Page 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

SABTU, Pahing, 7 Juli 2012/17 Sya’ban 1433 H

No: 23918 Tahun Ke-66

Terbit 32 Halaman (A1-12, B1-12, C1-8)

Harga Eceran: Rp2.500,-


BUPATI Buol, Amran Batalipu (tengah) dikawal petugas KPK setibanya di Bandara Mutiara Palu, Sulawesi Tengah, Jumat (6/7).

KPK Tangkap Bupati Buol

Festival Budaya Melayu Agung Digelar Di Medan

PALU (Antara): Bupati Buol, Amran Batalipu, tersangka suap izin usaha perkebunan sawit di daerahnya diterbangkan ke Jakarta guna menjalani pemeriksaan di Gedung Komisi Pemberantasan Korupsi (KPK), Jumat (6/7) sore. “Iya. Langsung ke KPK. Tidak ada pengawalan di pesawat. Kan ada pilot yang bawa pesawatnya,” kata seorang petugas dari KPK yang ikut mengawal Amran saat keluar dari ruang tunggu tamu penting (Very Important Person/VIP) di Bandar Udara Mutiara, Palu. Petugas tersebut tidak bersedia memberikan penjelasan lebih jauh tentang penangkapan Amran. Ia dan petugas dari KPK lainnya terus berjalan menuju pesawat. Amran Batalipu terlihat dikawal sejumlah polisi dipimpin Kepala Kepolisian Resort (Kapolres) Palu, AKBP Ahmad Ramadhan. Saat beberapa wartawan melontarkan pertanyaan, Amran yang juga Ketua Dewan Pimpinan Daerah (DPD) Partai Golongan Karya (Golkar) di Buol itu tampak menunduk di tengah-tengah pengawalan aparat. Amran menggunakan kaos putih dan celana kain hitam, serta menyembunyikan kedua tangannya yang diborgol ke dalam baju. Ia menjadi penumpang terakhir yang naik ke pesawat Garuda Indonesia melalui tangga depan pukul 16:00 WITA.

MEDAN (Waspada): Pembukaan Festival Budaya Melayu Agung dalam rangka Visit Medan Year 2012 di Lapangan Merdeka Medan, Jumat (6/7) malam, berlangsung meriah,dihadiri Raja-raja se Nusantara. Festival berlangsung hingga 10 Juli 2012. Hadir Sri Sultan Hamengku Buwono X, Sultan Deli Mahmud Lamanjiji Perkasa Alam, Pemangku Sultan Deli Tengku Raja Muda Deli Hamdy Osman Deli Khan, Sultan Serdang T.Ahmad Thala’a, Sultan Palembang juga Ketua Umum Yayasan Raja Sultan Nusantara (Yarasutra) Sultan Iskandar Mahmud Badaruddin, Wali Kota Medan Rahudman Harahap, Wakil Wali Kota Medan Dzulmi Eldin, sejumlah raja/ sultan se Indonesia dan undangan. Wali Kota Medan Rahudman Harahap selaku tuan rumah mengatakan, Festival Budaya Melayu Agung ini baru pertama kali digelar di Kota Medan. Tahun-tahun mendatang, festival seperti ini akan lebih baik lagi dan bertaraf internasional. ‘’Ini salah satu bentuk dan upaya pelestarian budaya-budaya di Kota Medan dan di Indonesia pada umumnya,’’ sebut Rahudman. Festival Budaya Melayu Agung dimeriahkan tarian Zapin dan tari Serampang 12 serta dihibur artis Iyet Bustami. Sejumlah stan kuliner, 6 pelaminan khas Melayu menghiasi festival ini. Festival ditutup 10 Juli 2012.

Lanjut ke hal A2 kol. 1

Waspada/Surya Efendi

WALI KOTA Medan Rahudman Harahap, Sultan Deli Mahmud Lamanjiji Perkasa Alam dan Sri Sultan Hamengku Buwono X memukul gendang pada pembukaan Festival Budaya Melayu Agung di Lapangan Merdeka Medan, Jumat (6/7) malam.

Lanjut ke hal A2 kol. 1

10.217 Lulus SNMPTN Sumut-Aceh MEDAN (Waspada): Sebanyak 10.217 mahasiswa baru akan menimba ilmu di Perguruan Tinggi Negeri Sumut-Aceh. Adapun rinciannya ,Universitas Sumatera Utara (USU) menerima sebanyak 3.344 mahasiswa baru melalui SNMPTN 2012 jalur tertulis. Universitas Negeri Medan (Unimed) sebanyak 2.245 orang. Unsyiah Banda Aceh 2.746, dan Unimal Aceh Utara 1.882 mahasiswa.

Hasil SNMPTN tahun 2012 jalur tertulis di USU, Unimed, Unsyiah dan Unimal diumumkan secara serentak, Jumat (6/7) pukul 19:30 oleh ketua dan sekretaris panitia lokal (Panlok). Ketua Panlok USU Prof Zulkifli Nasution mengatakan hasil pengumuman dapat dilihat melalui website dan media cetak. Didampingi Sekretaris Panlok Ir Saipul Bahri Daulay MSi dan Ka Humas USU Bisru Hafi SSos Msi, Prof Zulkifli mengatakan panitia USU juga menyediakan papan pengumuman hasil ujian ditempatkan di kampus USU. Katanya, jumlah peserta

SNMPTN diterima terdiri dari 138 Bidik Misi dan 3.206 Non Bidik Misi atau berdasarkan pengelompokannya terdiri dari 1.895 IPA dan 1.449 IPS. Jumlah calon mahasiwa baru yang diumumkan ini merupakan hasil seleksi ujian tulis yang dilaksanakan pada 12-13 Juni 2012 dengan jumlah peserta terdaftar

mencapai 35.591 orang. Jumlah calon mahasiwa baru yang diterima tersebut akan menduduki kursi pada 47 program studi S-1 Reguler di universitas ini. Sementara itu secara terpisah, Ketua Panlok Unimed, Prof Kahiril Ansari mengatakan dari 19.114 peserta yang mengikuti

SNMPTN 2012, melalui jalur tertulis, 2.245 dinyatakan lulus. “Kami umumkan jumlah peserta SNMPTN 2012 jalur tertulis sebanyak 2.245 orang,” katanya didampingi Pembantu Rektor III Unimed, Prof Dr Biner Ambarita dan Kabag Humas, Tappil Rambe. Prof Khairil mengatakan

jurusan paling diminati Biologi, Fisika, Matematika, Kimia, dan Bangunan. Dia mengatakan jumlah ini meningkat 10 persen dari SNMPTN tahun lalu. Menurut Prof Khairil, persaiangan atau seleksi masuk Unimed begitu ketat, hanya 5,7 persen

Lanjut ke hal A2 kol. 3

Pemprovsu Cairkan Anggaran PON


SEBUAH mobil Toyota Innova BK 1192 KI tergencet kontainer setelah bertabrakan dengan truk kontainer L 8767 UR dan Isuzu Panther AD 8437 JB di Simpang Empat Semampir, Kediri, Jawa Timur, Jumat (6/7) dini hari.

Lima Warga B. Aceh Tewas Di Kediri BANDAACEH (Waspada) : Kecelakaan lalu lintas di Kediri, Jawa Timur tepatnya di perempatan jembatan baru Kel. Semampir, Kota Kediri merenggut lima nyawa warga Kota Banda Aceh, Jumat (6/7). Korban yang baru pulang dari liburan di Bali dengan menumpang mobil Innova tewas akibat tertimpa bak container. Para korban, yakni Jenda Ingan Mahali ,48, dosen dari Universitas Muhammadiyah Aceh, Koirul Fadli, 28, pengemudi dan Andi sopir cadangan.Yulia Sari, 38, (istri Jenda Ingan Mahali), Bella Tamia Grasi, 17, (anak Yulia Sari), Tasya Amalia, 12, (anak Yulia Sari). Ayahanda Yulia Sari, Samsul Bahri di kediamannya di kawasan Lampineung Kota Banda Aceh mengatakan, korban selamat yaitu menantunya Jenda Ingan Mahali. “Jenda yang memberi kabar kepada keluarga di Banda Aceh,” ujarnya. Mendapat kabar itu, keluarga yang berada di Jakarta dan Aceh langsung berangkat menuju Kediri untuk membawa pulang

Lanjut ke hal A2 kol. 1

MEDAN (Waspada): Setelah sebelumnya sempat tidak jelas dan terkatung-katung nasib kontingen Pekan Olah Raga Nasional (PON) asal Sumatera Utara (Sumut), akhirnya Pemprovsu mencairkan anggaran untuk membiayai seluruh kebutuhan atlet. Sekretaris Daerah Provinsi (Sekdaprov) Nurdin Lubis kepada wartawan di Kantor Gubsu, Jumat (6/7) mengatakan, pihaknya telah membentuk tim gabungan yang mengevaluasi anggaran untuk kebutuhan kontingen PON Sumut. Hasilnya anggaran sudah bisa dicairkan sebesar Rp29 miliar lebih. ”Sudah-sudah, hari ini kita cairkan. Di APBD Rp30 miliar tapi kita evaluasi ada pengurangan sedikit menjadi Rp29 miliar lebih,” katanya. Ditegaskannya, pengurangan yang dilakukan bukan untuk pemotongan. Tapi murni hasil evaluasi bersama yang dibentuk tim gabungan. Jadi, kelebihannya akan menjadi Sisa Lebih Penggunaan Anggaran (SILPA). Lanjut ke hal A2 kol. 3

Pelantikan Bupati/Wabup Aceh Timur

Gubernur: Pusat Pemerintahan ‘Wajib’ Di Idi IDI (Waspada) : Pelantikan Bupati/Wakil Bupati Aceh Timur Hasballah Syahrul berlangsung lancar, Jumat (6/7). Gubernur Aceh dr Zaini Abdullah meminta pasangan Rocky-Syahrul membawa wilayah itu ke arah yang lebih baik dan yang paling penting adalah pusat Pemkab Aceh Timur harus di Idi. “Pusat Pemkab Aceh Timur harus di Idi. Jika selama ini Kantor Dinas dan Badan serta instansi lainnya

Lanjut ke hal A2 kol. 6

Waspada/Muhammad H Ishak

ZAINI Abdullah menyematkan tanda jabatan kepada Bupati Aceh Timur Hasballah saat pelantikan Bupati/Wabup Aceh Timur 2012-2017 di gedung Serbaguna Idi Rayeuk, Jumat (6/7).


Al Bayan

Ibadah Puasa Oleh: Tgk. H. Ameer Hamzah Dalam hadits Qudsi Allah telah berfirman: Tiap-tiap amal anak Adam adalah untuk dirinya sendiri, kecuali puasa. Puasa itu untuk-Ku adan Aku sendiri yang akan memberi balasan kepadanya.... (HQR:Bukhari Muslim)

Binjai, Pelaksana MTQ I BINJAI, mencatat sejarah sebagai tempat pertama dilaksanakannya Musabaqah Tilawatil Quran (MTQ) di Sumatera Utara. Masjid Raya Binjai yang batu pertamanya

diletakkan oleh Sultan Lang-kat, H. Musa pada 1887, dan peresmian pemakaian pertama Masjid Raya dilakukan oleh Sultan Langkat yang dijabat oleh T. Abd. Aziz pada tahun 1890,

IBADAH-ibadah lain akan mendapat pahala yang cepat sejak dari dunia ini sampai akhirat dengan takaran-takaran yang sudah digambarkan oleh Allah SWT. Misalnya pahala ibadah sunat dalam bulan Ramadhan seperti pahala ibadah wajib pada bulan lain. Sedangkan ibadah wajib pada bulan

Lanjut ke hal A2 kol. 3

Waspada/Riswan Rika

MASJID Raya Binjai, sebagai saksi pelaksanaan MTQN pertama Sumatera Utara.

menjadi saksi bisu sejarah. Gubernur Sumatera Utara saat itu dijabat EWP Tambunan, ketika membuka MTQN Prov. Sumatera Utara 1983, di lapangan Merdeka Binjai, mengutip pemberitaan koran Waspada tentang sejarah MTQ pertama di kota Binjai. Data-data tertulis tentang MTQ I itu ada di arsip koresponden Waspada di kota Binjai yang dikirim pegawai Depag Kota Binjai Alm. M. Karim Yusuf, pada 1982. Pada Rapat Kerja Daerah Lembaga Pengembangan Tilawatil Quran (LPTQ) Kota Binjai di Bukit Lawang, Kab. Langkat, hal itu terbuka kembali dan sejarah itu hendaknya diteliti secara konfrehensip.KetuaLPTQKotaBinjai Drs. H. Amir Hamzah, MAP

Lanjut ke hal A2 kol. 6

Waspada/Amir Syarifuddin

PLT Gubsu H Gatot Pujo Nugroho bersama Dirjen Perikanan Tangkap Kementerian Kelautan dan Perikanan Ir Heryanto Marwoto memencet tombol sirene tanda diresmikannya pembangunan perluasan dermaga Sibolga, Jumat (6/7).

Terima e-KTP, Sidik Jari Warga Diuji MEDAN (Waspada): Kadis Kependudukan dan Catatan Sipil Medan Muslim mengatakan, sebelum e-KTP diserahkan kepada masyarakat, maka warga yang akan menerima e-KTP tersebut akan diuji kembali sidik jarinya melalui alat verifikasi. Hal ini guna untuk memastikan apakah e-KTP itu milik yang bersangkutan atau tidak. “Maka sidik jarinya harus diuji dulu melalui alat verifikasi. Jika sidik jarinya benar, maka seluruh data warga yang

Tapteng Menuju Sentra Perikanan Di Pantai Barat MEDAN (Waspada): Pemasangan tiang pancang pembangunan dan pengembangan Pelabuhan Perikananan Nusantara,Jumat(6/7), akan menjadikan Kota Sibolga dan Kab. Tapanuli Tengah sebagai sentra industri perikanan dan kelautan terbesar di Pantai Barat Sumatera Utara. Besarnya potensi dan optimisme ini diungkapkan Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho, saat melakukan peresmian pemasangan tiang pancang pembangunan dan pengembangan PPN Sibolga. Disaksikan Dirjen Perikanan Tangkap Kementerian Kelautan dan Perikanan Ir Heryanto Marwoto dan Bupati Tapanuli Tengah Raja Bonaran Situmeang, SH, MHum, Wakil Bupati Tapanuli Tengah H Sukran Jamilan Tanjung, SE, Gatot bertekad menjadikan kekayaan sumberdaya kelautan dan perikanan di kabupaten itu sumber ekonomi baru di provinsi ini. “Potensi kekayaan laut di Sibolga dan Tapanuli Tengah ini

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 6

Raih Adhikarya Pangan Nusantara 2011

Ada-ada Saja

Tim BI Kunjungi DS

Kisah Tragis Akibat Mati Lampu

LUBUKPAKAM (Waspada) : Tim Kantor Pusat Bank Indonesia (BI) diwakili Direktur Pendidikan Study BI Jakarta Jefri Kairupan bersama rombongan melakukan audiensi kepada Bupati Deliserdang H.Amri Tambunan di Lubukpakam, Kamis(5/7). Lanjut ke hal A2 kol. 3

GARA-gara mati lampu, seorang dokter salah dalam melakukan operasi yang hanya diterangi cahaya lilin. Akibatnya, seorang ibu muda berusia 20 tahun kehilangan nyawanya saat sedang melakukan operasi persalinan. Menurut laporan stasiun televisi NDTV India, kisah

Lanjut ke hal A2 kol. 2

Serampang Waspada/HM Husni Siregar

BUPATI Deliserdang H Amri Tambunan memberikan cendramata kepada Direktur Pendidikan dan study kepada Jefri Kairupan selaku ketua tim, saat berkunjung ke Kab. Deliserdang, Kamis (5/7).

- Senang sama senangkan...? - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

SABTU, Kliwon, 7 Juli 2012/17 Sya’ban 1433 H

z zNo: 23918 * Tahun Ke-66

Terbit 32 Halaman (A1-12, B1-12, C1-8) z zHarga Eceran: Rp 2.500,-


BUPATI Buol, Amran Batalipu (tengah) dikawal petugas KPK setibanya di Bandara Mutiara Palu, Sulawesi Tengah, Jumat (6/7).

KPK Tangkap Bupati Buol

Petrus Berondong Truk Angkut Bahan Kelontong

PALU (Antara): Bupati Buol, Amran Batalipu, tersangka suap izin usaha perkebunan sawit di daerahnya diterbangkan ke Jakarta guna menjalani pemeriksaan di Gedung Komisi Pemberantasan Korupsi (KPK), Jumat (6/7) sore. “Iya. Langsung ke KPK. Tidak ada pengawalan di pesawat. Kan ada pilot yang bawa pesawatnya,” kata seorang petugas dari KPK yang ikut mengawal Amran saat keluar dari ruang tunggu tamu penting (Very Important Person/VIP) di Bandar Udara Mutiara, Palu. Petugas tersebut tidak bersedia memberikan penjelasan lebih jauh tentang penangkapan Amran. Ia dan petugas dari KPK lainnya terus berjalan menuju pesawat. Amran Batalipu terlihat dikawal oleh sejumlah polisi dipimpin Kepala Kepolisian Resort (Kapolres) Palu, AKBP Ahmad Ramadhan. Saat beberapa wartawan melontarkan pertanyaan, Amran yang juga Ketua Dewan Pimpinan Daerah (DPD) Partai Golongan Karya (Golkar) di Buol itu tampak menunduk di tengah-tengah pengawalan aparat. Amran menggunakan kaos putih dan celana kain hitam, serta menyembunyikan kedua tangannya yang diborgol ke dalam baju. Lanjut ke hal A2 kol 6

IDI (Waspada): Satu truk intercooler BK 8282 CM dikemudikan Muksalmina,20, sopir dua warga Desa Blang Baroe, Kec. Geulumpang Baroe, Pidie, mengangkut bahan kelontong dari Medan, diberondong kawanan penembak misterius (Petrus) di Jalinsum Banda Aceh-Medan persis di perbatasan Aceh Timur-Langsa,Jumat (6/7) dinihari. Saat kejadian, sopir satu Ikhwan, 30, asal desa dan kecamatan yang sama sedang tidur. Tidak ada korban jiwa dalam penembakan itu, namun tiga ban truk dan bak truk terkena tembakan. Informasi Waspada peroleh, pemberondongan berawal dari satu unit truk Interculer bermuatan barang kelontong melaju dengan kecapatan sedang dari Medan tujuan Aceh. Sesampai di perbatasan Desa Alue Rangan, Kec. Sungai Raya (wilayah hukum Polres Langsa) dengan Desa Seuneubok Punti di Kec. Peureulak Timur (wilayah hukum Polres Aceh Timur) tiba-tiba terdengar suara tembakan diarahkan ke truk. Spontan, truk naas itu kempes bannya. Dianggap terjadi sesuatu terhadap dirinya, lalu Muksalmina mencoba mengendalikan truk hingga sampai di depan Mapolsek Peureulak Timur. Jarak lokasi kejadian Lanjut ke hal A2 kol 8


SEBUAH mobil Toyota Innova BK 1192 KI tergencet kontainer setelah bertabrakan dengan truk kontainer L 8767 UR dan Isuzu Panther AD 8437 JB di Simpang Empat Semampir, Kediri, Jawa Timur, Jumat (6/7) dini hari.

5 Warga Aceh Tewas Di Kediri

KPK Periksa Agung Laksono JAKARTA (Antara): Menteri Koordinator Kesejahteraan Rakyat Agung Laksono membantah mengenal Lukman Abbas, tersangka dalam kasus tindak pidana korupsi penerimaan hadiah terkait perubahan Peraturan Daerah Provinsi Riau Nomor 6 Tahun 2010 tentang Dana Pengikatan Tahun Jamak Pembangunan Lokasi PON.

“Saya tidak ada pertemuan dengan Lukman Abbas dan tidak ditanyakan dalam pemeriksaan tadi, saya juga tidak kenal Lukman Abbas,” kata Agung setelah diperiksa di kantor Komisi Pemberantasan Korupsi (KPK) Jakarta selama sekitar delapan jam mulai pukul 08:40 hingga 16:30 WIB, Jumat (6/7). Agung datang memenuhi

panggilan KPK setelah dua kali tidak memenuhi panggilan tersebut, yaitu pada hari Rabu (5/7) dan Kamis (6/7). “Saya ke sini hanya memberi keterangan tentang tugas pokok Kemenko Kesra untuk olahraga. Saya selaku Menko Kesra melakukan rapat koordinasi dengan Gubernur Lanjut ke hal A2 kol 7

BANDAACEH (Waspada): Kecelakaan lalu lintas di Kediri, Jawa Timur tepatnya di perempatan jembatan baru Kel. Semampir, Kota Kediri merenggut lima nyawa warga Kota Banda Aceh, Jumat (6/7). Korban yang baru pulang dari liburan di Bali dengan menumpang mobil Innova tewas akibat tertimpa bak container. Para korban, yakni Jenda Ingan Mahali ,48, dosen dari Universitas Muhammadiyah Aceh, Koirul Fadli, 28, pengemudi dan Andi sopir cadangan. Yulia Sari, 38, (istri Jenda Ingan Mahali), Bella Tamia Grasi, 17, (anak Yulia Sari), Tasya Amalia,

LHOKSEUMAWE (Waspada): Hasil tes Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) Universitas Malikussaleh menerima 1.873 mahasiswa baru dari 20 program studi. Pembantu Rektor I Universitas Malikussaleh (Unimal) Aceh Utara Ferri Safriwadi mengatakan, hasil pengumunan Sub Panitia Lokal (panlok) SNMPTN Unimal diterima 1.873 mahasiswa baru. Sedangkan pendaftar sebanyak 4.204 mahasiswa pada 20 program studi. Antara

SEJUMLAH warga menyaksikan kebakaran toko swalayan di depan Mesjid Raya Baiturrahman, Banda Aceh, Aceh, Kamis (5/7) malam. Kebakaran yang melanda pusat perbelanjaan itu menyebabkan kerugian mencapai puluhan miliar rupiah.

Polres Asahan Amankan CPO Dijual Ilegal menyita truk bersama tiga drum ditambah 70 Kg CPO, sopir dan seorang pekerja ke Mapolres Asahan. Informasi dihimpun Waspada, operasi dipimpin Kanit Reskri Polsek Labuhanruku Iptu A Siringoringo bersama anggotannya melakukan

Al Bayan

IDI (Waspada): Pelantikan Bupati/Wakil Bupati Aceh Timur Hasballah-Syahrul berlangsung lancar, Jumat (6/7). Gubernur Aceh dr Zaini Abdullah meminta pasangan RockySyahrul membawa wilayah itu ke arah yang lebih baik dan

yang paling penting adalah pusat Pemkab Aceh Timur harus di Idi. “P u s a t Pe m k a b Ac e h Timur harus di Idi. Jika selama ini Kantor Dinas dan Badan serta instansi lainnya masih di Kota Langsa—induknya

Aceh Timur—sebelum pemekaran, tapi sekarang sudah saatnya pusat pemerintahan di Idi,” ujar Zaini Abdullah menjawab wartawan usai pelantikan Bupati/Wabup Lanjut ke hal A2 kol 6

penyisiran di wilayah Jalinsum, tepatnya di Desa Seibalai, Kec. Seibalai, Kab. Batubara. Di lokasi, petugas berpakaian preman mencurigai salah satu bekas rumah makan yang disinggahi truk CPO

Untuk peminat Unimal sebanyak 6.517 peserta yang mendaftar di berbagai perguruan tinggi lain. Namun dari yang diterima tersebut, Program Studi Agroekoteknologi paling banyak diterima, yaitu 158 mahasiswa. Sedangkan tingkat fakultas, Fakultas Ekonomi terbanyak, yaitu 427 mahasiswa dari tiga prodi. Jumlah tersebut, kata Ferri, sudah termasuk mahasiswa baru dari jalur undangan Bi d i k m i s i s e b a n y a k 1 7 3 Lanjut ke hal A2 kol 1

Pemprovsu Cairkan Anggaran PON MEDAN (Waspada): Setelah sebelumnya sempat tidak jelas dan terkatung-katung nasib kontingen Pekan Olah Raga Nasional (PON) asal Sumatera Utara (Sumut), akhirnya Pemprovsu mencairkan anggaran untuk membiayai seluruh kebutuhan atlet. Sekretaris Daerah Provinsi (Sekdaprov) Nurdin Lubis kepada wartawan di Kantor Gubsu, Jumat (6/7) mengatakan, pihaknya telah membentuk tim gabungan yang mengevaluasi anggaran untuk kebutuhan kontingen PON Sumut. Hasilnya anggaran sudah bisa dicairkan sebesar Rp29 miliar lebih. ”Sudah-sudah, hari ini kita cairkan. Di APBD Rp30 miliar tapi kita evaluasi ada pengurangan Lanjut ke hal A2 kol 5

Lanjut ke hal A2 kol 3

Waspada/Muhammad H Ishak

GUBERNUR Aceh Zaini Abdullah menyematkan tanda jabatan kepada Bupati Aceh Timur Hasballah saat pelantikan Bupati/Wabup Aceh Timur 2012-2017 di gedung Serbaguna Idi Rayeuk, Jumat (6/7).

KIP Agara Tunda Rekapitulasi Penghitungan Suara Sanu-Ali Basrah Raih 51.060 Suara KUTACANE (Waspada): KIP Aceh Tenggara selaku penyelenggara Pilkada pemilihan Bupati-Wakil Bupati Agara periode 2012 – 2017 menunda tahapan rekapitulasi penghitungan suara tingkat kabupaten yang seharusnya dimu-

lai Jumat (6/7) hingga Sabtu (7/7) diplenokan. Hal itu sesuai surat ditandatangani Ketua KIP Agara Dedi Mulyadi Selian, surat nomor 23 tahun 2012 tertanggal 5 Juli 2012 tentang penundaan sementara. Informasi dihimpun


Berhasil Raih Adhikarya Pangan Nusantara 2011

MASJID Raya Binjai, sebagai saksi pelaksanaan MTQN pertama Sumatera Utara.

LUBUKPAKAM ( Waspada): Tim Kantor Pusat Bank Indonesia (BI) diwakili Direktur Pendidikan Study BI Jakarta Jefri Kairupan bersama rombongan melakukan audiensi kepada Bupati Deliserdang H.Amri Tambunan di Lubukpakam, Kamis(5/7). Kunjungan Tim BI terdiri dari Deputi Kepala Perwakilan BI Wilayah IX Achmad Fauzi dan enam staf BI Jakarta dan Medan serta pejabat Badan Ketahanan Pangan Pemprovsu dalam rangka mewujudkan ketahanan pangan daerah setelah Deliserdang memperoleh Adhikarya Pangan Nusantara Tahun 2011.

Tim BI Kunjungi Deliserdang

Ibadah Puasa Oleh: H. Ameer Hamzah Dalam hadits Qudsi Allah telah berfirman: Tiap-tiap amal anak Adam adalah untuk dirinya sendiri, kecuali puasa. Puasa itu untuk-Ku adan Aku sendiri yang akan memberi balasan kepadanya.... (HQR:Bukhari Muslim) IBADAH-ibadah lain akan mendapat pahala yang cepat sejak dari dunia ini sampai akhirat dengan takaranLanjut ke hal A2 kol 2

Gubernur Aceh: Pusat Pemerintahan ‘Wajib’ Di Idi

Hasil SNMPTN Unimal Dan Unsyiah Diumumkan


KISARAN ( Waspada): Aparat Polsek Labuhanruku Polres Asahan mengamankan satu truk berisi CPO beserta sopirnya di satu gudang penampungan liar kawasan Jalan Lintas Sumatera,Kamis (5/7) sore, Dalam kasus itu, polisi

12, (anak Yulia Sari). Ayahanda Yulia Sari, Samsul Bahri di kediamannya di kawasan Lampineung Kota Banda Aceh mengatakan, korban selamat yaitu menantunya Jenda Ingan Mahali. “Jenda yang memberi kabar kepada keluarga di Banda Aceh,” ujarnya. Lanjut ke hal A2 kol 6

Pelantikan Bupati/Wabup Aceh Timur

Waspada/Riswan Rika

Binjai, Pelaksana MTQ I BINJAI, mencatat sejarah sebagai tempat pertama dilaksanakannya Musabaqah Tilawatil Quran (MTQ) di Sumatera Utara. Masjid Raya Binjai yang batu pertamanya diletakkan oleh Sultan Langkat, H. Musa pada 1887, dan peresmian pemakaian pertama Masjid Raya dilakukan oleh Sultan Langkat yang dijabat oleh T. Abd. Aziz pada Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 3

Waspada, penundaan tahapan rekapitulasi penghitungan suara tingkat kabupaten Pilkada Agara yang diikuti 7 pasang calon bupati tersebut, berawal dari desakan massa Lanjut ke hal A2 kol 1

Ada-ada Saja

Kisah Tragis Akibat Mati Lampu

GARA-gara mati lampu, seorang dokter salah dalam melakukan operasi yang hanya diterangi cahaya lilin. Akibatnya, seorang ibu muda berusia 20 tahun kehilangan nyawanya saat sedang melakukan operasi persalinan. Lanjut ke hal A2 kol 5

Serampang Waspada/HM Husni Siregar

BUPATI Deliserdang H Amri Tambunan memberikan cendramata kepada Direktur Pendidikan dan study kepada Jefri Kairupan selaku ketua tim , saat berkunjung ke Kab. Deliserdang, Kamis (5/7).

- Ujung-ujungnya cair juga - He.... he....he....

Berita Utama

A2 Hasil SNMPTN ....

mahasiswa. Untuk itu, kepada mahasiswa yang telah lulus untuk melakukan daftar ulang mulai 16-23 Juli 2012. Lokasi daftar ulang ada tiga lokasi, Fakultas Pertanian dan Teknik di kampus Utama Reuleut, Kecamatan Muara Batu, Aceh Utara, Fakultas Ekonomi, Hukum dan FISIP di kampus Bukit Indah, Blang Pulo, Kecamatan Muara Satu, Lhokseumawe dan Kedokteran di kampus PSPD Uteunkot, Muara Dua, Lhokseumawe. SNMPTN Unsyiah Hari ini, Sabtu(7/7), hasil Se l e k s i Na s i o n a l M a s u k Perguruan Tinggi Neger i (SNMPTN) ujian tulis, diumunkan secara serentak melalui media massa, baik cetak maupun online. Dari 16.386 peserta yang mengikuti SNMPTN jalur tulis ini di Panitia Lokal Banda Aceh, 4.646 dinyatakan lulus dengan rincian 2.746 dinyatakan lulus di Universitas Syiah Kuala (Unsyiah), dan 1.882 lulus di Universitas Malikussaleh (Unimal). “Khusus untuk Unsyiah, jumlah yang lulus bertambah 10 persen dari rencana semula yang berjumlah sekitar 2.400. Ini permintaan Mendikbud langsung,” ucap Penjabat Rektor Unsyiah, Prof Samsul Rizal MEng, kepada wartawan Jumat (6/7) kemarin di ruang kerjanya. Menurut Samsul Rizal, rencana awal Unsyiah akan menampung mahasiswa baru tahun akademik 2012/2013,

KIP Agara ....

bersama 6 kandidat di kantor panwas sehingga Panwas Agara melalui surat nomor 386/ panwas/AGR/VII/2012 tertanggal 4 Juli 2012 dalam rekomendasi ditandatangani Ketua Panwas Junianto Siahan berpedoman UU No.32 tahun 2004 dan UU nomor 15 tahun 2011 terkait dengan aksi unjukrasa yang dinilai pihak panwas, Kapolres, KIP dan Dandim berpotensi besar menimbulkan kerusuhan sehingga direkomendasikan agar KIP Agara menghentikan sementara tahapan penghitungan suara tingkat kabupaten. Hal itu menanggapi surat Panwas, bersamaan dengan aksi massa di KIP dengan tuntutan yang sama yakni meminta Pilkada ulang, hingga KIP Agara melalui Ketua KIP Dedi Mulyadi mengeluarkan surat nomor 23 tahun 2012, isinya dengan memperhatikan surat KIP Aceh nomor 270/ 3007/tanggal 5 juli 2012 dengan mempertimbangkan analisis pihak kepolisian tidak memungkinkan dilakukan rekapitulasi suara, maka penghitungan rekapitulasi suara dapat ditunda sementara hingga kondisi normal. Ketua KIP Agara Dedi Mulyadi melalui sekretaris KIP Irwandi Ramud membenarkan secara keseluruhan kotak suara dari 493 TPS se-Agara telah berada di kabupaten dari PPK dan yang terakhir masuk dari PPK Kecamatan Leuser. Sesuai hasil perolehan suara diterima dari PPK 16

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, h3xg2+. 2. Bxg2, Bb1+. 3. MxBb1, MxBg2+mat. (Jika 2. Rg1, Kh3+mat).

Jawaban TTS: TTS Topik

Musik & Filem

untuk semua jalur sebanyak 5.523 orang. Sedangkan untuk jalur SNMPTN ujian tulis hanya 2.011 orang. Setelah pengumuman SNMPTN Jalur Undangan, jumlah kelulusan direncanakan sekitar 2.400 orang. “Karena ada per mintaan Mendiknas Mohammad Nuh agar jumlah kelulusan SNMPTN ditambah lagi, yang akhirnya yang kita terima melalui jalur ini menjadi 2.764 orang,” tambah Samsul Rizal. Bagi mereka yang dinyatakan lulus agar mendaftar ulang mulai 11-16 Juni dengan membawa kelengkapan yang diperlukan. Persyaratan dapat dilihat melalui laman UMB-PT Dibuka Sedangkan bagi yang belum tertampung, menurut Samsul Risal, masih memiliki peluang yang sama untuk masuk ke Unsyiah. Mereka dapat mendaftar kembali melalui jalur Ujian Bersama Masuk Pergur uan Tinggi (UMB-PT) 2012. Jalur UMB, pendaftaran calon mahasiswa dibuka dari tanggal 4 Juni hingga 18 Juli mendatang. Sedangkan pembayaran dapat dilakukan melalui BNI di seluruh Indonesia dalam kurun waktu 4 Juni-18 Juli 2012. Informasi UMB-PT secara rinci dapat dilihat melalui l a m a n w w w. s p m b. o r. i d . Sedangkan pendaftaran juga dilakukan secara online melalui laman (cmk/b07) kecamatan se-Agara, perolehan suara masing-masing pasangan calon yang tertera dan tinggal menunggu proses pleno, pasangan RaidinMuslim memperoleh 37.412 suara, dan pasangan Hasanuddin B- Ali Basrah memperoleh suara paling besar menduduki peringkat pertama yakni sejumlah 51.060. Pasangan Rajidin –Sarim dari independen perolehan suaranya 599. Selanjutnya pasangan Armen Desky-Tgk Appan dari independen memperoleh suara 10.474, pasangan Marthin Desky-Kamasiah memperoleh 2.039 suara, pasangan Amriko-Riduan memperoleh 1.739 dan pasangan Ridwan – Erwin Sihombing memperoleh 4.469 suara. Pemilih 107.788 suara dan suara tak sah 1.684 serta suara sah 107.716. (b25)

History ....

tahun 1890, menjadi saksi bisu sejarah. Gubernur Sumatera Utara saat itu dijabat EWP Tambunan, ketika membuka MTQN Prov. Sumatera Utara tahun 1983, di lapangan Merdeka Binjai, mengutip pemberitaan koran Waspada tentang sejarah MTQ pertama di kota Binjai. Data- data tertulis tentang MTQ I itu ada di arsip Koreponden Waspada di kota Binjai yang dikirim oleh pegawai Depag Kota Binjai Alm. M. Karim Yusuf, pada 1982. Pada Rapat Kerja Daerah Lembaga Pengembangan Tilawatil Quran (LPTQ) Kota Binjai di Bukit Lawang, Kab. Langkat, hal itu terbuka kembali dan sejarah itu hendaknya diteliti secara konfrehensip. Ketua LPTQ Kota Binjai Drs. H. Amir Hamzah, MAP sangat antusias, agar sejarah Binjai sebagai kota pelaksana MTQ I di Sumatera Utara bisa dijadikan sejarah bagi kota Binjai. Momentum itu pula membuat Amir Hamzah antusias menjadikan Binjai menjadi tuan rumah pelaksanaan MTQN Prov. Sumatera Utara ke-34 pada tahun 2014. “Sudah saatnya Binjai kembali menjadi tuan rumah, sebab Binjai baru satu kali sebagai pelaksana MTQN Prov. Sumut, yaitu pada 1983. Apalagi Binjai sebagai pelaksana MTQ Sumatera Utara pertama,” ujarnya. Data sejarah pelaksanaan MTQ pertama di Sumatera Utara atau Sumatera Timur, oleh Alm. M. Ridwan yang pernah menjabat Kepala Jawatan

Al Bayan ....

Jawaban Sudoku: 9 0 7 3 4 1 2 5 8 6

4 5 1 0 6 8 3 9 2 7

8 2 4 6 0 5 7 1 3 9

6 3 9 5 7 2 8 4 0 1

7 1 8 2 3 9 6 0 5 4

3 8 2 7 1 0 4 6 9 5

0 9 6 4 5 3 1 8 7 2

2 4 5 9 8 6 0 7 1 3

1 6 3 8 9 7 5 2 4 0

5 7 0 1 2 4 9 3 6 8

takaran yang sudah digambarkan oleh Allah SWT. Misalnya pahala ibadah sunat dalam bulan Ramadhan seperti pahala ibadah wajib pada bulan lain. Sedangkan ibadah wajib pada bulan Ramadhan akan dilipatgandakan oleh Allah dari 10 sampai 700 kali lipat. Lain halnya dengan puasa. Puasa itu akan dibalas oleh Allah SWT melebihi puasa ibadah lain. Hanya Allah yang tahu ukurannya. Boleh jadi puasa seseorang itu tidak diterima oleh Allah karena yang bersangkutan berpuasa tanpa ilmu yang benar. Seperti sabda Rasulullah: Betapa banyak orang yang berpuasa, tetapi tidak mendapatkan apa-apa kecuali

Polres Asahan ....

