusi yang luas tidak hanya mendukung zona larangan terbang, tetapi juga memungkinkan negara-negara anggota untuk ‘mengambil semua langkah yang diperlukan’ untuk melindungi warga sipil di Libya. Resolusi PBB ini mengingatkan pada langkah yang sama oleh Presiden George HW Bush pda November 1990, yang memberikan Irak enam minggu untuk menarik diri dari Kuwait setelah invasi Hussein ke negara itu. Resolusi PBB 1990 itu juga memberikan kekuasaan pada negara-negara lain untuk menggunakan ‘semua tindakan yang

DOUALA, Kamerun (AP): Televisi negara Kamerun mengatakan, 15 pria bersenjata menyerbu satu bank dengan granat dan kemudian melarikan diri dengan menggunakan perahu cepat dalam kejar-kejaran yang berubah menjadi ajang perang senjata. Televisi itu mengatakan Minggu (20/3), sedikitnya tujuh orang tewas, dan pejabat bank mengatakan perampok berhasil mem-bawa lari uang sebesar 400.000 dolar. Dua di antara pria bersenjata itu berhasil ditangkap setelah serangan di kota Douala itu. Pejabat setempat Fai Yengo Francis mengatakan, seorang tentara tewas dalam usaha mengejar para perampok. Seorang perampok dan lima orang lainnya tewas. Pejabat di angkatan bersenjata Sona Mbengue mengatakan, insiden itu mirip kejadian tiga tahu lalu yang dituding para pejabat dilakukan para perompak dari Nigeria. Serangan perompan meningkat di Nigeria dalam beberapa tahun terakhir.(m23)

Warga Syria Berduka Atas Korban Tewas Aksi Protes DARAA, Syria (AP): Para pemuda yang berduka sambil meneriakkan tembakan ‘Jangan ada lagi ketakutan!’ mengadakan pawai melalui satu kota Syria di mana para pemrotes antipemerintah melakukan konfrontasi maut dengan pasukan keamanan beberapa hari terakhir. Seorang wartawan The Associated Press di Daraa mengatakan polisi anti-huruhara bersenjatakan tongkat memburu kerumunan demonstran Senin (21/3), namun tidak ada korban. Namun aksi kekerasan akhir-akhir ini di Daraa mengisyaratkan bahwa kerusuhan di salah satu negara Arab lainnya kini sedang mengakar. Para aktivis HAM mengatakan pasukan keamanan melepaskan tembakan ke arah para pemrotes di Daraa Jumat yang menewaskan lima orang. Selama dua hari, pasukan keamanan menutup kawasan itu ketika para pemrotes yang marah membakar sejumlah gedung pemerintah. Para pemrotes berkumpul Senin untuk memperingati para korban tewas dalam kerusuhan. Kekerasan mempercepat datangnya tantangan besar bagi Presiden Bashar Assad. Ratusan demonstran membakar gedung pengadilan, beberapa bangunan lainnya dan mobil di kota Daraa di Syria Selatan dalam protes keras. Kekerasan itu terjadi setelah sedikitnya satu orang tewas dan lebih dari 100 orang terluka, termasuk dua orang dalam keadaan kritis, ketika pasukan keamanan menggunakan rentetan peluru tajam terhadap ribuan demonstran pada hari ketiga langsung demonstrasi di kota tersebut, kata beberapa aktivis hak asasi manusia. Para demonstran di Daraa, tempat lima orang tewas Jumat, menurut kelompok-kelompok hak asasi manusia, menuntut diakhirinya 48 tahun undang-undang darurat, pembebasan para tawanan politik dan kebebasan yang lebih besar. (m10)


WASPADA Selasa 22 Maret 2011

Minggu, 20 Maret Sunderland vs Liverpool Chelsea vs Man City

Sabtu, 19 Maret

Aston Villa vs Wolves Blackburn vs Blackpool Man United vs Bolton Stoke City vs Newcastle Tottenham vs West Ham West Brom vs Arsenal Wigan vs Birmingham Everton vs Fulham

0-2 2-0 0-1 2-2 1-0 4-0 0-0 2-2 2-1 2-1

Pencetak Gol Terbanyak 20 Dimitar Berbatov (MU) 18 Carlos Tevez (Man City) 10 Clint Dempsey (Fulham) Didier Drogba (Chelsea) Javier Hernandez (MU) Odemwingie (West Brom) Van der Vaart (Tottenham)

Klasemen Liga Premier Man United 30 Arsenal 29 Chelsea 29 Man City 30 Tottenham 29 Liverpool 30 Bolton 30 Everton 30 Sunderland 30 Stoke City 30 Newcastle 30 Fulham 30 Blackburn 30 Aston Villa 30 Blackpool 30 West Brom 30 West Ham 30 Wolves 30 Birmingham29 Wigan 30

18 17 16 15 13 13 10 9 9 11 9 7 9 8 9 8 7 9 6 6

9 7 6 8 10 6 10 13 11 4 9 14 6 9 6 9 11 5 13 12

3 5 7 7 6 11 10 8 10 15 12 9 15 13 15 13 12 16 10 12

64-30 59-29 53-24 45-27 41-34 41-36 42-41 40-39 33-37 36-38 44-45 33-33 39-51 37-51 45-60 41-56 36-49 35-49 28-41 29-51

63 58 54 53 49 45 40 40 38 37 36 35 33 33 33 33 32 32 31 30

Minggu, 20 Maret: Napoli vs Cagliari Fiorentina vs Roma Bari vs Chievo Bologna vs Genoa Inter Milan vs Lecce Juventus vs Brescia Sampdoria vs Parma Udinese vs Catania

Sabtu, 19 Maret: SS Lazio vs Cesena Palermo vs AC Milan

2-1 2-2 1-2 1-1 1-0 2-1 0-1 2-0 1-0 1-0

Pencetak Gol Terbanyak: 25 Antonio Di Natale (Udinese) 22 Edinson Cavani (Napoli) 19 Samuel Eto’o (Inter Milan) 18 Marco Di Vaio (Bologna) 16 Alessandro Matri (Juventus) 14 Zlatan Ibrahimovic (Milan) 12 Giampaolo Pazzini (Inter) Alexis Sznchez (Udinese)

Klasemen Liga Seri A AC Milan Inter Milan Napoli Udinese Lazio AS Roma Juventus Palermo Fiorentina Bologna Cagliari Genoa Chievo Parma Catania Sampdoria Cesena Lecce Brescia Bari

30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30

18 18 18 17 16 14 12 13 10 11 11 10 8 7 8 7 7 7 6 3

8 6 5 5 6 8 9 4 11 10 6 9 11 11 8 10 8 7 8 8

4 6 7 8 8 8 9 13 9 9 13 11 11 12 14 13 15 16 16 19

51-22 56-32 46-27 56-30 36-25 47-41 45-38 45-46 35-31 33-37 36-36 29-33 30-32 29-41 25-40 25-34 25-41 31-52 24-38 17-45

62 60 59 56 54 50 45 43 41 40 39 39 35 32 32 31 29 28 26 17

Minggu, 20 Maret Ath Bilbao vs Villarreal Deportivo vs Levante Hercules vs Osasuna Malaga vs Espanyol Santander vs Sociedad S Gijon vs Almeria Valencia vs Sevilla

Sabtu, 19 Maret

Atletico vs Real Madrid Barcelona vs Getafe Mallorca vs Zaragoza

A9 0-1 0-1 0-4 2-0 2-1 1-0 0-1 1-2 2-1 1-0

Pencetak Gol Terbanyak 27 Lionel Messi (Barcelona) Cristiano Ronaldo (Madrid) 17 David Villa (Barcelona) 15 Fernando Llorente (Bilbao) 13 Pedro Rodriguez (Barcelona) 12 Sergio Aguero (Atletico) Salomon Rondon (Malaga) 11 Felipe Caicedo (Levante) Nilmar (Villarreal)

Klasemen Liga Primera Barcelona Real Madrid Villarreal Valencia Espanyol Ath Bilbao Sevilla Atl Madrid Mallorca Levante Osasuna Sociedad Getafe Santander S Gijon Deportivo Zaragoza Malaga Almeria Hercules

29 29 29 29 29 29 29 29 29 29 29 29 29 29 29 29 29 29 29 29

25 23 16 16 14 13 12 11 11 10 9 11 9 8 7 7 7 8 5 7

3 1 4 2 6 7 6 7 1 14 3 13 6 11 6 12 5 13 5 14 8 12 2 16 7 13 9 12 11 11 10 12 9 13 5 16 11 13 5 17

81-15 78 69-21 73 48-30 54 42-33 54 37-41 43 44-41 42 43-43 42 42-39 39 30-38 38 30-39 35 34-33 35 39-48 35 39-45 34 28-43 33 27-35 32 23-39 31 28-40 30 38-59 29 30-48 26 25-47 26

Minggu, 20 Maret AS Monaco vs Nancy Caen vs Arles-Avignon Marseille vs Paris SG

Sabtu, 19 Maret Auxerre vs Sochaux Lorient vs St Etienne Montpellier vs Rc Lens Lyon vs Stade Rennes Stade Brest vs Lille Toulouse vs Nice Valencs vs Bordeaux

Klasemen Ligue 1

0-1 2-0 2-1 2-0 0-0 1-4 1-1 1-2 1-1 2-2

Pencetak Gol Terbanyak 19 Moussa Sow (Lille) 16 Kevin Gameiro (Lorient) 14 Youssef El Arabi (Caen) 13 Anderson Nene (Paris SG) 12 Gervinho (Lille) Lisandro Lopez (Lyon) 11 Modibo Maiga (Sochaux) Gregory Pujol (Valencs)

Lille 28 15 10 3 49-27 55 Marseille 28 14 9 5 41-24 51 Rennes 28 14 8 6 32-21 50 Lyon 28 13 10 5 47-26 49 Paris SG 28 12 9 7 42-30 45 St Etienne 28 10 9 9 35-33 39 Montpellier 28 10 9 9 24-30 39 Bordeaux 28 9 11 8 37-34 38 Lorient 28 10 8 10 35-34 38 Toulouse 28 11 4 13 29-30 37 Sochaux 28 10 5 13 40-35 35 St Brest 28 9 8 11 28-32 35 Caen 28 9 8 11 31-38 35 AS Nancy 28 10 5 13 30-41 35 Nice 28 8 10 10 19-28 34 Valencs 28 7 12 9 33-31 33 Auxerre 28 6 14 8 32-34 32 Monaco 28 5 14 9 26-29 29 Rc Lens 28 6 10 12 28-42 28 Arles 28 1 9 18 16-55 12 (jonny/afp/espn)

Biru Bicara Gelar Lagi LONDON (Waspada): Pelatih Chelsea Carlo Ancelotti mulai bicara gelar Liga Premier lagi, setelah skuadnya mengalahkan Manchester City 2-0.


STRIKER Napoli Edinson Cavani (kiri) mengalahkan bek Cagliari Simone Missiroli dalam duel udara di San Paolo Stadium, Senin (21/3) dinihari WIB.

Mourinho Suka Napoli ROMA (Waspada): Entrenador Real Madrid Jose Mourinho mengaku suka dengan Napoli yang kini bertengger di posisi ketiga klasemen Liga Seri A. “Kota itu adalah tempat hebat untuk bermain sepakbola,” tutur Mourinho, seperti dilansir Goal, Senin (21/3). “Saya hanya bisa membayangkan betapa indahnya suatu saat membawa Real Madrid ke San Paolo melawan Napoli di Liga Champions,” jelasnya lagi. Mourinho pun yakin, Napoli memiliki kemampuan menarik pemain top dunia untuk bergabung. Selain karena prestasi menembus papan atas Seri A, juga karena gaya hidup di Naples merupakan salah satu daya tarik utama mantan klub Diego Maradona itu. “Naples kota yang menyenangkan. Saya menikmati setiap mendampingi tim bermain di San Paolo,” beber mantan manajer Inter Milan, Chelsea dan FC Porto tersebut. “Saya berteman dekat dengan Diego Maradona dan setiap kali kami berkomunikasi, arah pembicaraan selalu mengerucut ke Na-

ples,” katanya menambahkan. Napoli memantapkan posisinya di urutan ketiga Seri A, setelah menaklukkan tamunya Cagliari 2-1, Minggu (Senin WIB). Kemenangan ini melanjutkan tren positif I Partenopei sepanjang musim ini. Edinson Cavani kembali menjadi pahlawan dengan memborong gol kemenangan Napoli, yang hanya terpaut tiga poin dari pemuncak klasemen AC Milan. Gol pertama penyerang Uruguay itu tercipta melalui tendangan penalti menit 49, setelah bek Cagliari Lorenzo Ariudo menjatuhkan Ezeguiel Lavezzi di kotak terlarang. Cagliari langsung bereaksi. Belum genap sepuluh menit tuan rumah berpesta, Robert Acquafresca menyamakan kedudukan setelah menerima umpan Cossu dari sektor kanan. Berselang empat menit, Marek Hamsik memberikan umpan cantik pada Cavani yang lepas dari jebakan off-side. Penyerang Uruguay itu lantas mengelabui kiper lawan yang coba menutup pergerakannya. (m15/goal/tf )

“Kami masih mempunyai sembilan pertandingan untuk dimainkan dan kami harus melakukan yang terbaik,” ucap Ancelotti, seperti dikutip dari AFP, Senin (21/3). Si Biru naik ke peringkat tiga, tapi tertinggal sembilan poin di belakang pemimpin klasemen Manchester United dan empat angka di bawah tim peringkat dua Arsenal. “Kami mesti mencoba untuk menang di setiap laga. Manchester United menang, jadi selisih tetap sama,” tekad Ancelotti. “Sekarang akan ada masa istirahat untuk laga internasional. Ketika pemain kembali, saya ingin mereka mempunyai semangat dan sikap yang sama,” tambah pelatih asal Italia itu. Dua gol kemenangan The Blues atas The Citizens di Stamford Bridge, London, Minggu (SeninWIB), disumbangkan bek David Luiz menit 77 dan Ramires pada injury-time. Bomber termahal Biru yang dibeli seharga 50 juta dolar dari Liverpool, Fernando Torres, kembali gagal mencetak gol. Gol London Blues bahkan baru tercipta setelah striker Spanyol itu digantikan Didier Drogba. “Duel berjalan ketat. Kami siap menghadapi setiap partai

dan kami terus bekerja keras untuk memenanginya,” jelas gelandang Chelsea Michael Essien. Seperti bosnya, kapten Ghana itu juga kembali bernyali untuk bicara mempertahankan mahkota Premiership. “Jadi lihat saja apa yang terjadi nanti,” tegasnya dalam Sky Sports. Essien pun mengklaim timnya akan terus berjuang merebut setiap poin hingga akhir musim. “Kami harus yakin bisa melakukannya dan masih panjang jalan menuju akhir musim,” katanya menambahkan. Mancini rawan The City yang tidak diperkuat mesin golnya Carlo Tevez karena memar pada pahanya, mengawali laga dengan kesigapan Yaya Toure menjinakkan kiper Petr Cech. Tim tamu sempat menekan Biru terutama melalui bomber Bosnia Edin Dzeko, tapi tetap tak mampu mengoyak gawang Cech. Pelatih City Roberto Mancini menjadikan faktor kelelahan sebagai penyebab utama kegagalan pasukannya di London. Pasalnya, Citizens baru mentas di Liga Europa, Kamis lalu.

Heynckess Diskusi Bayern


BERLIN (Antara/AFP): Pelatih Bayer Leverkusen Jupp Heynckes (foto) akan mendis-kusikan masa depannya dengan manajemen klub, saat pers Jerman menjadikannya favorit mengambil-alih Bayern Munich. “Saya akan diskusi dengan para bos Senin (21/3) setelah sesi latihan. Saya berharap akan mempublikasikan keputusan saya segera sesudahnya,” jelas Heynckes. Dia menyatakan demikian, Minggu (Senin WIB, setelah timnya menang 2-0 atas FC Schalke 04 pada laga lanjutan Bundesliga. Kontraknya bersama Leverkusen selesai pada akhir musim ini, namun Heynckes santer disebutkan akan menggantikan Louis van Gaal di Munich. Namun Heynckes, teman dekat Presiden Bayern Uli Hoeness, bisa tergoda melatih FC Hollywood untuk ketiga kalinya. Sebelumnya, dia memenangi dua gelar Bundesliga bersama Bayern antara 1987 dan 1991. Heynckes pun pernah melatih Bayern untuk lima laga pada akhir musim 2009, setelah raksasa Bavarian itu memecat mantan pelatih Jerman Jurgen Klinsmann.

Rakitic Permalukan Valencia


MADRID (Waspada): Sevilla mempermalukanValencia pada laga La Liga Primera di Stadion Mestalla, Minggu (Senin WIB), lewat gol tunggal Ivan Rakitic (foto) menit 70. Berhasil mencuri bola rebound, Rakitic dengan mudah menjebol gawang tuan rumah yang dikawal kiper Vicente Guaita Panadero. Hasil ini membuat Valencia digeser Villarreal dari peringkat tiga, sedangkan

Problem Catur Hitam (utara) melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2.

Sevilla masih tertahan di papan tengah. Jesus Navas menjadi orang pertama yang mendapatkan peluang bagi Sevilla. Navas sempat berdiri leluasa di dalam kotak penalti Los Ches, tapi tendangannya masih belum menemui sasaran. Striker Valencia Roberto Soldado dijatuhkan di kotak terlarang oleh Mouhamadou Dabo, tapi wasit memutuskan


tidak ada pelanggaran. Di San Mames, Villarreal menaklukkan tuan rumah Athletic Bilbao 1-0 melalui gol Marco Ruben menit 57. Tambahan tiga poin membuat The Yellow Submarines naik ke posisi tiga, unggul selisih gol di atas Ches. Bilbao tetap di urutan keenam bersama Sevilla dengan koleksi nilai 42. Striker Spanyol Fernando Llorente gagal melanjutkan

kisah kepahlawanannya di Bilbao. Llorente hanya membuat bola menyamping dari tiang gawang lawan dan kiper Villarreal Diego Lopez bereaksi indah ketika menjinakkan tembakan Andoni Iraola menit 18. Bilbao mestinya dapat menyamakan kedudukan menit 69, tetapi pemain pengganti Markel Susaeta menembak terlalu tepat ke tubuh Lopez. (m15/ap/uefa)


BEK Chelsea David Luiz (kanan) menjinakkan bomber City Edin Dzeko di Stamford Bridge, London, Minggu (Senin WIB). “Kami yakin bisa berlatih dan mempersiapkan diri dengan lebih baik lagi dalam delapan laga ke depan, karena kami sudah tidak lagi bermain di Liga Europa,” dalih Mancini. “Mulai sekarang, kami masih memiliki delapan pertandingan ke depan. Penting buat kami

untuk bisa dalam kondisi bugar,” ujarnya lagi. Akibat kekalahan di Liga Europa dan di Liga Premier itu, nasib Mancini pun menjadi rawan. Sheik Mansour bin Zayed Al Nahyan dikabarkan makin serius memboyong pelatih terbaik dunia Jose Mourin-

Milan Mulai Khawatir ROMA (Waspada): AC Milan terancam kehilangan dua pilarnya saat menjajal musuh bebuyutannya Inter Milan dalam laga Liga Seri A, awal April mendatang. Kedua pemain dimaksud adalah bomber Alexandre Pato (foto) dan bek Marek Jankulovski, yang mengalami cedera saat I Rossoneri dipecundangi Palermo 1-0, Sabtu lalu. “Pergelangan kaki kiri Pato sedikit terkilir dan diharapkan pulih dalam waktu sekitar 10 hari,” jelas Milan dalam situs resminya, Senin (21/3). Sedangkan Jankulovski menderita cedera keseleo di lutut kiri. Ini jelas pukulan berat buat Il Diavolo, yang masih memimpin klasemen dengan keunggulan hanya unggul dua poin lagi di atas I Nerazzurri. Karenanya gelandang Gennaro Gattuso mulai khawatir, Rossoneri gagal lagi meraih scudetto untuk kali pertama sejak tahun 2004. “Selalu ada ketakutan. Hanya meraih satu poin dari empat laga terakhir membuat anda pantas mengalami kekhawatiran,” tutur Gattuso dalam laman UEFA. “Kami kebobolan dua gol mudah di dua laga terakhir. Kami membuat banyak peluang, namun hanya mencetak satu

gol,” tambah gelandang temperamental Italia itu. Selain Inter, Napoli juga menguntit di posisi ketiga dengan hanya minus tiga angka saja setelah mengalahkan Cagliari 2-1 di San Paolo, Minggu (Senin WIB). Jadi jika La Beneamata mampu mengalahkan Il Diavolo, maka tim besutan Leonardo de Araujo itu bakal memuncaki klasemen untuk kali pertama sepanjang musim ini. “Kami harus bermain lebih berani dan lebih klinis. Kami juga membutuhkan keberuntungan,” tegas Gattuso. “Kami tahu mesti melakukan sesuatu, karena yang kami lakukan saat ini tidak cukup,” tambah jangkar berumur 33 tahun itu. Leonardo tenang Beda dengan Milan yang dilanda kecemasan, Leonardo yang mengarsiteki Inter justru biasa-biasa saja menatap derbi mendatang. Menurut mantan punggawa Rossoneri itu, duel itu nantinya hanya salah satu dari sisa laga musim ini. “Jadi tidak akan menentukan apa-apa. Masih ada tujuh laga lagi setelah derbi ini,” tutur Leonardo, seperti dikutip dari Goal. “Yang kami inginkan adalah tetap menjaga jarak dengan




1. Pengguguran kandungan. (Larangan dengan pengecualian diatur dalam UU No.36/2009). 3. Kebuntuan (Inggris populer). 7. Hukum sebab-akibat. 8. Sistem demokrasi yang dikuasai orang kaya atau bermodal disebut demokrasi ______ (Pilih: Klitokrat, Slomokrat atau Plutokrat). 9. Pemeriksaan saksi dalam persidangan perkara perdata, baik yang diajukan oleh penggugat maupun tergugat; Penyelidikan oleh DPR terhadap kegiatan pemerintah. 11. Jawaban kedua (dari terdakwa atau pembela) sebagai jawaban replik. 13. Sita, dari asal bahasa Belanda. 15. Keadaan sulit yang memerlukan penanggulangan segera, terbagi atas militer dan sipil. 16. Hak tunggal untuk berusaha yang dilarang UU No. 5/1999. 17. Ilmu tentang pengaruh faktor geografi terhadap ketatanegaraan; Kebijaksanaan negara atau bangsa sesuai dengan posisi geografisnya. 20. Tidak; Bukan: Gerakan ___ Blok.

ho ke City of Manchester Stadium. Menurut Daily Mail, Senin (21/3), Sheik Mansour telah menyiapkan gaji luar biasa besar senilai 10 juta pounds per tahun untuk membuat Mourinho mandah dari Real Madrid. (m15/afp/sky/dm)

21. Teguran untuk membayar karena si berutang lalai seperti diatur pasal 1238 KUHPerdata. 22. Besar risikonya.


1. Orang yang berprofesi memberi jasa hukum. 2. Jawaban jaksa penuntut atas tangkisan terdakwa atau pengacaranya. 4. Ilmu yang mempelajari sidik jari dan telapak kaki manusia untuk keperluan identifikasi. 5. Kerjasama antara beberapa partai untuk memperoleh kelebihan suara dalam parlemen. 6. Satuan Kerja Perangkat Daerah. 10. Tindakan yang berani; Tindakan keras untuk menakuti dsb. 12. Badan yang terdiri atas wakilwakil rakyat yang terpilih melalui pemilu. 13. Nama burung asal Nias, dipakai untuk mencap orang yang meniru saja perkataan orang lain. 14. Peniadaan peristiwa pidana; Penghapusan. 15. Mengesampingkan penuntutan. 18. Organisasi olahraga yang sempat dituduh jadi ajang politik. 19. Panca.


Milan, agar kami tetap di jalur persaingan meraih gelar,” tambah alenatorre asal Brazil tersebut. Leonardo yakin, Merah Hitam akan sangat tertekan karena mesti mengamankan posisi puncak klasemen. Dia juga menegaskan, tidak ada partai balas dendam kendati dirinya dipecat Silvio Berlusconi tahun lalu dari Milan. “Tidak akan. Hidup akan terus berjalan dan semua belajar dari pengalaman. Jika saya melihat ke belakang, saya hanya melihat aspek positif dari hubungandenganMilan,”tegasnya. “Saya tidak pernah melupakan masa-masa 13 tahun bersama Rossoneri. Saya hidup berdasarkan cinta, bukan kebencian,” tambah Leonardo. (m15/vvn/uefa/goal)


Isi kotak kosong dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di halaman A2 kolom 1.

8 9 3 7 4 0 6 0 5 3 1 3 6 4 7 6 7 8 0 3 6 9 0 5 3 1 8 2 3 1 8 7 5 0 5 0

7 3 9 2 0 3 1 7 4 6 3 4 m10



WASPADA Selasa 22 Maret 2011

Hasil MotoGP Qatar Casey Stoner Jorge Lorenzo Dani Pedrosa Andrea Dovizioso Marco Simoncelli Ben Spies Valentino Rossi Colin Edwards Nicky Hayden Hiroshi Aoyama Cal Crutchlow Hector Barbera Karel Abraham

(Australia/Repsol Honda) 42:38.569 (Spanyol/Yamaha) + 03.440 detik (Spanyol/Repsol Honda) 05.051 (Italia/Repsol Honda) 05.942 (Italia/Honda Gresini) 07.358 (AS/Yamaha) 10.468 (Italia/Ducati) 16.431 (AS/Yamaha Tech 3) 26.293 (AS/Ducati) 27.416 (Jepang/Honda Gresini) 28.920 (Inggris/Yamaha Tech 3) 34.539 (Spanyol/Ducati Aspar) 34.829 (Rep Ceko/Ducati Cardion AB) 37.957

PARA pembalap MotoGP 2001 menunjukkan aksi prihatin kepada korban bencana tsunami di Jepang di sela-sela MotoGP Qatar, Senin (21/3) WIB.

Stoner Langsung Unjuk Gigi DOHA (Waspada): Rider terbaru Repsol Honda, Casey Stoner, langsung unjuk gigi pada seri pertama MotoGP 2011 dengan merebut gelar di Losail International Circuit, Doha, Senin (21/3) WIB. Mengawali balapan dengan menempati pole position, Stoner berhasil menyentuh garis finish pertama dengan mengungguli juara dunia Jorge Lorenzo serta rekan satu timnya asal Spanyol, Dani Pedrosa. Stoner menyelesaikan balapan dengan waktu 42 menit 38,569 detik disusul Lorenzo yang tertinggal 3,440 detik dan

Pedrosa dengan selisih 05,551 detik. Sukses juara membuat Repsol Honda yang tampil cemerlang sepanjang sesi pramusim sebagai favorit kuat kampiun juara dunia musim ini seraya menggeser dominasi Yamaha. Hasil ini merupakan kemenangan keempat Stoner di Qatar, setelah juga menjadi

juara pada 2007, 2008 dan 2009. Tahun lalu, gelar juara direbut Valentino Rossi saat masih memperkuat tim Fiat Yamaha. Selepas start, Pedrosa langsung menggebrak dengan menyodok posisi pertama diikuti Stoner dan Lorenzo. Rossi, kini membela Ducati, sempat menyeruak ke posisi dua namun sembilan kali juara dunia itu melebar dan tercecer ke posisi enam selepas tikungan pertama. Nasib sial menghampiri dua pembalap Pramac Racing. Randy De Puniet dan Loris Capi-

rossi. Bila De Puniet gagal menjinakkan kuda besinya saat melahap tikungan hingga terjatuh, maka Capirossi gagal melanjutkan lomba karena tergelincir ke gravel saat menghindari rekannya itu. Memasuki tiga tikungan pertama, juara dunia Lorenzo berhasil mengambil pimpinan lomba dari Pedrosa yang turun ke urutan tiga di belakang Stoner. Namun, sang juara bertahan tak bertahan lama sebagai pembalap terdepan karena Stoner berhasil mengambil alih pimpinan.

Di pertengahan lomba, teror mental yang terus dihadirkan Lorenzo kepada Pedrosa akhirnya membuahkan hasil. Di sisa delapan lap, pembalap Yamaha itu sukses melewati Pedrosa yang gagal menutup ruang geraknya saat menikung. Rekan setim Lorenzo, Ben Spies juga berhasil memenangi duel sengit dengan Rossi dan mengamankan posisi enam. Rossi sendiri finish di tempat ketujuh disusul Colin Edwards, Nicky Hayden dan Hiroshi Aoyama yang melengkapi 10 besar. (ap/crash/m47)

Rockets Curi Tiket Playoff HOUSTON, AS (Waspada): Houston Rockets mengalahkan Utah Jazz dalam pertarungan perebutan tempat playoff terakhir di Wilayah Barat musim ini dengan kemenangan 110108 di Toyota Center, Houston, Senin (21/3). Rockets meraih kemenangan ke-11 dalam 14 pertandingan terakhir untuk memperkecil selisih dengan Jazz sekaligus bisa melampaui Memphis Grizzlies dalam perebutan posisi kedelapan dan terakhir pasca musim reguler. Pada duel ini, Kevin Martin mencetak 34 poin plus seluruh 18 kesempatan lemparan bebasnya. Kyle Lowry mencatat triple double bagi Rockets dengan perolehan 28 angka 11 rebound, sedangkan Jazz dipimpin Paul Millsap 35 poin 10 rebound. “Saat ini dia bermain dengan

sangat hebat, tidak hanya dari sudut pandang statistik, tetapi juga dari segi kepemimpinan. Dia adalah jenderal kami di lapangan,” ujar guard Rockets Chuck Hayes memuji penampilan gemilang Martin. Di Staples Center, Derek Fisher memperlihatkan dirinya masih memiliki taji kala memberikan kontribusi tiga assist vital bagi LA Lakers saat menekuk Portland Trailblazers 8480. Assist D-Fish, julukan akrabnya, memang cukup memukau karena turut berperan dalam 22 angka yang ditoreh Kobe Bryant selaku top skor Lakers. Tak hanya itu, tembakan three point Fisher memastikan kemenangan Lakers atas Blazers. Hasil ini juga merupakan kemenangan ke-12 dari 13 laga bagi skuad Phil Jackson pasca NBA All Star di Los Angeles. “Saya memang sadar de-

ngan peluang membantu tim meraih kemenangan. Pengalaman memang cukup membantu dalam mengatasi situasi, ketika anda dalam tertekan. Ini sama seperti naik sepeda,” ungkap Fisher. “Fisher sering membuat big shots. Statistiknya memang tidak begitu bagus, karena mengalami foul trouble. Namun, Fisher memberikan kontribusi cukup dengan membuat poin penting,” puji Kobe. Di laga lain, Washington Wizards mengalahkan New Jersey Nets 92-98, Atlanta Hawks vs Detroit Piston 104-96, Milwaukee Bucks vs New York Knicks 100-95, Phoenix Suns vs LA Clippers 108-99, Sacramento Kings vs Minnesota T’wolves 127-95, Toronto Raptors vs Oklahoma City 95-93 dan Dallas Mavericks vs Golden State Warriors 101-73. (m33/ap)


PROMOTION Manager CV Indako Trading Co Gunarko Hartoyo (kanan) foto bersama pembalap Honda Sumut.

Harapan Besar Tim Repsol Honda


GUARD LA Lakers, Shannon Brown (2 kanan), berusaha melewati hadangan pemain bertahan Portland Trailblazers dalam laga NBA di Staples Center, Los Angeles, Senin (21/3).

Terry Terhormat LONDON (Waspada): Bek Chelsea John Terry merasa terhormat kembali terpilih sebagai kapten tim nasional Inggris. “Saya menerima saya kehilangan ban kapten, namun saya tidak pernah kehilangan kepercayaan dengan manajer,” tutur Terry dalam The Sun, Senin (21/3). “Saya juga tidak pernah menyerah untuk berharap akan kembali menjadi kapten Inggris,” tambah komandan London Blues tersebut. Terry sempat menjadi pilihan pertama pelatih Fabio Capello untuk menyandang pangkat kehormatan itu. Namun skandal seks yang menimpanya tahun lalu, membuat Capello

terpaksa mencopot jabatan Terry. Kini dia kembali akan memimpin Wayne Rooney dan kawan-kawan dengan aksi pertama laga kualifikasi Euro 2012 kontra Wales di Cardiff, Sabtu depan. “Saya selalu melakukan apapun yang manajer butuhkan untuk memastikan kemenangan kami. Mengalahkan Wales adalah hal penting dan sebuah laga besar,” tegas Terry. Kendati menimbulkan sentimen dari bek sentral Manchester United Rio Ferdinand, tapi pengangkatan kembali Terry mendapat dukungan banyak dari berbagai kalangan. Termasuk dari legenda hidup

De Rossi Paham ROMA (Waspada): Gelandang AS Roma Daniele De Rossi dan penyerang Manchester City Mario Balotelli terpaksa dicoret dari skuad Italia. Pencoretan terkait hukuman yang mereka terima dari UEFA usai tampil di Liga Champions (De Rossi) dan Liga Europa (Balotelli). De Rossi (foto) mengaku tidak mempermasalahkan kebijakan pelatih Cesare Prandelli, karena dia paham sudah melanggar kode etik. AP “Saya menerima keputusan pelatih, sebab saya tahu telah melanggar kode etik dan peraturan yang seharusnya saya hormati,” jelas De Rossi, seperti dilansir Goal, Senin (21/3). “Namun saya berharap hanya akan absen di dua laga ini saja, dan bisa kembali mengenakan kostum Azzurri se-cepatnya,” katanya lagi. Keduanya berarti absen dalam laga kualifikasi Euro 2012 melawan Slovenia dan eksibisi menghadapi Ukraina. De Rossi dilarang bermain di tiga laga internasional akibat menyikut pemain Shakhtar Donetsk Darijo Srna. Balotelli kena kartu merah karena menendang perut pemain Dynamo Kiev Goran Popov. Prandelli pun membuat kejutan dengan memanggil dua punggawa Cesena, Marco Parolo dan Davide Santon. “Hingga dua hari lalu, saya tak pernah merasa ini bisa ter-jadi. Bagi saya rasanya seperti mimpi yang jadi kenyataan se-telah kerja keras,” beber Parolo. “Saya sangat senang bisa ke timnas. Terima kasih kepada Prandelli yang telah memberi kepercayaan,” timpal Santon. “Juga kepada Cesena yang membantu saya menemukan konsistensi hingga bisa dipanggil ke tim nasional,” tambah bek milik Inter Milan itu. (m15/goal)


PELATIH Inggris Fabio Capello (kiri) merasa sudah cukup dalam menghukum John Terry. Inggris Peter Shilton. “Anda ingin yang terbaik dan John Terry selalu menjadi se-

orang pemimpin alami. Saya minta maaf kepada Rio, tapi saya menempatkan dia (Terry)

di atas Rio untuk menjadi kapten,” jelas Shilton. Ferdinand sendiri masih cedera, sehingga kembali tidak dipanggil Capello untuk melawan Wales. Sebaliknya, striker anyar Liverpool Andy Carroll tetap masuk tim walaupun sedang cedera ringan. Ini cukup mengejutkan. Sebab manajer Liverpool Kenny Dalglish sudah meminta Capello agar tidak memanggil Carroll yang baru pulih dari cedera paha dan belum fit sepenuhnya. Kejutan lainnya, mantan pelatih Real Madrid, Juventus dan AC Milan itu memasukkan nama winger Wolves Matt Jarvis dalam skuadnya. Capello berpaling pada Jarvis karena Theo Walcott (Arsenal) dan Adam Johnson (Manchester City), semuanya sedang tidak prima. (m15/sun/rtr)

PSSI Sumut Hanya Bisa 10 Hari Biaya Tim Pra PON MEDAN (Waspada): Tim Pra PON Sumut kembali bakal terkendala berlatih intensif. Pasalnya, pengurus PSSI Sumut hanya bisa menanggulangi pelaksanaannya selama sepuluh hari terhitung mulai, Senin (21/3). Setelah itu PSSI Sumut menyerahkannya kepada KONI Sumut. “PSSI Sumut hanya bisa menganggulangi biaya pelatihan selama sepuluh hari ke depan. Kemudian kita akan menyerahkannya kepada KONI Sumut,” kata Plt PSSI Sumut Idrus Djunaidi. Dia menyatakan demikian kepada Waspada di sela-sela pelaksanaan Turnamen Futsal Antar Pelajar Piala Walikota Medan Drs H Rahudman Harahap MM di QS Futsal dan Food, Jalan Medan Sunggal, Senin (21/3). Menurut Idrus, PSSI Sumut sedang mencari bapak angkat sekaligus manajer tim. Namun apabila tidak berhasil juga, maka menyerahkan tim kepada KONI Sumut. “Yang punya nama nanti kan KONI Sumut. PSSI Sumut juga mengharapkan supaya KONI Sumut dapat memberikan perhatiannya,” jelas Idrus, yang juga wakil manajer tim Pra PON Sumut. KONI Sumut kan memberikan bantuan kepada atlet? “Ya.

KONI Sumut setiap bulannya memberikan biaya transport kepda 23 atlet sebesar Rp 750.000,” jawabnya. “Namun selain itu kita kan membutuhkan dana yang lebih besar lagi seperti dana konsumsi dan pertandingan ujicoba hingga menjelang parhelatan yang dijadwalkan pada Juni mendatang,” katanya lagi. Idrus melanjutkan, tim Pra PON Sumut yang dipoles pelatih Rudi Saari, Subono AT dan Mardianto, sudah tidak menggelar pelatihan sejak menjuarai Piala Inalum pada 2 Februari lalu. Padahal, tim telah menjalani latihan lebih dari enam bulan. “Selama ini kita patungan

mendanai tim ini, karena belum pernah menerima bantuan dari pihak terkait. Untuk itu, kami sangat berharap tim segera mendapat bantuan dari KONI Sumut dan Pemprovsu,” pintanya. Sebelumnya bendahara tim Azzam Nasution mengatakan, sepakbola Sumut gagal berlaga pada PON lalu karena tak lolos kualifikasi. “Jangan sampai kegagalan itu terulang lagi,” harapnya. “Kita sudah buktikan mampu membentuk tim yang solid dan telah mengukir beberapa prestasi. Terakhir memperoleh medali perak pada PON XVI di Palembang tahun 2004,” tambah Azzam. (m18)

MEDAN (Waspada): Musim balap MotoGP 2011 telah dimulai di Sirkuit Losail, Qatar, Minggu (Senin WIB). Deru knalpot mesin motor berkapasitas 800cc kembali menggema, dan hasil luar biasa didulang tim Repsol Honda yang dimotori trio Casey Stoner, Dani Pedrosa, dan Andrea Dovizioso. Gunarko Hartoyo, Promotion Manager CV. Indako Trading Co selaku main dealer Honda di Sumatera Utara, pun mengungkapkan harapan besarnya buat ketiga pembalap andalan Honda tersebut. “Kami sangat mengharapkan Tim Repsol Honda dapat meraih prestasi terbaik,” tutur Gunarko di Medan, Senin (21/3). “Namun semua itu sangat tergantung bagaimana Honda dapat mengarahkan ketiga jagoannya agar bisa ‘Satu Hati’ sesuai slogan One Heart yang kini dikembangkan Honda,” tambah Gunarko. Menurutnya, sesi tes resmi beberapa kali di Sepang telah memberikan angin segar bagi Tim Repsol Honda yang sukses mendominasinya. Tiga podium utama diisi Stoner, Pedrosa dan Dovizioso, itu juga berlanjut di Qatar. Stoner membawa Honda kampiun, pembalap Yamaha Jorge Lorenzo runner-up, selebihnya posisi ketiga sampai kelima dikuasai pembalap Honda melalui Pedrosa, Dovizioso dan Marco Simoncelli dari tim Honda Gresini. Keberhasilan di Qatar pun semakin menegaskan bahwa pabrikan asal Jepang ini berhasil

memperkuat persaingan untuk menjadi juara musim 2011 ini. Harapan besar pada Tim Repsol Honda juga ditunjukkan pembalap-pembalap andalan Sumut seperti Eko “The Red”, Yogi Permana, dan Rizky Hamdani, yang tergabung dalam tim KitaKita Racing Community. Mereka malah memiliki pembalap idola yang diharapkan akan menjuarai MotoGP 2011. Eko yang pernah berkesempatan foto bareng dengan Dani Pedrosa, sangat mengidolakan pembalap Spanyol itu. “Eko memang ngefans dengan Pedrosa. Dia sangat menginspirasi banyak pembalap muda di Indonesia bahwa dengan kerja keras, gak ada yang gak mungkin untuk bisa meraih impian menjadi pembalap MotoGP,” ucap Eko, yang optimis Pedrosa bakal menjuarai musim ini. Yogi dan Rizky yang sangat ngefans dengan Casey Stoner, justru meyakini idolanya akan menjadi juara MotoGP. Keyakinan mereka didukung kemampuan pembalap Honda asal Australia itu untuk selalu bersaing di garis depan sekaligus mampu finish tercepat di Losail. “Senang sekali ketika tahu Stoner bergabung ke Tim Repsol Honda. Berarti jagoannya Honda di MotoGP kan jadi bertambah banyak,” ujar Yogi. Dengan mengandalkan kemampuan trio tersebut, Tim Repsol Honda pun sangat berpotensi meraih triple crown sebagai juara dunia rider, the best team, dan the best motorcycle. (adv)

11 Kontingen Bertarung, DS Optimis Kejurda Voli Remaja Sumut Di Tanjungbalai TANJUNGBALAI (Waspada): Walikota Tanjungbalai Drs H Thamrin Munthe M Hum resmi membuka Kejuaraan Daerah (Kejurda) Bola Voli Remaja se Sumatera Utara di GOR Kota Tanjungbalai, Senin (21/3), diikuti 11 kontingen (10 tim putra dan 9 putri). Dalam arahannya,Walikota menyambut baik penyelenggaraan event itu demi mendukung program “Tanjungbalai Maju 2012” dan ajang kompetisi sekaligus evaluasi voli di Sumut. Untuk itu, dia berharap peserta semangat dan tetap menjunjung tinggi sportivitas bertanding. “Kalah menang hal biasa, yang terpenting bangkitkan semangat bermain dan tingkatkan sportivitas agar event ini dapat melahirkan tim handal, solid dan berprestasi,” ujar Walikota. Sedangkan Ketua KONI Tanjungbalai M Nur dan Ketua DPRD diwakili Hakim Tjoa Kien Lie, menyampaikan ucapan terima kasih kepada Pengcab PBVSI Tj Balai. Ketua Panitia AKBP Drs Puja Laksana MHum melaporkan kejurda tersebut diikuti 11 kontingen dan pihaknya telah melakukan berbagai upaya dalam mensukseskan kegiatan. Dikatakan, pertandingan akan

Waspada/Rasudin Sihotang

TIM voli putri Kabupaten Asahan (kanan) mengalahkan Kodya Binjai 4-1 pada pertandingan perdana Kejurda Voli Remaja se Sumatera Utara di GOR Kota Tanjungbalai, Senin (21/3). digelar selama satu minggu sejak Sabtu lalu. Turut hadir di antaranya Wakil Walikota Rolel Harahap, Danlanal Letkol Laut (P) Firman Nugraha, Ketua KNPI Adi Herman, Kadis Disporabudpar Dra Nurmalia dan undangan lainnya. Pada pertandingan perdana, tim putri Asahan menaklukkan Binjai 3-1, Tebingtinggi memukul Batubara 3-0 di Grup X. Grup Y yang dihuni putri Deli Serdang, Medan, Siantar dan Tanjungbalai, baru akan bertanding Selasa (22/3) ini. Untuk putra, Medan me-

ngatasi Simalungun 3-0 di Grup A. Sedangkan tim favorit Deli Serdang berada di Grup B gabung Langkat, Siantar, Tebingtinggi dan tuan rumah Tanjungbalai. Pelatih DS Zulhamni mengaku optimis tim putranya bakal dapat melewati penyisihan grup kendati persaingan kali ini cukup ketat. “Kita yakin, karena tim putra Deli Serdang diperkuat sebagian besar pemain Popwil lalu. Secara teknis dan pengalaman tanding, mereka sepertinya mampu mengatasi para pesaing di Grup B,” jelas Zulhamni. (a32)


WASPADA Selasa 22 Maret 2011


PSMS Gagal Kedua Kali Kalah 1-3 Dari Persih MEDAN (Waspada): Permainan ciamik yang dipertontonkan PSMS Medan belum cukup untuk mengalahkan tuan rumah Persih Tembilahan dalam lanjutan kompetisi Divisi Utama di Stadion Beringin, Senin (21/3). Tampil mendominasi, PSMS harus takluk 1-3 dan gagal melakukan revans.

Waspada/Austin Antariksa

GOL Donny F Siregar (kiri) belum cukup menghindari kekalahan bagi PSMS Medan dari Persih Tembilahan di Stadion Beringin, Senin (21/3).

Posisi PSMS Melorot MEDAN (Waspada): Posisi PSMS Medan setelah kalah atas tuan rumah Persih Tembilahan di Stadion Beringin, Senin (21/ 3), melorot setingkat menjadi keempat di klasemen sementara grup I kompetisi Divisi Utama Liga Indonesia 2010/ 2011. Gol andil dari dua pemain asingnya Gbeneme Friday dan Leonardo Veron membuat The Killer merasa kekecewaan terutama bagi Asisten Pelatih Edy Syahputra. Kepada wartawan seusai pertandingan, Edy mengecam tindakan wasit Faurur Rosi. “Kalau kalah fair, pasti kami akui. Tapi tidak dengan begini,”

ujarnya merujuk pada buruknya kepemimpinan wasit tersebut. Menurutnya, akibat tindakan wasit yang dinilainya cukup buruk itu, PSMS harus menerima kenyataan kalah sampai tiga gol. “Kepemimpinan wasit sangat buruk, terutama pada gol-gol awal Persih yang meruntuhkan kami,” tambah Edy seraya menegaskan PSMS bertekad bangkit di laga menghadapi Persires Rengat. “Saya harap anak-anak lebih berkonsentrasi di pertandingan selanjutnya. Masih ada laga lagi di Rengat menghadapi tuan rumah Persires yang harus kita

menangkan pada Jumat (25/3) nanti,” ketusnya. Sebaliknya, kubu Persih menyambut hasil kemenangan atas PSMS dengan sukacita. “Alhamdulillah Persih dapat poin penuh. Memang permainan anak-anak agak kacau ketika sudah unggul 3-0. Perubahan skema menjadi 4-4-2 dilakukan untuk memperkuat pertahanan,” terang pelatih Persih, Raja Faisal. Tiga angka ini sangat penting untuk melanjutkan perjuangan tim menuju Liga Super Indonesia (LSI),” tukas pelatih Persih Raja Faisal. (m17)

Akibat kekalahan itu, posisi PSMS melorot setingkat dari urutan ketiga menjadi keempat di klasemen sementara grup I. Sebaliknya, kemenangan Persih membuat mereka melonjak ke urutan ketiga menggantikan posisi Ayam Kinantan dengan keunggulan satu poin. Peranan wasit Faurur Rosi yang kurang fair juga menghiasi pertandingan. Dua gol yang diciptakan striker asing Leonardo Veron dan Friday Gbeneme menjadi bukti peran pengadil yang berat sebelah. Sontak, kekalahan ironis itu menimbulkan kekecewaan mendalam bagi kubu PSMS. Misi mencuri poin membuat PSMS langsung tancap gas kendati tampil sebagai tim tamu. Satu menit kickoff berjalan, AriYuganda langsung menebar ancaman lewat tembakan dari luar kotak penalti, namun masih bisa diblok kiper Persih Agus Salim. Berikutnya, tandukan Gaston Castano di menit

13 melayang tipis di atas mistar gawang lawan. Tak lama berselang, umpan lambung Antonio Claudio berbuah keuntungan bagi Harimau Rawa. Berawal dari perangkap offside yang disiapkan PSMS untuk Veron tidak digubris asisten wasit,Veron pun dengan mudah mengecoh Andi Setiawan di menit 16. Malapetaka kedua terjadi bagi PSMS berawal dari jatuhnya Donny F Siregar yang tidak dianggap pelanggaran. Para pemain PSMS yang mengira bakal dihadiahi tendangan bebas pun memperlambat geraknya, namun wasit tetap membiarkan pertandingan berlanjut sehingga Friday leluasa menjebol gawang Andi untuk kedua kalinya. PSMS berupaya bangkit dari ketertinggalan, tapi sebaliknya malah kebobolan untuk ketiga kali di menit 32. Di sini, Friday melengkapi kemenangan Persih berawal dari keterlambatan Andi

Waspada/Austin Antariksa

VAGNER Luis (33) dan Gaston Castano (32) gagal memimpin PSMS Medan melakukan revans kepada Persih Tembilahan dalam lanjutan kompetisi Divisi Utama di Stadion Beringin, Senin (21/3). menutup gerak pemain berkulit hitam yang sedang berjibaku menggapai bola dariVagner Luis. Setelah tembakan kerasnya ditepis kiper di menit 57, Donny F Siregar akhirnya sukses menaklukkan Agus Salim tujuh menit kemudian hasil meman-

faatkan umpan Faisal Azmi. Pasca gol tersebut, PSMS berusaha mengejar ketinggalannya namun dirusak aksi permainan negatif dari anak-anak Persih. Bahkan Ari Yuganda dan Novi Handriawan kerap mendapat perlakuan kasar dari An-

tonio Claudio cs. Kendati begitu, hanya dua kartu kuning yang diberikan kepada tim asuhan Raja Faisal, yakni untuk Susanto dan Sahroni. Selanjutnya, PSMS akan menghadapi Persires Rengat pada Jumat (25/3) nanti. (m17)

menanggapi sanksi yang diberitakan di media. Maklum saja karena posisi hukuman itu kan hanya lewat media. Sudah begitu, menjatuhkan hukuman tapi tak ada durasi waktunya,” tegas Abi. Meski begitu, ia memastikan LPI tetap akan memberikan

bantuan hukum kepada pihakpihak yang terkena sanksi. Hal itu karena sudah menjadi komitmen awal sejak LPI diluncurkan, terlebih karena mereka memiliki beberapa pakar hukum yang dipastikan bisa membantu penyelesaian sanksi Komdis PSSI itu. (yuslan)

LPI Pertanyakan Sanksi JAKARTA (Waspada): Keputusan PSSI menjatuhkan sanksi kepada sejumlah pihak yang terlibat di kompetisi Liga Primer Indonesia (LPI) mendapat tanggapan sinis dari para terhukum. Hal tersebut karena keputusan Komisi Displin (Komdis) PSSI terlihat janggal dan tidak seperti biasanya akibat tiadanya penjelasan durasi waktu terhadap sanksi yang diberikan. Komdis PSSI hanya mengatakan bahwa pihak-pihak itu dikenakan hukuman larangan

ikut serta dalam aktivitas sepakbola di seluruh jenjang di dalam yurisdiksi PSSI, termasuk penggagas LPI yang juga pengusaha kondang Arifin Panigoro. “Selain tidak ada durasi waktu, kami juga sampai sejauh ini belum menerima surat resmi dari PSSI terkait sanksi tersebut. Tapi kami tidak heran, karena ini memang kebiasaan PSSI yang selalu menjatuhkan hukuman lewat media. Kami pun tidak dimintai keterangan sebelum sanksi dijatuhkan,” kata juru

bicara LPI Abi Hasantoso, Senin (21/3). Karena itu, lanjut Abi, LPI bakal menunggu surat resmi dari PSSI sebelum memutuskan langkah selanjutnya. Selama surat itu belum diterima, Abi memastikan LPI tidak akan melakukan upaya apapun, termasuk melakukan perlawanan hukum dengan jalur banding. “Jadi posisi kami saat ini menunggu surat resmi dulu. Selama tidak ada surat resmi, sudah pasti kami tidak akan

Bupati Berharap Bantuan CSR Waspada/Setia Budi Siregar

WALIKOTA Medan Drs Rahudman Harahap didampingi Wakil Walikota Drs Dzulmi Eldin MSi menyerahkan piala bergilir kepada Ketua Panitia Pelaksana Aulia Andri di QS Futsal dan Food Jl Bunga Asoka Medan Sunggal, Senin (21/3).

Rahudman Bakar Semangat Atlet Pelajar Medan Competition Futsal MEDAN (Waspada): Walikota Medan Drs Rahudman Harahap MM membakar semangat para pelajar yang mengikuti turnamen Medan Futsal Competition memperebutkan piala bergilir Walikota dan piala tetap Kadis Pendidikan Kota Medan Drs Hasan Basri MM di QS Futsal dan Food Jl Bunga Asoka Medan Sunggal, Senin (21/3). “Saya gembira dengan semangat para atlet pelajar untuk mengikui event ini. Untuk itulah saya berharap pelaksanaan ini dapat dilaksanakan berkesinambungan,” kata Rahudman dalam sambutannya sekaligus membuka turnamen yang diikuti 113 tim dari sekolah di Kota Medan dan kategori umum putri. Seremonial pembukaan tampak meriah, bahkan se-

mangat tim putri juga tidak kalah dibandingkan peserta pelajar kendati hanya menampilkan tujuh tim. Untuk itulah, Rahudman meminta kepada peserta tim untuk tetap menjunjung tinggi sportivitas. “Kalau pelaksanaan pertama lancar, mengapa tidak dilanjutkan pada pelaksanaan berikutnya,” tambah Rahudman didampingi Wakil Walikota Drs Dzulmi Eldin MSi, Kapolresta Medan, Kapolres KP-3 Belawan, Dandim 0201/BS dan Dan Yon Zipur Letkol Inf Rizal Ramdani SSos termasuk Kadis Diknas Medan Drs Hasan Basri MM. Ketua Panitia Aulia Andri didampingi M Said Harahap mengatakan, kompetisi ini diikuti 113 tim dari kategori pelajar SLTA (37 tim), kategori SLTP (79 tim) dan tujuh kategori umum

20 Tim Ikut Turnamen Lestari VC MEDAN (Waspada): Sekira 20 tim akan bersaing pada turnamen voli diadakan klub Lestari VC Medan di lapangan klub tersebut, Jl. AR Hakim Gg Sukmawati, Kecamatan Medan Area, mulai 10 April mendatang. Turnamen memperebutkan trofi Ketua KNPI Sumut Ir A Yasir Ridho Lubis itu hanya mempertandingkan kelompok putra. “Event ini untuk menggelorakan kembali olahraga voli di Sumut, khususnya Kota Medan yang terkesan “lesu darah” sehingga kurang diminati,” ujar Ketua Panpel Turnamen, Wempy Saragih, Senin (21/3). Selaku pembina LestariVC,Wempy mengaku prihatin di mana klub-klub voli yang di era tahun 80-an begitu menjamur hingga ke pelosok daerah, kini seolah hilang ditelan bumi. “Kalau pun masih ada, jumlahnya bisa dihitung dengan jari, itu pun keberadaannya bak hidup segan mati tak mau,” katanya. Wempy pun berharap digelarnya turnamen tersebut dapat membangkitkan kecintaan masyarakat Kota Medan, khususnya para remaja untuk kembali menggeluti voli sebagai olahraga rakyat yang sarat prestasi. “Dengan semangat dan dukungan semua pihak, saya yakin voli dapat kembali digemari mengingat olahraga ini tergolong murah meriah,” pungkasnya. (m42)

Bupati Batubara Lepas Atlet Porseni LIMAPULUH (Waspada): Bupati Batubara H OK Arya Zulkarnain SH MM meminta atlet Batubara mencapai prestasi terbaik membawa nama baik daerah pada Porseni Madrasah Provinsi Sumatera Utara di Medan pada 21-25 Maret ini. “Kami harapkan para atlet mengikut pertandingan sekaligus memperoleh prestasi terbaik. Tingkatkan disiplin, jaga fair play dan citra daerah Batubara,” tegas OK Arya saat melepas kontingen di halaman kantornya, Senin (21/3). Didampingi Sekdakab H Sofyan MM, para Kadis dan SKPD, OK Arya menyerahkan petaka kepada ketua kontingen kepada Ptg Kakemenag Batubara Mhd Nurdin agar dapat berkibar mencapai prestasi. Sebelumnya, pimpinan kontingen Batubara H Ahmad Yusro SH melaporkan sebanyak 81 atlet dan ofisial akan diterjunkan pada Porseni Madrasah Provsu dengan mengikuti cabang atletik, bulutangkis, tenis meja, bola voli, MTQ dan kaligrafi. (a12)

puteri. Aulia menjelaskan, Medan Futsal Competition ini mendapat respon baik dari kalangan pelajar hingga sempat membuat panitia kewalahan menerima pendaftaran. Dia menambahkan, kompetisi ini digelar untuk menjaga hubungan erat antara Walikota Medan Drs Rahudman Harahap MM dengan kalangan pelajar, karena selama ini Rahudman dinilai sangat dekat dengan pelajar di Kota Medan. “Guru olahraga dari sekolah-sekolah juga menyambut baik event ini, karena anak didik mereka bisa berkompetisi dan mendapat pelajaran tentang sportivitas. Apalagi, penyerahan piala dan hadiah akan dilakukan di Kantor Walikota yang tentu akan menjadi kebanggaan bagi pelajar,” ungkapnya. Di laga eksebisi, Pemko Medan yang diperkuat Walikota Rahudman Harahap dan Wakil Walikota Drs Dzulmi Eldin menang atas Pensiunan PNS Pemko Medan 8-3 dan tim Kodim 0201/BS imbang 3-3 melawan Polresta Medan. (m18)

Pelantikan KONI Labura AEKKANOPAN (Waspada): Bupati Labuhanbatu Utara H Kharuddinsyah SE mengharapkan perusahaan BUMN maupun swasta menyisihkan dana bantuan Community Social Responsibility (CSR) untuk dunia olahraga, karena Pemkab Labura minim anggarannya dalam memajukan olahraga daerah. Hal itu disampaikan Bupati Labura saat pengukuhan pengurus KONI Kabupaten Labuhanbatu Utara di aula SMAN Aekkanopan, Senin (21/3). Menurutnya, sudah menjadi kewajiban bersama untuk komit dan bertanggungjawab dalam memajukan olahraga di daerah, khususnya KONI yang baru dikukuhkan.

“Keberadaan KONI bukan saja tempat berkumpulnya cabang olahraga secara sturktural, akan tetapi harus mampu melihat bakat atlet untuk dapat dibina secara maksimal dan berkesinambungan,” kata Bupati didampingi Wakil Bupati H Sahminan Pasaribu SH MM, Ketua DPRD Drs H Ali Tambunan, pimpinan ormas, OKP dan pimpinan perusahaan BUMN dan swasta. Ketua Umum KONI Sumatera Utara H Gus Irawan SE AK MM yakin akan perkembangan olahraga di daerah Labuhanbatu Utara yang baru dimekarkan akan dapat berkembang pesat karena pengurus KONI bersama pemerintah didukung DPRD sama-sama bersinergi.


BUPATI Labuhanbatu Utara H Kharuddinsyah SE didampingi Wakil Bupati Sahminan Pasaribu SH MM, Ketua DPRD Drs H Ali Tambunan, Ketua Umum KONI Sumut H Gus Irawan SE AK MM foto bersama pengurus KONI Labura yang baru dikukuhkan.

“Saya yakin di bawah kepemimpinan Haji Buyung Bupati Labuhanbatu Utara, perkembangan olahraga di daerah ini akan berkembang pesat, apalagi pengurus KONI yang baru dilantik masih muda dan mau berkorban,” ujar Gus. Ketua Umum KONI Labuhanbatu Utara H Rori Syahputra Tambunan mengatakan perkembangan olahraga modern menuntut pengelolaan, pembinaan dan pengembangan yang terencana, sistimatik dan berkesinambungan agar dapat bersaing. Ditambahkan, sebagai wujud turut serta berperan aktif dalam meningkatkan olahraga di Labuhanbatu Utara, KONI akan berupaya semaksimal dalam menciptakan atlet yang dapat membawa nama daerah baik di tingkat provinsi maupun nasional. Pengurus KONI Labuhanbatu Utara periode 2010-2014 yang dikukuhkan antara lain Ketua Umum H Rori Syahputra Tambunan, Ketua Harian Maria Nusa SE, Wakil Ketua Hendriyanto, Ir Tasrif Mubaroq, Abdi Muliawan SE, Sekretaris Indra Muhery SSos,Wakil Drs Selamat Riyadi, Taufik Hidayat, Erlinda, Ninda Ariani, Bendahara Erwin Hanafi ST, Wakil Hotman Kosnen, Imanuddin dan lainnya. (a16)

Cegah Tawuran Lewat Futsal Turnamen SLTP Se Tj Balai TANJUNGBALAI (Waspada) : Turnamen futsal antar SLTP se-Kota Tanjungbalai yang memperebutkan piala bergilir SMPN 4 bertujuan untuk meningkatkan rasa persaudaraan dan mencegah aksi tawuran antar sesama siswa. Turnamen futsal antar pelajar yang pertama kali diadakan di kota itu dibuka resmi oleh Kadis Pendidikan Kota Tanjungbalai Hj Delima didampingi Kasi Dikdasmen Andika Cahyadi disaksikan para kepala sekolah, guru serta siswa di lapangan SMPN 4, Senin (21/3). Dalam sambutannya, Hj Delima mengatakan dengan dilaksanakannya turnamen itu hendaknya para pelajar lebih terpacu meningkatkan prestasi di bidang olahraga khususnya futsal dan menjadikannya sebagai budaya hidup sehat di samping menumbuhkembangkan hubungan kekerabatan antar siswa. Turnamen itu diikuti 16 tim futsal dari masing-masing SLTP se-Kota Tanjungbalai baik sekolah swasta maupun negeri dan dilaksanakan hingga Sabtu (26/3) mendatang.(a32)

Griya Gelar Turnamen Bulutangkis MEDAN (Waspada): Griya Badminton Centre untuk pertama kalinya akan menggelar turnamen kategori perorangan dan beregu umum/klub di gedung bulutangkis Griya Medan, Jl T Amir Hamzah, 15-19 April mendatang. “Event ini dalam rangka mendukung pembinaan olahraga bulutangkis di Sumut, sehingga diharapkan seluruh klub yang ada di daerah ini dapat mengirimkan atletnya,” ujar Ketua Panpel Kejuaraan Edi Mulyono di Medan, Senin (21/3). Dikatakan, selain hadiah total Rp30 juta, kejuaraan juga menyediakan hadiah satu unit sepeda motor Honda Absolute Revo bagi juara beregu putra. “Ini kesempatan pebulutangkis Sumut untuk unjuk gigi, terlebih atlet nasional tidak dibenarkan tampil,” jelas Edi. Ketua Pengcab PBSI Medan, H Ahmad Thamrin yang hadir pada acara itu menyatakan event tersebut sangat bermanfaat dalam meningkatkan jam tanding atlet. “Kita berharap kejuaraan ini digelar bekesinambungan sehingga menjadi kalender tetap PBSI Medan,” katanya. Nomor yang dipertandingkan, yakni tunggal dan ganda perorangan masing-masing kelompok umur di bawah usia 10, 13, 15, 17 dan 19. Selanjutnya, beregu putra (ganda 3 partai) masingmasing pasangan usia bebas, usia 93 tahun (minimal salah seorang pemain usia 43 tahun) dan usia 100 tahun (minimal salah seorang pemain 45 tahun). Juga dipertandingan nomor ganda putri perorangan dengan total usia pasangan 60 tahun dengan minimal salah satu pemainnya usia 30 tahun. (m42)

Sport Sensasi Djokovic


INDIAN WELLS, AS (Waspada): Petenis Serbia Novak Djokovic bermain luar biasa kala meraih kemenangan sensasional saat mengalahkan raja tenis dunia Rafael Nadal dalam final Turnamen Indian Wells Masters 1000, Senin (21/3).


Petenis Serbia Novak Djokovic (atas) dan ratu tenis dunia Caroline Wozniacki (bawah) memamerkan trofi Indian Wells yang sama-sama direbutnya pada Senin (21/3).

Kemenangan ini sekaligus memperpanjang rekor kemenangan Djokovic dalam 18 laga selama tahun ini. Usai menang di Australia Terbuka dan Kejuaraan Dubai, Djokovic terus mentasbihkan diri sebagai seorang master tenis di musim ini. Itu dibuktikan Djokovic dengan kembali menyisihkan Nadal dalam pertarungan tiga set 4-6, 6-3, 6-2.

Pertarungan menarik sudah terjadi sejak set awal. Kedua petenis papan atas dunia ini langsung menunjukan kemampuannya. Tapi, Nadal lebih menguasai permainan di set pembuka dan mematahkan tiga servis Djokovic. Set kedua, petenis asal Spanyol ini memulai pertandingan dengan servisnya yang sensasional. Tapi, Djokovic mampu merepons de-


Pasang Iklan HP. 081370328259 Email:

ngan menunjukkan dirinya pantas menjadi petenis nomor dua dunia terkini. “Saya tahu musim ini sangat panjang dan tidak ingin terlalu terbawa euforia atas kemenangan ini. Saya perlu merayakan sedikit dan kemudian menatap ke depan,� ujar Djokovic.


Selasa 22 Maret 2011

Sebelumnya di final putri, ratu tenis dunia Caroline Wozniacki mengalami kondisi berbeda dengan Nadal. Pasalnya, unggulan 15 asal Prancis Marion Bartoli berhasil diakhiri perlawanannya dengan kemenangan rubber set 6-1, 26, 6-3. Raihan Wozniacki ini sekaligus melengkapi pencapaiannya di Dubai di mana petenis asal Denmark itu keluar sebagai juara usai mengalahkan Svetlana Kuznetsova (Rusia) di partai pa-

mungkas, Februari silam. Wozniacki pun menyebut prestasinya di ajang Indian Wells sangat berarti besar buat dirinya. “Ini sangat berarti. Ini merupakan turnamen besar yang sangat, sangat penting. Saya telah menunjukkan bisa bermain tenis dengan baik dan mengalahkan beberapa petenis unggulan dalam beberapa pekan ini,� seru Wozniacki bahagia. (m33/ap)

Sumatera Utara

WASPADA Selasa 22 Maret 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:34 12:48 12:35 12:42 12:42 12:38 12:35 12:31 12:37 12:37

‘Ashar 15:41 15:57 15:42 15:51 15:50 15:41 15:41 15:46 15:44 15:45

Magrib 18:38 18:52 18:39 18:46 18:46 18:42 18:39 18:35 18:41 18:41



Shubuh Syuruq


19:46 20:00 19:47 19:54 19:54 19:50 19:47 19:43 19:50 19:49

05:04 05:17 05:04 05:11 05:11 05:08 05:04 05:00 05:07 05:06

05:14 05:27 05:14 05:21 05:21 05:18 05:14 05:10 05:17 05:16

L.Seumawe 12:40 L. Pakam 12:34 Sei Rampah12:33 Meulaboh 12:44 P.Sidimpuan 12:32 P. Siantar 12:33 Balige 12:33 R. Prapat 12:30 Sabang 12:47 Pandan 12:34

06:28 06:41 06:29 06:36 06:35 06:32 06:29 06:24 06:31 06:31

Zhuhur ‘Ashar 15:49 15:40 15:39 15:52 15:34 15:38 15:47 15:33 15:57 15:37





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:44 18:38 18:37 18:48 18:36 18:37 18:37 18:34 18:52 18:38

19:55 19:46 19:45 19:57 19:44 19:45 19:45 19:42 20:00 19:46

05:10 05:03 05:02 05:14 05:02 05:02 05:02 04:59 05:16 05:03

05:20 05:12 05:12 05:24 05:12 05:12 05:12 05:09 05:26 05:13

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:34 12:35 12:45 12:38 12:35 12:42 12:30 12:40 12:33 12:32

18:38 18:39 18:49 18:42 18:39 18:46 18:34 18:44 18:37 18:36

19:46 19:42 19:57 19:50 19:47 19:54 19:42 19:52 19:45 19:45

05:03 05:05 05:14 05:07 05:04 05:11 04:59 05:10 05:03 05:02

05:13 05:15 05:24 05:17 05:14 05:21 05:09 05:20 05:13 05:12

Panyabungan 12:31 Teluk Dalam12:38 Salak 12:36 Limapuluh 12:31 Parapat 12:33 GunungTua 12:30 Sibuhuan 12:30 Lhoksukon 12:40 D.Sanggul 12:34 Kotapinang 12:29 AekKanopan 12:30

06:34 06:27 06:26 06:38 06:26 06:26 06:26 06:23 06:41 06:27

15:47 15:40 15:54 15:42 15:41 15:49 15:35 15:46 15:37 15:38

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:27 06:29 06:39 06:31 06:28 06:35 06:24 06:34 06:27 06:26

Zhuhur ‘Ashar 15:32 15:39 15:40 15:37 15:38 15:33 15:32 15:49 15:38 15:32 15:35




Shubuh Syuruq

18:35 18:42 18:40 18:35 18:37 18:34 18:34 18:44 18:38 18:33 18:34

19:43 19:50 19:48 19:43 19:45 19:42 19:42 19:52 19:46 19:41 19:42

05:00 05:07 05:05 05:01 05:03 05:00 05:00 05:09 05:03 04:58 05:00

05:10 05:17 05:15 05:11 05:13 05:10 05:10 05:19 05:13 05:08 05:10

06:24 06:31 06:29 06:25 06:27 06:24 06:24 06:33 06:28 06:22 06:24.

Polres L. Batu Panggil Kadisdik RANTAUPRAPAT (Waspada) : Usai memeriksa saksi dan tersangka dalam dugaan korupsi dana sertifikasi guru (anggaran APBN 2010) Rp2,9 miliar, Reskrim unit ekonomi melayangkan surat panggilan ke Kadis Pendidikan Labuhanbatu. “ Surat panggilan dilayangkan ke kadisdik Labuhanbatu tertanggal 11 Maret 2011. Dan diminta hadir di Polres sebagai saksi 21 Maret!,” paparsalahseorangperwiradiMapolres,kemarin. Menurut perwira itu, penyidik akan melihat sejauhmana keterlibatan Kadisdik dalam proses pencairan dana sertifikasi yang telah mengorbankan hak-hak 233 guru. Pada penyidikan bendahara Dinas Pendidikan HL.40, diakuinya, dana sebagian dipakai untuk keperluan pribadi. Sebagian lagi kemana dananya ? Ini yang menjadi persoalan sebab HL sampai saat ini masih bungkam. “ Mungkin

doktrin yang ditanamkan pada tersangka HL cukup kuat sehingga beliau belum mau‘nyanyi,” papar perwira itu. Ketika disinggung, apakah HL mau jadi ‘tumbal’ demi menyelamatkan pimpinannya, perwira tadi hanya tersenyum. “ Kalau dia tidak buka mulut maka sulit bagi kita untuk memenjarakan aktor intelektualnya,” paparnya. Pasca tertangkapnya Bendahara Dinas Pendidikan HL, masyarakat memberikan apresiasi tinggi kepada pihak Polres Labuhanbatu yang telah menunjukkan kinerjanya dalam mengusut kasus tersebut. HaltersebutdiungkapkanKetuaLSMYayasan Informasi Indonesia untuk Masyarakat Desa (Yasima) Kabupaten Labuhanbatu H Agus Salim Harahap kepada Waspada, Senin (21/3) di Rantauprapat. (a17)

Mengubah Paradigma Pembangunan Asahan

Waspada/Abdul Hakim

RISIKO BELAJAR Mobil sedan Toyota GL BK 1892 HI yang dikendalikan Chanda, 36, warga Stabat masuk parit di ruas jalan Kwala Bingai tepatnya hanya beberapa meter dari Mapolres Langkat, Senin (21/3) siang. Tidak ada korban jiwa maupun korban luka dalam kejadian. Informasi yang diperoleh, Chanda masih belajar mengendarai mobil dan salah injak rem dalam kejadian itu. ‘’Risiko belajar begitu,’’ kata salah seorang warga dari sekian banyak yang berkerumun melihat.

700 Kaum Ibu Patumbak Ikuti Pengajian Akbar PATUMBAK (Waspada): Ratusan kaum ibu Kecamatan Patumbak mengikuti pengajian akbar di Dusun II, Desa Lantasan Baru, Kabupaten Deliserdang, Jumat (18/3). Al ustadz M Nursyam Ashmarqandi dalam tausyiahnya mengajak para ibu memperbaiki diri dalam hidup dan beribadah. “Harus diperbaiki hidup dan beribadah seperti cara berwudhu, shalat dan beramal dengan fiqih, tauhid dan tawadhu,” ujarnya. Dikatakan, Allah SWT tidak pernah melihat rupa umat dalam beribadah. “Allah SWT hanya melihat kesucian dan ketakwaan umat manusia dalam beribadah. Maka celaka lah orang-orang yang lalai dalam shalat dan ibadah lainnya,” katanya. Camat Patumbak Khairul Saleh Siregar dalam sambutannya menyebutkan, agar masyarakat tetap menjaga dan memelihara silaturrahim. Melalui pengajian akbar ini diharapkan terus menerus terciptanya generasi muda Muslim yang kaffah berilmu, beriman dan bertaqwa sejalan terbangunnya kehidupan masyarakat yang lebih sejahtera. (c02)

Apel Akbar Pramuka Di Binjai BINJAI (Waspada): 6.000 Anggota Pramuka siaga, penggalang, penegak dan Pembina Kota Binjai adakan apel akbar di lapangan Merdeka, Minggu( 20/3) dan dihadiriWagubsu Gatot Pujonugroho (Waka Mabida) serta Walikota Binjai HM Idaham. Pembina upacaraWalikota HM Idaham menyebutkan, aktivitas Pramuka sangat positif dan direncanakan membangun bumi perkemahan atau Lembaga Cadika Pramuka di Kota Binjai. Sementara, Wagubsu mengharapkan Pramuka mampu membina generasi muda yang trampil. Gatot juga mengikuti acara senam Pramuka dan pelantikan Satgas Pramuka Peduli Binjai.Sekretaris Kwarcab Pramuka Binjai Drs HT Syarifuddin , MPd menjelaskan apel gabungan Pramuka sebagai membangkitkan kembali Pramuka di Kota Binjai.(a04)

Puskesmas Pembantu Lubuk Kertang Dan Desa Perlis Minta Dibangun P.BRANDAN (Waspada): Pusat Kesehatan Masyarakat ( Puskesmas ) – Pembantu ( Pustu ) di Desa Lubuk Kertang dan Desa Perlis minta segera dibangun pada Anggaran tahun 2011 ini mengingat sarana infra struktur ini guna pelayanan kepada masyarakatsangat dibutuhkan sekali, ujar Ka Puskesmas Kecamatan Brandan Barat di Desa Tangkahan Durian, Kecamatan Brandan Barat Langkat dr H Suhadi kepada Waspada baru-baru ini. Bupati Langkat H Ngogesa Sitepu yang mencanangkan agar Puskesmas di setiap kecamatan segera buka 24 jam dan para dokter jaga siaga beserta paramedis guna melayani masyarakat yang membutuhkan pengobatan. Pustu di Desa Klantan, Kec.Brandan Barat sudah siap dibangun dan petugas setiap harinya siaga di tempat. (c01 )

Pemilik Warkop Rangkap Jadi Jurtul Judi Togas BINJAI (Waspada) : Pemilik warung kopi merangkap jadi Jurtul (Juru Tulis ) judi Togas, RN, (41) warga Lingkungan IX pasar III, Pekan Selesai, Minggu (20/3) pukul 20:00 diringkus Sat Reskrim PolresBinjai,dipimpinKanitIV,unitVC(ViceControl)IpdaHL.Tobing, tersangka terlibat kasus perjudian ini diringkus dari warung kopi. Guna pengusutan selanjutnya tersangka bersama barang bukti, uang sebanyak Rp 300.000 diduga uang tebakan pemasang, satu buah buku tafsir mimpi dan alat judi lainnya, diamankan dibalik jeruji besi rumah tahanan Sat Reskrim Polres Binjai, sebelum berkas perkaranya dilimpahkan ke Jaksa Penuntut Umum (JPU). Kapolres Binjai, AKBP Dra Rina Sari Ginting melalui Kasat Reskrim AKP Ronni Bonic ketika dikonfirmasi membenarkan. (a05)

Sedang Nyabu Diringkus Polisi BINJAI (Waspada) : S alias Darso, 47, warga jalan KH Dewantara, Desa Sei Limbat, Kecamatan Selesai, Minggu (20/3) pukul 18:30 diringkus Sat Narkoba Polres Binjai, dipimpin Kanit Idik Ipda Nazrides SH. Tersangka diringkus sedang nyabu tidak jauh dari rumahnya. Untuk penyidikan selanjutnya tersangka bersama barang bukti, 1 paket kecil (Pahe) shabu dan alat untuk untuk nyabu diamankan. Kapolres Binjai, AKBP Dra Rina Sari Ginting melalui Kasat Narkoba AKP Achiruddin ketika dikonfirmasi membenarkan. (a05)

Terkait Penipuan Di T. Pura

Mobil Penjual Bungkus Rokok Dihancurkan Warga STABAT (Waspada) : Penipuan bermodus menjual rokok terjadi Di Tanjungpura, Kab. Langkat. Pelaku kini ditahan di Polres Langkat setelah diserahkan warga yang mengejarnya. Informasi dan data yang dihimpun, pelaku TR, 35, warga Titi Papan Medan datang ke Tanjungpura menawarkan satu karton rokok kepada Rudi Halim di sebuah toko di Jalan Langkat, Kel. Pekan Tanjungpura, Sabtu (19/3). Korban Rudi tidak merasa curiga dan membeli rokok tersebut senilai Rp6 juta. Setelah

pelaku pergi korban kemudian membuka rokok, tetapi isinya hanya tumpukan bungkus rokok. Merasa ditipu, korban berusaha mengejar pelaku. DikawasanPasarIX,Tanjungberingin, Kec. Hinai pelaku yang mengendarai mobil Avanza BK 1283 JP berhasil dihentikan korban bersama temannya. Meski sempat terjadi pertengkaran, pelaku berhasil diamankan korban dan dibawa ke Mapolres Langkat untuk mempertanggungjawabkan perbuatannya. Namun sebelum dibawa ke Polres Langkat, sejumlah warga yang mengetahui pelaku melakukan penipuan spontan merusak mobil milik TR hingga seluruh kaca pecah.

Waspada/Abdul Hakim

Mobil pelaku penjual bungkus rokok dirusak, Senin (21/3). Kasat Reskrim Polres Langkat AKP Doni Alexander membenarkan kejadian itu. ‘’Tersangka TR telah ditahan,’’ katanya Senin (21/ 3). (a03)

Dua Penghuni LP Binjai Miliki Ganja Kering BINJAI(Waspada):Duapenghuni LP (Lembaga Permasyarakatan ) Binjai, masing-masing RI alias Reza, 25 dan BR alias Banda, 26, kedua-duanya terkait kasus Narkotika jenis shabu, Sabtu (19/ 3) kembali ditangkap pegawai LP karena memiliki 230 amplop dan 1bungkusbesardaunganjakering diperkirakan seluruhnya seberat 2 ons, dari kamar XI blok A. Guna pengusutan selanjutnya Minggu (20/3) kedua penghuni LP tersebut bersama barang bukti diserahkan ke Sat Narkoba

Polres Binjai. Kapolres Binjai, AKBP Dra Rina Sari Ginting melalui Kasat Narkoba AKP Achiruddin HasibuanSH,MHketikadiKonfirmasi tentang diserahkan kedua penghuniLPBinjai,memiliki2onsdaun ganja kering membenarkan. Keterangan diperoleh, ketika pegawai LP, Sabtu malam sekira pukul 22:00 memeriksa seluruh ruangantahanan.Begitudikamar XI blok A menemukan ganja kering dari tangan RI alias Reza. Kepada petugas yang meme-

riksanya, Reza mengaku kalau ganja diperoleh dari A, warga Aceh baru dijual sebanyak 2 amplop seharga Rp 10.000 kepada BR alias Banda. Untuk membuktikan kebenarannya oleh petugas lalu memanggil Banda dan diakuinya kalau ia baru membeli ganja kering dari Reza, untuk dipakainya sendiri. Kedua penghuni LP mendekam di LP Binjai terkait kasus Shabu. Seyogianya Banda akan bebas Mai 2011 ini, namun karenaterlibatlagikasusganja.(a05)

Illegal Logging PT IA, Komisi A DPRD Batubara Lapor Ke Menhut LIMAPULUH (Waspada): Operasional PT IA di Bogak Sebrang, Desa Bogak, Kec.Tanjungtiram, Kab. Batubara yang diduga melakukan illegal logging merambah hutan menjadi kebun sawit segera dilaporkan ke Menteri Kehutanan sekaligus penindakan hukum sesuai Undangundang No 41/1999 Tentang Kehutanan. ‘’Ini kesimpulan dari pertemuan rapat dengar dengan pihak perusahaan PT IA diwakili Hery PP putra pengusaha yang tidak mampu menunjukan dokumen dari Menhut RI atas pengelolaan kawasan hutan,’’ sebut Ketua Komisi A DPRD Kab Batubara Al-As’ari SAg kepada Waspada seusai memimpin rapat pertemuan yang dihadiri masyarakat beserta instansi terkait seperti Kadis Kehutanan di ruang rapat umum dewan, Senin (21/3). Selain tidak memiliki izin Menhut, operasional perusahaan melanggar Undang-undang 32/

2009 maupun Peraturan Menteri NegaraLingkunganHidupNo:11/ 2006 tentang jenis rencana usaha dan /atau kegiatan yang wajib dilengkapi dengan Analisis Mengenai Dampak Lingkungan Hidup (Amdal). Di samping instalasi pengolahan air limbah, ditemukan saluranpembuanganhasilproses produksi langsung dialirkan ke laut melanggar, sehingga jelas Peraturan Pemerintah No. 19/ 1999 tentang pengendalian pencemarandan/atauperusakanlaut sebagaimana diatur dalam Pasal 10 (2). Sementara, alasan perusahaantidakmelengkapiizinkarena memerlukan banyak dana mengurusnya. ‘’Jadi, jika perusahaan tidak mampu mengurus izinnya, lebih baik ditutup saja,’’ ujar AlAs’ari sembari meminta institusi hukum dan terkait untuk memproses dan memberi sanksi tegas. Terkait illegal logging selain melaporkan ke Menhut, Dinas

Kehutanan setempat dan polisi supaya berkordinasi menghentikan aktivitas pengolahan kawasan hutan sekaligus menarik alat berat berupa escavator dari lokasidanmenindaklanjutisecara hukum. Sedangkan lahan kawasan hutan lindung dan sebagian HPT itu menurut pengakuan Hery dibelinya dari sejumlah warga petambak dan seorang anggota dewan maupun pejabat. Sedangkan dugaan penambangan pasir kuarsa, ditindak lanjuti dengan memanggil kembali Dinas PU yang tidak hadir dalam pertemuan sehingga tidak memperoleh kejelasan dalam masalah itu. ‘’Segera kami agendakan kembali memanggil Dinas PU terkait dugaan penambangan pasir kuarsa PT IA,’’ujarnya didampingi anggota komisi Sutan Sitompul, Hamonangan Simatupang, Usman dan Ahmat Mukhtas.(a13)

WAGUBSU H.Gatot Pujonugroho ST dalam sidang paripurna istimewa Hari Jadi Ke- 65 Asahan, Selasa (15/3), mengungkapkan, laju pertumbuhan ekonomi Asahan rata rata 4,51 persen. “Tingkatkatkan lagi laju pertumbuhan ekonomi dengan distribusi yang merata sehingga tidak terdapat kesenjangan,” tukas Gatot. Pernyataan ini berkaitan dengan visi Pemkab Asahan di bawah kepemimpinan Bupati/Wabup Drs.H.Taufan Gama Simatupang,MAP/H. Surya, BSc (2010-2015) membangun Asahan yang relijius, sehat, cerdas, dan mandiri. Jika disimak cermat, Taufan/Surya dalam mengusung visi tersebut di Pilkada Asahan 2010 mengisyaratkan realita sebuah daerah kabupaten yang butuh pembangunan nilai reliji, belum semua rakyatnya sehat, belum semuanya mendapat pendidikan yang layak, dan belum semuanya mandiri. Dalam konteks mandiri inilah kaitan laju pertumbuhan ekonomi Asahan, dari sudut pandang Gatot, perlu ditingkatkan sekaligus pendistribusian yang merata sehingga tidak ada lagi kesenjangan ekonomi di masyarakat Asahan, barulah terwujud apa yang disebut mandiri. Pada 2005 menurut‘atas dasar harga berlaku’ Product Domestic Regional Bruto (PDRB) Kabupaten Asahan mencapai Rp.15.527,79 miliar, di mana sektor industri penyumbang terbesar 40,71 persen, pertanian 27,98 persen, kemudian perdagangan/hotel/restoran 11,99 persen. Performa Asahan ini terpacu kembali dengan laju pertumbuhan ekonomi rata rata 4,51 persen di awal pemerintahan Taufan/Surya. Pertanyaannya, apakah pendapatan ril rakyat Asahan sudah tercermin atau tercapai dengan performa dimaksud? Oh, tentu tidak. Untuk itulahTaufan/Surya bertekad membangun Asahan yang mandiri dan patut digarisbawahi ‘ingin mewujudkan rakyat yang memiliki pendapatan masing masing di tingkat layak secara ekonomi’. “Asahan mempunyai potensi dengan letak geografis yang strategis, sehingga wilayah ini menjadi sektor perkebunan dengan menampung tenaga kerja terbesar. Sehingga pembangunan di sektor itu harus menjadi perhatian tanpa mengesampingkan sektor lainnya,” cetus Gatot. Fokus Pembangunan pada hakekatnya merupakan suatu proses terus menerus untuk mencapai suatu tujuan atau perubahan ke arah lebih baik dengan berbagai dampak dan implikasi, secara sosio ekonomis seharusnya merupakan sebuah perubahan positif bertujuan meningkatkan taraf hidup,kualitaskehidupandanmartabatmanusia, serta mengubah sosial budaya. Everett M.Rogers dalam Komunikasi dan Pembangunan; Perspektif Kritis1985 menyebutkan, pembangunan adalah perubahan yang berguna menuju suatu sistem sosial ekonomi yang diputuskan sebagai suatu keinginan bersama. Melihat visi Pemkab Asahan, agaknya fokus kepada perubahan fundamental warganya, bila dilihat dari kata: Relijius, Sehat, Cerdas, dan Mandiri.Taufan/Surya dengan visi ini ingin merubahparadigmapembangunankabupatenAsahan. Sebagai ilustrasi patut dikutip pernyataan Gatot di atas ‘sektor perkebunan menampung tenaga kerja terbesar’ dengan memunculkan apakah potensi perusahaan perkebunan sudah member kontribusi layak dengan pola UMR terhadap pendapatan tenaga kerja (baca: warga Asahanyangberkerjadiperusahaanperkebunanred) untuk tenang beribadah, menyehatkan keluarga, memberikan pendidikan yang layak kepadaanak,tentunyadikuncidenganpertanyaan sudah mandirikah tenaga kerja perkebunan? Mungkin yang dimaksudkan pendistribusian oleh Gatot di atas tentu tidak hanya berlaku di perusahaan perkebunan tetapi semua sektor ekonomiharusdipacunaikdiikutipendistribusian yang merata sehingga tidak terdapat kesenjangan sosial ekonomi. Jika ingin mengubah paradigma pembangunan di Asahan, pola ukur Income Perkapita (pendapatan nasional dibagi populasi-red) harus ditinggalkan.Asahantidakperlulagimenampilkan performa paradigma lama untuk mengundang investor. Asahan ingin mengukur keberhasilan pembangunannyadenganpolapendapatannyata tiapwarga,agaknyainiyangdimaksudkanTaufan/ Surya sebagai mandiri. Taufan/Surya mulai melangkah dalam peningkatan kualitas pendidikan dengan menggodok Peraturan Daerah Jam Belajar Malam pukul 19:00 sampai 21:00, di mana warga usia sekolah pada rentang waktu itu harus belajar, serta shalat dan mengaji bagi pemeluk agama Islam.

Waspada/Nurkarim Nehe

PEMBANGUNAN Pos Jaga SDN 010086 Selawan Kisaran Timur, simbol partisipasi warga dalam pembangunan. Anggaran Pendidikan Asahan dalam APBD Tahun2011membengkakantara28persensampai sekitar 30 persen, di antaranya bersumber dari Dana Alokasi Khusus. Cukup signifikan jika dikaitkan dengan target Sisidiknas dengan pola 20 persen anggaran pendidikan. Prof DR HM Arif Nasution, MA, pakar politik USU, Sabtu (19/3), menyatakan, realisasi target20persenituhanyasekitar10 sampai11 persen saja, itupun terdistribusi untuk administrasi dan lain lain sekitar tujuh persen dan hanya tiga persen untuk pembelajaran. Arif membandingkan anggaran belanja pendidikan Singapura 32 persen dan Jepang 38 persen. MengukurpendidikandiIndonesiayangbaru menghasilkan Strata-1 di bawah 5 persen menurut Arif sangat menentukan mentalitas populasinya, sehingga berdampak kepada rekrutmen legislator dan Pilkadasung, yang pada akhirnya mempengaruhi sebuah keputusan dalam menentukan kebijakan. “Lihat undang-undang Politik kita,” katanya. Sedangkan Drs Mapilindo MPd selaku anggota Dewan Pendidikan Asahan dan anggota DPRD Asahan mengakui anggaran pendidikan Asahan, khususnya yang dari DAK, masih dominan berkutat untuk fisik, administrasi termasuk gaji. Tetapi, Pemkab Asahan sudah membuat kebijakan tidak akan menambah ruang belajar, selain untuk memberi kesempatan lembaga pendidikan swasta bisa “bernafas” juga efisiensi anggaran agar bisa tersalur kepada peningkatan mutu pembelajaran,baikmutupendidikmaupunmutu pola kegiatan belajar dan mengajar. “Kecuali di desa tertentu, misalnya Pematang SeiBaruKecamatanTanjungbalai,masihmembutuhkan ruang belajar. Kota Kisaran mutlak tidak dibenarkan sekolah negeri menambah ruang belajar,” ujar Mapilindo. Secara bertahap pola penggunaan anggaran mulai diubah Pemkab Asahan ke arah peningkatan mutu pembelajaran, sehingga Komite SDN 010086 Kelurahan Selawan, Kecamatan Kota Kisaran Timur mulai menyahuti hal itu, sesuai fungsinya menggalang partisipasi masyarakat dan dunia usaha dalam membangun ruang DewanGurudanPosJagaSekolah,mengembangkan dana hibah bersaing yang didapat dari Dewan Pendidikan Nasional. Partisipasi masyarakat muncul, sekarang Komite SDN 010086 Selawan sedang mengerjakan Pos Jaga. “Jika diawali dengan niat baik, bekerja dengan baik, kenapa tidak? Visi Taufan/Surya harus diapresiasi dalam bentuk partisipasi masyarakat memberikan kontribusi terhadap pembangunan Asahan,” ujarWakil Ketua DPRDSU Sigit Pramono Asri,SE, (foto) yang putra Asahan ini. Sigit yakin mengubah paradigma pembangunan,walautaksemudahmembalikkantelapak tangan, jika diapresiasi masyakarakat dengan tekad mandiri dan komitmen Pemkab Asahan berjalan, niscaya partipasi masyarakat sangat berguna dalam perubahan Asahan ke arah lebih baik lagi. Taufan/Surya sebagai salah satu bagian “cerdas” masyarakat Asahan dengan mengusung visi“denganImtaqdanIptekmewujudkanAsahan yang Relijius, Sehat, Cerdas dan mandiri”. Cerminan indikator pembangunan sesungguhnya, sehingga kelak akan gampang mengukur tingkat keberhasilan pembangunan Asahan. Terhadap faktor lingkungan, di mana potensi sumber daya alam Asahan sangat potensial, agaknya patut digarisbawahi “warning” M.Arif Nasution,pemanfaatanSDAuntukmeningkatkan pendapatan harus menghitung dampak negatif atau kerusakan lingkungan yang timbul. Bacalah buku Mahbub Ul Haque 13 Dosa PerencanaanPembangunanyangmemenangkan hadiah nobel, tukas Arif. Nurkarim Nehe

Sumatera Utara


Satu Rumah Terbakar Di Sidikalang


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Kalitbang: Hj. Emma Sujianti Tarigan. Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); H.T. Donny Paridi (Aceh); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Rustam Effendi, Mursal Alfa Iswara. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri Batubara. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Asahan: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapak Tuan: Zamzamy Surya. Blang Pidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Pengaduan Bahrum Sihotang Diterima Polres Pakpak Bharat SALAK (Waspada) : Pengaduan Bahrum Sihotang akhirnya diterima pihak Kepolisian Resor (Polres) Pakpak Bharat berdasarkan surat tanda penerimaan laporan yang ditandatangani Aiptu S Ginting, tertanggal 17 Maret 2011. Adapun pengaduan dimaksud adalah telah melaporkan tindak pidana PemalsuanTandatangan untuk pencairan dana yang 5 persen sebesar Rp39.825.000 atas proyek Pembangunan Konstruksi Instalasi PLTMH (Pembangkit Listrik Tenaga Micro Hydro) II di Desa Malum, Kecamatan STU Jehe, Kabupaten Pakpak Bharat tahun anggaran (TA) 2009 yang berbiaya Rp796.500.000 bersumber dari APBD dengan pelaksana pekerjaan CVYusran/Mangiring Purba (Wakil Direktur). Sebelumnya, BS saat itu telah melaporkan permasalahan tersebut. Namun, pihak Polres tidak menerima pengaduannya karena berkasnya terlebih dahulu harus dileges dari DKPLH. Tapi, permasalahan dimaksud membuat BS menjadi kewalahan dan tambah bingung. Pasalnya, oknum Plt DKPLH Pemkab Pakpak Bharat berinisial MAG terkesan berupaya menghalang-halangi proses hukum. Dimana, dia tidak mau untuk meleges sebelum melihat dari pada berkas aslinya. Setelah berminggu-minggu lamanya, akhirnya, Panitera Sekretaris Pengadilan Negeri (PN) Sidikalang-Pakpak Bharat Megawati Simbolon tertanggal 14 Maret 2011 dengan ditandatangani meleges fotocopy yang sesuai dengan aslinya/turunannya berkas dari pada BS. (a37)

WASPADA Selasa 22 Maret 2011

SIDIKAANG (Waspada) : Sebuah rumah tinggal hangus terbakar di Jalan HKBP II, Sidikalang, Kabupaten Dairi, Sabtu (19/3) malam. Diperoleh kabar, hunian dimaksud milik marga Manalu pengusaha kopi. Api tidak sempat merambat ke bangunan tetangga lantaran warga dan petugas bekerja keras menghentikan kobaran. Pada waktu bersamaan, kendaraan pemadam kabakaran milik pemerintah daerah juga meluncur. Konstruksi itu berupa bangunan permanen di sebelah depan sedang bagian dapur terbuat dari kayu. Polisi membenarkan peristiwa ketika dikonfirmasi melalui telefon seluler. (a20)

Judi Togel Semakin Merebak Di Simalungun

Waspada/Abdul Khalik

SEJUMLAH Kasek SD/SMP Kota Tebingtinggi menandatangani naskah serah terima dana BOS disaksikan Pj Walikota Tebingtinggi, Kadis Pendidikan dan Ketua Dewan Pendidikan, Senin (21/3).

SIMALUNGUN (Waspada) : Judi togel (toto gelap) akhir-akhir ini semakin merebak hingga kepelosok pedesaan di wilayah hukum Kab.Simalungun.Wargamemintapihakberkompetensegerabertindak dan jangan sampai judi terselubung itu merusak keluarga dan generasi muda. Peredaran judi togel di Simalungun sudah mulai terang-terangan. Di antaranya dilakukan di rumah juru tulis (jurtul) bahkan juga sudah mulai dijual di warung-warung kopi terutama warung yang jauh dari pantauan petugas keamanan. Mereka (jurtul) tampaknya sudah tidak segan-segan lagi menjual kupon putihnya kepada para pelanggannya. Selain menggunakan kupon, agen (penjual) togel juga membuka jaringan telefon dengan pelanggannya. (a29)

Program Pokok PKK Pengangkatan Honorer Dibiayai 10Tupoksi Beberapa SKPD BOS Merupakan Kejahatan T. TINGGI (Waspada): Pengangkatan tenaga honorer sekolah yang dibiayai dari dana Bantuan Operasional Sekolah oleh kepala sekolah merupakan kejahatan. Karena, kepala sekolah tidak berhak mengangkat tenaga honorer, tapi yang berhak adalah kepala daerah. Untuk 2011 diharapkan tidak ada lagi kepala sekolah yang mengangkat tenaga honorer.