BK 878 7BE. Saat dilakukan pemeriksaan, ditemukan gudang dan pembuangan CPO secara ilegal. Aksi itu sempat dihadang para pekerja dan terjadi pertengkaran mulut, sehingga Kabag Ops Polres Asahan Kompol Faisal F Napitulu bersama Kasat Reskrim AKP Fahr izal tur un ke lokasi kejadian.Akhirnya truk CPO beserta pengemudinya PN,37, warga Desa Seimuka, Kec. Talawi, Kab. Batubara, dan seorang pekerja digiring ke Polres Asahan untuk menjalani pemeriksaan. PN, pengemudi truk di Mapolres Asahan yang ditemui Waspada, mengakui menjual CPO secara ilegal di gudang tersebut seharga Rp200 ribu (70 Kg). Hal itu dilakukan untuk uang tambahan.CPO berasal dari PKS Kec. Seisilau tujuan penamp u n g d i Ku a l a Ta n j u n g , Batubara. (a15)

Tahanan Polresta Medan Kabur Ditangkap Kembali MEDAN (Waspada): Dua dari tiga tahanan Polresta Medan ditangkap kembali dari rumah pacar masing-masing, Kamis (6/7) sekira pukul 22:00. Seorang wanita yang turut membantu pelarian mereka dengan memberikan gergaji pemotong terali besi dijebloskan ke dalam sel. Kedua tahanan yang ditangkap itu Samsudin alias Udin, 29, warga Jl. Klambir V Gg Rambutan, Kec. Sunggal, terlibat dalam kasus pencurian dengan pemberatan dan Dedi Arianto Nasution, 32, warga Jl. Kelambir V Gg Tower, Kec. Medan Sunggal, terlibat kasus pembunuhan dan kepemilikan senjata api.

Seorang lagi Raja David Pasaribu, 22, warga Jl. Kongsi Gg Family Medan, terlibat kasus pencabulan, sudah ditangkap terlebih dahulu saat hendak melarikan diri. Selain itu, seorang wanita berinisial SN, 25, warga Jl. Rupat, Kel. Gg Buntu, Kec. Medan Timur diduga pacar Samsuddin, ditangkap di Medan Mal. Dia diduga membantu aksi pelarian tersebut dengan membawakan gergaji besi. Saat ditangkap, kedua tersangka tidak memberikan perlawanan. Dari keterangan SN, polisi meringkus Samsudin di kawasan Jl Pasar Lama, Payageli Kampunglalang, Kec. Medan

Audiensi Tim BI diterima Bupati H Amri Tambunan didampingi Asisten II Setdakab Drs Agus Ginting MSi,Staf Ahli Bidang Ekonomi dan Keuangan Ir Hj Rosita Siregar, Kadis Pertanian Ir Hj Eka Rezeki Yanti Danil MM, dan sejumlah pejabat Pemkab Deliserdang. Direktur Pendidikan dan Study BI Jefri Kairupan selaku Ketua Tim menjelaskan kunjungan untuk berdiskusi mengenai upaya-upaya dalam mewujudkan ketahanan pangan daerah serta mencari masukan dan kiat-kiat dilakukan pemerintah Kab. Deliserdang dalam membina dan mengembangkan pertanian sehingga Bupati Deliserdang memperoleh penghargaan Adhikarya Pangan Nusantara Tahun 2011 dari Presiden RI. Selain itu,kunjungan dikaitkan dengan program kerja inisiatif penguatan ketahanan pangan daerah menjadi pilot project untuk komoditas beras dan cabai yang diinisiasi oleh Bank Indonesia. Dalam kesempatan itu,

Bupati H Amri Tambunan menyampaikan terima kasih atas kunjungan Tim Pusat BI ke Deliserdang yang tentunya akan member i semangat tambahan dan harapan baru bagi peningkatan pertanian di daerah ini. Dijelaskan H Amri Tambunan, berbagai pola pembangunan yang diterapkan di Deliserdang tidak terlepas keikutsertaan masyarakat dan swasta dengan bersinerjinya tiga pilar kekuatan melalui program Gerakan Deli Serdang Membangun (GDSM) dalam membangun infrastruktur terutama jaringan irigasi desa maupun infrastruktur jalan usaha tani yang dibangun secara swakelola. Dalam penyertaan pembangunan dengan pola tiga pilar itu, kata H.Amri Tambunan, warga merelakan tanahnya untuk pelebaran irigasi maupun pelebaran jalan tanpa ganti rugi yang nilainya lebih Rp225 miliar. Pada kesempatan itu, H.Amri Tambunan menekankan seluruh instansi terkait untuk terus melakukan koor-

dinasi termasuk pihak BI yang telah memberi perhatian.Dan, ke depannya Deliserdang menjadi daerah percontohan penguatan ketahanan pangan bagi daerah lain . Sementara Kadis Pertanian Ir Hj Eka Rejeki Yanti Danil MM mengatakan meskipun perkembangan pertanian sudah dianggap cukup baik namun tidak bisa dipungkiri masih banyak kendala maupun hambatan yang dialami para petani terutama dalam mengatasi biaya pengolahan lahan maupun penyediaan bibit yang baik. Salah satu solusi yang diharapkan para petani adanya bantuan dana pinjaman lunak dari pihak perbankan. Pertemuan penuh keakraban ditandai saling tukar cendramata, selanjutnya Tim Pusat BI turun ke Dinas Pertanian Kab.Deliserdang untuk mengumpulkan data dan fakta guna mendukung terwujudnya program ketahanan pangan daerah tersebut. (a06)

Penerangan (sebelum diganti menjadi Deppen) Kab.Langkat menuliskan, pelaksanaan sayembara Alquran digagas oleh Alm. H.A. Halim Hasan, orangtua H. Amru Daulay, SH yang pernah menjabat Bupati Madina dua periode. Konsep sayembara Alquran itu, untuk mengembalikan tradisi mengaji dan memperbaiki tajuid membaca Alquran. Apalagi Alm. HA Halim Hasan dikenal sebagai ahli tafsir di Indonesia dan Malaysia. HA. Halim Hasan saat itu menjabat Kepala Jawatan Agama, Kab.Langkat dan berkantor di Binjai, melakukan koordinasi dengan kepala daerah, seperti Bupati Langkat Alm. H. OK. Salamuddin. Sedangkan pengeras suara dipinjam kepad a Ja w a t a n Pe n e r a n g a n Provinsi Sumatera Utara. Alat tersebut merupakan bekas peralatan tentera Belanda. Pelaksanaan MTQ I memperoleh sambutan meriah dari masyarakat Medan, Deliserdang, Tebingtinggi, Kab. Langkat, Simalungun. P.Siantar, Tanjungbalai, Asahan, bahkan ada dari Tapanuli. Panitia dipimpin Alm HA. Halim Hasan dan (Alm) HA. Wahab, Alm. M. Amin Kasim mengonsep peserta MTQ dari daerah Sumatera Utara atau Sumatera Timur. Dewan juri ditetapkan H. Abu Bakar Yacub dari Medan sebagai ketua dan anggota HM Thahir, juga dari Medan, M. Said Johor dan M. Zakaria Wool, dari Tanjungpura. Pemenangnya adalah H. Azrai A Rauf dari Medan, Kedua, H. Usman Fatah dari

Langkat, dan ketiga Musa Tambi dari Asahan. H. Usman Fatah menuliskan pada 1982, membenarkan sayembara Alquran di Masjid Raya Binjai yang dilaksanakan 27 dan 28 Januari 1951, untuk pertama kali diadakan. Begitu juga Usman Fatah dalam pengakuannya, sebagai Imam di Masjid Al Ma’sum Medan, mengakui kesan luar biasa. Dan merasakan belum pernah berada di tengah masyarakat Islam yang melimpah ruah, di sepanjang jalan dan komplek Masjid Raya Binjai. Lain lagi dengan Ustad H. Azrai Abd.Rauf, menuliskan setelah pulang dari Makkah, ia diundang mengikuti sayembara Alquran di Masjid Raya Binjai. Waktunya sayembara bertepatan dengan pembubaran panitia penyelenggara pembentukan Provinsi Sumatera Utara, yang diketuai oleh Sarimin Reksodiharjo dan penyerahan Gubernur Sumatera Utara yang baru A. Hakim. Kegiatan tersebut sekaligus dengan peringatan Maulid Nabi Besar Muhammad SAW. H. Azrai bertugas membaca Alquran. Diakui Azrai, usai menunaikan tugas, dia langsung “terbang” ke Binjai untuk mengikuti MTQ. Yang pasti, Masjid Raya Binjai sudah menyimpan sejarah pelaksanaan MTQ. Sisi lain, Masjid Raya kota Binjai, sudah pantas dijadikan cagar budaya, sebab Masjid Raya itu juga pernah dijadikan pusat perjuangan rakyat melawan Belanda. * Riswan Rika

lapar dan dahaga. (Hadits Bukhari). Niatnya keliru dan kemampuan ibadah puasanya sangat rendah. Misalnya mereka hanya berpuasa karena tradisi keluarga, bila tidak dilakukan dia akan malu dengan keluarganya. Maka diapun berpuasa tanpa ruh puasa. Cuma mereka berpuasa menahan minum dan makan serta menahan nafsu seksual. Anggota tubuh lainnya tidak mereka puasakan. Tangannya suka memukul, membunuh, mencuri, korupsi, meneken kwitansi palsu, menjamah yang bukan miliknya pada siang hari. Matanya melotot pada hal-hal yang terlarang, misalnya menonton aurat di televisi, kakinya tidak dipuasakan

sehingga kaki itu selalu melangkah ke tempat-tempat maksiat, menyipak orang lain, dan sebagainya. Otaknya juga membuka puasa dengan berpikir yang negatif melulu. Hatinya juga tak berpuasa karena sering melupakan nikmat Allah SWT. Jika seseorang ingin berpuasa yang berkualitas hendaklah orang tersebut bersungguh-sungguh menjalankan ibadahnya. Wajib berusaha mendekati puasa Rasulullah dengan mencari lewat hadits-hadits yang ditinggalkan kepada kita serta wali sang Nabi yakni para ulama yang benar-benar tahu bidang ini. Puasa yang benar akan mendapat pahala yang sangat besar tentunya. Insya Allah!

KANIT Reskrim Polsek Labuhanruku Polres Asahan Iptu A Siringoringo bersama anggotanya sedang menurunkan tiga drum dan 70 Kg CPO dan membawa satu truk di halaman belakang Polres Asahan, karena CPO tersebut diturunkan secara ilegal. Waspada/Sapriadi

Tim BI Kunjungi ....

Pemprovsu ....

sedikit menjadi Rp29 miliar lebih,” katanya. Ditegaskannya, pengurangan yang dilakukan bukan untuk pemotongan. Tapi murni hasil evaluasi bersama yang dibentuk tim gabungan. Jadi, kelebihannya akan menjadi Sisa Lebih Penggunaan Anggaran (SILPA). Nurdin yakin pencairan anggaran PON tidak lagi bertentangan dengan Peraturan Menteri Dalam Negeri (Permendagri) No 32/2011. Karena sudah dibahas dan dievaluasi oleh Dinas Pemuda dan Olahraga (Dispora), Biro Keuangan, Inspektorat dan Biro Hukum sekitar dua hari lalu. Selama ini anggaran belum bisa dicairkan karena alokasi anggaran dana hibah dan bantuan sosial yang ditampung dalam APBD 2012 belum merujuk pada Permendagri 32/2011 yang mensyaratkan sebelum disetujui anggaran harus dievaluasi oleh Satuan Ke r j a Per a n g k a t D aer ah (SKPD) terkait. Saat itu pengesahannya masih mengikuti pola lama karena aturan tersebut keluar saat pembahasan RAPBD sudah berjalan. (m28)

Ada-ada Saja ....

Menurut laporan stasiun televisi NDTV India, kisah tragis ini terjadi di sebuah rumah sakit dekat Mumbai, India yang sedang mengalami mati lampu. Saat itu dokter melakukan operasi sesar dengan hanya diterangi cahaya lilin. Karena tidak bisa melihat dengan jelas, dokter mencabut bagian rahim wanita tersebut secara tidak sengaja. Yang lebih parah, pihak rumah sakit mengaku mereka punya generator (genset) tapi tidak bisa menghidupkannya karena seseorang telah mencuri bensin di tempat penyimpanan. Sebelum membawa ibu hamil itu, dokter awalnya memberi kabar gembira kepada keluarga si wanita bahwa mereka sedang menantikan kelahiran bayi kembar. Setelah bayi dikeluarkan, dokter salah tarik dan mencabut bagiah rahim wanita itu yang mengakibatkan ia mati kehabisan darah. Keluarga wanita malang itu menuturkan, tim dokter yang melakukan operasi langsung kabur dari rumah sakit tak lama setelah insiden terjadi. (emirates247/rzl)

Sunggal. Sementara, Dedi Arianto Nasution ditangkap pukul 22:30 di rumah kekasihnya seorang janda beranak satu di kawasan Pasar IX, Tembung. Ketiganya ditangkap tanpa ada perlawanan. Tersangka Raja David Pasaribu yang ditahan sejak Juni 2012, mengaku terpaksa ikut melarikan diri karena diancam oleh Dedi. “Awalnya aku tak mau ikut. Karena diancam terus sama Dedi, akhirnya ikut kabur,” sebutnya. Sementara, tersangka Samsudin mengatakan, menyuruh kekasihnya untuk membawakan gergaji karena disuruh oleh tersangka Dedi. Kasat Reskrim Polresta Medan Kompol M Yorris menjelaskan, dari hasil penyelidikan akhirnya diketahui rencana pelarian itu diotaki oleh Dedi Arianto Nasution. Pada 29 Juni 2012, Dedi menyuruh Samsudin memesan dua gergaji b e s i k e p a d a S N . G er g a j i diserahkan SN Selasa (3/7) saat men-jenguk pacar nya di Polresta Medan. ‘’ Sementara 16 tahanan lainnya tidak mengetahui aksi mereka karena sedang terlelap tidur,” ujar Kompol Yorris. (h04)

WASPADA Sabtu 7 Juli 2012

KPK Periksa ....

Riau Rusli Zaenal,” tambah Agung. Ia mengaku bertanggung jawab untuk menyelenggarakan rapat tersebut karena sebagai Menko Kesra, penyelenggaraan Pekan Olahraga Nasional (PON) berada dalam wewenangnya. “Pertemuan yang saya lakukan dengan Gubernur Rusli Zainal adalah rapat koordinasi resmi, pihak pengundang adalah saya sebagai Menko,” ungkap Agung. Ia juga membantah mendapatkan uang RP500 juta untuk menambah anggaran pembangunan fasilitas PON tersebut. “Tidak ada permintaan penambahan anggaran. Yang ada adalah permintaan realisasi anggaran karena turunnya anggaran berjalan lambat,” jelas Agung. Artinya Agung mengaku tidak ada lobi yang melibatkan dirinya untuk pembangunan fasilitas PON yang telah menghabiskan APBD Riau senilai Rp3,8 triliun sejak 2006 tersebut. Pada kasus itu, selain Lukman, penyidik KPK juga sudah menetapkan tiga tersangka lain, yaitu anggota DPRD Riau masing-masing Muhammad Dunir (PKB), Muhammad Faisal Aswan (Golkar), dan Taufan Andoso Yakin (PAN). Sementara dua tersangka lain adalah Eka Dharma Putra selaku Kepala Seksi Sarana dan Prasarana Olahraga pada Dispora Riau serta Rahmat

Syahputra dari pihak rekanan PT Pembangunan Perumahan (PP) selaku pengerja proyek PON Riau. Eka Dharma Putra bersama Lukman Abbas dan Rusli Zainal selaku Gubernur Riau serta Rahmat Syahputra selaku site Administrasi Manajer dalam Kerja sama Opreasional (KSO) antara PT Pembangunan Perumahan (PP), PT Adhi Karya dan PT Wijaya Karya menyetujui adanya dana yang disebut sebagai “uang lelah” sebagai imbalan pembahasan Perda. Taufan meny ebutkan “uang lelah” itu mencapai Rp1,8 miliar untuk sejumlah anggota DPRD Riau. Hari ini, KPK juga dijadwalkan memeriksa Taufan Andoso Yakind dan Lukman Abbas.

Petrus Berontong ....

dengan Polsek sekitar 5 kilometer ke arah barat. Kapolres Aceh Timur AKBP Iwan Eka Putra ketika dikonfirmasi membenarkan adanya penembakan truk yang dilakukan orang tak dikenal di jalinsum Banda Aceh – Medan persisnya di perbatasan wilayah hukum Aceh Timur – Langsa. “Setelah korban melapor ke Polsek, personel Polsek Peureulak Timur dibantu tim gabungan dari Polres langsung melakukan penyisiran ke lokasi,” katanya.Namun, kawanan itu belum tertangkap. (b24)

Gubernur Aceh: ....

runkan angka kemiskinan di Aceh Timur, karena wilayah tersebut masih banyak yang kehidupannya pada titik garis menengah ke bawah. Guberbur Aceh juga meminta, dalam menjalankan roda pemerintahan agar terus mengedepankan koordinasi dan konsultasi serta ketegasan sehingga visi dan misi pasangan Hasballah – Syahrul bisa diwujudkan secara bersama. Mantan Penjabat Bupati Aceh Timur Nasrullah Muhammad mengatakan, untuk membangun Aceh Timur dibutuhkan kerjasama dan kerja keras semua pihak, terutama masyarakat di seluruh pelosok sehingga aspirasi

masyarakat benar-benar bisa dijalankan sesuai dengan alokasi anggaran yang ada serta merata. Amatan Waspada, pelantikan Bupati/Wabup Aceh Timur dilakukan dalam Rapat Paripurna Istimewa DPRK Aceh Timur yang dipimpin Ketua DPRK Aceh Timur Tgk Alauddin didampingi Wakil Ketua I dan II. Hadir pada acara itu unsur Muspida plus dan sejumlah tokoh politik nasional seperti Nasir Djamil dari DPR-RI, Ketua FOPKRA Fajroel Hasan dan ikut dihadiri oleh sejumlah mantan Cabup/ Cawabup Aceh Timur seperti Rusli Ranto dan ribuan tamu dan undangan. (b24)

5 Warga Aceh ....

pulang liburan dari Bali, namun naas menimpa keluarga Samsul, anak beserta dua cucunya, Bella dan Tasya telah dipanggil yang Maha Kuasa. Tiga hari sebelum kejadian,Yulia Sari sempat menanyakan kabar orangtuanya, “Dia menanyakan di mana bapak dan ibu, mungkin itu salah satu pertanda,” ujar Samsul. Kronologis tabrakan karambol maut melibatkan tiga kendaraan yakni Innova bernopol BK 1192 KI, truk kontainer bernopol L 8767 UR dan Isuzu Panther nopol AD 8437 JB terjadi, Jumat (6/7) sekitar

pukul 03:00 di jembatan baru Kel. Semampir, Kota Kediri. Akibat kecelakaan itu, lima penumpang dan pengemudi serta sopir cadangan Innova tewas terjepit container, dan satu penumpang lainnya selamat. Sedangkan pengemudi Panther dan truk kontainer selamat dari kecelakaan maut itu. Proses evakuasi korban tewas yang terjepit bodi truk kontainer memakan waktu sekitar 4 jam. Para korban yang selamat maupun meninggal dunia dievakuasi ke RS Bhayangkara Kediri dan kemudian dibawa pulang ke Aceh. (cb01)

KPK Tangkap ....

pesawat penumpang Express Air. Selama sekitar empat jam di ruang VIP, gedung terminal tersebut mendapat penjagaan ketat dari polisi. Semua pintu masuk ke dalam gedung itu dijaga petugas. Sementara itu keluarga besar Amran Batalipu dan sejumlah kerabatnya yang menunggu di terminal penumpang hanya bisa melihat Amran tertunduk dalam pengawalan aparat menuju pesawat. “Saya hanya sempat lihat dia menunduk. Kasian rasanya,” kata salah seorang ang-

gota keluarga. Amran ditangkap KPK di kediaman pribadinya di Kelurahan Leok I, Buol, Jumat pukul 04.00 WITA setelah sebelumnya KPK menetapkan mantan Ketua DPRD Buol itu sebagai tersangka dalam kasus dugaan penyuapan penerbitan izin perkebunan kelapa sawit milik pengusaha Hartati Murdaya. Setelah ditangkap Amran kemudian dibawa ke Tolitoli, dan diamankan di Polres setempat. Ia kemudian dibawa ke Palu menggunakan pesawat reguler.

Aceh Timur periode 2012-2017 di gedung Serbaguna Idi Rayeuk. Menurut dia, di bawah kepemimpinan Hasballah Syahrul, pembangunan di Aceh Timur InsyaAllah bisa terus dipacu secara berkesinambungan sehingga potensi yang ada bisa dimanfaatkan untuk kesejahteraan Aceh Timur, lebih-lebih di bidang perikanan dan pertanian. Dalam sambutan sebelumnya, Zaini Abdullah menyebutkan, wilayah pesisir Aceh Timur yang berbatasan langsung dengan Selat Malaka bisa menjadi salah satu sudut untuk mempercepat menuMendapat kabar itu, keluarga yang berada di Jakarta dan Aceh langsung berangkat menuju Kediri untuk membawa pulang jenazah ke Aceh. “Seluruh jenazah dikebumikan di Banda Aceh, Insya Allah jika tidak ada halangan besok siang kita makamkan,” kata Samsul Bahri. Jenazah dibawa pulang menggunakan ambulans dari Bandara Polonia Medan ke Banda Aceh, dengan didampingi pihak keluarga. Menur u t p e n j e l a s a n orang tua korban, satu keluarga tersebut sedang perjalanan

Ia menjadi penumpang terakhir yang naik ke pesawat Garuda Indonesia melalui tangga depan pukul 16.00 WITA. Amran ditangkap petugas KPK dalam kasus dugaan suap izin perkebunan sawit pada Jumat pukul 04.00 WITA, dan dalam perjalanan ke Jakarta dikawal lima petugas. Sebelum diterbangkan ke Jakarta, Amran diamankan di ruang tunggu VIP Bandara Mutiara, Palu, sejak pukul 11.45 WITA, setelah diterbangkan dari Tolitoli menggunakan


Berita Utama

Polres Asahan Amankan CPO Dijual Ilegal KISARAN ( Waspada): Aparat Polsek Labuhanruku Polres Asahan mengamankan satu truk berisi CPO beserta sopirnya di satu gudang penampungan liar kawasan Jalan Lintas Waspada/Sapriadi Sumatera,KaKANIT Reskrim Polsek Labuhanruku Polmis (5/7) sore, Dalam ka- res Asahan Iptu A Siringoringo bersama angsus itu, polisi gotanya sedang menurunkan tiga drum dan menyita truk 70 Kg CPO dan membawa satu truk di halabersama tiga man belakang Polres Asahan, karena CPO drum ditam- tersebut diturunkan secara ilegal. bah 70 Kg CPO, sopir dan seorang pekerja ke Mapolres Asahan. Informasi dihimpun Waspada, operasi dipimpin Kanit Reskri Polsek Labuhanruku Iptu A Siringoringo bersama anggotannya melakukan penyisiran di wilayah Jalinsum, tepatnya di Desa Seibalai, Kec. Seibalai, Kab. Batubara. Di lokasi, petugas berpakaian preman mencurigai salah satu bekas rumah makan yang disinggahi truk CPO BK 878 7BE. Saat dilakukan pemeriksaan, ditemukan gudang dan pembuangan CPO secara ilegal. Aksi itu sempat dihadang para pekerja dan terjadi pertengkaran mulut, sehingga Kabag Ops Polres Asahan Kompol Faisal F Napitulu bersama Kasat Reskrim AKP Fahrizal turun ke lokasi kejadian.Akhirnya truk CPO beserta pengemudinya PN,37, warga Desa Seimuka, Kec. Talawi, Kab. Batubara, dan seorang pekerja digiring ke Polres Asahan untuk menjalani pemeriksaan. PN, pengemudi truk di Mapolres Asahan yang ditemui Waspada, mengakui menjual CPO secara ilegal di gudang tersebut seharga Rp200 ribu (70 Kg). Hal itu dilakukan untuk uang tambahan.CPO berasal dari PKS Kec. Seisilau tujuan penampung di Kuala Tanjung, Batubara. (a15)

Festival Budaya Melayu ... Untuk mengisi acara dilangsungkan hiburan dan festival dendang Melayu, festival Serampang XII, fashion show songket Melayu dan pagelaran teater tradisional Putri Bungsu pada Sabtu (7/7). Pada Minggu (8/7) diadakan kirab budaya Melayu, festival marching band lagu Melayu, festival balai Melayu (rekor MURI), penampilan engrang, hiburan, dendang dan kelakar Melayu, festival tari zapin dan pagelaran teater bangsawan Melayu. Pada Senin (9/7) digelar lomba berbalas pantun, syair puisi Melayu, pegelaran tim kesenian Jakarta dan seminar Melayu bertema ‘Sejarah Keagungan Kesultanan Deli. Dan pada penutupan Selasa (10/7) digelar hiburan, dendang dan kelakar Melayu. (m46)

Lima Warga B. Aceh ... jenazah ke Aceh. “Seluruh jenazah dikebumikan di Banda Aceh, Insya Allah jika tidak ada halangan besok siang kita makamkan,” kata Samsul Bahri. Jenazah dibawa pulang menggunakan ambulans dari Bandara Polonia Medan ke Banda Aceh, dengan didampingi pihak keluarga. Menurut penjelasan orang tua korban, satu keluarga tersebut sedang perjalanan pulang liburan dari Bali, namun naas menimpa keluarga Samsul, anak beserta dua cucunya, Bella dan Tasya telah dipanggil yang Maha Kuasa. Tiga hari sebelum kejadian,Yulia Sari sempat menanyakan kabar orangtuanya, “Dia menanyakan di mana bapak dan ibu, mungkin itu salah satu pertanda,” ujar Samsul. Kronologis tabrakan karambol maut melibatkan tiga kendaraan yakni Innova bernopol BK 1192 KI, truk kontainer bernopol L 8767 UR dan Isuzu Panther nopol AD 8437 JB terjadi, Jumat (6/7) sekitar pukul 03:00 di jembatan baru Kel. Semampir, Kota Kediri. Akibat kecelakaan itu, lima penumpang dan pengemudi serta sopir cadangan Innova tewas terjepit container, dan satu penumpang lainnya selamat. Sedangkan pengemudi Panther dan truk kontainer selamat dari kecelakaan maut itu. Proses evakuasi korban tewas yang terjepit bodi truk kontainer memakan waktu sekitar 4 jam. Para korban yang selamat maupun meninggal dunia dievakuasi ke RS Bhayangkara Kediri dan kemudian dibawa pulang ke Aceh. (cb01)

KPK Tangkap Bupati ... Amran ditangkap petugas KPK dalam kasus dugaan suap izin perkebunan sawit pada Jumat pukul 04.00 WITA, dan dalam perjalanan ke Jakarta dikawal lima petugas. Sebelum diterbangkan ke Jakarta, Amran diamankan di ruang tunggu VIP Bandara Mutiara, Palu, sejak pukul 11.45 WITA, setelah diterbangkan dari Tolitoli menggunakan pesawat penumpang Express Air. Selama sekitar empat jam di ruang VIP, gedung terminal tersebut mendapat penjagaan ketat dari polisi. Semua pintu masuk ke dalam gedung itu dijaga petugas. Sementara itu keluarga besar Amran Batalipu dan sejumlah kerabatnya yang menunggu di terminal penumpang hanya Jawaban Problem Catur, bisa melihat Amran tertunduk dalam pengawalan aparat meTTS Dan Sudoku nuju pesawat. “Saya hanya sempat lihat dia menunduk. KasiDari Halaman Sport. an rasanya,” kata salah seorang anggota keluarga. Amran ditangkap KPK di Jawaban Problem Catur: kediaman pribadinya di Kelura1. ......, h3xg2+. han Leok I, Buol, Jumat pukul 04.00WITA setelah sebelumnya 2. Bxg2, Bb1+. KPK menetapkan mantan Ketua DPRD Buol itu sebagai tersang3. MxBb1, ka dalam kasus dugaan penyuapan penerbitan izin perkebuMxBg2+mat. (Jika nan kelapa sawit milik pengu2. Rg1, Kh3+mat). saha Hartati Murdaya. Setelah ditangkap Amran kemudian dibawa ke ToJawaban TTS: litoli, dan diamankan di Polres setempat. Ia kemudian dibaTTS Topik Musik & Filem wa ke Palu menggunakan pesawat reguler.

Ada-ada Saja ...

Jawaban Sudoku: 9 0 7 3 4 1 2 5 8 6

4 5 1 0 6 8 3 9 2 7

8 2 4 6 0 5 7 1 3 9

6 3 9 5 7 2 8 4 0 1

7 1 8 2 3 9 6 0 5 4

3 8 2 7 1 0 4 6 9 5

0 9 6 4 5 3 1 8 7 2

2 4 5 9 8 6 0 7 1 3

1 6 3 8 9 7 5 2 4 0

5 7 0 1 2 4 9 3 6 8

ini terjadi di sebuah rumah sakit dekat Mumbai, India yang sedang mengalami mati lampu. Saat itu dokter melakukan operasi sesar dengan hanya diterangi cahaya lilin. Karena tidak bisa melihat dengan jelas, dokter mencabut bagian rahim wanita tersebut secara tidak sengaja. Yang lebih parah, pihak rumah sakit mengaku mereka punya generator (genset) tapi tidak bisa menghidupkannya karena seseorang telah mencuri bensin di tempat penyimpanan. Sebelum membawa ibu hamil itu, dokter awalnya memberi kabar gembira kepada keluarga si wanita bahwa mereka sedang menantikan kelahiran bayi kembar. Setelah bayi dikeluarkan, dokter salah tarik dan mencabut bagiah rahim wanita itu yang mengakibatkan ia mati kehabisan darah. Keluarga wanita malang itu menuturkan, tim dokter yang melakukan operasi langsung kabur dari rumah sakit tak lama setelah insiden terjadi. (emirates247/rzl)

Pria Berseragam Militer Rampok Mandor Bangunan MEDAN (Waspada): Tiga pria nengendarai mobil Avanza warna hitam, dua diantaranya memakai seragam militer melakukan perampokan terhadap terhadap mandor pekerja bangunan ruko di Jl. Binjai sekitar Km 15, 5 ,Kec. Sunggal, Kab. Deliserdang, Jumat (6/7). Saksi mata kepada Waspada di lapangan, tiga pelaku datang ke bangunan ruko dan belakang mobil didekatkan ke pintu salah satu ruko yang sedang dicat bagian dalamnya.Setelah itu, dua pelaku berseragam militer, satu lagi memakai pakaian sipil menemui mandor pekerja yang baru datang. Kehadiran pelaku disambut mandor a Kasmun, 47, warga asal Semarang. Pelaku meminta besi untuk penjara.Namun, sebelum korban menjawab, salah seorang pelaku yang berseragam militer memegang-pegang gagang senjata api yang terselip di pinggangnya. Satu lagi mengambil uang dari saku kor-

ban senilai Rp3 juta.Pelaku yang berpakaian sipil memantau di luar bangunan tersebut. Setelah hasil kejahatan dikuasai, pelaku naik ke mobil dan kabur ke arah Binjai. Kanit Reskrim Polsek Sunggal AKP Victor Ziliwu, SH, SIK,dan anggota yang turun ke lapangan setelah mendapat informasi segera melakukan penyelidikan, memintai keterangan korban dan sejumlah saksi lainnya. KKasmun mengatakan, pelaku datang tiga orang, dua berseragam militer. “Saya takut terkena tembakan, bahkan satu orang memakai segeram militer sempat memegang gagang senpi di pinggangnya. Uang Rp3 juta, rencananya untuk gaji pekerja ludes diambil pelaku,” ujarnya. Pengawas bangunan,Victor Doloksaribu, 32, warga Jakarta mengatakan, pihaknya ada menerima informasi dari Kades banyak anggota TNI diduga gadungandankitaharustetapwaspada.

Perawat RS Colombia Hari yang sama, Lenny Br Sebayang, 37, pekerja RS Colombia menderita luka-luka karena sepedamotor yang dikendarainya diterjang perampok di Jl. Binjai Km 14,8, Kec. Sunggal, Kab. Deliserdang. Korban Lenny kepada Waspada di Tempat Kejadian Perkara (TKP) mengatakan, dia perawat RS Colombia dengan mengendarai sepedamotor Honda Vario CB5 BK 5850 FQ hendak pulang ke rumahnya di Jl. Binjai Km 15/Jln. Sampe Citra Baru, Blok B.Namun, dalam perjalanan, tas yang dibawanya dirampok seorang pelaku bersepedamotor Honda GL Pro. Kanit Reskrim Polsek Sunggal AKP Victor Ziluwu, SH, SIK, mengatakan, dalam kasus itu, korban telah membuat pengaduan di Mapolsek Sunggal, pelakunya buron. Korban menderita kerugian tas warna ungu berisi uang Rp200 ribu, KTP, SIM C, STNK, kartu ATM Bank Mandiri dan lainnya. (m36)

Terima e-KTP, Sidik ...

Pusat akan mengirimkannya melalui pos ke kantor camat masing-masing,” imbuhnya. Saat ini, e-KTP yang sudah selesai baru 332.625. Sedangkan jumlah warga yang telah melakukan perekaman e-KTP seluruhnya sekitar 1.268.398 jiwa. “Sudah semua warga terekam. Namun, jika masih ada warga kita yang berada diluar kota yang belum e-KTP, masih kita tunggu sampaibulanDesemberiniuntuk mengikuti e-KTP ini,” jelasnya. Terkait akta kelahiran, Muslim mengaku pihaknya telah mengambil kebijakan jemput bola. Artinya, tim dari Disduk Capil menggunakan mobil keliling mendatangi warga guna mempermudah pengurusan. Saat ini, pihaknya masih melakukan di 4 kecamatan yakni Kec.

Medan Marelan, Medan Deli, Medan Labuhan dan Medan Belawan. “Dalam tiga hari, sekitar 213 warga melakukan pengurusan. Jemput bola ini akan terus kita lakukan. Selanjutnya, kita mendatangi 13 kecamatan yang berada di pinggiran kota seperti Kecamatan Medan Sunggal, Medan Johor, Medan Tuntungan, Medan Tembung dan Medan Denai,” katanya. Intinya, katanya, jemput bola ini kita lakukan khusus untuk masyarakat yang bermukim jauh dari Kantor Disduk Capil.Warga cukup mendatangi kantor camat dan melakukan pengurusan di tempat itu, sebab kita telah mempersiapkan proses pengurusannya di sana. (h02)

ra Tahun 2011 dari Presiden RI. Selain itu,kunjungan dikaitkan dengan program kerja inisiatif penguatan ketahanan pangan daerah menjadi pilot project untuk komoditas beras dan cabai yang diinisiasi oleh Bank Indonesia. Dalam kesempatan itu, BupatiHAmriTambunanmenyampaikan terima kasih atas kunjungan Tim Pusat BI ke Deliserdang yang tentunya akan memberi semangat tambahan dan harapan baru bagi peningkatan pertanian di daerah ini. Dijelaskan H Amri Tambunan,berbagai pola pembangunan yang diterapkan di Deliserdang tidak terlepas keikutsertaan masyarakat dan swasta dengan bersinerjinya tiga pilar kekuatan melalui program Gerakan Deli Serdang Membangun (GDSM) dalam membangun infrastruktur terutama jaringan irigasi desa maupun infrastruktur jalan usaha tani yang dibangun secara swakelola. Dalam penyertaan pembangunan dengan pola tiga pilar itu, kata H.Amri Tambunan, warga merelakan tanahnya untuk pelebaran irigasi maupun

pelebaran jalan tanpa ganti rugi yang nilainya lebih Rp225 miliar. Pada kesempatan itu, H.Amri Tambunan menekankan seluruh instansi terkait untuk terus melakukan koordinasi termasuk pihak BI yang telah memberi perhatian.Dan, ke depannya Deliserdang menjadi daerah percontohan penguatan ketahanan pangan bagi daerah lain . Sementara Kadis Pertanian Ir Hj Eka Rejeki Yanti Danil MM mengatakan meskipun perkembangan pertanian sudah dianggap cukup baik namun tidak bisa dipungkiri masih banyak kendala maupun hambatan yang dialami para petani terutama dalam mengatasi biaya pengolahan lahan maupun penyediaan bibit yang baik. Salah satu solusi yang diharapkan para petani adanya bantuan dana pinjaman lunak dari pihak perbankan. Pertemuan penuh keakraban ditandai saling tukar cendramata, selanjutnya Tim Pusat BI turun ke Dinas Pertanian Kab. Deliserdang untuk mengumpulkan data dan fakta guna mendukung terwujudnya program ketahanan pangan daerah tersebut. (a06)

Tata cara pelaporan dan kelengkapan administrasi yang harus dibawa peserta pada saat melakukan pelaporan terdiri dari Kartu Peserta SNMPTN 2012 jalur tertulis asli, ijazah asli/ SKHUN (Surat KeteranganHasil Ujian nasional). Peserta harus datang sendiri atau tidak boleh diwakili, berpakaian rapi (tidak dibenarkan memakai kaos oblong, sandal/selop, topi dan cadar). Sedangkan bagi peserta Bidik Misi tambahan bagi kelengkapan administrasi yang harus dibawa, Fotokopi Kartu Tanda Siswa. SNMPTN Unsyiah Dan Unimal Hari ini, Sabtu(7/7), hasil Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) ujian tulis, diumunkan serentak melalui media massa, baik cetak maupun online. Dari 16.386 peserta SNMPTN jalur tulis di Panitia Lokal Banda Aceh, 4.646 dinyatakan lulus dengan rincian 2.746 dinyatakan lulus di Universitas Syiah Kuala (Unsyiah), dan 1.882 lulus di Universitas Malikussaleh (Unimal). Penjabat Rektor Unsyiah,

Prof Samsul Rizal MEng, kepada wartawan Jumat (6/7) di ruang kerjanya mengatakan, rencana awal Unsyiah akan menampung mahasiswa baru tahun akademik 2012/2013, untuk semua jalur sebanyak 5.523 orang. Untuk jalur SNMPTN ujian tulis hanya 2.011 orang. Setelah pengumuman SNMPTN Jalur Undangan, jumlah kelulusan direncanakan sekitar 2.400 orang. “Karena ada permintaan Mendiknas Mohammad Nuh agar jumlah kelulusan SNMPTN ditambah lagi, akhirnya yang kita terima melalui jalur ini menjadi 2.764 orang,” tambah Samsul Rizal. Bagi mereka yang dinyatakan lulus agar mendaftar ulang mulai11-16Junidenganmembawa kelengkapan yang diperlukan. Persyaratan dapat dilihat melalui laman UMB-PT Dibuka Sedangkan bagi yang belum tertampung, menurut Samsul Risal, masih memiliki peluang yang sama untuk masuk ke Unsyiah. Mereka dapat mendaftar kembali melalui jalur Ujian Bersama Masuk Perguruan Tinggi (UMB-PT) 2012.Pendaftaran calon mahasiswa dibuka dari 4 Juni hingga 18 Juli mendatang. Sedangkan pembayaran dapat dilakukan melalui BNI di seluruh Indonesia dalam kurun waktu 4 Juni-18 Juli 2012. Informasi UMB-PT secara rinci dapat dilihat melalui laman Sedangkan pendaftaran juga dilakukan secara online melalui laman (m49/m41/b07)

bersangkutan akan terlihat dengan jelas, makanya dalam pengambilan e-KTP ini tidak bisa diwakilkan oleh siapapun, harus orang yang bersangkutan,” jelas Muslim kepada Waspada, Jumat (6/7). Dalam pengambilan e-KTP ini, kata Muslim, warga tidak perlu berbondong-bondong ke kecamatan, karena pihak kecamatan nantinya akan mengirimkan undangan ke rumah warga. “Pihak kecamatan-lah yang mengetahui e-KTP warganya sudah selesai atau belum. Kalau yang belum selesai, berarti masih di Jakarta dan belum selesai, karena penyelesaian ini bertahap. Nanti kalau e-KTP nya dari Jakarta sudah selesai, maka

Tim BI Kunjungi ... KunjunganTim BI terdiri dari Deputi Kepala Perwakilan BI Wilayah IX Achmad Fauzi dan enam staf BI Jakarta dan Medan serta pejabat Badan Ketahanan PanganPemprovsudalamrangka mewujudkan ketahanan pangan daerahsetelahDeliserdangmemperoleh Adhikarya Pangan Nusantara Tahun 2011. Audiensi Tim BI diterima Bupati H Amri Tambunan didampingi Asisten II Setdakab Drs Agus Ginting MSi,Staf Ahli Bidang Ekonomi dan Keuangan Ir Hj Rosita Siregar,Kadis Pertanian Ir Hj Eka Rezeki Yanti Danil MM, dan sejumlah pejabat Pemkab Deliserdang. Direktur Pendidikan dan Study BI Jefri Kairupan selaku Ketua Tim menjelaskan kunjungan untuk berdiskusi mengenai upaya-upaya dalam mewujudkan ketahanan pangan daerah serta mencari masukan dan kiat-kiat dilakukan pemerintah Kab. Deliserdang dalam membina dan mengembangkan pertanian sehingga Bupati Deliserdang memperoleh penghargaan Adhikarya Pangan Nusanta-

10.217 Lulus ... yang lolos. ”Posisi kita berada di bawah, UPI, UNP, UI, IPB, Unair,” katanya. Dia menegaskan para peserta yang lulus diminta melakukan regitrasi ulang ke kampus Unimed. Sementara, Sekretaris Panlok Unimed Prof Biner Ambarita menambahkan, hasil verifikasi penerimaan mahasiswa baru melalui jalur Bidik Misi, dinilai tepat sasaran artinya yang lulus benar-benar pintar dan dari keluarga kurang mampu.”98 persen tepat sasaran, memang ada 5 orang didiskualifikasi karena setelah diverifikasi, peserta itu bukan bukan orang miskin,“ tegasnya. Sedangkan, Kepala Biro Akademik USU Nurmalia SH mengingatkan peserta yang diterima diwajibkan melakukan pelaporan tanggal 16-17 Juli. Untuk kelompok Eksak pelaporan dilakukan pada tanggal 16 Juli sedangkan untuk kelompok Non-Eksak pelaporannya dilakukan pada tanggal 17 Juli. Jadwal pelaporan dimulai pukul 09.00-14.00 WIB dipusatkan di Gelanggang Mahasiswa USU.

Pemprovsu Cairkan ... Nurdin yakin pencairan anggaran PON tidak lagi bertentangan dengan Peraturan Menteri Dalam Negeri (Permendagri) No 32/2011. Karena sudah dibahas dan dievaluasi oleh Dinas Pemuda dan Olahraga (Dispora), Biro Keuangan, Inspektorat dan Biro Hukum sekitar dua hari lalu. Selama ini anggaran belum bisa dicairkan karena alokasi

anggaran dana hibah dan bantuan sosial yang ditampung dalam APBD 2012 belum merujuk pada Permendagri 32/2011 yang mensyaratkan sebelum disetujui anggaran harus dievaluasi oleh Satuan Kerja Perangkat Daerah (SKPD) terkait. Saat itu pengesahannya masih mengikuti pola lama karena aturan tersebut keluar saat pembahasan RAPBD sudah berjalan. (m28)

Al Bayan ... Ramadhan akan dilipatgandakan oleh Allah dari 10 sampai 700 kali lipat. Lain halnya dengan puasa. Puasa itu akan dibalas oleh Allah SWT melebihi puasa ibadah lain. Hanya Allah yang tahu ukurannya. Boleh jadi puasa seseorang itu tidak diterima oleh Allah karena yang bersangkutan berpuasa tanpa ilmu yang benar. Seperti sabda Rasulullah: Betapa banyak orang yang berpuasa, tetapi tidak mendapatkan apa-apa kecuali lapar dan dahaga. (Hadits Bukhari). Niatnya keliru dan kemampuan ibadah puasanya sangat rendah. Misalnya mereka hanya berpuasa karena tradisi keluarga, bila tidak dilakukan dia akan malu dengan keluarganya. Maka diapun berpuasa tanpa ruh puasa. Cuma mereka berpuasa menahan minum dan makan serta menahan nafsu seksual. Anggota tubuh lainnya tidak mereka puasakan.

Tangannya suka memukul, membunuh, mencuri, korupsi, meneken kwitansi palsu, menjamah yang bukan miliknya pada siang hari. Matanya melotot pada hal-hal yang terlarang, misalnya menonton aurat di televisi, kakinya tidak dipuasakan sehingga kaki itu selalu melangkah ke tempat-tempat maksiat, menyipak orang lain, dan sebagainya. Otaknya juga membuka puasa dengan berpikir yang negatif melulu. Hatinya juga tak berpuasa karena sering melupakan nikmat Allah SWT. Jika seseorang ingin berpuasa yang berkualitas hendaklah orang tersebut bersungguhsungguh menjalankan ibadahnya.Wajib berusaha mendekati puasa Rasulullah dengan mencari lewat hadits-hadits yang ditinggalkan kepada kita serta wali sang Nabi yakni para ulama yang benar-benar tahu bidang ini. Puasa yang benar akan mendapat pahala yang sangat besar tentunya. Insya Allah!

Gubernur: Pusat ... masih di Kota Langsa—induknya Aceh Timur—sebelum pemekaran, tapi sekarang sudah saatnya pusat pemerintahan di Idi,” ujar Zaini Abdullah menjawab wartawan usai pelantikan Bupati/Wabup Aceh Timur periode 2012-2017 di gedung Serbaguna Idi Rayeuk. Menurut dia, di bawah kepemimpinan Hasballah - Syahrul, pembangunan di Aceh Timur InsyaAllahbisaterusdipacusecara berkesinambungan sehingga potensi yang ada bisa dimanfaatkan untuk kesejahteraan Aceh Timur, lebih-lebih di bidang perikanan dan pertanian. Dalam sambutan sebelumnya, Zaini Abdullah menyebut-

Tapteng Menuju ... luar biasa. Namun perlu terobosan agar semua sumberdaya ini bisa lebih optimal. Dan, industrialisasi perikanan yang tetap menjaga kelestarian lingkungan di Sibolga serta Tapanuli Tengah ini adalah jawabannya,” kata Gatot di hadapan ratusan nelayan dan warga yang hadir dalam kegiatan ini. Gatot menambahkan, Sumatera Utara sebenarnya sangat potensial mengembangkan sektor kelautan di samping sektor perkebunan yang lebih dulu eksis. Saat ini provinsi ini memiliki garis pantai sepanjang 11.300 Km. Garis ini membentang sepanjang Pantai Barat, Pantai Timur dan Pulau Nias. ‘’ Semua perairan di garis pantai tersebut memiliki potensi perikanan dan kelautan mencapai 276.030 ton di Selat Malaka dan 1.076.890 ton di Samudera Hindia,’’ kata Gatot. Namun, imbuhnya, sepanjang 2011 hanya 11,23 persen saja, potensi itu yang tergarap atau hanya sekitar 120.902 ton. Gatot menargetkan untuk tahun 2012, Provinsi Sumatera Utara akan memproduksi perikanan laut maupun perikanan budidaya menjadi 623.703 ton. Target besar itu bisa dicapai dengan segera berlangsungnya industrialisasi perikanan seperti di PPN Sibolga yang segera dimodernisasi dan diperluas. Selain PPN Sibolga, Sumatera Utara memiliki Pelabuhan Perikanan Samudera di Belawan, Pelabuhan Perikanan Pantai Pulau Tello dan sejumlah

WASPADA Sabtu 7 Juli 2012 kan, wilayah pesisir Aceh Timur yang berbatasan langsung dengan Selat Malaka bisa menjadi salah satu sudut untuk mempercepat menurunkan angka kemiskinan di Aceh Timur, karena wilayah tersebut masih banyak yang kehidupannya pada titik garis menengah ke bawah. Guberbur Aceh juga meminta, dalam menjalankan roda pemerintahan agar terus mengedepankan koordinasi dan konsultasi serta ketegasan sehingga visi dan misi pasangan Hasballah – Syahrul bisa diwujudkan secara bersama. MantanPenjabatBupatiAceh Timur Nasrullah Muhammad mengatakan, untuk membangun Aceh Timur dibutuhkan kerjasama dan kerja keras se-

mua pihak, terutama masyarakat di seluruh pelosok sehingga aspirasi masyarakat benarbenar bisa dijalankan sesuai dengan alokasi anggaran yang ada serta merata. Amatan Waspada, pelantikan Bupati/Wabup Aceh Timur dilakukan dalam Rapat Paripurna Istimewa DPRK Aceh Timur yang dipimpin Ketua DPRK Aceh Timur Tgk Alauddin didampingi Wakil Ketua I dan II. Hadir pada acara itu unsur Muspida plus dan sejumlah tokoh politik nasional seperti Nasir Djamil dari DPR-RI, Ketua FOPKRA Fajroel Hasan dan ikut dihadiri oleh sejumlah mantan Cabup/Cawabup Aceh Timur seperti Rusli Ranto dan ribuan tamu dan undangan. (b24)

laboratorium penelitian perikanan kelautan di Belawan, Medan serta Tanjungbalai. Sementara, Dirjen Perikanan Tangkap Kementerian Kelautan dan Perikanan (KKP) Ir Heryanto Marwoto mewakili Menteri Kelautan dan Perikanan Sharif C Sutardjo menjelaskan, pengembangan PPN Sibolga merupakan wujud nyata perhatian dari KKP.Hal ini diharapkan dapat meningkatkan fungsinya dalam mengelola sumberdaya kelautan dan perikanan untuk membantu akselerasi peningkatan taraf hidup masyarakat nelayan setempat, serta mendorong pertumbuhan dan perkembangan perekonomian daerah. Dikatakan Marwoto, pengembangan pelabuhan merupakan salah satu bagian inti dari program Industrialisasi Kelautan dan Perikanan yang diamanatkan oleh Peraturan Menteri (Permen) Kelautan dan Perikanan No. 08 Tahun 2012 tentang Kepelabuhanan Perikanan. Sebagai langkah nyata, KKP akan mengucurkan dana sebesar Rp69,4 miliar bersumber dari dana pinjaman Bank Dunia (IDB) untuk mengembangkan dan meningkatkan pelayanan pelabuhan di Kec. Sarudik, Kab. Tapanuli Tengah. Selain itu, Kab. Tapanuli Tengah mendapatkan bantuan lainnya berupa tiga unit Kapal Inka Mina berbobot 30 GT senilai total Rp4,5 miliar, 250 Sertifikat Hak Atas Tanah (SHAT), Satker PPN Sibolga sebesar Rp4 miliar. Berdasarkan data Pemerintah Tapanuli Tengah, kontribusi

dari sub sektor perikanan menempati urutan ketiga setelah sub sektor tanaman perkebunan terhadap pembentukan nilai PDRB sektor pertanian, yaitu sebesar 19,13 persen pada tahun 2010. Sementara pada 2011 produksi ikan di Kabupaten Tapanuli sebanyak 294.715 ton, yang terdiri dari perikanan tangkap 41.000 ton dan perikanan budidaya 253.715 ton. Sebagai wujud nyata dan bentuk perhatian dalam mengoptimalkan industri perikanan di Provinsi Sumatera Utara, KKP mengucurkan dana bantuan senilai total lebih dari Rp174 miliar. Bantuan itu di antaranya, 30.000 Kartu Nelayan, lima unit Kapal berbobot kurang dari 30 GT, 14 unit Kapal INKA MINA berbobot lebih dari 30 GT, pengembangan usaha mina pedesaan (PUMP) kepada 204 Kelompok Usaha Bersama (KUB) masing-masing senilai Rp100 juta,tiga paket rumah ikan, dana dekonsentrasi sebesar Rp3,19 miliar. Selain itu, diberikan dana bantuan sebesar Rp1,5 miliar untuk pembangunan PPI PUD Toba, 650 Sertifikat Hak Atas Tanah (SHAT), sarana alat penangkapan Ikan 10 Paket, PUMP 117 Paket bagi 16 Kab/ Kota, pengembangan sistem kesehatan ikan dan lingkungan pembudidaya ikan, pengembangan sistem produksi pembubidaya ikan, pengembangan sistem perbenihan ikan, escavator dua unit, peralatan sistem rantai dingin untuk 15 TPI dan PPI di Sumut sebanyak 34 paket. (m28)

HISTORY ... sangat antusias, agar sejarah Binjai sebagai kota pelaksana MTQ I di Sumatera Utara bisa dijadikan sejarah bagi kota Binjai. Momentum itu pula membuat Amir Hamzah antusias menjadikan Binjai menjadi tuan rumah pelaksanaan MTQN Prov. Sumatera Utara ke-34 pada tahun 2014. “Sudah saatnya Binjai kembali menjadi tuan rumah, sebab Binjai baru satu kali sebagai pelaksana MTQN Prov. Sumut, yaitu pada 1983. Apalagi Binjai sebagai pelaksana MTQ Sumatera Utara pertama,” ujarnya . Data sejarah pelaksanaan MTQ pertama di Sumatera Utara atau Sumatera Timur, oleh Alm. M. Ridwan yang pernah menjabat Kepala Jawatan Penerangan (sebelum diganti menjadi Deppen) Kab.Langkat menuliskan, pelaksanaan sayembara Alquran digagas oleh Alm. H.A. Halim Hasan, orangtua H. Amru Daulay, SH yang pernah menjabat Bupati Madina dua periode. Konsep sayembara Alquran itu, untuk mengembalikan tradisi mengaji dan memperbaiki tajuid membaca Alquran. Apalagi Alm. HA Halim Hasan dikenal sebagai ahli tafsir di Indonesia dan Malaysia. HA. Halim Hasan saat itu menjabat Kepala Jawatan Agama, Kab.Langkat dan berkantor di Binjai, melakukan koordinasi dengan kepala daerah, seperti Bupati Langkat Alm. H. OK. Salamuddin. Sedangkan pengeras suara dipinjam kepada Jawatan Penerangan Provinsi Sumatera Utara. Alat tersebut merupakan bekas peralatan tentera Belanda. Pelaksanaan MTQ I memperoleh sambutan meriah dari masyarakat Medan, Deliserdang, Tebingtinggi, Kab. Langkat, Simalungun. P.Siantar, Tanjungbalai, Asahan, bahkan ada dari Tapanuli. Panitia dipimpin Alm HA. Halim Hasan dan

(Alm) HA.Wahab, Alm. M. Amin Kasim mengonsep peserta MTQ dari daerah Sumatera Utara atau Sumatera Timur. Dewan juri ditetapkan H. Abu Bakar Yacub dari Medan sebagai ketua dan anggota HM Thahir, juga dari Medan, M. Said Johor dan M. Zakaria Wool, dari Tanjungpura. Pemenangnya adalah H. Azrai A Rauf dari Medan, Kedua, H. Usman Fatah dari Langkat, dan ketiga Musa Tambi dari Asahan. H. Usman Fatah menuliskan pada 1982, membenarkan sayembara Alquran di Masjid Raya Binjai yang dilaksanakan 27 dan 28 Januari 1951, untuk pertama kali diadakan. Begitu juga Usman Fatah dalam pengakuannya, sebagai Imam di Masjid Al Ma’sum Medan, mengakui kesan luar biasa. Dan merasakan belum pernah berada di tengah masyarakat Islam yang melimpah ruah, di sepanjang jalan dan komplek Masjid Raya Binjai. Lain lagi dengan Ustad H. Azrai Abd.Rauf, menuliskan setelah pulang dari Makkah, ia diundang mengikuti sayembara Alquran di Masjid Raya Binjai. Waktunya sayembara bertepatan dengan pembubaran panitia penyelenggara pembentukan Provinsi Sumatera Utara, yang diketuai oleh Sarimin Reksodiharjo dan penyerahan Gubernur Sumatera Utara yang baru A. Hakim. Kegiatan tersebut sekaligus dengan peringatan Maulid Nabi Besar Muhammad SAW. H. Azrai bertugas membaca Alquran. Diakui Azrai, usai menunaikan tugas, dia langsung “terbang” ke Binjai untuk mengikuti MTQ. Yang pasti, Masjid Raya Binjai sudah menyimpan sejarah pelaksanaan MTQ. Sisi lain, Masjid Raya Binjai, sudah pantas dijadikan cagar budaya, sebab Masjid Raya itu pernah dijadikan pusat perjuangan rakyat melawan Belanda. Riswan Rika

Medan Metropolitan


WASPADA Sabtu 7 Juli 2012

Palsukan SIMB

Polisi Tangkap Calo Bangunan MEDAN (Waspada): Seorang calo pengurusan surat izin mendirikan bangunan (SIMB) diringkus petugas Reskrim Polresta Medan, setelah membuat surat IMB palsu sekaligus memalsukan tandatangan Kepala Dinas Tata Ruang dan Tata Bangunan Kota Medan Syampurno Pohan. Usai menjalani pemeriksaan, Kamis (5/7) tersangka berinisial FU alias Atong, 48, warga Kec. Medan Johor, dijebloskan ke dalam tahanan. Informasi yang diperoleh di kepolisian, Jumat (6/7), tersangka FU ditangkap berdasarkan

pengaduan korbannya Lili Tjahja, 40, warga Jln. Pancurbatu No 22, Kec. Medan Perjuangan. Awalnya, pada Agustus 2011, Lili Tjahja meminta tolong kepada seorang pria bernama Agus untuk membuat surat izin mendirikan bangunan (SIMB) untuk 23 unit rumah toko (ruko) di Jalan Rahayu/Mestika, Medan. Selanjutnya, Agus memperkenalkan Lili Tjahja kepada tersangka FU yang mengaku bisa menguruskan SIMB dan dijanjikan siap satu bulan. Pada September 2012, Lili Tjahja diberikan 8 lembar SIMB untuk 23 pintu ruko berikut fotokopi SIMB yang telah dilegalisir dan korban memberikan uang tunai Rp240 juta. Penyerahan uang

Hatta Radjasa Hadiri Pelantikan BM PAN Sumut MEDAN (Waspada): Ketua DPP PAN Hatta Radjasa dijadwalkan menghadiri pelantikan pengurus Dewan PengurusWilayah Barisan Muda Penegak Amanat Nasional (DPW BM PAN) Sumut di Convention Hall Hotel Danau Toba Medan 13 Juli mendatang. “Insya Allah beliau (Hatta Radjasa) hadir bersama pengurus DPP PAN lainnya, termasuk Ketua DPP BM PAN Yandri Susanto dan Hafiz Tahir,” kata Ketua Panitia Pelantikan Zulfi Amri di Sekretariat BM PAN Sumut Jln. Selamet Ketaren Medan, Rabu (3/7). Selain pengurus DPP PAN dan BM PAN Pusat, pelantikan akan dihadiri tiga anggota DPR RI Dapil Sumut I, II dan III yaitu Nasril Bahar, Yahdil Abdi Harahap dan H Ibrahim Sakti Batubara serta anggota DPRDSU dari PAN. Zulfi didampingi Sekretaris Abdul Majid Siregar, Bendahara Rindu Parhusip dan Fajar mengatakan, pelantikan ini momen penting bagi BM PAN Sumut melakukan konsolidasi dan merapatkan barisan. Karena itu dia berharap seluruh kader BM PAN Sumut hadir. “Tidak mengurangi rasa hormat pemberitaan di media sebagai undangan bagi kader BM PAN se-Sumut,” kata dia. Selain menjadi ajang silaturahmi bagi kader, kata Zulfi, pelantikan juga sebagai sarana koordinasi antara kader dengan pengurus serta para elit partai untuk mengusung Hatta Radjasa sebagai Presiden RI. Wakil Ketua Umum DPP BM PAN Raji N Sitepu menambahkan, kepengurusan DPW BM PAN Sumut pimpinan HM Iskandar Sakti Batubara dan Sekretaris M Sabri Fiin Tanjung diharapkan bekerja keras dan bekerja ikhlas untuk kemajuan rakyat dan PAN. Selain itu seluruh jajaran organisasi harus melakukan konsolidasi sampai tingkat paling bawah, dengan kegiatan menyentuh kepentingan masyarakat banyak.(m27)

Anggota DPRD Toyohashi Jepang Kunjungi PDAM Tirtanadi MEDAN (Waspada): Sekretaris Daerah Provinsi Sumatera Utara (Sekdaprovsu) H Nurdin Lubis SH, MM yang juga Ketua Dewan Pengawas PDAM Tirtanadi menerima rombongan DPRD dan pengusaha Kota Toyohashi Jepang, di Kantor Gubsu, Selasa (3/7). Rombongan anggota dewan dan pengusaha Jepang itu berjumlah 7 orang yakni, Kondo Hisayoshi, Hikosaka Yukio, Naitou Takanari, Ozaki Masateru, Kako Eri, Nakagawara Shiro dan Nitta Masayuki. Mereka ditemani oleh Dirut PDAM Tirtanadi Ir Azzam Rizal M.Eng, Kadiv PR Ir Amrun, dan Kadiv PLT Ir Delviyandri M.Psi. Dalam kesempatan itu, Anggota DPRD Kota Toyohashi Jepang Kondo Hisayoshi mengatakan, tujuan kedatangan mereka ke Sumatera Utara adalah untuk menjajaki peluang bisnis yang dapat dikerjasamakan. Menurut Kondo, dirinya sengaja membawa beberapa orang pengusaha Jepang agar dapat melihat langsung peluang bisnis yang ada di Sumut. Kata dia, ada beberapa peluang yang dapat dikerjasamakan, di antaranya pengelolaan air minum, pertanian, dan pertukaran informasi. Di samping itu mereka siap memberikan pelatihanpelatihan sehingga tenaga kerja yang dikirimkan bisa menguasai teknologi di bidang industri dan pertanian. Sementara H Nurdin Lubis menuturkan, banyak sekali peluang di Sumatera Utara yang dapat dikerjasamakan, terutama dalam pengelolaan sumber daya alam dan teknologi. Sumut siap menerima investor yang ingin menanamkan modalnya. Sebelumnya rombongan anggota DPRD dan pengusaha Kota Toyohashi tersebut berkunjung ke PDAM Tirtanadi Sumatera Utara dan ini merupakan kunjungan balasan. Selain itu berkunjung keWali Kota Medan, Kadin Sumut, Kabupaten Serdang Bedagai, dan Instalasi Pengolahan Limbah Cemara yang dikelola PDAM Tirtanadi. Rombongan itu juga akan melanjutkan kunjungan ke DPRD Sumatera Utara dan Instalasi Pengolahan Air Sibolangit. (cwan)


SEKDAPROVSU H Nurdin Lubis SH, MM (tiga kanan) didampingi Dirut PDAM Tirtanadi Ir Azzam Rizal M.Eng (kanan) foto bersama anggota DPRD dan pengusaha Kota Toyohashi Jepang, di kantor Gubernur Sumatera Utara.

tersebut langsung oleh Lili Tjahja kepada FU disaksikan Agus dan Hutagalung di rumah korban Jalan Pancurbatu. Berbekal SIMB berdasarkan surat keputusan Kepala Dinas Tata Ruang dan Tata Bangunan Pemko Medan Sampurno Pohan dengan nomor 648/1737 tertanggal 27 September 2011 itu, Lili Tjahja mulai membangun ruko berlantai III dan IV itu. Namun, saat pembangunan ruko mulai menaikkan tiang lantai II, tiba-tiba datang petugas Dinas TRTB memerintahkan penghentian bangunan sekaligus membongkar bangunan. Setelah bangunan dihentikan dan dibongkar, Lili langsung menghubungi tersangka Atong. Setelah bertemu dengan Atong dan petugas Dinas TRTB, akhirnya pembangunan dilanjutkan kembali. Namun, pada Oktober 2012, petugas Dinas TRTB datang lagi sekaligus membongkar bangunan fondasi 15 ruko dan tiang. Begitu mengetahui pembangunan rukonya dibongkar petugas Dinas TRTB, Lili Tjahja

menghubungi tersangka Atong sekaligus mempertanyakan mengapa bangunannya tetap dihentikan dan dirobohkan meskipun telah memiliki SIMB. Saat itu, tersangka Atong berdalih ada kekeliruan pengurusan SIMB dan berjanji akan mengembalikan uang korban Rp240 juta pada Desember 2011. Merasa curiga dan ada sesuatu yang tak beres dalam SIMB tersebut, korban Lili Tjahja mendatangi Kadis TRTB Kota Medan Syampurno Pohan. Korban mempertanyakan kepada Syampurno Pohan, mengapa rukonya dirobohkan padahal sudah ada SIMB No 648/1737. Setelah meneliti SIMB No 648/1737 tersebut akhirnya diketahui bahwa SIMB tersebut ternyata palsu. Sesuai dengan surat No 648/4232 tertanggal 15 Juni 2012 Kadis TRTB Syampurno Pohan menyatakan SIMB milik Lilis Tjahja adalah palsu. Selanjutnya pada 21 Juni 2012, Lilis Tjahja mengadukan tersangka FU alias Atong dan kawan-kawannya ke Polresta Medan yang tertuang dalam la-

poran pengaduan No LP/1677/ VI/2012 Resta Medan. Akibat pemalsuan SIMB tersebut, korban mengalami kerugian Rp 500 juta. Pemilik bangunan diwakili Ir Hermansyah mengharapkan agar tersangka FU alias Atong ditindak tegas dan dikenakan dengan pasal berlapis yakni kasus penipuan dan pemalsuan surat/dokumen negara. “Kasus pemalsuan SIMB ini harus diusut tuntas sekaligus membongkar dugaan sindikat pemalsuan SIMB, apalagi tersangka Atong sudah tak asing lagi di lingkungan kantor Dinas TRTB,” sebutnya. Hermansyah juga mengharapkan agar Kepala Dinas TRTB Syampurno Pohan juga membuat laporan pengaduan karena pemalsuan SIMB berikut tandatangannya dan korps TRTB. “Bila Syampurno Pohan membuat laporan polisi maka akan terbongkar sindikat pemalsuan SIMB tersebut. Lagian, kan Dinas TRTB sebagai pihak yang dirugikan dalam pemalsuan SIMB ini,” katanya. (h04)

PoliMedia Terapkan Kompetensi Produksi Dan Kewirausahaan MEDAN (Waspada): Politeknik Negeri Media Kreatif (PoliMedia) memiliki visi “Menjadi Lembaga Pendidikan Tinggi Terkemuka dan Unggul di Bidang Industri Kreatif”. Slogan yang digunakan untuk mewarnai gerak langkah PoliMedia adalah “Where the Innovation Grows”. Slogan tersebut merupakan sumber motivasi agar seluruh civitas akademika terdorong untuk menjadi insan kreatif, inovatif, dan produktif yang didedikasikan untuk sebanyak-banyak manfaat bagi kemajuan bangsa Indonesia. Institusi pendidikan Poli Media diharapkan dapat memberikan kontribusi inovasi dalam perkembangan era baru masyarakat modern di Indonesia. “PoliMedia memiliki tanggung jawab untuk membawa bangsa ini sejajar dengan bangsa lain dalam kancah percaturan dunia pendidikan internasional, sebagai katalisator untuk pengembangan potensi bangsa,” kata Nasruddin SH, MAP, selaku penanggung jawab PoliMedia Kreatif Medan.

Kata Nasruddin, didirikannya PoliMedia di Medan, adalah dalam rangka menindaklanjuti pidato Presiden Susilo Bambang Yudhoyono saat membuka Pekan Produk Budaya Indonesia (PPBI) di Jakarta Convention Center pada 4 Juni 2008 lalu, yakni : “.....We now must look at the creative future.” Pernyataan itu menandakan industri kreatif yang berbasis kreativitas dan budaya perlu secara sistematis didukung oleh kebijakan pemerintah, baik dari aspek industri maupun dukungan SDMnya. Selanjutnya pada reshuffle Kabinet tahun 2011. Presiden secara khusus membentuk Kementerian Pariwisata dan Ekonomi Kreatif. Kementerian Perdagangan mengkategorikan 14 sektor industri kreatif, yaitu : arsitektur, desain, fesyen (mode), film/video/fotografi, kerajinan, komputer dan piranti lunak, musik, penerbitan, dan percetakan, periklanan, pasar seni dan barang antik, permainan interaktif, reset dan pengembangan, seni pertunjukan, televisi dan Radio.

PoliMedia menerapkan proses pendidikan yang berorientasi pada kompetensi produksi dan kewirausahaan, yaitu proses pendidikan yang menekankan pada peningkatan kemampuan aspek kognitif, efektif, dan psikomotorik peserta didik untuk mampu menguasai proses produksi dan kewirausahaan sesuai dengan program studi yang diminati. Proses pendidikan tersebut diselenggarakan melalui pola kerjasama antara PoliMedia dengan dunia usaha dan industri melalui sistim orientasi industri yang dilaksanakan pada semester dua. Magang industri pada semester IV, dan praktik industri pada semesterVI. Untuk mencapai pada pendidikan tersebut, rasio pembelajaran yang diterapkan adalah teori 40% dan praktik 60%. Untuk ajaran 2012/2013 Politeknik Negeri Media kreatif (Polimedia) Medan membuka penerimaan mahasiswa baru Program Studi Desain Grafis, Teknik Grafika dan Multimedia Jalur Bidik Misi, PMDK, dan UMPN. (cwan)

STIKes Mutiara Indonesia Siap Hadapi Era Globalisasi MEDAN (Waspada): Perkembangan ilmu pengetahuan dan teknologi kesehatan menuntut setiap tenaga kesehatan harus lebih terampil dan profesional. Salah satu faktor yang berperan terhadap kualitas sumber daya manusia adalah pendidikan berkualitas, berpengalaman di bidangnya serta mempunyai jejaring yang luas. Karenanya, perguruan tinggi jangan hanya sekadar menghasilkan lulusan, tetapi harus memikirkan bagaimana agar alumninya dapat bersaing di era globalisasi, mengabdikan dirinya di tengah masyarakat serta mampu menjadi pribadi yang tangguh dan berdisiplin. “Dalam hal ini, diperlukan komitmen dari pimpinan perguruan tinggi agar setiap proses pembelajaran dapat berjalan sesuai visi dan misi yang telah ditentukan,” kata Ketua Sekolah Tinggi Ilmu Kesehatan (STIKes) Mutiara Indonesia DR. Ivan Elisabeth Purba, M.Kes kepada wartawan di Medan, Jumat (6/7). Dalam menghadapi era globalisasi, lanjut Ivan, STIKes

Mutiara Indonesia yang berada di bawah naungan Yayasan Sari Mutiara Medan memiliki komitmen kuat untuk menghasilkan tenaga kesehatan berkualitas sehingga mampu bersaing di industri pasar bebas. Ivan menjelaskan, Yayasan Sari Mutiara Medan bergerak di bidang rumah sakit dan pendidikan tenaga kesehatan. Yayasan ini didirikan Drs. W. Purba dan Bidan S. Sitanggang pada 1970. Selain mengelola RS Sari Mutiara di Medan dan Lubukpakam, yayasan ini juga mengelola institusi pendidikan tinggi sejak tahun 1982. Sampai saat ini, pengurus yayasan berkomitmen memberikan sumbangsih kepada masyarakat. Hal ini dibuktikan dengan semakin banyaknya program studi yang diselenggarakan yakni Keperawatan (D3, S1 dan Profesi Ners), Analis Kesehatan (D3), Analisa Farmasi & Makanan (D3), Kebidanan (D3) dan Kesehatan Masyarakat (S1 dan S2). “Seluruh program studi tersebut telah terakreditasi oleh

Badan Akreditasi Nasional Perguruan Tinggi (BAN-PT) dan Kementerian Kesehatan RI. Yayasan juga menyediakan beasiswa bagi mahasiswa yang tidak mampu secara ekonomi, namun memiliki prestasi di bidang pendidikan,” tambah Ivan. STIKes Mutiara Indonesia dikelola secara profesional dan memiliki dosen berpendidikan minimal S2 yang kompeten dan berpengalaman. Kegiatan belajardidukungfasilitaslaboratorium danperpustakaan online.Bahkan pada tahun 2011 perpustakaan STIKes Mutiara Indonesia terpilih sebagai perpustakaan terbaik tingkat perguruan tinggi. Pada tahun akademik 2012/ 2013 STIKes Mutiara Indonesia Medan menerima mahasiwa baru. Tempat pendaftaran di Kampus STIKes Mutiara Indonesia – Komplek RS Sari Mutiara Jln. Kapten Muslim No. 79 Medan Tel (061) – 8476769 atau HP. 0813 6209 2630. Ujian masuk bagi mahasiswa baru akan diadakan tanggal 11 Juli 2012 (gelombang pertama) dan 7 Agustus 2012 (gelombang kedua).(rel)

Waspada/Anum Saskia

AIR menggenangi halaman SMPN 15 Medan yang dikhawatirkan menjadi ancaman banjir permanen.

SMPN 15 Terancam Banjir MEDAN (Waspada): SMPN 15 di Jalan M Nawi Harahap Gg Suka, Kel. Siti Rejo II, Kec. Medan Amplas, terancam banjir permanen, akibat tumpatnya sejumlah aliran air di kawasan itu. Kepala Sekolah SMPN 15 Drs Sangka Harahap MM, Jumat (6/7) menyebutkan, kawasan sekolah semakin sering tergenang air saat hujan deras. “Biasanya air hujan segera mengering, tapi sudah tiga hari airnya tidak juga surut,” katanya. Dia mengakui jika air yang tergenang di sekolah itu akibat saluran air yang tumpat di beberapa tempat, bahkan di bagian pemukiman penduduk yang semakin memperkecil aliran parit. “Sudah pernah gotong royong antar warga dan pihak kelurahan serta kecamatan, tapi

belum memberikan hasil yang maksimal. Jika hujan terus menerus kami merasa terganggu apalagi menjelang tahun ajaran baru ini, bagaimana siswa akan mengikuti kegiatan Masa Orientasi Sekolah (MOS) jika halaman sekolah banjir,” sebut Sangka. Menurut dia, selain sering banjir, sekolah yang dibangun sejak tahun 1976 itu belum pernah direhab secara sempurna. Jika ada penambahan lokal hanya sebagian saja, tetapi secara keseluruhan masih banyak yang harus diperbaiki. “Bangunan asli tahun 1976 masih ada, makanya dua tahun lalu ada lokal yang runtuh karena sudah terlalu tua. Itupun perbaikannya hanya sederhana dan belum disempurnakan,” ujarnya. Kepala Lingkungan IV Siti

Rejo II Akmaluddin Siagian mengatakan, jika sekolah tersebut butuh perhatian khusus dari pemerintah agar siswa bisa belajar dengan nyaman. “Meski sudah sering gotong royong di lingkungan ini, namun tingginya badan jalan dan semakin padatnya pemukiman penduduk serta minimnya parit pembuangan limbah, secara otomatis air hujan langsung merembes ke kawasan ini,” tuturnya. Rosni, orangtua siswa baru yang mengantarkan anaknya mendaftar ulang ke sekolah itu, meminta perhatian Kadis Pendidikan Kota Medan terkait masalah air tergenang ini. “Janganlah anak-anak kami kena penyakit seperti DBD karena air ini menjadi sarang nyamuk,” sebutnya. (m37)

Soal Dugaan KKN Pengangkatan Kadis Kesehatan Sumut

Suryantini: Tanya Langsung Sama Pak Gatot MEDAN (Waspada): Kabar tentang adanya indikasi KKN (Korupsi, Kolusi dan Nepotisme) dibalik pengangkatan dr. Raden Roro Sri Hartati Suryantini sebagai Kepala Dinas Kesehatan Sumut, membuat dirinya gerah. Saat ditanya wartawan dugaan KKN tersebut, dr. Suryantini menyuruh wartawan bertanya langsung kepada Plt. Gubsu Gatot Pujo Nugroho. “Tanya langsung sama Pak Gatot, jangan sama saya. Saya tidak pernah meminta jabatan ini. Sayapun tidak tahu bisa jadi kepala dinas ini,” kata Suryantini kepada sejumlah wartawan usai acara pisah sambut Kepala Dinas Kesehatan Sumut di aula kantor instansi tersebut, Jumat (6/7). Mengenai jabatannya yang masih merangkap sebagai Kabid PMK Dinas Kesehatan Sumut dan Plt. Direktur RS Haji Medan, Suryantini mengatakan, jabatan tersebut akan diserahkan. Namun penyerahan jabatan ini membutuhkan proses. “Sekarang saya jadi Kadis, kan saya tidak tahu. Tidak serta merta pada hari itu juga saya menyiapkan orang jadi Kabid. Jadi, penyerahan Kabid PMK ini kan masih dalam proses. Kita kan masih ada atasan lagi,” jelasnya.