Penegasan itu disampaikan Pj. Walikota Tebingtinggi Drs H Eddy Syofian, MAP, Senin (21/ 3), saat menghadiri penanda tanganan penyaluran dana BOS kepada sekolah, di aula Dinas Pendidikan. Terlihat hadir Kadis Pendidikan Drs H Pardamean Siregar, MAP dan seluruh Kasek SD/SDLB dan SMP/SMP Terbuka. Dikatakan, dalam proses penyaluran dana BOS, semua dana semestinya untuk mendukung kegiatan belajar mengajar siswa dan bukan dilakukan untuk

berbagai kebutuhan yang tak ada sangkut pautnya dengan itu. Dana itu, kata Pj.Walikota, bukan miliknya kepala sekolah, Dinas Pendidikanatauyanglainnya,tapi milik siswa. Maka penggunaannya harus dilakukan secara transparan. Artinya, kegiatan yang dilakukan menggunakan dana BOS harus diketahui masyarakat. “Cantumkan penggunaannya di papan pengumuman sekolah,” pinta Pj. Walikota. Disebutkan,KotaTebingtinggi merupakan daerah pertama yang mencairkan dana BOS dari 33 kab/kota di Sumut. Atas dasar

itu, Pj. Walikota meminta agar selesaipenandatanganannaskah penyerahan, siang harinya dana itusudahmasukrekeningsekolah masing-masing. Sementara Manajer BOS DinasPendidikanDatingPasaribu, SPd, dalam keterangannya mengatakan, untuk 2011 sebanyak 28.352 siswa SD/SMP negeri dan swasta menerima dana BOS. Jumlah siswa SD/SDLB yang menerimamencapai19.223siswa dan SMP/SMP Terbuka 9.129 siswa. Untuk SD/SDLB menerima Rp400 ribu per siswa per tahun, sedangkan SMP/SMP

Terbuka menerima Rp575 ribu per siswa per tahun. Total dana yang disalurkan mencapai Rp12,828 miliar lebih. “Penyaluran dana dilakukan per triwulan,” ungkap Dating. Untuk Kota Tebingtinggi, jumlahSDnegeriyangmenerima BOS triwulan I (Januari-Maret) sebanyak 77 sekolah, SD swasta 17 sekolah, SMP negeri 11 sekolah dan SMP swasta 12 sekolah. SD/ SMP negeri menerima Rp2,504 miliar dan SD/SMP swasta Rp729,943 juta, dengan total Rp3,234 miliar. (a09)

Pengibaran Bendera LPTQ Diwarnai Hujan, Pawai Ta’ruf Dibatalkan KOTAPINANG (Waspada): Kendati diguyur hujan namun arena Musbaqah Tilawatil Quran (MTQ) dan Festival Seni Nasyid (FSN) Kab. Labusel tetap ramai. Upacara penaikan bendera LPTQ dan LPPSN yang berlangsung,Seninpetang(21/3)ditanah lapangTanjungMedan,KecKampung Rakyat dipimpin inspektur upacara Bupati Labusel. PantauanWaspada,sejumlah undangan dan unsur Muspida

Labusel sudah mulai memadati lokasi upacara sekira pukul 14.00. Seyogianya pelaksanaan upacara penaikan bendera LPTQ dan LPPSN dilaksanakan pukul 14:30, namun karena cuaca tiba-tiba mendung disusul hujan deras disertai petir, membuat arena MTQ becek, sehingga upacara penaikan bendera LPTQ dan LPPSN baru dapat dilaksanakan pukul 16:30. Sedangkan pelepasan pawai

ta’ruf seogianya dilaksanakan pukul 15:30 terpaksa ditiadakan karena hujan tak kunjung henti. Meski demikian, peserta dan undangan serta masyarakat dengan tertib tetap mengikuti kegiatan seremonial hingga selesai. Dalamkesempatanitu,Bupati Labusel juga melantik dewan hakim MTQN dan dewan juri FSN. Sedangkan upacara pembukaan akan berlangsung tadi malam. (a19/c18)

10.639 Siswa Se T. Tinggi Laksanakan Pra UN T. TINGGI ( Waspada): Selama tiga hari, 10.639 siswa se Kota Tebingtinggi mengikuti kegiatan pra Ujian Nasional 2011. Kegiatan itu, diikuti siswa mulai dari SD/MI kelas VI, SMP/MTs kelas IX dan SMA/MA/SMK kelas XII dengan mata ujian yang nantinya akan diujikan pada UN. Kabid Dikdasmen Drs J Sitinjak,Senin(21/3),mengatakan mata ujian Pra UN terdiri dari SMP/MTs Bah. Indonesia, MM dan Bah. Inggris. Untuk SMA/ MA, Bahasa Indonesia, Biologi, Sosiologi, Sastra Indonesia, MM, Bah. Inggris, Kimia, Geografi, Fisika, Ekonomi, Sejarah Budaya/ Antropologi dan Bah. Asing.

Sedangkan SMK terdiri dari Bah. Indonesia, MM dan Bah. Inggris. Pj.Walikota Drs H Eddy Syofian,MAP,saatmeninjausejumlah sekolah yang melaksanakan pra UN, mengatakan kegiatan itu, merupakanujikemampuansiswa dalampersiapanmenghadapiUN 2011. Persiapan terpenting itu, kataPj.Walikota,adalahpersiapan mental siswa. Karena bagaimana pun juga mengikuti UN itu, harus diakui berat karena tekanan psikologisnyatinggi.“Takadayang mau gagal kan? Semua ingin berhasil, karena itu harus dipersiapkan. Pemko memfasilitasi upaya itu,” jelas dia. Dalam kunjungan Pj. Wali-

kota,beberapasiswayangditanya mengatakan senang dengan pelaksanaan pra UN itu. Alasannya, bisa mengetahui bagaimana pelaksanaan UN yang sebenarnya, sehinggabisalebihrileksnantinya. Direktur BT/BS Bima yang turut menjadi penyelenggara Ir. Robert Valentino, mengatakan dalam kegiatan pra UN itu, lembaganya hanya bersifat membantu pelaksanaan. Misalnya membuat soal dan mencetak soal-soal yang ada. Sedangkan pelaksana kegiatan adalah Ikatan Keluarga Guru Indonesia (IKGS). Dari berbagai keterangan yang diperoleh, kegiatan pra UN

dibiayai oleh wali murid melalui Komite Sekolah. Tiap-tiap mata ujian dibayar Rp5.000 per siswa. Misalnya untuk SMA dengan enam mata ujian, siswa harus membayar Rp30 ribu. Diperkirakan, dana penyelenggaraan pra UN mencapai Rp1,9 miliar lebih. Untuk 2011, dana itu tidak dianggarkan dalam APBD kota. Pra UN yang dilaksanakan di berbagai sekolah, sebelumnya mendapat tanggapan miring berbagai pihak, karena dinilai tak bermanfaat dan hanya menghabiskan dana dan waktu. Sedangkan tingkat akurasinya dengan UN sangat rendah. (a09)

Hari Ini Mubes SPBUN PTPN II

SPBUN Konsisten Menjadi Wadah Perlindungan Pekerja TANJUNGMORAWA (Waspada): Serikat Pekerja Perkebunan (SP-BUN) PTPN II kembali menggelar pesta demokrasi pemilihanpaketketuaumumdan sekretaris SP-BUN Periode 20112016 ajang musyawarah besar (Mubes) ke-3 tingkat perusahaan di Hotel Madani, Medan, Selasa (22/3). Ketua Panitia (OC) M A Fadli Harahap didampingi Ketua SC Toni Nixon, Senin (21/3) menyebutkan, sekira 257 orang dipastikan akan menghadiri Mubes di antaranya 150 peserta antara lain utusan dari ketua, sekretaris dan

bendahara SPBUN unit se PTPN II, 57 dari unsur pejabat pemerintah, tokoh agama, pemuda, serta 50 pengurus pleno. “Mubes selain memilih kepengurusan periode mendatang, juga diharapkan dapat melanjutkan tugas dan perjuangan pengurus lama yang dipimpin Ir M Idris Nasution yang sekaligus menjabat penanggung jawab Mubes,” ujarnya. Dilanjutkan, tugas dan perjuangan tersebut antara lain memberikan perlindungan, pembelaan hak dan kepentingan pekerja untuk meningkatkan ke-

sejahteraan, menciptakan suasana kondusif demi ketenangan kerja dan kelangsungan perusahaan serta mengamankan iklim usaha hubungan industrial. “SPBUN sebagai wadah para pekerja untuk menyalurkan aspirasi demi terciptanya daya guna dan hasil guna dalam melaksanakan program-program serta mewujudkan tujuan, sifat dan fungsi serikat,” kata Fadli. Dijelaskan, Mubes merupakan sejarah baru dimana SPBUN PTPN II beserta stake holder menggalang pola produktifitas untuk meningatkan kinerja peru-

sahaan sekaligus mengangkat martabat pekerja PTPN II. “Selain memilih pengurus, juga mereview/mengevaluasi AD/ART SPBUN ke arah profesionalisme,integritasdankapabel dengan menetapkan program kerjalimatahunkedepan,dimana selama ini telah terjalin harmonisasihubunganindustrialSPBUN dengan manajemen/pemberi kerja yang diharapkan ke depan akan lebih baik lagi,” jelas Fadli Mubesdirencanakandihadiri Wagubsu Gatot Pujo Nugroho, Dinas Tenaga Kerja dan Direksi PTPN II. (c02)

Pemkab DS Cairkan Dana BOS SD-SMP LUBUK PAKAM (Waspada): Pemerintah Kabupaten Deliserdang melalui tim manajemen Bantuan Operasional Sekolah (BOS) mencairkan dana bantuan 2011 kepada seluruh Kepala Sekolah tingkat SD Negeri/swasta dan SMP Negeri/swasta. ‘’Pencairan dana mengacu kepada Permendiknas 37/2010 tentang petunjuk teknis dana bantuan BOS tersebut,’’ kata Manager Tim pelaksana BOS Kab. Deliserdang Drs H Asli Rambe,

SH.MPd yang juga Kabidpora Disdikpora Deliserdang, Senin (21/3). Untuk itu kepada seluruh Kepala Sekolah selaku Pembantu Bendahara Pengeluaran Pembantu (PBPP) untuk segera mencairkan dana BOS tersebut. Sedang penyaluran dana BOS bagi sekolah negeri SD dan SMP melalui Bendahara Pembantu Penyaluran. Dan bagi sekolah swasta penyalurannya melalui Dinas Pengelola Keuangan

Daerah (PKD) Kab.Deliserdang. H Asli Rambe juga menjelaskan, pembentukan Tim Manajemen BOS di Kab. Deliserdang berdasarkan SK Bupati Deliserdang 203 pada 15 Maret 2011 dengan komposisi Bupati Deliserdang Drs H Amri Tambunan dan Ketua Bappeda Deliserdang Ir H Irman Dj Oemar, MSi selaku Tim pengarah. Kadisdikpora Deliserdang Hj Saadah Lubis, SPd. MAP dan Kepala Dinas PKD Drs Agus Suman-

tri sebagai penanggungjawab. Sedangkan tim pelaksana BOS sebagai manager Kabidpora Disdikpora Deliserdang Drs H AsliRambe,SH,M.Pd,Bendahara pengeluaranpembantuSitiHadijah, Unit pendataan SD/SDLB Rusli Efendi Lubis, SE, Unit pendataan SMP/SMPLB/SMPT Drs AJ Pasaribu MPd. Unit monitoring dan evaluasi Raya Mandai, SEsertaUnitpelayanandanpenanggulanganpengaduan masyarakat Drs Budi Pratama, MPd.(a06)

P. SIANTAR (Waspada) : 10 Program pokok Pemberdayaan Kesejahteraan Keluarga (PKK) merupakan tugas pokok dan fungsi (Tupoksi) dari beberapa satuan kerja perangkat daerah (SKPD) Pemda. “Karena itu, pelaksanaan Rakerda VII PKK Pematangsiantar merupakan momen penting untuk menyatukan persepsi dan derap langkah pemerintah sebagai pengelola program dengan mitra pemerintah guna bersama-sama membangun Pematangsiantar yang mantap, maju dan jaya,” kata Walikota Pematangsiantar Hulman Sitorus melalui Sekda Donver Panggabean, saat membuka Rakerda VII PKK Pematangsiantar di gedung Dharma Wanita, Jalan Porsea, Kamis (17/3). KetuaTPPKKNyRusmiatiRomannaHulmanSitorusmengatakan, Rakerda VII PKK sebagai tindak lanjut dari Rakerda Provsu pada l7 Desember 2010 di Medan dan mengharapkan pada Rakerda VII itu dapat bersama-sama mengevaluasi kemajuan, hambatan, dan tantangan yang dihadapi di dalam melaksanakan berbagai program yang sudah direncanakan. (a30)

Bidan Di P. Siantar Dukung Program Jaminan Persalinan Gratis P.SIANTAR (Waspada) : Kalangan Bidan yang tergabung dalam wadah Perkumpulan Bidan Indonesia (PBI) di Pematangsiantar menyatakan mendukung program jaminan persalinan gratis dilaksanakan di daerahnya. “PBI siap mensukseskan program jaminan persalinan gratis didaerahini,”kataketuaPBIPematangsiantar-KabupatenSimalungun, Lia Fadhila Siregar Am.Keb, Minggu (20/3) di Pematangsiantar. Bidan Lia, demikian panggilan akrabnya, saat melaksanakan kegiatan sosial pe layanan pemeriksaan bagi para ibu dan bayi dari keluarga kurang mampu di daerah pinggiran kota itu mengatakan, selama ini biaya untuk persalinan yang dikenakan pihak rumah sakit maupun klinik persalinan dirasakan cukup memberatkan para ibu-ibu yang datang dari keluarga miskin. “Maka program jaminan persalinan gratis yang sudah diluncurkan pemerintah, sebaiknya dilaksanakan di rumah-rumah sakit, baik pemerintahmaupunswastadanjugaklinik-klinikpersalinan,termasuk praktik bidan,” kata bidan lulusan Akbid MH Thamrin Jakarta itu. (c16)

Walikota Hadiri Peringatan Maulid Bersama TNI-Polri P. SIANTAR (Waspada) : Walikota Pematangsiantar Hulman Sitorus menghadiri peringatan Maulid Nabi Muhammad SAW 1432 H bersama TNI, Polri di Kota Pematangsiantar yang digagasi Panitia Hari Besar Islam (PHBI) setempat. Peringatan Maulid Nabi Muhammad SAWTahun 1432 H dengan tema“Dilandasinilai-nilaireligiusmemberdayakanpotensimasyarakat yang serasi dan selaras dengan tuntutan pembangunan yang berkeadilan” di lapangan H. Adam Malik, Pematangsiantar, Kamis (17/3) malam. Menurut Kabag Humas dan Protokoler Pemko Daniel H Siregar, Jumat (18/3), dilaksanakannya Maulid ini dengan harapan masyarakat dapat merefleksikan kembali perjuangan dan suri teladan Nabi Muhammad SAW ke dalam kehidupan bermasyarkat, berbangsa dan bernegara yang diridhoi Allah SWT.(a30)

Camat Diminta Tertibkan Surat Tanah SIMALUNGUN (Waspada) : Camat harus proaktif untuk menertibkan surat–surat dan data tanah masyarakat. Bagi masyarakat yang ingin mengurus sertifikat tanah agar dapat dilayani dengan sebaik–baiknya serta lebih dipermudah. Hal itu disampaikan Bupati Simalungun JR Saragih saat memberikan bimbingan dan arahan dalam rangka Sosialisasi BPHTB (Bea Perolehan Hak Tanah dan Bangunan) sesuai UU Nomor 28 Tahun 2009 tentang Pajak Daerah dan Retribusi Daerah di Pamatang Raya, kemarin. Kepada camat dan notaris diminta harus proaktif menginformasikan kepada masyarakat mengenai pertaturan tentang pertanahan. Misalnya menyangkut tanah pertapakan rumah, berapa meter jarak rumah dengan badan jalan, baik jalan negara maupun jalan provinsi. Hal itu bertujuan untuk mendukung pembangunan dan mempermudah pemerintah bila dikemudian hari diadakan pelebaran jalan. (a29)

Pemkab Dan PHBI Simalungun Peringati Maulid SIMALUNGUN (Waspada): Ribuan umat muslim di . Simalungun berkumpul bersama di lapangan bolakaki Serbelawan, Kec. Dolok Batunanggar mengikuti peringatan Maulid Nabi Besar Muhammad SAW yang digelar Pemkab dan PHBI Simalungun, Kamis (17/3). Peringatan Maulid mengusung thema “Dengan menauladani Nabi Muhammad SAW, mari kita tingkatkan persatuan dan kesatuan dalam keragaman suku dan agama untuk membangun Kabupaten Simalungun”. Peringatan Maulid tersebut juga dihadiri Bupati Simalungun JR Saragih,Wakil Bupati Hj Nuriaty Damanik, unsur Muspida, mewakili manajer PTPN-IV Kebun Dolok Ilir dan PT Bridgestone, KPU, OKP, para pejabat dan camat se- jajaran Pemkab Simalungun, ormas Islam dan para tokoh agama. Ketua panitia pelaksana drg Amrianto mengatakan, tujuan dilaksanakan peringatan Maulid sebagai sarana syiar Islam di daerah ini dan dalam rangka melaksanakan program kerja Panitia Hari Besar Islam (PHBI) Simalungun. (a29)

WASPADA Selasa 22 Maret 2011

Sumatera Utara

Guru Di Paluta Keluhkan Insentif Belum Cair

Proyek Pasca Bencana Di Tabuyung Hampir Rampung

GUNUNGTUA (Waspada) : 3.000-an Guru berstatus PNS di lingkungan Dinas Pendidikan dan Kebudayaan (Disdikbud) Padanglawas Utara mengaku resah dengan belum cairnya tunjangan atauinsentifgurusebesarRp250.000perbulanterhitungsejakDesember 2010. Para guru khawatir anggaran insentif hangus karena tahun anggaran 2010 sudah berakhir. “Banyak guru yang mengeluhkan belum cairnya tunjangan insentif ini, pasalnya ditakutkan hangus,” kata N boru Harahap, salah seorang guru SMA, Senin (21/3). Dikatakan, biasanya tunjangan fungsional ini digelontorkan setiap semester. Namun, sampai sekarang belum ada kejelasan pemberian hak guru itu. Kepala Dinas Pendidikan Paluta Hazairin Hasibuan ketika dikonfirmasi membenarkan bahwa pihaknya belum mencairkan insentif sebesar Rp250 ribu kepada para guru PNS di seluruh Paluta. Namun Hazairin menyebutkan anggarannya sudah di as daerah. (a35)

PANYABUNGAN ( Waspada) : Proyek pembangunan dan rehabilitasi jalan dan jembatan di Desa Tabuyung, Kec. Muara Batang Gadis, Kab. Mandailing Natal sudah hampir rampung. Pantauan di lapangan tahap pengerjaan sudah mencapai 85 persen, hanya tinggal penyiraman sirtu, diperkirakan kalau cuaca bagus dalam waktu dekat ini pekerjaan akan tuntas. Proyek pasca bencana diTabuyung ini berupa konstruksi profil badan jalan dengan anggaran Rp2.221.000.000 dikerjakan PT Rendy Raya Perkasa,konstruksipenurunanbadanjalandengan anggaranRp4.728.000.000dikerjakanPT.AnaKarya Jaya, pembangunan jembatan Aek Godang ManuncangdengannilaianggaranRp600.000.000, rehabilitasi jembatan Aek Panunggulan II dengan anggaran Rp520.000.000 oleh CV Mulkti Kencana dan pembangunan jembatan Aek Panunggulan dengan nilai anggaran Rp860.000.000 oleh CV Natalindo. Pemantauan di lapangan, proyek pasca bencana di Desa Tabuyung ini dimulai dari titik nol simpang eks Keang Nam sampai km 17. Para pekerja dan alat berat sibuk menyelesaikan proyek agar selesai tepat waktu. Di kiri kanan terlihat pembuatan parit yang memanjang dan sebagian

Borkat, Calon Tunggal Ketua DPD PAN Tapsel P.SIDIMPUAN (Waspada) : Borkat merupakan satu-satunya calon ketua yang mendaftar ke sekretariat panitia musyawarah daerah (Musda) DPD Partai Amanat Nasional (PAN)Tapanuli Selatan di Sopo PAN, Jalan Brigjen Katamso, Kampung Marancar, Kota Padangsidimpuan. “Hanya saudara Borkat yang mendaftar menjadi Calon Ketua DPD PAN Tapsel. Sedangkan untuk calon Tim Formatur, yang mendaftar ada 9 orang dan akan disaring menjadi 7,” kata Ketua dan Sekretaris Panitia Toto Indra Jaya dan Buyung M Holil, Jumat (18/ 3). Disebutkan, panitia pelaksana Musda (SC) telah membuka pendaftaran selama empat hari, Senin-Kamis (14-17/3). Tapi calon ketua yang mendaftarkan diri hanya Borkat yang periode sebelum ini menjabat Sekretaris DPD PAN Tapsel. Sedangkan calon Tim Formatur ada sembilan orang yang mendaftarkan diri yakni Toto Indara Jaya Siregar, Turmizi Harahap, Ali Imran Hasibuan, Sori Monang Panjaitan, Nehru Harahap, Ahmad Rivai Matondang, Payaman Hutasuhut, Erwin Siregar dan Buyung Muhammad Holil. (a27)

Pemimpin Yang Baik Kampanye Di Jalan Tuhan PANYABUNGAN (Waspada) : Pasangan pemimpin yang baik adalahyangkampanyedijalanTuhan.Dantidakakanberhasilpemimpin untuk memimpin jika mereka sendiri mengotori jalannya pemilihan, menghalalkansegalacara,cederailawan,khianatikawan,dantebarkan uang adalah pembodohan. Demikian disampaikan pengurus IMA NABANA Aswan Lubis, Senin (21/3) terkait coblos ulang Pilkada Madina yang dijadwalkan berlangsung 20 April 2011. Ia berharap momentum pilkada sangat berharga untuk mencapai misi pembangunan. Ia mengimbau masyarakat Madina harus jeli dalam memilih pemimpin untuk pasangan Bupati/Wakil Bupati Madina periode 2010-2015, dan jangan memilih pasangan yang money politics. Masyarakat Madina dari semua elemen harus belajar dari pengalaman diulangnya pilkada akibat money politics. (c14)

Forum Peduli Gizi Buruk Di Paluta Bakal Dibentuk GUNUNGTUA (Waspada) : Kabid Pelayanan Kesehatan (Yankes) Dinas Kesehatan Kabupaten Padanglawas Utara (Paluta) Dr Irwan mengungkapkan pihaknya bakal membentuk Forum Peduli Gizi Buruk yang bertujuan upaya penanganan kasus secara konfrehensif. Dr Irwan kepada Waspada, Kamis (17/3) mengatakan, pembentukan forum peduli Gizi Buruk sebagai upaya meningkatkan taraf kesehatan warga Padanglawas Utara. “Forum ini adalah upaya untukmembangunsemangatkebersamaandalamupayapenyelesaian kasus gizi buruk di Padanglawas Utara,” katanya. Rencananya, forum peduli gizi buruk ini bakal dibentuk terdiri dari berbagai lintas sektor seperti Dinas Kesehatan, Badan Ketahanan Pangan, Pemberdayaan Perempuan, PKK, tokoh masyarakat, kalangan pers dan LSM.(a35)

LSM Desak DPRD Percepat Jadwal Pelantikan Bupati Karo KABANJAHE (Waspada) : Sesuai tahapan Pemilihan Umum Kepala Daerah (Pemilukada) Kabupaten Karo tahun 2010, jadwal pelantikan pasangan Calon Bupati dan Calon Wakil Bupati Karo terpilih Kena Ukur Surbakti denganTerkelin Brahmana dilaksanakan pada 27 Januari 2011. Namun saat ini DPRD Kabupaten Karo masih menggodok usulan jadwal pelantikan tersebut, Senin (20/3). Atas dasar pengunduran jadwal rapat Pimpinan dan Badan Musyawah (Bamus) dewan, serta salah seorang pimpinan DPRD diduga tidak ikut menandatangani berkas pengusulan pelantikan bupati terpilih ke Mendagri melalui Gubernur Sumatera Utra. Faktor inilah tampaknya yang berakibat penundaan pelantikan bupati. Sementara keterlambatan pelantikan tersebut menuai kecaman dari berbagai kalangan masyarakat. Pasalnya, pergantian jabatan SKPD yang kosong maupun memasuki pensiun tidak dapat dilakukan, serta pembahasan APBD TA 2011 juga tidak dapat dilaksanakan. Ketua LSM DPD Generasi Muda Peduli Tanah Air (GEMPITA) Karo Robinson Purba didampingi Sekjennya NatanaelTarigan, Senin (21/3) mengatakan, persoalan yang terkendala akibat dari penundaan jadwal pelantikan bupati, seperti halnya jabatan Camat Lau Baleng yang kosong akibat meninggal dunia, tidak dapat diganti dan dampaknya urusan administrasi kependudukan masyarakat di kecamatan itu terhambat. (c10)

Diduga Stres, Pelayan Kafe Tewas Di Rumah Kos KABANJAHE (Waspada) :Warga Jalan Jamin Ginting Gang Advent, Kabanjahe dikejutkan dengan penemuan mayat dari dalam rumah kos yang kondisinya terlihat kaku, Senin (21/3). Temuan mayat yang diketahui berjenis kelamin wanita atas nama Santi br Ginting, 26, yang sehari- harinya bekerja sebagai pelayan sebuah kafe di Desa Sumbul Kecamatan Kabanjahe, Tanah Karo. Tetangga kos yang pertama melihat mayat tersebut melaporkan ke Polres Tanah Karo, setelah mendapatkan laporan dari warga Kasatreskrim AKP Harry Azhar, SIk berserta anggotanya ke tempat kejadian perkara untuk olah TKP Kapolres Tanah Karo AKBP Ig Agung Prasetyoko melalui Kasatreskrim AKP Harry Azhar membenarkan kejadian. “Sementara penyebab kematian korban masih dalam penyidikan dan beberapa teman korban masih dimintai keterangan,” ujar Harry.(c10)

Jalan Gundaling Satu Dan Dua Akan Dilebarkan BERASTAGI (Waspada) : Kawasan Jalan Gundaling Satu dan GundalingDuadirencanakanakandilebarkansesuaidenganperaturan Perda yang berlaku selebar 8,5 meter. Camat Berastagi Swingli Sitepu, Senin (21/3) pagi mengatakan, pengguna jalan baik roda dua dan empat tidak merasakan kesempitan jalan dengan pelebaran jalan itu. Ditambahkan saat sedang musim hujan maka akses ruas jalanitu,terkesanseperti kubangan kerbau. Dengan adanya pelebaran, maka jalan inti kota Berastagi yang menghubungkan hingga ke puncak Gundaling, serta ke pedesaan semangkin menarik wisatawan yang berlibur. (c19)


Waspada/Alpin Lubis

PROYEK pasca bencana berupa pembangunan dan rehabilitasi jalan dan jembatan di Desa Tabuyung, Kec. Muara Batang Gadis, Kab. Mandailing Natal sudah hampir rampung.

Pelantikan Bupati Karo Tersendat

Puluhan Pejabat Dan PNS Datangi DPRD KABANJAHE (Waspada) : Jadwal pelantikan Bupati/Wkl Bupati Karo terpilih hasil Pilkada Karo 21 Desember 2010 lalu, pasangan DR HC Kena Ukur Surbakti dan Terkelin S Berahmana SH, masih tersendat-sendat. Keadaan itu berdampak negatif terhadap pelaksanaan pemerintahan di Kabupaten Karo. Terkait dengan itu ,puluhan pejabat eselon dua,eselon tiga, eselon IV dan PNS sebagai perwakilan PegawaiNegeriSipil(PNS) di lingkungan Pemkab Karo, mendatangi DPRD Karo, Senin (21/3) pagi, menanyakan kendala pelantikan pasangan Bupati Karo terpilih. Kedatangan mereka disambut Ketua DPRD Karo Siti Aminah Peranginangin, didampingi Wakil Ketua Ferianta Purba SE, Onasis Sitepu, SE dan Ketua komisi B Frans Dante Ginting, Rendra Gaulle Ginting serta sejumlah anggota dewan lainnya di lantai tiga gedung DPRD Karo, Jalan Veteran Kabanjahe. Juru bicara PNS Pemkab Karo Drs Terus MuliTarigan yang juga Asisten I Pemerintahan mengaku kedatangan mereka ke gedung dewan bukanlah selaku pejabat,tetapisebagaiperwakilan PNS se Kabupaten Karo, untuk menyampaikan aspirasi PNS sebagai mitra DPRD, terkait lambatnya pelantikan Bupati dan dampak yang ditimbulkan. 10 Dampak Terus Muli Tarigan mengatakan,ada 10 dampak sebagai akibat belum dilantiknya Bupati Karo terpilih antara lain, menyebabkan proses pemerintahan tidak dapat berjalan dengan baik, sesuai dengan yang diharapkan, karena kebijakan tidak dapat dibuat Plh Bupati Karo. Dampak lainnya, proses

anggaran untuk pembiayaan pembangunan pemerintahan dan kesejahteraan terhalang karena Bupati Karo yang defenitif belum ada, karena sesuai yang diamanatkan kementerian dalan negeri harus menunggu Bupati defenitif termasuk yang berkaitan dengan semua dokumen-dokumen anggaran/pembiayaan. Selain itu, sesuai dengan Permenkeu Nomor 126/PMK.07/ 2010 tentang pelaksanaan dan pertanggung jawaban anggaran transferkedaerahdanPermenkeu Nomor 04/PMK.07/2011 tentang cara penyampaian informasi keuangandaerahmakapemerintah Kabupaten Karo akan dikenakan sangsi berupa penundaan penyaluran dana perimbangan sebesar 25 persen dari jumlah DAU. Imbasnya mengakibatkan pembayaran gaji PNS tidak mencukup,yang berakibat pelayanan kepada masyarakat menjadi terkendala. Akibat lainnya kata TM Tarigan, ratusan pegawai honorary Pemkab Karo, termasuk petugas dinas kebersihan sampai saat ini belum menerima honor sehingga tidak adapat melaksanakan tugas secara optimal. “Termasuk berbagai peraturan daerah yang menyangkut kepentingan masyarakat umum terhambat untuk disepakati oleh DPRD dan pihak eksekutif”,ujar TM Tarigan. Ironisnya, lanjut Drs Simon Sembiring yang juga Plt Asisten II, belum dilantiknya Bupati dan wakil Bupati Karo,juga berdampak pada pembahasan dan pengesahan APBD Karo 2011, menjadi terkendala. Akibatnya pembayaran segala fasilitas, sarana maupun prasarana pemerintah seperti listrik, telepon kantor, dana air bersih akan sgera dicabut oleh yang berwenang, sehingga berdampak kepada terganggunya proses pelayanan publik, khususnya di RSU Kabanjahedanpelayananpubliklainnya. Belum Terima SK Menanggapi hal itu Ketua

DPRD Karo Siti Aminah Peranginangin mengatakan, sebagai wakil rakyat,dewan sangat berharap roda pemerintahan di Karo dapat berjalan dengan baik. Dalam pada itu Siti Aminah menjelaskan,setelah bupati terpilih ditetapkan melalui rapat plenoKPU24Desember2010lalu, ada pihak calon peserta pemilukada yang mengajukan gugatannya ke Mahkamah Konstitusi (MK), sehingga proses lanjutan penetapan tersebut harus menunggu keputusan MK. Seharusnya kata Siti, SK Bupati Karo terpilih sudah semestinya sampai kepada DPRD Karo. “Namunhinggasaatini,jangankan aslinya, fotocopynya sajapun belum sampai kepada kami di DPRD Karo ini,” ujarnya. Dikatakan,s esuai dengan aturan yang berlaku, pelantikan pasangan bupati/wakil bupati terpilih harus melalui Tata tertib DPRD. Dalam hal ini, kata Siti, DPRD tidakpernahmenghalanghalangi pelantikan Bupati Karo itu. “Masalahnya sekarang proses pelantikan ini bukan karena dewan, tetapi lama ditangan Depdagri dan ditangan Gubernur. Kami tidak ingin permasalahan ini dijadikan alat untuk pembodohan masyarakat,” tegas Siti. Kata Siti,pada hari itu pihaknyaakanmelakukanrapatpimpinandewanyanghasilnyadiserahkan ke rapat Badan Musyawarah (Banmus)dewan.Setelahitukatanya, pimpinan dewan bersama pinpinan fraksi akan menghadiri rapatpersiapanpelantikanBupati Karo terpilih di kantor Gubernur Sumut di Medan,Senin (21/3) pukul 16:00. Sementara anggota DPRD Karo lainnya Frans Dante Ginting mengatakan, menyangkut pertanyaan kenapa Bupati Karo belum dilantik , bukan ke DPRD Karo tempatnya bertanya, tetapi selayaknya hal itu ditanyakan ke GubernurSumateraUtarakarena yang melantik adalah Gubernur bukan dewan,” tandas Dante. (c09)

lagi penimbunan pinggir jalan yang masih rawarawa. Jalan yang lebarnya mencapai 6 - 8 meter ini berasal dari APBN untuk perbaikan pasca bancana di Kecamatan Muara Batang Gadis setelah banjir bandang menimpa wilayah ini setahun lalu. Dengan selesainya nanti proyek infrastruktur jalandanjembataninitentunyasangatmembantu transportasi dan perekonomian warga Aek Godang, Panunggulan, Manuncang, Suka Makmur, Tagilang dan Sale Baru. Padahal sebelumnya, keenam desa ini termasuk desadesa terisolir dan tertinggal di wilayah Pantai Barat. Kadis PU Madina melalui Kabid Bina Marga Anwar Daulay yang ditemui, Senin (21/3) mengatakan, pengerjaan proyek ini sesuai dengan rencana, dalam waktu dekat akan selesai. Darlin Lubis, Kepala Lorong Desa Tabuyung yang dijumpai mengaku senang dengan dibangunnya jalan ini. Hal yang sama juga dikatakan tokoh masyarakat Tabuyung H Ishak Hasibuan. Ishak yang setiap hari mempergunakan jalur ini sangat bersyukurdanberterimakasihkepadapemerintah yang membangun jalan ini. (c15)

HIPMI Madina Desak Lokalisasi Galundung Emas PANYABUNGAN (Waspada) : Ketua Umum HimpunanPengusahaMudaIndonesiaKabupaten Mnadailing Natal Saparuddin Haji alias Akong, mendesak pemerintah secepatnya menertibkan dan melokalisasi pengoperasian galundung emas di Panyabungan. Hal itu dikatakan, Minggu (20/3) di kediamannya. Menurutnya, Muspida Plus Madina harus bertindak cepat karena jumlah galundung yang akandanberoperasimakinbertambahjumlahnya. Ironisnya lagi, mesin galundung tidak saja dibangundiatasaliranSungaiAekPohondikawasan jalan lintas timur. Tapi juga membuang limbah air raksa ke sungai dan persawahan penduduk. Kondisi itu dikhawatirkan menjadi ancaman penyakit serius bagi masyarakat Panyabungan. Karena masyarakat setiap waktu memanfaatkan air sungai untuk mandi, cuci, dan kakus (MCK). Diperparah lagi dengan meresapnya air sungai

ke sumur-sumur air minum penduduk. “ Secara pribadi kita tidak menolak usaha galundung maupun tambang emas rakyat, karena membuka peluang kerja bagi masyarakat luas. Hanya saja, dampak lingkungan mengakibatkan penyakit harus diantisipasi sedini mungkin,” ucap Aji. Dijelaskan, air raksa (kuiq) merupakan zat kimia mengendap dalam air dan tidak hancur karena air. Zat tersebut berbahaya dan berpotensi menimbulkan penyakit gatal-gatal, merusak gen manusia, kemandulan, keguguran, dan penyakit berbahaya lainnya. Untuk itu, Muspida Plus tidak cukup hanya melakukan sosialisasi dan peringatan, tapi harus melakukan tindakan nyata. Karena masyarakat saat ini sudah terobsesi dengan hasil tambang emas dan lupa akan bahaya yang ditimbulkannya. (c14)

DPRD Madina Didesak Bentuk Pansus PT Sorik Mas Mining PANYABUNGAN (Waspada) : Warga KecamatanUluPungkutDIMandailingNatalmendesak DPRD Madina agar secepatnya membentuk Pansus terkait aktivitas dan keberadaan PT Sorik MasMining(PTSMM)diwilayahMandailingNatal. “Kita mendesak DPRD Madina untuk segera membentuk Pansus PT SMM,” kata tokoh masyarakat Ulu Pungkut Syafruddin Lubis, Senin (21/ 3) di Panyabungan. Syafrudin melanjutkan, DPRD Madina seharusnya jangan mengulur-ulur pembentukan Pansusini,sebabhaliniuntukkejelasankeberadaan danaktivitasPTSMMdiwilayahini.DPRDMadina harus berpihak kepentingan rakyat, bukan kepentinganperusahaan.Sebabinformasiyangditerima, berlarut-larutnya pembentukan Pansus ini disebabkan tarik- menarik kepentingan antara anggota DPRD Madina sendiri. “Kalau memang ini terjadi, kita sangat menyesalkan kinerja DPRD Madina,”

ujarnya. Selama ini, aktivitas yang dilakukan PT SMM dimasyarakatsudahmenimbulkanpolemik,selain tidak ada sosialisasi kepada masyarakat terkait dengan keberadaan dan aktivitas mereka, juga tidak tahu sejauh apa kegiatan yang mereka lakukan. “Kami warga Ulu Pungkut dengan tegas menolak kehadiran PT SMM ini, sebab kehadiran perusahaan ini tidak akan membawa kebaikan kepada masyarakat, tapi sebaliknya akan merusak lingkungan hidup yang ada,” pungkasnya. Ketua DPRD Madina Imran Khaitamy saat dimintai komentarnya tentang desakan warga Ulu Pungkut ini agar DPRD Madina segera membentuk Pansus mengatakan, DPRD juga inginmembentuk Pansus ini, tapi kendalanya masih menunggu mekanisme yang tepat. (c15)

Pencairan Dana BOS Terlambat, Kepsek Jadi Korban SIMALUNGUN (Waspada) : Kepala Dinas Pendidikan dan Pengajaran Simalungun Albert Sinaga dituding mengkambinghitamkan para kepala sekolah di daerahnya, terkait keterlambatan pencairan dana BOS (Bantuan Operasional Sekolah). Menurut Sinaga, keterlambatan pencairan dana BOS, karena masih banyak kepala sekolah yang belum selesai menyusun RKA, sehingga pencairan dananya terpaksa ditunda. “Uangnya sudah ada, jadi sampai sekarang belumdapatdicairkankarenamasihbanyakkepala sekolah yang belum selesai menyusun RKA, sehingga dana BOS triwulan pertama sebesar Rp16,5 miliar kita tunda dulu pencairannya,” kata Sinaga. Dikatakan, tidak ada unsur kesengajaan terkait belum dicairkannya dana BOS triwulan pertama tahun 2011, kepada 1.109 sekolah SD dan SMP, dan pihaknya berupaya dalam waktu dekat ini dapat segera dicairkan. Sementara itu, Irwansyah salah seorang

anggota Dewan Pendidikan Simalungun sangat menyesalkan keterlambatan pencairan dana BOS ke sekolahh SD dan SMP yang ada di daerah ini. Dia juga menyayangkan pihak Dikjar dalam hal ini Kepala Dinas Dikjar Simalungun yang dengan entengnya menyalahkan atau‘mengkambinghitamkan’ para kepala sekolah. Menurutnya, dana BOS triwulan pertama seharusnyasudahharusdicairkansejakawalMaret lalu. Dikatakan, keterlambatan pencairan dana BOSakanberdampakpadaterganggunyakegiatan belajar mengajar (KBM) di sekolah, karena dana bantuan pemerintah pusat itu sangat dibutuhkan untuk membeli alat tulis kantor (ATK), serta menggaji guru-guru honor. Irwansyah juga menyatakan, keterlambatan pencairan dana BOS bukan hanya dapat mengganggu kegiatan belajar mengajar, namun juga dapat dikenakan sanksi pemotongan oleh KementerianPendidikanNasional,jikadanatersebut belum juga dicairkan paling lambat 15 Maret 2011. (a29)

Anggota DPRD Tapsel Bantah Aniaya Saprin Batubara P.SIDIMPUAN (Waspada): Anggota DPRD Tapanuli Selatan dari Partai Demokrasi Pembaruan (PDP), Robinton Simanjuntak, membantah melakukan penganiayaan terhadap Saprin Batubara, sebagaimana pengaduan ke Polres Tapsel. “Ini fitnah, dia (Saprin-red) telah memutar balik fakta yang sebenarnya. Saya tidak terima ini dan akan membuat pengaduanbalikkePolsekBatangToru,” kata Robinton, Senin (20/3), menyikapi pemberitaan media tentang penganiayaan yang dilakukannya terhadap Saprin. Anggota DPRD itu menceritakan, kejadian berawal dari adanya pekerjaan bangunan gedung 3,5 lantai untuk sarang burung walet miliknya di Kelurahan Muara Ampolu, Kecamatan Muara Batang Toru, Kab. Tapsel. Untuk membuat bangungan ini dia mempercayakannya kepada seorang warga Cristian BengawanaliasATien,penduduk Sibolga. Namun tanpa sepengetahuan Robinton, ternyata A Tien men-sub-kan pekerjaan itu kepada Erwin Junaidi Panggabean. Pekerjaan dimulai sejak

Januari kemarin, dan setelah dua bulan sudah sampai tahap pekerjaan cor lantai satu. Pada Rabu (16/3) pagi kemarin, Robinton datang ke lokasi bangunan untuk sekedar memantau pekerjaan. Di lokasi bangunan milik pribadinya itu, Robinton melihat pekerja sedang sibuk dengan aktifitas masing-masing dan diawasi A Tien. Siangnya dia pulang ke rumah yang berjarak sekira 800 meter dari lokasi. Kemudiandatanglagipadasoreharinya. Sejam kemudian, Erwin Junaidi Panggabean dan seorang temannya yang tidak dikenali Robinton, tapi belakangan diketahui bernama Saprin Batubara, datang ke lokasi. Begitunaikkelantaisatutempat pekerja mencor, tiba-tiba Saprin marah-marah dan menendang besi yang sudah dijalin untuk dicorkan. Dia bilang jarak jalinannya terlalu rapat, bahkan di depan Robinton sebagai pemilik bangunan, dia menendangnendang besi tersebut. “Saya diam saja, meskipun bangunan itu milik saya dan besinya dia tendang di depan mata saya. Padahal saya sama

sekali tidak mengenal dia, dan malah berani berbuat tak baik di depan saya sebagai pemilik,” ujar Robinton. Kemudian, Saprin turun dari lantaisatudanmendatangipekerja yang sedang mencampur pasir dengan semen. Dia marah-marah dan mengatakan, campurannya terlalu banyak, 2 sekop pasir kerikil dan 2 sekop semen. Sambil mengatur pekerja dengan suara marah dan menggunakan kakinya, Saprin perintahkan agar pasir kerikilnya 3 sekop dan semennya 2 sekop. Padahal menurut Robinton, perjanjian dengan A Tien adalah 2 sekop pasir kerikil dan 2 sekop semen untuk cor lantai. Merasa tersinggung dengan perlakuanSaprinyangsamasekali tidak dikenalinya itu. Robinton memanggil A Tien dan bertanya siapa orang yang ribut dan patentengan mengatur pekerja dengan menggunakan kaki. “A Tien mengaku tidak kenal orang itu dan bahkan tidak ada urusan atau keterkaitannya dengan pembangunan itu. Saya Tanya apa itu mandornya, Atien bilang mandornya adalah Darwis

Lubis,” tuturnya. Robiton turun mendekati pekerja yang mengoperasikan mesin pencampur semen dan pasir kerikil (molen). Ditanya kenapa campurannya 3:2, sedangkan perjanjian 2:2, pekerja itu mengakudisuruhSaprin,danbahkan mereka pernah diperintahkan mencampur semen dengan tanah. Lalu Robinton mendatangi Saprin yang sibuk marah-marah dan mengatur pekerja dengan menggunakan kaki. “Saya tanya dia itu siapa dan apa urusannya dalam pekerjaan bangunan saya ini. Malah dia memberikan jawabanyangjustrumembingungkan saya. Dia jawab, dia anggota si Pantas,” ujarnya. Robinton semakin bingung lagi, siapa pria itu dan siapa si Pantas. Bahkan pada saat itu, sedikitpun Saprin tidak ada memberikan perilaku hormat terhadapRobintonselakupemilik bangunan. “Sambil mendorongkan punggung telapak tangan saya ke dadanya, saya suruh dia pergi dan keluar dari lokasi bangunan milik saya itu. Saya takut emosi,

danmintadiapergisajadarisana,” ucap Robinton. Tidak berapa jauh setelah Saprinpergi,tiba-tibaErwinturun dari lantai satu bangunan yang sedang dikerjakan itu sambil bertanya,“AdaapaBang?”kepada Robintom. Sambil memegang tiang tangga dan membuatnya tergoyang, Robinton bertanya kenapa Erwin membawa orang seperti itukelokasibangunan.LaluErwin menjawab ini semua hanya salah faham dan dia minta agar dimaafkan. Lalu Robinton bilang tidak ada yang perlu dimaafkan. Kemudian Robinton pulang kerumahnya. Dalam hatinya ada harapan kalau Erwin dan Saprin akan mendatanginya untuk sekedar minta maaf atau meluruskan permasalahan kecil tersebut. Namun justru sekira pukul 20:00, orang dari Polsek Batang Toru yang meneleponnya. Katanya,Saprintelahmelaporkan Robinton ke Polres dengan kasus penganiayaan yang mengakibatkan bibirnya pecah dan luka di tubuh. Saksi kejadian pada laporan itu adalah Erwin Junaidi. “Saya justru bingung kenapa

bisabibirnyapecahdanbadannya luka. Padahal cuma saya dorong pakai punggung telapak tangan ke dadanya dan dia tidak jatuh. Tapi kenapa bisa bibirnya yang pecah,” ucap Robinton mengisahkan keheranannya itu. Selanjutnya dia ke lokasi bangunan, dan sekira pukul 23:00 diamenanyakankepada13orang pekerja, apakah ada melihat dia memukul Saprin. Pengakuan itu direkamnya dan dibuat secara tertulis. Hasilnya, 11 orang mengaku tidak melihat apa-apa, dan 2 orang melihat hanya di dorong saja. Akibat kejadian yang diduga direkayasa dan laporan ke Polres itu, Robinton mengaku merasa dizolimi dan nama baiknya dicemari. Karena itu, Senin (20/3) sore, dia akan membuat laporan balik ke Polsek Batang Toru. “Saya siap menghadapi laporan mereka dan akan ceritakan kejadian sebenarnya. Saya punya saksi dan saya merasa dizolimi. Itu bangunan saya, dia yang tidak saya kenal datang marah-marah dan main tendang. Saya hanya mendorongnya,kenapabisa bibir pecah, ini sudah ada rekayasa,” katanya. (a27)


WASPADA, Selasa 22 Maret 2011

Bersambung ke hal. B5

Sambungan dari hal. B4

WASPADA Selasa 22 Maret 2011

Sumatera Utara


Waspada/Rasudin Sihotang

BEBERAPA tahun terakhir, banjir akibat pasang kian parah melanda Kota Tanjungbalai yang diakibatkan penebangan hutan dan pengelolaan lingkungan yang kurang baik. Terlihat air pasang mencapai badan jalan di Jalan Besar Teluknibung beberapa waktu lalu.

Banjir Musiman Di T. Balai Tak Ditangani Serius TANJUNGBALAI (Waspada): Walikota Tanjungbalai Drs H Thamrin Munthe, M.Hum diharapkan keseriusannya dalam menangani banjir musiman akibat pasang yang selama ini melanda kota itu. “Kondisibanjirmusimanyang selama ini terjadi diharapkan dapat menjadi prioritasWalikota untuk diantisipasi karena pengaruhnyasangatmerugikanmasyarakat baik materi maupun aktivitas kegiatan sehari-hari,” ucap anggota DPRD KotaTanjungbalai

Fraksi PDI Perjuangan Hakim Tjoa Kian Lie kepada Waspada, Senin (21/3). Selain kerugian itu kata Hakim, banjir juga akan menimbulkan berjangkitnya wabah penyakit, seperti diare, penyakit kulit (gatal-gatal), demam berdarah, disamping gangguan psikis yang dialami warga akibat luapan air yang kotor dan tercemar limbah rumah tangga dan industri. Dijelaskan Hakim, daerah yang kerap mengalami banjir meliputi Jalan AR Hakim,Taqwa,

AhmadYani,Veteran, kemudian Kampungbaru, Persatuan, Sejahtera, Pasarbaru, Matahalasan, dan daerah pinggiran sungai lainnya.DijelaskanHakim,kondisi itu disebabkan semakin dangkalnya aliran sungai akibat penebangan di hulu ditambah saluran drainase yang tidak memadai. Bukan itu saja tambah Hakim, hal itu diperparah lagi dengan banyaknya sampah baik organik maupun non organik seperti plastik limbah rumah tangga yang dibuang secara

sembarangan sehingga menjadi penyebabtersumbatnyadrainase dan terhambatnya aliran air menuju pembuangan besar. “Jika tidak dibenahi secara bijaksana dalam menata dan mengelola lingkungan hidup, maka hal itu jelas menjadi ancaman bagi kelangsungan makhluk hidup di masa mendatang,” ujarnya. Untuk itu kata Hakim, perlu pembenahan secara menyeluruh dari pemerintah demi pencegahan kerugian yang lebih besar. (a32)

Proyek PNPM Mampu Atasi Banjir RANTAUPRAPAT (Waspada): Proyek pembangunan rabat beton, plat dwicer, drainase dan pencucian parit Jalan Lintas Sumatera (Jalinsum) yang dananya bersumber dari Program Nasional Pemberdayaan Masyarakat Mandiri Perkotaan (PNPM-MP) dilingkungan Pemancar, Kelurahan Siringo-ringo, Kecamatan Rantau Utara, Labuhanbatu ter-

Soal Rekrutmen Satpol PP, Ketua DPRD Simalungun Nyaris Baku Hantam SIMALUNGUN (Waspada): Rapat dengar pendapat antara Komisi I DPRD Simalungun dan anggota Satpol PP (Satuan Polisi PamongPraja)berlangsungricuh. Bahkan, antara ketua DPRD Simalungun, Binton Tindaon, nyaris‘bakuhantam’denganMey Friadin Purba perwakilan Satpol PP, karena selalu dibatasi dalam berbicara. “ Sebagai ketua dan wakil rakyat tidak boleh arogan dan berbicara asal-asalan. Saya juga punyahakuntukberbicaradalam rapat ini,” ujar Mey Friadin, di ruangrapatgedungDPRDSimalungun, Senin (21/3). Mey tidak terimaatasucapan-ucapanKetua DPRD Simalungun, Binton Tindaon, yang dianggap tidak membela hak dan kebutuhan sekitar 80personilSatpolPPyangdipecat tanpa alasan oleh Kakan Satpol

PP Pemkab Simalungun, Janter Purba. Mey Friadin langsung berdiri dari kursinya, dan menyatakan bahwa dirinya tidak takut ‘main’ (berantam) demi memperjuangkan para anggota Satpol PP agar diterimakembalibekerjasebagaimanabiasanya.“Kasihanmereka (Satpol PP), sudah dibiayai dari rumah oleh orang tuanya untuk bekerja, tetapi tiba-tiba dipecat tanpa alsan yang jelas,” teriak Mey yang mengundang perhatian banyak orang yang berada di gedung dewan terhormat itu. Mendapat tantangan demikian, Ketua DPRD Simalungun, Binton Tindaon, sambil berdiri dari kursinya membalas dengan kata-kata, dirinya juga tidak takut dengan siapapun. “ Jangan Anda jadi pahlawan dalam masalah Satpol PP, kami juga sudah ber-

juang agar mereka (Satpol PP) dapat bekerja kembali,” tegas Tindaon. Mendapat bentakan seperti itu, Mey Friadin, semakin berani dan berupaya akan mendorong ketua dewan yang sudah berdiri, namun para anggota Satpol PP dengan sigap menahan dan melerai, sehingga baku hantam tidak sempat terjadi. Yang membanggakan, meskipun sudah sempat saling adu urat leher, keduanya dapat kembali duduk bersama, setelah Sekretaris Dewan (Sekwan) SML Simangunsong dan anggota Komisi I, Abu Sofyan Siregar, berupaya menenangkan situasi tersebut, sehingga agenda rapat dapat dilanjutkan kembali. Rekomendasi Sementara, hasil musyawarah antara Komisi I DPRD

Simalungundenganparaanggota Satpol PP melalui perwakilannya, Mey Friadin Purba, disepakati Ketua DPRDSimalungun,Binton Tindaon, akan merekomendasikan para anggota Satpol PP yang dipecat sejak 18 Januari 2011 lalu agar kembali dipekerjakan sebagaimana mestinya. “ Sejak rapat pertama, kedua dan hingga saat ini, DPRD Simalungun tetap berupaya agar para adik-adik personil Satpol PP dapat bekerja seperti semula,” tegas Binton. Terkait dengan adanya rencana pengalihan rekrutmen anggota Satpol PP menjadi personil drum band, Binton mengatakan tidak tahu menahu tentang itu. Yang dia tahu adalah rekrutmen Satpol PP sesuai dengan pembicaraan dengan Kakan Satpol PP, Janter Purba. (a29)

Mobil Sekretariat DPRD Sergai Kontra Sepeda Motor, 1 Tewas SEI RAMPAH(Waspada): Mobil sekretariat DPRD Serdang Bedagai kontra sepeda motor di Jalan Lintas Sumatera (Jalinsum) Medan Tebingtinggi, kilometer 52-53, tepatnya di Desa Liberia, Kec.Teluk Mengkudu, Kab.Serdang Bedagai, Minggu (20/3) sekira pukul 23:45. Pengendara sepeda motor tewas dan seorang mengalami luka berat.

Keterangan yang Waspada peroleh di kepolisian, sebelum peristiwa itu terjadi mobil Sekretariat DPRD Serdang Bedagai BK 7006 N yang dikemudikan Melky Sipayung,22,warga Desa Pagar Manik, Kec.Silinda,Kab.Serdang Bedagai datang dari arahTebingtinggi menuju Medan. Di TKP datang sepeda motor Beat BL 5963 UJ yang dikemudikan Riduwansyah,24,warga

Jalan Rantau Bukit Tempurung No.25 Kab.Aceh Tamiang berboncengan dengan Irfan,22, warga Dusun Mawar,Desa Bukit Rata,Kec.Kejuruan Muda, Kab. Aceh Tamiang dari arah yang berlawanandalamkeadaanoleng dan menerkam depan mobil sekretariat DPRD Sergai yang membuat kaca mobil pecah dan bagian depan peot. Akibat itu Riduwansyahlukaberatdantewas

di tempat kejadian perkara(TKP). SedangkantemannyaIrfanhanya menagalami luka berat. Anggota Satlantas Polres Serdang Bedagai yang mendapat laporan segera meluncur ke TKP dan meng evakuasikeduakorban ke RSU Sultan Sulaiman guna keperluan visum. Sedangkan mobil sekretariat DPRD Serdang Bedagai dan sepeda motor diamanakan petugas. (a08)

KA Tubruk Sepeda Motor, Dua Pelajar Sekarat KISARAN(Waspada):Sebuah sepeda motor hancur tertubruk KA di lintasan rel Jalan Merpati, Kelurahan Gambirbaru, Kisaran. Minggu (20/3) malam. Akibatnya, pengendara sepeda motor dan rekannya sekarat sehingga secepatnya dievakuasi ke RSUD Kisaran. Informasi dihimpun Waspada, korban Joko Swondo,16,

warga LingkunganV, Kelurahan Gambirbaru,Kisaran,mengalami luka di kepala dan tangan kiri patah, sedangkan rekannya Bintang Saputra,16, warga yang sama luka di kepala, dan kaki kanan patah. Kejadian itu diduga saat mereka melintasi rel dengan sepeda motorBK2570DBtidakmemperhatikan keadaan jalan, sementara tidak ada palang pengaman,

akibatnya kereta api penumpang jurusan Medan-Tanjungbalai menghantam bagian belakang sepeda motor mereka, sehingga kedua remaja yang masih duduk di bangku SMA itu berpental empat. Kecelakaan itu mengundang perhatian warga karena KA sempat berhenti sejenak dan langsungmelanjutkanperjalanan. Kapolres Asahan AKBP J

Didiek Dwi Priantono, melalui Kasat Lantas AKP Eko Hartanto, didampingi Kanit Laka Ipda MP Pardede, dikonfirmasi Waspada, membenarkan. dan hingga saat ini masih dalam proses penyelidikan. Dia mengimbau masyarakat untuk selalu waspada dan memperhatikan rambu-rambu lalu lintas saat berkendara, apa melintas di rel KA. (a15)

nyata mampu mengatasi banjir yang selama ini selalu dialami masyarakat sekitar. “Proyek pembangunan infratrukturinisangatbermanfaat bagi masyarakat. Selama ini kalau musim hujan, air pasti masuk ke dalam rumah, terkadang tingginya mencapai lutut. Air yang bercampur lumpur dan sampah menjadi pemandangan yang

lajim, terlebih belakangan tahun ini karena parit kecil dan mulai tertumpat,”terangIrSabarMPurba warga Lingkungan Pemancar disela-sela mengawasi proyek PNPM-MPdidaerahnya,Minggu (20/3) kepada wartrawan. Koordinator Lembaga Keswadayaan Masyarakat (LKM) Kelurahan Siringo-ringo M SitorusdidampingiUnitPengelola

Lingkungan (UPL)/Pengawas TimbulRitongadanHermansyah Putra Hasibuan menerangkan, untuk daerahnya telah 6 lingkungan yang dilakukan pembangunan seperti pembuatan parit dan rabat beton. “Mayoritas permintaan dari masyarakatuntukpembangunan paritdanrabatbeton,”ujarSitorus. (a18)


Sumatera Utara

WASPADA Selasa 22 Maret 2011

Pancur Batu Tuan Rumah MTQ-FSN DS LUBUK PAKAM (Waspada): Bupati Deliserdang Drs H Amri Tambunan melalui Sekdakab Drs H Azwar S.MSi menyampaikan keputusan Pemkab yang menetapkan pelaksanaan Musabaqah Tilawatil Quran (MTQ) XLIV dan Festival Seni Nasyid (FSN) XXXIII Kabupaten Deliserdang 2011 dimulai 28 s/d 31 Maret 2011 di Lapangan Porta Desa Tanjung Anom Kec.Pancur Batu. Hal itu disampaikan Sekdakab Deliserdang Drs H Azwar S,MSi didampingi Kepala Dinas Infokom Deliserdang Drs Neken Ketaren padapertemuandengan

Panitia Pelaksana,Dewan Hakim dan Juri MTQ XLIV dan FSN XXXIII Kab.Deliserdang sekaligus menyerahkan SK kepada panitia, dewan hakim dan juri, di Aula Cendana kantor bupati Deliserdang di Lubuk Pakam, baru-baru ini. Sekdakab H Azwar menekakan agar seluruh panitia, dewan hakim dan dewan juri yang bertugas agar bekerja secara professionalkegiatansakraliniterlaksana dengan aman, tertib, lancar dan sukses. Khususkepadadewanhakim maupun dewan juri diminta untuk benar-benar memberikan nilai positif sebab para pemenang dari kedua kegiatan ini (MTQFSN) akan menjadi “duta” Deliserdang ke tingkat Sumut membawa nama baik Kab. Deliserdang. Panitia,Hakim dan Juri dari

kedua kegiatan ini bertanggungjawab penuh kepada bupati Deliserdang Drs H Amri Tambunan. Karenanya semua hal-hal yang berkaitan dengan pelaksanaan MTQ dan FSN Deliserdang,mulai dari dikeluarkan SK hingga berakhirnya kegiatan,agar terus dikoordinasikan dan di informasikan kepada Pemkab Deliserdang,sehingga perhelatan besar umat Islam ini berlangsung sukses. Camat Pancur Batu Suryadi, S.Sos melaporkan segenap elemen masyarakat di wilayah kecamatanitucukupantusiasatas ditetapkannya daerah mereka sebagai“tuan rumah” MTQ-FSN tingkat Deliserdang. Saat ini warga secara kekeluargaandankebersamaanmelakukan gotong royong menata kecamatan dan bermusyawarah untuk menjadi tuan rumah yang baik,jelas Camat (a06)

Terkait Penyiksaan Nelayan, KTNI Surati Kedubes P.BRANDAN (Waspada):Terkait penyiksaan terhadap empat orang nelayan tradisonal asal Desa Kelantan, Kec.Brandan Barat, Langkat, Presedium Kesatuan Nelayan Tradisonal Indonesia (KNTI) Region Sumatera melayangkan surat ke Kedubes RI di Kuala Lumpur. Selain itu, KNTI juga melaporkanperistiwainikepadaKetua KomisiIDPRRI,MenteriKelautan danPerikanan,KementerianLuar Negeri, dan Direktorat Perlindungan WNI dan Bantuan Hukum Indonesia dengan harapan kasus kesewenang-wenangan oknum aparat dari negeri jiran ini mendapat perhatian. Presedium KNTI, Tajrudin HasibuankepadaWaspada,Senin (21/3) menyatakan, insiden ini menimbulkan kerugian material dan psikologis bagi nelayan tradisonal Indonesia. Ia menuding, peristiwa yang terjadi 50 mil

dari lepas pantai Babalan Kab. Langkat ini merupakan aksi perompakan oleh police marine Malaysia. KNTI mendesak Menterian Luar Negeri, Ketua Komisi I DPR RI, Kedibes RI di Malysia, mengirimkan nota keberatan sekaligus mendesak pemerintah Malaysia agar segera meminta maaf serta memberikan ganti rugi terhadap para nelayan yang menjadi korban penganiayaan. Secara terpisah, Kabag Kelautan dan Perikanan Kab. Langkat, Ali Mukti, saat dimintai tanggapannya, Senin (21/3) terkait kasus penganiayaan dan perampasan terhadap keempat orang nelayan asal Desa Kelantan menyatakan, pihaknya belum ada menerima laporan. Ditanya, apakah ada upaya Dinas Perikanan untuk membantu para korban agar mereka dapat melanjutkan pekerjaannya

setelahmerekakehilangansarana melaut seperti, komputer dan satelit, ia mengatakan, masalah ini akan dikoodinasikan. Presedium KNTI sangat menyesalkan lambannya respon Dinas Perikanan dan Kelautan Kab. Langkat. “Ironis kalau merekamengatakanbelummenerima informasi, sementara permasalahan yang menimpa keempat nelayan ini sudah menjadi komsumsi pemberitaan media massa nasional,” ujarnya. Seperti diberitakan sebelumnya, Thamrin, 29, nelayan yang menjadi korban mengaku, ia dan tiga temannya ditangkap dan dianiaya sejumlah oknum aparat yang mereka yakini dari Malaysia atas tuduhan melanggar batas negara. Aparat tersebut merampas hasil tangkapan termasuk perangkat komputer dan satelit. (a02)

Gerakan Menanam Tumbuhkan Kesadaran Pentingnya Oksigen SEIRAMPAH (Waspada): Oksigen dihasilkan tumbuhan hijau penghasil klorofil pada proses fotosintesis, terjadi perubahan zat anorganik HO2 dan CO2 oleh klorofil menjadi zat Organik (karbohidrat) dan oksigen dengan bantuan cahaya. Dalam hal itu jelas tumbuhan hijau adalah produsen Oksigen, suatu unsur kimia yang mutlak harus ada untuk kelangsungan hidup kita. oleh karenanya, kita harus mempertahankan tumbuhan atau pohon yang ada, bahkanmemperbesarjumlahnya mengingatpopulasimanusiajuga terus bertambah.

Demikian Kepala Dinas Kehutanan dan Perkebunan Kab. Serdang Bedagai Ir HM Taufik Batubara, Senin (21/3) kepada Waspada di Sei Rampah. “ Untuk mengatasi, minimal mengurangi dampak dari perubahan iklim (climate change) dan pemanasan global (global warming) yang cukup dirasakan oleh seluruh penduduk dunia, Pemerintah telah berupaya melaksanakan beberapa gerakan penanaman diantaranya, gerakan Nasional Rehabilitasi Hutan dan Lahan (GNRHL/Gerhan), yang dimulai pada tahun 2005,” sebut Taufik Batubara.

Selanjutnya, imbuh Taufik, gerakan Perempuan Tanam dan PeliharayangdilaksanakanTahun 2007,PenanamansatuOrangsatu pohon (OneManOneTree), 2009 dan gerakan penanaman satu milyardpohon (OBIT-OneBillion Indonesia Trees yang dimulai Februari 2010. Menanam pohon diharapkan menjadi budaya sekaligus menyadarkan masyarakat akan pentingnya penyediaan Oksigen oleh tumbuhan, perlu dilaksanakan gerakan menanam pohon dilaksanakandisertaiajakanuntuk memelihara pohon yang telah ditanam tersebut, harapnya. (c03)

Peletakan Batu Pertama Dan Gotroy Renovasi Mushala Subullul Huda Jadi Masjid LABUHANDELI (Waspada): Camat Labuhandeli, Kabupaten Deliserdang, Dedy Maswardi beserta warga Desa Pematangjoharmelaksanakangotongroyong sekaligus meletakkan batu pertama renovasi mushala Subulul Huda yang direncanakan menjadi masjid, Minggu (20/3). Hadir dalam kegiatan itu Ka. KUA Drs. Fahrim Siregar, Kades PematangjoharSupriyono,Ketua BPD Sudarman, SPd, Ketua LKMD Sajar, Ketua BKM Subullul Huda Surahman, Kadus XI Miskun, Kadus XII Bejo, Ketua Pembangunan Mushalla Subullul Huda Buchari Muslim, Kades Manunggal Misgiat, Kades Helvetia Zakaria, para Kades dan para Kadus lainnya. Laporan pelaksana renovasi, mushallatersebutdibangunpada tahun 70 an dan sudah pernah direnovasi, dan kali ini renovasinya diperhitungkan menelan biaya Rp400 juta dan dimungkinkan bakal menjadi masjid. Disebutkan, munculnya ide renovasi dari BKM serta tokoh warga secara spontan terkait kondisi kubah mushalla yang mulai bergoyang-goyang apabila tertiup angin. ‘’Ide itu mendapat dukungan segenap warga, terbukti dana awal terkumpul oleh swadaya masyarakat hampir Rp30 juta. Direncanakan setiap warga Muslim di Dusun XI dan XII menyumbang setiap minggu,’’ tambah Buchari Muslim. Hal itu diperkuat oleh Ka. KUA yang dalam sambutannya mengemukakan,ditingkatkannya status mushalla tersebut menjadi masjidsangatdimungkinkan.Hal inimengingatjumlahwarga Desa Pematangjohar, khususnya

Dusun XI dan XII. Camat Labuhandeli Dedy Maswardi dalam sambutan sekaligusarahanmengemukakan, renovasi mushala bakal menjadi masjid ini yang dikerjakan secara gotong royong oleh masyarakat serta dana swadaya warga, patut mendapat dukungan. Namun, katanya, yang tidak kalah penting adalah persatuan dan kesatuan disertai semangat kebersamaan guna mewujudkan keinginan masyarakat berdirinya masjid yang awalnya mushala. Dikemukakan, kegiatan gotongroyongmerenovasimushala Subullul Huda ini masih serangkaian Bulan Bhakti Gotong Royong yang sejalan dengan program Bupati Deliserdang Drs H Amri Tambunan, yakni Gerakan Deliserdang Membangun (GDSM). ‘’Dalam GDSM ada tiga pilar kekuatan yang terlibat, yakni pemerintah, masyarakat serta

pengusaha. Dengan demikian, dimungkinkan pula para pengusaha di kawasan Desa Pematangjohar ikutmemberikansumbangsihnya dalam renovasi tersebut,’’ kata Dedy. Seusai arahannya, camat beserta unsur panitia renovasi, Ka. KUA, para Kades dan lainnya meletakkan batu pertama sekaligus pengecoran awal tiang pondasi bangunan. Selanjutnya, camat juga menyerahkan piagam penghargaanyangditerimadariBadan Ketahanan Pangan Provsu, kepada Kades Pematangjohar Supriyono. Pada kesempatan itu pula Dedy menyampaikan, saat ini aparat Kecamatan Labuhandeli sedangmelaksanakanpendataan warga yang kediamannya tidak layak huni. Ini terkait dengan program bupati untuk merehabilitasi 10 ribu unit rumah warga Deliserdang yang memang benar-benar tidak layak huni.(m34)

Waspada/Feirizal Purba

CAMAT Labuhandeli, Kabupaten Deliserdang Dedy Maswardi didampingi unsur kecamatan, Desa Pematangjohar, Ka. KUA serta panitia renovasi mushalla Subulull Huda yang direncanakan menjadi masjid, meletakan batu sekaligus pengecoran pertama pondasi pembangunan rumah ibadah tersebut, Minggu (20/3).

Bersambung ke hal. B7

Sambungan dari hal. B6

WASPADA Selasa 22 Maret 2011

Sumatera Utara



BARANG pecah belah yang terbuat dari keramik dan belakangnya bertuliskan Nederlandsch beserta logo Singa ditemukan warga di dasar Sungai Silau. Namun barang-barang itu tidak terlalu diperhatikan, padahal itu semua kemungkinan besar berkaitan dengan sejarah peradaban Kabupaten Asahan.

Benda Bersejarah

Penggalian Sungai Silau Hanya Dilakukan Arkeolog Pelajar TK Marhamah Kunjungi Perkantoran Warga Pinang Awan Sweeping Truk Lebihi Tonase RANTAUPRAPAT (Waspada): Memotivasi pelajar Taman Kanakkanak (TK) Marhamah untuk belajar cerdas dan bekerja dengan melakukan kunjungan kantorLinmas, TelkomdanLantasmerupakan bagian program belajar dengan tema ‘pekerjaan’. DemikianPimpinanLembagaPendidikanMarhamahJalanPerisai Padang Bulan, Hj Marhamah Nasution, AMd kepada Waspada, Senin (17/3) di Rantauprapat. Belum lama ini, RA Marhamah mengadakan kunjungan ke Kantor Pelayanan Masyarakat bagian Pemadam Kebakaran, PT Telkom, Satlantasdanketangkahanpasirpaindoan,sesuaidenganpembelajaran dengan tema ‘pekerjaan.’ Pimpinan Lembaga Pendidikan Marhamah Hj Marhamah Nasution, AMd mengucapkan terima kasih kepada Kantor Pelayanan Masyarakat bagian pemadam kebakaran, PT Telkom, Lantas Polres Labuhanbatu, dan masyarakat pemilik tangkahan pasir Paindoan yang telah bekerjasama dengan TK Marhamah. (a17)

TORGAMBA (Waspada): Kesal badan jalan sering rusak, akhirnya masyarakat Dusun Pinang Awan, Desa Aek Batu, KecamatanTorgamba, Labusel, Senin (21/3) men ‘sweeping’ truk milik PT Milano melebihi tonase yang melintas. Pantauan Waspada, warga menahan setiap truk yang melintas menuju PKS PT Milano di Dusun Sigambal II, Desa Pinang Dame, dan PKS PT SKL di Kecamatan Simpang Kanan, Kabupaten Rokan Hilir. Warga juga memeriksa mua-

tantrukapakahmelebihikapasitas jalan. Setiap truk yang melebihi kapasitas muatan maksimum, tak dibenarkan melintasi jalan kelas 3 C tersebut. Saddam Efendi selaku juru bicara masyarakat mengatakan, selama ini banyak truk bermuatan20tonyangmelintasiruasjalan tersebut. Padahal, ruas jalan itu diperuntukkan bagi kendaraan berkapasitas 8 ton ke bawah. Akibatnya, badan jalan selama ini tak pernah mulus. Warga selalu makan abu, karena badan jalan hancur dilindas truk,

katanya. Dia mendesak Kepolisian khususnya lalu lintas dan Dinas Perhubungan Labusel, agar menjalankan aturan sesuai dengan UU No. 22 Tahun 2009, tentang lalu lintas dan angkutan jalan. “Solusi yang diharapkan yakni perusahaan menggunakan angkutanyangsesuaidengankelas jalan atau, pihak perusahaan melaksanakan tanggung jawab sosial dengan membangun jalan danmenyesuaikanbangunanfisik jalan dengan muatan ataupun jenis truk,” katanya. (c18)

KISARAN (Waspada): PenggalianSungaiSilauuntukmencari benda bersejarah milik kerajaan atau peninggalan bangsa asing hanya bisa dilakukan arkeolog, karenabarangantikitudilindungi undang-undangdanmiliknegara sehinggaharusdijagadenganbaik. Hal itu diungkapkan Sejarawan Asahan, Zasnis Sulungs kepada Waspada, Senin (21/3). Menurut benda benda yang ditemukan di Sungai Silau yang berbentuk peralatan makan dan benda pecah belah merupakan peninggalan bangsa asing, begitu juga dengan patung wajah wanita. Penggalianharusdilakukanuntuk mencari barang lainnya yang masih terkubur di dasar sungai, begitu juga dengan dugaan ada kapal yang masih terbenam, sehingga harus diangkat untuk mengetahuinya kebenarannya. “Penggalian itu hanya bisa

dilakukan oleh arkeolog karena hanya mereka yang berwenang akan hal itu. Masalah ini telah kita bawa ke Bupati Asahan dan ditanggapi positif,” ungkap Zasnis. Untuk saat ini belum bisa dipastikan kapan penggalian itu dimulai, kata Zasnis, karena menunggu kesiapan pihak arkeolog provinsi. Menunggu hal itu, pihak Pemkab Asahan telah bekerja sama dengan Polres Ashan untuk membuat police line agar kawasan itu tidak digali oleh pihak lain. “Kita masih mengumpulkan sejumlah informasi dari warga sekitar tentang keberadaan barang baerharga itu, sehinga semuanya bisa gali dan diselamatkan,” ungkap Zasnis. Secara terpisah Kadis Porabudpar (Pemuda, Olahraga, Budaya dan Pariwisata) HM Safii melalui Kabid Budaya Muslim mengatakan akan mengum-

pulkan benda berharga itu di dalam satu wadah, sehingga akan dibangun museum di Kisaran. “Hal itu kita lakukan untuk penyelamatan benda bersejarah di Asahan,” kata Muslim. Sebelumnya, di dasar Sungai Silau banyak ditemukan peralatan pecah belah seperti piring, mangkuk dan sendok, benda itu diyakinipeninggalanbangsaasing karena bagian belakang ada tertulis Nederlandsch begitu juga dengan sejumlah koin mulai dari abad XIX (1800-an), sama halnya ditemukan kayu yang masih terbenam dalam sungai dan diyakini adalah kapal yang masih terkubur sehingga perlu diangkat untuk diteliti, karena pada waktu itupinggiranSungaiSilau,tepatnya di Desa Tanjung Alam, Kecamatan Seidadap, Kabupaten Asahan ada Pelabuhan kerajaan Kesultanan Asahan Ke-5, Dewasyah. (a15)

Prajab CPNS 2009 Gelap RANTAUPRAPAT (Waspada): Para CPNSKabupatenLabuhanbatu tahun angkatan 2009 mengesalkan sikap Badan Kepegawaian Daerah (BKD) setempat yang belum jadwalkan kegiatan pendidikan dan pelatihan (diklat) prajabatan(Prajab) CPNS.Akibatnya, gaji para CPNS angkatan tahun 2009 ini belum 100 persen. Menurut seorang CPNS yang bertugas di lingkungan Pemkab Labuhanbatu, sebanyak 300-an lebihrekannyasesamaCPNSangkatan 2009 belum ada yang diikutkan diklat prajabatan, sehingga gaji yang mereka peroleh masih 80 persen dari jumlah yang sesungguhnya. “Padahaldidaerahlainsudah

lama mereka (CPNS angkatan 2009) mengikuti diklat prajabatan dan sudah menerima gaji 100 persen. Maka kami heran dengan kinerja BKD Labuhanbatu. Kalau bongkarpasangKepalaSKPDdan Kepala Badan masalah gampang bagi pihak BKD,” kata CPNS yang tak mau disebutkan namanya, Minggu (20/3) CPNS golongan III A ini mengaku dengan kondisi itu, para CPNS angkatan 2009 telah dirugikan setiap bulannya, karena belum memperoleh gaji 100 persen. Sedangkan kinerja mereka sehari-hari, sama dengan pegawai lainnya. Ironisnya,menurutdia,didua daerah kabupaten pemekaran

LabuhanbatuCPNSsatuangkatan denganmerekatahun2009sudah lama mengikuti Diklat Prajab di Jalan Sunggal Medan. Kepala Badan Kepegawaian Daerah (BKD) Kabupaten Labuhanbatu Aswad Siregar tidak dapat dihubungi, meskipun tiga nomor telefon pribadinya sudah dihubungi. Wakil Bupati Labuhanbatu Suhari Pane ketika disinggung dengan persoalan diklat prajab ini mengatakan, dirinya akan menanyakan langsung kepada kepala BKD Labuhanbatu. “Kepala BKD secara teknis sebaiknya mengaturpelaksanaan diklat prajab tersebut. Saya akan tanyakan beliau,” katanya. (a17)

Bupati Labura Tetapkan 100 Hari Evaluasi Kinerja SKPD AEKKANOPAN (Waspada): Bupati Labuhanbatu Utara H Kharuddin Syah menegaskan, akan mengevaluasi kerja 100 hari SKPD untuk meningkatkan kemampuan dalam mengelola pemerintahan dalam melayani masyarakat. ‘’Jika tidak menunjukkan kinerja yang baik, maka akan dikeluarkan kebijakan baru berkaitan dengan jabatan yang diemban,’’ tegasnya. Bupati juga minta Sekretaris Daerah segera menyusun tim percepatan pembangunan Kabupaten Labura dengan mengelompokkan SKPD sesuai Tpoksi masing masing. Dia memaparkan itu saat pelantikan pejabat eselon II,III dan IV, di aula Pemkab, Senin (21/ 3). Hadir pada pelantikan itu, Wakil Bupati H Minan Pasaribu, SH. MM,Ketua DPRD Drs H Ali Tambuan, Sekdakab H Amran Matondang, SH.Mhum, serta seluruh SKPD di lingkungan Pemkab Labura. Dikatakan Kharuddin, perlu tiga pilar dalam percepatan pembangunan di Labura, ketiga pilar ituPemerintahan,Pembangunan dan Ekonomi serta PembangunanBidangMasyarakatdanSDM nya. “ Saya yakin seluruh SKPD yang dilantik mampu melaksanakan amanah dan kepercayaan yang saya berikan,” sebutnya. Pejabat yang dilantik, antara lain H Amrihuddin Naipospos sebagai Staf Ahli Bidang (Sahlibid) Hukum dan Pemerintahan dan Lingkungan, yang sebelumnya menjabat Asisten II, Ir H Paijo sebagai Asisten Bidang Administrasi Umum, sebelumnya menjabat Kepala Bappeda. Saimin, SP, sebagai Kadis Pasar, Kebersihan dan Pertamanan, sebelumnya Sekretaris PU, H Mahmud Sagala sebagai Kadis Koperasi dan UMKM, sebelumnya Kadispenda, H Bidar Alam-

Waspada / Syahri ilham Siahaan

BUPATI Labura H Kharuddinsyah Sitorus. SE, menyematkan tanda jabatan kepada Jhon Ferry, SSTP sebagai Camat Aekkuo di aula Pemkab Labura Senin (21/3). syah, SH sebagai Asisten II Administrasi,sebelumnyaAsisten III Ekbang. Drs Ismail Hasibuan, MM, sebagai Kadis Perindag, sebelumnya staf Setdakab, M Asril,S.Sos, sebagai Kadis Sosial dan Tenaga Kerja, sebelumnya menjabat Kabag Sosial, Drs DarwinYusma, MAPsebagaiKadisPerhubungan, sebelumnya menjabat Kabag Umum. Drs Ahmad Fuad, MSi dipercaya sebagai Kadis Pendapatan, PengelolaanKeuangan,sebelumnyastafpadaSetdakab,DrsImam Ali Harahap dipercaya sebagai Kaban LH, sebelumnya staf pada Setdakab,HDhaniSetiawanIsma S.Sos dipercaya sebagai Kepala Bappeda, sebelumnya Kepala BKD. Jempol, S.Sos.MSi sebagai StafBidangEkbang,Marwansyah SH, sebagai Kepala BKD sebelumnya staf Setdakab, Siti Roilan, SKM.MAP sebagai Kadis Kesehatan, sebelumnya Plt Kadis Kesehatan, HeriWahyudi Marpaung, SSTP.MAP sebagai Kadispora, sebelumnya Camat Kualuhhulu. Sampurna SIP, sebagai Ka-

kesbang, sebelumnya Inspektur Pembantu Keuangan pada Inspektorat, Dahmi Suheri,ST, sebagai staf ahli Bidang Kemasyarakatan dan SDM, sebelumnya Kadis PU. Pejabat eselon III, Drs Adi Winarto menjadi Camat Kualuhhulu, Sakti Sormin, SE, sebagai Camat Na IX X, John Ferry, SSTP sebagai Camat Aekkuo, sebelumnya Sekcam Kualuhhulu, Jimmi Maulana, SSTP sebagai Kabag Sosial, sebelumnya Camat Na IX X. Sukisman, S.Sos, menjabat Sekretaris Kesbang, sebelumnya Camat Aekkuo, Drs April sebagai Kabag Umum dan Protokol, M Dariatsyah SE, sebagai Sekretaris Dinas Perindag, Lukman Pohan Sekretaris Koperasi UMKM, Dra Elisda menjabat Sekretaris Dinas Pasar dan Kebersihan, dr H Arianto M.Kes sebagai Direktur RSU Labura. Eselon IV yang dilantik yaitu, Lukman sebagai Lurah AekkanopanTimur, dan Furiani sebagi Kasi Evaluasi Pengendalian pada Bidang Meteorologi dan Pengendalian pada Dinas Perindag. (c08)


B8 07.30 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Seputar Peristiwa 13.00 Sinema Siang : Pacarku Bodyguard 15.00 Cek & Ricek 16.00 Minta Tolong 17.00 Seputar Indonesia 17.30 Silet 18.30 Ketika Cinta Bertasbih 19:30 Putri Yang Ditukar 22:30 Mega Sinema


07:15 Inbox 09:00 Liputan 6 Terkini 09:03 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12.30 SCTV FTV 14:00 SL Liputan 6 Terkini 14:30 Status Selebriti 15:00 Uya Emang Kuya 16:00 SL Liputan 6 Terkini 16:30 SL Sensasi Artis 17:30 Uya Emang Kuya 18:00 Islam KTP 21.00 Pesantren & Rock n Roll 22:33 SCTV FTV Utama

07:00 Disney Club : Stich 07.30 Upin & Ipin 08:00 Layar Pagi 09:00 Cerita Pagi 11:00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 13.30 Cerita Siang 15.00 Upin & Ipin 15.30 Disney Club : Phineas & Ferb 16:00 Lintas Petang 16.30 Zona Juara 17:30 Upin & Ipin Dkk 18:00 Baim Jaim 19.00 Dunia Udah Kebalik 20.00 Sinema Utama Bollywood 0.00 Lintas Malam

07.00 Land Before Time 08.30 Sinema Pagi 10.30 Acak Acak 11.30 Topik Siang 12.00 Klik! 13.00 Sinema Spesial 16.30 Topik Petang 17.30 Katakan Katamu 18.35 Super Games 20.00 Ripley’s Believe Or Not 21.00 World Most Amazing Video 22.00 Topik Kita 00.00 Topik Malam

07.00 Sensasi Artis 07.30 FTV Drama 11.30 Patroli 12.00 FTV Siang 14.00 Happy Song 15.00 KiSS Sore 15.30 Fokus 16.30 Bread, Love & Dreams 17.00 Artis Sahabat 18.00 Dia Anakku 19.00 Nada CInta 20.00 Cinta Fitri 21.00 Antara Cinta Dan Dusta 22.00 Mega Asia 00.00 Angling Dharma 01.00 Fokus Malam

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.05 Eleven Show 11.30 Metro Siang 13.05 Archipelago 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 16.30 Metro Realitas 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Metro 10 21.05 Top Nine News 22.05 Today’s Dialogue 22:30 Auto Zone 23.00 Newsmaker 23.30 Metro Sports

WASPADA Selasa, 22 Maret 2011

07.00 Insert Pagi 07.30 Rangking 1 08.30 Kuliner Islami 09.00 Bioskop Indonesia 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Sinema Spesial 16.00 Kejar Tayang 17.00 Reportase Sore 18.00 Jika Aku Menjadi 18.45 Sketsa 19:15 Bioskop Indonesia 21.15 Bioskop TRANS TV 23.15 Bioskop TRANS TV 01.15 Reportase Malam

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

06.30 Apa Kabar Indonesia 10.00 Coffee Break 09.30 Kabar Pasar Pagi 11.00 Menyingkap Tabir 11.30 Kabar Keadilan 12.00 Kabar Siang 13.30 Nuansa 1000 Pulau 14.00 Yang Terlupakan 14:30 Jendela Usaha 15.00 Kabar Pasar 16.00 Tatap Muka 17.00 Renungan Hari Ini 17.30 Kabar Petang 19.30 Jakarta Lawyers’Club 21.00 Apa Kabar Indonesia Malam 22.30 Highlight Sampoerna Proliga 23.00 Documentary One Dr Danger Series 2

08.00 Avatar 09.00 Vicky & ampamp 09.30 Obsesi 10.30 Nyaris Mati 11.30 Sudah Lunas 12.00 Awas Ada Sule 13.30 Momon 14.00 Petualangan Panji 14.30 Amel Cemal Cemil 15.00 Handmade 15.30 Fokus Selebriti 16.30 Berita Global 17.00 The Penguin Of Madagascar 18.30 Mong 19:00 Super Hero Kocak 20.00 Big Movies 22.00 Big Movies

07.00 Tom & Jerry 07.30 Selebrita Pagi 09.00 Scooby Doo 10.00 Jagomatika 11.00 Warna 11.30 Redaksi Siang 12.00 Selebrita Siang 13.00 Laptop Si Unyil 14.30 Dunia Binatang 15.00 Koki Cilik 16.00 Jejak Petualang 16.30 Redaksi Sore 17.00 Asal Usul Fauna 18.00 Wara Wiri 18.30 Hitam Putih 19.30 On The Spot 20.00 Opera Van Java 22.00 Bukan Empat Mata 23.30 Berburu 00.00 Jejak Misterius


Kenangan 80-an Di Rock Spektakuler SELAMA dua hari (19-20 Maret 2011), gemuruh rock se-Sumut dan Aceh telah mengguncang Lapangan Benteng Medan. Pagelaran akbar bertajuk Rock Spektakuler itu, menyuguhkan pertunjukan gratis bagi masyarakat umum dan pecinta musik rock. Tidak tanggung-tanggung, dua panggung yang telah digelar dalam acara itu tidak hanya menampilkan grup musik yang beraksi di festival band rock dari Sumut dan Aceh. Sejumlah band rock era 80 hingga 90-an yang tampil di atas panggung, mengajak para penonton bernostalgia. Pada hari pertama, bandband rock era 80 hingga 90-an yang tampil di panggung Go To Rock antara lain Master Plan, Relix, Lucifer, Vivax, Challenger, New Chordex, Morbid, Crazy Rock dan Valhalla. Di hari kedua, giliran Cranium, Glanter, Bad Radio, C Man, Great Metal, Black Light,Witness, MMG dan Metallaser.

Waspada/surya efendi

Aksi panggung Erucakra bersama C Man-nya di ajang Rock Spektakuler C Man Band tampil mewakili genre Progressive Rock di ajang Rock Spektakuler digelar Kampusi Promo selama dua hari 19-20 Maret 2011 di Lapangan Benteng Medan. Dengan formasi Erucakra Mahameru-gitar/vokal, Rusfian Karim-drummer, Jenesby-Saxophone, Heri-keyboard serta Ediebassit mereka membawakan tiga lagu diantaranya sebagai pembuka mengusung komposisi milik Emerson, Lake & Palmer (ELP) Touch & Go. Lagu ini memang pernah hits di tahun 70-an dengan sentuhan

classikrock,namundiubahCMan kekonsepprogressiverockhingga hasilnya menjadi lebih gahar. Myrian Moment ciptaan Erucakra Mahameru menjadi lagukeduayangmerekabawakan cukup menyentak dengan nadanada Jazz Rock serta ditutup lagu milik kelompok Yess Owner Of A Lonely Hearts. Tidak cuma C Man tampil memikat,bandlainsepertiMaster Plan membawakan karya Linkin Park, Saint Loco ikut mewarnai reuninyaparamusisirockini.Relix tak mau ketinggalan dengan mengusung ciptaan sendiri

diantaranya Dugem, Cinta Oh Cinta dan Preman. Suasana pun kemudian berganti ke arena modern rock dengan munculnya Lucifer membawakan Plush-StoneTemple Pilot, Smell Like Teen Spirit, Rape Me-Nirvana. Begitu juga denganVivaxmengajakpenonton menikmati lagu-lagu milik Gun N Roses diantaranya Sweet Child O Mind, maupun Paradise City. Penggemar kelompokWhite Snake juga terwakili lewat penampilan Chalenger. Mereka membawakan lagu-lagunya antara lain Here Im go Again, Give my All Your Love sampai Crying In The Rain. New Cordex sudah pasti tak jauh dengan lagu milik God Bless dan Gong 2000 sepertio Misteri, Musisi, Rumah Kita dan Kepada Perang. Panggung GoTo Rock semakinpanasdenganmunculnyagrup Morbid, bergaya rapper menyuguhkan tembang ciptaan sendiri diantaranya Tanda Tanya, Kau PikirAyam,Basa-BasidanOnDeat Dying. Aksi seru juga ditunjukan grup Grazy Rock yang mencoba mengulang kegilaan mereka saat memanjat tower di arena Pekan Raya Sumatera Utara beberapa tahun silam. Denganmengusunglagu-lagu milik Deep Purple, kenakalan Grazy Rock masih terlihat saat sang vokalisnya memancat tiang

penyangga panggung sambil membawakan beberapa lagu diantaranyaSmokeOnTheWater, Black Night, Storm Binger dan Burn. ValHalla menjadi grup penutup di hari pertama dengan mengusunglagumilikMegadethHoly Wars, dan Metallica- Enter Sandman. Di hari kedua, panggung Rock Spektakuler diisi grup Cranium yang membawakan lagu-lagu ciptaan sendiri diantaranya Dunia Baru, Emosi Para Bangsat dan lainnya. Glanter mewakili grup musik asal Aceh pun tak mau ketinggalan dengan mengusung Jade-CrazyAerosmits. Sementara penggemar Pearl Jam terwakili dengan tampilnya Bad Radio membawakan dua lagunya seperti State Love and Trust dan Even Flow. Black Light bergayamembawakanlaguWhite Lion-Broken Heart dan Angly Kid Joe yang mewakili lagu-lagu era 90-an. Kemudian,GreatMetalmencoba mengembalikan kenangan bersama Power Metal maupun IronMaidendanWitness mengajak penggemar Motley Crue bernostalgia bersama MMG membawakan suasana Judas Priest dan ditutup penampilan Metallaser masih akrab dengan Led Zeppelinnya. (m19/m32)

Vierra Goyang Pengunjung PRSU Ke-40

Salah satu grup peserta Festival Band saat tampil di acara Rock Spektakuler

Semangat Rock Musisi Medan Masih Ada SEMANGAT rock musisi Medan ternyata masih belum mati, walaupun mereka sekarang sudah tidak muda lagi, bahkan perut pun mulai buncit, tapi tetap saja nafas rock mereka masih sangat kencang hingga terkadang slogan Rock Never Die memang benar adanya. Adalah Kampusi Promo mencoba mengangkat kembali kejayaan anak-anak band rock Medan yang pernah berjaya di erah 80-an hingga 90-an lewat pagelaran Rock Spektakuler di Lapangan Benteng Medan 1920 Maret 2011. Kampusi Promo di ajang ini, tidakcumamengajakkembalinya anak-anak band rock Medan untuk sekedar reuni, tapi mereka juga melengkapi acara tersebut dengan menggali potensi anakanak muda sekarang agar lebih mencintai lagi musik rock melalui Festival Musik yang berhasil menjaring lebih 41 peserta. Untuk melihat potensi rockers muda ini, Kampusi Promo sengaja mengundang Jelly Tobing-drummer yang pernah memiliki nama besar di Medan maupun Indonesia pada umumnya menjadi salah seorang juri bersama dua wartawan Medan masing-masing Jenda Bangun dan Diurnanta. JellyTobing sendiri berharap, lewat ajang Rock Spektakuler maupunFestivalBandini,Medan

mampu bangkit khususnya menghidupkan kembali semangat musik rock di tanah air. Apalagi dulunya, Kota ini pernah menjadi barometernya musik rock dan menjadi kota paling menakutkan buat grup band. Sepopular apapun seorang penyanyi ataupun grup musik di Indonesia, tapi kalau belum mampu menaklukkan publik Medan, mereka belum berhak atas gelar supergrup. Namun sayangnya, setelah era The Rythm King, The Mercy’s,The Mintreal’s danThe Great Session berlalu, seolah anak band Medan seakan tak mampu lagi berbicara di tingkat nasional. Namun syukurnya di era 80an muncul band-band penerus mereka dengan beragam genre musik rock mereka anut, misalnya Hard Rock, Progressive Rock, Trash Metal sampai Hard Core danbanyaklagialiranlainnyayang mempengaruhi grup-grup tersebut. Diantara band-band pernah berjaya di era 80-an sampai 90an tersebutlah Lucifer, New Cordex, Grazy Rock, Valhall, Chalenger, Morbit,Vivax, MMG, Witness, Metallaser, Bad Radio, sampai Grazy Rock ditambah lagi Master Plan, Relix, Black Light, dan Cranium. Bagi Herwin Kampusi selaku penggagas acara Rock Spektakuler ini, memang perlu

mengangkatkembalikemeriahan panggung musik rock di Medan yang pernah ia rasakan sendiri sebagai pelaku atau tepatnya disebut Event Organizer (EO). Dan dibawah payung Kampusi Promo dulunya banyak-banyak Medan menjadi asuhannya. Tentu saja sebagai tanggung jawabnya sebagai pelaku bisnis hiburan dia tidak ingin Medan tenggelam dengan serbuan band-band asal daerah Lampung. Rock Spektakuler pun bergulir sebagai jawaban bahwa musikrockMedanmasihadadan terbukti memang selain bandband pengisi GoTo Rock, 41 band yang ikut dalam Festival Band di acara yang sama itu membuktikan potensi itu belum mati. Dan satu hal yang membingungkan, konser Rock Spektakuler digagas Kampusi Promo ini tanpa dukungan sponsor, kecuali cuma sekedar partisipasi, tapi promotor nekad ini tetap saja berjalan sesuai rencana yang telah mereka buat. Untuk urusan idealisme mengangkat potensi Medan dan sebagai tanggungjawabnya buat kemajuan musik di Medan kita patut acungkan jempol terhadap pemilik nama Herwin Kampusi ini yang memiliki suara berat alias bariton. * Jun

GROUP bandVierra beranggotakanWidi (vocal), Kevin (kibord), Trian (Drum), Raka (gitar) yang terbentuk dar Friendster sepertinya telah memukau ribuan pengunjung yang hadir pada hari ke-2 Pekan Raya Sumatera Utara (PRSU) Sabtu (19/3) malam. Dengan tembang-tembang bertajuk ’First love’ dengan single bertemanya ’Dengarkan Curhatku’ beraliran Power pop membuat para pengunjung terpesona sehingga hal ini menjadi awal baru bagi PRSU ke-40. ”Pengunjung terpesina dengan lantunan lag- lagu hits yang dinyanyikan Vierra pada malam ini. Dan pengunjung PRSU yang begitu ramai terlihat sangat terhibur,” ujar SekertarisYayasan PRSU Armansyah Tanjung SE, menjawab wartawan, kemarin. Menurut Armansyah Tanjung, setelah group badn vierra ini PRSU juga akan menampilkan artis ibukota lainnya yaitu, kangen Band pada tanggal 27 Maret, Zivilia 2 April Goliath 3 April, D’ Bagindas 9 April, Drive 10April dan Armada 15 April 2011. Selain itu lanjut Armansyah PRSU diisi dengan kegiatan pameran hasil-hasil pembangunan dan beragam produk andalan dari berbagai daerah, juga disemarakkan dengan sejumlah festival seni. “PRSU (Pekan Raya Sumatera Utara) tahun ini juga disemarakkan dengan sejumlah festival seni budaya dan lomba bintang,” ujar Armansyah Tanjung. Festival dan lomba yang digelar di arena PRSU 2011, antara lain lomba bintang budaya PRSU 2011, PRSU Got?s Talent, tran Modelling, tari Kreasi daerah, lomba mewarnai, otomotif kontes dan festival band. Penyelenggaraan festival dan lomba seni yang digelar PRSU bekerjasama dengan perusahaan event organizer Trans Kreasindo Production cukup banyak diminati oleh peserta. Festival tersebut digelar di sejumlah panggung di arena PRSU, antara lain panggung utama, panggung terbuka dan panggung Kinaya Food. Di masing-masing panggung hiburan itu akan ditampilkan berbagai atraksi budaya dari berbagai etnis di Sumatera Utara yang disajikan oleh 33 kabupaten/kota. Selain itu juga lanjutnya, para pengunjung juga akan dihibur oleh penampilan seni dan budaya dari Pulau Penang, Malaysia. Di pangung mini Kinaya Food, misalnya, digelar festival lagu yang khusus diikuti peserta dari kalangan anak-anak dan remaja. (m38)

band Vierr

The Hobbit Movie/ist

Pembuatan Film Hobbit Dimulai

PEMBUATAN film yang lama tertunda Hobbit dimulai pada Senin, sehingga mengakhiri penundaan gara-gara masalah dana dan sengketa tenaga kerja yang nyaris membuat proyek itu dialihkan ke luar dari Selandia Baru. Kedua film tersebut akan disutradarai Peter Jackson (49), sutradara asal Selandia Baru yang membuat trilogi laris peraih Oscar Lord of the Rings, sebagaimana dikutip dari Reuters Life! Pembuatan film akan berlangsung di Stone Street Studios diWellington dan sejumlah lokasi di seluruh, sementara alamat pastinya dirahasiakan rapat-rapat. Yang pertama dari kedua film tersebut akan diluncurkan pada Desember 2012 dan kedua diperkirakan diluncurkan setahun kemudian. Kedua film itu telah dirongrong serangkaian masalah, paling mencolok ancaman tahun lalu oleh Time Warner Inc, unit dari Warner Bros. untuk memindahkan proyek tersebut ke luar negeri akibat kekhawatiran bahwa serikat pekerja akan melakukan boikot guna mendukung

tuntutan bagi satu kontrak kolektif. Pemerintah tahun lalu mengubah peraturan kerja untuk mempertahankan produksi bernilai 500 juta dolar AS tersebut dan peningkatan pajak buatWarner Bros, dengan alasan kerugian yang mungkin diderita industri kecil film di negeri itu. Tantangan terakhir datang dari dirawatnya Peter Jackson di rumah sakit tahun ini untuk menjalani operasi darurat gara-gara ia menderita borok bernanah. The Hobbit dilandasi atas petualangan Bilbo Baggins, seorang hobbit yang tinggal di daratan Bumi-tengahdanmelakukanpenjelajahanuntuk menemukan harta yang dijaga oleh naga. Buku tersebut, pertama kali diterbitkan pada 1937, adalah pendahuluan bagi trilogi Lord of the Rings — juga berlangsung di Bumi-tengah. Casting bagi film itu meliputi peraih Oscar, Cate Blanchett, Ian McKellen, Orlando Blood, Ken Stott dan Martin Freeman sebagai Bilbo Baggins.(ant)


Ikang Fawzi-Marissa Haque feat Es Creem Coklat Band dan Fadiya Harry Satwiko menghibur mahasiswa dengan membawakan tembang ‘Jangan Bedakan Kami’ di Kampus Politeknik LP3I Glugur By Pass Medan, Senin (21/3).