Suryantini menambahkan, dirinya segera menyerahkan jabatan Plt. Direktur RS Haji Medan, jika diminta Plt. Gubsu. “Jika saya diminta keluar, saya pasti keluar. Karena yang menentukan jabatan sebagai Kadis dan Plt Direktur RS Haji bukan saya,” katanya seraya berjanji akan bekerja semaksimal mungkin. Ketika ditanya tentang program ke depan, Suryantini akan memprioritaskan program percepatan pencapaian Millenium Development Goals (MDGs). Hal ini sesuai dengan target yang ingin dicapai pemerintah Indonesia. Beberapa target MDGs yakni mengurangi angka kematian ibu dan anak, pemberantasan penyakit menular seperti TB, HIV dan malaria. “Ketiga hal itu jadi prioritas saya, selain beberapa program yang sudah ditetapkan sebelumnya,” kata Suryantini. Sementara itu, mantan Kadis Kesehatan Sumut dr. Candra Syafei, SpOG berharap dr. Suryantini dapat meneruskan program yang telah dibuatnya dan menghilangkan pro dan kontra. Menurut Candra, hal yang perlu dilakukan adalah melaksanakan program melalui upaya

kuratif, promotif dan preventif. “Contohnya program Jamkesda, cuci darah, obat kanker dan program penyakit menular,” ujarnya. Seperti diberitakan sebelumnya, pengangkatan Suryantini sebagai Kadis Kesehatan Sumut menimbulkan tanda tanya. Pasalnya, Suryantini tidak memiliki prestasi selama bertugas di Dinas Kesehatan Sumut dan gagal membenahi RS Haji Medan ketika ditunjuk sebagai pelaksana tugas direktur rumah sakit tersebut. Sejumlah sumber Waspada mengaku tidak terkejut ketika Suryantini dilantik sebagai Kadis Kesehatan Sumut. Pasalnya, Suryantini disebut-sebut memiliki hubungan kekerabatan dengan pejabat teras Pemprovsu. “Sejak setahun lalu, sudah beredar kabar bahwa dr. Suryantini bakal menggantikan dr. Candra Syafei sebagai Kadis Kesehatan Sumut. Maklum saja, dr. Suryantini memiliki hubungan kekerabatan dengan penguasa di daerah ini. Buktinya, walaupun dr. Suryantini tidak memiliki prestasi, tapi tetap ditunjuk sebagai Plt. Direktur RS Haji Medan dan diangkat jadi Kadis Kesehatan Sumut. Ini benarbenar aneh,” ujar sumber.(h02)

PT PLS Lecehkan DPRD Sumut MEDAN (Waspada): Pengusiran rombongan Komisi B DPRD Sumut saat hendak masuk ke kawasan sawmill PT Panai Lika Sejahtera (PLS) dinilai sangat melecehkan. Namun dipihak lain, anggota DPRD Sumut mengaku kalau koordinasi di lembaga legislatif selama ini sangat lemah. Anggota Komisi A DPRD Sumut Akhmad Ikhyar Hasibuan, berbicara kepada wartawan di gedung dewan, Jumat (6/7). Dia mengomentari kasus pengusiran rombongan Komisi B DPRD Sumut yang melakukan kunjungan lapangan sebuah perusahaan kayu PT PLS di Simaronop, Kel. Pardouan, Kec. Angkola Selatan, Kab.Tapanuli Selatan (Tapsel). Diberitakan sebelumnya, rombongan Komisi B diusir oleh sejumlah orang sambil mengucapkan kata-kata kotor. Padahal, menurut Ketua Komisi B

Washington Pane, mereka ke sana untuk menindaklanjuti pengaduan Aliansi Mahasiswa Masyarakat Peduli Pelestarian Hutan (AMMPKH), yang menyebut adanya perambahan hutan lindung di Tapsel. Menanggapi ini, anggota Komisi A DPRD Sumut Ahmad Ikhyar Hasibuan mengatakan, di situlah kesalahan Komisi B. Mereka kurang memahami tugas dan fungsi (Tupoksi) komisi. Masalah perambahan hutan bukan Tupoksi Komisi B, tapi tugasnya Komisi A. “Karena menyangkut masalah perizinan,” ujarnya. Ikhyar Hasibuan menyoroti tentang lemahnya koordinasi di lembaga dewan selama ini. Katanya, bisa saja masyarakat atau pribadi-pribadi anggota dewan menerima laporan tentang perambahan hutan. Tapi bukan berarti dapat ditangani oleh seluruh komisi.

Komisi B, lanjut dia, boleh saja menerima pengaduan dari AMMPKH tentang perambahan hutan lindung. Tapi yang menangani masalah ini adalah Komisi A. Harusnya Komisi B mengkoordinasikannya dengan Komisi A. Bukan mereka yang menanganinya. “Karena bukan Tupoksi Komisi B mengurusi masalah perizinan,” sebutnya. Tentang pengusiran yang dilakukan perusahaan? Kata Ikhyar Hasibuan, itu juga salah. Kalaupun mungkin perusahaan tahu kalau yang berkunjung itu bukan anggota dewan dari komisi yang bersangkutan, tapi harusnya tidak langsung main usir. Kalau perusahaan beritikad baik, harusnya rombongan Komisi B itu diterima dahulu, kemudian diberikan penjelasan. “Kalau langsung main usir seperti ini, itu juga namanya pelecehan terhadap lembaga dewan,” tuturnya. (m12)

WASPADA Sabtu, 7 Juli 2012



Politik & Hukum

Masyarakat Berharap Cagubsu Amanah Dan Dipercaya MEDAN (Waspada) : Masyarakat mengharapkan Cagubsu mendatang sebaiknya orang yang amanah dan dipercaya sehingga dapat mengelola asetasetPemprovsumenjadikesejahteraan rakyat Sumatera Utara. Sebenarnya aset milik Pemprovsu nilainya luar biasa, kalaulah dapat dikelola melalui manajemen andal sehingga tidak ada lagi daerah-daerah tertinggal dan orang miskin di Sumatera Utara. Selama ini masyarakat mengetahui aset Pemprovsu ada di mana-mana, namun bagaimana memberdayakan aset tersebut agar dapat dinikmati masyarakat luas secara keseluruhan, tidak transparan. Itulah perlunya kandidat Gubsu yang amanah dan dipercaya. Demikian penegasan Ance Selian (foto), Ketua DPW PKB Sumatera Utara di Bandara Polonia Medan, setiba dari Jakarta, Kamis (5/ 7), berkaitan banyaknya kandidat calon Gubsu ke depan yang mendaftar di parpol-parpol. Kata Selian, belum lagi membicarakan sumber daya kelautan di pesisir timur dan barat aset Sumut juga luar biasa nilainya. Namun hasil laut itu hanya sebagian kecil saja yang dapat dinikmati masyarakat Sumut. Jadi, masyarakat berharap, bagaimana nantinya gubernur ke depan dapat memacu ekonomi mereka, setidaknya kawasan Sumut tidak ada lagi daerah tertinggal yang kehidupan warganya di bawah garis kemiskinan. Sebagai contoh, kota Medan ke depan menjadi kota metropolitan, namun ada beberapa

daerah di Sumut seperti Phakpak Barat, Tapanuli Tengah, Nias Barat, Timur dan Nias Selatan (Nisel) masih tergolong daerah tertinggal, memerlukan perhatian pemerintah. Padahal di daerah tertinggal itu ada lapangan terbang (bandara), namun hanya digunakan untuk hilir mudik para pejabat terutama saat Pemilu dan Pilkada, sementara masyarakat tetap tinggal di bawah garis kemiskinan dan kurangnya perhatian kepada mereka. Bahkan dia menilai, kandidat Gubsu mendatang benar-benar menumbuhkembangkan sikap keteladanan. Jadi, apakah sikap keteladanan dalam bekerja dan kepemimpinan. Hal itu penting, kata Ketua DPW PKB Sumut, kalau sikap tersebut dimiliki calon Gubsu, masyarakat dengan mudah mengenalinya. Dengan demikian dapat menghemat biaya Pilkada akibat tidak terlalu banyak sosialisasi ke masyarakat. Sikap keteladanan seperti dimiliki tokoh nasionai Bung Hatta dan Bung Karno yang akrab dengan masyarakat saat sebelum menjadi pemimpin negara bahkan sertelah itu tetap seperti warga biasa. Namun susahnya pejabat sekarang, sepertinya sikap mereka jauh berbeda saat menjabat dan setelah menjabat, seperti ada jurang pemisah (gap) dengan masyarakat. Padahal kita hidup dalam suasana prularisme (beragam). Isu prularisme hanya slogan saja, terutama saat kampanye Pilkada dan tidak pernah menjadi kenyataan di tengah-tengah masyarakat, kata Ance Selian. (m32)

Cagubsu 2013 Jangan Lupakan Isu HAM MEDAN (Waspada): Ketua Ikatan Keluarga Orang Hilang (Ikohi) Sumut Suwardi mengatakan, pencalonan Gubernur Sumatera Utara jangan melupakan isu Hak Asasi Manusia (HAM). Selama ini, katanya, dari beberapa pemilukada di Sumatera Utara, isu HAM menjadi isu yang dikesampingkan. “Kita ketahui bersama kalau perjalanan bangsa ini banyak diwarnai oleh peristiwa kejahatan HAM yang terjadi pada masa lalu. Suka atau tidak, setuju atau tidak, negara saat ini masih tidak perduli terhadap para korban dan keluarganya,” kata Suwardi kepada Waspada, Kamis (5/7) siang Akibatnya, lanjut Suwardi, implikasi dari peristiwa kejahatan HAM yang terjadi masa lalu dan pembiaran (omission) yang dilakukan oleh negara dapat menciptakan rasa pesimis korban dan keluarga korban terhadap para pemimpin negeri ini. “Termasuk di daerah adalah tanggung jawab kepala daerah dalam memperhatikan nasib para korban. Rencana permintaan maaf kepada para korban pelanggaran HAM yang terjadi pada masa lalu oleh Presiden SBY, harus menjadi perhatian khusus bagi calon pemimpin termasuk di

Sumatera Utara agar juga memperhatikan nasib para korban pelanggaran HAM.” Dijelaskannya, saat ini massif peristiwa kejahatan HAM yang terjadi di masa lalu membuat banyaknya korban yang tersebar di seluruh daerah termasuk juga di Sumatera Utara memilih untuk tidak perduli kepada para calon pemimpin yang memang tidak memperdulikan mereka. “Misalkan ribuan korban dan keluarga korban pelanggaran HAM dalam peristiwa tragedi kemanusiaan 65’ di Sumatera Utara masih belum melihat calon pemimpin berperspektif HAM. Kecenderungan para calon tidak mempedulikan mereka membuat para korban semakin tidak tertarik untuk menjadi bagian dari proses pemilukada tahun 2013 nanti,” tegasnya. Dalam diskusi dengan para korban yang dilakukan Ikohi Sumut, katanya, korban masih belum melihat komitmen negara dalam menyelesaikan kasus pelanggaran HAM yang terjadi, termasuk di Sumatera Utara. (h02)

Pilgubsu Berjalan Baik Kalau Penyelenggara Jujur Dan Adil MEDAN (Waspada): Pemilihan umum (Pemilu) atau pemilihan kepala daerah (Pilgubsu) bisa berjalan bersih, adil,terbuka, dan beradab, jika penyelenggaranya melaksanakan pesta demokrasi dengan jujur dan adil (jurdil). “Artinya Pemilu yang demokratis menjadi syarat mutlak untuk mendapatkan legitimasi kekuasaan yang kuat, sebaliknya kekuasaan mudah goyah bila kemenangan dalam Pemilu diraih dengan cara tidak demokratis,” kata Muslim Muis, SH, M.Hum. Berbicara kepadaWaspada, Kamis (5/7), praktisi hukum Sumut itu mengatakan kalau kemenangan itu diraih dengan curang maka legitimasinya lemah, bahkan rentan konflik. Pemilu yang berlangsung secara tidak demokratis juga bisa melahirkan konflik horizontal. Menurut Muslim, tanpa keberadaan penyelenggara Pemilu berkualitas, maka jangan mimpi hasil pesta demokrasi akan diterima dengan legowo oleh para kandidat yang merasa dirugikan maupun pendukungnya.”Gugatan hasil Pemilu pun akan bergulir artinya Pilkada itu tidak berjalan mulus,” tegasnya. Menurut Wakil Direktur Lembaga Bantuan Hukum (LBH) itu, kualitas demokrasi amat sangat ditentukan oleh hadirnya Pemilu yang mencerminkan keinginan rakyat bukan kehendak elite politik tertentu. “ Upaya-upaya sistematis yang berusaha mencederai proses demokarsi terutama dalam proses penghitungan suara harus diantisipasi dan dicegah oleh pihak terkait,” tegasnya. Dia mengatakan penyelenggaraan Pemilu harus bekerja dengan profesional, baik itu KPU maupun Panwas. Kedua lembaga ini harus bisa menjamin setiap warga negara memiliki kesempatan dan hak yang sama memilih dan dipilih. “Penyelenggara dan peng-

awas Pilkada harus memberikan ruangyangsamakepadamasingmasing pihak sesuai ketentuan berlaku. Contohnya, persamaan hak kampanye. Semua calon diberi kesempatan sama melakukan kampanye,” tegasnya. Kebebasan warga negara memberikan suara tanpa tekanan dan diskriminasi, menurutnya, juga sangat penting, selain kejujuran dan keterbukaan dalam penghitungan suara juga sangat diperlukan. Selama penyelenggara Pemilu tidak mencerminkan sikap jurdil dan independen serta profesional,maka ketidakpuasan dan rasa ketidakadilan akan muncul dan ini memicu terjadi perlawanan hukum terhadap hasil Pemilu. Bahkan, menurutnya, situasi demikian rawan menimbulkan konflik antarindividu dan kelompok di masyarakat dan kondisi tentu akan menguras energi warga masyarakat. Hal senada disampaikan praktisi hukum Sumut lainnya, Kasiaman Pasaribu, SH.

Katanya dalan konteks pesta demokrasi itu, semua harus dilakukan melalui penegakan hukum yang baik dengan diiringi adanya kesadaran seluruh rakyat untuk selalu patuh dengan hukum terutama dalam pesta demokrasi. Menurutnya Pemilu akan berjalan mulus ketika penyelenggara berlaku jujur, tidak memihak, dan bersikap adil. ”Penyelenggara Pemilu harus objektif dalam segala hal yang berkaitan pesta demokrasi,” tegasnya. Tidak kalah pentingnya, kata dia, tindakan pidana bagi pihak yang melanggar ramburambu Pemilu ditindak tegas sesuai ketentuan yang berlaku. “Selain tindakan hukum, pelanggaran administrasi juga harus jalan bagi yang melakukan pelanggaran administrasi. Kalau kriteria di atas berjalan, diyakni, pesta demokrasi seperti Pilgubsu mendatang akan berjalanmulus artinya apapunhasilnya pasti diterima secara legowo baik oleh kandidat maupun pendukungnya,”tegasnya. (m49)

Terjadi 3.391 Pelanggaran

Waspada/Rudi Arman

KANIT Lantas Polsek Medan Timur AKP Sawangin Manurung didampingi Panit Provost Aiptu Rizal memberikan surat tilang kepada sopir truk yang masuk kota di Jalan Krakatau simpang Jalan Jemadi, Jumat (6/7).

Tewas Gantung Diri Di Hotel Kesawan MEDAN (Waspada): Willy Wirya Bakti, 45, warga Komplek Taman Riviera Blok M No.03 Tanjung Morawa, tewas gantung diri di kamar 201 Hotel Kesawan Jln. A. Yani Medan, Rabu (4/7). Korban gantung diri menggunakan tali nilon hijau yang diikatkan di gantungan penyangga tv. Tidak ditemukan tanda-tanda penganiayaan di tubuh korban. Petugas identifikasi Polresta Medan dan Polsek Medan Barat kemudian membawa mayat korban ke RSU Pirngadi Medan. Informasi Waspada peroleh di lokasi kejadian, korban tewas tergantung diketahui sekira pukul 14:00 oleh salah seorang petugas hotel bernama Riky, 30, yang mengecek kamar korban yang mau check out. Pria warga keturunan itu masuk hotel (check in) Senin (2/7) pukul 12:00 dan akan chek out Rabu (4/7) pukul 12:00. Dia menginap di kamar hotel seorang diri. Namun hingga pukul 14:00, Willy belum keluar dari kamar hotel. Petugas hotel kemudian mengecek ke kamarnya dan melihat pintu masih terkunci dari dalam.

Petugas hotel kemudian mengintip dari sela pintu dan melihat korban tergantung dengan tali. “Ketikasayalihatdariselapintu,korbansudahdalam posisi tergantung dibawa penyangga tv,” ujar Riky. Pihak hotel kemudian melaporkan kejadian tersebut ke Polsek Medan Barat. Selanjutnya bersama petugas Indentifikasi Polresta Medan melakukan penyelidikan dan membawa mayat korban dibawa ke RSU Pringadi Medan. Sedangkan Resepsionis Fahru Rozi mengatakan, sebelumnya Rabu pagi sekira pukul 08:00, korban sempat minum kopi di lobi hotel. Petugas hotel juga sempat mengantar sarapan ke kamar korban yang tepatnya dilantai II. ”Korban memang langganan menginap di hotel ini. Kalau menginap di sini sering duduk di lobi hotel di sudut sambil menonton tv dan tidak ada yang aneh selama menginap,” katanya. Belum diketahui secara pasti motif korban nekat gantung diri, karena saat dibawa ke RSU Pirngadi Medan, pihak keluarganya belum ada yang datang. (m39)

Waspada/Rudi Arman

MAYAT korban Willy yang tewas gantung diri ditutupi kain saat dibawa keluar dari Hotel Kesawan untuk dibawa ke RSU Pirngadi Medan, Rabu (4/7).

ban luka ringan 15 orang dengan kerugian material Rp42,6 juta. Nainggolan merinci wilayah terjadi Laka Lantas, yaitu Polresta Medan 3 kasus, Asahan 2 kasus, Binjai 1 kasus, Humbahas 1 kasus, Langkat 2 kasus, Simalungun 2 kasus, Nias 1 kasus, Deliserdang 1 kasus, T. Tinggi 1 kasus, Tapsel 2 kasus. Tobasa 1 kasus. Sedangkan korban meninggal terjadi di wilayah Simalungun dua orang, dan Humbahas satu orang. Dia mengimbau agar masyarakat pengguna jalan raya melengkapi seluruh kendaraannya, dan tidak ugal-ugalan di jalan raya. “Operasi patuh ini merupakan tindaklanjut operasi simpatik, dengan tujuan penindakan terhadap pengguna jalan raya yang tidak mematuhi peraturan berlalu lintas,” kata dia. 93 truk ditilang Sementara itu, selama tiga

hari Ops Patuh Toba 2012, Unit Lantas Polsek Medan Timur telah menilang 93 truk yang masuk inti kota. “Sejak 4-6 Juli sudah 175 surat tilang kita berikan kepada pengendara dengan perincian tilang truk 93 unit, tilang sepedamotor 17 unit, dan betor 10 unit,” kata Kapolsek Medan Timur Kompol Patar Silalahi melalui Kanit Lantas AKP Sawangin Manurung, Jumat. Ditemui Waspada saat menggelar Ops Patuh di Jalan Krakatau simpang Jalan Jemadi, AKP Sawangin mengatakan, truk masuk inti kota merupakan atensi dari Kapoldasu Irjen Pol Drs. Wisjnu Amat Sastro. “Hal ini disebabkan keberadaan truk yang bertonase diatas 3.000 kg menjadi salah satu penyebab kemacatan di inti kota Medan maka dilarang masuk kota,” sebutnya. (m27/m39)

Empat Rumah Hangus Terbakar MEDAN (Waspada): Empat rumah kontrakan di Jln. Sisingamangaraja Gang Mandailing dan Gang Masjid, Kel. Sitirejo III, Medan Amplas, hangus terbakar, Jumat (6/7) dinihari. Tidak ada korban jiwa dalam kebakaran tersebut, namun kerugian ditaksir mencapai ratusan juta rupiah. Sedangkan penyebab kebakaran belum diketahui, tetapi dugaan sementara karena korsleting arus listrik dari salah satu rumah di Gang Mandailing yang di tempati Agung. “Belum diketahui secara pasti, tetapi dugaan sementara karena korsleting arus listrik,” kata Kapolsek Patumbak AKP Triyadi. Warga disana kepada Waspada, Jumat siang mengatakan, kebakaran terjadi sekira pukul 01:00. Api diduga berasal dari rumah yang ditempati Agung, yang ketika itu sedang tidak berada di rumahnya. Dikatakan warga, api kemudian membesar dan menjalar ke rumah yang berada di samping kanan dan kiri rumah Agung, lalu menjalar lagi ke rumah lain yang berada di belakangnya. Ada empat rumah yang terbakar, tiga rumah berada di Gang Mandailing masing-masing ditempati Dedek, 35, bersama keluarganya, Agung, 29, dan keluarganya, serta seorang nenek berusia 70, yang seharinya pedagang sandal di Pasar

Sabtu 7 Juli 2012

Polling Gubernur Sumut Pilihan Pembaca Waspada Pemilihan Gubernur Sumut akan berlangsung 7 Maret 2013. Sejalan dengan itu bermunculanlah para peminat jabatan tersebut. Mereka al. Gatot Pujo Nugroho, Gus Irawan, Chairuman Harahap, AY Nasution, Amri Tambunan, Cornel Simbolon, RE Nainggolan, Benny Pasaribu,Wildan Tanjung, T.Milwan,Soetan Bhatoegana,Rosiana Sianipar,Anuar Shah, Kamaluddin Harahap,Bintatar Hutabarat, Erry Nuradi, Fadly Nurzal, Syah Afandin, dan Kastorius Sinaga. Dari sekian banyak nama-nama tsb di atas, Anda tentu mempunyai pilihan. Tuliskan satu nama saja calon Gubernur Sumut pilihan Anda di bawah ini. Nama




No. KTP/SIM : � Kirim ke Harian Waspada Jl. Brigjen Katamso No. 1 Medan. � Harian Waspada akan mengumumkan setiap hari hasil polling Gubernur Sumut mulai tanggal 10 Juli 2012. � Polling akan ditutup pada tanggal 16 Agustus 2012 sekaligus dengan pengumuman undian bagi 10 pemenang yang berpartisipasi. � 10 Pemenang polling masing-masing akan mendapat 1 (satu) buah BlackBerry 8520 Gemini. � Keputusan panitia tidak dapat diganggu gugat. (tim)

PENGENDARA sepedamotor melintas di depan kantor Komisi Pemilihan Umum (KPU) Sumut di Jln. Perintis Kemerdekaan Medan, Jumat (6/7). KPU Sumut telah menyiapkan serangkaian tahapan menjelang pelaksanaan Pemilihan Gubernur Sumatera Utara (Pilgubsu) 2013.

Waspada/Arianda Tanjung

Hari Ketiga Ops Patuh Toba

MEDAN (Waspada): Hari ketiga Operasi (Ops) Patuh Toba 2012 di seluruh jajaran Polda Sumut, telah menindak 3.391 pelanggaran lalu lintas. Kasubbid Pengelola Informasi Data (PID) Humas Poldasu AKBP MP Nainggolan kepada wartawan, Jumat (6/7) mengatakan, laporan penindakan pelanggaran lalu lintas itu terjadi di seluruh wilayah sejak Ops digelar Rabu hingga Jumat. Dari total jumlah pelanggaran itu, petugas Lantas seluruh wilayah telah mengeluarkan 3.084 surat tilang dan 307 surat teguran. Sementara angka kecelakaan lalu lintas (Laka Lantas) dalam tiga hari Ops berjalan sebanyak 17 kasus. Dari jumlah kasus itu, kata Nainggolan, tercatat korban Laka Lantas meninggal dunia 3 orang. Kemudian korban luka berat 12 orang dan kor-


Dua Mobil Hilang Dari Depan Rumah BELAWAN (Waspada): Dua mobil milik warga Medan Marelan hilang saat parkir di depan rumah. Kedua pemilik mobil telah melaporkan pencurian itu ke Polsek Medan Labuhan, Kamis (5/7). Ahmad, 44, warga Jln. Paku Gg Famili, Kel. Tanah 600, Kec. Medan Marelan, dalam laporannya di Polsek Medan Labuhan mengatakan, mobil Daihatsu Taft GT 4x4 BK 1324 OQ warna biru miliknya hilang dicuri saat diparkirkan di depan rumah. Menurut Ahmad, pada Senin (2/7) malam, dia pulang ke rumah dari tempatnya bekerja. Namun, saat korban tidur, rumahnya dimasuki pencuri. “Ketika bangun Selasa (3/7) pagi, mobilku sudah tak ada lagi,” katanya kepada petugas SPK Polsek Medan Labuhan. Selain itu, tambah korban, surat akte notaris jual beli tanah yang berada di dalam mobil juga dibawa pencuri tersebut. Nasib yang sama dialami Andino, 33, warga Jln. Marelan Komplek Deli Indah Permai No.C.18, Kel. Tanah 600, Kec. Medan Marelan. Dia mengaku kehilangan Mobil Mitsubishi Colt L 300 Diesel E-2 PU FD tahun 2011 warna hitam BK 8715 CJ, Minggu (1/7). Dalam laporannya di Polsek Medan Labuhan, korban mengaku mobil itu hilang ketika parkir di depan rumah. “Mobilku parkir di halaman mulai pukul 23:00 dan aku mulai istirahat pukul 01.00. Begitu aku bagun pagi pukul tujuh, aku lihat mobil sudah tidak ada,” sebutnya. (h03)

Pencuri Helm Dihajar Massa MEDAN (Waspada): Seorang pencuri helm berinisial MT, 34, warga Jalan Pasar VII Padang Bulan, babak belur dihajar massa setelah ketahuan mencuri helm di halaman parkir komplek Perumahan Milala Jln. AH Nasution Medan, Jumat (6/7). Polisi yang datang ke lokasi mengamankan tersangka dari amuk massa dengan memboyongnya ke Mapolsek Delitua. Informasi dihimpun di Mapolsek Delitua menyebutkan, siang itu tersangka bekerja sebagai sopir angkot Medan Bus 135 itu, datang ke perumahan Milala menumpang angkot. Di perumahan itu, tersangka melihat helm merek Helmet tersangkut di sepedamotor milik Andri Riswadi, warga Jalan Pancing, Medan Tembung, yang merupakan suvervisor XL yang berkantor di perumahan tersebut. Tersangka MT mengambil helm tersebut dan langsung menyetop angkot. Namun sebelum tersangka naik angkot itu, diteriaki maling oleh warga yang melihat aksi pencurian tersebut. Selanjutnya massa menarik tersangka yang berusaha naik angkot tersebut dan menghajarnya hingga babak belur. Tersangka bersama barang bukti helm yang dicuri diboyong petugas ke Polsek Delitua. Sedangkan korban Andri telah membuat laporan pengaduan. Kapolsek Delitua Kompol SP Sinulingga saat dikonfirmasi membenarkan kasus pencurian helm itu. “Saat ini tersangka masih menjalani pemeriksaan,” katanya.(m40)

Waspada/Ika Erlia

SALAH seorang warga melintasi rumah yang hangus terbakar di Jalan Sisingamangaraja Gang Mandailing, Jumat (6/7). Sambas. Sedangkan rumah di Gang Masjid, berada di belakang Gang Mandailing ditempati Syamsir Lubis, 65. Semua rumah itu berada di sekitaran kawasan Pasar Simpang Limun. “Saya kira ada warga yang kemalingan atau berkelahi malam itu. Begitu membuka pintu, saya lihat api besar dari rumah kontrakan, dan warga berlarian membawa ember,” kata Kiyah, warga sekitar mengatakan, api berhasil dipadamkan pukul 03:00 oleh petugas pemadam kebakaran dibantu warga. “Semua ludes terbakar. Karena panik saya tidak sempat

menyelamatkan benda berharga, termasuk surat-surat berharga,” sebut Rahmat, 35, anak Syamsir. Warga lainnya, Rahman menyebutkan, petugas pemadam kebakaran baru datang pukul 01:45 setelah rumahrumah itu hampir musnah. Pemilik rumah kontrakan, Marhamah, 40, yang membuka toko perabot tidak jauh dari lokasi kebakaran mengatakan, Dedek dan Agung baru dua bulan mengontrak rumahnya, sedangkan nenek penjual sandal sudah 3 tahun mengontrak. Saat ini, korban kebakaran mengungsi ke rumah warga dan keluarga terdekat. (m27)


TERSANGKA MT sedang memegang barang bukti helm yang dicurinya, di Mapolsek Delitua.

Luar Negeri

WASPADA Sabtu 7 Juli 2012


2 Warga Uzbekistan Dituduh Menembak Imam Di Swedia

Seputar ASEAN

STOCKHOLM (AP): Satu pengadilan Swedia telah mengajukan tuduhan atas seorang pria dan seorang wanita Uzbekistan karena terlibat dalam usaha pembunuhan seorang imam yang melarikan diri dari Uzbekistan yang menghadapi ancaman setelah mengecam kebijakan pemerintah. Obidkhon Sobitkhony terkena tembakan pada bagian kepalanya di Stromsund di utara Swedia, Februari lalu. Dia masih berada di rumah sakit dengan cedera yang mengancam keselamatannya. Dalam dakwaan Jumat (5/7) itu, Jaksa Krister Petersson mengatakanpasanganitu,yangkeduanyaberkebangsaanUzbek,telahmembantu saturencanaorangketiga,menggerakkandanmelaksanakanserangan. Tersangka pria bersenjata itu hingga saat ini masih belum tertangkap. Penguasa Uzbekiostan menuduh korban, yang juga dikenal sebagai Obid-kori Nazarov, membentuk satu organisasi teroris setelah dia mengeritik langkah-langkah pemerintah pada akhir 1990an lalu tentang pengawasan ketat atas berbagai lembaga Islam. Pada 1998, Sobitkhony melarikan diri ke negara tetangganya Kazakhstan dan diberikan suaka di Swedia pada tahun 2006. (m10)

PM Najib: Partai Oposisi Racuni Pikiran Rakyat

Presiden Yaman Desak Dunia Internasional Beri Bantuan SANA’A (Antara/Xinhua-OANA): PresidenYaman Abd-Rabbu Mansour Hadi mendesak dunia internasional memberikan bantuan lebih kepada negara itu setelah kerusuhan tahun lalu masih sulit untuk ditangani, kata kantor berita resmi Saba. “Kerusakan akibat krisis politik tahun lalu masih ada, yang terus-menerus mempengaruhi orang,” kata Hadi saat bertemu delegasi Kongres Amerika Serikat di Sana’a, ibukota Yaman.Hadi, yang mengambil alih kekuasaan pada Februari lalu berdasarkan kesepakatanalihkekuasaanyangmengakhiripemerintahanpemimpin lama Ali Abdullah Saleh, mengatakan bahwa pemerintahannya sedang berjuang untuk mengurangi tingkat pengangguran dengan menciptakan lapangan kerja baru. “Hampir enam juta pemudaYaman membutuhkan pekerjaan, dan sekitar satu juta lulusan universitas telah menganggur selama bertahun-tahun,” katanya.Dia menambahkan bahwa “sejumlah besar pengungsi Somalia dan Ethiopia di Yaman telah membawa beban ekonomi tambahan bagi pemerintah.” Menurut laporan terbaru pemerintahYaman, tingkat kemiskinan di negara Arab miskin itu meningkat dari 35 persen pada 2006 menjadi 54 persen pada akhir 2011. Presiden telah berjanji untuk terus memerangi kelompok teroris dan meningkatkan ekonomi negara selama dua tahun masa pemerintah sementaranya.

China Tangkap 802 Orang Terlibat Perdagangan Anak BEIJING (AP): Kepolisian China telah menangkap 802 orang atas dugaan perdagangan anak dan menyelamatkan 181 orang anak dalam satu operasi besar yang mencakup 15 provinsi, demikian menurut Kementerian Keamanan Umum China Jumat (6/7). Operasi baru-baru ini telah membongkar dua jaringan perdagangan anak dan berhasil menangkap para pemimpin jaringan itu, kata kementerian tersebut dalam satu pernyataannya. PerdagangananakmerupakanproblembesardiChina.Kebijakan yangketatsatuanakChina—yangmembatasisebagianbesarpasangan di kota-kota besar agar hanya memiliki satu anak dan dibenarkan duajikayangpertamalahirperempuan—telahmenyebabkanmaraknya pasarperdagangananak,terutamaanaklaki-lakikarenatradisiwarisan yang harus jatuh ke tangan anak laki-laki. Kebanyakan anak yang diperdagangkan adalah hasil penculikan, namunsebagiandijualolehparakeluargamiskinkarenasulitmemelihara anak atau mereka memang tak menghendaki anak perempuan. Anak-anak yang diculik kerap dijual untuk diadopsi, atau sebagai buruh dan pembantu rumah tangga. Dalam operasi terakhir itu, anak-anak diselamatkan dari sindikat di 15 wilayah dan provinsi, termasuk Hebei, Shandong, Henan, Sichuan, Yunnan. Investigasi yang mengarahkan polisi pada penangkapanpenangkapaninidimulaipadaDesember2011ketikaempattersangka ditangkap di provinsi Henan saat berusaha menjual empat bayi. Seorang tersangka yang“paling dicari”, Shao Zhongyuan, ditangkap di distrik Pingyi, provinsi Shandong, kata kementerian. Dia diduga berasal dari sindikat yang menjual lebih dari 100 anak. Beberapa tersangka kunci juga ditangkap, kata polisi.Kementerian merilis laporan pada Maret 2011 mengatakan polisi menyelamatkan puluhan ribu anak dan perempuan yang diculik. Dalam operasi sebelumnya, polisi menangkap sindikat penjual perempuan Cina untuk dijadikan pelacur di Angola, dan menambahkan 19 perempuan diselamatkan dan 16 orang ditangkap. Kebebasan bergerak yang lebih besar sebagai dampak reformasi ekonomi China juga diduga sebagai faktor yang memudahkan sindikatsindikat ini beroperasi. (m10)

Lima Tewas. 40 Terluka Dalam Serangan Bom Di Irak BAGHDAD, Irak (Antara/Xinhua-OANA): Lima orang tewas dan 40 lainnya cedera dalam serangan terpisah, termasuk pengebom bunuhdiri di Irak, kata polisi. Di Irak Utara, seorang pengebom bunuhdiri meledakkan rompi peledaknya di satu tempat tukang cukur di pusat kota Mosul, sekitar 400 kilometer utara Baghdad, menewaskan seorang tentara dan empat warga sipil, kata satu sumber polisi provinsi yang tak bersedia disebut namanya kepada Xinhua. Ledakan itu juga melukai 20 orang, menghancurkan tempat tukang cukur dan menyebabkan kerusakan pada beberapa tokotoko terdekat, kata sumber itu. Dalam insiden terpisah, sebuah mobil jebakan meledak di satu persimpangan jalan di barat Mosul, melukai 13 orang dan menyebabkan kerusakan pada beberapa mobil sipil yang ada di dekatnya, sumber tersebut menambahkan. Di provinsi bagian utara-tengah Irak, Sahahudin, polisi melihat seorang pembom mobil bunuh diri yang dicurigai dan mengejarnya, tapi ia meledakkan bahan peledak yang sarat di dekat mobilnya di pasar pusat kota Tikrit, sekitar 170 kilometer utara Baghdad, sumber polisi setempat mengatakan. Empat orang yang lewat juga terluka akibat ledakan itu, kata sumber itu.


MENYEMATKAN MEDALI. Presiden baru Mesir Mohamed Moursi menyematkan satu medali di dada seorang prajurit dalam satu upacara di satu pangkalan militer Iskandariyah, di kawasan Laut Tengah Mesir, kira-kira 230 km di utara Kairo, Kamis (5/7).