Ikang Fawzi-Marissa Haque Hibur Mahasiswa Politeknik LP3I MESKI kini lebih sibuk sebagai pengusaha properti, Ahmad Zulfikar Fawzi populer dengan nama Ikang Fawzi (musisi dan penyanyi rock, juga pemain film era 1980-an), masih mampu menghibur mahasiswa Politeknik LP3I Medan bersama sang istri Marissa Haque yang menyandang sebagai Duta LP3I. Selain menghibur mahasiswa dengan menyambangi tiga kampus Politeknik LP3I Medan yakni kampus Gajah Mada, Glugur By PassdanSisingamangaraja,sangTheBestRocker pada 1987 bersama aktris Marissa Haque ini, juga memberikan bimbingan dan motivasi kepada mahasiswa, bahwa pendidikan tidak hanya untuk mencari kerja tetapi juga menciptakan lapangan kerja dengan berwirausaha, serta mengamalkan ilmu itu bagi pembangunan bangsa dan negara. Marissa Haque yang kini berkarir sebagai konsultan hukum, dosen tamu di berbagai universitas negeri dan swasta, guru pendidikan khusus tunarungu dan politikus Indonesia ini menyampaikan,mahasiswayangmemilihkuliah di Politeknik LP3I sudah tepat. “Politeknik LP3I dalam pendidikannya tidak hanya sekadar mendidik, tetapi juga menciptakan dan mempersiapkan mahasiswanya tidak hanya siap sebagai tenaga kerja (SDM) yang profesional, tetapi juga akan melahirkan pengusahapengusaha yang sukses,” ungkap Marissa yang

juga mantan anggota DPR RI ini. Dalam roadshow tersebut, Marissa Haque bersama Ikang Fawzi tersebut keduanya didampingi Direktur Politeknik LP3I Medan Akhwanul Akmal, Investor Politeknik LP3I Fadiya Harry Satwiko, Kepala Kampus Gajah Mada Syahril Sutan Saidi, Wakil Kepala Kampus Asri Sanusi, Kepala Kampus Glugur By Pass Surya Hendra Putra, Head of Marketing M Kifrawi dan lainnya. Usai memberikan motivasi dan menceritakan berbagai pengalamannya, Ikang Fawzi didampingi sang istri dan Fadiya Harry Satwiko, langsung menghibur para mahasiswa dengan membawakan tembang lawas ‘Panggung Sandiwara’ dan disambut riuh para mahasiswa. Pada kesempatan itu Ikang Fawzi juga berkesempatan duet dengan Es Creem Coklat Band dari LP3I dengan membawakan tembang ‘Jangan Bedakan Kami’. Pada kesempatan itu, Fadiya Harry Satwiko yangjugasebagaiPembinaPoliteknikLP3IMedan menyampaikan, kedatangan Duta LP3I Marissa Haque dan suaminya Ahmad Zulfikar Fawzi iniuntukberbagi,sharingpengalaman,bagaimana nantinya lulusan Politeknik LP3I tidak hanya sekadar menjadi SDM yang handal dan profesional dalam memenuhi kebutuhan perusahaan kerja, tetapi lulusan LP3I nantinya juga menjadi pengusaha-pengusaha Indonesia. (m41)


WASPADA Selasa 22 Maret 2011


Pertemuan Sesama Pedagang Ikan Di Disperindagkop Berlangsung Alot TAKENGEN (Waspada): Pertemuan pedagang ikan yang berjualan di Komplek Pasar Ikan Bawah, Kampung Baru, Kec. Lut Tawar, dengan para pedagang ikan di lokasi Pasar Pagi, Jalan Putri Ijo, Takengen berlangsung alot. Pertemuan di Kantor Dinas Perindustrian, Perdagangan, Koperasi, Energi Sumber Daya Mineral (Disperindagkop-ESDM) Aceh Tengah, Sabtu (19/3) kemarin, membahas larangan berjualan di pasar pagi Jalan Putri Ijo. Pertemuan antar sesama pedagang ikan itu buntut dari protes yang sempat dilayangkan puluhan pedagang di komplek Pasar Ikan Bawah, Kampung Baru, Takengen ke dinas tersebut 9 Maret lalu. Mereka menolak dan minta pedagang ikan di pasar pagi ditertibkan karena dinilai telah melanggar aturan.

Sedangkan pedagang di pasar pagi tetap bertahan berjualan di lokasi pasar sayur itu dengan berbagai alasan. Untuk menyelesaikan permasalahan itu, dinas terkait mengundang kedua belah pihak yang sedang berselisih untuk mencari jalan ke luar. Menurut Kepala Bidang Perdagangan Ir Zainul Adha Purba, Minggu (20/3), hasil pertemuan disepakati pedagang di pasar pagi diperbolehkan membuka lapak dengan syarat hanya sampai pukul 08:00 setiap hari. “Bila lewat dari batas yang disepakati, petugas Satpol-PP akan mengambil tindakan untuk menertibkan mereka. Pertemuan berlangsung a lot, tapi akhirnya ada kesepakatan antara pedagang,” kata Zainul Adha Purba.(cb04/cir)

Kehadiran Legislatif Subulussalam Disesalkan SUBULUSSALAM (Waspada): Kecilnya persentase kehadiran anggota legislatif Subulussalam dalam forum Musyawarah Perencanaan Pembangunan (Musrenbang) sangat disesalkan. Padahal, kehadiran para wakil rakyat pada forum Musrenbang tingkat Kota Subulussalam, Kamis (17/3) itu sangat dibutuhkan dan menentukan, paling tidak menjadi forum yang lebih efektif bagi masyarakat untuk menyampaikan aspirasi, tanpa harus datang ke gedung dewan. Syahril Tinambunan didampingi Darmin T dan Lase, Pengurus LSM Berkah Subulussalam, Senin (21/3) di Sekretariat Persatuan Wartawan Kota (Perwako) Subulussalam menandaskan, minimnya kehadiran anggota DPRK dalam forum tahunan itu bisa jadi menjadi salah satu indikator penilaian publik kalau lembaga perwakilan rakyat itu kurang peduli rakyat. Sejumlah anggota DPRK yang hadir dalam forum itu, sebut Syharil, Ketua LSM Berkah yakni Pianti Mala dan Siti Ansari Bancin selaku Ketua dan Wakil Ketua serta dua orang anggota, HM Sugito dan Sapriadi Boangmanalu. “ Ada anggota DPRK yang tercatat dalam agenda acara sebagai moderator, tetapi dalam acara mereka tidak hadir,” sesal Syahril. Karenanya Syahril diamini Darmin dan Lase berharap, para wakil rakyat di sana lebih respon dengan hal-hal yang menyangkut dengan kepentingan rakyat. “Kalau dalam forum Musrenbang anggota yang terhormat itu tidak hadir, bagaimana rakyat menyuara-

kan aspirasinya, padahal forum itu menjadi kesempatan masyarakat untuk bertatap muka langsung dengan anggota DPR,” pungkas Syahril menambahkan, tidak semua masyarakat punya nyali untuk menemui wakil rakyat di gedung DPR. Menanggapi LSM Berkah, Ir. Netap Ginting, Ketua Komisi B DPRK t melalui ponselnya, Senin menegaskan kalau kehadiran lembaga legislatif dalam forum Musrenbang bukan sebuah kewajiban. Malah sistem reses yang menjadi agenda DPR dinilai sangat efektif dalam menyerap aspirasi masyarakat. “Kita punya kewajiban melakukan reses tiga kali dalam setahun dan langsung terjun ke masyarakat untuk menyerap aspirasi rakat,” tandas Netap menambahkan, Musrenbang menjadi agenda Kab/Kota yang difasilitasi oleh Bappeda, bukan DPR. Netap yang saat Musrenbang mengaku sedang berada di Malaysia dalam rangka studi dan tidak terkait dengan tugas DPR menambahkan, hadirnya sejumlah anggota DPRK dalam forum Musrenbang itu sudah sangat positif. MengomentariWalikota Merah Sakti yang mengawali sambutannya sesaat membuka Musrenbang melakukan konfirmasi terkait kehadiran para Kepala SKPK, Netap sangat mendukung.“Kalau ternyata ada kaban/kadis tidak hadir atau terlambat menghadiri forum Musrenbang, ya memang kewajiban walikota menegur. Bila perlu mutasi saja jika ada indikasi kaban/kadis tidak menghargai forum resmi, seperti Musrenbang itu,” jelas Netap.(b33)

Kelangkaan Pupuk Bersubsidi Di Aceh Tengah Harus Diusut TAKENGEN (Waspada): Dewan Perwakilan Rakyat Kabupaten (DPRK) Aceh Tengah, Bardan Sahidi minta pihak berwajib mengusut hilangnya pupuk Urea bersubsidi di sebagian wilayah di Kab. Aceh Tengah. Hilangnya pupuk Urea bersubsidi di daerah penghasil kopi itu, disinyalir karena adanya permainan kotor pihak distributor untuk tujuan tertentu sehingga penyebarannya tidak merata. Dikatakan Bardan kepada Waspada, Minggu (20/3), untuk Kab. Aceh Tengah ada dua distributor yang menanandatangani kontrak kerjasama dengan produsen pupuk Urea, dari PT Pupuk Iskandar Muda (PIM) Lhokseumawe. Salah satunya Badan Usaha Milik Daerah (BUMD) Pembangunan Tanoh Gayo, untuk wilayah distribusi tujuh kecamatan meliputi Kec. Lut Tawar, Pegasing, Bebesen, Silih Nara, Bies, Kute Panang dan Kec. Ketol. “Mustahil bisa hilang, pupuk ini kan memakai logo resmi dan bertuliskan pupuk bersubsidi di karung kemasannya. Demikian

Waspada / Sudarmansyah

TERLANTAR: Proyek maritim untuk komunitas nelayan di Desa Babah Lhung Kec. Darul Makmur, Nagan Raya yang dibangun pada 2006, dibiarkan terlantar. Proyek yang menelan dana hingga puluhan miliar tersebut disinyalir sarat korupsi dan penyimpangan. Foto direkam Minggu (20/3).

Proyek Maritim Bernilai Puluhan Miliar Mubazir NAGAN RAYA (Waspada) : 50 Unit rumah serta fasilitas pendukung untuk komunitas nelayan seperti Tempat Pendaratan Ikan (TPI), serta Mushalla dan Gudang penyimpanan yang bernilai puluhan miliar rupiah yang berlokasi di desa Babah Lhung Kecamatan Darul Makmur, Nagan Raya, mubazir dan dibiarkan terbengkalai. Padahal proyek maritim yang bersumber dari APBN tersebut dikerjakan sejak 2006, bahkan bantuan pendukung lainnya berupa 25 unit boat bernilai miliaran rupiah juga raib

dantakdiketahuikeberadaannya. Muslim, 40, tokoh masyarakat, Minggu (20/3) menuturkan, temuan proyek bermasalah itu sudah lama terdeteksi namun terkesan tidak tersentuh hukum. “Kita sangat kecewa atas perbuatan seperti ini. Bayangkan berapa banyak dana yang dihamburkan untuk proyek ini tapi tak bisa kita manfaatkan. Belum lagi permasalahan lain yang sarat penyimpangan. Contohnya 25 unit boat yang dibuat dari kayu sembarang tetapi harganya mencapai Rp450 juta. Boat itu kini tidak diketahui keberadaannya bahkan banyak yang karam karena tidak bisa digunakan,” ungkap Muslim. Ditambahkan, upaya membongkar penyimpangan oleh pihak berwajib, juga dinilai

seperti ‘mimpi’. Hingga saat ini tak ada tanggapan apa pun terhadap penyimpangan yang mereka sinyalir terjadi dalam proyek APBN tersebut. Pihaknya mengaku sudah beberapa kali melaporkan temuan tersebut ke pihak yang berwajib. “Kami hanya bisa pasrah, sebab tidak ada lagi yang mau mendengar suara kami rakyat kecil di sini,” ujar Muslim. Sudah Diserahkan Terkait temuan tersebut, mantan Kepala Dinas Kelautan dan Perikanan Kab. Nagan Raya, Mahmud, yang coba dikonfirmasi mengaku mengetahui kondisi proyek Maritim tersebut. Namun dia mengaku tidak mengetahui secara penuh permasalahannya, sebab tidak pernah ada informasi apa pun ke kabupaten. Bahkan proyek itu

juga dengan kuota per bulan, kepada siapa disalurkan, kapan serta kios pengecer mana semua telah diatur dalam kesepakatan. Demikian juga dengan harga, pemerintah telah menetapkan harga eceran tertingi (HET) per kilo,” kata politisi PKS ini. Ditambahkan Bardan, setelah mendapat informasi terjadi kelangkaan pupuk, ia beserta sejumlah tim langsung melakukan investigasi ke lapangan dan banyak menerima laporan masyarakat. Dari hasil laporan itu, disinyalir ada permainan kotor oleh distributor nakal untuk kepentingan tertentu. “Saya minta pihak berwajib mengusut tuntas oknum tertentu yang ingin mengambil keuntungan sesaat dengan merugikan petani yang berdampak pada hasil produksi pertanian,” sebutnya. Berdasarkan keterangan, yang kesulitan mendapat pupuk bersubsidi antara lain petani di Kec. Linge, Atu Lintang, Rusip Antara, Celala, Jagong dan Bintang.(cb04/b18)

Dari DPRK hadir Rahmad, SH dan Aryani, S.Pd. Mubaligh Maulid adalah pegawai Dinas Syariat Islam Simeulue, Riswan. Dia menyebutkan, Muhammad Rasulullah SAW adalah pelopor reformasi dunia. Muhammad SAW adalah pahlawan bagi para kaum wanita. Muhammad SAW memiliki Ahlaqulkarimah yang sangat elok. Menurutnya, hal terpenting yang harus dipetik dari Maulid ini adalah mentauladani sosok Muhammad SAW secara kaffa tentang Ahlaqulkarimah yang disegani dan dikagumi oleh umat hingga sekarang. Rasulullah memiliki empat sifat: Si’dik, Amanah, Tablihq dan Fatanah. Artinya selalu benar dalam ucapan dan perbuatan. Amanah, tidak menghianat bila dipercaya, selalu menyampaikan yang benar dan Rasulullah Muhammad SAW cerdas dan tangkas.(cmr)

terhadap proyek tersebut. Dia menyatakan akan melakukan penelusuran lebih jauh dalam waktu dekat. PantauanWaspada di lokasi, Minggu (20/3), bangunannya mulai rusak dan tertutup semak. Bahkan hampir seluruh bangunan kondisinya rusak parah. (sdp)

Serah Terima Jabatan Polres Sabang SABANG (WaspadaA): Serah terima jabatan Kepala Bagian Sumber Daya Manusia (Kabag Sumda) Kepolisian Resort (Polres) Kota Sabang, dari AKP Hazairi Edy Harahap kepada AKP Mugianto berlangsung di Mapolres setempat. Setelah prosesi serah terima jabatan, Kapolres Sabang, AKBP Sigit Kusmardjoko, menyampaikan terima kasih dan selamat bertugas kepada pejabat lama AKP Hazairi Edy Harahap yang pindah tugas ke bagian Biro SDM Polda Aceh. Kepada Pejabat yang baru, AKP Mugianto diminta menyesuaikan diri dengan lingkungan tugas yang baru, membangun sinergi serta melanjutkan program yang belum sempat terlaksana. “Ini tantangan yang berat bagi Kabag Sumda yang baru dalam meningkatkan fungsi pembinaan di lingkungan Polres Sabang,” kata Kapolres.(b29)

Kinerja Dinas SI Dinilai ‘Ompong’ IDI, Aceh Timur (Waspada): Kinerja Dinas Syari’at Islam (SI) se Aceh, dinilai bobrok alias ‘ompong’. Pasalnya, tiga qanun yang telah disahkan, maisir (judi), khalwat (zina) dan khamar (miras) tidak jalan. Selain itu, pengawasan yang selama ini berada di tangan Polisi Syari’at (Wilayatul Hisbah) juga dinilai mandul. Sebab, saban hari terjadi pelanggar SI—khususnya khalwat (meusum)—pihak terkait sama sekali tidak melakukan eksekusi dengan alasan kekurangan dana. Demikian penilaian Direktur EksekutifYayasan Advokasi Rakyat Aceh (YARA), Safaruddin, SH, kepada Waspada, Senin (21/3). Menurut dia, mandulnya WH tak terlepas dari ketidaktegasan pimpinan dalam memanajemenkan anggota di lapangan. Karenanya, lanjut Safaruddin, agar Syari’at Islam tidak terkesan jalan di tempat maka Dinas SI harus menempuh langkah-langkah yang dapat memicu semangat personelWH, sehingga pengawasan di tiap-tiap desa dan kecamatan tidak beku serta terus terpantau melalui kerjasama dengan aparatur desa dan instansi terkait, seperti Kantor Urusan Agama (KUA).(cmad)

Warga Desa Suka Karya Santuni 80 Anak Yatim SIMEULUE (Waspada): Warga Desa Suka Karya, Sinabang, Simeulue, pada perayaan Maulid Nabi Besar Muhammad Rasulullah SAW di Masjid Istiqamah, Minggu (20/3), menyantuni 80 anak yatim piatu dengan membagi-bagi uang Rp250.000 per orang plus satu kain sarung. Ketua Panitia, Kasmanitar, S.Ag menyatakan, santunan semula ditargetkan untuk 100 orang namun yang berhasil dicover untuk 80 orang. Ditambahkan Kepala Desa Suka Karya, Darul Amin Adamy, dana perayaan Maulid adalah sedekah warga desa dan dari sejumlah donatur termasuk Bupati Simeulue, Drs. Darmili. Sedangkan kain sarung dari Sekdakab Simeulue, Drs. Mohd. Riswan R alias Moris. Hadir Wakil Bupati Drs. M.Yunan T. Sekda Drs. Mohd. Riswan R. Kepala Dinas Syariat Islam, Kepala Dinas Kesehatan dan lainnya.

menurutnya pernah diserahkan kepada Muspika, tapi masyarakat enggan menempati lokasi komplek nelayan Babah Lhung tersebut. Sementara Evendi, anggota DPRK Nagan Raya dari Komisi B membidangi masalah kelautan dan perikanan, mengaku belum mengetahui secara persis

Waspada/Ali Amran

RUSAK: Jembatan penghubung Desa Pulonas Baru Kec. Lawe Bulan dengan Kota Kutacane Kec. Babussalam, masih rusak dan belum bisa dilalui kenderaan bermotor, akibat dihantam banjir pekan lalu.

Warga Pinggiran DAS Cemaskan Banjir KUTACANE (Waspada): Ribuan warga Aceh Tenggara yang berdomisili di sepanjang Daerah Aliran Sungai (DAS) kali bulan, mengaku cemas terhadap banjir menyusul semakin tingginya curah hujan di hulu sungai. Pasalnya, meski telah dibangun tanggul pengaman, namun bila curah hujan tinggi, kerapkali aliran sungai kali bulan yang membelah kota Kuta Kutacane dan beberapa kecamatan lainnya membuat banjir dan mengakibatkan terjadinya abrasi. “Pasti cemas dan was-was, masalah cuaca saat ini tidak menentu dan sulit diprediksi, sedikit saja hujan dibagian hulu sungai , debit air terus bertambah dan mengancam keselamatan

warga serta harta benda kami di pinggiran DAS,” kata Erni warga Kota Kutacane. Putusnya jembatan dan ambruknya beberapa rumah warga serta berpindahnya aliran sungai kali bulan di kecamatan Deleng Pokisen, seperti yang terjadi beberapa hari lalu, jelas sangat meresahkan ribuan warga yang berdomisili di pinggiran DAS, apalagi banjir baru ini menghanyutkan kayu besar disertai lumpur. Nawi Sekedang, Ketua LSM Lankgar mengatakan, besarnya dampak yang terjadi akibat banjir serta meluapnya sungai kali bulan, merupakan gambaran bila hutan dibagian hulu sungai mulai rusak. “Penebangan hutan itu,

memang bukan sekarang, tapi beberapa tahun lalu, namum akibatnya baru dirasakan warga tahun ini, menyusul rusak dan ambruknya beberapa fasilitas umum, rumah warga, lokasi wisata dan lahan pertanian serta perkebunan warga,” ujar Nawi. Pantauan Waspada, meski jalan penghubung Kec. Deleng Pokisen –Kec. Badar di kawasan Salang Baru/Pantai Barat sudah bisa dilalui kenderaan setelah Pemkab menurunkan alat berat. Namun jembatan Marlboro yang menghubungkan Kec. Babussalam- Kec. Lawe Bulan di Pulonas baru, belum bisa dilewati kenderaan bermotor akibat masih menganganya lubang besar di kepala jembatan. (b27)

Pedalaman Pantee Bidari Butuh Bus Sekolah LHOKNIBONG, Aceh Timur (Waspada): Ratusan pelajar dari sejumlah desa di pedalaman Kec. Pantee Bidari, Kab. Aceh Timur membutuhkan bus sekolah. Sebagian besar pelajar di kawasan itu selama ini jalan kaki ke sekolah dengan jarak tempuh mencapai puluhan kilometer. Pantauan Waspada, desa yang paling membutuhkan armada angkutan pelajar antara lain Desa Blang Seunong dan desa tetangganya— Suka Damai. Kedua desa ini tergolong desa terpencil, terpaut sekitar 40-45 km dari Lhoknibong—ibukota kecamatan Pantee Bidari. “Derajat ekonomi masyarakat Desa Blang Seunong rata-rata masih di bawah garis kemiskinan. Jangankan membeli sepedamotor, untuk membeli sepeda saja susah. Tak heran, rata-rata pelajar di desa ini, termasuk murid SD, harus berjalan kaki hingga belasan kilometer ketika bersekolah,” kata Keuchik Desa Blang Seunong, Ali Amren, baru-baru ini. Ali menjelaskan, luas Desa Blang Seunong sekitar 80.000 ha persegi, terbagi dalam 11 dusun. Dari 11 dusun itu hanya 5 dusun yang memiliki SD, yakni Dusun Sarah Gala, Sijuek, Sijudo, Ranto Panjang, dan Dusun Blang Seunong. Sedangkan SMP hanya ada satu unit, itupun dibangun satu atap dengan SD di Dusun Sijudo. Setali tiga uang dengan kondisi Blang Seunong, ratusan pelajar SD dan SMP di Desa Suka Damai harus berjalan kaki ketika bersekolah. Bahkan desa ini tidak memiliki SD dan anak-anak usia sekolah dasar terpaksa bersekolah ke Dusun Blang Seunong, Desa Blang Seunong. Sementara untuk pelajar SMP dan SMA mesti turun ke Desa Alue Ie Mirah dan Lhoknibong dengan jarak tempuh antara 15 km hingga 45 km.(cmus)

Forsimas Aceh Deklarasikan Intelektual Muda

Waspada/Muhammad Rapyan

Sekretaris Kepala Dinas Kehutanan Simeulue,Hasrat,SP menyerahkan secara simbolis sumbangan Sekda Moris kepada para anak yatim pada Maulid Nabi Muhammad SAW yang dilaksanakan masyarakat Desa Suka Karya, Sinabang, Minggu (20/3).

BANDA ACEH (Waspada): Forum Silaturrahim Kemakmuran Mesjid se Rantau (Forsimas) Aceh, ingin mewujudkan organisasi yang dipimpinnya sebagai gerakan dakwah dan pendidikan kaum intelektual Islam yang bisa mengayomi umat di Aceh khususnya. Pernyataan tersebut dikemukakan Sekretaris Forsimas Aceh, Muhammad Hasan Basri pada pendeklarasikan Pemuda

Forsimas, di Banda Aceh, Minggu (20/3). “Ide mendeklarasikan Pemuda Forsimas sebagai upaya regenerasi organisasi untuk mewujudkan pemuda sebagai pemimpin intelektual Islam ke depan,” katanya. Muhammad Hasan Basry menyebutkan, ia sudah terlalu tua untuk melanjutkan program pengembangan masyarakat, generasi pemuda adalah ujung

tombak berjalannya roda organisasi dakwah ini dalam upaya menjalankan program pendidikan bagi masyarakat Islam khususnya di Aceh. Sementara Abdul Rani Usman selaku koordinator Forsimas Aceh, mengharapkan Forsimas yang telah mempunyai induk di negara-negara Asia ini harus berupaya menjadi motor penggerak kaum muda intelektual Islam.(b07)


JALAN KAKI: Sejumlah murid SD asal Desa Blang Seunong, pulang sekolah dengan berjalan kaki karena tidak adanya bus sekolah. Foto direkam di jembatan apung, kawasan perbatasan Desa Blang Seunong dan Desa Tanah Merah, Kec. Langkahan, Kab. Aceh Utara, baru-baru ini.



WASPADA Selasa 22 Maret 2011

PT. Pos Indonesia Sosialisasi Pemakaian Elpiji 3 Kg

Jangan Jadikan PAUD Tempat Penitipan Anak

LAMNO, Aceh Jaya (Waspada): Pihak PT. Pos Indonesia selaku penyalur gas elpiji, melakukan sosialisasi penggunaan tabung gas elpiji 3 kg kepada masyarakat Kec. Jaya, Kab. Aceh Jaya, di aula kantor camat setempat, Senin (21/3), Dalam sosialisasi tersebut, pihak PT. Pos Indonesia menjelaskan bagaimana cara memasang dan menghidupkan kompor serta cara penggunaan yang benar. AhmadYani selaku instruktur, memperlihatkan juga bagaimana mengatasi jika ada masalah tentang kebocoran pipa atau ada sulutan api. “Bila kran tabung dalam posisi off, pasti tidak akan terjadi kebakaran,” kata Yani menyakinkan masyarakat. Sementara itu, minat masyarakat Jaya dalam penggunaan tabung gas 3 kg ini tidak begitu antusias, karena rata-rata di dapur warga sudah memiliki tabung gas berukuran 12 kg. Salah seorang warga Lamno, Imran, mengaku hanya tertarik pada harga isi ulang saja,. Karena, jika tabungnya kecil, maka isi ulangnya lebih praktis dan harganya juga lebih murah. ’Tapi saya waspada juga, karena maraknya pemberitaan mengenai tabung gas 3 kg yang katanya sering meledak,” katanya serius. Dalam kesempatan itu, selain masyarakat juga hadir Muspika Kec. Jaya serta Sekretaris Desa se Kec. Jaya. Sementara dari PT. Pos Indonesia hadir Wakil Kepala Pos Banda Aceh, Hasmin Dali dan Kepala PT. Pos Lamno, Darmadi.(b07)

BIREUEN (Waspada): Pendidikan Anak Usia Dini (PAUD) dan Himpunn Pendidik Aak Usia Dini Indonesia (Himpaudi) sebagai wadah untuk mencapai sasaran dan tujuan dalam meningkatkan pendidikan. Para orang tua diharapkan jangan menjadikan PAUDPAUD sebagai tepat penitipan anak semata. Tapi pendidikan dan kasih sayang orang tua hal yang sangat mendasar dibutuhkan bagi anak. Bupati Bireuen Nurdin Abdul Rahman mengemukakan hal itu pada pelantikan Pengurus Forum PAUD dan HIMPAUDI Kab. Bireuen priode 2011-2013, di Aula Setdakab lama, Senin (21/3). Dikatakan, PAUD dan Himpaudi adalah wadah pendidikan bagi anak-anak usia dini sangat penting dalam melahirkan generasi bangsa yang terampil dan cerdas di masyarakat. Keberadaan PAUD dan Himpaudi hendaknya dapat berfungsi secara maksimal dalam meningkatkan kualitas dalam megisi dan melaksanakan berbagai program pendidikan pada gilirannya dapat meningkatkan mutu pendidikan sejak dini.(b16)

Baitul Muttaqin Peringati Maulid MADAT, Aceh Timur (Waspada): Keluarga besar Majelis taklim dan Majelis Samadiyah Masjid Baitul Muttaqin, Desa Tanjoeng Minjei, Kec. Madat, Kab. Aceh Timur, Minggu (20/ 3) memperingati maulid Nabi Besar Muhammad SAW. Acara diawali meudikee atau berzikir dan bershalawat kepada nabi, seusai Shalat Ashar, lalu selepas Magrib dilanjutkan menyantap khenduri bersama puluhan yatim. Ritual yang turut dihadiri unsur Muspika Plus ini ditutup dengan Shalawat dan Doa setelah sebelumnya diisi dengan ceramah agama yang dipaparkan Tgk Fauzan Azima. “Selain memuliakan hari lahirnya baginda Rasulullah SAW, kegiatan ini juga untuk mempererat silaturrahmi, baik sesama jamaah majelis maupun antara jamaah dengan masyarakat serta pemerintah,” kata Ketua Panitia H. Saiful Puteh didampingi Kepala Desa Tanjong Minjei, Mukhtar Usman alias Keuchiek Adek.(cmus)

Penipuan Melalui Handphone Di Bireuen BIREUEN (Waspada): Aparat gadungan mulai mencari mangsa di Kec. Simpang Mamplam Kab. Bireuen. Seorang warga, Ilyas asal Desa Lhok Mane nyaris tertipu komplotan yang mengaku sebagai aparat. Ilyas, Senin (21/3) mengatakan, dia mendapat telepon dari seseorang yang meberitahukan adiknya, Marzuki, 35, ditangkap petugas karena kasus sabu-sabu dan tertangkap di Keude Samalanga. Untuk membebaskan adiknya, Ilyas diminta menebus Rp2 juta oleh polisi gadungan itu. Dia menyebutkan, dalam pembicaraan via telepon selular, Ilyas mengaku akan melunasi uang yang diminta pelaku, terlebih saat pelaku memperdengarkan suara laki-laki lain yang mirip dengan suara adiknya. “Bang lon ka didrop, bagah bang neu peusiap peng, (bang saya sudah ditangkap, tolong disiapkan uang),” kata Ilyas mengulang kata ucapan pria yang mirip suara adiknya. Kemudian, teman Ilyas, Jufri menghubungi Marzuki yang dikabarkan sudah ditangkap polisi. Ternyata, Marzuki sedang pulang bersama isterinya dari Samalanga menuju rumah mereka. “Hampir saya tertipu,” ucap Ilyas.(cb03)

Muhammad Akbar Ajiansah Meninggalkan Rumah LANGSA (Waspada): Muhammad Akbar Ajiansah, 14, siswa kelas VI SD Muhammadiyah, Kota Langsa, sudah tiga bulan meninggalkan rumah. Ibunya, Afrida, sekarang gelisah karena tidak tahu kemana anaknya itu harus dicari. Dengan membawa selembar pasphoto anaknya, Afrida, mendatangi Waspada, Minggu (20/3), minta bantuan agar dapat diberitakan. Harapannya tidak lain, agar siapa saja pembaca Waspada yang pernah melihatnya agar tergerak hati mereka untuk memberi tahu di mana Akbar berada. Menurut Afrida, kondisi Akbar sejak ayahnya tidak ada lagi memang agak tertinggal dalam berpikir, sehingga ada kemungkinan dia diajak orang untuk meminta-minta. Afrida yang sehari-hari berjualan kain di pasar Langsa, tidak tahu siapa yang mengajaknya dan kemana dia dibawa, ada orang bilang kepadanya pernah melihat sekali di salah satu mall di Kota Medan. Afrida sangat berharap jika ada orang yang melihat di mana Akbar berada dapat memberi informasi kepadanya melalui Hp. 082170005496. Karena untuk mencari langsung ke sejumlah tempat pihaknya tak sanggup, selain tidak ada biaya, dia juga tidak berani berpergian seorang diri.(b22)

17 Kades Usulkan Pejabat Imum Mukim PANTONLABU, Aceh Utara (Waspada): Sebagian besar dari 17 geuchik/kepala desa (Kades) di Kemukiman Jambo Aye Tengah, Kec. Tanah Jambo Aye, Aceh Utara mengharapkan Muspika mengusulkan Asy-‘ari (foto) menjadi Pj. Imum Mukim di kemukiman tersebut. Wilayah kemukiman yang membawahi 17 gampong/desa ini sudah sekian lama mengalami kekosongan jabatan adat (Imum Mukim), menyusul berakhirnya masa jabatan Murizal Jamil, tahun 2007. Pelaksanaan pemilihan Imum Mukim secara serentak di kecamatan ini, beberapa waktu lalu telah diselenggarakan, namun di Kemukiman Jambo Aye Tengah, gagal memilih sosok pemimpin adat sehingga sudah tiga tahun lebih kawasan kemukiman ini dalam status quo. “Terkait hal tersebut, kami mengharap agar Muspika Kec. Tanah Jambo Aye, menunjuk Asy’ari sebagai pelaksana tugas selama satu tahun ke depan, dalam rangka memproses Imum Mukim devinitif,” kata juru bicara 17 Kades Kemukiman Jambo Aye Tengah, M Amin Usman kepada Waspada di Pantonlabu, Senin (21/3). Kalau Musyawarah pimpinan kecamatan (Muspika) Kec. Tanah Jambo Aye, bisa mendukung harapan kami tersebut, yaitu Asy’ari menjadi Pj. Imum Mukim, mudah-mudahan kekosongan pimpinan adat di kawasan ini sudah tuntas dalam pekan ini, sebut Kades Buket Jrat Manyang (juru bicara), M Amin Usman yang diamini para Kades lainnya, antara lain Kades Buket Alue Puteh, Ibrahim Saleh dan beberapa lainnya. “Asy’ari, pernah menjabat Kades Tj Ara dari tahun 2008 – 2010 dengan kinerjanya yang sukses. Namun, ketika pelaksanaan Pilkades di gampong ini, ia (Asy’ari) tak sedia maju selaku calon, sehingga dilihat dari kualitas intelektual dan penguasaan ilmu agama, sudah pantas jabatan Imum Mukim dijabat olehnya,” jelas Kades Buket Alue Puteh. Sehubungan ini Camat Tanah Jambo Aye, T M Yakob, SE yang dihubungi, Senin kemarin, mengatakan. “Jika sebagian besar dari 17 Kades sudah menghendaki Asy’ari, tidak ada halangan lagi dari pihak kami (Muspika). Yang penting, kekosongan pemimpin adat di Kemukiman Jambo Aye Tengah segera teratasi,” ujarnya.(b10)

Perhatian Masyarakat Terhadap PAI Menurun Waspada/Zafrullah

SOSIALISASI: Ahmad Yani dari PT. Pos Indonesia melakukan sosialisasi penggunaan tabung gas elpiji 3 kg kepada masyarakat Kec. Jaya Lamno di aula Kantor Camat Jaya.

Jembatan Blang Guci Nyaris Putus IDI, Aceh Timur (Waspada): Puluhan ribu jiwa dalam puluhan desa di Kec. Idi Tunong dan Banda Alam, Kab. Aceh Timur, Provinsi Aceh, terancam terkurung. Pasalnya, satu-satunya jembatan penghubung di Desa Blang Guci, Kec. Idi Tunong, terancam putus. Pengamatan Waspada, Senin (21/3) jembatan dengan ukuran lebih kurang 45X4,5 meter itu kondisinya kini sangat memprihatinkan. Setelah ter-

perosoknya truk beberapa kali di atas jembatan itu, kondisinya kini kian terpuruk, bahkan satu persatu lantai jembatan berjatuhan ke sungai. Menurut pengakuan warga, jembatan tersebut mulai rusak sejak 10 tahun yang silam. Saat konflik berkecamuk di Aceh, jembatan yang notabenya tercatat satu-satunya penghubung Kota Idi dengan dua kecamatan di pedalaman Aceh Timur tersebut juga sempat dibakar dan rusak OTK ketika Aceh dilanda Darurat Militer (DM). “Hingga kini tidak pernah dibangun secara menyeluruh. Perbaikan yang dilakukan seca-

ra sederhana mustahil jembatan ini bertahan lama, sehingga dalam tiga bulan terakhir saja sudah lebih 5 truk dan 10 sepedamotor terperosok,” jelas M. Ali, tokoh masyarakat Idi, Senin (21/3) di Idi. Menurutnya, kondisi jembatan Blang Guci tersebut semakin tidak layak pakai menyusul terperosoknya satu unit truk jenis Tronton yang mengangkut hasil alam dari Keude Geurobak, Kecamatan Banda Alam ke Idi. Bahkan, saat itu sopir dan kernek truk nyaris meninggal dunia akibat terjepit. Kata dia, berdasarkan keluhan masyarakat dan usulan

Waspada/Muhammad H. Ishak

TERANCAM PUTUS: Jembatan Blang Guci, Kec. Idi Tunong, Kab. Aceh Timur, terancam putus. Tampak seorang pengguna jalan ekstra hati-hati mendorong sepedamotor melintasi jembatan. Foto diambil baru-baru ini.

pihak kecamatan, jembatan tersebut telah dimasukkan dalam pembangunan dengan menggunakan Anggaran Pendapatan Belanja Aceh (APBA), namun hingga kini belum terealisasi sebagaimana keinginan masyarakat. “Kita benarkan pembangunan sudah mulai terlihat. Tapi setelah kedua ujung jembatan dibangun, hingga kini sudah setahun lebih tidak terlihat batang hidung pekerja disana,” kata M. Ali seraya menyebutkan, terlepas dari persoalan yang terjadi, tetapi masyarakat sangat mendambakan jembatan tersebut segera dibangun. “Jika tidak segera dibangun, maka puluhan desa dalam dua kecamatan di pedalaman Aceh Timur ini akan terkurung. Jika hal itu terjadi maka tidak tertutup kemungkinan jalur sungai dimanfaatkan untuk memasok logistik,” ujar M. Ali seraya meminta, Pemerintah Aceh dan Pemkab segera membangun jembatan tersebut. Bupati Aceh Timur, Muslim Hasballah melalui Camat Idi Tunong, Tgk. Sulaiman, S.Ag saat dikonfirmasi kemarin mengaku, pihaknya telah berulangkali menyampaikan kondisi jembatan Blang Guci ke pihak Pemkab dan Pemprov Aceh, agar segera dilakukan pembangunan baru. “Sebab kondisi jemnbatan ini sudah tidak memungkinkan lagi dilakukan rehab. Apalagi, jembatan ini juga tercatat satusatunya jembatan terpanjang di Aceh Timur,” ujar Tgk. Sulaiman seraya meminta, masyarakat bersabar dan percaya, bahwa jembatan tersebut tetap dibangun, namun menunggu keputusan di tingkat provinsi.(cmad)

Tiga Ranmor Terlibat Lakalantas 1 Kritis, 3 Luka-luka LHOKNIBONG, Aceh Timur (Waspada): Tiga kenderaan bermotor yakni sedan, Mopen Jumbo dan sepedamotor terlibat kecelakaan lalulintas (lakalantas) di jalan nasional, Desa Paya Demam Sa, Kec. Pante Bidari, Aceh Timur, Minggu (20/ 3) sekitar pukul 15:00. Insiden ini menyebabkan pengendara sepeda motor, Razali Ismail, 38, pedagang asal Desa Alue Mulieng, Kec. Simpang Ulim, Aceh Timur, kritis dan hingga kemarin masih dirawat di Rumah Sakit TNI-AD,

Lhokseumawe. Sementara tiga penumpang mopen menderita luka ringan. Keterangan dihimpun Waspada, sore itu sedan mewah BK 1854 HR yang disopiri Imam Zahari, 28, Mahasiswa warga Lamteumen Timur, Banda Aceh, dilaporkan melaju kencang dari arah Idi Rayeuk atau arah timur menuju arah Lhokseumawe. Setiba di Desa Paya Demam Sa, sedan tersebut menyenggol Supra X 125 BL 3637 QR yang dikendarai Razali Ismail, yang

melaju dari arah sama dan korban pun langsung terpelanting jatuh ke badan jalan. Pasca menubruk Razali, sopir sedan tidak berhenti. Dia tetap memacu mobilnya dan disebut-sebut berencana melarikan diri. Namun baru sekitar 1 Kilometer dari lokasi Razali terkapar, sedan itu kembali menyeruduk mobil penumpang (Mopen) jenis Jumbo, persis di tikungantajamDesaPayaDemam. Mopen jumbo BL 7582 NB yang melaju dari arah Lhokseumawe itu disopiri Anwar Efendi,

40, asal Gampong Teungoh Kota Langsa. Anwar sempat mengelak. Bahkan, mobilnya nyungsep ke parit jalan hingga 3 penumpangnya menderita luka ringan. Kapolres Aceh Timur, AKBP Drs Ridwan Usman, melalui Kasat Lantas Iptu Hangga Utama, membenarkan adanya kejadian lakalantas itu. “Untuk proses pemeriksaan lebih lanjut, ketiga ranmor tersebut kini sudah kita amankan di Pos Polantas—Kuta Binjei, Julok,”kata Iptu Hangga Utama.(cmus)

Demam Batu Akik Landa Lhokseumawe LHOKSEUMAWE (Waspada): Deman batu akik melanda Lhokseumawe, mereka memburu sendiri batu mulia itu di tempat-tempat yang terdapat tebaran batu. Selain jalan, pada saat usai hujan, baik orang tua ataupun muda, mereka sering berkeliaran di bukit-bukit yang terdapat banyak batuan, seperti di Alue Awe, Paya Punteut, Buket Panggoi, dan di mana saja terdapat galian C. “Untuk apa mencari di sungai, sudah banyak sekali orang yang memburu ke sana. Jauh-jauh pergi dan capek tidak dapat yang bagus. Kalau untung, di jalan pun bisa dapat batu yang unik,” kata Said Jaya kepada Waspada, Selasa (15/ 3) sambil menunjukkan batu cempaka merahnya yang bergaris hitam. Batu-batu di wilayah Lhokseumawe dikenal sebagai batu Pase, umumnya bagus dan memiliki khasiat bermacammacam. Karena keyakinan akan khasiat inilah, maka sejumlah penggemar batu cincin bermunculan, dan hampir di semua kedai kecamatan terdapat penjual dan pengrajin batu akik. Bahkan, sebagian batu mulia yang agak langka ini diminati oleh datok-dotok pejabat di Malaysia yang rela

mengeluarkan uang puluhan juta hanya untuk sebiji batu cincin. “Banyak sudah batu di sini yang dibeli orang Malaysia,” kata M Ali seorang pengrajin batu cincin di Samudra. Batu-batu akik ini bisa berharga sangat tinggi karena jenis dan kelangkaannya. Biasanya batu-batu yang lebih tua, keras, dan warnanya mengkilat akan bernilai tinggi. Batubatu tua dipercayai memiliki kekuatan pancaran aura atau magis lebih tinggi dibandingkan batu yang berumur muda. Umumnya, kebanyakan dari kaum lelaki memang memakai cincin bermata batu, dan kebanyakan dari mereka lebih puas mendapatkannya sendiri daripada membelinya ke pedagang batu. Maka sejumlah pengasah batu tidak henti-hentinya mendapat pesanan untuk mengasah. Sebagaimana diakui Ayi, perajin batu di Paloh, setiap harinya dia mendapatkan lima enam pelanggan yang memintanya untuk mengasah sampai dua puluh batu, dengan ongkos Rp10 ribu-Rp20 ribu per batu. “Kalau batunya sedang murah, tapi kalau besar ongkosnya harus ditambah,” ucap Ayi, yang lebih dikenal dengan sebutah The Stone Ayi.(b12)

BIREUEN (Waspada): Kepala Dinas Pendidikan, Pemuda, dan Olah Raga Kabupaten Bireuen, Drs. Asnawi, M.Pd mengatakan, perhatian masyarakat terhadap Pendidikan Agama Islam (PAI) terhadap anak relatif menurun sejak beberapa tahun terakhir. Demikian antara lain disampaikanya ketika mendampingi Ketua Majelis Pendidikan Daerah (MPD) Aceh, Prof. Dr. Warul Walidin, AK, MA, dan Kasi Supervisi Kanwil Kemenag Aceh, Drs. Abdul Hanafiah melakukan monitoring terhadap pelaksanaan Ujian Sekolah Berstandar Nasional (USBN) khusus pelajaran PAI di SMA Negeri 2 Bireuen, Senin (21/3). Karenanya, Asnawi mengajak semua komponen untuk menggalakkan kembali pengajian-pengajian di desa-desa yang sebelumnya pernah eksis di tengah-tengah masyarakat di Aceh. Menurutnya, pendidikan terhadap anak tidak hanya tanggungjawab pemerintah, namun juga harus mendapat dukungan sepenuhnya dari masyarakat, orangtua. “Kita harapkan pendidikan agama harus menjadi fokus landasan dalam membangun pendidikan,” tegas Asnawi seraya menyebutkan, pihaknya akan berkoordinasi dengan instansi terkait untuk mengwujudkan rencana tersebut. Dengan pelaksanaan ujian PAI dengan sistem USBN diharapkan para orangtua atau siswa lebih insentif lagi belajar pendidikan agama, khususnya bagi siswa yang beragama Islam, ucap Asnawi. Hal senada diucapkan Kabid Dikmenjur, Drs. M. Nasir, M.Pd. Dia menyebutkan, hasil ujian ini akan dijadikan bahan untuk melakukan penyesuaian kurikulum. “Apalagi di Bireuen sekarang sedang dilaksanakan pilot projek pendidikan karakter di delapan sekolah,” terang dia. Sebelumnya, Kasi Supervisi Kanwil Kemenag Aceh, Drs. Abdul Hanafiah menyebutkan, dengan USBN ini dapat diketahui sejauh mana PAI yang diajarkan di sekolah sudah memenuhi standar kompetensi. “Ada tiga aspek yang dinilai, yaitu koknitif, afektif, dan psikomotorik,” terangnya. Pada kesempatan yang sama Ketua Majelis Pendidikan Daerah (MPD) Aceh, Prof. Dr. Warul Walidin, AK, MA menyebutkan, pelaksanaan UNSB bidang studi PAI juga diikuti pelajar Aceh yang sedang berlatih sepakbola di Paraguay. Di mana, untuk memenuhi kebutuhan 30 pelajar yang sudah sempat berdomisili di Amaerika Latin itu, Pemerintah Aceh melalui dinas terkait telah mengirim soal ujian melalui kepada Duta Besar RI di sana untuk dilanjutkan kepada siswa.(cb03)

IPPAT Bantu Korban Banjir Tangse IDI, Aceh Timur (Waspada): Ikatan Pemuda Pelajar Aceh Timur (IPPAT) yang berkantor pusat di Banda Aceh, Minggu (20/3) petang menyerahkan bantuan kemanusiaan untuk korban banjir bandang di Tangse, Kab. Pidie. Bantuan berupa pakaian, termasuk kain sarung, dengan nilai total sekitar Rp10 juta itu diserahkan langsung oleh rombongan Ketua IPPAT, Aftahurriza, di tiga titik kamp pengungsian, yakni di Desa Ie Reu, Ranto Panyang dan Desa Blang Dalam, Kec. Tangse. “Bantuan ini merupakan hasil penggalangan dana dari para pelintas di bundaran Simpang V Banda Aceh, selama empat hari. Meski tidak seberapa, mudah-mudahan, bisa meringankan beban korban banjir Tangse,” harap Aftahurriza didampingi Sektaris Umum IPPAT, Bahagia Bachtiar Gade. Pada kesempatan itu, IPPAT juga meminta pemerintah Aceh meningkatkan kepedulian terhadap lingkungan, khususnya kelestarian hutan dan memberi ganjaran tegas kepada para pelaku illegal logging yang disinyalir sebagai salah satu pemicu utama banjir bandang di Tangse.(cmus)

Pemuda Subulussalam-Singkil Pertanyakan Kinerja Penegak Hukum BANDA ACEH (Waspada): Kalangan pemuda dan mahasiswa asal Subulussalam-Singkil di Banda Aceh, mempertanyakan kinerja penegakan hukum di dua wilayah itu, terkait makin maraknya kasus-kasus korupsi di daerah tersebut. Penegakan hukum lemah disebabkan aparatnya tak memiliki ketegasan dalam menuntaskan sejumlah kasus korupsi di wilayah itu. “Kondisi seperti ini berbahaya bila dibiarkan berlarut-larut,” ungkap kalangan mahasiswa yang tergabung dalam Aliansi Mahasiswa Peduli Subulussalam-Singkil (AMPESS) melalui jubirnya, Ardhiyanto, Jumat (18/3). Semakin banyaknya kasus-kasus korupsi, kata dia, menandakan lemahnya penegakan hukum di sana. Penegakan hukum tak mampu memberi efek jera, seperti contoh yang riil dalam menyelesaikan kasus-kasus korupsi yang membuat seluruh elemen masyarakat termasuk para pejabat ke dua daerah itu takut korupsi. “Kami menilai kelambanan dan ketidaktegasan penegak hukum dalam menyelesaikan kasus yang ada, membuat kalangan masyarakat kurang percaya penegak hukum di sana, sehingga korupsi di Subulussalam dan Singkil seperti dibiarkan begitu saja,” ungkap Ardhi. Kata dia, saat ini sulit mendapatkan kasus korupsi yang diselesaikan secara serius oleh penegak hukum di sana, baik polisi maupun kejaksaan, padahal kasus itu sudah lama ditangani. Namun dalam perjalanannya, kasus tersebut sesekali bagai hilang di telan bumi dan sewaktu-waktu booming kembali ke publik. Kasus-kasus yang belum terselesaikan hingga kini diantaranya kasus pengadaan pupuk di Kota Subulussalam yang merugikan negara lebih dari Rp1 miliar, kasus PNPM di Penanggalan yang kerugiannya Rp360 juta, serta kasus jembatan Penangkalan di Aceh Singkil kerugian senilai Rp141.839.087. “Kasus-kasus tersebut ada yang ditangani sejak tahun 2009 lalu, namun sampai sekarang baru pada tahapan penyelidikan dan tahapan penyempurnaan berkas-berkas saja. Ini kan terkesan lambat sekali dalam penanganannya,” ujarnya. Selain itu, AMPESS juga mempertanyakan mengenai kasuskasus lain, seperti dugaan mark up dalam pengadaan tanah pendopo Walikota Subulussalam yang beberapa waktu lalu juga telah diaudit BPKP Aceh, namun tak ada kabar lagi. (b07)

RUMAH DISEWAKAN Rumah type 54 di Setia Budi Vista Medan. Min. 2 thn. Fasilitas: Kolam Renang, Lap. Basket, Play Ground dll. Hub. 0813 61455015. Harga nego.

PASANG IKLAN MINI ACEH Hub: 0651-22385 0645-42109


WASPADA Selasa 22 Maret 2011

C3 ForPALA Bertekad Jadikan Pala Sebagai Komoditas Unggulan

Polisi Buru Komplotan Bersenjata Api LHOKSUKON, Aceh Utara (Waspada): Jajaran Polres Aceh Utara memburu komplotan kriminal bersenjata api di wilayah tersebut, termasuk pelaku penembak warga Norwegia di Meunasah Dayah Aron, Senin (14/3) dinihari dan perampok toke getah, di Cot Matahe, Geureudong Pase, Minggu (20/3) dinihari. “Bahkan sebagian petugas standby di lapangan demi mengungkap identitas dan keberadaan pelaku. Kita optimis, cepat atau lambat pelaku pasti tertangkap,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim AKP Erlin Tangjaya, Senin (21/3). Seperti diberitakan, sekelompok orang tak dikenal (OTK) menembak mati Hanafiah, 51, warga negara Norwegia asal Aceh, saat nonton tayangan sepakbola di warung kopi desa kelahirannya, Meunasah Dayah Aron, Kec. Syamtalira Aron, Kab. Aceh Utara, Senin (14/3) dinihari. Sepekan kemudian, tepatnya Minggu (20/3) dinihari, kejahatan bersenjata api kembali terjadi di wilayah hukum Polres Aceh Utara. Toke getah Satriadi alias Jiran, 34, asal Desa Alue Siwah Serdang, Kec. Nurussalam—Bagok, Kab. Aceh Timur dirampok OTK di Desa Cot Matahe, Kec. Geureudong Pase.(cmus)

BANDA ACEH (Waspada): Forum Pala Aceh (ForPALA) bertekat menjadikan pala sebagai komoditas unggulan di provinsi Aceh pada tahun 2015, sehingga petani tanaman keras itu bisa kembali berjaya seperti masa lampau. “Kami terus berupaya dorong petani mengembangkan kapasitasnya agar pala menjadi komoditas unggulan di Provinsi Aceh pada 2015,” kata Ketua ForPALA Mustafril di Banda Aceh, Minggu (20/3). Ia mengatakan, petani pala di Aceh, terutama di kawasan pesisir barat dan selatan, pernah merasakan masa kejayaan di era tahun 70-an hingga 90-an. Namun, kata dia, kejayaan tersebut perlahan-lahan terkikis seiring meningkatnya intensitas konflik bersenjata di Aceh di akhir tahun 90-an. Konflik tersebut menyebabkan petani pala menelantarkan tanamannya. “Kami berharap pala menjadi komoditas unggulan di Aceh. Karena itu, kami terus mendorong petani pala kembali bersemangat mengembangkan komoditi tersebut,”ujarnya. Menurut dia, bukan pekerjaan mudah membangkitkan semangat petani pala meraih kejayaannya kembali. Selain perlu restrukturisasi tanaman, juga butuh kerja keras. Kendati begitu, kata dia, ForPALA siap mendorong dan membantu para petani agar mereka benar-benar kembali fokus mengelola dan mengembangkan kebun-kebun pala yang pernah ditelantarkan. “Semuanya butuh proses. Tapi, kami yakin proses tersebut mampu dilalui para petani, khususnya di daerah yang pernah menjadi sentra seperti di Aceh Selatan, sehingga pala menjadi komoditas unggulan pada 2015,” katanya.(gto)

Petani Aceh Utara Butuh Benih Kelapa Sawit ACEH UTARA (Waspada): Puluhan hektar lahan milik koperasi perkebunan kelapa sawit di Geureudong, Aceh Utara yang sudah dibersihkan terlantar akibat tidak tersedia bibit. Petani mengharapkan pemerintah membantu menyediakan benih dan kebutuhan lainnya, sehingga lahan mereka tidak terlantar. Tokoh warga Geureudong Pase, Zulkifli Rasyid, Senin (21/3) mengatakan, sekitar, 108 ha lahan petani di Gampong Dayah Seupeng digarap petani kelapa sawit dari Koperasi Geureudong Jaya. “Tapi karena kekurangan bibit, hanya 70 ha baru ditanami,” jelasnya. Sisanya terancam terlantar. Geureudong Pase berada di kawasan pedalaman Aceh Utara. Kecamatan baru hasil pemekaran dengan Kec. Syamtalira Bayu tersebut dikenal sebagai sentral perkebunan warga. Selain kelapa sawit juga bayak terdapat kakao (coklat) dan karet di kawasan tersebut. Untuk meningkatkan kesejahteraan para petani, sejumlah warga telah membentuk koperasi. Anggota DPR Aceh DP Aceh Utara-Kota Lhokseumawe, Nuraini Maida menegaskan, dana yang telah disalurkan untuk petani kelapa sawit Geureudong Pase tahun lalu sabanyak Rp500 juta. “Tahun ini juga telah dianggarkan untuk membantu petani kelapa sawit,” jelas politisi Partai Golongan Karya ini. Bantuan dari Pemerintah Aceh ini juga akan disalurkan melalui koperasi.(b17)

300 Mahasiswa Donor Darah KOTA LHOKSEUMAWE (Waspada): Muhammad Nazar, Gubernur Dakwah di Sekolah Tinggi Agama Islam Negeri (STAIN) Malikussaleh Lhokseumawe, Senin (21/ 3) pagi mengatakan, DEMA Dakwah menggelar kegiatan donor darah di kawasan KP3 Lhokseumawe. Kegiatan ini dilaksanakan hasil kerjasama dengan KSR PMI unit 08. Selain dari para mahasiswa, peserta juga diundang dari kalangan PNS di berbagai instansi, TNI dan Polri, seluruh BEM di Aceh Utara dan Lhokseuamwe, serta masyarakat umum lainnya. Jumlah total pendonor 300-an orang. Kata M. Nazar, kegiatan donor darah dilaksanakan untuk memenuhi kekurangan darah di Aceh Utara dan Kota Lhokseumawe. “Informasi yang kita peroleh dari media massa, Aceh Utara dan Kota Lhokseumawe sedang mengalami kekurangan darah. Karena itu kita berinisiatif menggelar acara ini. Darah hasil donor masyarakat kita sumbang ke PMI Aceh Utara di Lhokseumawe. Semoga kekurangan darah dapat teratasi,” kata Muhammad Nazar. Menjawab Waspada, untuk mensuksekan acara ini, dana diperoleh dari berbagai sumber, begitu pun, panitia tidak mendapat dukungan dana dari Pemerintah Kota Lhokseumawe dan Aceh Utara. (cmun)

Waspada/M Jakfar Achmad

LAKALANTAS: Kondisi bus BE yang mengalami kecelakaan di jurang Gunung Seulawah, Minggu (20/3).

Bus BE Masuk Jurang 1 Tewas 26 Luka-luka ACEH BESAR (Waspada): Bus BE masuk jurang di Gunung Seulawah, satu orang tewas dan 26 lainnya luka berat dan ringan. Nuraini, 50, warga Gampong (Desa) Babah Lueng, Kec. Kuta Makmur, Aceh Utara, korban tewas dalam kecelakaan lalulintas yang terjadi Minggu (20/3) pukul 04:00 dinihari. Penumpang lainnya menderita patah tulang, luka parah dan ringan, kini dirawat di Rumah Sakit Umum Daerah Zainal Abidin (RSUDZA) Banda Aceh. M Ali AR, 40, adik kandung Nuraini menjelaskan kepada Waspada di Tempat Kejadian Perkara (TKP), bus BE BL 7619 Z yang dikemudikan Sulaiman, 38, warga Kec. Syamtalira Bayu, Aceh Utara membawa sejumlah 27 penumpang berangkat dari Lhokseumawe ke Darussalam Banda Aceh, untuk takziah di rumah duka abang Nuraini. Entah bagaimana, kata M. Ali, setiba di lokasi atau di kawasan jembatan kembar Seuneupet, Kec. Leumbah Seulawah, bus hilang kendali hingga meluncur jungkir balik ke jurang. Kasusnya ditangani unit lantas Leumbah Seulawah. (b10)

Tangse Masih Tanggap Darurat Waspada/Iskandarsyah

LOMBA MENEMBAK: Memeriahkan Pekan Kedirgantaraan Tahun 2011, Lanud Iskandar Muda Blang Bintang, Aceh Besar menggelar berbagai kegiatan di antaranya kejuaraan road race, pameran, festival band dan pasar malam. Salah satu kegiatan yang digelar dan paling diminati pengunjung adalah lomba menembak menggunakan senjata airsoft gun. Tampak Wakil Gubernur Aceh H Muhammad Nazar di dampingi Danlanud SIM Kolonel Pnb. Maman Suherman mencoba senjata airsoft gun jenis MP-4 dan senjata Sniper jenis SPR, di Hanggar Lanud SIM Blang Bintang, Aceh Besar, Minggu (20/3).

Pemerintah Janji Bangun Rumah Korban Banjir BANDA ACEH (Waspada): Pemerintah pusat melalui Menkokesra berjanji akan membangun rumah bagi korban banjir bandang di Kec. Tangse, Kab. Pidie. Pembangunan rumah tersebut bertujuan agar para korban mendapatkan tempat tinggal yang layak. Niat pemerintah pusat membangun rumah untuk para korban banjir bandang itu disampaikan Menkokesra Agung Laksono sebagaimana dikutip Wakil Gubernur Aceh H Muhammad Nazar seusai

menutup Agribisnis Fair VII di Taman Budaya Banda Aceh, Minggu (20/3) malam. “Pemerintah pusat melalui Menkokesra telah menyatakan untuk membantu pembangunan rumah bagi korban banjir bandang Tangse,” kata H. Muhammad Nazar seraya menambahkan, kepastian mengenai pembangunan rumah untuk para korban banjir tersebut diperoleh beberapa hari lalu, setelah dirinya melaporkan kerugian yang dialami warga dalam musibah yang terjadi 10 Maret itu. Dikatakan yang dibangun pemerintah nanti diperuntukkan kepada keluarga yang kini tinggal di pengungsian atau di rumah sanak-saudaranya. “Rumah itu juga diharapkan dapat mengembalikan privasi

Majelis Hakim Pertimbangkan Sebagian Pembelaan M. Ali BIREUEN (Waspada): Majelis hakim mengambil sikap mempertimbangkan sebagian pembelaan tersangka M. Ali M. Amin yang didakwa dengan pasal penggelapan dan penipuan oleh Jaksa, dan sebagian lainnya ditolak. Pasalnya, kasus itu dinilai ada benarnya sebagaimana disampaikan terdakwa melalui pengacara Hendri Ramadhani, SH, dan ada juga yang masih menjadi pertimbangan. Apalagi telah mencuat informasi di masyarakat bahwa kasus tersebut kemungkinan besar merupakan rekayasa oknum polisi yang memaksakan persoalan perdata menjadi pidana. Bahkan diduga merupakan suruhan dari oknum lain untuk kepentingan politik hingga berbuntut sampai persidangan. Sidang di Pengadilan Negeri (PN) Bireuen Senin (21/3) ini, dipimpin Ketua Majelis Hakim Said Hasan, didampingi anggota Hakim Safri, SH dan Zulkarnain, SH. Menurut majelis hakim, sebagian dari eksepsi terdakwa akan dipertimbangkan sementara sebagian lagi ditolak.

Karena menurut hakim, apa yang disampaikan terdakwa ada benarnya. Di antaranya seperti sudah didamaikan namun proses hukumnya masih dilanjutkan, Tapi hakim menolak bila dikatakan tidak berhak mengadili perkara itu. Selanjutnya, kata hakim, kasus ini ada kaitannya dengan masalah politis karena ada pihak yang bermain. Ini akan menjadi pertimbangan hakim atau akan ditelaah lebih jauh. Rekayasa Hendry Rachmadani, SH selaku pengacara M. Ali juga memaparkan sejumlah tindakan kriminal yang dilakukan sejumlah sipil yang memiliki beking. Kasus ini sudah dilaporkan ke polisi tapi tidak ditindaklanjuti. Usai sidang, kuasa hukum Hendri Ramadhani kepada wartawan mengatakan, kasus yang menjerat M. Ali setidaknya mulai diketahui dan merasakan kebenaran yang sebenarnya. Bahwa itu penuh rekayasa pihak-pihak tertentu dalam memuluskan politiknya untuk menjegal M. Ali pada saat masih memimpin DPC Partai Demokrat Bireuen, bekerjasama dengan

UPAYA pemerintah menghadirkan industri di Kab. Bireuen seakan jalan di tempat, alias mandeg. Banyak anggaran dikucurkan,namunhinggakinidenyutnadi berbagai industri itu tak juga bergetar.

Seperti industri biodiesel di Desa Bunyoet Kec. Juli yang pada 2009 dimodifikasi menjadi Bioindustri, tapi hingga kini peralatannya menjadi ‘besi tua’. Pabrik bioindustri ini tak juga beroperasi.

Berangkat (flight, tujuan, waktu)

GA 146 Jakarta/Medan


GA 147 Medan/Jakarta


Y6 537 Medan


Y6 538 Medan


JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


AK 305 Kuala Lumpur *


AK 306 Kuala Lumpur*


FY 3401 Penang **


FY3400 Penang **


Batavia Air Lion Air

Sriwijaya Air Air Asia Fire Fly

* Setiap Senin, Rabu , Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

oknum polisi. “Kasus ini sudah diketahui publik, bahkan masalah ini sudah kami laporkan ke Mabes Polri, termasuk telah diketahui anggota DPR RI Komisi III adanya unsur permainan pihak-pihak tertentu,” katanya. Menurut Hendri, pihaknya tidak akan tinggal diam dan akan mengungkapkan fakta lain supaya kasus ini terungkap kebenarannya. “Saya juga sudah menyurati beberapa elemen lainnya, bahkan Komnas HAM. Kemunkinan mereka juga akan turun. Mudah-mudahan tidak menjadi bumerang bagi yang merekayasa kasus ini,” pungkasnya. Sementara M. Ali secera terpisah mengatakan keberatan dituntut dengan hukum pidana karena kasus ini mutlak perdata. Ali juga menyatakan dia tidak bermaksud merusak nama baik polisi, namun malah membantu menegakkan kredibilitas polisi. Tindakan sejumlah oknum polisi ini yang sebenarnya hendak merusak nama baik polisi. Majelis hakim melanjutkan sidang pada Kamis (24/3).(b15/amh)

Waspada / H. Rusli Ismail

BANTUAN PWI: Ketua Persatuan Wartawan Indonesia (PWI) Cabang Aceh, Tarmilin Usman (kiri) didampingi Wakil Ketua Bidang Kesra PWI Aceh, Drs. H. T. Anwar Ibrahim (satu dari kanan) menyerahkan bantuan korban banjir bandang Tangse diterima Sekdakab Pidie, M. Iriawan, SE (dua dari kanan), Minggu (20/3).

Membangun Industri Di Bireuen Ibarat Menegakkan Benang Basah?

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

dari sebuah keluarga dan menghidupkan kembali perekonomian warga yang terkena banjir bandang. Jadi, rumahrumah tersebut dibangun sebagai upaya untuk meringankan beban korban banjir bandang,” ujarnya. Menurut Wakil Gubernur Aceh, selain rumah pemerintah pusat juga akan membantu memperbaiki infrastrukltur seperti jalan, jembatan, irigasi, area persawahan yang hancur terkena banjir bandang. “ Pemerintah pusat dan daerah terus berupaya membangun kembali sarana yang dibutuhkan oleh masyarakat agar dapat segera bangkit dari keterpurukan,” sambungnya.(b09)

TANGSE, PIDIE (Waspada): Pemkab Pidie masih menetapkan status operasi tanggap darurat banjir bandang Tangse Kab. Pidie hingga 3 April mendatang. “Kita mengusulkan masa tanggap darurat diperpanjang hingga 3 April 2011, karena belum sepenuhnya tertangani dengan baik,” kata M. Iriawan, SE. Ketua Posko Induk Pengendalian Penanggulangan Bencana Banjir Bandang Tangse yang tak lain juga Sekdakab Pidie, M. Iriawan, SE, Minggu (20/3) menyatakan, penanganan para korban baru tertanggulangi sekira 60 persen, sehingga masih dibutuhkan waktu beberapa hari lagi. “Seharusnya masa tanggap darurat tahap pertama selesai Senin (21/3). Tapi hingga saat ini pemulihan belum tertangani secara maksimal, “ katanya usai menerima sejumlah bantuan pakaian dari PersatuanWartawan Indonesia (PWI) Cabang Prov. Aceh dan Lembaga Dakwah Islam Indonesia (LDII) Aceh. Dikatakan, setelah masa tanggap darurat berakhir baru dilakukan pendataan tentang kerusakan dan kerugian untuk rehab rekon. Musibah yang melanda 12 desa di Kec. Tangse itu mengakibatkan 12 warga meninggal dunia dan sekira 600 rumah penduduk rusak. Juga mengakibatkan infrastruktur seperti jembatan, jalan, dan fasilitas kesehatan rusak berat. Banjir bandang juga mengakibatkan rusaknya lahan pertanian sawah seluas 200 ha dan jaringan irigasi. Menyinggung logistik, Iriawan menyatakan cukup untuk seminggu ke depan. Warga yang masih mengungsi sekira 5.000 jiwa, sudah ada yang kembali ke rumah masingmasing. Serahkan Bantuan Sementara itu, pada hari yang sama Ketua PWI Cabang Aceh, Tarmilin Usman, SE, M. Si dan Ketua LDII Aceh, Tgk. H. Burhan menyerahkan bantuan secara simbolis diterima Sekdakab Pidie, M. Iriawan, SE. Tarmilin Usman didampingi Wakil Ketua Bidang Kesra PWI Aceh, Drs. H. T. Anwar Ibrahim menyatakan, mudah-mudahan bantuan yang berasal dari sumbangan anggota PWI dan warga LDII itu bisa bermanfaat bagi para korban PWI Aceh membuka Posko Peduli Tangse sampai 14 April 2011. “Jadi masyarakat, organisasi yang ingin membantu melalui PWI dipersilahkan menyalurkan ke Kantor PWI Aceh di Simpang Limong, Banda Aceh, “ kata Tarmilin. PT Pertamina Sementara PT. Pertamina (Persero) melalui Pertamina Peduli menyerahkan sejumlah bantuan dalam bentuk barang dengan total nilai Rp50 juta, meliputi sembako dan bahan makanan serta perlengkapan kebutuhan mendasar bagi para korban banjir, Minggu (20/3) sore. Asisten Community Development External Relation PT. Pertamina Pemasaran Regional I, Sudarman, usai menyerahkan bantuan diterima M. Iriawan mengatakan, Pertamina peduli setiap bencana alam yang terjadi di Indonesia, termasuk Tangse. Diharapkan bantuan ini bisa dirasakan para korban.(b21/b04)


Seorang warga memperhatikan perlatan Bioindustri yang belum beroperasi di Desa Bunyot Kec. Juli, Bireuen belum lama ini.

Dilaporkan, industri ini tidak dapat beroperasi karena bahan baku (buah jarak) dan peralatan belum lengkap. “Jenis pohon jarak yang ditanam bukan yang bagus, artinya benih yang tidak bersertifikat,” ucap seorang warga. Begitu juga pabrik susu kedelai di Kec. Peudada, terbengkalai. Sedangkan pabrik Garment di kawasan Desa Buket Teukuh Kec. Kota Juang, sempat menghasilkan produk namun akhirnya ‘gulung tikar’. Markas Koperasi Pabrik Garmen Aceh (KPGA) bantuan GTZ Jerman itu, akhirnya jadi Kantor Dinas Kelautan dan Perikanan. Hal sama terjadi pada investasi di sektor perkebunan sawit oleh pengusaha asal Malaysia di Desa Pulo Harapan, Kec. Peusangan Selatan, di mana pengusaha itu pun akhirnya hengkang. Dikabarkan, pihak Eplore Reliance Plantation. Sdn. Bhd ogah melanjutkan investasi karena lahan yang tersedia tidak jelas statusnya. Pasalnya, dari 9.000 ha lahan yang direncanakan, 5.000 ha di antaranya masuk kawasan hutan produksi yang tidak dibenarkan dibuka lahan perkebunan. Lain lagi kebijakan Pemkab Bireuen yang menetapkan Batee Geulungku masuk wilayah Kec. Pandrah dan Kec. Simpang Mamplam se-bagai Kawasan Industri Bireuen (KIB), di mana

pemerintah mengucurkan anggaran. Tapi sampai sekarang belum ada tanda-tanda akan ada industri di KIB. Kepala Dinas Perindustrian, Perdagangan, Koperasi dan UKM melalui Kabid Industri, Muhammad, ST kepadaWaspada, Senin (21/3) mengungkapkan, terhambatnya produksi pabrik bioindustri ini karena peralatan belum lengkap. Pada 2009, dengan dana Otsus, pabrik Biodiesel dimodifikasi untuk menjadi Bioindustri dengan anggaran Rp2.948.900. 000, dan biaya perencanaan Rp49 juta bersumber dari dana Otsus, di mana modifikasinya dilaksanakan perusahaan asal Banda Aceh. “Tapi sampai sekarang tak juga siap,” terang Muhammad. Melihat gelagat yang tidak baik tersebut, Asnawi Hasan, SE, (sebelum dimutasi) atas nama Kepala Kepala Dinas Perindustrian, Perdagangan, Koperasi dan UKM Bireuen mempertanyakan kelanjutan modifikasi mela-lui surat 7 Januari 2011 kepada reka-nan pelaksana. Namun, kata Muhammad,

reka-nan tidak menggubris, sehingga pada 1 Maret 2011, dinas kembali mela-yangkan surat mempertanyakan hal yang sama. Di mana pada surat ke-dua posisi kepala dinas dijabat Drs. IskandarYusuf,MM menggantikan Asnawi Hasan. Anehnya, kendati pekerjaan belum rampung tapi rekanan pelaksana telah ‘menggondol’ habis anggaran yang disediakan pemerintah. “Saat itu mendesak penarikannya karena akan mati anggaran,” ucap Muhammad. Terkait pabrik pengolahan susu kedelai di Kec. Peudada, Muhammad mengatakan belum diserahkan Pemerintah Aceh ke Pemkab Bireuen. Sedangkan menyangkut KPGA, Muhammad mengaku tidak tahu. Salah satu faktor terhambatnya pembangunan sektor industri di Kab. Bireuen, kataya, karena tidak tersedianya SDM memadai. “Kalau kita mau melakukan pelatihan, tidak didukung anggaran,” jelas Muhammad. Terlepas dari hal tersebut, tidaklah berlebihan, jika masyarakat berharap, ‘kegagalan’ ini menjadi cambuk untuk pemerintah guna berbenah diri di masa mendatang. -Amiruddin



Libya Korban Kejahatan Zionis Global


iliter Amerika Serikat (AS) bersama sekutunya Inggris, Perancis dll melancarkan serangan rudal membombardir sejumlah sasaran di Tripoli, ibukota Libya, menewaskan puluhan orang dan ratusan penduduk sipil tak berdosa. Sekutu mengklaim sasarannya lokasi-lokasi militer Libya, namun jatuhnya korban di pihak sipil tak dapat dielekkan membuat dunia Islam terperanjat, menangisi tragedi kemanusiaan terkutuk itu. Kondisi yang terjadi kemarin sungguh memprihatinkan dunia internasional, khususnya umat Islam. Masalahnya, AS dan sekutunya melakukan penyerangan dengan pesawat tempur canggih untuk melumpuhkan kamp militer Libya yang sebelumnya juga berupaya mengerahkan pesawat tempur menghajar sasaran para pemberontak di kawasan Libya timur, seperti Benghazi dll. PBB memang sudah membuat resolusi yang menetapkan zona larangan terbang guna mendukung upaya pemberontak menggulingkan pemimpin Libya Moammar Khadafi. Dari yang tersurat, tujuannya untuk melindungi rakyat Libya dari gempuran pesawat tempur Sekutu. Namun, hal itu bisa dinilai sekadar basa-basi karena faktanya, pesawat Sekutu pun melancarkan serangan membabi-buba sehingga sasarannya juga rakyat sipil Libya. Semakin banyak saja rakyat Libya menjadi korban (tewas) sejak terjadi aksi demonstrasi menentang Khadafi, beranjut pemberontakan hebat di sejumlah wilayah penghasil minyak itu, sampai akhirnya PBB dan AS beserta sekutunya campur tangan. Lantas, apa bedanya pesawat tempur Libya memerangi ‘pemberontak’ (anti-Khadafi) dengan pesawat serangan pihak AS dan sekutu yang juga menimbulkan begitu banyak korban di pihak rakyat sipil tak berdosa? Tetap saja korban mayoritas rakyat sipil di sana. Kalau Sekjen Liga Arab Amr Moussa menyesalkan tindakan militer ASdan sekutunya yang secara membabi-buta melakukan pengeboman terhadap warga sipil di Libya, hal itu sangat tepat. Tapi, yang diperlukan oleh negara-negara Arab, khususnya rakyat Libya adalah segera dilakukan upaya perdamaian secara menyeluruh di Libya dengan mengedepankan hak-hak rakyat sipil. Artinya, negara-negara Arab harus bersatu Intisari memperjuangkan kedaulatannya dari campur tangan asing. Jangan seperti ini, Liga Arab tak ubahnya ‘’macan Campur tangan Zionis selama ompong’’ karena dapat dipecah, bahkan Global menggulingkan membantu pasukan AS dan sekutu. Campur tangan AS dan sekutunya Khadafi berujung jatuhLibya bukan baru kali ini saja. nya banyak korban sipil terhadap Sudah banyak negara berdaulat yang tak berdosa. menjadi korban tindak semena-mena atau perlakuan agresi Sekutu terhadapn negaranegara yang dianggap tidak mau tunduk di bawah ketiak Sekutu. Peristiwa perak Irak misalnya, kelihatan sekali kalau Sekutu ingin menjatuhkan Saddam Hussein dan menempatkan pemerintahan baru Irak sebagai boneka AS dan sekutu sehingga mudah diintervensi dalam bidang apa saja, apakah politik, ekonomi, hukum, sosial, budaya dll. Tak pelak lagi, seperti halnya Irak dan banyak negara lainnya yang sudah menjadi korban, maka Libya pun menjadi korban dari skenario kejahatan atau penjajahan model baru dari yang namanya Zionis Global. Kalau Irak dituduh sebagai negara yang menyimpan peluru nuklir dan senjata kimia massal, tapi faktanya semua tuduhan itu omong kosong. Ujung-ujungnya AS dan sekutunya mengincar ladangladang minyak Irak yang menghasilkan begitu banyak dolar. Dalam konteks Libya pun sama saja. Ladang minyak Libya yang begitu besar—produknya setingkat di bawah Arab Saudi— menjadi target sasaran Barat (Zionis Global). Jadi, apa yang terjadi sekarang, di mana PBB menerapkan sanksi zona larangan terbang dan AS bersama sekutunya langsung melepaskan seratus rudal Tomahawk lewat armada kapal perang dan pesawat tempurnya, menurut analisis para pengamat merupakan trik untuk menggantikan pemerintahan Khadafi yang sudah berkuasa empat dasawarsa lebih. Tak pelak lagi, tujuan memberlakukan zona larangan terbang hanya jalan masuk untuk bisa menaklukkan Khadafi dan akhirnya menguasai ladang-ladang minyak Libya. Saatnya, negara-negara Arab menyadari skenario busuk berupa kejahatan perang yang dirancang Zionis Global (AS dan sekutunya). Mereka tidak pernah senang dengan kemajuan dan kemakmuran yang dicapai negara-negara Arab, khususnya berpenduduk muslim. Mereka dengan mudah menggerakkan nafsu setannya untuk melakukan intervensi guna mengguncang rezim di negara-negara Arab yang sudah puluhan tahun berkuasa sehingga terjadilah aksi protes dan demo akibat kemunduran dalam demokrasi. Ujung-ujungnya, semua negara Arab, termasuk Arab Saudi pada suatu saat nanti— sekalipun selama ini terlihat ‘’adem ayem’’ akan terjadi pergolakan serupa. Zionis Global yang dipimpin AS selalu mengampanyekan perlunya demokrasi dan perlindungan hak-hak warga sipil, namun dilakukan dengan cara-cara yang tidak demokratis, yaitu menggunakan cara-cara mematikan, seperti terjadi di Libya sekarang ini. Sejumlah pengeboman dilakukan dengan target sasaran militer walaupun faktanya warga sipil paling banyak menjadi korban kejahatan Zionis Global. Korban sipil akan semakin parah mengerikan jika Khadafi nekat menjadikan rakyat tak berdosa sebagai tameng atau perisai hidup dengan mempersenjatai mereka melawan pasukan biadab, koalisi AS dan sekutunya, atau identik dengan kumpulan ‘monster’ bernama Zionis Global.+


Faks 061 4510025

Face Book username: smswaspada

+6285275709700 Selama rumah-rumah makan membuang sisa-sisa nasi kepada pemulung,maka kandang-kandang BABI akan kian semakin subur.., dari itu janganlah buang nasi kepada pemulung. Trims WASPADA +6287868625663 Pak Walikota Medan, cepatkanlah cairkan dana untuk PSMS Medan. Pemain pada semangat semua menuju ISL. Dan segeralah renovasi stadion Teladan Mohon dimaklumi. +628126534154 Yth. Kadis PU Sumut. Dan Bupati Simalungun. Tolong perhatikan jalan kami di Serbelawan. Yang Aspalnya sudah terlapisi oleh pasir sehingga setiap kenderaan yang lewat menyebabkan debu. Saya jamin masyarakat Serbelawan banyak yang sakit TBC. Kami sakit ini tanggung jawab dinas PU. Trims Waspada. +6285276505260 Saya setuju apabila Gatot Pudjonugroho menjadi Gubernur Sumatera Utara karena beliau pemimpin yang tampan, kharismatik, berjiwa anti korupsi, dermawan dan tegas. Gatot Pudjonugroho adalah pemimpin Sumatera Utara yang pantas dan tepat untuk didukung. +6281396622989 Yth. Bpk Bupati, di desa kami PURWODADI SUNGGAL DELI SERDANG kok bisa pegawai kantor kepala desa, abangnya inisial JS berhenti digantikan dengan adiknya inisial P. Kami warga AMAT SANGAT KECEWA, KKN sudah pasti terjadi dan SEKDES memperkaya diri melalui pungli terhadap pabrik2 yang ada didesa kami. Trims. +6285260048430 Ass. Wrwb. Saya karyawan PTPN 1 Kbn Uj. Lamie. Ingin menyampaikan keluhan kami, tentang pembayaran transport TBS bulan Agustus 2009 yang sampai sekarang belum juga ada dibayarkan. Kejadiannya pada bulan Agustus 2009 itu masa peralihan dari PT BPI KSO PTPN 1. Memang seharusnya pembayaran tersebut ditanggung PT BPI selaku KSO dengan PTPN 1. Tapi mengapa pihak PTPN 1 tidak ada (belum ada niat) membayarkan upah tersebut. Kami sebagai karyawan sangat mengharapkan pembayaran yang tertunda tersebut. ( PENGUSAHA TRANSPORT TBS KBN UJUNG LAMIE). +6281361371593 Sebagai pendukung ketika kampanye sampai terpilih men jadi Wagub Sumut, dan sekarang sudah resmi men jadi gubernur, saya mohon pada Mas Gatot, jalankan amanah Allah dengan benar, saya selalu mendo’akanmu.

WASPADA Selasa 22 Maret 2011

Rahmat Bagi Umat Manusia & Bumi Oleh Bachtiar Hassan Miraza Kegiatan ekonomi di Makkah dan Madinah hidup 24 jam perhari dan tujuh hari dalam seminggu. Itu berarti tak satu detikpun kegiatan ekonomi terhenti di sana


agi umat Muslim yang pernah melaksanakan ibadah haji atau umroh ke tanah suci Makkah dan Madinah pastilah mendapatkan bukti bahwa diturunkannya Muhammad sebagai Rasul ke bumi ini merupakan rahmat bagi sekalian umat manusia. Sebagai seorang ekono, penulis melihatnya dari sudut kemampuan tanah suci menggerakan ekonomi di atas bumi ini, baik pada negara Islam maupun non Islam, yang memberikan rahmat bagi kehidupan manusia. Kegiatan ekonomi tanah suci mampu menggerakan kegiatan ekonomi di berbagai wilayah diatas bumi ini. Dengan demikian kegiatan ekonomi tanah suci mampu menciptakan kesempatan kerja dan pendapatan bagi masyarakat, mampu menggerakan pertumbuhan ekonomi bagi menciptakan barang dan jasa, mampu mendorong penggunaan sumberdaya alam dan sumberdaya manusia dan mampu memajukan peradaban manusia di wilayah lainnya. Tanah suci merupakan pusat pertumbuhan ekonomi dunia. Di tanah suci semua kebutuhan barang dapat ditemukan sepanjang memenuhi persyaratan halal. Barang konsumsi dan barang modal yang ditemukan berasal dari produk negara luar. Produk negara negara Eropa, Jepang, China, Amerika, Asia dan Afrika ada di sini. Produk yang tersedia berasal dari industri besar yang mempergunakan tekonologi tinggi sampai kepada barang yang dihasilkan oleh rakyat jelata, yang di Indonesia disebut dengan usaha kecil dan mikro. Dari sinilah kita melihat gerak ekonomi tanah suci menggerakan ekonomi daerah lain. Kegiatan ritual Islam di tanah suci mampu menggerakan ekonomi negara lain dan mampu mensejahteraan masyarakat negara lain. Teknologi (science and tecnology) tinggi demikian pula. Bahkan dengan teknologi tinggi tanah suci dibangun, gunung batu diubah menjadi pusat perkotaan dan tempat pemukiman, fasilitas publik (public utilities) diciptakan bagi memudahkan siapa saja yang berkunjung ke sana. Islam berkembang

didorong oleh pemanfaatan teknologi dan sumberdaya manusia yang maju. Tanpa teknologi tinggi rasanya tak mungkin kota suci Makkah dan Madinah dapat dibangun seperti keadaannya saat ini. MakkahdanMadinahadalahduakota suci yang moderen dan bersifat dinamis. Kedua kota menggiring wilayah lainnya dibumiiniuntukmenggerakanperekonomian di wilayahnya masing masing. Disinilah bedanya dengan kota ke agamaan lainnya yang pada dasarnyabersifatstatishanya bagi kemegahan ritual keagamaannya saja. Secaratidak langsung kedua kota mempengaruhi gerak pembangunan wilayahyang mempunyai hubungan ekonomi dengan Makkah dan Madinah. Sepertinya kedua kota ini dibangun bukan untuk kota itu sendiri tetapi bagi mendorong pembangunan wilayah lainnya diatas bumi ini. Kedua kota ini sebagai pusat kegiatan keagamaan umat muslim sekaligus menjalankan fungsi memajukan peradaban manusia. Awal yang terlihat adalah bagaimana tanah suci hidup sepanjang tahun tanpa henti. Kegiatan ekonomi di Makkah dan Madinah hidup 24 jam perhari dan tujuh hari dalam seminggu. Itu berarti tak satu detikpun kegiatan ekonomi terhenti di sana. Untuk itu pulalah barangkali mengapa pemerintah Arab Saudi perlu menetapkan waktu tersendiri (waktu Makkah) seperti GMT untuk waktu internasional, dengan membangun jam besar dipuncak sebuah gedung tinggi yang dapat terlihat dari mana saja walau kita sedang berada di pelataran Ka’bah sekalipun. Kehidupan ini menuju pada suatu perubahan besar dilihat dari pertumbuhan fisik dan aktifitas ekonomi wila-

yah tanah suci. Kita tidak akan pernah melihat penampilan Makkah dan Madinah sama seperti tahun lalu andaikata kita berkunjung pada tahun ini. Demikian juga penampilan Makkah dan Madinah tahun ini tidak akan sama dengan tahun depan seandainya tahun depan kita berkunjung lagi kesana. Tak pernah terjadi kegiatan yang terhenti, sebagai pertanda begitu dinamisnya aktifitas manusia dan gerak pertumbuhan ekonomi. Mengubah gunung batu bagi perluasan sebuah kota bukan hal yang luar biasa bagi kota Makkah. Dan ini terus berlangsung sepanjang jaman. Wilayah ini terus berkembang sebagai pertanda kegiatan ekonomi akan berjalan cepat mengiringi kemajuan ekonomi dan kesholehanumatmuslimyangterusmeningkatkepadaAllahSWT.Memangsemuanya diawali dan dilandasi oleh kegiatan keagamaan. Kota tidak hanya d i i s i dengan pembangunan hotel pencakar langit tapi disertai dengan jalan dan transportasi kotayangmaju sertatersedianya listrik, air bersih dan rumah sakit yang berkelas. Kota MakkahdanMadinah adalah kota pusat kegiatan Islam yang moderen yang mempunyai pengaruh besar bagi pertumbuhan ekonomi negara lain. Demikian juga halnya dengan pembangunan yang terjadi di Madinah. Makkah dan Madinah sepertinya kota kembar yang pembangunannya berjalan seiring. Kitapun bisa mendapatkan barang kebutuhan apa saja pada saat kapan saja. Masjid Nabawi pun tidak lagi mempergunakan sistim tutup buka. Masjid dimana bersemayam Rasul dan dua sahabatnya Abubakar dan Umar sudah dibuka selama 24 jam setiap hari sehingga setiap jamaah yang berkunjung ke Madinah bisa berziarah ke makam Rasul dan kedua sahabatnya itu serta sholat di Rhaudah secara lebih mudah di tengah malam. Ditengah malam kita menemukan manusia lalu lalang dengan kegiatannya masing masing apakah beribadah atau berdagang. Bus bus besar juga lalu lalang membawa jamaah

yang baru tiba dari Jeddah. Kita tidak mendapatkan kota ini lepas dari aktifitas manusia. Masjid Nabawi yang begitu luas dengan kebersihan yang terjaga dan berhawa sejuk serta memiliki aroma yang khas (wangi) membangun jiwa setiap jamaah ingin kembali berkunjung ke makam Rasul dan kedua sahabatnya dan melaksanakan ibadah sebanyak banyaknya. Namun disini (Madinah dan Makkah) setiap jamaah masih diuji keimanannya. Maukah ia merebut berkah dan rahmat yang besar itu atau tidak. Keimanan dan kondisi kesehatan jamaah sangat menentukan. Disini berlaku sistim rewards and punishment. Artinya siapa yang bekerja keras tentu akan mendapatkan rahmat dan berkah yang besar dan sebaliknya. Begitulah Islam mengarahkan umatnya. Islam mendorong umatnya untuk bekerja keras. Islam memberikan status yang sama bagi semua umatnya tapi tidak dalam keimanan yang dimiliki. Semua yang diuraikan diatas sebenarnya tidak terlepas dari tangan seorang perencana ekonomi dunia yang berupaya menghubungkan fungsi kota Makkah dan Madinah. Ia adalah Muhammad SAW, yang diangkat Allah sebagai Rasul, penyelamat dan pemberi rahmat bagi semua umat manusia. Sulit ditemukan jamaah yang tidak mengeluarkan air mata saat menziarahi makam beliau dan memberikan pengakuan sebagai pengikutnya. Begitu dalam makna seorang Rasul pada sanubari seorang muslim. Ini pulalah yang menyebabkan semakin banyaknya umat Islam ingin mendapatkan ridho Allah SWT agar bisa berkunjung kesana. Dari kunjungan inilah kota Makkah dan Madinah menjadi kota ”pasar dunia” yang menggerakan ekonomi dunia. Disini ditemukan umat muslim dari berbagai belahan bumi, ditemukan berbagai barang produk antar negara, ditemukan berbagai tenaga kerja dari berbagai penjuru dunia, ditemukan hampir semua mata uang negara di dunia dan lain sebagainya. Kita tidak tahu apa yang akan terjadi pada satu abad mendatang. Kita serahkan pada Allah SWT sebagai penguasa bumi ini karena semua itu adalah tanda tanda kebesaran Nya. Selamat tinggal kota suci Makkah dan Madinah dan semoga Allah SWT memberikan undangannya kembali pada masa mendatang. Amin. Penulis adalah Pemerhati Ekonomi

Stabilisasi Harga & Pemerataan Ekonomi Oleh Coki Ahmad Syahwier

Peran BI Sebenarnya, kebijakan mengendalikan harga sesungguhnya sudah menjadi domain utama Bank Indonesia (BI). Namun peranan BI dalam mengendalikan harga-harga masih sangat terbatas. BI hanya bisa memengaruhi harga-harga melalui sisi moneter atau mengelola tekanan harga dari sisi permintaan agregat (aggregate demand) relatif terhadap kondisi sisi penawaran. Artinya, BI melakukan pengendalian harga melalui instrumen yang dimilikinya untuk mencapai kestabilan nilai mata uang terhadap barang dan jasa. Hal tersebut tentu tidak terlalu banyak berarti untuk merespons kenaikan hargaharga yang bersifat temporer. Padahal kenaikan harga-harga yang terbentuk saat ini lebih disebabkan dipicu oleh pengaruh sesaat dari faktor-faktor eksternal dan internal, seperti lonjakan drastis kenaikan harga minyak mentah dunia hingga mencapai lebih dari 116,5 dolar per barel, faktor musim (factor of cycle), faktor kebijakan (administered price), bencana alam dan terganggunya distribusi barang (negative supply shock), dan ekspektasi berlebihan para produsen terhadap harga. Oleh sebab itu, BI selaku otoritas moneterdituntutuntuklebihproaktifmenjalin koordinasi dan kerjasama yang kuat untuk mengatasi problema harga. BI dengan segala kemampuan yang dimilikinya, sangat berpotensi mengungkap dan mengidentifikasi sumber-sumber pemicu inflasi dan mengeliminasi dampaknya terhadap kenaikan harga. Sudah saatnya BI memperkuat daya ungkitnya sebagai motor penggerak bangkitnya perekonomian yang lebih maju dan terbuka bagi terselenggaranya aktivitas ekonomi yang melibatkan banyakorang.BItidakbisahanyamemantau perkembangan harga dari sisi moneter an sich melainkan juga bersentuhan dengan bergeraknya sektor riil ke arah posisi terbaiknya.

konsumsi sehari-hari sehingga berimplikasi pada inflasi. Secara teoritis, inflasi adalah gejala ekonomi yang ditandai dengan kenaikan harga-harga secara umum dan terus menerusdenganrentangwaktuyanglama disebut dengan inflasi. Fenomena inflasi tinggi dapat dianalogikan bagaikan mencium aroma tidak sedap menusuk hidung tapi tidak diketahui dari mana asal muasal sumbernya.Inflasiterjadiapabilakenaikan harga sejumlah barang tertentu berdampak luas terhadap kenaikan harga ikutan pada barang-barang lainnya. Kenaikan harga terindikasikan oleh perkembanganConsumerPriceIndexatau Indeks Harga Konsumen (IHK) dari waktu ke waktu. IHK menunjukkan pergerakan harga dari seperangkat barang dan jasa yang dikonsumsi masyarakat. Seberapa besar nilai paket harga barang dan jasa biasanya dilakukan melalui Survei Biaya Hidup oleh Badan Pusat Statistik (BPS). BPSakanmemantauharga-hargadisetiap kota yang dijadikan sampel perhitungan inflasi secara bulanan. Berdasarkan perhitungan BPS, inflasi nasional tahun 2010 relatif tinggi sebesar 6,97 persen. Inflasi umum bulan Februari 2011sebesar0,13persendenganlajuinflasi tahunan atau year on year terhadap Februari2010sebesar6,84persen.Sedangkan inflasi tahunan bulan Januari 2011 sebesar 7,02 persen. Prospek inflasi nasional pada masa akan datang tampaknya bukan hal yang ringan. Potensi inflasi akan melesat tinggi masih sangat besar. Setidaknya terdapat lima faktor yang dapat memicu inflasi tahun 2011 meningkat. Pertama, faktor kebijakan pemerintah berkenaan dengan pengurangan subsidi bahan bakar minyak (BBM). Kedua, krisis harga dan pasokan pangan yang terus berlanjut. Ketiga, tingginya ekses likuiditas di pasar keuangan dalamnegeri.Keempat.derasnyaarusmodal masuk (capital inflow) ke pasar uang domestik. Kelima, arus distribusi yang masih terkendala. Faktor-faktor tersebut akan berakumulasi memicu inflasi dari sisi dorongan biaya (cost push inflation).Oleh karenaitu,perlukebijakanyangfokuspada upaya menahan laju kenaikan biaya produksi. Mengapa inflasi perlu dikendalikan ? Persoalannya bukan semata-mata pada angka inflasi yang berpotensi meningkat melainkan pada dampak sistemik yang ditimbulkan inflasi.

bekerja kurang dari 35 jam per minggu yang meningkat dari waktu ke waktu sejalan dengan kesempatan kerja yang terbatas. Pada tahun 2010, pengangguran setengah terbuka diperkirakan mencapai 32 juta jiwa lebih. Pengangguran setengah terbukainilahyangmencerminkantingkat kesejahteraan tenaga kerja di tanah air. Sedangkan angka kemiskinan tahun 2010 mencapai 31,02 juta jiwa. Namun, kalau melihat angka kemiskinan relatif diperkirakan mencapai 30 juta jiwa lebih. Kemiskinanrelatiflebihdiposisikansebagai golongan masyarakat yang rentan miskin apabila tingkatinflasiterusbertambahdan berbagai kebijakan kurang optimal berpihak bagi program penyangga kemiskinan. Pemerataan ekonomi terutama di daerah yang terwujudkan secara nyata, berimplikasi terhadap penguatan fondasi strukturkeuanganrumahtangga.Semakin kuat struktur keuangan diharapkan akan mampu mengimbangi laju inflasi yang meningkat. Pada akhirnya harga-harga akan kembali pada posisi keseimbangan semula yang positif bagi pasar.