Assad Makin ‘Gagah’ AS ‘Gusar’ Dan Dorong Desak PBB Jatuhkan Sanksi Keras PARIS (AP): Keberhasilan rezim Presiden Bashar Assad mengatasi berbagai gerakan yang dilakukan oposisi dalam usahanya untuk menjatuhkan penguasa di Damaskus itu, telah membuat Amerika Serikat makin ‘gusar’ sehingga Washington mendorong agar PBB menjatuhkan sanksi keras atas Damaskus. Bukti keberhasilan Syria terus mengungguli oposisi terjadi lagi Jumat (6/7) ketika mereka merebut kubu gerilyawan di Provinsi Idlib di Syria Utara, Khan Sheikhoun setelah satu serangan terhadap kota kecil itu dengan dukungan helikopter, kata jurubicara gerilyawan. “Tentara (Syria) Baru mundur dari kota kecil tersebut semalam, setelah kehabisan amunisi. MiliterAssadmenguasainya,”kata Abu Hamam, jurubicara gerilyawan yang melarikan diri ke satu desa yang berdekatan. Amerika Serikat di pertemuan Paris berusaha memimpin seruan untuk dijatuhkannya sanksi baru PBB yang lebih keras terhadap Assad dan kroninya, kata para pejabat AS, Kamis. Hal itu disampaikan oleh seorang pejabat bertepatan dengan saat Menteri Luar Negeri Hillary Clinton terbang ke Paris untuk menghadiri pertemuan Temanteman Syria itu. Pertemuan itu merupakan saatnya untuk ‘bersama-sama medukung resolusi

dewan keamanan yang meningkatkan tekanan bagi Bashar, termasuk memberikan konsekuensi nyata’ seperti sanksi ekonomi. “Kami percaya sebagian besar negara yang hadir di Paris berpikir bahwa sanksi ekonomi pada Bashar harus termasuk dalamBab7,”kataseorangpejabat yang tidak disebutkan namanya, yang mengacu kepada suatu klausul dalam piagam PBB. “Banyak negara di Paris telah mempunyai sanksi-sanksi mereka sendiri namun menyatukan seluruh sanksi itu tepat penting. Ini adalah argumen yang akan terus kami sampaikan kepada Rusia dan China.” Tujuannya adalah untuk mempertahankan momentum, berdasarkanpembicaraandiJenewa dan Kairo dan Paris, dengan Dewan Keamanan PBB siap untuk menetapkan sanksi segera pekan depan. “Sudah ada banyak hal yang dilakukan di NewYork dalam hal pemikiran tentang bentuk dari

resolusi ini,” kata seorang pejabat lain AS. “Idenya adalah untuk... segera membawanya ke New York tanpa menunda-nunda lagi. Berapalamasemuaituakandapat disetujui, adalah hal yang cukup berat namun harus diantisipasi. Tetapiprosessedangberlangsung dan fokusnya akan di New York pekan depansegera setalah kami menyelesaikan pertemuan Paris ini.” Pertemuan Teman-teman Syria dijadwalkan dihadiri oleh sedikitnya 80 negara serta organisasi non pemerintah dan perwakilan dari oposisi Syria. Menurut para aktivis 80 persen warga telah melarikan diri sejak Kamis. Khan Sheikhoun, kota kecil yang dihuni oleh lebih dari 70.000 warga di pedesaan Provinsi Idlib, dilalui jalan raya barat —yang menghubungkan ibukota Syria, Damaskus, dengan Aleppo. Kota kecil itu telah menjadi salahsatufrontyangdiperebutkan oleh militer Suriah, yang bertujuan memadamkan aksi perlawanan16-bulanterhadapBashar. Gerilyawan menyatakan mereka telah menderita kekalahan besar selama pertempuran yang bertambah sengit Rabu malam. “Yang sekarang berlangsung adalah operasi yang sangat gencar, tampaknya Bashar telah mengerahkan semua militernya

guna menggilas Khan Sheikhoun dan kota kecil di sekitarnya,” kata Abu Hamam. Para pegiat mengatakan lebih dari 200 orang telah ditahan sejak Rabu. AS makin‘gusar’ setelah terlihat dalam pertemuan para oposisi Syria adanya perpecahan dan saling tidak percaya satu sama lain, sehingga Jenderal membelot Meskipun pasukan Assad mengalami banyak kemajuan di beberapabagian,namunseorang jenderal senior yang dekat dengannya bertolak menuju Paris setelah membelot, kata Menteri Luar Negeri Prancis Laurent Fabius, Jumat. “Seorang pejabat senior dari rezim Syria, seorang komandan diPengawalRepublik,telahmembelot dan bertolak ke Paris,” kata FabiusdalampertemuanTemantemanSyriayangdihadiriolehwakil dari lebih dari 100 negara di Paris, setelahlaporantentangpembelotan MunafTlass.Namundiataksecara pasti me-nyebut nama Tlass. Tlass, perwira paling senior militer Syria yang telah meninggalkan pemerintah Bashar, berada dalam perjalanan ke Paris untukbergabungdenganistridan saudarinya, Nahed Ojjeh —janda dari pialang senjata dan jutawan Arab Saudi Akram Ojjeh, kata satu sumber yang dekat dengan pemerintah Syria. (m10)

Virus Kiamat Internet Ancam Hampir 250.000 Komputer Di Dunia Senin BOSTON (Antara/Reuters): Sebanyak seperempat juta pengguna komputer di seluruh dunia menghadapi resiko kehilangan akses Internet Senin (9/7), akibat perangkat lunak berbahaya kelompok peretas yang dilumpuhkanpemeritahAS,Novemberlalu. Beberapa laporan berita dan bloghebohmembicarakanresiko gangguantersebut,memperingatkan mengenai potensi “kegelapan” dan menggambarkan perangkat jahat Alureon sebagai virus Kiamat Internet. Meski begitu, para ahli mengatakan hanya segelintir pengguna komputer menghadapi resiko, dan penyedia Internet akan dihubungi agar segera me-

mulihkan layanan mereka. Para ahli mengatakan mereka menganggap ancaman itu kecil dibandingkan dengan virus lain yang lebih ganas seperti Zeus dan SpyEye —yang menyerang jutaan komputer pribadi (PC) serta dimanfaatkan untuk melakukan penipuan keuangan. Hingga pekan ini, sebanyak 245.000 komputer di seluruh dunia masih terserang virus Alureon dan‘saudaranya,’ kata perusahaan keamanan komputer, Deteque,sebagaimanadilaporkan Reuters.Jumlahitumeliputi45.355 komputer di Amerika Serikat. Virus dirancang untuk mengalihkan arus lalu lintas Internet melalui server DNS merah yang

dikendalikan para penjahat, kata FBI. Server DNS adalah papanpenghubung komputer yang mengarahkan lalu lintas Jejaring. Ketika pihak berwenang mematikan server merah, seorang hakim federal di New York memerintahkan agar server sementaratetapdioperasikansementara mesin korban diperbaiki. Server sementara tersebut akan dimatikanpadapukul12.01WaktuAmerika Timur pada Senin. Itu berarti PC yang terserang dan belum diperbaiki tak lagi bisa terhubung dengan Internet. Layanan Internet Sebagian penyedia layanan Internet, termasuk AT&T dan TimerWarner Cable, telah melaku-

kan pengaturan sementara sehingga pelanggan mereka akan dapat memperoleh akses ke Internet dengan menggunakan alamat server DNS merah. Informasi mengenai cara mengenali dan membersihkan virus dapat ditemukan di jejaring yang didirikan oleh sekelompok perusahaan keamanan dan ahli lain: http:// “Itu sangat mudah diperbaiki,”kataGunterOllmann,Wakil Presiden Penelitian bagi Perusahaan Keamanan Damballa. “Ada banyak alat yang tersedia.” Banyak mesin yang masih terinfeksi barangkali tidak digunakan secara aktif sebab kebanyakan korban sudah diberitahu

PEKAN (The Star): Partai-partai politik oposisi mengajari masyarakat berbagai hal yang buruk, bahkan masalah yang bertentangandenganagama,demikianmenurutPMMalaysiaNajibRazak. Buktinya,tigahalburukantaralaintidakperlumenyelesaikanmasalah hutang,perbuatanbaikdapatdilupakandanjanjitidakperludirepati. “Banyakjanjiyangdibuat(olehpartaioposisi)selamapemilihan umum yang lalu namun (setelah mereka berkuasa di beberapa negara bagian) mereka tidak memenuhi janji mereka,” katanya dalam satu penyerahan pakaian Idulfitri untuk 45 organisasi non-pemerintah dan 53 boat kepada para nelayan di konstituen parlemennya di Pekan. Najib mengatakan pemerintah Barisan Nasional, di bagian lain, tidak hanya memenuhi janji-janjinya, tapi juga memberikan bantuan kepada masyarakat padahal sebelumnya tidak pernah dijanjikan. Dia juga mengatakan bahwa Islam mengharuskan semua hutang harus dibayar dan bahwa bila orang meninggal dunia, hutang-hutang mereka harus diselesaikan oleh warisnya. BagiNajibomongbohongdaripihakoposisitidakharusditanggapi. Menurutnya, dalam Islam semua janji harus ditepati, atau nantinya harus dibayar di akhirat. “Oposisi juga telah meracuni pikiran rakyat. Mereka menganjurkan rakyat untuk tidak menghargai apa yang sudah pemerintah lakukan bagi mereka,” tutur Razak. Dirinya pun melihat Malaysia harus dipimpin oleh tokoh visioner dan memiliki integritas tinggis. Menurutnya, tanpa ada integritas dan visi, semua rencana akan berakhir dengan kehancuran. (m10)

Myanmar Tahan Warga Thai BANGKOK,Thailand (Reuters): Angkatan bersenjata Myanmar menahan 75 penduduk desa Thailand yang dicurigai menyerobot tanahMyanmardiwilayahdimanaperbatasantidakdiberipatokan yang pas, kata Wakil PM Thailand Jumat (6/7). Penduduk desa itu dikepung tentara Myanmar Rabu malam dari daratan lewat distrik Kra Buri di Provinsi Ranong, 570 km baratdaya ibukota Thailand, Bangkok, kata Yutthasak Sasiprapa dalam satu konferensi pers. “Kami sedang mendiskusikan dengan Myanmar jalan keluar dari situasi ini. Pejabat angkatan bersenjata Thailand di wilayah itu dan Kementrian Luar Negeri kami sedang berunding dengan sempalan di Myanmar,” katanya. Pihak kementrian luar negeri mengatakan dalam satu pernyataan 50 penduduk desa ditahan. Parapendudukdesaitumungkintelahmelintasimasukwilayah Myanmar, di mana sebagian di antaranya menanam pohon karet di sisi perbatasan yang salah, kataYutthasak, sambil menambahkan angkatan bersenjata Thailand diperintahkan untuk menghentikan penduduk desa masuk secara illegal ke Myanmar. Thanit Kumthorn, Kepala Distrik Kra Buri, kepada Reuters lewat telepon mengatakan para penduduk desa tidak disiksa dan mereka diperlakukan secara layak. Dia tidak mendengar adanya laporan tentang jatuhnya korban dalam insiden itu.(m23)

Jurubicara: Pemerintah Filipina Sambut Kongres MILF MANILA, Filipina (Antara/Xinhua-OANA): Pemerintah Filipina Jumat (6/7) menyambut sidang umum dipelopori kelompok Front Pembebasan Islam Moro (MILF) di Provinsi Maguindanao, Filipina Selatan, kata seorang pejabat senior. Jurubicara Kepresidenan Edwin Lacierda mengatakan, pemerintah akan mengirim perwakilan untuk kongres empat hari yang secara resmi akan dimulai Sabtu sampai Senin, di Darapanan, Sultan Kudarat, Provinsi Maguindanao. “Kami melihat ini sebagai perkembangan positif bagi MILF untuk mengonsolidasikan dukungan bagi perjanjian perdamaian. Dan itu adalah sesuatu yang kami sambut baik,” katanya. Teresita Deles, Penasehat Presiden mengenai Proses Perdamaian dan anggotatimperundinganakanhadirdiDarapananuntukberpartisipasi dalam acara tersebut. Dia mengatakan, pemerintah berharap bahwa pertemuan itu akan membantu terwujudnya perjanjian perdamaian dengan MILF. Sekitar satu juta pendukung dan pejuang MILF diperkirakan juga akan ikut ambil bagian dalam acara itu.

Pabean Hongkong Sita 649 Kg Kokain Bernilai AS$98 Juta HONGKONG (AP): Para pejabat pabean Hongkong mengumumkan Jumat (6/7) bahwa mereka telah berhasil penyitaan kokain terbesar yang belum pernah dilakukan sebelumnya di kota itu. Kokain seberat 649 kg dengan nilai 76 juta dolar Hongkong atau AS$98 juta. Obat terlarang itu dikirimkan dalam satu konteiner yang tiba di pelabuhan Hongkong dari Ekuador, kata John Lee, kepala Biro InvestigasiObatTerlarangPabeanHongkong(CDIB).Leemengatakan dia yakin sebagian besar pengiriman ditujukan ke Asia Tenggara atau Daratan China. Ketika para petugas pabean melakukan pemeriksaan, sejumlah petugas menemukan 541 bungkus kokain, yang masing-masing beratnya1,2kg,yangtersembunyididalamsatutumpukanpengiriman kayu. Tiga orang yang berhubungan dengan pengiriman konteiner tersebut telah ditahan. Lee mengatakan departemen pabean Hongkong tahun ini telah bekerjasama dengan DEA dari badan pengawas narkotika Amerika Serikat dan para penegak hukum Amerika Selatan dalam memerangi perdagangan obat terlarang. Penyitaan terakhir itu melampaui satu keberhasilan tahun lalu ketika pihak berwenang menyita 560kg kokain seharga AS$77 juta yang ditemukan di satu gudang. Lima warga Mexico dan seorang Kolombia termasuk di antara delapan orang yang ditangkap dalam kasus itu. (m10)

Dua Kekuatan Besar Dunia Bermain Di Timur Tengah PERANG saudara yang terjadi di Syria sekarang ini menunjukkan dua kekuatan besar dunia masih bermain Timur Tengah. Setelah bubarnya Uni Soviet tahun 1990-an disebutsebut Perang Dingin sudah berakhir. Uni Soviet adalah gembong Blok Timur dan Amerika Serikat dan sekutunya merupakan Blok Barat. Kedua blok ini mencari pengaruh masingmasing di berbagai belahan dunia khususnya di Timur Tengah. Dengan usainya Perang Dingin seyogyanya kedua blok tidak lagi mencari pengaruh di dunia dan dapat menciptakan perdamaian dunia. Meskipun secara formal kedua blok sudah hapus, tapi kenyataannya sekarang sebagaimana sewaktu perang dingin dua kekuatan besar dunia yaitu Amerika Serikat dan sekutu baratnya serta Uni Soviet — yang kini diwakili hanya oleh Rusia masih berlangsung. Usai perang dingin bukannya membuat dunia menjadi damai tanpa perang, tapi malah makin hancur karena Amerika Serikat merasa tidak memiliki lawan lagi yang menghalanginya un-

tuk menyerang dan menghancurkan negara lain seperti yang terjadi di Irak dan Afghanistan. Syria seperti diketahui merupakan sekutu tradisonal Rusia sejak zaman Uni Soviet belum bubar duku, ketika Hafez Assad yaitu ayah Bashar Assad masih berkuasa, Syria tetap setia menjadi sekutu Uni Soviet.Sementara ketikaBasharberkuasa,Syriatetap sahabat dekat Uni Soviet yang sekarang jadi Rusia. Sebab itu ketikaBaratinginmengambilopsi militer terhadap pemerintahan Bashar karena tindakannya memerangi pihak oposisi yang memintanya mundur dari pemerintahan mengikuti revolusi Arab yang terjadi di negara-negara Arab, Rusia dan China memveto resolusi yang melegitimasi tindakan militer barat di Syria. Presiden RusiaVladimir Putin beralasan seranganmiliterASdansekutunya di Irak, Afghanistan dan Lybia menghasilkankondisilebihburuk dari sebelum invasi dilakukan. Sementara itu AS memiliki dendam lama terhadap Syria karena sejak masa pemerintahan Hafez Assad sebagaimana Iran dan Irak, Syria menentang

dominasi AS di Timur Tengah. Selain itu, Syria juga dituduh bersahabat dengan Iran yang sangat dimusuhi Barat karena program nuklirnya. Syria bersama Iran dituduh mendukung perjuangan kelompok Hizbollah di Lebanon Selatan, Hamas di Palestina dan kelompok militan dan radikal lainnya di Timur Tengah untukmemerangiIsrael.Jadiketika revolusi Arab atau Arab Springs terjadi di Syria mengikuti gejolak yang terjadi di Aljazair,Mesir dan Libya, AS dan sekutu Barat berkesempatandengansegaladayadan upaya serta dengan mengatasnamakandemokrasidanHAM berusahauntukmendongkel rezim Bashar Assad. Lain dengan Libya, Rusia dan China tidak memveto resolusi yang melegitimasi serangan pasukan NATO di Afrika Utara itu yang menyebabkan tewasnya secara tragis Moammar Khadafi. Padahal selama lebih satu dekade belakangan ini, Khadafi yang dulu menentang dominasi AS di Timur Tengah dan berpihak pada Uni Soviet sudah membina hubungan baik dengan Barat dengan

tidak lagi berkonfrontasi dengan AS dan sekutunya serta menamakan berbagai investasi di berbagai negara Barat. Bagi Rusia, Syria sekarang ini merupakan benteng terakhirnya untuk mempertahankan pengaruhnya di Timur Tengah setelah hampir seluruh kawasan itu dipengaruhiASdansekutunya setelah jatuhnya rezim Khadafi dan Saddam Hussein karena serangan AS. Kendati cuma Syria yang tersisa dari pengaruh Rusia di kawasan bergolak itu namun Syria tidak dapat disepelekan. Karena Syria sejak masa pemerintahan Hafez memiliki wibawa dan pengaruh besar di kawasan Timur Tengah khususnya bagi negara-negara dan kelompok-kelompok yang menentang dominasi AS di kawasan itu. Iran sampai sekarang diketahui sangat menentang pengaruh AS di Timur-Tengah namun negeri para mullah itu tidak memiliki ketergantungan yang besar terhadap Rusia. Iran selama ini secara ekonomi bersifat mandiri tidak banyak tergantung kepada negara-negara lain untuk membantunya.

Dengan mengatasnamakan revolusi Arab, rakyat dan pemerintah negeri-negeri di kawasan Timur Tengah itu tidak menyadari bahwa kini mereka masuk dalamperangkapadudombadan politik dominasi licik kawasan Timur Tengah yang sejak dahulu diperebutkannegara-negarabesar karena kekayaan minyaknya dan pasar strategis untuk menjual senjata-senjata militer canggih produksi AS dan Rusia. Sebagai kawasan yang mayoritas Muslim rakyat dan pemerintah negara-negara di Timur Tengah seharusnya cerdas menyikapi politik licik negaranegara besar untuk menghancurkan mereka. Sebagai umat Islam, seharusnya mereka mengikuti al-Qur’an dan hadits yang menganjurkan kaum Muslimin untuk bersatu, saling berkasih sayang dan jangan terpecah belah. Jika bersatu tidak ada satu kekutan pun yang mampu menghancurkan dan mengalahkan kita. Bagaimanapun kalau konflik terjadi rakyatlah yang paling menderita dan banyak menjadi korban. (Nurhayati Baheramsyah)


JOHN Lee (tengah), kepala Biro Investigasi Narkotika Pabean Hongkong berbicara — di depan setumpukan kokain yang berhasil disita — satu temu pers yang diselenggarakan Departemen Pabean Hongkng d Hongkong Jumat (6/7). Para petugas pabean berhasil menyita kira-kira 649 kg kokain dengan harga pasar gelap kira-kira AS$98 juta, demikian menurut laporan Jumat. Obat terlarang itu ditemukan di dalam satu konteiner yang datang dari Ekuador di Terminal Konteiner Kwai Chung dan tiga orang ditangkap dalam kasus itu.

A8 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

A C : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

P S : Power Stearing PW : Power Window RT : Radio Tape VR : Velg Racing EW : Electric Window

CHEVROLET Blazer Thn. 2002. Warna hijau met. Siap pakai/Mulus. Hub. HP. 0813 7602 6026 DAIHATSU Taft Rocky 4x4 Thn. 93. Hitam, BK Medan lengkap, siap pakai. Gerdang Porsneling senyap. Harga 75 Juta/damai. Hub. 0812 65451974


Xenia....DP 30 Jt-an...Angs. 3 Jt-an Terios.....DP 35Jt-an...Angs. 3 Jt-an Pick Up..DP 11 Jt-an...Angs 2 Jt-an Luxio......DP 20 Jt-an...Angs. 3Jt-an Hub. Capella Medan (Josua) 0812 6311 0820

DAIHATSU Xenia Delux Th. 2008. BK Mdn W. Silver met, cat dan mesin mulus, siap pakai. Hrg. 108Jt Nego. HP. 0821 6021 0957


Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 4 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067


Xenia 1.300cc Angs. 2,4Jt-an/bln. Gran Max Pick Up Angs. 2,3Jt-an/bln. Hub. DIKA 0852 7074 7744 (Terima Tukar Tambah)

5 CM 6 CM

Rp. 65.000 Rp. 78.000

W. Hitam, AC, Tape/CD/TV, VR, BR, Jok kulit. Original, sehat, tinggal pakai. Harga 133Jt/ damai. Hub. (061) 77731399. Pemakai. TOYOTA Kijang Capsul Diesel LGX, Th, 2000. W. Merah metalic. AC DB, Tape, VR, BR, PS, PW, CL, Jok kulit. Body kaleng. Mulus. Tdk kecewa. Hrg. Nego. Hub. 0813 7582 3555

SUZUKI Carry Real Van DRV Th. 2006. BK Mdn W. Biru met. Cat dan mesinsiap pakai. Hrg. 65Jt HP. 0852 7080 0042

TOYOTA Kijang Capsul LGX Th. 2003. W. Biru metalic, AC DB, Tape, VR, BR, PS, PW, CL, Jok kulit. Body kaleng, mulus seperti baru. Hub. 0813 6233 0595

SUZUKI Carry Extra 1.0 Thn. 91. Warna merah, Velg Racing, Tape, Siap pakai. Adi putro. Harga 26Jt Nego. Hub. 0821 6399 9191

TOYOTA Kijang Krista Thn. 1997. Wrn hijau Bensin 1,8. BK Medan 1 tangan. Hrg. 95Jt Nego/damai. Hub. 0812 63779410

Ertiga, APV Arena, Carry Pick Up Hub. 0852 6111 7724

TOYOTA Kijang Super Pick Up Thn. 1994. Sangat mulus/kaleng2 warna biru Rp. 50Jt. (nego setelah dilihat) HP. 0812 650 8253


SUZUKI Realvan 1.3 Thn. 97. BK Medan. W. Hijau met. Hub. 0812 6368184 SUZUKI Katana GX Thn. 95/96. W. Hitam. BK Medan, AC, Tape, V. Racing. Hub. 0813 6176 1239 DEALER RESMI SUZUKI

Carry PU DP 15Jt-an Angs. 3,2Jt 3 Thn. APV DP 20 Jt-an Angs. 5 Jt 2 Thn. Splash DP 42Jt-an Angs. 4,7Jt-an 3 Thn. Ertiga DP 42Jt-an Angs. 4,6Jt 3 Thn. Hub. RIDWAN SIREGAR 0813 6143 7654

SUZUKI Carry Futura Dijual. Minibus 1,3. Thn. 92/93. BK Medan AC/Jok kulit. Siap pakai. Hrg. 35Jt Nego. Hub. 0812 639 3235 SUZUKI Side Kick ‘96. W. Ungu met, BK Panjang, model Escudo. Komplit, mulus. Hub. 0821 6717 6723 / 77967597


Carry PU DP 15Jt-an Angs. 3,2Jt 3 Thn. APV DP 20 Jt-an Angs. 5 Jt 2 Thn. Splash DP 42Jt-an Angs. 4,7Jt-an 3 Thn. Ertiga DP 42Jt-an Angs. 4,6Jt 3 Thn. Hub. RIDWAN SIREGAR 0813 6143 7654

Ready: Xenia, Terios, Sirion, Pick Up, Grand, Max, Proses Cepat, Full cash back. Terima Tukar Tambah Hub. Yudha 0852 7695 7747

ALL NEW XENIA (BARU) 1300cc, AC DB, Sensor Parking, CD, MP3, USB, Alarm, Central Lock, Angs. 2.333.100. Pick Up Angs. 2.409.000. Terios Angs. 2.747.000. Hub. Adek - Astra. 0812 6340055. PIN 274CA61C


SUZUKI Carry Futura Dijual. Minibus 1,3. Thn. 92/93. BK Medan AC/Jok kulit. Siap pakai. Hrg. 35Jt Nego. Hub. 0812 639 3235


TOYOTA Kijang Commando Th. 93. Warna hijau met BK Mdn AC, Tape, VR, BR, Cat mulus. H. Nego. 0821 6161 0902

DIJUAL - Daihatsu Terios TX 2012. Jok dibalut coklat MB Tech + alas lantai + doortrim. W.putih. - Hub. 0821 6416 4489

TOYOTA Altis G Warna Hitam Thn. 2002. BK Medan. Hrg. 126Jt/Nego. Hub. 0852 6267 7735

Xenia, Luxio DP 20Jt-an Angs. 2Jt-an Terios, Sirion DP 30Jt-an Angs. 3Jt-an Ready Stock Hub. Hasibuan Astra 0812 6362 4634

- D. Hiline 4x4 PU. BK, Biru, 02, 04, 06 - D. Hiline 4x4 PU, BK Htm -92, 97, 01 Bantu Kredit Hub. Yos Sudarso 42-F. Lewat Pajak Glugur, 0812 6070 476 PROMO DAIHATSU JULI

Xenia DP 17 Jt-an angs. 4 Jt-an Pick Up DP 7 Jt-an angs. 2 Jt-an Terios DP 17 Jt-an angs. 4 Jt-an Sirion DP 12 Jt-an angs. 4 Jt-an Luxio DP Nego. Full Discount, Ready Stock, Proses Cepat. Hubungi: IRNANDA 0813 7580 2895 / 0821 6761 2659

TOYOTA Avanza G/2004, W. Gold BK Medan asli, pajak panjang mulus. Hrg. Rp. 107Jt/Nego. Hub. Jl. Perintis Kemerdekaan No. 38 G/ Di depan Indosat.


TOYOTA Corolla All New Th. 98. Warna merah, Mobil cantik Rp. 80Jt. Hub. 0852 6260 3333


TOYOTA Kijang Super Short Thn. 1994, 1486cc, W. Abu-abu Tua Met, AC, C. Lock. R/T. BK asli Medan, Pajak panjang, dijual. Hrg. Rp. 58Jt (Nego Tipis). (Tanpa Perantara). Lokasi Psr.7 Tembung. Hub.0813 6172 9040

DAIHATSU Taruna CSR EFI Thn. 2001/2000 Hitam met (Over kredit). Plat BM - Mulus - Siap pakai - Balik DP: 48Jt (nego). Sisa Angsuran: 2,5Jtx21 bulan. Hub. 0852 9775 0771 77756757. Jl. SM. Raja - Simp. Amplas.

Xenia, Terios DP 24 & 27 Jt-an /Angs. 2 Jt-an Luxio..DP 13 Jt-an/Angs. 2 Jt-an Gran Max, MB DP 17 Jt-an/angs. 2 Jt-an Pick Up DP 11 Jt-an/Angs. 2 Jt-an “Proses Cepat & Dapatkan Penawaran Khusus” Hub. R I A N A S T R A 0 8 1 2 6 3 8 3 6 9 1 Xenia DP 17 Jt-an angs. 4 Jt-an Pick Up DP 7 Jt-an Angs. 2 Jt-an Xenia DP 17 Jt-an Angs. 4 Jt-an Sirion DP 12 Jt-an Angs. 4 Jt-an Luxio DP Nego. Full Discount, Ready Stock, Proses Cepat. Hubungi: Bobby 0823 6492 4487

HONDA Civic Genio Th. ‘93. Hijau tua, BK Medan, Velg Chrome. 17 Inch, Orisinil, sangat mulus. Jl. Jermal IV No. 84 Medan Denai. HP. 0852 9640 7363

HONDA CRV Th. ‘07, Manual, 2000cc. Wrn abu2 metalik, full orisinil. Pajak panjang, mobil ctk, 1 tangan dr baru, Rp. 249Jt. Depan sekolah Eria No. 200. 0821 6767 7000 / 7851402

HYUNDAI Atoz Thn. 2001 GLS Wrn Biru met, manual, lengkap. Orisinil, BK, Mdn, Hrg. 59Jt. Nego. Hub. 0812 6599 2655 HONDA Civic 2002 Dijual. Warna merah metalik, mobil mulus, BK Medan. Sudah di modifikasi, jok kulit, Auto Gade, Kenwood, TV, Info. Hub. IRFAN 0853 7000 3189

ISUZU Panther Thn. 95. W. Merah metalik, AC DB, Tape, VR, BR, CL, BK Panjang, Body lempang. Jamin mulus. H. Nego. Hub. 0852 6129 5788

Rp. 91.000 Rp. 104.000

M-Eterna 92, BK -121-UH. Warna Abu2 tua, Full sound. Kondisi mulus sekali (original). Hub. 0821 6399 3022

# DAIHATSU BARU UNTUK LEBARAN # - Ready Stock: Xenia, Gran Max Pick Up, Terios -Dapatkan Full Diskon bunga Rendah, Cicilan Ringan -Proses Cepat, Data Dijemput, mobil diantar Segera Hub. Ahmad Nasution Astra 0812 6005 2465

READY STOCK !!! ASTRA Xenia, Terios, Pick Up Cepat...!!! Hub. FERRY (0821 6736 3637 DAIHATSU Proses

7 CM 8 CM

ISUZU Panther Thn. 96 Wrn. Hijau. Lengkap Hub. 0812 646 0880

TOYOTA Kijang Kapsul LGX Th. 2000. BK Mdn. W. Silver met, mesin dan cat mulus. Hrg. 110Jt/Nego. 0852 7650 6242

BU TOYOTA Avanza TP S. Thn.’07. W. Hitam met, mulus, mesin sehat, pajak panjang. Hrg. 129Jt. Nego. Berminat Hub. 0812 6415 8848 TOYOTA Avanza G W. Merah 2005. BK Medan, mulus sekali. Hub. 0821 6717 6723 - 7796 7599 TOYOTA HARRIER Thn. 2004 Dijual. Warna dark blue 2400cc. BK Mdn. Harga 325Jt Nego. Hub. 0813 7085 4369 TOYOTA Kijang LSX 1,8 Efi Thn. 2002/ 2003. New. Asli Mdn lengkap. W. Biru, Mica cat asli. Jrg pakai Hub. 0813 6084 0653 Khs. Pemakai TP. TOYOTA Kijang SGX Bensin 1,8. Thn. 2001/02. Silver met. Asli Medan, mulus, orisinil, siap pakai. Hrg. Rp. 99Jt/Nego. Hub. 0823 6420 0751

ISUZU Panther Hi-Grade Thn. 96. AC, Tape, VR, BK Medan. Hub. 0821 6407 4413

TOYOTA Kijang LGX Bensin 1,8 Thn. 2000/01. Asli Medan mulus, orisinil, siap pakai. Rp. 114Jt/Nego. Silver met. Hub. 0852 7011 3661

SUZUKI Carry Minibus Th. ‘96. Wrn biru tua metalik, siap pakai. Rp. 43Jt/BU. Jl. SM. Raja No. 200. 0815 337 336 88 / 7851402

Ready Stock Fortuner, Yaris, Discon Besar Avanza Innova, Rush, Hilux. Bisa Tukar tambah. Cash/ Kredit. Hub. 0813 6120 1719 / 68 78 3325



9 CM Rp. 126.000 10 CM Rp. 140.000

TOYOTA Kijang Super Commando Thn. 92 W. hijau metalic, AC, Tape, VR, BR, BK Medan, jok kulit, Kepala gren body lempang, jamin mulus. Seperti baru. H. Nego. Hub. 0852 7599 6758

TOYOTA Kijang Krista Thn. 1997. Wrn hijau Bensin 1,8. BK Medan 1 tangan. Hrg. 95Jt Nego/damai. Hub. 0812 63779410

TOYOTA Kijang Super Minibus Thn. 1991. Siap pakai, AC/VR/6 Speed. Hrg. Rp. 36Jt. (Nego setelah dilihat) HP. 0812 650 8253 TOYOTA Kijang Super Pick Up Thn. 1994. Sangat mulus/kaleng2 warna biru Rp. 50Jt. (nego setelah dilihat) HP. 0812 650 8253

TOYOTA Kijang Super-G Dijual. Thn. ‘95. Warna biru Hub. 0857 60 988044


Avanza, Innova, Fortuner PURBA: 0813 9789 4633 DIJUAL SALAH SATU

TOYOTA Kijang Super G SSXG Short Th. 1996. W. Hitam gelap Rp. 67Jt atau LGX Solar Th. 2001 BK Medan. Warna Biru met. Rp. 125Juta dua2nya nego. Mulus, siap pakai. Hubungi: 0813 6227 1115 Jl. Amaliun Dpn SD Kartini No. 146

TOYOTA Avanza G Th. 2009 BK Medan. W. Abu2 met, mobil simpanan. Hrg. 141Jt Nego. 0811 652 506 TOYOTA Kijang Capsul Thn. 2003. Diesel Model LGX New 2003. W. Hitam. 1 tangan, Komplit AC DB, Tape, Power, Subwoofer, PS, CL, Remot, mulus, original, body kaleng BU Hub. HP. 0823 6979 5303 Mdn.

LGX Solar Thn. 2000 akhir Bln. 12. Biru mika, mesin ok, cat, body, interior dalam original. Hub. 0813 6269 6789

Truk Interquler dijual. 6D 22. Tahun 1998 warna biru. Hub.0821 6107 3266 BU DIJUAL FOOT RANGGER Dable Cabin 4x4. Warna putih, kondisi sehat, kaleng2, Thn. 2006. Hub. 0852 7613 1317


Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500


Pelanggan Yang Terhormat


Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602


HILANG Surat Penyerahan Hak atas Tanah A/n. Masa Sitepu. Yang terletak di Jl. Mesjid Suhada Gg. Sehati Kel. Beringin No. 17 Kec. Medan Selayang. Luas 5x30m2=150m





ELEKTRONIK REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat


KHUSUS REPARASI /SERVICE Kulkas, M. Cuci, Sanyo Air, Dispenser, Bongkar Pasang AC Hub. PRATAMA ELECTRIC GARANSI Telp. 7343789



HILANG BPKB No. 4662077-B. a/n. Helmina Fitri Sirait, Sp. Alamat Jl. Penguin I No. 53 Ps. Tuan Kab. D/S

Surat Keterangan Tanah SK Bupati Deli Serdang No. 20208/A/I/2F. Tgl. 23 Oktober 1973 An. Alm. Karjo Sumitro

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda



Jl. Binjai Kuala Km. 13 Pasar 2 Padang Cermin – Selesai – Langkat Telp. (061) 457.6116 HP. 0813.6137.2321

Umroh Reguler 9hr = 09, 14 July Umroh Ramadhan (Awal) 21 dan 25 Juli Tgl. 28 Juli dan 11 Agustus (AKhir Ramadhan) ONH Plus/Khusus

- Menerima Santri/Yah Baru Tsanawiyah, Aliyah - Diasuh Alumni² Tim. Tengah: Madinah, Mesir, Syria dan India – Plus USU – UNIMED, IAIN - Medium Arab – Inggris – Plus Tahfizul Qur’an - Kurikulum umum, Agama seimbang - Tersedia beasiswa bagi siswa prestasi, fakir miskin & Anak² muallaf - Saatnya membentuk generasi solih/solihah Segera daftar ke alamat diatas atau Hub. Telp. Diatas Pimp. Dr. H. Syafi’I Siregar, MA

Jamaah Luar kota dapat menginapan/hotel, makan dan transportasi ke Bandara Gratis !!!! Manasik Haji Multazam: Setiap hr Sabtu Pkl. 14.00-16.00 WIB hr Minggu Pkl. 09.00-11.00 Wib

Tempat Manasik Mesjid Agung Medan Jl. P. Diponegoro DAFTARKAN SEGERA KE: KANTOR PUSAT MULTAZAM MEDAN Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6495.8456

Membuat General Ledger utk UKM



Dibutuhkan Tk. pangkas yang berpengalaman, Jaminan 70 Ribu Hub. 0821.6842.6463


Sabtu, 14 Juli 2012

Materi Workshop Instalasi, User, COA, Entry Jurnal, Tutup Buku, Membuat Laporan Neraca, Laba Rugi, Arus Kas.

Biaya: 200.000

No. 12-13 CC, Medan Telp. (061) 822.8225 - (061) 822.8125 HP. 0852.6114.0004






TERIMA LAPTOP SEKEN Hub. 0813 7519 0803



4 Bh Camera + DVR 4 Chanel + HDD 500 Gb + Power Suply 10 A .............................................Rp. 2.8 Jt

* PAKET & CHANEL + INFRARED +HARD DISK 500GB 8 Bh Camera + DVR 8 Chanel + HDD 500GB + Power Suply 15 A

...............................................Rp. 4.5Jt

NB: Harga belum termasuk pemasangan dan Kabel. KAMI MENYEDIAKAN HARGA GROSIR KHUSUS UNTUK DEALER !! Setiap pembelian Paket dapat memilih Camera Outdoor / Indoor sesuai dengan kebutuhan rumah. Kantor, Pabrik, Dll

Toko H.W JALAN ASIA NO. 1C TELP. 061.7346093 - 75330002





Jl. Setiabudi, Komp. Bisnis Point

TERCECER DI TEBINGTINGGI An. Tugimin. BK 8154 MN. No. Rangka MHC TLD 24. CPC. 000093. No. Mesin C929401. No. BPKB 0727030-B. No. HP. 0813 6176 6418

DIJUAL CEPAT (BORONGAN) Alat Alat Listrik. 0813 969 77287

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput





HILANG Surat Tanah Hilang a/n. Sutilah. Luas Tanah 18x82M. Hilang pada pertengahan april Thn. 1999. Alamat Jl. Perjuangan No. 88. Tj. Rejo. Kec. Medan Sunggal.


Hotel Madani Medan 09.00 - 15.00 WIB

Telah hilang/Tercecer Surat Tanah. A/n. BASA MANURUNG yang terletak di Jalan Cemara Kampung Pulau Brayan Darat II Komplek Perumahan Pegawai Kantor Bendahara Negara Medan No. 158 Seluas 600 M2. Tercecer disekitar Jl. Gatot Subroto


HILANG Surat Penyerahan Penguasaan Atas Tanah Dengan Cara Ganti Rugi atas nama: DEWI RAHMAYANI Nomor: 592.2/229/2012. SK. Camat. TERCECER



HILANG Surat Penyerahan Penguasaan Atas Tanah Dengan Cara Ganti Rugi atas nama: DEWI RAHMAYANI Nomor: 592.2/229/2012. SK. Camat.

Grop Investor Siap Bantu Kucurkan Dana dan Mudah Disetujui. Jaminan Properti Hub. 0823 6732 1000 - 061.8222 774

HILANG Surat Penyerahan Hak atas Tanah A/n. Masa Sitepu. Yang terletak di Jl. Mesjid Suhada Gg. Sehati Kel. Beringin No. 17 Kec. Medan Selayang. Luas 5x30m2=150m

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab

TOYOTA Kijang Super Minibus Thn. 1991. Siap pakai, AC/VR/6 Speed. Hrg. Rp. 36Jt. (Nego setelah dilihat) HP. 0812 650 8253 TOYOTA Corolla All New, matic, 96 Dijual. BK Medan, warna hijau. Kondisi mulus sekali (original). Hub. 0821 6399 3022

11 CM Rp. 165.000 12 CM Rp. 180.000

Sabtu, 7 Juli 2012

MENERIMA MAHASISWA BARU T.A. 2012/2013 INFORMASI PENDAFTARAN: MAHASISWA BARU AKPER KESDAM I/BB MEDAN JL. PUTRI HIJAU NO. 17 MEDAN Telp. (061) 455.0069 Fax. (061) 455.0069 (Komplek Rumah Sakit Tk II Putri Hijau Medan) Waktu: Gel I: 7 Mei 2012 s/d 10 Juli 2012 Gel II: 11 Juli 2012 s/d 1 Agustus 2012 Pendaftaran: Setiap hari kerja Pukul: 08.00 WIB s/d selesai Syarat-syarat pendaftaran: Lulusan SMA dan sederajat jurusan IPA/ IPS, lulusan SPK, SPRG, SMF, SMAK, SMK





HP. 0812.6570.8255


LOWONGAN DIBUTUHKAN Perempuan/Laki-laki Utk jualan es kue, Syarat: Islam, Ada KTP, Jujur, Usia max. 35 thn Hub. Bg Epi 0853.7206.7644 / 0878.6964.7856 Jl. Karya Pembangunan No. 20 Komplek BLPLP Asrama Haji Medan

Kami perusahaan yang bergerak dibidang Rumah Makan membutuhkan beberapa karyawan yang akan ditempatkan di Perusahaan kami. Kirimkan surat lamaran anda, lengkap dengan CV, pas photo 4x6: 2 lbr, Fotocopy KTP beserta No. HP yang bisa dihubungi Lamaran diantar langsung ke: Jl. Sisingamangaraja No. 2F Telp. (061) 457.4646 Depan PDAM Tirtanadi Medan


Yang berpengalaman, tempat strategis, Aman, Ramai Hub. langsung Pangkas Nuansa Baru Telp. 736.4470 HP. 0852.7602.2961


Mahir, Jujur, Bertanggung jawab, Rapi bersih, Ada jaminan Hub. 0812.636.9995


SMU/D3/S1 sbg Guru, Syarat Kreatif Datang langsung hub: Jl. KH. Wahid Hasyim 92 Medan Tp. 453.3875 - 456.9269


TK/ Playgroup, SMU/ D3/ S1 Syarat Kreatif, datang langsung: Jl. Karyawisata No. 23A Johor Tp. 786.1690 / 786.2156 Medan




1. Kawat Beronjong atau Harmonica Dilapis PVC Cocok untuk pagar dan ternak itik - ayam - Baru. Harga perkilo Rp. 8.500,- Jumlah 1 ton. 2. Seng Gelombang Zingalume 8 kaki. Panjang 2,4Mtr. Lebar 83cm - baru, tebal 0,25mm dan 0,30mm Agak sedikit terkelupas - ada 90 Lembar. Harga Rp. 37.500 / Lembar. 3. Asbes Calsibot 120cmx 60cm tebal 6 mili. Baru Rp. 6.000 / Lembar Hub. HP. 0813 6070 7607 0813 6221 5072 ATAP & DINDING EURODEK



1. Assisten Salon

Perusahaan yang bergerak dibidang jasa Kecantikan/salon membutuhkan: Assisten Salon dengan syarat: - Perempuan - Bisa creambath, cuci blow, gunting rambut, facial & blow variasi - Komunikatif - Dapat bekerja dengan tim, dan mempunyai disiplin yang tinggi Untuk informasi lebih lanjut, hubungi Nike: 0813.7666.2062/ (061) 455.0065, pada jam kerja (08.00 s/d 16.00 WIB)





Jl. Tomat No. 4 Medan Baru Medan 20153. Paling lambat 1 (satu) minggu setelah iklan ini terbit







Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.7194 Fax. (061) 415.7504 SUMUT - INDONESIA

Sebuah perusahaan farmasi membutuhkan tenaga kerja untuk posisi: A. Sales Supervisor B. Salesman C. Pengemudi Syarat: - Pria (A), Pria/ Wantia (B) - Pendidikan min. SMA/sederajat (A, B, C) - Memiliki SIM C (A, B), SIM B1 (C) - Berpenampilan menarik, komunikatif, jujur dan mau bekerja keras - Memiliki sepeda motor (A, B) Surat lamaran lengkap diantar langsung ke:





WC WC 8219951 WC 0813 7035 7291 WC TUMPAT/ SAL. AIR

845.8996 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim

TUMPAT/ SEDOT Bergaransi



Ada Garansi


845.8996 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim

Ingin Promosikan Produk Anda



Media yang Tepat untuk Iklan Anda

Nusantara A9 123.225 Orang Lulus SNMPTN

WASPADA Sabtu 7 Juli 2012

Tersisa 194 Kursi JAK ARTA ( Waspada): Sebanyak 123.225 orang lulus Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) jalur ujian tulis (utul). Kelompok IPA sebanyak 57.869 orang dan kelompok IPS sebanyak 65.356 orang. Ketua Panitia Pusat SNMPTN 2012, Akhmaloka

mengatakan, para peserta yang lulus akan mengisi 123.419 kursi di 61 PTN. “Itu artinya tersisa 194 kursi,” kata Akhmaloka di Jakarta, Jumat (6/7). Kursi kosong tersebut akan diserahkan kepada masing-masing rektor. SNMPTN utul dilaksanakan pada 12-13 Juni lalu. Pendaftarnya lebih dari 600 ribu orang

dan meningkat sebanyak 14 persen dibanding tahun lalu. Dalam kesempatan itu, Akhmaloka yang juga Rektor Institut Tekhnologi Bandung (ITB) menyebutkan 10 daerah dengan nilai rata-rata kelulusan terbaik. Untuk IPA ke-10 provinsi dengan nilai rata-rata terbaik adalah DKI Jakarta, DI Yogyakarta, Banten, Jawa Tengah,

Jawa Barat, Jawa Timur, Sumatera Barat, Lampung, Sumatera Utara dan Kepulauan Riau. Sedangkan IPS nilai ratarata tertinggi diraih Provinsi DKI Jakarta, DI Yogyakarta, Jawa Tengah, Jawa Barat, Banten, Lampung, Sumatera Barat , JawaTimur, Sumatera Utara dan Sumatera Selatan. Dirjen Pendidikan Tinggi

Kemdikbud, Djoko Susanto mengatakan, ke depan SNMPTN akan diarahkan untuk jalur undangan. “Tujuannya supaya lebih banyak calon mahasiswa berprestasi dari bangku SMA yang terjaring. Sekaligus implementasi program integrasi SNMPTN dengan hasil UN,” kata Djoko.(dianw)

Hanya Sebagian Kecil Menolak Dirjen PHU: Keberngkatan Calon Rencana Pengeboran Lapindo Jamaah Haji Sesuai Nomor Pendaftaran Antara

NENENG KEMBALI DIPERIKSA: Neneng Sri Wahyuni usai diperiksa Komisi Pemberantasan Korupsi, Jakarta Selatan, Jumat (6/7). Neneng kembali diperiksa sebagai tersangka kasus korupsi Pembangkit Listrik Tenaga Surya di Kemenakertrans.