Fenomena inflasi Apabila mencermati perkembangan geopolitik Timur Tengah terakhir, tampaknya produksi minyak mentah dunia akan mengalami penurunan. Penyebabnya, sejumlah kilang-kilang minyak padang pasir mengalami kerusakan yang parah. Kondisi tersebut menyebabkan pasar minyak mentah dunia mengalami gangguanstrukturalyangserius.Gangguan struktural pada produksi minyak mentah akan mendorong kenaikan harga. Kondisi diatas menciptakan shocks (kejutan) dalam pasar dalam negeri. Disparitas yang terjadi mampu mengganggu mainstream keseimbangan pasar barang

Pemerataan Inflasi yang tidak dikelola dengan baik berpotensi menurunkan pendapatan masyarakat. Penurunan pendapatan masyarakat akan dirasakan secara nyata oleh golongan masyarakat menengah kebawah. Penurunan pendapatan berkorelasi positifdenganmenurunnyakesejahteraan. Indikator kesejahteraan yang selalu digunakanadaduayaknitingkatpengangguran dan kemiskinan. Jumlah pengangguran tahun 2009 adalah 9,25 juta jiwa, turun menjadi 8,5 juta jiwa pada tahun 2010 atau turun sebesar 667 ribu orang. Jumlahinibelumtermasukpengangguran setengah terbuka atau tenaga kerja yang

* Menko Kesra: Warga berhak dapat jaminan sosial - Tapi kok masih ada Gepeng?

Ekspektasi masyarakat atas harga-harga sangatlah mendasar sebagai bentuk refleksi upaya pencapaian nilai tambah bagi standar kehidupannya


ealita kehidupan yang kian menyesakkanamatdirasakanmasyarakat berpenghasilan rendah saat ini. Himpitan beban biaya hidup seharihari semakin berat.Terutama ketika harga barang-barang kebutuhan pokok mengalami kenaikan tanpa alasan yang kurang dapat dipahami. Harga-harga terus menyasar ke segala arah baik di pasar-pasar tradisional maupun setengah moderen, bahkan di pusat pelayanan kesehatan dan pendidikan. Masyarakat hanya menjadi pihak penerima harga (price taker) dari suatu mekanisme pembentukan harga yang tidak berimbang. Faktor harga adalah salah satu faktor yang mendeterminasi permintaan masyarakat khususnya terhadap barangbarangkonsumsisehari-hari.Berdasarkan terminologinya, jumlah permintaan masyarakat terhadap barang dan jasa merupakan fungsi dari harga. Artinya, seberapa besarpermintaanmasyarakatdipengaruhi oleh faktor harga dengan asumsi faktorfaktor lain konstan. Permintaan masyarakatmenjadihalterpentingberlangsungnya dinamika pasar yang bertumbuh. Permintaanmasyarakatyangmeningkat akan berimplikasi pada perekonomian yang dinamis dan berkembang. Sebaliknya, permintaan masyarakat yang menurun akan berakibat kondisi pasar akan mengalamikelesuandanberpotensimelemahkankemampuandayasaing.Keadaan pasar dapat dijadikan indikasi dinamisnya suatu perekonomian. Dengan demikian, faktor harga begitu teramat penting dalam pembentukan persepsi dan ekspektasi masyarakat terhadap kondusifnya rejim suatu perekonomian. Mengapa masyarakat begitu peduli dengan harga? Karena masyarakat memiliki hak normatif untuk mendapatkan harga-harga yang terjangkau dari sisi pendapatannya, dan kenaikan harga yang tidak berlebihan. Persepsi masyarakat selaku konsumen sudah jelas, bagaimana harga yang terbentuk adalah harga pasar yang diharapkan tidak terdistorsi oleh faktor-faktor pengganggu. Faktor-faktor tersebut antara lain, tindakan spekulasi harga,kebijakanstabilisasihargayangtidak efektif, dan koordinasi antarinstansi terkait yanglemahdalammemastikanketersediaan pasokan. Kegagalan dalam meredam gejolak harga yang dipicu faktor-faktor tersebut akan berdampak luas atas lonjakan kenaikan harga Ekspektasi masyarakat atas hargaharga sangatlah mendasar sebagai bentuk refleksi upaya pencapaian nilai tambah bagi standar kehidupannya untuk lebih baikdimasaakandatang.Inilahparadigma berpikir bagaimana harga-harga perlu dikendalikansekaligusmemberipengaruh positifbagipeningkatankemampuandaya beli masyarakat. Sejalan dengan hal demi-

kian, diperlukan suatu kebijakan pengendalian harga yang berpengaruh pada peningkatan kualitas hidup masyarakat.

Penulis adalah Staf Pengajar Departemen Ekonomi Pembangunan Fakultas Ekonomi USU


Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.


* Kebijakan pembatasan BBM Subsidi tak efektif - Apalagi menaikkan harga BBM, he...he...he * Wagubsu diingatkan jangan langgar UU Pemda - Nampaknya mulai dapat tantangan neh!


D Wak


WASPADA Selasa 22 Maret 2011

Ustad Zulfikar Hajar Berjiwa Besar Meskipun antara saya dengan ustad K.H Zulfikar Hajar Lc ada perbedaan pendapat dalam beberapa hal masaalah Aqidah atau Ibadah yang kadang-kadang sampai berdebat atau adu argumentasi kadang-kadang suara lembut terkadang meningkat keras di pengajian, atau bentuk tulisan melalui Hr Waspada. Namun hal itu bisa kami batasi hanya sebatas di dalam berdakwah. Namun di luar berdakwah, misalnya dalam masaalah keduniaan perbedaan pendapat itu tidak kami bawa-bawa yang bisa menyebabkan ukhuwah kami rusak. Satu contoh bagaimana pun sengitnya debat kami itu yang kadang-kadang isteri saya almarhumah Dahniar Tanjung terlibat adu argumentasi dengan beliau K.H Zulfikar Hajar Lc. Namun ketika beliau mendengar isteri saya meninggal dunia, beliau menyempatkan diri datang bertakziah ke rumah saya bersilaturrahmi seraya menyampaikan rasa turut berduka cita dan memaafkan almarhumah sekaligus mendoakan semoga almarhumah diterima Allah SWT disisi-Nya. Amin Ya robbal Alamin ! Maka saya sebut K.H Zulfikar Hajar Lc berjiwa besar, bisa memilah antara beda pendapat masaalah Aqidah/Ibadah dengan hubungan silaturrahmi (ukhuwah Islamiyah). Setiap berjumpa kami berpelukan, kami bercengkerama sehingga pernah mantan Rektor IAIN Prof.Dr.H.Yasir Nasution ketika melihat kami duduk berbincangbincang dan bergurau di kursi peserta, lalu Prof. yang duduk di pentas pembicara (nara sumber) berkata : “Saya heran, saya tak sangka yang kata orang antara dr.Arifin S.Siregar dan K.H Zulfikar Hajar, Lc “berantam“ tapi rupanya mereka sangat akrab, semoga inilah yang kita tiru”. Semoga penyampaian saya ini diberkati Allah SWT. Akhirnya bersama ini saya mohon maaf seandainya almarhumah ada kesalahannya pada kita semua dan mohon doa semoga almarhumah diterima disisi Allah SWT. Juga kita semua diberi Allah SWT keberkatan, diampuni Allah dosa kita, sehat, murah rezeki, tambah kuat iman kita. Amin!! Dan terima kasih saya pada Harian Waspada yang telah memberitakan wafatnya almarhumah penyampaian yang menyentuh dan mengharukan hati. dr Arifin S.Siregar

Mohon Atensi BPKP Dan Polda Sumut Berdasarkan keterangan Pihak Penyidik, dalam hal ini Penyidik pada Polresta Kota Tanjungbalai.Yaitu mengenai proses tindak lanjut kasus dugaan Tindak Pidana Korupsi Milyaran Rupiah pada Proyek NUSSP Pematang Pasir Kota Tanjungbalai. Hal mana menurut versi Penyidik bahwa proses penyidikan kasus tersebut di atas terhambat disebabkan menunggu kedatangan dan hasil auditor BPKP perwakilan Medan untuk menghitung besaran kerugian keuangan negara. Maka berdasarkan kondisi di atas, dengan ini kami masyarakat Kota Tanjungbalai secara resmi meminta dan memohon perhatian serius dari Pihak BPKP dan Bapak Kapolda Sumatera Utara. Bahwa kasus di atas telah menjadi perhatian publik di kota Tanjungbalai dan telah membuat masyarakat bertahun-tahun lamanya dalam penantian atas hasil tindak lanjut penanganan kasus korupsi tersebut. Di samping itu kami masyarakat Kota Tanjungbalai tidak rela dan tidak sudi Visi dan MisiWalikota danWakilWalikota kami yang baru, yakni Bapak Dr. H. Thamrin Munthe, M.Hum dan Bapak Rolel Harahap dalam rangka menjadikan kota Tanjungbalai sebagai Kota Ber-Iman menjadi terhambat atau kandas dipersimpangan jalan. Sebab salah satu ciri-ciri Kota Ber-Iman adalah: anti dan tegas dalam menindak kemungkaran, termasuk korupsi yang merupakan kejahatan dan kemungkaran besar serta musuh segala umat yang beradab. Maka harus ditindak dan diberantas tanpa pandang bulu atau pandang baju, sebab seluruh dunia telah sepakat bahwa korupsi adalah musuh bersama. Oleh karena itu, sekali lagi kami mohon pada Pihak BPKP perwakilan Medan dan Bapak Kapoldasu untuk segera merespon aspitasi kami dan tolong jangan hambat Visi dan Misi Walikota dan Wakil Walikota kami yang tercinta. Atas perhatian dan tindakan nyata dari Bapak-bapak terlebih dahulu kami ucapkan terima kasih. Andy Marpaung Kota Tanjungbalai

Kepada Bapak Kapoldasu Dengan hormat, Bapak Kapolda,saya yang bernama Tan Kok Jong,Laki-laki,berumur 59 tahun,bertempat tinggal di Jalan Sutrisno No. 93/67, bersama surat ini datang memohon keadilan dan perlindungan kepada Bapak Kapolda atas penderitaan yang saya alami. Adapun duduk permasalahannya, saya membeli sebuah mobil Toyota Avanza 1300 G, Tahun 2007, BK 1010 JK,Warna Kuning Metalik, No. Rangka MHFM1BA3J7K045180, No. Mesin, DC23452 seharga Rp. 120 Juta sesuai dengan harga pasaran dan transaksi kami lakukan di rumah saya sendiri, dan pada saat saya membeli dilengkapi dengan BPKB, STNK, Faktur Toko, dan Kwitansi kosong sesuai dengan nama yang tertera di BPKB mobil tersebut dan semua ini adalah syarat mutlak untuk pembelian sebuah mobil. Bapak Kapolda, ternyata setelah mobil itu saya beli dan saya pakai pihak Polda SUMUT Unit Ranmor menahan mobil dan dokumennya sesuai laporan polisi No. Pol: LP/60/II/ 2011/Dit Reskrim, tanggal 02 Pebruari 2011 (dokumen terlampir) dengan alasan dokumen palsu dan setelah itu pihak Polda memeriksa saya dan pihak yang menjual kepada saya yaitu Jty alias AIM beserta kelompoknya. Setelah dilakukan pemeriksaan oleh pihak Polda terhadap Jty alias AIM ditahan selama lebih kurang 10 hari, tapi setelah itu pihak Polda melepaskan Jty alias AIM padahal saya jelas-jelas dirugikan Rp. 120 Juta, dan malah anehnya pihak Polda membuat saya menjadi “Penadah” yang jelas-jelas sangat membingungkan saya karena saya jelas-jelas adalah korban permainan kelompok pemalsu BPKB dan STNK yang dikomandoi Jty alias AIM. Karena saya membeli mobil tersebut sesuai dengan harga pasar malah di atas harga pasar dan transaksi jual beli di rumah saya sendiri disaksikan isteri dan anak saya. Jadi seharusnya pihak Polda melindungi saya sebagai pembeli yang beritikad baik dari kelompok pemalsu dokumen negara dan bukan malah pihak Polda sibuk membuat saya sebagai “Penadah” yang jelas-jelas tidak sesuai dengan rasa keadilan. Seharusnya pihak Polda harus menahan Jty alias AIM yang jelas-jelas memalsukan Dokumen Negara, tapi dalam kasus ini pihak Polda cenderung menganggap remeh Pemalsu Dokumen Negara. Jadi saya mohon pihak Polda menghapus kekebalan hukum terhadap kelompok Jenty alias AIM yang mungkin sudah sering melakukan pemalsuan-pemalsuan BPKB dan STNK ditempat lain karena terbukti dalam penjualan mobil dokumen palsu kelompok ini mempunyai tugas-tugas seperti Jenty alias AIM yang bertugas sebagai pemasaran dengan berpura-pura menjual mobil atau suruhan orang lain, padahal hanya permainan rekayasa untuk mengelabui pihak kepolisian dengan melihat celah hukum oleh kelompok pemalsu BPKB dan STNK ini. Bapak Kapolda, seharusnya pihak Polda harus betul-betul membongkar kasus ini sampai ke akar-akarnya tanpa dibarengi dengan rekayasa bukan seperti saat ini yang telah menganggap remeh pemalsuan Dokumen Negara dengan melepas begitu saja Jty alias AIM yang telah merugikan saya Rp. 120 Juta dan Demi Tuhan saya tidak mengetahui bahwa BPKB itu adalah palsu. Jadi saya mohon Bapak Kapolda supaya menangkap kembali Jenty alias AIM dan memeriksa kembali kasus ini yang membuat saya sebagai “Penadah” yang jelas-jelas adalah rekayasa kelompok Jenty alias AIM. Demikianlah surat permohonan saya ini saya sampaikan, dan supaya Jenty alias AIM ditangkap kembali. Atas perhatian Bapak Kapolda saya ucapkan terima kasih. Hormat saya, Tan Kok Jong

Soal Tayangan TV Sejak lama tayangan TV kita telah menimbulkan berbagai masalah. Dari mulai tampilannya yang sangat seronok, mengumbar kemewahan sampai urusan mistik yang tak mendidik. Anehnya aparat berwenang seperti tak berkutik menyelesaikan masalah ini semua. Orang-orang di lingkaran kekuasaan seperti tak memiliki kesanggupan menyelesaikannya agar tayangan TV kita bisa lebih sejuk dan mendidik. Gimana mau mendidik, pagi-pagi tayangan TV telah menyajikan musik-musik secara berlomba-lomba. Seakan tidak punya kerjaan lain, baru buka mata langsung disajikan musik. Remaja kita diajak untuk berpikir halusinasi sehingga tidak memikirkan hal-hal yang penting. Diajak berpikir secara dangkal sehingga tak punya interest untuk ikut bersinergi membangun bangsa. Belum lagi kalau ada bentrokkan seperti kasus Ahmadiyah, TV mengeksploitasinya seolah ada keadaan yang sangat menyeramkan dan mengerikan sedang terjadi. Padahal cuma orang-orang Ahmadiyah yang cari gara-gara agar orang emosi dan bentrok. TV bukannya menyejukkan tapi malahan memanas-manasi agar semakin heboh. Apa yang dipentingkan oleh para pengelola TV tidak lain adalah sensasi demi rating semata, seperti mengabaikan persoalan moralitas bangsa dan hal-hal yang bisa menjadi dampak negatif bagi kehidupan berbangsa dan bernegara. Karena dengan tingginya rating maka akan banyak iklan yang mampir, kalau iklan banyak maka akan banyak uang mengalir. Itulah kepentingan sesaat media massa televisi kita. Dari Warga Medan


Mewaspadai Keracunan Pangan Oleh dr Candra Syafei, SpOG Meningkatnya makanan jajanan dibanyak negara termasuk di Indonesia adalah akibat peningkatan populasi penduduk, perubahan keadaan sosio ekonomi


istimKeamananPanganTerpadu (SKPT) adalah program nasional yang terdiri dari semua stakeholders kunci yang terlibat dalam keamanan pangan, mulai dari lahan pertanian sampai siap dikonsumsi. SKPT merupakan sistim yang mengkombinasikan keahlian dan pengalaman dari pemerintah, industri, akademisi dan konsumen secara pangan. Bersama-sama kita meningkatkan keamanan pangan di Indonesia adalah semboyanuntuksistimkeamananpangan terpadu (SKPT) nasional di Indonesia. Semboyan ini merupakan terobosan cara baru untuk bekerja secara bersama-sama. Keamanan makanan menjadi faktor yang sangat penting dalam pemilihan makanan, karena betapapun nikmatnya suatumakanantetapibilamanatidakaman bagi kesehatan tentu tidak layak dikonsumsi oleh konsumen. Menurut survei Badan POM Nasional menunjukan 78 persen, anak sekolah jajan di lingkungan sekolah, baik di kantin maupun penjaja makanan di sekitar sekolah. Survei yang dilakukan pada tahun 2008 itu juga menunjukanbahwapanganjajanandisekolah memegang peran penting dalam memberikan asupan energi dan gizi bagi anakanak usia sekolah. Makanan minuman umumnya tersusun dari karbohidrat, protein, lemak, vitamin,mineraldanair,danberbagaizatkimia lain yang sudah berada dalam makanan secara alami maupun yang sengaja ditambahkan.Ternyatapanganjajanandisekolah telah berkontribusi terhadap pemenuhan kebutuhan energi sebesar 31,1 % dan protein sebesar 27,4% akan tetapi, dilemanya tingkat keamanan pangan jajanan disekolah cukup memprihatinkan. Dari hasil pengawasan jajanan anak sekolah yang dilakukan rutin oleh Badan POMselama2006–2010menunjukanmasih adanya serkitar 40-44 persen jajanan anak sekolah yang tidak memenuhi syarat keamanan pangan yang disebabkan oleh penggunaan bahan kimia berbahaya. Misalnya formalin, boraks, zat pewarna rhodaminBdanmethanylyellow,penggunaan pemanisbuatan(siklamat)dalamminuman maupun kue-kue. Faktor lain yang tidak kalah penting adalah rendahnya tingkat pengetahuan produsen ataupun penjaja makanan mengenaikeamananpanganjajanan,praktek hygieneyangmasihrendah,atauprodusen tidak peduli dengan aspek keamanan pangankarenamengejarkeuntunganyang besar, merupakan faktor utama penyebab masalah keamanan pangan. Kondisi seperti ini dapat mengakibatkan penyakit akibat pangan pada anak-anak baik secara akut maupun kronis. Pada penelitian yang dilakukan di Bogor juga telah ditemukan Salmonella Paratyphi A dalam 25 % - 50 % sampai minuman yang dijual di kaki lima. Bakteri ini mungkin berasal dari es batu yang tidak

dimasakterlebihdahulu.BakterE-Colijuga ditemukan dalam jajanan berbentuk minuman seperti es sirup dan minuman sejenis.Jajananbisatercemarbakteriantara lain karena proses pengolahan yang tidak hygienis, tempat penyajian yang terkontaminasi serangga dan debu serta perilaku penjaja yang kurang memperhatikan kebersihan seperti mengambil makanan menggunakan tangan langsung tanpa alat bantu/pelapis, melayani pembeli sambil berbicara/bersin-bersin. Makanan yang tercemar bakteri E – Coli bisa menyebabkan diare. Secara spesifik, jajanan makanan sekolah banyak yang tidak sehat dan tidak layak konsumsi. Karena selama ini para penjual makanan jajanan sekolah, menjual dagangannya di area terbuka dan didekat atau di atas selokankotortanpapenutupataudipinggir jalan yang banyak debu beterbangan. Kondisi ini dapat memicu dan memacu pencemaran terhadap jajanan sekolah sehingga menjadi tidak sehat dan berbahaya. Makanan jajanan yang dijual oleh pedagang kaki lima, menurut FAO didefinisikan sebagai makanan dan minuman yang dipersiapkan dan/atau dijual oleh pedagang kaki lima di jalanan dan tempattempat keramaian umum lain yang langsung dimakan atau dikonsumsi tanpa pengolahan atau persiapan lebih lanjut. Meningkatnya makanan jajanan dibanyak negara termasuk di Indonesia adalah akibat peningkatan populasi penduduk, perubahan keadaan sosio ekonomi. peningkatan angka pengangguran, urbanisasi, dan turisme. Makanan jajanan kaki lima menjadi pilihan masyarakat karena murah, mudah, menarik dan bervariasi. Dari sudut pandang ekonomi, makanan jajanan kaki lima ini dapat menjadi sumber pendapatan utama. Karenanya jajanan kaki lima selama ini menjadi alternatif untuk mendapatkan makanan secara cepat, karena posisinya selalu dekat jalan raya atau tempat orang melintas. Sehingga menjadi bagian penting dalam sistim suplai makanan. Namun amankah makanan jajanan tersebut? Bahaya pangan yang tidak aman Pada umumnya yang sering menjadi masalah yang berhubungan dengan pangan adalah kebiasaan makan di kantin atau warung dan kebiasaan makan fast food. Laporan FoodWatch memaparkan hasilmonitoringjajanananaksekolah(JAS) yang sering tidak memenuhi syarat (TMS) karena penggunaan bahan tambahan pangan (BTP) yang melebihi batas. Penyalahgunaan bahan berbahaya yang seharusnya tidak boleh digunakan dalam pangan, serta cemaran mikroba yang mencerminkan kualitas mikrobiologi pangan jajanan anak sekolah. Bahan kimia berbahaya yang dilarang namun sering digunakan untuk pangan adalah 1).Formalin (bahan pengawet

mayat,antiseptic,pengawetkayudanpenghilangbau),digunakanuntukmiedantahu. 2).Boraks(bahanpengawetkayu,antiseptik toilet, las karbit, bahan baku pada industri kaca), digunakan untuk bakso, mie,kerupuk,lontong dan lupis. 3) Zat perwarna rhodamin B dan methanyl yellow (bahan pewarna tektil), digunakan untuk aneka kue dan minuman warna-warni. Bahan-bahan tersebut dapat terakumulasi pada tubuh manusia dan bersifat karsinogenik yang dalam jangka panjang menyebabkan penyakit-penyakit seperti kankerdantumorpadaorgantubuhmanusia.Pengaruhjangkapendekmenimbulkan gejala-gejala yang sangat umum seperti pusing dan mual. Sebenarnya pemanis buatan itu tidak memiliki nilai gizi kalori, dan jika dikonsumsidalamjumlahyangberlebihandapat menyebabkanhipoglikemiayangberakibat turunnyadayabelajar,jugabisamenimbulkan kanker prostat. Adapunciri-cirikhususdari bahanmakananmengandungbahanberbahayadan pewarna yang dilarang jika bahan-bahan makanan mie, tahu, bakso, lontong dan lupis terlihat kenyal, mengkilat, dan tidak dihinggapi lalat, maka patut dicurigai bahwa bahan tersebut mengandung boraks atau formalin. Dan makanan atau minuman warna-warni yang warnanya sangat cerah dan ngejreng/cas,serta tidak mudah hilang jika kena tangan atau dilidah, maka itu merupakan awal tanda-tanda makanan atau minuman tersebut mengandung pewarna tekstil rhodamin B atau methanyl yellow. Untuk mengurangi paparan terhadap anak sekolah dari makanan jajanan yang tidaksehatdantidakaman,perludilakukan usaha promosi keamanan pangan baik kepada pihak sekolah, guru, orang tua, murid serta pedagang. Sekolah dan pemerintah perlu menggiatkan kembali UKS (Upaya Kesehatan Sekolah). Materi komunikasi tentangkeamananpanganyangsudahpernah dilakukan oleh Badan POM dan Kementrian Kesehatan dapat ditingkatkan penggunaannya sebagai alat bantu penyuluhan keamanan pangan disekolah-sekolah. Bahkan pada tanggal 31 Januari 2011 yang lalu,Wapres RI Boediono telah mencanangkan ”gerakan jajanan sekolah sehat dan bersih. Resiko kesehatan yang ditimbulkanakibatjajananyangtidakamantidak bermutuberdampakjangkapanjangterhadap pembentukan generasi bangsa yang lebih baik. Karena itu sangat penting untuk menjadikan gerakan jajanan anak sekolah yang aman, bergizi dan bermutu. Gerakan pengawasan pangan jajanan anak sekolah perlu melibatkan berbagai pihak. Di sini diperlukan kesadaran, keterlibatan dan partsipasi aktif dari berbagai pihak dalam meningkatkan keamanan pangan. Gerakan ini jangan sebatas gertak sambal sehingga harus diupayakan secara terus menerus dan terpadu agar hasil yang dicapaidapatmaksimal.Untukitumasingmasing pihak yang terkait memiliki peran aktif yang terintegrasi. Anak sekolah adalah investasi bangsa, karena mereka adalah generasi penerus bangsa. Kualitas bangsa di masa depan ditentukankualitasanak-anaksaatini.Untuk itu upaya peningkatan kualitas sumber daya manusia harus dilakukan sejak dini,

Sistimatis dan berkesinambungan. Pertumbuhan dan perkembang anak usia sekolah yang optimal tergantung pemberian nutrisiyangberkualitassertakuantitasyang baik serta benar. Dalam masa tumbuh kembang tersebut pemberian nutrisi atau asupan makanan pada anak tidak selalu dapat dilaksanakan dengan sempurna.Yang sering menimbulkanmasalahadalahpemberian makanan yang tidak benar dan menyimpang. Penyimpangan ini mengakibatkan gangguan pada banyak organ dan Sistim tubuh anak. Food Borne diseases atau penyakit bawaan makanan merupakan masalah kesehatan masyarakat yang utama di banyak negara. Penyakit ini dianggap bukan termasuk penyakit yang serius sehingga sering kali kurang diperhatikan. Peran dinas kesehatan Sebagaimana Keputusan Menteri KesehatanRepublikIndonesiaNo:922/Menkes/SK/X/2008,tentangTeknisPembagian Urusan Pemerintah Bidang Kesehatan antara Pemerintah, Pemerintah Daerah Provinsi dan Pemerintah daerah Kabupaten/Kota. Yang menjadi urusan dan kewenangan dinas kesehatan adalah a)Pengawasandanpengendaliandalamrangka pencegahan dan mengatasi Kejadian Luar Biasa (KLB) akibat pencemaran makanan. b)Pelaksanaan pemeriksaan sarana produksidandistribusimakanandanminuman hasil industri rumahtangga.c)Pelatihan pengambilan contoh makanan minuman hasilindustrirumahtangga.d)Pengawasan dan registrasi makanan minuman hasil industri rumah tangga. e)Penerbitan sertifikat laik sehat bagi produsen makanan minuman siap saji. d)Pengawasan dan pengendalian dalam rangka penggunaan bahan tambahan yang dilarang termasuk cemaran mikroba patogen dalam makanan minuman produksi rumah tangga. Dalam skala provinsi akan dilaksanakan dinas kesehatan provinsi dan skala kabupaten/kota akan dilaksanakan dinas kesehatan kabupaten/kota. Dinas kesehatan provinsi adalah sebagai leading sektor peloporterdepanmemimpindanmelakukan koordinasi pembinaan, pengawasan dan pengendalian keseluruh kabupaten/ kota. Berita yang memprihatinkan dari Sumatera Utara adalah akhir-akhir ini sering terjadikejadiankeracunanpangandengan tenggat waktu yang relatif beruntun. Dimulai kasus di Akademi kesehatan di Padang Sidempuan, KasusTempat Pelatihan Helvetia, Kasus di Asrama Sekolah Kesehatan - Medan, Kasus di proyek pembangunan rumah sakit Jalan Dr MansyurMedan, Kasus di jalan Ngalengko - Medan sampai dengan kasus keracunan anak sekolah - Medan Johor, SD Al Washliyah Jalan Bromo – Medan dan SD N 105292 Bandar Klippa Kecamatan Percut Sei TuanDeli Serang. Sehingga apakah kasus-kasus ini akan berlanjut terus? Untuk itu mari kita semua saling kuatkan koordinasi lintas program dan lintas sektor yang bertekad mencegahkeracunanpangandiSumatera Utara. Semoga! Penulis adalah Kepala Dinas Kesehatan Provinsi Sumatera Utara

Fasilitator & Pembentukan Kelompok Oleh Rahdiansyah Pane Peran fasilator menggerakkan rasa sadar (aware), tergugah minat (interest) dan terbuka wawasan (understanding) dari masyarakat terhadap pengembangan kelompok


alam program pemberdayaan, terdapat beberapa unsur di dalamnya yang mempunyai satu kesatuan yang tidak dapat terpisahkan. Unsur tersebut meliputi, masyarakat, fasilitator,pemerintah,pihakswasta.Secara profesi,fasilitatorlebihdituntutperanannya memfasilitasi masyarakat. Posisi fasilitator sangatstrategis,karenasetiapsaatlangsung berhadapan dan berdampingan dengan masyarakat. Tugas terpenting fasilitator harus mampu menciptakan transformasi sosial (perubahan sosial). Peranan fasilitator sangat strategis dalam memfasilitasi pemberdayaan masyarakat khususnya di wilayah perkotaan. Strategi yang digunakan dalam pemberdayaan masyarakat adalah dengan penguatan kelembagaan yang merupakan sebuah kegiatan memberdayakan masyarakatagarmampusecaramandiriberperan serta dalam meningkatkan kesejahteraan hidupnya.Salahsatupendekatanyangdilakukanadalahdenganpengembanganatau pembentukan kelompok-kelompok yang mandiri. Jadi, fasilitator tidak terlepas perannya dalam pembentukan kelompok atau pengembangan kelompok yang sudah ada di masyarakat. Tujuan adanya kelompok ini sebagai wadah berorganisasi, pembelajaran, wahana bekerjasama, dan unit produksi yang mampu menghasilkan solusi dan rekomendasi bagi kemajuan kelompoknya hinggamasyarakatsecaraluas. Peran pembentukan kelompok kadangkala mendapat hambatan karena tidak semuanya masyarakat perkotaan berminat untuk membentuk atau mengembangkan kelompok yang telah ada. Walaupun, di wilayah perkotaan banyak bermunculan kelompok-kelompok masyarakat yang telah terbentuk, namun kurang berjalan secara ideal sehingga tujuandansasarantidaktercapai.Ironisnya, kegagalan kelompok-kelompok berproses disebabkan tujuan yang tidak jelas, tanpa arah dan mengedepankan kepentingan kelompok semata. Hakekatnya, kelompok sangat dibutuhkan untuk sebuah perubahan. Tanpa

kelompok, perubahan akan tersendat pertumbuhannya Justru itu, fasilitator memandang dengan adanya kelompok akan mempermudah ruang gerak menjalankan misi perubahan. Fasilitator harus mampu memfasilitasi lahirnya kelompokkelompok peduli dan mengakar di masyarakat yang akan menjadi agen of change (agen perubahan) di wilayahnya sendiri. Berbagai upaya yang dilakukan dalam membentuk kelompok-kelompokdimasyarakat, para fasiltiator mengawalinya dengan memahamiterlebihdahulu karateristik masyarakat setempat (local specific) atau melalui kearifan lokal. Pemahaman terhadap masyarakat merupakan awal dari keseluruhan kegiatan pemberdayaan.Tanpa adanya pemahaman terhadap masyarakat, sangat sulit bagi fasiltator untuk melaksanakan kegiatan pemberdayaan. Dalam upaya mengajak anggota-anggotamasyarakatagarmemiliki wadah kerjasama itu, tentu memperkenalkan tentang kelompok, fungsi, tujuan sertasasaranyanghendakdicapaisehingga masyarakat menyadari betapa pentingnya kelompok itu. Di sinilah peran fasilator menggerakkanrasasadar(aware),tergugah minat (interest) dan terbuka wawasan (understanding) dari masyarakat terhadap pengembangan kelompok sebagai wadah aspirasi masyarakat. Seiring telah terbentuknya kelompok, fasiltator tidak serta merta meninggalkan kelompokituberdirisendiri.Fasilitatortetap melakukan pembinaan dan penguatan serta menciptakan rasa kebersamaan di antara anggota kelompok. Setiap bagian kegiatanPNPMMandiriPerkotaan(PNPM – MP) berorientasi kelompok. Lihat saja, setiapsiklusselalumengedepankanadanya

kelompok. Misalkan saja, Rembug Kesiapan Masyarakat (RKM) salah satunya fasilitator melahirkan adanya relawanrelawanyangakanyangakanmenjalankan program secara bersama. Begitu juga dengan siklus selanjutnya, sepertiRefleksiKemiskinan(RK),Pemetaan Swadaya (PS) yang juga bergerak secara kelompok. Bahkan, diskusi-diskusi yang dibangunmenggunakandiskusikelompok atau Focus Discussion Group (FGD). Selain itu,fasilitatormemfasilitasilahirnyasebuah kelompok/lembaga keswadayaan masyarakat yang mengakar dan representatif sebagai kekuatan masyarakat dalam penanggulangan kemiskinan. Berbagai strategi yang dilakukan para fasilitator memperkuat lembaga ini melalui proses pembelajaran, dimulai dari pemahamanprogram, penggalian potensi SDM-nya, pemantapan jati diri hingga muncul kepedulian mengkaji masalah, kebutuhan dan masalah di wilayahnya. Keberadaan Lembaga Keswadayaan Masyarakat (LKM) ini diarahkan mampu menumbuhkan kelompok lainnya yang lahir dari masyarakat bergerak di setiap bidang yaitu lingkungan, ekonomi dan sosial. Kelompok ini biasanya dinamakan Kelompok Swadaya Masyarakat yang tumbuh atas dasar adanya ikatan pemer-satu berupa kesamaan masalah dan kebutuhan. Posisi fasilitator sangat penting dalam proses ini guna meningkatkan per-kembangan kelompok dan aktivitasnya melalui diskusi, rembug, pelatihan dan On the Job Training (OJT), pembelajaran transfaransi dan akuntabilitas serta lainnya. Mengemuka pertanyaan tentang perkembangan kelompok di masyarakat. Kenapa kelompok yang dibidani PNPMMP lebih berkembang dan mampu bertahan ketimbang kelompok yang lahir diluarPNPM?Beranekaragamalasanyang sangat mendasar dapat dikemukakan menjawab pertanyaan di atas. Kelompok yang dilahirkan PNPM Mandiri Perkotaan

(PNPM–MP) mempunyai visi dan misi yang inklusif serta diaflikasikan dalam kehidupan bermasyarakat, sementara kelompok di luar PNPM mempunyai visi dan misi cendrung eksklusif sehingga aflikasinya terbatas . Kita ambil sebuah contoh, kelompok paguyuban etnis, agama atau profesi tertentuyangadadimasyarakat,cendrung berpola eksklusif dan elitis (tertutup) dan hanya untuk kalangan tertentu saja. Sedangkan LKM / KSM lebih inklusif, populis (terbuka) dan sasarannya untuk masyarakat luas. Letak perbedaan yang mencolokadalahpadaproses.LKM/KSM mengedepankan proses pembelajaran dankesadarankritis,sedangkankelompok di luar PNPM – MP bersifat pertemuan formal.Prosespembelajaranlebihmampu bertahan dari pada pertemuan formal, karena proses pembelajaran meningkatkanwawasanilmupengetahuan,aturan disusun bersama, sehingga menghasilkan kemandirian. Sedangkan formal diikat aturan yang kaku sehingga melahirkan polastructuraldanpatronismyangbersifat ketergantungan. Melalui PNPM-MP telah menyebar di seluruh Indonesia kelompok yang mandiri dan peduli terhadap pembangunan di daerahnya dalam menata lingkungannya, membangun berbagai usaha guna meningkatkan perekonomian masyarakat. Bicara perkembangan kelompok itu, untuk Kota Padangsidimpuan saja terdapat 79 Lembaga Keswadayaan Masyarakat berada di setiap Desa / Kelurahan yang ter-bentuk secara bertahap. Sedangkan KSM – KSM telah mencapai ratusan dari berbagai bidang seperti KSM bergulir, KSM sosial dan KSM lingkungan. Sebagian besar KSM – KSM ini masih menjalankan aktivitasnya. Sungguh potensi yang luar biasa bilamana kelompok masyarakat ini tetap terpelihara keberadaannya. Sebuah potensidankekuatanyangmampumenggerakkan kemajuan negara, khususnya di daerah. Dengan adanya kelompok ini dapat dijadikan pelaku pembangunan sekaligus bersama pemerintah setempat menciptakan good governance (tata pemerintahan yang baik) sehingga tujuan nasional mewujudkan masyarakat Indonesiayangaman,adildanmadanitercapai. Penulis adalah Asisten Kota Koordinator Kota 8 Padangsidimpuan – Sibolga Bidang Infrastruktur KMW 1 OC 1 Sumatera Utara

C6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 318i M/T Thn. 97/98 Hitam, BK Mdn VR 18. Rp. 72Jt. Hub. 91327433 DAIHATSU Sirion M/T Thn. 2009 Hitam. BK Mdn Rp. 118Jt. Hub. 0853 6034 8028 NEW DAIHATSU READY. New Xenia VVTi...............................DP 10 Jt-an New Terios TS....................................DP 15 Jt-an Gran Max PU & MB...........................DP 10 Jt-an Dapatkan diskon & MB...................DP 10 Jt-an Dapatkan Diskon & hadiah Hub. Gery 0813 7694 1988 / 061-77722561

Bawa Pulang Daihatsu Baru Anda Sekarang!!! Xenia, Terios, Luxio, Sirion, Grand Max Minibus. Pick Up...DP dan angsuran DP dan Angsuran Dpt disesuaikan....Prose Cepat dan Dijemput...Manda Astra Daihatsu. SM. Raja Medan 0812 6316 330 / (061) 664 70080 NEW DAIHATSU PROMO Miliki Daihatsu Baru dengan Pelayanan Terbaik - Xenia - Luxio - Terios - Grand Max, Dop Pick Up DP dan Angsuran Ringan, Proses Cepat

Yusuf Astra Daihatsu 0852 6168 1210 - 7777 9356

DAIHATSU Xenia 1000cc. Li Sporty. Lengkap, siap pakai, BPKB 1 nama, Ada Ass All Risk. Sampai Bln Sept, Mulus. Harga 112Jt Nego. Hub. 0812 6000 709

HONDA Civic Wonder 87/88 Dijual. Sport 2 pintu, hijau metalic, AC Dingin, VR, BR, Tape, Harga 23Jt/Nego. Hub. 0821 6092 6751 (TP) New Kia Picanto Cosmo 100% Baru DP 10% atau Angs. 2Jt-an Irit BBM 1 Ltr: 23 Km, Garansi 5 Thn. Mutu Hebat, Harga Hemat SONY 0813 8723 8734

KIA Picanto Thn. 2005. Biru met. Type paling lengkap. BK Mdn Mutasi Rp. 87Jt. Hub. 7786 3981 KIA CARNIVAL DIESEL MATIC Thn. 2000. Hitam, BK Siantar Rp. 75Jt. Nego. Hub. 0813 61450 444 MITSUBISHI Kuda 2004/05 Dijual. Pajak Baru. AC, PW, C. Lock, Remote, TV, CD, VCD, RT Kenwood Hitam Mutiara (Lengkap). TASBI II Blok 6 No. 93. 0812 7513 190 TP

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000

M-ETERNA - BK 678-DS. Satu tangan dari baru. Kondisi mulus sekali, Original. Hub. 061-91145520

TOYOTA Kijang Commando Dijual. Thn. 91 Hijau 6 Speed, AC, Tape, VR, BR, Mobil mulus, Orisinil Hrg. 48Jt. Damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90. Sei Agul. 20 Mtr. Dari Simpang (4) Lampu Merah.

MITSUBISHI Kuda, Diesel Super Exceed Thn 2000, W. Hitam Met, Mulus, Lengkap, Siap pakai, Hrg nego Serius hub. 0812.6415.8848

TOYOTA Avanza Type S Th. ‘07, Manual. Wrn. Silver, 1500cc, Pakai Sensor, Komplit, AC DB, Mobil ctk, 1 tangan dari baru Rp. 136Jt. Jl. SM. Raja No. 200. Kembar Ponsel. (Dpn Sekolah Eria) 0815 337 336 881 / 7851 402

MITSUBISHI 100% BARU Angs Rp. 3 Jt-an...bawa Pulang L300, (Ready Stock)...Pajero, T120SS L200 Triton, Cold Diesel 74, 73 dan 71 PS. Serius Hub. 0812 653 3319 dan 081 370 765 319

MOBIL DIJUAL CEPAT Mitsubishi Galan VR Thn. 1995, Komplet, VR 17 inci dan masih original, Hrg. 55Jt. (damai) HP. 0813 7063 3953 NISSAN Livina 09 Akhir. Sangat cantik, Tipe lengkap. Wrn. Abu2 terbaru. Kulkas 6 Rak. Pembeku Es, TV 29 Inchi. Merek Fuji. Hub. 4145116 - 77422 698 DEALER RESMI SUZUKI MOBIL PU 1.5 DP 4 Jt-an Angs. 3.272.000,APV GX Arena DP. 10 Jt-an Angs. 4.058.000,Splash GL DP 4 Jt-an Angs. 3.839.000,Swift ST DP 6 Jt-an Angs. 4. 484.000,SX4 DP 9 Jt-an Angs. 5.161.000,Hub. 0812 654 0809 / (061) 77722121

SUZUKI APV ‘05 Over Kredit. Type X, Hitam met, Sisa 24 Bln. Mls. Lengkap, Blk DP 45Juta/Nego. Hub. 0852 7002 5974

SUZUKI Carry (Extra) 1987 Minibus (Adi Putro). Merah Maron/Siap pakai/Rp. 18Jt/Nego. Hub. 0852 6215 9494 (TP)

SUZUKI Katana Thn. 92 Rp. 30Jt. 0813 6227 5293 TOYOTA Kijang Grand Rover Diesel Thn. 98. Biru, BK Mdn Mutasi Rp. 70Jt. Hub. 0812 6594 2789 TOYOTA Kijang Krista Bensin Matic Thn. 2001 Coklat Met. BK Mdn Mutasi Rp. 109Jt. Hub. 0852 7538 3218



TOYOTA Kijang Capsul Model LGX New Bensin 1.8 Th. 2003. Hitam Met, BPKB 1 NM, VR, BR, PS, PW, CL, E. Miror, AC Doble, Full Sound Pake TV, Hrg. 130Jt. Nego. Hub. 061-6967 9753 TOYOTA Kijang Commando Long Thn. ‘90 Dijual. Merah metalik, sudah P. Steering, AC DB, Ban masih baru, mobil mulus dan mesin bagus. Peminat serius Hub. 0813 9665 6961

DICARI MOBIL OVER KREDIT Innova/Avanza/L300 PU/Carry Kontan Pun Ok! H. SAIFUL: 0811 6131 07 / SMS. TOYOTA Kijang Capsul SGX Bensin 1.8 Biru met Thn. 97. Sgt sehat, asli Medan, VR, BR, PS, PW, CL, RMT, AC DB, Full Sound Sistem, DVD, MP3, Hrg. 90Jt. Nego. Hub. 0812 64777 088

TIMOR DOHC Injection Silver Met thn. 98. Mulus, sgt Orisinil, Complit, S. Pakai. Hrg. 46Jt. Ng. Hub. 0821 6811 9355 SEDAN ANTIK

Austin 1956, Kuning, BK Medan asli, Mesin modif, AC, PS, Tape, Siap pakai A/n. Pemilik, 100 Jt (Hub. 0811.658.357)

TOYOTA Avanza 2010 Hitam, jok kulit, Velg 17, Mulus. Over Kredit. Balik DP. 80Jt/Nego. Sisa 24bln x Rp. 4.041.000,. HP. 0812 6422 853

TOYOTA Super Kijang G Thn. 95, Warna Abu2 met Original, Power Steering, AC, Tape, VR, BR. Hub. HP. 0811 648 358

TOYOTA Kijang LGX Bensin Th. ‘01, Bln 7, Wrn silver, asli Medan, siap pakai. Mobil kaleng2 Rp. 119Jt. Kembar Ponsel Jl. SM. Raja No. 200 (Depan UISU) 0812 6038 5555 / 785 1402

TOYOTA Kapsul Silver LGX Thn. 2000 Dijual. Diesel, BK Kota Medan, body original. Kaleng, Full musik & CD. Km. 24000. Harga 129Juta. Hub. 0821 6085 5592

TOYOTA LGX Thn. 99 W. biru metalic lengkap. Satu nama dari baru, mulus, komplit. Hub. 0813 9610 1939

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di

061-4576602. Terimakasih

TOYOTA Kijang Commando 89. Short 6 Speed. Wrn. Hijau, VR, AC Dingin, Original, Mulus, siap pakai. Hrg. Nego. Hub. 0852 1090 8484

TOYOTA Starlet 1,3 Thn. 88. Hitam, Pajak panjang, asli Medan, Ban baru, siap pakai. Hub. 0813 9621 6511 - (061) 7679 3535

TOYOTA Kijang Minibus 1991, Lampu Grey Grand/Kristal Lp. Blkng, AC, Central, Disc, Jok kulit, langit2 full Accesories. Hub. ACUAN Jl. Kirana 17. T. Tamb. Cash Cred. Masih Tangan I. 77159251 - 0821 6035 8777

All New Spark, Cuma Bayar 9Jt, Bawa Pulang Mobil baru Spark. Hub. 061-77118255 - 76373255


SEPEDA MOTOR YAMAHA Scorpio Z CW Hitam, Thn. 2008 Rp. 16,2Jt Hub. 0813 6131 4188 DIJUAL CEPAT

HONDA Supra Thn. 99. Warna hitam mulus, kondisi sehat, stater hidup. Harga Rp. 4,7 Juta Nego. Hub. 0853 6093 5632

DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik)



Telp. (061) 8446489, 8826936, 8477880, 7954444, 7368754, (0622) 430780, (0624) 21796


KIRIM MOBIL - Medan - Jkt - Medan

Extra Murah - 061.7777 1067 0813 7562 6150 - 0878 6953 3882 Fax. 061.7380966



DISEWA ALAT BERAT 2 (Dua) unit Vibro Roller 25 Tons Merk Bomag Type Ben 211D-40 Tahun 2010 Hub. 061.77885162




1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633



Cuci - Tambah Freon - Bkr/Psg Perbaikan dan Spare Parts AC - KULKAS - MSN CUCI Siap Ditempat & Bergaransi

HUB: 061 7797 2065 HP. 0813 6149 7921



Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput






BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0816.314.1807


TOYOTA Kijang Super Th. 89. W. Hijau KF40. 5 Speed. BK Medan. Mesin sangat bagus, Body mulus. Hrg. 37 damai. Hub. 0852 7681 4491

Selasa, 22 Maret 2011


KULKAS, DISPENSER, M. CUCI HUB. MAJU TEKNIK Tel. 7030118, Flexi 76750084 REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 0812 1671 84742 Siap Ketempat





KOMPUTER + Prin + modem + cam Latop Baru Wfi + camera + G1Th=2xJt (PC: Warnet@1Jt) Lcd peca, lambam, padam Servis Part Acer-toshiba-ibm-axio-compaq: Isi antvirus Gratis, Upgrade ram hdd (tambah kecepatan/fress)

Komputer P4 + Monitor=799rb (Tukar+) hub-0812 636-1967. Jl. rantang 20

JUAL & BELI Laptop, AC, TV, LCD, PS, Ampli, Spk, AC, Kulkas, Projector, Handycam, Camera, Keyboard, dll. UD SENANG HATI: 4517509 - 69677449- 76804949. Jl. Sekip 67 A

Telah Hilang/Tercecer - SKT No. 1590/ A/I/17, Tgl. 30 April 1973. dan Akta Pelepasan Hak Dengan Ganti Rugi No. 406/2/APH/MTT/1981, tgl. 17 Juni 1981. Ya n g m e r u p a k a n a l a t h a k / kelengkapan Surat Tanah kepunyaan Dr. ORATNA GINTING, atas tanah seluas +/- 225m2, yang terletak di Jl. Bunga Cempaka, Kel. P.B. Selayang II, Kec. Medan Selayang. Tercecer disekitar Jl. Wajir Medan. Di Sekitar Bulan Oktober 2010.