Anas Akui Citra Partai Demokrat Turun SINGARAJA (Antara): Ketua Umum Dewan Pimpinan Pusat (DPP) Partai Demokrat, Anas Urbaningrum mengakui bahwa citra partai yang dipimpinnya menurun di mata masyarakat akibat kasus dugaan korupsi yang melibatkan kader partai politik pemenang Pemilu 2009 itu. “Adanya beberapa kader yang tersangkut masalah hukum, jelas berpengaruh terhadap citra partai, sehingga kami perlu konsolidasi ke daerah-daerah,” katanya di Desa Giri Enas, Kecamatan Sawan, Kabupaten Buleleng, Bali, Jumat (6/7). Menurut dia, sebenarnya kader-kader Partai Demokrat yang tersangkut persoalan hukum lebih sedikit dibandingkan dengan partai lain.

“Akan tetapi, apa pun yang terjadi, kami siap menghadapinya demi penegakan supremasi hukum,” katanya setelah membuka Pelatihan Kepemimpinan dan Kepemiluan itu. Anas juga menegaskan bahwa dirinya sama sekali tidak terlibat dalam kasus korupsi pembangunan perkampungan atlet di Hamba-lang, Bogor, Jawa Barat, yang kini ditangani Komisi Pemberantasan Korupsi (KPK) itu. “Semua keterangan sudah saya sampaikan di depan penyidik KPK. Kalau masih diperlukan, saya siap memberikan keterangan lagi kepada penyidik KPK,” kata mantan Ketua Umum Pengurus Besar Himpunan Mahasiswa Islam (PB HMI) itu. Oleh sebab itu, dia menyerahkan sepenuhnya proses hukum kepada KPK.

Ani Yudhoyono 60 Tahun, Dapat Kado Cucu JAKARTA (Antara): Ibu Negara Ani Yudhoyono mendapat kado istimewa pada hari ulang tahunnya yang ke-60, seorang cucu yang masih berada di dalam kandungan sang menantu, Aliyah Rajasa “Dari Aliyah. Doakan saja. Itu juga suatu kado yang manis buat saya,” kata Ani Yudhoyono ketika mendapatkan ucapan selamat dari para wartawan di komplek Istana Kepresidenan, Jakarta, Jumat (6/7). Aliyah adalah puteri Menteri Koordinator Perekonomian Hatta Rajasa yang disunting oleh putera bungsu Presiden Susilo Bambang Yudhoyono, Edhie Baskoro Yudhoyono atau Ibas.

Ani yang saat itu didampingi oleh Ibas mengatakan, cucu dari putera bungsunya itu diperkirakan lahir pada Desember 2012. Pada acara perayaan ulang tahun itu Ibu Negara, yang beberapa kali mendapat perawatan di rumah sakit, juga berharap selalu mendapat karunia kesehatan seiring pertambahan usianya. “Saya berharap ke depan saya semakin sehat, diberikan kesehatan agar tentu saja dengan badan yang sehat itu saya bisa mendukung Bapak Presiden dalam melaksanakan tugasnya,” katanya pada acara yang hanya dihadiri kerabat dekat itu.

Demokrat Hormati Pencegahan Hartati Murdaya JAKARTA (Antara): Anggota Dewan Pembina Partai Demokrat Amir Syamsuddin mengatakan, Partai Demokrat menghormati langkah pencegahan ke luar negeri yang diberlakukan terhadap Hartati Murdaya. “Tidak ada masalah,” kata Amir ketika ditemui di komplek Istana Kepresidenan, Jakarta, Jumat (6/7). Komisi Pemberantasan Korupsi telah mengajukan permintaan pencegahan terhadap Hartati. Pengusaha sekaligus politisi Partai Demokrat itu dicegah ke luar negeri, sehingga bisa memberikan keterangan saat dibutuhkan. Keterangan Hartati dibutuhkan terkait kasus dugaan suap kepengurusan hak guna usaha

(HGU) perkebunan kelapa sawit di Kabupaten Buol, Sulawesi Tengah. Selain itu, KPK juga mencegah Bupati Buol Amran Batalipu serta tiga karyawan PT Hardaya Inti Plantation, yaitu Benhard, Seri Sirithorn, dan Arim. Amir menjelaskan, pencegahan adalah salah satu upaya hukum resmi yang harus dihormati. “Kejagung, KPK, Polisi memang berkewajiban untuk melaksanakan (pencegahan) itu,” katanya. Partai Demokrat sendiri juga akan melakukan perbaikan internal. Menurut Amir, pada saatnya Dewan Kehormatan Partai akan melakukan upaya-upaya terkait kasus itu.

Ical: Bila Sudah Dinyatakan Bersalah Akan Diberi Sanksi SOLO (Antara): Ketua Umum Partai Golongan Karya (Golkar) Aburizal Bakrie (Ical) mengatakan bahwa tidak akan mengambil tindakan apapun kepada para kadernya yang kena masalah dan dipanggil Komisi Pemberantasan Korupsi (KPK) sebelum ada keputusan hukum tetap. “Kepada para kader yang telah dinyatakan tersangka pun itu juga tidak akan diambil tindakan, karena belum ada keputusan hukum tetap,” ujarnya, seusai memberikan ceramah pada Kader Bangsa Fellowship Program Angkatan IV di Surakarta, Jumat (6/7). Kepada kader partai berlambang pohon beringin itu, Ical mengemukakan, apabila sudah dinyatakan bersalah dan ada ketetapan hukum, maka partai pasti akan memberikan sanksi tegas.

“Ya, nanti kalau sudah ada ketetapan hukum pasti partai akan memberikan sanksi. Tunggu saja. Jadi, mereka yang dipanggil KPK itu belum tentu salah. Untuk itu, kami meminta kepada semua pihak untuk menunggu dari hasil pemeriksaan dan keputusan dari pengadilan nanti,” katanya. Ical dalam pengarahannya tersebut mengatakan, persoalan bangsa ini masih belum selesai. “Masih banyak persoalan bangsa yang harus diselesaikan, seperti adanya pertengkaran antar suku, kemiskinan, dan lain-lain,” katanya. Ia mengemukakan, di Indonesia sekarang ada sekitar 31 juta warga miskin dan ini harus diselesaikan, belum mengenai masalah kesehatan pendidikan.

16 Juta Penduduk Indonesia Alami Ketulian JAKARTA (Antara): Data terakhir Kementerian Kesehatan menunjukkan sebanyak 16 juta atau 4,6 persen dari penduduk Indonesia mengalami ketulian. Data tersebut disampaikan oleh Dokter spesialis telinga hidung dan tenggorokan dari Komisi Nasional Penanggulangan Gangguan Pendengaran dan Ketulian (PGPKT) Dr. Damayanti Soetjipto, SpTHT (K) di Jakarta, Jumat (6/7). Ia juga menyebutkan, berdasarkan data dari Badan Kesehatan Dunia (WHO), Indonesia berada di posisi ke empat sebagai negara dengan penderita ketulian terbanyak di Asia. “Kita adalah negara yang berada di posisi keempat setelah Srilanka, Myanmar dan India,” ujarnya.

Ia menjelaskan masalah ketulian terjadi pada negara-negara yang sudah mengalami kemajuan pada bidang teknologi. “Mendengarkan musik keras-keras, polusi suara, serta bisingnya suara tempat permainan anak di mal, dapat berpotensi menyebabkan ketulian,” katanya. Ia menjelaskan besaran bising yang terdapat di tempat permainan anak di mal mencapai 97 desibel, sedangkan pada konser musik mencapai lebih dari 100 desibel. “Sementara itu, batas bising yang dapat diterima telinga selama 24 jam adalah 80 desibel, itu pun biasanya seseorang dianjurkan untuk menggunakan alat pelindung telinga,” ujar Damayanti.

JAKARTA (Waspada) Penolakan rencana pengeboran kembali areal Lapindo di Desa Kalidawir dan Desa Kedung Banteng, Kecamatan Tanggulangin,Sidoarjo, Jawa Timur, hanya dilakukan sebagian kecil warga. Itu pun, diduga akibat informasi yang diberikan lembaga swadaya masyarakat secara sepihak dan tidak trasnparan, “Sebenarnya jumlah mereka yang tidak setuju kecil sekali prosentasenya dibanding jumlah seluruh warga di RT 7, apalagi dibandingkan seluruh desa yang berjumlah sekitar 900 KK,” ujar Iftahudin, tokoh masyarakat Sidoarjo, Jumat, (6/7). Bahkan, katanya di Desa Kedung Banteng malah lebih kondusif, dan hampir semua mendukung dan tidak ada gejolak. Iftahudin menungkapkan, persetujuan atau ketidaksetujuan warga, tergantung dari tingkat pemahaman mereka terhadap kegiatan itu. Selama ini , disebutkan yang tidak setuju hanya mendapat pasokan informasi dari mereka tanpa mau membuka informasi lain yang berimbang. “Pengeboran di sini (Kalidawir dan Kedung Banteng) hanya berkisar pada kedalaman 1.200 feet dan sudah melalui penelitian dari pihak yang berwe-

nang, jauh lebih kecil resikonya dibanding pengeboran dalam di pusat semburan lumpur yang mencapai 10 ribu sampai 15 ribu feet,” papar Iftahudin. Kalau ada, perbedaan, imbaunya, lebih baik didialogkan. “Seharusnya kita melihat masalah ini lebih obyektif, kalau ada pengeboran tentu banyak yang merasakan manfaatnya. Selain untuk melunasi pembayaran korban lumpur, rencananya tahun depan hasil pengeboran Lapindo akan buat jaringan gas untuk rumah tangga. Harusnya kegiatan awal untuk menuju ke sana diberi apresiasi,” tegas Iftahudin. Sementara Kepala Desa Kalidawir, M Anas mengakui, belakangan ini banyak LSM dari luar yang beraktivitas di wilayahnya. “Mereka tidak pernah berkordinasi dengan kami, entah mengapa sehingga saya tidak tahu persis kegiatannya,” katanya saat dihubungi. Dia pun mengungkapkan, hingga saat ini belum ada rencana pemboran baru oleh Lapindo. “Sampai sekarang belum ada pemboran baru., yang ada hanya Well Test. Ini yang ditolak sebagian warga dari RT7 /RW 2. Jumlah warga di sana 67 KK sedang kan dari seluruh RT berjumlah sekitar 900 KK,” ujarnya.(aya)

RUMAH BARU PONDOK SURYA BLOK II NO. 74 SHM, LT. 294, LB. 264M HUK, TINGKAT, 6 KMR 4 KAMAR MANDI HUB. 0816.9999.69 (021) 585.4405 BURSA


Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik


Rmh kost, Warnet 3 tingkat Jl. Gedung Arca Gg. Sehat No. 1 (061) 6872.1968/ 0812.6021.0202


Di perumahan Villa Asri Permai No. 11, 1 KM dari Villa Gading Mas/ simpang Kongsi Marindal, Luas Tanah 145m ², Luas bangunan 80m², ada halaman belakang depan, Teralis besi, Carport, Harga 375 Jt/bisa KPR Hub Telp. 0813.7533.4051


LT. 6x17m, depan Sekolah/ Mesjid, Cocok utk usaha Jl. Merpati 2 No. 3 Perumnas Mandala Hub. 0821.7149.8887


1. GRAHA TANJUNG SARI, LT. 306, LB. 144, KT 4, KM 3, AC 4, LISTRIK 2200 WATT, HARGA NEGO 2. BUMI ASRI, LT. 10X20M, LB. 300M, KT 4, KM 3, AC 1, HARGA NEGO HUB. 0813.6167.5888 (061) 7731.7788


HUB: 0813.6176.9645 0821.6216.2946

JAKARTA (Waspada ): Keberangkatan calon jamaah haji tetap menggunakan pola lama, yakni sesuai dengan nomor pendaftaran calon jamaah haji saat membayar tabungan haji. “Artinya tidak boleh ada calon jamaah haji yang meminta privilege (hak istimewa) pemberangkatan haji. Semua harus sesuai urutan pendaftaran,” kata Direktur Jenderal Penyelenggaraan Haji dan Umrah (Dirjen PHU) Kementerian Agama, H. Anggito Abimanyu usai meninjau kantor Sistem Komputerisasi Haji Terpadu (Siskohat) di lingkungan Kementrian Agama (Kemenag ) kepada wartawan di Jakarta, Jumat (6/7). Kendati jumlah calon jamaah haji yang mendaftar tak dipungkiri mendorong berbagai upaya negatif yang dilakukan oleh para calon jamaah dan oknum haji. Dengan meminta kemudahan pemberangkatan haji pada musimnya. Menurut Anggito, pemberian privilegebagi calon jamaah haji itu dapat merusak sistem penyelengaraan haji.Bahkan dapat memancing berbagai persoalan lain. Akibatnya berdampak menurunkan kepercayaan publik terhadap pelayanan haji. Dengan demikian, tidak boleh satu pejabat di Dirjen Haji yang membawabawa calon jamaah haji. Baik itu dari kalangan politisi, birokrat atau

DIKONTRAKKAN Perhari/ bulan, Sebuah bangunan lengkap dgn Peralatan masak + 3 steling untuk usaha Mie Aceh, dll, Lokasi strategis di Jl. Jamin Ginting Sp. Selayang Medan Hub. 0821.6457.7884 - 0821.6555.9855 Pak Guru, SMS TANAH TANAH DIJUAL

Di Desa Sihitang, P. Sidempuan TImur, Tapsel, terletak di Jl. Raya dekat Asrama Kodim & Universitas-Stain, Luas Tanah 10.328m², Cocok utk pesantren/sekolah, Pabrik, Gudang, Rumah sakit, Perumahan, PEternakan, PErkebunan, SHM, Harga 250 Rb/mtr (nego), No. SMS & Miscall Hub. 0821.6775.5333 (Tanpa perantara) KEBUN SAWIT DAN KOLAM D I J U A L C E PAT Luas Tanah 39000m², SK Camat, Buah pasir, Rumah 14x14m, Listrik 1200 watt, Smr bor, Alamat Jl. Gaharu Hamparan Perak, Harga Rp. 800 Jt/nego Hub. 0813.7514.1239 Maaf tanpa perantara


8x18m, SK camat, 40 Jt/bs nego 8x22, Rmh permanen, SK Ntrs, 85 Jt/bs nego Jl. Marindal II Psr. XII Hub. 0853.7139.9377 Roby


Murah dkt Kota Perbaungan Uk: 20x20: Rp. 70 Jt 8x18,8: Rp. 25 Jt 6x20: Rp. 20 Jt, 9x21: Rp. 30 Jt Sertifikat BPN Dijual Tnh ± 4 Rante Tamora Desa Wono Sari: Rp. 130 Jt Hub. 0813.6104.5505



pengusaha. “ Semua calon jamaah haji berangkat sesuai nomor pendaftaran,” tegas Anggito, seraya menambahkan, hal ini lah yang perlu diluruskan dulu. Saya tahu, banyak jamaah yang ingin berangkat haji dalam waktu secepatnya. Hal itu menumbuhkan peluang-peluang negatif. Pejabat eselon I Kemenag itu yang didampingi Sekretaris Ditjen PHU Cepi Supriatna, Direktur Pengelolaan Dana Haji Syariful Mahya Bandar dan mantan Kepala Biro Hukum dan Humas Arifin Nurdin mengemukakan, bahwa sistem pendaftaran haji yang ada saat ini sudah cukup baik. Namun tingkat pelaksanaannya harus terus dievaluasi. Terlebih pada peluang-peluang mencari manfaat memberangkatkan calon jamaah diluar waktunya. Selain itu, pola yang ada sangat mewakili aspek keadilan. Walaupun si calon jamaah haji tersebut, memiliki uang banyak, namun nomor pendaftarannya masih lama, tidak berarti bisa berangkat cepat. Sedangkan bagi calon jamaah yang sudah waktunya berangkat, dijamin dapat melaksanakan haji. Dengan catatan, harus melunasi biaya hajinya terlebih dahulu, seandainya sampai waktunya belum juga melunasi biaya hajinya, itu kan juga tidak boleh,” jelas Anggito.

DICARI Agen U’ jual pakaian & sepatu, dapatkan katalognya GRATIS produk Bandung, Ketik: DAFTAR kirim sms ke: 0858 1168 2006 Telp. 0852 2142 1414


Mencari member/anggota, produk lengkap (baju, sepatu, tas, accesories, ccokware, kosmetik, kopi, bumbu masak, produk anak², edukasi, dll). dapatkan bonus “uang, spd motor, perjalanan ibadah, wisata, mobil, rumah.


HP. 0813.6229.7935 - 0812.654.8425 0819.601.5795 - (061) 7638.8063 (Ikuti Seminar Sukses:”MEMBANGUN PRIBADI YANGDAHSYAT”BersamaTanuSutomo (Pendiri IFA Dahsyat), Minggu 08 Juli 2012 Tempat:CONVENTIONHALLAMALIUNFOODCOURT Jl. Amaliun No. 3 Medan, pukul 11.00 s/d selesai Investasi Rp. 50.000 (seminggu sebelum acara disc 50%) sudah termasuk lunch + doorprize

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866




Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat


Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll



No. Izin Kejaksaan, Nomor: B12/DSP.5/01/2012 Metode: Penanganan dari ujung kaki sampai pada pangkal alat vital untuk membetulkan urat yang tersumbat dan melancarkan peradaran darah membetulkan aliran sperma. kemudian dikusuk/ terapy untuk penambah ukuran besar dan panjang tidak ada efek samping, permanen, bebas pantangan dan untuk semua agama. WANITA: PRIA - Panjang: 10 - 12 - - Memperindah payudara - Menjadikan G-spot, seperti 14 - 16 - 18 - Besar: 3 - 4 - 5 - 6 - 7 perawan kembali - Sperma encer - keturunan - Ejakulasi dini KONSULTASI UMUM: DIJAMIN - Susuk semar asih BERGARANSI - Susuk Ratu Malam - Ajian pemutus & penyambung cinta


Anda Butuh Perabot Jepara Asli?


HP. 081311196331


Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

MODAL HANYA 6,5 JT, Penghasilan mencari lebih 100% Perbulan, selama .... Andapunlangsungmenjadi“BosPengusaha Gerai Ice Cream” Dijamin berhasil Tidak percaya ?? Silahkan buktikan !!! (NB. Hanya untuk 100 orang pertama) Info Hub. 0852.9777.7979 Kantor: CV. PMC Medan Jl. Panglima Denai No. 03 Medan

DARI PELABUHAN RATU SUKABUMI Merawat kejantanan secara alami (tidak ada efek samping) besar dan panjang, permanen dan cukup sekali datang Alamat: Jl. SM. Raja masuk Jl. Sempurna No. 18 (samping UISU SM. Raja)


Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun









TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Menyinggung kapan penetapan Biaya Perjalanan Ibadah Haji ( BPIH ) 1433 H/ 2012 M, Anggito berharap dalam waktu dekat sudah diputuskan dengan KomisiVIII DPR. “Insya Allah minggu depan sudah bisa disahkan. Keresahan jamaah saya maklum. Saya maklum, saya sendiri merasa dewan punya hak, mereka ingin supaya tranparansi dan itu yang kita ingin lakukan dan Alhamdulillah dewan percaya saya bisa lakukan transparansi itu,” tuturnya. “ Berapa dana yang dikumpulkan dan berapa dana yang dikembalikan untuk jamaah haji itu semua nanti pada rapat pleno akan saya sampaikan. Diperkirakan naik atau tidak saya belum bisa beri tahu sekarang “. Tentang program pembenahan yang dilakukan selama menjabat Dirjen Haji, Anggito mengaku sudah menyusun sejumlah langkah. Di antaranya meningkatkan pelayanan haji di tanah suci, sekaligus mempermudah pendaftaran haji. Dia merasa proses pendaftaran haji dapat dilakukan melalui on line. Model itu tengah dikembangan saat ini. Sehingga secara teratur dapat pula mengetahui jadwal keberangkatannya. “Jadi calon jamaah haji bisa lihat di situs tersebut. Tidak perlu khawatir ada permainan lagi,” ujarnya (j06)

ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari


Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR

DIJAMIN 100% Hanya Tempat

Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333



Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222



WASPADA Sabtu 7 Juli 2012


Nesta Ikut Ramaikan MLS KLUB Major League Soccer (MLS), Montreal Impact mengumumkan sudah mendapatkan bek veteran Italia, Alessandro Nesta (foto), dengan status bebas transfer. Namun detail transfer tidak dipublikasikan mengingat hal ini adalah bagian dari kebijakan klub. Nesta, kini berusia 36 tahun, nampak senang berada di klub barunya itu. Dirinya juga sudah tidak sabar untuk bisa memulai petualangan baru di MLS bersama Montreal setelah malang melintang di Seri A bersama SS Lazio dan AC Milan. “Saya sangat senang bisa berada di sini. Meski ada tawaran datang untuk melanjutkan karier di Eropa, saya lebih mencari tantangan baru dan ingin bermain di MLS,” ucap Nesta saat diperkenalkan di hadapan wartawan, Jumat (6/7). Tanggapan positif juga datang dari kubu Montreal Impact. Direktur Olahraga Nick De Santis mengaku senang bisa mendapatkan seorang pemain yang pernah mengangkat trofi Piala Dunia. Begitu juga pelatih Jesse Marsch yang mengaku tak sabar lagi bisa melihat aksi Nesta di lapangan.

KAPTEN Timnas Brazil untuk Olimpiade 2012, Thiago Silva (depan), siap memimpin rekan-rekannya merebut medali emas pertama sekaligus menggagalkan impian Spanyol.


Modric Beri Madrid Batas GELANDANG Tottenham Hotspur, Luka Modric (foto), mulai putus asa dengan kegagalan kubu Real Madrid bernegosiasi dengan Spurs terkait transfer dirinya. Ia pun menetapkan tanggal 17 Juli mendatang sebagai batas akhir negosiasi. Madrid sudah sejak lama mengincar Modric. Namun, niat mereka selalu dihalangi keinginan Spurs yang ngotot mempertahankan bintang asal Kroasia itu. Meski demikian, Los Blancos tak menyerah dan terus mencoba untuk menggaet Modric. Akan tetapi, masalah timbul karena harga pemain 26 tahun itu terlalu tinggi. Menurut The Sun, Los Blancos harus terlebih dulu menjual beberapa pemain sebelum membeli Modric dengan harga 35 juta pounds. Namun, kedatangan Andre Villas-Boas sebagai manajer baru Spurs juga menguatkan tekad mereka mempertahankan Modric yang masih terikat kontrak sampai 2016 mendatang. Modric sudah membela Spurs sejak 2008 lalu. Ia merupakan ruh permainan klub London Utara itu. Hingga kini, Modric telah membela Spurs dalam 159 pertandingan dengan torehan 17 gol dan 26 assist.


Maicon Lebih Pilih Madrid KLUB Liga Premier, Chelsea, tampaknya masih harus meyakinkan bek sayap FC Inter Milan, Douglas Maicon (foto), untuk hengkang ke London. Seperti diketahui, kubu The Blues dan I Nerazzurri sebenarnya telah sepakat dengan banderol transfer pemain asal Brazil tersebut. Namun, Maicon tampaknya memiliki pemikiran tersendiri. Pasalnya, muncul kabar bahwa Maicon lebih ingin hengkang ke klub raksasa La Liga Primera Spanyol, Real Madrid. Marca mengabarkan Maicon yang dibanderol sebesar 6,4 juta euro lebih ingin berlabuh di Santiago Bernabeu agar kembali reuni dengan pelatih Jose Mourinho. Kini, Marco Branca yang juga petinggi Inter tinggal menunggu lampu hijau dari Presiden klub Massimo Moratti untuk merampungkan negosiasi dengan Chelsea maupun Madrid. Jika semua berjalan mulus, Maicon bakal berpindah klub pekan depan.

Samba Ladeni Tantangan Matador RIO DE JANEIRO (Waspada): Pelatih Timnas Brazil U-23, Mano Menezes, resmi mengumumkan 18 nama pemain yang akan dibawa ke Olimpiade 2012 di London akhir Juli nanti. Sebelumnya, Spanyol juga merilis sejumlah pemain bintang dalam timnya, seperti Juan Mata, Adrian Lopez, dan Jordi Alba. Berambisi merebut emas Olimpiade perdana dan menggagalkan dominasi Matador pun membuat Menezes mendaftarkan pemain-pemain bintangnya. Di lini belakang, ada Thiago Silva (AC Milan) dan Marcelo (Real Madrid). Untuk barisan

gelandang, Menezes memanggil bintang muda asal Santos, Ganso, untuk memanjakan andalan lini depan yang dipercayakan kepada Neymar (Santos) dan Hulk (FC Porto) bersama Alexandre Pato (AC Milan). Neymar mengepak sembilan gol dalam 18 partai bersama timnas senior. Di lain pihak, reputasi Pato dan Hulk tak perlu diragukan. Khusus Hulk yang tengah menjadi incaran

MANCHESTER, Inggris (Waspada): Manchester City bersiap segera mendatangkan skipper Arsenal, Robin van Persie (foto), setelah pemain asal Belanda itu menyatakan dirinya tak akan memperpanjang kontrak di Emirates. Arsenal pun dipaksa untuk segera memutuskan untuk menjualnya musim panas ini atau akan melepasnya saat kontraknya berakhir musim depan tanpa mendapatkan apaapa. The Citizens memimpin perburuan pemain berusia 28 tahun itu dengan tawaran paket

gaji sebesar 220 ribu pounds atau Rp3,2 miliar per pekan, seperti dilansir Mirror, Jumat (6/7). Tawaran menggiurkan itu menempatkan Van Persie berada dalam jajaran penerima bayaran termahal di Eastland bersama Yaya Toure dan Carlos Tevez. Selain City, Juventus juga berada di dalam jalur perburuan Van Persie dengan nilai tawaran sebesar 8 juta pounds. Namun, City tetap mendominasi dengan kekuatan uang yang sangat besar. JikaVan Persie jadi berlabuh ke Etihad, ini akan menjadi “kesialan” kedua Arsenal karena

Skuad Samba kali ini diperkuat banyak bintang-bintang muda. Bek muda Manchester United, Rafael, juga dipilih Menezes bersama Sandro (Tottenham Hotspur) untuk mewakili pemain dari Liga Premier. Thiago Silva, baru menandatangani perpanjangan kontrak selama lima tahun di San Siro, nantinya akan menjadi kapten Selecao. Di Olimpiade nanti, Brazil tergabung di Grup C bersama Mesir, Belarus, dan Selandia Baru. Sebelum memulai pertandingan perdananya, Tim Samba akan terlebih dulu melakoni laga persahabatan melawan Inggris

Skuad Brazil untuk Olimpiade Kiper :Rafael Cabral (Santos), Neto (Fiorentina) Belakang :Marcelo (Real Madrid), Rafael Silva (Man United), Danilo, Alex Sandro (FC Porto), Thiago Silva (AC Milan), Juan (Inter Milan), Bruno Uvini (Sao Paulo) Tengah :Romulo (Vasco da Gama), Ganso (Santos), Oscar (Internacional), Sandro (Tottenham Hotspur), Lucas (Sao Paulo) Depan :Neymar (Santos), Alexandre Pato (AC Milan), Leandro Damiao (Internacional), Hulk (FC Porto) Raya pada 20 Juli mendatang. Sepanjang sejarah persepakbolaan Brazil yang gemilang, Olimpiade menjadi ajang yang belum pernah dimenanginya dalam 24 kali penyelenggaraan. Prestasi terbaik tim Selecao di Olimpiade adalah merebut

medali perak pada 1984 dan 1988. Raihan ini jauh di bawah torehan negara tetangga sekaligus rival berat mereka, Uruguay dan Argentina, yang sudah dua kali merebut emas Olimpiade. (m33/ini/sky)

kehilangan kapten mereka, Cesc Fabregas. Bila jadi gabung bersama City, pasukan Roberto Mancini diprediksi kian besar peluangnya untuk mempertahankan gelar Liga Premier. Di Italia, meyakini Van Persie akan menomorsatukan Juve karena adanya garansi sebagai pemain reguler di tim utama Antonio Conte. Sebaliknya, RvP belum pasti menjadi starter di bawah komando Mancini karena masih ada David Silva, Carlos Tevez, Mario Balotelli, Edin Dzeko, dan Sergio Aguero. (m33/ini/mir)


Arema Tetap Hormati Ayam Kinantan Minggu Besok Di Stadion Baharoeddin Siregar


Garuda Junior Akan Berguru Di Belanda

David Silva Setia Citizens

Chelsea, penyerang haus gol itu sudah menyumbang tiga gol untuk timnas senior sejak menjalani debut pada 2009. Dengan terpilihnya Thiago Silva, Marcelo, dan Hulk, maka kuota tiga pemain berusia lebih dari 23 tahun sudah lengkap. Artinya, David Luiz (Chelsea) dan Dani Alves (Barcelona) terdepak dari tim Samba. Setelah sadar tidak terpilih, Dani Alves sempat memberikan komentar lewat akun Twitter.“Terima kasih atas dukungan anda semua. Hidup harus terus berjalan dan semoga skuad Brasil bisa beruntung. Mereka pasti bisa membuat kami semua bangga.”

City Goda Rp3,2 M Untuk RVP

PRESIDEN KNVB Micheal van Praag dan Ketua Umum PSSI Djohar Arifin Husin (kanan) berbincang serius di sela-sela Euro 2012 beberapa pekan lalu.

DAVID Silva (foto) menolak untuk menanggapi tawaran yang diajukan Real Madrid. Winger lincah milik Manchester City ini lebih memilih untuk menetap di Etihad Stadium dan memperpanjang kontraknya bersama klub asal Inggris itu. Saat ini, Silva masih menyisakan dua tahun masa kontrak bersama City. Namun, pemain timnas Spanyol ini dikabarkan akan menyetujui perpanjangan kontrak sebesar 52 juta pounds selama lima tahun ke depan. Kabarnya, Silva akan menerima gaji sebesar 200 ribu pounds per pekan. Kabar menyebutkan, ofisial City telah bertemu dengan agen Silva untuk membicarakan masalah tersebut. Untuk itu, pemain berusia 26 tahun itu diyakini akan segera menandatangani kontrak baru dalam beberapa hari mendatang. “Saat ini, saya sedang menikmati liburan. Namun, agen saya sedang melakukan negosiasi dengan City untuk memperbaharui kesepakatan yang ada. Saya pikir ini akan selesai dalam waktu dekat ini,” ujar Silva, Jumat (6/7). (m33ini/fbi/goal)


JAKARTA (Waspada): Ketua Umum PSSI, Djohar Arifin Husin, menyatakan timnas yang dipersiapkan tampil pada SEA Games 2013 di Myanmar akan melakukan pemusatan latihan di Belanda, demi mewujudkan target meraih medali emas cabang sepakbola ajang multi event bergengsi dua tahunan tingkat Asia Tenggara itu. Mengenai waktu pelaksanaan pemusatan latihan tersebut, lanjut Djohar, sepenuhnya diserahkan kepada pelatih Aji Santoso sebagai Penanggung Jawab Program Latihan Timnas U-23 Indonesia. Hanya saja, Djohar memberi gambaran kemungkinan Pelatnas di Belanda akan digelar pada Agustus tahun depan. “Kita berharap pemusatan latihan di Belanda dilakukan seusai kompetisi musim depan digelar, sehingga para pemain yang terpilih bisa berkonsentrasi penuh tanpa harus terganggu dengan kegiatan di klub,” kata Djohar kepada Waspada di Jakarta, Jumat (6/7). Ditambahkan, keputusan memilih Belanda sebagai tempat menempa pemain Garuda Junior, karena negara bersangkutan memiliki fasilitas cukup baik. Selain itu, hal ini pun sudah disepakti setelah dirinya melakukan pembicaraan dengan Presiden Federasi Sepakbola Belanda (KNVB), Michael van Praag, ketika bertemu di sela-sela pertandingan Euro 2012 beberapa pekan lalu. “Insya Allah, KNVB siap membantu. Belanda memiliki fasilitas pendukung dan sports science lengkap di pusat latihan mereka di Kota Zeis. Lokasinya satu jam jalan darat dari Amsterdam. Di samping itu, banyaknya klub untuk ujicoba termasuk di beberapa negara yang berdekatan seperti Belgia, Jerman, dan Prancis, karena bisa ditempuh lewat jalan darat,” beber Djohar. (yuslan)

MEDAN (Waspada): Arema Indonesia yang berkekuatan 18 pemain tampaknya tidak mainmain menjalani laga tandang nes Sanawirimenghadapi PSMS Medan di Stadion Baharoeddin Siregar Lubukpakam, Minggu (8/7) besok. Tiba di Medan Kamis (5/7) malam, rombongan Arema menginap di Hotel Swiss-Belhotel di Jl Surabaya Medan. Dari 18 pemain yang dibawa, empat legiun asing yakni Andrew Nikolas Barisic, Dennis Romanov, Marko Krasic, dan Roman Chmelo ikut tur tersebut. “Kami tidak menganggap satu tim dengan tim lain itu berbeda. Semua laga harus dimainkan dengan serius. Ini kompetisi dan selayaknya, hingga akhir semua pertandingan bisa berjalan baik,” ujar Manajer Tim Arema Indonesia, Brillyanes Sanawiri, Jumat (6/7). Apalagi, Arema tetap berharap bisa mengakhiri kompetisi Indonesian Premier League (IPL) dengan manis, usai prestasi cukup buruk di putaran pertama lalu lantaran masalah internal yang menerpa. “Kami ingin tetap fokus hingga kompetisi berakhir dan harapannya bisa finish di peringkat kedua,” beber pria yang akrab disapa Brilly tersebut. Menurut Brilly, secara kualitas, PSMS yang saat ini berada di posisi 11 klasemen sementara bukanlah tim kacangan. Hasil imbang 2-2 kontra Persiba Bantul, Sabtu (30/6) lalu, membukti-

kan tim besutan Fabio Lopez tersebut harus tetap diwaspadai. “Kami hargai tim PSMS Medan. Kami juga ikut merasakan apa yang mereka rasakan,” ujar pelatih Dejan Antonic. Kendati tidak mengalami permasalahan yang sama dengan PSMS, pria yang cukup fasih berbahasa Indonesia ini berharap permasalahan finansial yang ada di klub-klub IPL segera berakhir. Kapten Arema, Legi-

min Raharjo, menilai laga menghadapi mantan klubnya itu merupakan pertandingan sulit. Hal itu disampaikan Legimin sesaat sebelum tim Singo Edan berlatih di lapangan Universitas Sumetera Utara (USU), Jumat (6/7). Menurut Legimin, karakter permainan yang dimiliki Ayam Kinantan cukup menyulitkan. “Bagi tim-tim luar yang bermain ke Medan akan merasakan

bahwa menghadapi PSMS itu sulit. Karakter Medan yang dikenal dengan permainan kerasnya itu cukup sulit bagi lawan,” ujarnya. Legimin juga sudah merasakan permainan PSMS di putaran pertama lalu, saat Arema unggul 2-1. Menurut Legimin, PSMS yang dibesut Fabio Lopez tersebut cukup punya karakter Medan. (m18)


WASPADA Sabtu 7 Juli 2012


Aksi Siwo Berlanjut MEDAN (Waspada): Seksi Wartawan Olahraga Persatuan Wartawan Indonesia (Siwo PWI) Cabang Sumut terus melakukan aksi penggalangan dana guna mendukung persiapan kontingen atlet Sumut menuju PON 2012 di Riau, September mendatang. LEBIH dari 1.000 pebulutangkis usia muda dari penjuru nusantara mengikuti upacara pembukaan audisi PB Djarum di GOR Jati Kudus, Jumat (6/7). -Waspada/ist-

1.038 Talenta Muda Audisi PB Djarum MEDAN (Waspada): Audisi PB Djarum telah dimulai sejak Jumat (6/7). Kegiatan yang bertujuan menjaring talenta muda bulutangkis Indonesia di GOR Jati Kudus itu dibuka resmi Program Director Bakti Olahraga Djarum Foundation, Yoppy Rosimin. Sejumlah 1.038 peserta dengan usia 10-15 tahun turut ambil bagian. “Animo masyarakat tahun ini sangat luar biasa. Tercatat sekitar 1.222 peserta mendaftar dan yang akhirnya melakukan daftar ulang serta ikut audisi sejumlah 1.038 atlet. Bukan hanya dari pulau Jawa, banyak juga peserta datang dari daerah seperti Sumatera, Kalimantan, dan Sulawesi. Semoga target kami mendapatkan atlet-atlet muda berbakat tercapai.” ujar Yoppy. Meskipun PB Djarum telah menetapkan usia atlet pendaftar

adalah 10-15 tahun, ada pula atlet yang belum genap berusia 8 tahun. Ia adalah Farel Aditya Pradana, atlet yang lahir di Rembang pada 18 September 2004 ini mengakui ingin ikut audisi, setelah pada tahun 2011 lalu menyaksikan proses audisi. “Tahun lalu lihat kakak audisi, jadi ingin bisa main badminton dan ingin jadi juara dunia,” ujarnya. Seluruh peserta audisi harus melewati tes tahap I pada hari pertama, di mana mereka bermain bulutangkis selama 10 hingga 15 menit. Tes tahap pertama ini bertujuan melihat seberapa matang teknik dasar para peserta audisi. Hal ini penting untuk memastikan bahwa para peserta bisa mengikuti program latihan yang akan dilaksanakan oleh PB Djarum. Menurut salah satu legenda

bulutangkis Indonesia, Christian Hadinata, yang juga jebolan PB Djarum, ada tiga kriteria yang harus dimiliki seorang atlet, yakni mental, fisik, dan teknik yang mumpuni. Kriteria tersebut dapat terlihat melalui empat tahapan audisi yang berakhir Minggu (8/7) besok. Bagi peserta yang lolos hingga tahap empat akan masuk ke tahap karantina selama seminggu. Selama dalam masa karantina, PB Djarum menanggung seluruh akomodasi peserta. Sejak didirikan 28 April 1969 silam di Kota Kudus, PB Djarum telah berhasil melahirkan atletatlet bulutangkis kelas dunia, seperti Liem Swie King, Kartono, Christian Hadinata, Hastomo Arbi, Hadiyanto, Heryanto Saputra, Hadibowo Sutanto, dan banyak lagi. (m33)

Dua Calon Ketum Mendaftar Klub Anggota PSSI Medan Gelar Muscablub MEDAN (Waspada): Klubklub anggota Pengcab PSSI Kota Medan akan menggelar Musyarawah Cabang Luar Biasa (Muscablub) dengan agenda utama memilih Ketua Umum Pengcab PSSI Kota Medan periode 20122016 di Gedung Sekretariat Mantan Pemain PSMS di Kompleks Kebun Bunga Medan, Minggu (8/7) besok pukul 10.00 WIB. “Sudah ada dua calon ketua umum yang mendaftar, yakni H Nobon Kayamuddin (mantan pemain PSMS) dan Ir Azam Rizal (Ketua PS Tirtanadi). Merekalah yang akan bersaing untuk menjadi ketua umum periode empat tahun ke depan dalam Muscablub nanti,” ujar Ketua Panpel Muscablub, H Martius Latuperisa, Jumat (6/7). Didampingi Sekretaris Panpel Sugeng Rahayu dan Bendahara Juanda, Martius mengaku telah mengundang seluruh klub-klub anggota PSSI Medan untuk mengikuti acara. Termasuk juga telah mengundang pihak Pengprov PSSI Sumut dan

Ketua KONI Medan. “Kami berharap Muscablub nantinya berjalan lancar dan ketua umum terpilih dapat menjalankan roda organisasi secara profesional dan penuh tanggungjawab, dalam misi mengembalikan kejayaan sepakbola Kota Medan,” ucap Martius yang juga Ketua Forum Klub-klub Anggota PSMS/PSSI Medan. Sekretaris Panpel, Sugeng Rahayu, menambahkan segala persiapan Muscablub sudah rampung dan tinggal digelar saja. Bagi klub anggota PSSI Medan yang mungkin belum menerima undangan dari panitia karena berbagai hal, diharapkan tetap hadir. Seperti diberitakan sebelumnya, klub-klub akhirnya bersikap tegas dengan mengambil-alih kepanitiaan Muscablub PSSI Kota Medan, menyusul penundaan dilakukan panitia Muscablub sebelumnya dengan alasan yang dinilai tidak rasional. Pengambil-alihan kepani-

PSMS Kehilangan Suharno “Tuang” MEDAN (Waspada): PSMS Medan kehilangan pemain legendaris tahun 1970-an, Suharno “Tuang”, yang meninggal di usia 59 tahun akibat sakit di rumah duka Dusun IV Bangun Sari, Gg Rois A, Tanjungmorawa. Almarhum dikebumikan di pekuburan muslim dekat rumah duka, seusai shalat Jumat. Sumardi, rekan almarhum yang juga mantan pemain PSMS, menuturkan almarhum sudah mengalami sakit stroke sekira empat tahun. Pada Kamis (6/7) malam, almarhum meninggal di rumah duka. Almarhum memulai karier sepakbola di PTPN VII Dolok Sinumba, Simalungun. Seusai itu, dia melanjutkan karier di PS Simalungun dan pindah ke klub anggota PSMS, Bintang Utara. Almarhum yang menempati posisi stopper terpantau memperkuat tim Sumut ke Pekan Olahraga Nasional (PON). Setelah tampil di PON, Suharno memperkuat PSMS era 1970-an seangkatan Suparjo, Zulkarnaen Pasaribu, Regowo, Sunardi B, Youngky Haurisa, dan lainnya. Selanjutnya, almarhum dikontrak Pardedetex FC di kompetisi Galatama. (m18)

Problem Catur Jawaban di halaman A2 8







1 B







Riau. Karena itu, kami tergerak untuk menggalang dana dari masyarakat,” ujar Hidayat. Sekretaris GMPP Heri Sanjaya didampingi M Rael Sahadi, mengatakan Pemerintah Provinsi Sumut diharapkan segera menyelesaikan masalah yang dihadapi kontingen Sumut, agar dapat fokus persiapan dan meraih hasil maksimal di PON. Aksi KMIB dan GMPP Sumut pun mendapat respon positif dari pengurus KONI Sumut. “Ini bukti bahwa bukan kami saja yang peduli dengan keadaan atlet. Kepedulian mereka memotivasi kami untuk terus melakukan pembinaan olahraga,” ujar Agung Sunarno. Agung menambahkan KONI Sumut memang sangat membutuhkan dana dari Pemprovsu yang hingga kini belum cair. Begitupun, pihaknya tetap menggelar pelatihan daerah (Pelatda) Penuh bagi atlet Sumut mulai Minggu (8/7) besok. Koordinator Aksi Siwo PWI

PSDS Jr Lolos Grup I Sumatera MEDAN (Waspada): PSDS Junior (Jr) lolos dari Piala Suratin U-17 Grup I Zona Sumatera dengan perjuangan berat, setelah terpaksa bermain dengan sembilan pemain akibat ulah wasit saat imbang 2-2 melawan tuan rumah PS Rokan Hilir (Rohil) Junior, Riau, Jumat (6/7). Dalam 10 menit pertama, PSDS sudah tertinggal dua gol lewat titik penalti. Bahkan wasit mengeluarkan dua pemain Traktor Kuning secara kontroversial. Demikian disampaikan Manajer Tim PSDS Jr, Juniman. Akibat pemberian dua hadiah penalti itu, wasit disinyalir berat sebelah mengingat tuan rumah wajib menang dengan selisih empat gol untuk lolos dari zona Sumatera. Sebelumnya, PS Rohil kalah 1-3 atas PSBL Langsa dan PSDS Jr menang 2-0 atas PSBL. Untuk itul, PSDS Jr hanya butuh hasil imbang untuk mendapatkan tiket ke tingkat nasional. Setelah tertinggal dua gol dengan sembilan pemain, PSDS Jr yang diarsiteki Nasib Iwan dan Susanto tetap ngotot. Menit 30, PSDS membalas melalui Baginda dan sekilas membuat ofisial PS Rohil terdiam. Meski begitu, wasit tetap menzolimi tim tamu. “Pertandingan babak pertama sempat terhenti sekitar 20 menit, namun kita tetap ingin main. Sebab, kalau ke luar lapangan sebelum laga selesai berarti kalah WO dan peluang ke tingkat nasional otomatis tertutup,” papar Juniman. Skuad Traktor Kuning pun mengambil inisiatif penyerangan di babak kedua. Lima menit berjalan, PSDS lagi-lagi dirugikan ulah wasit yang menunjukkan titik putih. Beruntung, Rohil gagal memaksimalkan hadiah tendangan 12 pas tersebut. Sebaliknya, PSDS Jr menyamakan kedudukan melalui Dimas Sumantri pada menit 70. (m18)

KONI Batubara Janjikan Bonus Tim Sepak Takraw Juara Popdasu LIMAPULUH (Waspada): Ketua KONI Batubara, Hadi Suriono, memberikan apresiasi kepada tim sepak takraw pelajar daerah itu yang sukses menjuarai Pekan Olahraga Pelajar Daerah Sumatera Utara (Popdasu) X/2012 di Madina, baru-baru ini. “Kepada atlet yang telah berprestasi, nantinya akan kami


Hitam melangkah, mematikan lawannya tiga langkah.


tiaan ini dilakukan dalam rapat yang berlangsung di Sekretariat Mantan Pemain PSMS di Kompleks Stadion Kebun Bunga Medan, Minggu (1/7) lalu. Sebelumnya, Pengcab PSSI Medan menyampaikan surat undangan tertanggal 15 Juni 2012 kepada pengurus klub-klub untuk mengikuti Muscablub pada 4 Juli 2012. Namun kurang seminggu pelaksanaan Muscablub, yakni 27 Juni 2012, Pengcab PSSI Medan tiba-tiba menunda ajang itu dengan alasan Ketua Pengprov PSSI Sumut tidak bisa hadir pada 4 Juli. Alasan itu dinilai tidak rasional mengingat harusnya Ketua Pengprov bisa diwakili wakilnya. Penundaan yang tidak jelas waktunya juga mendapat reaksi keras klub-klub. (m42)

Aksi serupa juga dilakukan Kaum Muda Indonesia Bergerak (KMIB) dan Gerakan Mahasiswa Pemerhati Pembangunan (GMPP) Sumut yang melakukan penggalangan dana di depan Gedung DPRD Sumut, Kantor Gubsu, dan Bundaran Majestik Medan. Dari aksi tersebut, mereka berhasil mengumpulkan sumbangan senilai Rp476.400. Sumbangan tersebut langsung diserahkan ke kantor KONI Sumut di Jl Pancing Medan yang diterima langsung oleh Wakil Ketua II KONI Sumut, Prof Agung Sunarno. Ketua KMIB Sumut Kun Hidayat didampingi Sekretaris Mardostahi Nababan, mengatakan aksi penggalangan dana itu mereka lakukan secara spontanitas setelah mendengar atlet Sumut mengalami masalah pendanaan dan terancam gagal ikut PON 2012. “Sumut ‘luar biasa’ kalau sampai tidak ikut PON 2012 di

berikan tali asih atau bonus untuk lebih memacu semangat mereka berlatih dan meraih prestasi yang lebih baik di masa mendatang,” ujar Hadi, Jumat (6/7). Kabid Olahraga Disbudparpora Batubara, Ilyas, mengatakan prestasi yang diraih tim sepak takraw merupakan buah dari kerja keras para pemain


saat berlatih dan bertanding, serta ketekunan tim pelatih dalam membina pemain. “Kami ucapkan terima kasih kepada Bupati Batubara dan Ketua KONI yang telah memberi dukungan motivasi serta doa restu pada kontingen Batubara sehingga dapat berpartisipasi dan meraih prestasi,” ucapnya. (c05)


1. (Isi nomor 1 dan 5 terpisah) Idola Indonesia (Inggris), pemilihan penyanyi berbakat oleh RCTI. memasuki grand final. 5. (Terkait pertanyaan diatas). 7. ______Ivanova, grand finalis acara RCTI diatas. 8. ______Y. Matthews, dipanggil Sean, grand finalis acara RCTI diatas. 9. Tunggal (menyanyi dan memainkan alat musik). 10. Orang berkostum laba-laba; Salah satu filem anak-anak yang sedang diputar di Medan. 13. Alat musik sepasang gendang kecil (yang dipukul-pukul dengan tangan). 14. Kelompok penyanyi/pemain musik yang bermain bersama secara tetap, misalnya _____Bukit Barisan. 15. Nada ke-5 tangga nada diatonik. 18. Alat musik tiup, seperti sangkakala. 20. Harry______, judul filem Hollywood tentang sekolah sihir. 21. Penyanyi bersuara antara sopran dan tenor. 22. Bunuh (Inggris). License To _____, judul filem serie James Bond. 23. Tom______, aktor Hollywood termahal versi majalah Forbes. 26. Judul filem yang diperankan Sylvester Stallone selain Rocky.

Waspada/Dedi Riono

PENGURUS KMIB dan GMPP menyerahkan hasil penggalangan dana kepada Wakil Ketua II KONI Sumut, Prof Agung Sunarno, Jumat (6/7). Cabang Sumut M Syamsir didampingi Koordinator Lapangan Ayub Kesuma, menambahkan aksi penggalangan dana terus berlanjut. Pada Jumat (6/7), aksi digelar di Jl Raden Saleh Medan dan berhasil mengumpulkan

Rp134.000 dalam tempo singkat. “Penggalangan dana di Jl Raden Saleh berlangsung singkat. Pasalnya, traffic light di persimpangan tersebut padam tiba-tiba. Padahal ketika sukarelawan dari Siwo tiba, traffic

light hidup dan padam saat aksi baru dimulai,” ucap Syamsir menambahkan Siwo kembali mendapat sumbangan dari Komunitas Catur Sumatera Utara senilai Rp1 juta yang diserahkan Perry Iskandar. (m42)

Green Perhitungkan Subhan Sergai Rally MEDAN (Waspada): Pasangan asal Selandia Baru, Brian Green/Fleur Pedersen, menyatakan tidak mudah merebut gelar juara di ajang Sergai Rally 2012, mengingat tampilnya sejumlah pereli terbaik Indonesia, terutama juara nasional Subhan Aksa. Menurut Green, tantangan akan sangat keras karena disebutnyaSubhanadalahpereli yang sangat cepat saat ini, terbukti dengan prestasinya di ajang PWRC. Namun Green yang merebut gelar juara reli Malaysia 2003 dan 2004 menyebut akan berupaya maksimal dalam penampilan pertamanya di Sumut. Diunggulkan, Subhan sendiri tak mau menganggap enteng dan menyatakan persaingan tahun ini sangat kompetitif. Dirinya mengaku juga sangat memperhitungkan peluang pereli Sumut, seperti Ijeck dan Harun Nasution yag sudah hapal trek di Rambong Sialang tersebut. Di kesempatan lain, Dade Nasution (R Speed) juga berharap bisa tampil terbaik guna meramaikan persaingan. Peringkat lima besar NSRC 2011 ini mengatakan ingin memberi hasil terbaik dan tampil maksimal di hari pertama. Bupati Serdang Bedagai, HT Erry Nuradi, mengatakan Pengprov IMI Sumut sudah tepat

Waspada/Armansyah TH

BUPATI Sergai HT Erry Nuradi didampingi unsur Muspida dan Ketua Pengprov IMI Sumut Ijeck melepas peserta no 1 Sergai Rally 2012 di Jalinsum Perbaungan, Jumat (6/7). memilih Sergai sebagai ajang penyelenggaraan seri I Kejurnas Sergai Rally 2012 dengan lokasi di kawasan perkebunan Rambong Sialang Estate. Tahun ini, Sergai Rally diikuti 35 peserta dengan juara nasional asal Sulsel, Subhan Aksa, dilepas pertama diikuti Rizal Sungkar (DKI) dan Ijeck di urutan ketiga. “Sergai bukan pertama kalinya menjadi ajang kejuaraan reli, karena Rambong Sialang sudah pernah menjadi lokasi kejuaraan dunia reli 1996 dan 1997 lalu. Berarti ini hanya mengulang sejarah,” sebut Erry dalam cer-

emonial start di lapangan replika Sultan Serdang, Jalinsum Perbaungan. Ketua Pengprov IMI Sumut, Ijeck, mengatakan harapan agar Sumut bisa kembali menjadi tuan rumah ajang APRC dan WRC sudah menunjukkan titik terang, dengan terselenggaranya kembali Kejurnas yang sudah memasuki seri kedua di daerah ini. Hari pertama Sergai Rally 2012 pada Sabtu (7/7) ini, akan memperlombakan lima dari total 9 SS, dengan jarak tempuh total 181 km. (m47)

Sumut Terhenti Di 8 Besar Voli Pantai Indonesia Open 2012 MEDAN (Waspada): Pasangan putra Sumut 1 yang diperkuat Didit Syahputra dan Andransyah harus puas terhenti di babak 8 Besar Kejuaraan Bola Voli Pantai Indonesia Open di Bengkalis, Riau, Jumat (6/7). Regu Sumut 1 gagal melaju ke semifinal setelah dihentikan Jatim 2-0 (10-21, 13-21). Sebelumnya, Sumut 1 melaju ke perempatfinal kala mengalahkan Riau 4 dengan skor 2-0 (21-13, 21-9) pada hari yang sama.

27. Nama panggilan pacar penyanyi Syahrini. 28. Irama nada.


1. _____Sardi, pemain biola nasional terkenal. 2. Pertunjukan jenaka/lawakan. 3. Nama balita perempuan yang dibobokkan dalam lirik lagu klasik. 4. Grup musik Apotik Kali Asin. 5. Permainan musik tanpa nyanyian. 6. Pertunjukan sandiwara dengan iringan gambang kromong (di Jakarta). 11. Dalam tempo yang cepat. 12. Alat musik dipukul dengan dua stik. 13. Alat musik yang mempunyai nada terendah. 14. Wanita berperan sebagai pelaku dalam pementasan drama di televisi, filem dsb. 16. Dekor pemandangan yang dipakai dalam pementasan drama. 17. Alat musik tiup berbentuk trompet panjang dengan alat sorong dan tarik. 19. Singkatan mikrofon. 23. Singkatan Computer Processing Unit. 24. Universitas di Medan mempelajari etnomusikologi (singkatan). 25. Perusahaan musik multinasional di Inggris. 26. Nada ke-2 tangga nada diatonik.

Nasib sama dialami pasangan putra Sumut 2 yang menurunkan Rizky Ramadanu/Yopi Pranata. Keduanya terhenti di babak 8 Besar setelah ditaklukkan Yogyakarta 2-0 (21-15, 2117). Sumut 2 tampil di 8 Besar dengan mengalahkan Siak 1 dengan skor 2-0 (21-9, 21-10). Kabid Binpres PBVSI Sumut, Elpian, memberikan apresiasi atas perjuangan dua pasangan asal Sumut yang mampu menembus babak 8 Besar. Me-

nurutnya, capaian prestasi itu sudah cukup bagus, mengingat event yang diikuti levelnya nasional. “Kekalahan dua pasangan Sumut di babak 8 Besar akan kita jadikan bahan evaluasi untuk ke depan lebih baik lagi dalam persiapan pemain. Begitupun, pemain sudah berjuang dan mereka kalah terhormat dari pasangan yang memang berkualitas,” pungkas Elpian. (m42)

Sudoku 10x10 Isi kotak kosong dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu kurang dari 15 menit. Jawaban di halaman A2 kolom 1.

0 7 1 4 6 4 1 8 3 1 3 7 9

7 3 3 1

2 1 4 6 5 4 5 8 9 2 4 8 1 0 4 7 2 3 9 7 6 4 5 ****39


Sport Aga Ulangi Sejarah 73 Tahun

WASPADA Sabtu 7 Juli 2012

LONDON (Waspada): Agnieszka Radwanska (foto) menjadi petenis pertama asal Polandia yang menembus final grand slam setelah menang 6-3, 6-4 atas Angelique Kerber (Jerman), Kamis (5/7).


Pedrosa Terdepan SACHSENRING, Jerman (Waspada): Pebalap Repsol Honda, Dani Pedrosa , mengakhiri hari pertama latihan bebas MotoGP Jerman di Sirkuit Sachsenring, Jumat (6/7), sebagai peserat tercepat. Pada latihan bebas kedua, pebalap Spanyol ini mencatat waktu 1 menit 32,228 detik. Dengan demikian, Pedrosa mempertahankan posisinya, karena pada sesi pertama juga menjadi pebalap. Di posisi kedua, pebalapLCRHonda,StefanBradl, membuat kejutan di pengujung latihan karena mengalahkan Jorge Lorenzo (Yamaha). Bradl hanya lebih lambat 0,076 detik, sedangkan Lorenzo terpaut 0,099 detik. Posisi keempat dihuni rekan setim Pedrosa, Casey Stoner. Juara dunia 2007 dan 2011 ini turun dua tangga, karena pada latihan pertama berada persis di belakang Pedrosa. Legenda hidup MotoGP asal Ducati, Valentino Rossi, membuat kemajuan. Jika pada latihan pertama terlempar dari posisi 10 Besar, maka kali ini The Doctor menghuni urutan kelima. Juara dunia tujuh kali MotoGP ini sempat berada di urutan kedua, sebelum dikalahkan Bradl, Lorenzo, dan Stoner di pengujung sesi. Alvaro Bautista, akan start dari posisi paling belakang di MotoGP Jerman sebagai hukuman atas kecerobohannya pekan lalu di Assen, berada di peringkat 11. Meski demikian, pebalap Gresini Honda ini cuma terpaut 0,999 detik. (m33/auto)

Grosjean Curi Posisi Hamilton SILVERSTONE, Inggris (Waspada): Romain Grosjean menjadi pebalap tercepat sesi free pactice I GP Inggris di Sirkuit Silverstone, Jumat (6/7). Pembalap Lotus itu sukses mencatatkan waktu 1 menit 56,552 detik. Sesuai perkiraan, balapan di Sirkuit Silverstone ini berlangsung dalam keadaan basah. Hujan terus mengguyur lintasan sepanjang sesi pembuka ini. Grosjean, melibas 13 lap, tampil cukup dominan dengan keunggulan 0,275 detik dari Daniel Ricciardo yang menempati posisi kedua. Lewis Hamilton, hanya tampil dalam enam lap, mencatat waktu 1 menit 57,174 detik dan berada di posisi ketiga. Jagoan McLaren tersebut diikuti Sergio Perez (Sauber) dengan waktu 1 menit 57,664 detik. Posisi kelima ditempati Felipe Massa. Rekan Fernando Alonso di Ferrari itu menoreh 1 menit 58,119 detik. Sementara itu, juara bertahan Sebastian Vettel hanya mampu parkir di urutan 11. Tampil dalam 11 lap, pebalap Red Bull itu meraih catatan 1 menit 59,414 detik atau kalah 2,862 detik dari Grosjean. (m33/auto)

ALHAMDULILLAH..., DENGAN DAMAR PROPOLIS KAKI DAN TANGAN SAYA BISA DIGERAKAN KEMBALI Memeriksakan kesehatan secara rutin memang sangat dianjurkan, apalagi jika sudah memasuki usia senja dimana imunitas seseorang akan turun, tentunya akan mudah mendeteksi penyakit yang diidapnya. Namun apa jadinya jika pemeriksaan yang dilakukan ternyata menimbulkan penyakit, hal ini pastinya akan menimbulkan penyakit lainnya. Hal ini diakui oleh Siti (65 tahun), nenek 10 cucu ini mengaku setelah mengikuti terapi yang dilakukan secara gratis, kakinya menjadi sakit bahkan sulit untuk berjalan. “Awalnya saya ikut terapi listrik tapi bukannya badan ini enak malah kaki saya sakit dan sulit untuk berjalan, ketika saya periksakan ke dokter saya divonis terkena asam urat dan kolesterol, namun hingga 4 bulan ini tidak kunjung sembuh dan kaki menjadi kaku. Alhamdulillah, sejak saya dikenalkan Damar Propolis dan mengkonsumsinya secara rutin, kaki saya sudah tidak sakit lagi dan saya sudah dapat berjalan seperti semula,” ujar warga Jatinegara Jakarta Timur yang kini giat menyarankan orang lain mengkonsumsi Damar Propolis untuk segala macam penyakit. (Siti - Jakarta) Tingginya kadar asam urat dan Kolesterol terkadang dialami oleh seseorang secara bersamaan, jika sudah merasakan keduanya bagian tubuh tertentu pasti akan merasa sakit bahkan kaku tidak bisa digerakan. Pengalaman ini dialami oleh Eni Mulyani (53 tahun), ibu empat orang anak ini mengaku sudah 2 bulan tangannya tidak bisa digerakan, ketika dilakukan pemeriksaan dokter ternyata ia mengidap asam urat dan kolesterol dengan kadar yang tinggi. “Mungkin karena saya tidak menjaga pola makan sehingga terkena asam urat dan kolesterol, rasanya sangat tidak enak, tangan saya kaku tidak bisa digerakan dan ini berlangsung selama dua bulan. Alhamdulillah, berkat mengkonsumsi Damar Propolis secara rutin kini tangan saya sudah dapat digerakan kembali, bahkan belum habis satu botol tubuh saya kini merasa segar dan fit,” pungkas warga Cipinang Jakarta Timur yang kini juga menyarankan orang lain mengkonsumsi Damar Propolis untuk mengatasi segala macam penyakit. (Eni Mulyani - Jakarta) Propolis adalah suatu zat yang dihasilkan oleh lebah madu yang dikumpulkan dari pucuk daun muda untuk kemudian dicampur dengan air liurnya. Propolis bersifat disinfektan yang dapat membunuh semua kuman. Damar Propolis dibuat dari 250ml murni sehingga memiliki takaran yang tepat tanpa campuran alkohol, sehingga berbeda dengan propolis merek lain. Propolis merupakan salah satu keajaiban yang diturunkan Sang Pencipta bagi mahluk-Nya. Sebagian besar penyakit dapat ditumbangkan oleh zat yang dihasilkan oleh lebah ini. Bahkan untuk penyakit menahun seperti Rematik dan Kolesterol dapat diobatinya, karena kandungan zat yang berfungsi sebagai antibiotik dan antimikroba tersebut tidak diragukan lagi. Damar Propolis, memiliki kandungan murni dan kompleks sehingga Damar Propolis memiliki lebih dari 60 manfaat positif bagi tubuh dan lebih dari 300 jenis penyakit yang dapat diobatinya. Untuk Info lebih lanjut silahkan kunjungi Atau menghubungi no: tlp. 0821-2631-1567. Bagi anda yang membutuhkan Damar Propolis bisa didapat di apotek/toko obat terdekat di kota anda diantaranya:

Medan. Apt. Global. AptkYarhammuni Rabbi. Apt. Libra II. Apt. Putra Farma. Apt. Rachel Farma Apt. Samudera 2 Apt. Sentosa. Apt. Yakin Sehat. BINJAI Apt. Jasa FarmaApt. SejatiApt. Kita FarmaApt. Bangkatan Pandia. Tebing Tinggi. Apt. Saudara Baru. Sei Rampah. Apt. Sahabat. Langkat. Apt. Citra Kabupaten Langkat. Apt. Hani. Apt. Nasional. Apt. Nurhayati. Apt. Medan. Apt. Sehat Sentosa. Apt. Sekawan. Kota Tebing Tinggi. Apt. Soudara baru. Kab Serdang Bergadai. Apt. Sahabat. Kab Batu Bara. Apt KualaTanjung. Apt. Paten. Kab Asahan. Apt Saudara. Apt. Adecyaa Farma. Kab Labuhan Batu Utara. Apt. Sarvita. Apt. Sanjaya Farma. Kab Labuhan Batu. Apt. Batam Jaya. TO. Apt. Batam Jaya. TO. Berkah Ibu.

Ini menjadi sejarah terbaru bagi negara tersebut dalam kurun waktu 73 tahun dan juga menjadi rekor pribadi Radwanska yang pertama kalinya maju ke partai puncak grand slam. Prestasi Radwanska ini menyamai kompatriotnya, Jadwiga Jedrzejowska, kala menembus final Prancis Terbuka 1939. Dengan demikian, Aga sapaan Radwanska- tinggal selangkah membuat rekor baru yang bakal tercatat dalam buku sejarah Polandia untuk menjadi jawara All England Club. Namun, di final Sabtu (7/5) besok, petenis berusia 23 tahun yang juga kampiun junior 2005 akan bertemu juara empat kali, Serena Williams. Sebenarnya Radwanska sudah membuat prestasi membanggakan ketika mengalahkan Maria Kirilenko (Rusia) di perempatfinal. Pasalnya, keberhasilannya menembus semifinal sudah membawa Aga mengakhiri “kutukan” selama empat tahun di arena grand slam, setelah selalu tersingkir di babak delapan besar. Sementara itu, Serena Williams untuk ketujuh kalinya melangkah ke finalWimbledon. Tiket ke partai puncak grand slam lapangan rumput ini diraih setelah menang 6-3, 8-6 atas

Pasang Iklan

Te l p . 4 5 2 8 4 3 1 H P. 0 8 13 7 0 3 2 8 2 5 9 Email:

unggulan kedua asal Belarus, Victoria Azarenka. Di tunggal putra, Andy Murray (Skotlandia) mengatasi David Ferrer (Spanyol) 6-7, 76, 6-4,7-6 saat ditonton PangeranWilliam dan Kate Middleton.

Nantinya, satu-satunya harapan tuan rumah tersebut akan menghadapi Jo Wilfred Tsonga yang lolos dengan menyingkirkan Philipp Kohlschreiber (Jerman) 7-6, 4-6, 7-6, 6-2. (m33/ap)

WASPADA Sabtu 7 Juli 2012

Medan Metropolitan


Poldasu – USU Kerjasama Berantas Narkoba MEDAN (Waspada): Kepolisian Daerah Sumatera Utara (Poldasu) dan Universitas Sumatera Utara menjalin kerjasama untuk memberantas penyalahgunaan narkoba terutama di kalangan mahasiswa. Hal itu terungkap ketika Kapoldasu Irjen Pol. Drs. H. Wisjnu Amat Sastro, SH bersama jajarannya berkunjung ke kampus USU dan diterima Rektor USU Prof. Syahril Pasaribu bersama stafnya, Jumat (6/7). Dalam kunjungan itu, Kapoldasu didampingi Direktur Reserse Narkoba Poldasu Kombes Pol Drs Andjar Dewanto, Direktur Binmas Kombes Pol Drs Heri Subiansauri, Kabid Humas Kombes Pol Drs Heru Prakoso, Kapolresta Medan Kombes Pol Monang Situmorang, SH, MSi, Kasat Narkoba Polresta Medan Kompol Dony Alexander, SH, SIK, M.Hum dan Kapolsek Medan Baru Kompol M Budi Hendrawan, SH, SIK. Salah satu upaya yang dilakukan untuk menekan angka penyalahgunaan narkoba yakni melakukan sosialisasi kepada para mahasiswa. Kemudian melakukan pendekatan kepada para remaja agar mereka tidak melakukan upaya mencoba-coba narkoba. “Kita minta kepada para orangtua agar meningkatkan pengawasan terhadap anak-anaknya yang telah beranjak remaja agar tidak terjerumus dalam ‘jurang’ pergaulan bebas dan penyalahgunaan narkoba,” kata Kapoldasu.(m36) Waspada/Ismanto Ismail

REKTOR USU Prof Syahril Pasaribu (kanan) melakukan pertemuan dengan Kapoldasu Irjen Pol Drs H Wisjnu Amat Sastro, SH (dua dari kanan), Kapolresta Medan Kombes Pol Drs Monang Situmorang, SH, MSi (empat dari kanan), Kasat Narkoba Kompol Dony Alexander, SH, SIK, M.Hum (dua dari kiri) dan Direktur Narkoba Poldasu Kombes Pol Drs Andjar Dewanto (kiri).

Hentikan Semua Acara Olga Syahputra MEDAN (Waspada): DPRDSU meminta Komisi Penyiaran Indonesia (KPI) menghentikan semua acara televisi yang menampilkan artis Olga Syahputra. Disebutkan Ketua Komisi A DPRDSU Isma Fadli Pulungan, lawakan Olga tidak saja menyinggung umat Islam, tapi juga merusak generasi muda. Berbicara kepada Waspada di gedung dewan, Jumat (6/7), Isma Fadli mengatakan, pihaknya bukan saja mendukung sikap KPI yang menghentikan sementara acara Pesbuker, tapi melarang seluruh tayangan televisi yang menampilkan Olga. Sikap, gaya dan bicara Olga Syahputra, menurut politisi

Partai Golkar ini sangat merusak. Tercatat beberapa kali artis pria berpenampilan kewanitawanitaan ini melakukan pelecehan, baik terhadap agama Islam maupun terhadap kehidupan sosial. ‘’Yang terakhir ucapan dia tentang Assalamu’alaikum itu. Kan sangat melukai hati umat Islam,’’ kata Isma Fadli. Dia mengaku tidak sepakat kalau tampilan Olga Syahputra merupakan trend anak muda saat ini. Yang benar adalah penampilan artis di TV akan menjadi contoh bagi para remaja. Karenanya, menurut Isma Fadli, televisi juga harus menampilkan acara-acara yang mendidik generasi bangsa ini. Yakni dengan

tidak menampilkan artis pria yang bersikap kewanita-wanitaan. ‘’Bayangkan, karena seringnya Olga tampil di TV, remaja laki-laki banyak yang mencontohnya. Bersikap keperempuan-perempuanan,’’ katanya. Menampilkan acara lawakan di TV, menurut Isma Fadli, sangat tidak salah. Namun artis yang membawakannya juga harus cerdas. Harus mengerti apa yang boleh diucapkan dan yang tidak boleh. Jangan asal bicara tanpa saringan, yang akhirnya menyinggung nilai-nilai agama, sosial dan budaya. Lihat saja kemasan acara televisi asing, menurut Isma Fadli, sangat baik. Acara humor

yang ditampilkan tetap lucu, walaupun artisnya tetap berpakaian rapi dengan jas dan dasi. ‘’Bukan seperti acara humor di TV kita. Yang ditampilkan lelaki bergaya perempuan dan bicaranyapun asalasalan, kasar dan sebagainya,’’ tambah Isma. Memasuki bulan suci Ramadhan tahun ini, sebagai Ketua Komisi A yang salah satunya membidangi informasi, Isma Fadli meminta kepada perusahaan televisi untuk tidak menampilkan Olga Syahputra, atau artis-artis sepertinya. Menurut Isma, bangsa ini tidak membutuhkan hiburan yang ‘murahan’ seperti itu. (m12)

Sumatera Utara

WASPADA Sabtu 7 Juli 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:32 12:45 12:33 12:40 12:39 12:36 12:33 12:28 12:35 12:35

‘Ashar 15:58 16:12 15:59 16:06 16:06 16:02 15:59 15:54 16:01 16:01

Magrib 18:42 18:59 18:43 18:53 18:51 18:43 18:42 18:38 18:45 18:46



Shubuh Syuruq


19:57 20:14 19:57 20:08 20:06 19:57 19:53 19:52 20:00 20:01

04:49 05:58 04:49 04:53 04:54 04:57 04:50 04:46 04:52 04:49

04:59 05:08 04:59 05:03 05:04 05:07 05:00 04:56 05:02 04:59

L.Seumawe 12:38 L. Pakam 12:31 Sei Rampah12:30 Meulaboh 12:42 P.Sidimpuan12:30 P. Siantar 12:30 Balige 12:30 R. Prapat 12:27 Sabang 12:45 Pandan 12:31

06:20 06:30 06:20 06:25 06:25 06:28 06:21 06:17 06:23 06:21

Zhuhur ‘Ashar 16:04 15:57 15:56 16:08 15:55 15:56 15:56 15:53 16:11 15:57





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:51 18:41 18:41 18:53 18:36 18:40 18:39 18:35 18:59 18:39

20:06 19:56 19:55 20:08 19:50 19:54 19:53 19:49 20:14 19:53

04:51 04:48 04:47 04:58 04:50 04:48 04:49 04:47 04:57 04:51

05:01 04:58 04:57 05:08 05:00 04:58 04:59 04:57 05:07 05:01

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:31 12:33 12:43 12:35 12:32 12:39 12:28 12:38 12:31 12:30

18:39 18:42 18:56 18:44 18:43 18:51 18:37 18:48 18:38 18:40

19:53 19:56 20:11 19:58 19:57 20:06 19:51 20:02 19:53 19:54

04:51 04:51 04:56 04:55 04:49 04:54 04:45 04:55 04:50 04:47

05:01 05:01 05:06 05:05 04:59 05:04 04:55 05:05 05:00 04:57

Panyabungan 12:28 Teluk Dalam12:35 Salak 12:33 Limapuluh 12:29 Parapat 12:31 GunungTua 12:28 Sibuhuan 12:28 Lhoksukon 12:37 D.Sanggul 12:32 Kotapinang 12:26 AekKanopan 12:28

06:23 06:19 06:18 06:29 06:21 06:19 06:20 06:17 06:29 06:22

15:57 15:59 16:09 16:01 15:59 16:05 15:54 16:04 15:57 15:56

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:22 06:22 06:28 06:25 06:20 06:25 06:16 06:26 06:21 06:18