Miliki Segera...Laptop berkwalitas, merk terkenal terjamin & digaransi. Akses internet cepat, komplit & Siap pakai. Dapatkan harga khusus utk pembelian 22% tgl. 27 Maret di Harga - Medan Mall Lt. Dsr: 0813 7078 2829 Rp. - Millenium Plaza: 0852 1090 7422 - Medan Plaza: 0852 6109 4014 - Aksara Plaza: 0813 9742 2213 - Siantar Plaza: 0813 9650 7030 - Binjai Supermall : 0813 9798 3820 - Merak Jingga: 0813 9720 5544 - Millenium Lt. Dsr: 0812 888 21 068



Dijual Cepat Harga damai Hub. CV MARKET. Telp. 76324682 - 0812 65393000 Jl. Setia Budi Psr. 4 No. 424 B T. Sari Dkt. BNI





CPU P4 2.0/40/256/MM/MON 15” .......................Rp. 890.000 CPU P4 2.4/40/256/MM/MON 15” .......................Rp. 950.000 CPU P4 3.0/80/512/MM/MON 15” ....................Rp. 1.100.000 CPU DUAL CORE/80/1 GB/MM/MON 15” ..........Rp. 1.400.000 CPU AMD/80/512/MM/MON 15”/VGA CARD 256 ....Rp. 1.450.000 INFOKUS HITACHI / HDD 80 GB .............Rp. 2.000.000/195.000 LCD 15”/17”/19” PETAK .............Rp. 525.000/675.000/775.000 NOTEBOOK ACER DUAL CORE/512/WIFI/CAMERA/TAS ....Rp. 2.550.000 NOTEBOOK TOSHIBA CELERON DUO /40/1GB/WIFI/TAS ....Rp. 1.950.000

HUB. SDC Jl. Jamin Ginting No. 746 Psr. 7 Padang Bulan Telp. (061) 30069808 HP. 0812 606 5140 NB: Terima Service LCD/CPU/Printer/Notebook Tersedia Main Board + Proc P4 3.0/2.4/2.6


HILANG/TERCECER TERCECER Surat Tanah An. DONGAN SIANTURI. Alamat Jl. Kuala Tanjung Perdagangan Luas 10x120M. Bagi yang menemukan Hub. 0812 7033 9007

TERCECER Surat Tanah An. HASUDUNGAN SITOHANG. Alamat Sugarang Bayu. Luas 25x200m. Bagi yang menemukan hubungi: 0813 6159 3381

HILANG Surat Pernyataan Melepaskan Penguasaan atas tanah No. 08/ LEG/017/I/2002. Tgl. 09. Januari 2002. Atas nama: RAHEL Br. SEMBIRING. Kel. Sempakata



WC 0812 60444275 WC 0813 6147 0812 JL. SETIA BUDI


Setia Budi

Jl. Brayan Medan

8442246 WC 08126427 1725

Tumpat Sedot




Ada Garansi


845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F

Ingin Promosikan Produk Anda


WASPADA Media yang Tepat untuk Iklan Anda

D/P RINGAN + CASH BACK 9 JUTA Kredit 1 s/d 4 tahun Proses Mudah dan Cepat


Hubungi Dealer



JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN


Ekonomi & Bisnis

WASPADA Selasa, 22 Maret 2011


Redenominasi Tak Masuk RUU Mata Uang JAKARTA (Waspada): Menteri Keuangan Agus Martowardojo mengatakan redenominasi rupiah belum masuk dalam Rancangan Undang-Undang (RUU) mata uang diusulkan pemerintah.

Waspada/Helmy Has

BANJIR: Nasib pedagang durian berjualan dipinggir jalan Jl Merdeka Tanjungtiram, Batubara, pasrah diguyur air pasang rob melanda kota nelayan itu, Minggu (20/3). Warga pesisir pantai se Batubara merasakan amuk air pasang, termasuk pedagang bukannya banjir durian tetapi durian diguyur banjir, hanya pasrah saja tak sampai merusak dagangannya.

Agus menjelaskan dalam kajian pemerintah redenominasi masih belum dibicarakan. “Di RUU mata uang tidak ada (redemnominasi),” ungkap Agus saat ditemui di Bank In-

donesia (BI), Jakarta, Senin (21/ 3). Namun demikian dia mengaku jika sampai saat ini belum mendapatkan laporan rincinya. “Saya belum cek lagi,” ujar Agus. Sebelumnya, Pemerintah dan DPR disebut-sebut setuju untuk memasukkan rencana redenominasi ke dalam RUU Mata Uang, di mana redenominasi bisa dilakukan setelah RUU disahkan. Hal ini harus tetap dilakukan dengan kajian mendalam dan matang. Anggota Komisi XI DPR RI, Kemal Azis Stamboel, RUU Mata Uang sendiri sudah selesai di tingkat Panja dan rencananya

akan diajukan ke paripurna pada 30 Maret 2011. “Nanti kita akan minta hasil kajiannya dari BI dan kitu uji dengan riset-riset atau pandangan pakar sebagai pembanding. Jadi tidak otomatis bisa jalan. Karena dampaknya luas, sebelum memberikan persetujuan, DPR akan melakukan uji publik atas kebijakan tersebut,” ujar Kemal. Menurut Kemal, saat ini masih terdapat dua kutub pandangan tentang redenominasi tersebut. Beberapa pihak menyatakan jika redenominasi dilakukan, transaksi jual beli di masyarakat akan cenderung kacau. Selain itu kebutuhan

untuk melakukan redenominasi tersebut tidak terlalu mendesak. Sistem mata uang saat ini dianggap masih berfungsi dengan baik, di mana masyarakat dan dunia finansial dapat melakukan transaksi tanpa kendala berlebihan. Di sisi lain, ada sebagian pihak melihat kebijakan redenominasi dapat mengubah citra dari rupiah menjadi lebih baik. Selain itu dengan redenominasi akan membuat nyaman karena digit nilai rupiah tidak terlalu banyak sehingga kalkulasinya akan lebih mudah. Anggota DPR dari PKS ini juga berpandangan untuk bisa melakukan kebijakan redenominasi tersebut ada empat

syarat mutlak dipenuhi yaitu: kondisi perekonomian stabil; inflasi rendah dan stabil; adanya jaminan stabilitas harga; dan didasarkan atas kebutuhan riil masyarakat atau adanya dukungan pemahaman masyarakat. Volatilitas angka inflasi saat ini yang juga relatif masih tinggi perlu diwaspadai dalam menjalankan kebijakan ini. Selain itu, dukungan publik juga menjadi sangat penting karena Indonesia memiliki jumlah penduduk sangat besar dengan sebaran geografis luas. Selain juga karena masyarakat masih trauma dengan kebijakan sanering pada masa lalu. (okz)

Kebutuhan Energi Asia Ancam Ekonomi RI

Populasi Ikan Jurung Di Sergai Kian Langka

J A K A RTA ( Wa s p a d a ) : Pemulihan ekonomi dunia dipimpin negara di kawasan Asia mendorong naiknya kebutuhan energi di wilayah ini. Hal itu menjadi risiko tersendiri bagi perekonomian nasional. Sebab, di saat kebutuhan meningkat, pasokan energi primer yang minim dari negara produsen minyak dunia berdampak pada sulitnya harga minyak berada di bawah level 90 dolar AS per barel. Direktur perencanaan ekonomi makro Kementerian Perencanaan Pembangunan Nasional (PPN)/Bappenas Bambang Prijambodo mengungkapkan, pada 2011–2012, kebutuhan minyak dunia meningkat hingga 1,6 juta barel per hari menjadi 88,3 juta barel per hari dari kebutuhan pada 2010 capai 86,7 juta barel per hari “Persoalannya kini pada

SUNGAI Bahbolon merupakan hulu sungai Padang yang melintasi Desa Tinokah, Marubun, Serbananti, Sipispis, Silau Padang, Buluh Duri serta Desa Nagur Pane di Kec. Sipispis Kab.Serdang Bedagai sepanjang 15 kilometer yang selama ini menjadi lokasi berkembang biak secara alami ikan jenis Jurung yang saat ini populasinya kian langka akibat penagkapan ikan dengan cara-cara ilegal. “ Sepuluh tahun yang lalu populasi ikan Jurung di Sungai Bahbolon, Kec. Sipispis masih banyak dan untuk mendapatkannya sangat mudah, sehingga setiap waktu kita bisa menikmati ikan tersebut. Namun saat ini sudah tergolong sulit harus pesan kepada pemancing dan butuh waktu beberapa minggu bahkan lebih untuk mendapatkannya,” ujar Ketua Komisi B



NEWTON PRIVATE LESS Ingin Sukses pada Ujian Semester UN, SNMPTN, SD - SMP, SMA Hub. 0813.9642.0150 KURSUS KOMPUTER CEPAT -


Ms Office (Word + Excel)......................... 200 Rb (2 minggu) Komputer Aplikasi Perkantoran Lengkap 450 Rb (1 bulan) Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) Desain Grafis + iNTERNET....................... 600 Rb (1 bulan) WEB Programing...................................... 500 Rb (10 hari) DISCOUNT 20% Daftar langsung belajar Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Telp. 844.2158 - 844.2159 WEBSITE:

pasokan dan keterbatasan produksi oleh negara non-OPEC,” ungkap Bambang di Jakarta, Senin (21/3). Dari total tambahan kebutuhan sebesar 1,6 juta barel per hari tersebut, negara nonOPEC hanya sanggup memproduksi 0,2 juta barel per hari. Untuk menutupi tambahan kebutuhan ini, kini sepenuhnya bergantung pada produksi negara OPEC.Di sisi lain,masalah yang ditimbulkan gejolak politik di Timur Tengah yang belum juga mereda membuat harga minyak makin tinggi. Menurut dia,Departemen Energi Amerika Serikat menyebutkan harga minyak tahun ini diperkirakan berada pada kisaran 102 dolar AS/barel dari sebelumnya hanya diperkirakan berada pada level 93 dolar AS per barel. “Jadi,kemungkinan sangat

DICARI TUKANG PANGKAS Yang berpengalaman Hub. 0813.6084.5333 Pak Lamindo Tarigan


Dibutuhkan segera tenaga kerja P/W usia (1735 thn) untuk posisi dlm kantor, BUKAN SALES Syarat: - Pendidikan min. SMU/ sederajat - Bawa berkas surat lamaran lengkap + Guntingan iklan ini untuk proses interview Penghasilan: Rp. 1.800.000/bln HUB. IBU ELSA, SE

HP: 0821.6563.3677 - 0812.6388.5458 Alamat kantor: Jl. Brigjen. Hamid No. 8B (±10m dari jembatan kanal arah Delitua Medan NB. 5 Pelamar pertama lebih diutamakan


2 orang laki² diutamakan mahasiswa IAIN dan tamatan Musthofowiyah Purba Baru, untuk menjaga sekolah SD Swasta Al-Halimiyah Jl. Mandala By Pass Gg. Aman No. 2 Medan Yang berminat hubungi alamat diatas

DIBUTUHKAN SEGERA INGIN LULUS KE PTN 2011? BERLATIHLAH DIBIMBINGAN TEST MEDICA Bimbingan Test Medica berpengalaman dibidangnya lebih dari 31 tahun sejak 1979 dan meluluskan ribuan siswa/i nya setiap tahun ke berbagai PTN di seluruh Indonesia

SMA PLUS SOPOSURUNG BALIGE Berlangganan ke Bimbingan “TEST MEDICA” lebih dari 19 tahun sejak 1992 dan rata-rata 100% ke PTN setiap tahun

Agar lulus PTN 2011 melalui SNMPTN dan Ujian PTN lainnya seperti: SIMAK UI, UM-UGM,USM STAN, dll INFORMASI LEBIH LANJUT HUBUNGI (SMS): -

Jonris M, S.Pd Berdaulat B, S.S Basri Ginting, S.T. Ir. Tagor Silalahi Rosmaulina Siregar

(0852.7955.6484 (0812.6455.287) (0812.639.6203) (0812.6493.252) (0852.1139.9449)


- Paling banyak siswa/i nya saat ini di kota Medan - Pilihan utama siswa/i kelas 3 SMA yang ingin melanjut ke PTN Daftarkan segera anak-anak anda ke Bimbingan Test Medica, jangan ke tempat lain demi keberhasilan investasi dari Bapak/ Ibu

PROGRAM INCENTIVE 20115 MEDICA: Mulai: 25 April 2011 s/d SNMPTN 2011 AGAR LULUS PTN TAHUN 2011 Informasi lebih lanjut hubungi: Jl. Bantam No. 12 Medan Telp. (061) 457.8058




Mendesak !! Sekolah Baru membthkan guru TK min lls SMA, kreatif & suka dunia anak Hub: Jl. Gatot Subroto No. 103 Bandar Siunembah Ph: 882.5895


Sebuah perusahaan dalam bidang IT dan Alat-alat Survey, membutuhkan staff/ karyawan sbb: 1. Sales Engineer: Jurusan Elektro, Tehnik Civil dan Informatika 2. Tehnisi: SMK Jurusan Elektro dan Elektronika Segera antar surat lamaran anda atau kirimkan via pos ke: Jl. Brigjend. Katamso No. 402-B Medan 20159

kecil (harga minyak) berada di bawah 90 dolar AS per barel,”tuturnya. Mengantisipasi hal itu Indonesia harus memperkuat ketahanan energinya. Sebab, dengan kuatnya laju pertumbuhan ekonomi nasional, kebutuhan energi pun semakin besar. Langkah jangka pendek dan jangka panjang untuk mengantisipasi hal ini perlu dipersiapkan. Indonesia yang memiliki sumber daya alam berlimpah, khususnya batu bara, gas, dan panas bumi, harus mampu mengembangkan potensi-potensi tersebut secara maksimal. Menteri PPN/Kepala Bappenas Armida Alisjahbana menambahkan, pemerintah masih terus memantau perkembangan harga minyak dunia dan relevansinya terhadap perekonomian nasional. (okz)

Kami perusahaan korea yang bergerak dibidang alat² terapi U/ ditempatkan sbg:


Dengan persyaratan: 1. Mampu bekerja dlm work team 2. Mampu memimpin org lain 3. Disiplin & jujur serta bertg. jawab 4. Diutamakan yg pernah mjd Manager



Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik RUMAH DIJUAL CEPAT Rumah 2 Tingkat, Luas Tanah: 200m², Luas Bangunan: 160m² Fasilitas: 3 Kamar Tidur, Dapur, Kamar Mandi, Garasi mobil, Ruang tamu Jl. Ibrahim Umar Gg. Reda Hati No. 8 Medan Hubungi HP. 0852.9670.9192 Tanpa SMS/ Tanpa Perantara, Harga 400 Jt

DIKONTRAKKAN/ DISEWAKAN Perumahan Anugrah Asri depan Kodam: 1 Tahun Rp. 7.500.000, Fasilitas: 2 unit AC + Mesin cuci Serius hub. 0813.6116.7144


Usaha Taman kanak-kanak dan peralatannya ada Tpt tinggal Hub. 0812.654.6463


HUB: JL. TITIPAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING MEDAN TELP. (061) 457.6116 - 451.2319 0813.6137.2321 - 0812.6495.8456























Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

Tingkat Keberhasilan Optimal, Profit Terus dan Strategi terbaik, Tak stress, santai. Hanya Rp. 2,5Jt. (sudah Termasuk deposit $100). Mr. WAM: 0852 7012 5480


Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866

Ingin Promosikan Produk Anda Harian

Media yang Tepat untuk Iklan Anda

Training Center

Pasang Iklan “WASPADA”

Telp: 061 - 4576602

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333


Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!



Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda




Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663




Kami memiliki Solusi Trading yang Nyaman dan menghasilkan minimal 100 pips / hari.

Metode CHAOS TRADING Biaya Training Rp 15.500.000,(*Tempat Terbatas, Max 5 Org/Kelas) MasterForex Sumatera Training Center Mandiri Building Lt.6, Jl. Imam Bonjol No. 16D Medan 20112 Sumatera Utara – Indonesia Tel. +62-61-3000 33 00 Fax. +62-61-3000 33 84 e-mail :

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan


Ingin Trading Futures : Forex, Index, Commoditi, Metals, Cfd Stock US, Cfd Indices, Cfd Financial Gold, Silver. Spread Mulai dari 2 Point Bebas Biaya (Swap Dan Cash Komisi)

0852 6544 9755 2630 0812 027 0812 65440888 027 061-7531 (061) 6310 7531 0888 0812 0401

Media yang Tepat untuk Iklan Anda











Ingin Promosikan Produk Anda

Cucu Asli Mak Erot Bersama

Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Harga Mulai Rp. 170 Jt-an SISA 6 UNIT

JL. KEDIRI NO. 36 MEDAN TELP. 451.6161


Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun





TELPON : 061 - 4576602 FAX : 061 - 4561347





* Format: JPG - TIFF (Photoshop)

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

085297552630 08126544027 081263100401



Seperangkat alat-alat salon Hub. 0812.6006.719

Dengan persyaratan sbb: 1. Pria, usia max. 40 thn (1, 2) 2. Pendidikan min. SMA sederajat (1, 2) 3. Berpengalaman dibidangnya min. 5 tahun (1) 4. Berpengalaman dibidangnya min. 3 tahun (2) 5. Mampu bekerja keras perorangan maupun team 6. Jujur, teliti, rajin, bertanggung jawab dan memiliki loyalitas tinggi Kirimkan lamaran lengkap, berikut foto terbaru, CV, dan perlengkapan penjang lainnya, ke: Jl. H. Adam Malik No. 72 dengan kode MK disudut kanan atas, paling lambat 1 minggu setelah iklan ini diterbitkan


Keterangan lebih lengkap silahkan hubungi:





Hub. 0852.6162.4824 0813.9600.7775

Kami perusahaan yang berkembang, membutuhkan karyawan untuk ditempatkan sebagai:

� Edi Saputra


HOTEL MADINAH : DALLAH TAIBA, AL-HARAM (5*) HOTEL MAKKAH : JAWHARAT ANFAL (4*) HOTEL JEDDAH : AL AZHAR (5*) JARAK HOTEL KE MESJID ±50 METER Khusus bagi jema’ah dari luar kota nginap di Hotel Madani Gratis Offic: Gedung Gelora Plaza Jl. SM. Raja No. 4/18 Medan Telp. (061) 732..6981 - 0813.7503.1889 Fax. (061) 732.6981

Tipe 21 di Perumnas BT 6 Pem. Siantar

Rumah Villa Jl. Beo Indah I No. 9 Sei Sikambing B, 4 KT, 3 KM, Km Pembantu, Garasi, Halaman luas Hub. 0852.6191.7311

Perikanan dan Kelautan Sergai juga pernah menaburkan benih ikan Jurung dan emas lainnya di aliran sungai Bahbolon di Desa Serbananti sekitar 20.000 ekor, sebagai upaya menambah populasi ikan langka itu,” terang Yatno. Sementara itu salah seorang pemancing warga Dolok Masihul Ishak Janggawirana menuturkan sekira lima tahun lalu masih mudah mendapatkan ikan Jurung dengan ukuran dua hingga tiga kg per ekornya di Sungai Bahbolon, Kec. Sipispis. Namun sekarang sudah sulit termasuk jenis ikan lainnya karena semakin langka sehingga terpaksa menyalurkan hobi memancing ke kolam pancing,” ujarnya kepada Waspada di Sei Rampah.

IZIN USAHA: 503/1099.SK.HO/SL/NT/08



Surat lamaran kerja ditujukan ke: Jl. Mesjid No. 139

SERTIFIKAT HAK MILIK HARGA NEGO HUB: 0813.9714.1313 0852.9799.9799


Lux, Type 45 Plus Jl. Mesjid Albadar VI No. 9A Mdn, Granit, 2 KT, 1 KM, RT, R. Mkn, Gypsum, SHM, Rp. 128 Jt, Cash(Disc 40%) Hub. 0812.6411.5330 (H. Amran) (061) 7690.3888 (H. Surya)

Law Office “HK & Associates” Jalan Waringin No. 22-G Medan Telp/ Fax: (061) 4553.778 Email:

Selambat-lambatnya 2 minggu setelah iklan ini terbit




Berpengalaman, Profesional


Hub. 0812.6333.9278


Dengan syarat sebagai berikut: 1. Pria, usia min. 25 tahun (1) & (2) 2. Wanita, usia min. 25 tahun (3) 3. Pendidikan min.SMU sederajat (1), (2) & (3) 4. Memiliki SIM C dan kenderaan sendiri (1) & (2) 5. Mengerti barang sparepart (2) 6. Sehat, disiplin, rajin, jujur, ulet dan bertanggung jawab (1), (2) & (3) 7. Mampu bekerjasama dalam team (1), (2) & (3) 8. Dapat bekerja lembur (1), (2) & (3) 9. Berdomisili disekitar Pulo Brayan s/d Belawan (1), (2) & (3)

TANAH DIJUAL Kavlingan Ukuran 7x29m di Jl. Medan - Batang Kuis, Dengan proyek Star Plaza Hubungi: 0813.1081.6239 - 0813.6241.9134

dalam hal ini Dinas Perikanan dan Kelautan kirannya untuk dapat mencari solusi guna melestarikan pupulasi ikan Jurung di Kec.Sipispis dan bila perlu dibeberapa lokasi dialiran sungai tempat berkembang biaknya ikan itu dijadikan lubuk larangan sehingga populasinya tetap terjaga, harap politisi asal PAN. Hal senada juga diutarakan oleh Kepala Desa Serbananti Suyatno mengaku langkanya populasi ikan Jurung diakibatkan penangkapan secara ilegal dan pengawasannya sulit karena sering dilakukan dimalam hari serta di lokasi-lokasi sunyi dan sulit. “Padahal kita selalu mengimbau kepada masyarakat untuk tidak melakukan menangkap ikan dengan cara ilegal. Sekitar tahun 2008 Dinas






Tanah/ Bangunan Uk. 17x23m Daerah L.P. Pemasyarakatan Hub. 0819.828.986/ 844.8380


Rumah ukuran, LB. 312m, LT. 4380m, KT 4, KM 5, Garasi, SHM, 200m sebelum Kantor Camat Kecamatan Seruway, Aceh Tamiang 0813.6050.4833

Kami sebuah perusahaan yang bergerak dibidang Jasa Angkutan, membutuhkan tenaga kerja yang potensial untuk menempati posisi: 1. Mandor Lapangan 2. Lapangan Pembelian Sparepart 3. Operator Telepon


Dijual Rumah L. Manis Psr. 14, LB. 10x15, 2 KM, 3 KT, Gudang, Keramik, Ukuran Tanah 30x15m

Kirimkan lamaran lengkap, dgn foto terbaru, CV, transkrip nilai terakhir ke: Jl. Mandala By Pass No. 108A Contact nomber: 0857.6500.2308

Dibutuhkan beberapa karyawati untuk ditempatkan sebagai: 1. Sekretaris 2. Public Relation 3. Keuangan Persyaratan: 1. Berpenampilan menarik 2. Umur maksimal 23 tahun 3. Pendidikan min. D1 4. Dapat berbahasa Inggris & Mengoperasikan komputer 5. Jujur, rajin serta bertanggung jawab: Lamaran diantar langsung ke:

Waspada/Edi Saputra KETUA Komisi B DPRD Sergai Mahyudin Porba, S.Sos menunjukkan ikan Jurung seberat 2,8 Kg hasil pancingan di sungai Bahbolon Kec.Sipispis populasinya kian langka akibat penangkapan ikan secara illegal. Foto direkam Minggu (20/3).

DPRD Sergai Mahyudin Purba warga Dusun I Desa Marubun Kec. Sipispis kepada Waspada, Senin (21/3). Bukan tanpa sebab, imbuhnya karena kurangnya kesadaran segelintir warga sekitar menangkap ikan langka itu dengan cara ilegal seperti meracun sungai, menyetrum, air mas serta memakai bom sehingga mengakibatkan terhambatnya perkembang biakan ikan Jurung khusunya dan jenis ikan lain umumnya, karena anak ikan sebagai cikal bakal turut musnah, imbuh bapak empat anak itu. “Padahal prospek ikan Jurung ini cukup menjanjikan dan bernilai ekonomis tinggi, kemarin ini saja dari pemancing setempat ikan seberat 2,8 kg satu ekor saya beli seharga Rp80 ribu per kilogramnya,’’ papar Mahyudin Purba. Kiranya Pemkab Sergai




Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887

Ekonomi & Bisnis


WASPADA Selasa 22 Maret 2011

GAPKI Terbitkan 82 Fakta Sawit MEDAN (Waspada) : Sebanyak 82 fakta yang ditunjukkan Gabungan Asosiasi Kelapa Sawit Indonesia (GAPKI) didalam menjawab pandangan miring negara Eropa terhadap produksi sawit Indonesia terlalu meningkat drastis setiap tahunnya.

Waspada/Ibnu Kasir

MANAJER Sentra Langkat Keramik HT Mahmud Yusuf ketika memberi penjelasan seputar ekspor perdana keramik/grabah dari Langkat secara langsung ke Krosia di Galeri Keramik Langkat di Kelurahan Kebunlada, Kecamatan Hinai, Minggu (20/3).

Grabah Langkat Ekspor Ke Eropa STABAT (Waspada): Berbagai bentuk keramik/grabah yang diolah dari tanah liat , merupakan buah tangan para pengrajin keramik dari Kecamatan Hinai, Kabupaten Langkat sejak beberapa tahun belakangan ini ternyata memperoleh peluang pasar pada bebe-

rapa negara di Eropa dan Asia. Walau selama ini ekspor keramik Langkat ke berbagai negara, masih menggunakan pihak ketiga. Setelah produk keramik/ grabah dari Langkat dipamerkan pada Ekspo 2010 di Jakarta tahun lalu, banyak pihak yang

Indonesia Diminta Bujuk Wisatawan Eropa Selain Jepang MEDAN (Waspada): Indonesia diharapkan dapat mengambil manfaat dari musibah gempa dan tsunami di Jepang, dengan memanfaatkan arus kunjungan wisatawan manca negara asal Eropa ke Indonesia bahkan ke Sumut. Wisatawan Jepang sudah pasti untuk waktu lama tidak akan datang berlibur ke Indonesia bahkan ke negara lain yang menjadi destinasi wisata selama ini. Jepang sedang membenahi infrastruktur daripada berlibur, kata Maruli Damanik, manajer Lovely Holiday saat dikonfirmasi di Bandara Polonia Medan menjelang bertolak ke Penang, Senin (21/3). Dia ke Penang dalam kaitan mempromosikan keindahan alam Sumut. Selama ini Sumut merupakan urutan pertama kunjungan wisatawan Malaysia, ada kaitan budaya dan keluarga. Dia menilai saat ini wisatawan mancanegara yang biasanya berkunjung ke Jepang pasti mengurung niatnya. Mereka wisatawan masih takut dan trauma kondisi imbas partikel meledak Pusat Listrik Tenaga Nuklir (PLTN) di Fukushima Jepang sejak Sabtu (12/3).

Dalam kaitan inilah, seharusnya pemerintah Indonesia dapat mengambil langkahlangkah tepat dan berusaha meyakinkan wisatawan yang biasanya datang ke Jepang, mengalihkan perjalanan ke Indonesia. Tentunya dalam kaitan ini harus dapat meyakinkan mereka dengan mempromosikan keindahan alam, memperbaiki infrastruktur termasuk hotel yang layak huni, kata Damanik. Bagaimana dengan kunjungan wisatawan Jepang ke Sumut, pimpinan Lovely Holiday menilai, selama ini Sumatera Utara bukan destinasi liburan wisatawan Jepang. Mereka datang karena kekeluargaan, budaya dan nenek mereka pernah bekerja di daerah ini. Destinasi wisatawan Jepang hanya Bali, karena mereka menyenangkan keindahan pantai dan budaya disana. “Kunjungan ke Sumut hanya sebatas bisnis bukan berlibur,” ujar Maruli Damanik. Begitupun, untuk masa akan datang dia yakin wisatawan manca negara termasuk Jepang akan ramai-ramai datang ke Sumatera Utara asalkan infrastruktur mendukung. (m32)

KP2KP Sibuhuan Sosialisasi Pajak OP PNS SIBUHUAN (Waspada): Kantor Penyuluhan dan Konsultasi Perpajakan (KP2KP) Sibuhuan mengadakan sosialisasi pajak dan pengisian SPT tahunan Orang Pribadi (OP) bagi Pegawai Negeri Sipil (PNS) dan bendaharawan di jajaran Dinas Pendidikan Padanglawas. Hendra Purwanto, Kepala Kantor Penyuluhan dan Konsultasi Perpajakan (KP2KP) Sibuhuan, Jumat (18/3) mengatakan, setelah pelaksanaan panutan penyampaian SPT tahunan PPh Kepala daerah (Bupati) dalam rangka meningkatkan kesadaran dan kepedulian

masyarakat (wajib pajak) untuk melaporkan SPT tahunan PPh orang pribadi. Maka KP2KP Sibuhuan juga melaksanakan sosialisasi tata cara pengisian SPT tahunan wajib pajak orang pribadi PNS dan bendaharawan, pengisian formulir 1721 A2 dilakukan bendahara menyangkut gaji PNS dalam satu tahun. Kata Hendra Purwanto mewakili Chr Erwin Priyambodo, pemateri dalam sosialisasi itu disampaikan Usman dan Satria Ginting, Account Representatif (AR) KPP Pratama Padangsidimpuan. (a33)

KPPPratama P.Sidimpuan Serahkan SPPT Dan DHKP PBB Palas SIBUHUAN (Waspada) : Kantor Pelayanan Pajak (KPP) Pratama Padangsidimpuan menyerahkan Surat Pemberitahuan Pajak Terhutang (SPPT) dan Daftar Himpunan Ketetapan Pajak (DHKP) Pajak Bumi dan Bangunan tahun 2011 Kabupaten Padanglawas. Kepala Kantor Penyuluhan dan Konsultasi Perpajakan (KP2KP) Sibuhuan, Senin (21/ 3) menjelaskan, penyerahan SPPT dan DHKP PBB kabupaten Padanglawas dilaksanakan langsung Kepala KPP Pratama P.Sidimpuan Chr. Erwin Priyambodo DP dan diterima secara simbolis oleh Bupati Basyrah Lubis. Dikatakan, SPPT diserahkan itu termasuk PBB sektor pedesaan dan perkotaan dari sem-

bilan kecamatan di Padanglawas dengan total pajak terhutang Rp1.691.990.798. Kata Hendra Purwanto, penyerahan SPPT dan DHKP itu merupakan kegiatan rutin tahunan dilaksanakan di awal tahun agar pemungutan dilakukan pemerintah daerah tidak melewati batas waktu bulan September yang telah ditetapkan sesuai peraturan dan dan perundang-undangan. Sementara target PBB dibebankan kepada KPP Pratama Padangsidimpuan untuk 2011 memiliki wilayah empat kabupaten/kota sebesar Rp 137 miliar. Sedang target PBB Padanglawas dari sektor perkebunan, pedesaan, dan perkotaan sebesar Rp27 miliar. (a32)

berminat untuk melakukan transaksi, kata Manajer Sentra Langkat Keramik HT Mahmud Yusuf dalam acara ekspor perdana secara langsung ke Krosia ( Eropa) di Galeri Keramik Langkat Lingkungan V-B Kelurahan Kebunlada Kecamatan Hinai, Minggu (20/3). Menurut Mahmud Yusuf, produk keramik grabah dari beberapa daerah di P Jawa seperti Kasongan dan Plered sejak lama populer di luar negeri, tetapi produk dari Langkat baru mulai mencuat namanya dalam dua tiga tahun belakangan ini. Persaingan pasar global kata Mahmud Yusuf, bukanlah dari dalam negeri akan tetapi dari beberapa negara Asia seperti Vietnam dan Kamboja. Bahkan keramik dari Itali merupakan pesaing utama, karenanya para pengrajin harus mampu bersaing dengan meningkatkan design dan kualitas produk.

Ekspor perdana Langkat Keramik ditandai dengan pelepasan satu unit truk bermuatan keramik dengan pemecahan kendi oleh Asisten Adm. Ekbangsos Indra Salahudin, sebagai tanda pemberangkatan ekspor secara resmi.’’ Kita menyambut baik upaya dilakukan sentra perajin ini dan berharap agar dapat mempertahankan kepercayaan konsumen,’’ kata bupati dalam sambutan tertulisnya. Wakil Ketua DPRD Abdul Khair, sangat mengapresiasi produk putra Langkat menembus pasar Eropa dan berharap pembukaan perdagangan ini memberikan nilai tambah bagi Pemkab Langkat. Dirinya berharap para pengusaha baik kecil, menengah maupun besar di Kabupaten Langkat untuk berupaya menembus pasar lokal maupun global dengan tetap mengedepankan mutu dan memperhatikan aturanaturan yang ada. (a01)

Pandangan miring tersebut tidak hanya mengambil lahan hutan melainkan ekosistem rentan bagi ketananan pangan rakyat Indonesia. Namun kenyataannya, hasilnya dari perkebunan itu justri lebih dari 70 persen untuk menghasilkan pangan. “Pada dasarnya secara alamiah luas lahan hutan Indonesia lebih dari 120 juta ha, namun apakah dengan luas lahan sawit

saat ini berkisar 8 juta ha mempengaruhi,” ujar Ketua GAPKI Sumut BalamanTarigan di Medan, Senin (21/3). Bahkan dari 82 fakta dipaparkan, lanjutnya, semuanya memberikan keuntungan bagi segmen-segmen usaha lainnya. “Untuk itu pada puncak 100 tahun sawit digelar di Medan pada 27 s/d 30 Maret di Lapangan Parkir Hotel Tiara nantinya akan diluncurkan buku Fakta Kelapa Sawit Indonesia dengan 82 manfaat dari perkebunan kelapa sawit itu sendiri,” ujarnya didampingi Timbas Ginting, Laksamana Adhyaksa, Darma, dan Hakim Bako. Dengan mengundang seluruh duta besar pengusaha sawit di dunia dari tujuh negara seperti Malaysia, Gana, Kolombia, dan negara lainnya. “Hal ini tentunya agar mengembalikan kepercayaan negara-negara Eropa terhadap hasil-hasil produksi di Indonesia,” ujarnya kembali. Bendahara GAPKI, Laksa-

mana Adhyaksa menyatakan pada peringatan 100 tahun sawit ini pihaknya selain menggelar workshop di lembaga penelitian sawit juga akan melakukan Memorandum of Understanding (MoU) bersama Apkasindo, dan LPP dalam penyediaan lembaga penyuluhan pertanian perkebunan sawit swadaya. “Tentunya dengan penyuluhan tersebut diharapkan program 35 – 26 ataupun 35 ton per hektar per tahun dengan kadar randemen 26 tercapai di tingkat petani,” ujarnya. Walau hal ini telah dilakukan oleh pihak perkebunan swasta, dan BUMN, lanjutnya, namun perlu ada pemerataan pengetahuan dan penghasilan agar dapat dirasakan petani sehingga ke depan lebih baik. “Selain kita saat ini sedang menjajaki apakah beberapa mentri akan ikut didalam mengisi 100 tahun sawit ini seperti Menteri Perekonomian, Pertanian, BUMN, dan lainnya,”

ujarnya. Namun intinya, lanjutnya, pagelaran ini diharapkan menjadi wadah perkebunan atau Indonesia Suistanable Palm Oil agar kedepannya hasil produk sawit di Indonesia lebih baik. PE dikembalikan Ketua GAPKI Sumut Balaman Tarigan juga berharap pajak ekspor hingga akhir 2010 mencapai Rp20 triliun agar dikembalikan ke Sumut ataupun minimal pembangunan infrastruktur dipercepat. “Dalam hal ini GAPKI, Apkasindo, Dewan Minyak Sawit, Apindo telah meminta kepada pemerintah untuk pengembalian pajak ekspor yang dipungut oleh pemerintah terhadap sawit kita seperti halnya provinsi Riau,” ujarnya. Namun, lanjutnya, saat ini kita sedang menunggu apakah pemerintah berbaik hati kepada Sumatera Utara atau tidak penting pelaksanaan 100 tahun sawit terlaksana dengan baik. (m38)

TBS Makin Merosot, Petani Di Simalungun Mengeluh SIMALUNGUN (Waspada): Harga kelapa sawit (TBS) di Simalungun terus mengalami penurunan cukup drastis, dari sebelumnya Rp1.800 per kg, kini menjadi tinggal Rp1.350 s/d Rp1.370 per kg. Penurunan harga kelapa sawit tersebut berlangsung secara bertahap dan sudah berlangsung sejak tiga minggu terakhir. Merosotnya harga kelapa sawit itu membuat kalangan petani di daerah itu mengeluh. “ Kami tidak tahu apa penyebab turunnya harga kelapa sawit ini. Padahal harga minyak goreng di pasaran tetap tinggi. Sementara harga penjualan kepada agen penampung yang biasanya membeli buah kelapa

sawit petani serempak menurunkan harga,” terang John Sinaga, petani di Kec. Bandar Huluan. Kepada Waspada, Senin (21/3), kalangan petani mengatakan turunnya harga kelapa sawit membuat mereka heran dan tak menyangka kalau penurunannya sampai sedemikian tajam. Apalagi harga minyak goreng dipasaran tidak mengalami perubahan atau penurunan. Sehingga petani bertambah heran dan menduga-duga turunnya harga kelapa sawit tersebut hanya permainan pihak-pihak pemilik PKS dan agen penampung. Lebih lanjut dijelaskan petani, saat ini harga jual kelapa sawit petani hanya tinggal Rp1.350 s/d Rp1.370 per kg. Padahal sebelumnya harga

telah cukup mengembirakan mencapai Rp1.700 – Rp1.800 per kg. Petani juga tidak mengetahui secara pasti apa menjadi penyebab turunnya harga kelapa sawit dimaksud. Biasanya kalau pun harga turun hanya sekitar Rp50 s/d Rp100 per kg dan dalam tempo beberapa hari kemudian harga kembali membaik. “ Kalau harga merosot terus, kami dipastikan tidak mampu merawat tanaman kami, karena harga kelapa sawit tidak sebanding lagi dengan harga pupuk yang jauh lebih mahal,” tambah Sinaga. Hal sama juga dikemukakan petani kelapa sawit lainnya. Menurut petani yang mengaku warga Kec. Gunung Maligas ini, turunnya harga komoditi kelapa sawit hingga ke tingkat terendah seperti itu membuat petani

‘kelabakan’ alias bingung tujuh keliling. Betapa tidak, rata-rata petani sawit telah berutang kepada agen pembeli sawit, sehingga dengan turunnya harga sawit tersebut membuat petani kesu-litan mencicil utangnya kepada agen. Sementara Jaya Saragih salah seorang agen penampung kelapa sawit di Pamatangbandar yang dihubungi membenarkan turunnya harga kelapa sawit tersebut. Menurutnya, penurunan harga berlangsung hampir setiap hari. Dia juga tidak mengetahui apa penyebab turunnya harga komoditi itu. “ Saya tidak tahu penyebabnya, tetapi yang menentukan harga adalah pihak PKS (Pabrik Kelapa Sawit). Kami hanya mengambil sedikit keuntungan untuk biaya transportasi,” tukas Saragih. (a29)

Pabrik Sawit Harus Tolak TBS Tak Penuhi Syarat

Waspada/Surya Efendi

PHILIPS CARE CENTER: Presiden Direktur PT Philips Indonesia, Robert Fletcher (tengah) didampingi Senior Marketing Manager Philips Lighting Hendry Syafrullah (kiri) meninjau kantor Philips Care Center saat peresmian di Medan, Sabtu (19/3). Philips Care Center yang pertama dibangun di Indonesia tersebut akan memberikan dukungan konsultasi dan solusi terkait tata cahaya kepada konsumen.

Pemerintah Jamin Pasokan BBM Di Daerah J A K A RTA ( Wa s p a d a ) : Pemerintah hingga saat ini belum memutuskan kebijakan pembatasan bahan bakar minyak (BBM) bersubsidi. Fokus utama pemerintah adalah menjaga kelancaran pasokan BBM di daerah. Menteri Koordinator Perekonomian, Hatta Rajasa, mengatakan, perhatian utama pemerintah menjamin agar jangan sampai terjadi penyelundupan BBM bersubsidi. “Pasokan di daerah cukup dan volume BBM bersubsidi 38,6 juta kiloliter. Membengkaknya penggunaan BBM bersubsidi karena ada penyalahgunaan dan penyimpangan,” kata Hatta usai rapat kerja dengan Bank Indonesia di gedung Bank Indonesia, Jakarta, Senin, (21/3). Mengenai perkembangan harga minyak mentah Indonesia (Indonesian Crude Price/ ICP) dan rencana pembatasan BBM, menurut Hatta, akan dibicarakan bersama Dewan Perwakilan Rakyat (DPR). Hatta juga mengatakan pemerintah tetap mencermati masukan Bank Dunia menilai momentum penerapan kebijakan pembatasan BBM tepat dilakukan saat ini.

“Kami mempertimbangkan dari segi fiskal dan tetap memperhatikan daya beli masyarakat,” tuturnya. Mengenai tiga opsi pembatasan BBM, menurut Hatta, pemerintah dapat mengajukan semua opsi, namun belum ada pemikiran menaikkan harga BBM. Sebelumnya, Tim Kajian Pengaturan BBM Bersubsidi, Anggito Abimanyu mengajukan tiga opsi terkait rencana pembatasan BBM. Pertama, harga premium menjadi Rp5.000 atau naik Rp500 per liter. Sementara itu, untuk angkutan umum diberikan cash back (pengembalian), sehingga secara riil harga Premium untuk angkutan umum tidak naik. Kedua, pengalihan konsumsi Premium ke Pertamax untuk mobil pribadi. Jika harga keekonomian Pertamax di atas Rp8.000, harga Pertamax dipatok sementara pada harga subsidi Rp8.000 per liter. Ketiga, harga Premium naik menjadi Rp5.000 per liter, sedangkan penjatahan volume Premium harga Rp4.500 liter untuk kendaraan umum pelat kuning. Dalam opsi ini perlu ada kendali seperti penggunaan

RFID (radio frequency identification). Menanggapi ketiga opsi tersebut, dalam rapat kerja dengan Komisi Energi DPR, hari ini, Menteri ESDM Darwin Zahedy Saleh, mengatakan, untuk opsi pertama, pemerintah memilih kebijakan tidak menaikkan harga BBM bersubsidi. Sementara itu, untuk opsi kedua, pemerintah akan mencari solusi BBM lain bagi pengguna mobil pribadi belum mampu membeli Pertamax. Namun, harga BBM akan disiapkan itu di bawah Pertamax. Selanjutnya, untuk opsi ketiga, pemerintah tidak menaikkan harga BBM bersubsidi. Meski demikian, perlu segera disiapkan alat kendali volume pembelian Premium. (vvn)

MEDAN (Waspada) : Asosiasi petani kelapa sawit Indonesia (Apkasindo) mendesak pabrik kelapa sawit (PKS) menolak tandan buah segar (TBS) tidak berkualitas atau tidak memenuhi syarat. Hal ini untuk perbaikan tanaman dan buah dihasilkan kebun petani dan menyukseskan program 35 ton per tahun per ha dengan kadar randemen sawit 26 (kadar minyak sawit) yang sesuai dengan standar TBS dunia atau (35 – 26). “Untuk itulah mengapa kita gencar meminta agar Peraturan Mentri Pertanian No. 17 Tahun 2010 tentang Pedoman Penetapan Harga Pembelian Tandan Buah Segar (TBS) Kelapa Sawit Produksi Pekebun,” ujar Ketua Apkasindo Pusat, Anizar Simanjuntak, di Medan, Senin (21/3). Karena dengan Permenpen tersebut, lanjutnya, harga minyak sawit mentah alias Crude Palm Oil (CPO) terus melambung tidak serta merta dinikmati oleh petani kelapa sawit. Hal ini dikarenakan, petani harus menanggung berbagai pungutan sehingga harga tanda buah segar (TBS) masih rendah di tingkat petani. “Saat ini hargaTBS di tingkat petani jauh di bawah harga patokan pabrik, jika harga patokan di pabrik sebesar Rp1.850 per kg, maka harga TBS diterima oleh petani bisa jadi hanya Rp1.350 per kg. Ini karena ada permainan pemasok tidak diawasi. Namun untuk saat ini, harga TBS mengalami penurunan dari Rp1.850 menjadi Rp1.670 per kg di tingkat petani,” ujarnya. Karenanya, Apkasindo berharap pemerintah merevisi kembali mengenai aturan pembelian TBS di tingkat petani. Karena dalam aturan ini tidak ada aturan jelas mengenai me-

kanisme pengawasan pembelian TBS di tingkat petani. Sehingga, para pengumpul bisa saja menekan harga dengan alasan kualitasTBS petani di luar standar yang ditentukan. Makanya, lanjutnya, Apkasindo mengusulkan ke pemerintah untuk melakukan pemeringkatan (grading) secara total. “Kalau buahnya tidak baik, harus dikembalikan. Selama ini buah yang jelek tetap diambil tapi dipotong harganya,” jelas Anizar. Selain itu, Anizar bilang Apkasindo juga mengusulkan kepada pemerintah agar dalam aturan pembelian TBS ini nantinya pemerintah menghapuskan pungutan biaya administrasi sebesar 3 s/d 5 persen. Tidak hanya itu, dalam revisi aturan ini, Apkasindo meminta pemerintah juga melibatkan Apkasindo dalam pengawasan pembelian TBS oleh pemasok. “Setiap suplier yang memasok TBS ke pabrik kelapa sawit (PKS) kalau bisa harus ada rekomendasi dari Apkasindo, karena yang dibeli itu TBS dari anggota Apkasindo,” ungkapnya. Untuk itu, lanjutnya kembali, pihaknya akan melakukan penyuluhan kepada petani didalam memilih bibit, teknologi bercocok tanam, akses pembiayaan, akses pupuk sehingga petani mendapatkan harga layak. “Kita juga berharap pemerintah dapat memberikan akses pembiayaan replanting bagi petani-petani yang telah memiliki kebun dengan masa tanam diatas 20 tahun. Jika tidak hal ini memungkinkan akan diambil investor luar,” ujarnya. Anizar Simanjuntak menyatakan ketiadaan dana untuk mereplanting memungkinkan petani menjual lahannya kepada investor luar seperti

Harga Emas Di Medan Jenis



London Murni






24 Karat

90 s/d 93%


Emas Putih

75 %

22 Karat




20 s/d 35%


Malaysia.“Sehingga yang dikhawatirkan adalah petani kita menjadi buruh di negerinya sendiri.” Ketua Apkasindo Tapteng, Akhyar Habeahan menyatakan kendala di masyarakat kurang pemahaman masyarakat tentang pemilihan bibit, perlakuan tanaman, kontinuitas pemberian pupuk serta pengambilan tandan buah segar di pohon, dan akses lainnya. “Dengan kondisi sedemikian rupa tersebut hasil diterima tidak maksimal bahkan pemotongan kerap terjadi di lapangan seperti di pabrik kelapa sawit,” ujarnya. Dirinya sendiri mengaku, sebelum menjadi anggota, pihaknya hanya dapat menghasilkan 40 s/d 50 ton dengan luas lahan 60 ha per panen. Namun setelah diberi penyuluhan kini mendapatkan 85 s/d 95 ton per panen. “ Ya meskipun diawal pelatihan ini kita mengalami kerugian lebih kurang sebesar Rp44juta per dua kali panen karena pemulangan TBS yang tidak memenuhi standar. Namun kita meraup untuk lebih seratus persen,” ujarnya. Untuk itu, lanjutnya, kita berharap petani lainnya juga melakukan hal sama dengan cara benar sehingga program pemerintah 35 – 26 tercapai. Sementara data lahan sawit Indonesia menurut Badan Pusat Statistik (BPS) diambil Apkasindo berkisar 8,4 juta ha dengan pemilik kebun negara 7,56 persen atau seluas 637.485 ha, pemilik kebun swasta 53,79 persen dengan luas lahan 4,523 ha. Sedangkan perkebunan rakyat 38,79 persen dengan luas lahan 3,269 ha dengan pola swadaya masyarakat sekitar 2,895 ha dan plasma 374.051 m2. (m38)

Valuta Asing Di Medan

Rp335.000 (m38)

Mata Uang



Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

9.140 8.226 8.620 14.068 1.169 104,50 6.679 11.825 2.870

8.890 8.054 8.454 13.783 1.148 101,50 6.445 11.063 2.800

Waspada, Selasa 22 Maret 2011  
Waspada, Selasa 22 Maret 2011  

waspada daily