Zhuhur ‘Ashar 15:54 16:01 15:59 15:55 15:57 15:54 15:53 16:04 15:57 15:52 15:54




Shubuh Syuruq

18:34 18:41 18:42 18:39 18:40 18:35 18:35 18:50 18:40 18:34 18:36

19:48 19:54 19:56 19:53 19:54 19:49 19:48 20:05 19:54 19:48 19:51

04:50 04:58 04:52 04:46 04:49 04:49 04:49 04:51 04:51 04:46 04:46

04:00 05:08 05:02 04:56 04:59 04:59 04:59 05:01 05:01 04:56 04:56

06:21 06:28 06:23 06:17 06:20 06:19 06:20 06:23 06:22 06:17 06:17

Wabup Sesalkan Warga DS Urus KTP Medan LUBUKPAKAM (Waspada): Wakil Bupati (Wabup) Deliserdang H. Zainuddin Mars menyesalkan jika ada warga Deliserdang mendapat pelayanan Pemko Medan untuk mendapat Kartu Tanda Penduduk (KTP) Medan. “Jangan karena jauhnya jarak pusat pemerintahan warga Deliserdang yang berada di perbatasan Kota Medan, lantas dijadikan alasan agar daerah perbatasan diserahkankePemkoMedan.Malah, hingga kini ia belum mende-

ngar langsung dari warga di perbatasan Deliserdang yang ingin bergabung ke Kota Medan hanya karena alasan fasilitas dan pelayanan,”sebutWabupdiruang kerjanya, Kamis (5/7). MenurutWabup, seharusnya

itu tidak terjadi. “Hal ini tentu karena ada sesuatu di balik itu. Tak tepat jika hanya karena alasan jauhnya jarak pusat pemerintahan yang di Lubukpakam, lantas daerah kita yang berbatasan dengan Medan diserahkan ke Pemko Medan,” tegas H. Zainuddin. “Contoh, banyak warga dari daerah lain yang bersekolah ke DeliserdangdanberobatkeRSUD Deliserdang, apa karena itu lantas harusmenjadiwargaDeliserdang, kan tidak. Sementara untuk pem-

Pemko Binjai Raih Opini WDP BINJAI (Waspada): BPK RI memberikan opiniWajar Dengan Pengecualian atas Laporan Keuangan Pemerintah Daerah (LKPD) Kota Binjai Tahun Anggaran 2011. Penilaian tersebut lebih baik dari tahun lalu. Kepala Perwakilan BPK RI Perwakilan Provinsi Sumatera Utara, Muktini, menyerahkan laporan hasil pemeriksaan (LHP) atas LKPD Kota Binjai TA 2011, kepada Ketua DPRD Kota Binjai Zainuddin Purba, SH dan Wali Kota Binjai HM Idaham, SH, M.Si, Kamis (5/7), di ruang rapat BPK RI Perwakilan Provinsi Sumatera Utara Jalan Imam Bonjol Medan. Penyerahan hasil penilaian dihadiri BPK perwakilan Provinsi Sumut,KasubaudSumutIR.Aryo Seto Bomantari, Kasubag Hukum dan Humas Mikael Togatorop dan Ketua Tim Pemeriksa IkaAvanti.DariPemkoBinjaihadir Kepala Badan Pengelola Keuangan dan Asset Daerah Drs. Aspian, Inspektur Kota Binjai Dra. Mustika Hadrah, Kepala bidang Akuntansi Dewi Ayu Putri, Kepala bagian Humas Zulfikar, S.Sos. Wali Kota HM Idaham menyatakan, dengan peningkatan

Waspada/Riswan Rika

KEPALA Perwakilan BPK RI Perwakilan Provinsi Sumatera Utara, Muktini menyerahkan Laporan Hasil Pemeriksaan atas Laporan Keuangan Pemerintah Daerah Kota Binjai TA 2011 kepada Wali Kota Binjai, HM Idaham, SH, M.Si. opini BPK akan terus bekerja keras untuk memperoleh opini WajarTanpa Pengecualian (WTP) pada TA 2012. Adanya peningkatan opini tersebut, menurut Idaham, didasari komitmen Pemko BinjaidenganDPRDuntukmemperbaiki diri dan menciptakan tatakelolapemerintahanyangbaik dan bersih. Ketua DPRD Kota Binjai Zai-

nuddin Purba mengakui kesungguhan Pemko Binjai untuk mengelolakeuangandenganbaik. Meskidiakuiopinitidakwajaratas LKPD Kota Binjai TA 2009 dan TA 2010 menjadi beban bagi pemerintahyangbaru.Zainuddin Purbamenyebutkan,dewanakan mendukung Pemko Binjai bisa memperoleh opini wajar tanpa pengecualian padaTA 2012.(a04)

“Keberadaan pedagang liar initakhanyamerugikanpedagang daging resmi seperti saya, tapi juga keuangan Pemkab Langkat, karena mereka dapat dipastikan tidak membayar retribusi yang wajib dikenakan kepada pedagang,” kata Sabir Ali ketika menyampaikan keluhannya kepada Waspada, Rabu (4/7). Iatakhabispikir,kenapadinas terkait tak mampu menertibkan pedagang liar, padahal permasalahaninisudahsejaklamadilaporkan, baik kepada Disperindag mau pun DPRD Langkat. Kalau pedagang bisa menggelar dagangan di sembarang tempat tanpa izin resmi, katanya, buat apa ia diwajibkan mengurus izin dengan mengeluarkan dana

besar. Ali menilai, kesemrawutan tatakelola pedagang di pusat pasar Tanjungpura, akibat tidak konsistennya aparat yang berkompeten melaksanakan Perda. Yang menambah keresahannya, ada kabar beredar, para pedagang liar ini bakal dikeluarkan izintempat.“Inikebijakanyangtak rasional di tengah lemahnya daya belikonsumen,”tandasnyaseraya meminta kepada Bupati Langkat, Ngogesa Sitepu, agar memerintahkan SKPD untuk menertibkan aktivitas pedagang daging liar. KadisPerindag,T.Nilfan,dikonfirmasiwartawankemarinmenyatakan,pihaknyaberupayamencari solusi terbaik agar para pedagang dagingdipasartradisionalTanjungpura bisa berjalan kondusif. (a02)

Robinson Manulang Memeluk Islam LAFAL istighfar yang diucapkannya masih banyak kesalahan.Duakalimatsyahadatyangdibacanyajugamasih jauh dari kesempurnaan. Begitu juga saat sosok pria tersebut menyebut nama Allah, tak mampu sama sekali. Hal itu karena Robinson Manulang baru pertama mengucapkannya. Inilah hari pertamanya memeluk Islam tanpa paksaan melainkan kesadaran. Prosesi pengambilan sumpah sebagai kewajibannya untuk memeluk Islam secara sungguh-sungguh berlangsung di rumah salah seorang warga diJalanKHZ.ArifinStabatKab. Langkat, dipandu Ustadz Abdul Salam LC, Rabu (4/7). Pembacaan dua kalimat syahadat disaksikan Ketua Ikatan Cendikiawan Muslim Indonesia (ICMI) Kab. Langkat yang juga pengurus MUI, H. Saiful Abdi bersama Camat Stabat M. Nurta serta warga. Setelahdipandubeberapa kali, akhirnya Robinson Manulang dapat membaca bagian dari ayat suci Alquran tersebut, meski banyak kekurangan. Secara pribadi diakuinya memeluk agama Islam merupakan keinginannya sebulan terakhir. “Beberapa kali saya bermimpi diganggu setan,tapiketikamengucapkan

Dan setiap minggu saya selalu ke desa itu tidak pernah kok ada keluhan warga tentang pendidikandansasarankesehatan.Malah infrastruktur jalan di daerah kita jauh lebih baik,” paparnya. Terkait adanya beberapa warga Desa Helvetia yang memiliki KTP Medan karena bekerja di Medan, menurut Dedy hal itu tidakbenarkarenaPemkoMedan tidak akan mengeluarkan KTP yang bukan warganya. Apalagi, persyaratan pembuatan KTP itu harus mulai dari tingkat kepala dusun. “Kalau memang ada warga Labuhan Deli yang KTP Medan, berarti dia pendatang. Jadi salah jika disebutkan ada warga Pematang Johar yang ingin bergabung ke kota Medan. Sebab, segala pelayanan pemerintahan jauh lebih dekat ke Kec. Labuhan Deli dibanding ke Kec. Medan Helvetia,” tandasnya. (a06/m16)

Dinas Perikanan Dan Kelautan Langkat Adakan Pelatihan

Pengaduan Pedagang Diabaikan Disperindag TANJUNGPURA (Waspada): Sudah setahun, Sabir Ali berjuang agar pedagang daging liar di pasar tradisional Tanjungpura dapat ditertibkan. Namun teriakan pedagang resmi itu terkesan diabaikan pejabat Dinas Perindustrian dan Perdagangan (Disperindag) Kab. Langkat, termasuk Satpol PP. Petugas pasar dan Satpol PP dianggap tak konsisten menerapkan Perda Kab. Langkat No. 23/ 2007 tentang Pembentukan Orga-nisasi Perangkat Daerah dan Peraturan Bupati Langkat No. 43/2008, tentang Rincian TugasdanFungsiDinasPerindustrian dan Perdagangan yang dengantegasmelarangpedagang berjualan di luar tempat yang telah ditetapkan pemerintah.

buatan KTP warga Kec. Labuhan Deli sudah beberapa tahun terakhirpembuatannyadilakukan di kantor camat setempat. Termasuk pembuatan e-KTP tetap dilakukan di kantor camat,” sebutnya. Camat Labuhan Deli, Dedy Maswardi, S.Sos yang dihubungi melaluitelefonselularnyamenyebutkan, selama ini warga Desa Pematang Johar tak pernah mengeluhkan tentang fasilitas Puskesmas dan pendidikan. Bahkan, warga Desa Pematang Johar yang dikenal dengan kegotongroyongannya dalam waktu dekat akan membeli lahan pertapakan untuk dijadikan Puskesmas rawat inap. “Rencana pembelian lahan itu murni swadaya masyarakat, malah dari Dinkes Deliserdang telah meninjau lokasinya. Jadi tidak benar kalau di Pematang Johar itu tidak ada Puskesmas.

lafal Allah roh jahat itu pergi dan saya selamat,” katanya. Dengan mimpi tersebut dicermatinya sebagai petunjuk untukmemilihajaranyangbenar. Robinson memiliki istri namun mereka telah lama bercerai. Seorangputriyangdikaruniaiatas nama Ridwana berusia enam tahun, menurut Ustadz Abdul Salamsaatmemandupriakelahiran 30 tahun silam itu mengucapkan syahadatain,otomatiskinimengikuti ayahnya yang telah memeluk Islam. Hanya saja dalam waktu dekat perlu dilakukan khitanan kepadanya. Camat Stabat M. Nurta turut

memberi nasehat kepada Robinson agar mempelajari ajaran Islam secara sungguhsungguh dan menyeluruh, bukan sekadar. Setelah disyahadatkan, mualaf yang seharihari bekerja di pabrik las di Kec. Sunggal DS itu kini telah berganti nama menjadi MuhammadIkhwanFirmansyah. Secara khusus dia diberi amanah untuk merenungi makna “Aku Bersaksi Tiada Tuhan Selain Allah dan Aku Bersaksi Bahwa Rasulullah itu Utusan Allah”, sebagaimana yang baru dia ucapkan. * Abdul Hakim

Waspada/Abdul Hakim

ROBINSON Manulang dipandu membaca dua kalimat syahadat saat memeluk Islam.

P. BRANDAN (Waspada): Dinas Perikanan dan Kelautan Langkat mengadakan pelatihan teknis pengolahan Satker pengembangan budidaya di gedung pelatihan Bukit-I Desa Tangkahan Durian, Kec. Brandan Barat, kataWirna, petugas Dinas Perikanan dan Kelautan Langkat kepada Waspada, Jumat (6/7). Hadir Konsultan CV. Khalimah, narasumber Kodir dari Dinas Perikanan dan Kelautan Langkat, Upt Brandan Barat dan peserta pelatihan. Pelatihan Angkatan II ini diikuti 80 peserta dari Kec. P. Susu Desa Pantai Pulau Sembilan, Desa Tanjung Pasir, Kec. Sei Lepan Kel. Sei Bilah Lk II dan jalan Pelabuhan. Sebelumnya, kataWirna, Angkatan I pelatihan Rabu (5/7). Mereka dari Desa Perlis dan Desa Lubuk Kasih Kec. Brandan Barat. “Semoga pelatihan ini bermanfaat bagi peserta,” katanya.(c01)

Berkenalan Melalui Handphone Jadi Korban Cabul BINJAI (Waspada): Akibat berkenalan melalui lewat handphone yang mengakibatkan Dara, 17, bukan nama sebenarnya penduduk Jalan Sedap Kel. Pahlawan Kec. Binjai Utara kehilangan kesuciannya karena dicabuli S, 38, warga Bayumas Jawa Tengah. Orangtua korban kemudian mengadu ke pihak Polres Binjai. Keterangan yang dikumpulkan, S yang menetap di Batam kepulauan Riau berkenalan dengan korban Dara lewat handphone. Kemudian korban dijanjikan kerjaan di Batam dengan iming-iming gaji menggiurkan. Korban pun langsung berangkat ke Batam. Kepada orangtuanya korban mengatakan akan dipekerjakan di tempat yang layak oleh temannya.SesampaidiBatam,korbanmenetapditempatkostersangka S. Di tempat itu korban dibujuk untuk menyerahkan kesuciannya dengan janji dinikahi, sehingga korban menyerah. Orangtua korban yang mengetahui kemudian menyusul ke Batam dan membawa keduanya pulang ke Binjai. Begitu sampai di Binjai orangtua korban menyerahkan tersangka ke Polres Binjai. Kasat Reskrim Polres Binjai AKP Aris Atianto, S.Sos ketika dikonfirmasi, membenarkan pihaknya sedang menangani kasus tersebut.(a05)

Waspada/Eddi Gultom

SEKDAKAB Drs. H. Haris Fadillah, M.Si didampingi Kepala Bappeda Ir. H.M. Taufik Batubara, M.Si, Kadis Kanla Ir. HM. Ramlan Matondang, M.Sc, Kadis Kesehatan Drg. Zaniyar, Plt. Kadis Perindagsar Dra. Hj. Dewi Iriani, M.Pd usai menerima kunjungan kerja para anggota DPRD dan pengusaha dari Kota Toyohashi Jepang.

Pengusaha Jepang Jajaki Peluang Investasi Di Sergai SEI RAMPAH (Waspada): Besarnya potensi Sumber Daya Alam (SDA) yang dimiliki Kab. Serdang Bedagai seperti perkebunan, perikanan, pertanian dan pariwisata pantai (wisata bahari) yang belum tereksplorasi secara optimal, menarik minat pengusaha asing khususnya pengusaha Jepang untuk menjajaki peluang kerjasama di bidang ekonomi dan perdagangan. Keinginan berinvestasi diutarakan Hisoyashi Kondo, pimpinan rombongan DPRD dan pengusaha Kota Toyohashi Provinsi Aichi Jepang saat melakukan kunjungan kerja diterima Sekdakab Drs. H. Haris Fadillah mewakili Bupati Sergai Ir. H.T. Erry Nuradi, M.Si, didampingi Kepala Bappeda Ir. HM. Taufik Batubara, M.Si di ruang Rapat Wabup Sergai Kompleks Kantor Bupati Serdang Bedagai di Sei Rampah, kemarin. Beberapa pengusaha yang ikut terdiri dari Shirou Nakagawara, Yukio Hikosaka, Takanori Naito, Masayuki Nitta serta Eri Kako, merupakan pengusaha berbagai bidang usaha seperti infrastruktur, pertanian, perikanan serta bidang pariwisata. Hadir anggota DPRD Kota Toyohashi Masateru Ozaki dan untuk pertama kalinya para pengusahamengunjungiProvinsiSumateraUtara. Juga Kadis Kesehatan Drg. Zaniyar M.AP, Kadis Kanla Ir. H.M. Ramlan Matondang MSc, Plt. Kadis Perindagsar Disperindagsar Dra. Hj. Dewi Iriani, M.Pd, Kabid Dikmenjur Disdik Sergai Drs. Janter

Siregar, MM dan Humas PDAM Tirtanadi Medan, Mohammad Rachmat Takarina. Menurut Hisoyashi Kondo, alasan lain yang menarik pihaknya melakukan investasi karena adanya sejumlah kesamaan potensi hasil-hasil bumi antara Kota Toyohashi dengan Kab. Sergai yakni bidang pertanian, perikanan dan perkebunan. Potensi tersebut bila dikembangkan dengan menerapkan teknologi modern akan memberi nilai tambah produksi. SalahsatupotensiandalanKotaToyohashi,yakni bidang perikanan lautnya yang telah menerapkan konsepteknologitinggipadapenangkapanhasillaut dan dikerjakan secara profesional. Dengan adanya kerjasama yang ditawarkan, pengusahaToyohashi siap membantu baik dalam pertukaran informasi dan penguasaan teknologi perikanan bagi nelayan daerah ini, sehingga memberi manfaat dalam mensejahterahkan kehidupan nelayan. Sementara Bupati Sergai Ir. H.T. Erry Nuradi, MSi diwakili Sekdakab Sergai Drs. H. Haris Fadillah, MSimengemukakanKab.Sergaiyangtelahberusia 8 tahun terus menerus melakukan percepatan pembangunan ekonomi masyarakatnya. Dengan didukung potensi sumber daya alam yang cukup besar terutama predikat salah satu lumbung padi terbesardiSumut,akanmemberipeluanginvestasi sebesar-besarnya di tanah bertuah negeri beradat ini, jelas Haris Fadillah.(a08)

Guru TK Dianiaya Dan Nyaris Diperkosa P. BRANDAN (Waspada): Dona Julianita, 20, mahasiswi salah satu perguruan tinggi swasta di Tanjungpura, dianiaya hingga babak belur dan nyaris diperkosa seorang pria dalam perjalanan pulang ke rumahnya di Jl. Perjuangan, Kel. Pelawi Utara, Kec. Babalan, Kamis (5/7) petang. Menurut keterangan, saat pulang kuliah petang itu, di pertengahan jalan melihat seorang pria tanpa kemeja membawa goni plastik dan broti. Setelah mendekat, pria itu menyergap korban lalu membekap kepala gadis itu dengan goni. Karena korban memberontak, pelaku

memukul punggung dan paha mahasiswi yang sekaligusguruTKitudenganbroti,sehinggakorban sempat tak sadarkan diri. Setelah korban tak berdaya, pelaku berinisial Pu alias Bayong mencium dan meraba bagian sensitif korban. Namun korban tersadar dan berteriak minta tolong. Sebelum kabur, pelaku sempat mempreteli anting dari telingan korban termasuk handphone. Kapolsek P. Brandan, AKP Zainuddin Lubis, dikonfirmasi di ruang kerjanya membenarkan peristiwa itu. “Saat ini anggota sedang melacak tempat persembunyian Pu,” kata Lubis.(a02)

Sumatera Utara

B2 Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

LIMAPULUH(Waspada): DP4 (Daftar Pemilih Pemula Potensial) dalam pelaksanaan Pilkada Gubsu di Kab Batubara dikhawatirkan menimbulkan polimik dimasyarakat, jika tidak segera di ambil langkah penyelesaian terbaik. Karena diusulkan 100 desa. Sedangkan jumlah desa/kelurahan di Batubara pasca pemekaran saat ini mencapai 151. “Ini perlu langkah terbaik menyelesaikan oleh pihak terkait beserta KPU Batubara menghindari hal tak diingini terjadi, karena 51 desa haknya dikhawatirkan tidak terakomodir nanti,” tukas sumber Waspada, Selasa (3/7). Apa lagi KPU setempat mulai melakukan tahapan-tahapan menghadap Pilkada, termasuk melakukan kroscek logistik di salurkan.”Jika berpedoman dari jumlah DP4 yang diusulkan ke Pemprovsu dikhawatirkan 51 desa/kelurahan lagi haknya tidak terakomodir. Maka perlu di cari solusi penyelesaian sebelum ini terjadi,”katanya. Menurut sumber, pengusulan daftar DP4 melihat jumlah desa/ kelurahanyangada.Karena51desadiBatubarabelum masukkedalam daftar adpinduk, sehingga diusulkan 100 desa/kelurahan sebagaimana data semula. (a13)

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta).

Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa,. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Minta Hentikan Kutipan Penerimaan Siswa Baru LIMAPULUH (Waspada): Dinas terkait diminta untuk menghentikan tindakan sekolah melakukan kutipan terhadap calon siswa baru dengan dalih uang pembangunan dan sebagainya. Sehingga, masyarakat khususnya orangtua murid merasa terbebani. Dan tidak menutup kemungkinan anak mereka terancam tidak melanjutkan sekolah karena ketiadaan biaya sebagaimana kebijakan diterapkan. Anggota DPRD Kab. Batubara Amat Mukhtas mengatakan hal itu, menanggapi kutipan dilakukan sejumlah SMAN dan SMK di Batubara terhadap calon siswa baru tahun 2012 dari Rp500 ribu s/d Rp1.750 ribu/siswa ketika melakukan pendaftaran ulang ke sekolah, Kamis (5/7). ‘’Ini kita harapkan dapat menjadi perhatian sekaligus melakukan evaluasi untuk lebih meningkatkan perhatian membuka akses pendidikan yang pro kepada masyarakat kecil di Batubara,’’ ujar politisi dari PKS tersebut Bila dilihat dari alokasi anggaran untuk dunia pendidikan secara persentase sudah memadai. Namun kenapa sekolah negeri masih melakukan kutipan dengan berbagai dalih. Dan pemerintah untuk tidak tutup mata dalam masalah ini. Menurut orangtua murid, sekolah kejuruan melakukan kutipan diperuntukan biaya baju dan perangkat sekolah beserta uang bulanan dan kewajiban di sekolah. Padahal, perhatian Pemkab Batubara dalam kepemimpinan Bupati H. OK Arya Zulkarnain, SH, MM cukup besar terhadap dunia pendidikan ditandai pengalokasian dana BOS sampai melakukan rehabilitasi terhadap sekolah mengalami kondisi kerusakan sampai membangun ruang baru secara bertahap. (a13)

Sabtu 7 Juli 2012

Hak 51 Desa Di Batubara Terancam Tak Terakomodir


Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi).


Sat Lantas Polres L. Batu Serahkan Helm

Waspada/Rasudin Sihotang

SEKDAKOT Tanjungbalai Erwin S Pane didampingi Kasatpol PP Yusmada, SH menerima aspirasi mahasiswa di gedung Wali Kota.

Mahasiswa Demo Terkait Kas Pemko Di Sejumlah Bank TANJUNGBALAI (Waspada): Sejumlah mahasiswa berdemonstrasi di Kantor Wali Kota Tanjungbalai Jalan Jend. Sudirman, Jumat (6/7), terkait dana kas daerah yang disimpan di sejumlah bank. “Kami mempertanyakan kenapa kas Pemerintah Kota Tanjungbalai disimpan di banyak bank, baik milik negara mau pun swasta,” ujar orator diikuti yelyel pendemo yang dikawal puluhan aparat keamanan dari Polres Tanjungbalai dan Satuan Polisi Pamong Praja. Di samping persoalan itu, mereka juga menilai kinerja sejumlah Satuan Kerja Perangkat Daerah(SKPD)masihminimdan jauh dari harapan. Sehingga pengunjukrasa minta Wali Kota

Tanjungbalai secara tegas menegur SKPD dimaksud demi optimalisasi dan peningkatan pelayanan kepada masyarakat. Dalam aksi itu mahasiswa kecewakarenatidakbertemuWali Kota Tanjungbalai, Thamrin Munthe. Namun mereka tetap mendapat perhatian Sekdakot Erwin S Pane didampingi Kepala Kantor Sat Pol PP Yusmada, SH dan SKPD lainnya. Dalamkesempatanitu,Erwin S Pane mengatakan, Wali Kota tidak dapat menemui mahasiswa

karena sedang tugas luar. Dia berjanji menyampaikan aspirasi pendemo sehingga ada tindaklanjut sebagaimana harapan para mahasiswa. Namun,terkaitpenyimpanan uang Pemko di beberapa bank, menurutErwintidakadamasalah karena sudah berjalan sejak pemerintahan Wali Kota sebelumnya. Namun, kata Erwin, saat ini pihaknya sedang berkonsultasi dengan Badan Pengawasan Keuangan dan Pembangunan (BPKP). Usai mendengar penjelasan itu, pendemo beranjak ke kantor KejaksaanNegeri.Disanamereka diterima Kasi Pidana Khusus Akhmad P Hasibuan. Setelah itu, pendemo membubarkan diri dengan tertib.(a32)

PNS Di Tanjungbalai Bakal Test Urine TANJUNGBALAI (Waspada): Seluruh PNS di jajaran Pemerintah Kota Tanjungbalai bakal mengikuti test urine dalam waktu dekat ini. “Kita menginginkan seluruh PNS di Tanjungbalai bebas dari narkoba. Maka itu, kita akan melakukan test urine secara mendadak, tinggal tunggu jadwal yang tepat,” kata Wali Kota Tanjungbalai Thamrin Munthe (foto), kepada Waspada di ruang kerjanya Rabu (4/7). Didampingi Kabag Humas Darul Yana Siregar, Thamrin menjelaskan, test urine itu untuk mengetahui apakah PNS Pemko Tanjungbalai bebas dari narkoba. “Ini merupakan salah satu upaya membersihkan narkoba dari lingkungan PNS,” kata Thamrin. Menurut alumni IAIN Sumut itu, test urine bagi PNS dilaksanakan secara rutin, bahkan anggarannya akan dimasukkan dalam Anggaran Pendapatan Belanja Daerah KotaTanjungbalai. Selain PNS, lanjut Thamrin, Pemko juga akan mengingatkan seluruh

lembaga pendidikan untuk melakukan pengawasan ekstra ketat terhadap anak supaya tidak terjerat narkoba. Dia mengakui, saat ini pihak luar menilaiTanjungbalai merupakan salah satu pintu masuk narkoba. Ini karenaTanjungbalai sebagai kota pelabuhan, berpotensi untuk memasukkan segalanya, seperti imigran gelap dan barang-barangdilarang,termasuk narkoba.

“Banyaknya temuan atau tangkapan atas upaya penyelundupan narkoba dengan berbagai modusoperandi,mengakibatkan orang luar menilai Tanjungbalai sebagai pintu masuk narkoba,” jelas Thamrin. Oleh sebab itu, untuk mencegah dan memperbaiki citra Tanjungbalai tersebut, kata Thamrin, Pemko bersama tokoh agama dan masyarakat membentuk Barisan Anti Narkoba Tanjungbalai (Bantai). “Saya sebagai ketua dewan pembina bersama tokoh agama dan masyarakat yang tergabung dalam Bantai akan bekerja keras memerangi narkoba,” tegas Thamrin. Disebutkannya, Bantai bakal adadiseluruhlapisanmasyarakat Tanjungbalai. “Kita komitmen mendukung keberadaan Bantai ini, sebab ini merupakan wujud bantuan tokoh agama dan masyarakat dalam memerangi narkoba di Kota Tanjungbalai,” jelas Thamrin. (a14)

Siswa MTsN R.Prapat Juara II Kompetisi Matematika Nasional Bilasiswanyameraihprestasi, maka nama sekolah pun turut harum, demikian juga nama daerahnya. Demikian pula dengan segenap civitas MTs Negeri Rantauprapat, boleh lah berbangga hati karena seorang siswanya, Dalila Ramadhanty Siregar, 14, berhasil meraih juara II pada Kompetisi Matematika Tingkat Nasional dan Expo (KMNE) di Bandung,JawaBarat,yangdigelar Kantor Kementerian Agama RI pada 25-29 Juni 2012 lalu. Dengan prestasi tersebut,

Dalila, yang merupakan siswa kelas IX Unggulan I MTsN Rantauprapat itu dikalungkan medali perakdanhanyakalaholehperaih medali emas dari Yogyakarta sebagai peraih juara I. Peserta KMNE itu sendiri berasal dari 32 provinsi se-Indonesia, minus Provinsi Maluku. Penuturan Kepala Sekolah MTsN R.Prapat Drs. H. Kamal Tanjung, MA didampingi Pengelola Kelas Unggulan Elvira Rahmaini, S.Pd dan Ketua Komite Sekolah H. Syarifuddin Tanjung


DALIA Ramadhanty Siregar (tiga dari kiri) diabadikan bersama Kasek dan Pengelola Kelas Unggulan MTsN R.Prapat Drs H Kamal Tanjung MA, Elvira Rahmaini S Pd (1 dan 2 dari kiri), Ibunda Dalila Lidiawati Hrp dan Ketua Komite Sekolah MTsN R. Prapat H Syarifuddin Tanjung.

kepada Waspada, Kamis (5/7) di ruang kerjanya, sejak masuk di MTsN R.Prapat, Dalila sudah menunjukkan kelebihan prestasinya dibanding teman-temannya, yaitu meraih peringkat I di kelas Unggulan. “Sejak semester I hingga semesterberikutnyasampaikepada kelas VIII, grafik prestasi Dalila terus menanjak, yakni tetap menempati rangking I di kelas dan rangking umum di sekolahnya,” ujar Kamal. Karena prestasinya itu, Dalila pun terpilih sebagai duta Kab. LabuhanbatupadalagaKompetisi Matematika Tingkat Provsu dan puncaknya meraih juara II sebagai utusan Sumut pada KMNE di Bandung tersebut. Ibunda Dalila, Lidiawati Hrp menambahkan, sejak SD, putrinyaituselalujuarakelasdang rangking umum di sekolahnya. Tetapipeningkatanprestasiterjadi ketika masuk di kelas unggulan MTsN R.Prapat. “Sejakmasukkelasunggulan, pola belajar Dalila semakin intensif, sudah bisa mengatur jadual belajar sendiri tanpa diarahkan orang tua. Kadang pola belajarnya terlalu ekstrem alias terlalu gilabelajar,tetapisayamensyukuri itu,”ucapLidiawatiyangmerupakan PNS di RSUD Rantauprapat. * Armansyah Abdi

RANTAUPRAPAT (Waspada): Dalam rangka pelaksanaan Operasi Patuh Toba 2012 yang sudah berlangsung sejak 4 Juli lalu, Satuan Lalulintas (Sat Lantas) Polres Labuhanbatu melakukan sosialisasi ke Kompi C 126/KC Rantauprapat, dirangkai penyerahan helm standar nasional (SNI), Kamis (5/7) di Aula Kompi C 126/KC. Sosialisasi pelaksanaan Operasi Toba 2012 itu dipimpin Kasat Lantas Polres Labuhanbatu AKP Faidil Zikri, S.Ik, SH sekaligus menyerahkan secara simbolis helm SNI kepada Komandan Kompi C 126/KC Kapten Inf Sofyan Sukri Nasution. Pada kesempatan itu Kasat Lantas AKP Faidil Zikri menyatakan, kunjungan ke Kompi C 126/KC dalam rangka kegiatan Operasi Patuh Toba 2012 yang digelar jajaran Polres Labuhanbatu dan saat ini sedang berlangsung. Selain itu, kunjungan juga merupakan sosialisasi pelaksanaan Operasi Patuh Toba. Sementara Komandan Kompi C 126/KC Kapten Inf. Sofyan Sukri Nasution mengatakan, kunjungan ini wujud kerjasama yang baik antara Kompi C 126/KC dan Sat Lantas Polres Labuhanbatu, dan perlu ditingkatkan. Dalam hal pelaksanaan Operasi Toba 2012, lanjut Kapten Inf Sofyan, jajaran Kompi C 126/KC yang merupakan Kompi terbaik tahun 2012 sejajaranYonif 126/KC sepenuhnya sangat mendukung kegiatan tersebut, dan telah diintruksikan kepada seluruh personil dan keluarga.(a17)

Wabup Labusel Buka Pameran Pembangunan 2012 KOTAPINANG (Waspada): Wakil Bupati Labuhanbatu Selatan (Labusel), Maslin Pulungan membuka Pameran Pembangunan 2012 menyemarakkan HUT ke-4 Kab. Labusel yang diperingati setiap 21 Juli, di lapangan MHB Kotapinang, Kamis (5/7). Dalam pidatonya, Wakil Bupati sempat menyentil keras pihak panitia karena pada saat pembukaan tidak ada gong, beduk, atau kentongan sebagai simbol untuk pembukaan, sehingga pameran dibuka dengan ketukan mikrofon. Selain itu, peserta yang hadir juga tidak begitu banyak, sementara lapangan sangat luas. “Ngapain digunakan lapangan seluas ini kalau yang hadir juga seperti ini,” katanya. Maslin berharap partisipasi aktif pihak swasta dan masyarakat, untuk menyukseskan pembangunan. Menurutnya, hingga empat tahun pemekaran, belum ada sepotong roti pun hasil karya masyarakat Labusel dengan merek Labusel. “Ini sangat memprihatinkan. Dan ini menjadi evaluasi bersama,” katanya. Menurutnya, kegiatan ini bertujuan mengajak masyarakatLabuselmensyukuriyangadasekarang dan untuk menemukan optimisme dalam diri masyarakat yang memiliki potensi dan dapat digali serta dioptimalkan. Pemkab berharap acara tersebut menjadi sajian inovatif yang unik dan

memberikan inspiratif, dan menjadi acara yang dirindukan masyarakat Labusel. Asisten II Pemkab Labusel, Syafruddin Nasution yang juga panitia kegiatan mengatakan, pameran diikuti 52 peserta terdiri dari 33 stand SKPD, 8 stand dari perusahaan swasta, 5 stand perbankan, 4 stand wira usaha, dan 2 stand dari organisasi kepemudaan. Menurutnya, pada HUT kali ini Pemkab menggelar berbagai kegiatan baik yang sudah berlangsung maupun yang akan berlangsung. Dijelaskan, pameran berlangsung lima hari dan akan ditutup dengan kegiatan Semarak HUT ke4 Kab. Labusel, Selasa, 10 Juli mendatang. “Puncak peringatan akan dilakukan 10 Juli,” katanya. Sementara pada 21 Juni mendatang, akan digelar Paripurna Istimewa Peringatan HUT Pemkab Labusel. Syafruddin mengatakan, dengan kegiatan ini diharapkan masyarakat dapat merasakan makna pemekaran yang telah dilakukan. “Ini adalah pesta rakyat,” katanya. Usai membuka kegiatan, Wakil Bupati melakukankunjunganke standpameranbersama SekdaRusmanSyahnan,tokohpemekaran,jajaran eselon dua Pemkab Labusel, Kapolsekta Kotapinang Kompol. J Panjaitan, perwakilan perusahaan swasta/BUMN, tokoh pemuda, tokoh masyarakat, dan lainnya.(c18)

Tanjungbalai Junjung Tinggi Budaya Melayu TANJUNGBALAI (Waspada): Wali Kota Tengku H.Yose Rizal. Seusai dilantik, Delima Thamrin Munthe mengatakan, sejak dulu, mengimbau agar seluruhtuandanpuanpengurus Tanjungbalai terkenal menjunjung tinggi tradisi, MABMIuntukbekerjasamamenjaga,melestarikan danmembesarkanadatbudayamelayu.“Sementara, adat dan budaya melayu. “Mulai tata cara pernikahan, penyambutan sambutantertulisKetuaUmumPBMABMISumut kelahiran bayi hingga kegiatan seremonial lainnya, Dato’ Sri Lelawangsa Syamsul Arifin SE dibacakan warga Tanjungbalai khususnya yang muslim, Ketua HarianTengku H.Yose Rizal SE, diharap PD senantiasa menggunakan adat dan tradisi melayu,” MABMI Tanjungbalai serius melaksanakan prokataThamrin,saatpelantikanpengurusPDMABMI gramkerjadanmelaksanakankonsolidasiorganisasi. “PengurusdanseluruhjajaranPBMABMIyang Kota Tanjungbalai periode 2012-2016 di RM barudilantikhendaknyabahumembahudanbekerja Bahagia, Tanjungbalai Rabu (4/7) malam. Olehsebabitu,kataThamrin,inimembuktikan sama dalammelaksanakanseluruhprogramkerja,” masyarakatTanjungbalai tidak bisa lepas dan tetap himbaunya. Kepengurusan MABMITanjungbalai menjunjung tinggi kebesaran melayu. “Maka itu, dipimpin Ketua Hj.Delima, sekretaris Firyadi dan keberadaan MABMI di kota ini semoga tetap Bendahara Raja Habsah. (a14) dipertahankan sekaligus menggiatkan kegiatan dalam membesarkanbudayamelayu. MABMI harus mampu melakukan terobosan dan inovasi baru serta menjadikan adat dan budaya melayu sebagai ciri khas Kota Tanjungbalai,” imbau Thamrin. Dia juga menuturkan, melayu merupakan rumpun suku yang menyebar di sepanjang garis pantai penjuru dunia. Dan, lanjut dia, melayu memiliki adat, bahasa serta tradisi bernilai luhur. Pelantikan Ketua PD MABMI Tanjungbalai Hj. Waspada/Rahmad F Siregar Delima,SPd,MM beserta KETUA Harian PB MABMI Sumut Tengku H.Yose Rizal melantik pengurus,dipimpinolehKetua Hj.Delima SPd,MM menjadi Ketua PD MABMI Kota Tanjungbalai Harian PB MABMI Sumut periode 2012-2016.

Disperindagkop UKM Labusel Telah Salurkan Rp700 Juta KOTAPINANG (Waspada): Dinas Perindustrian, Perdagangan, Koperasi, UKM (Disperindagkop - UKM) Pemkab Labusel telah menyalurkan kredit pengembangan Usaha Menengah,Menengah,danMikro(UMKM)Rp700 juta pada 2011 lalu. Tahun ini dana bantuan ditingkatkan menjadi Rp900 juta. Kadisperindagkop - UKM Pemkab Labusel, Ahmad Fuad, Kamis (5/7) mengatakan, pertumbuhanpenyalurankredityangcukupbagus inimelihattingkatpengembaliankreditdaripeserta yang cukup baik. “Seluruh dana yang kita gulirkan 2011 lalu sebagian besar sudah dikembalikan,” katanya. Dijelaskan, pada 2010 lalu sistim penyaluran dana tersebut diberikan kepada usaha perorangan,

namun kurang efisien karena pengembalian pinjaman tidak berjalan maksimal. Pada 2012 sistem itu diubah sehingga penerima bantuan adalah kelompok UMKM yang di dalamnya terdiri dari sejumlah kelompok usaha masyarakat. Dijelaskan,besarbantuanyangdiberikanuntuk satu unit usaha dalam satu kelompok yakni Rp10 juta hingga Rp20 juta. Pengembalian dana pinjaman tidak dikenakan bunga sama sekali. “Setelah kita evaluasi ternyata dampaknya bagus. Banyak usaha masyarakat seperti kios meningkat dengan adanya suntikan modal tersebut. Kita berharap agar pelaku usaha tepat waktu mengembalikannya sehingga dananya dapat kita gulirkandanbesarannyaterusdapatditingkatkan,” katanya. (c18)

Sumatera Utara

WASPADA Sabtu 7 Juli 2012


Pemkab Palas Usulkan Pergantian Sekda SIBUHUAN (Waspada): Bupati Padanglawas (Palas) H. Ali Sutan Harahap (TSO) mengungkapkan, Pemkab telah mengusulkan pergantian Sekda kepada Gubsu yang ditembuskan kepada Mendagri. “Dalam waktu dekat, saya akan mengkordinasikan hal ini kepada pemerintah atasan,” ujar Plt Bupati Palas kepada Waspada, kemarin. TSO menjelaskan, selama dia menjalankan tugas sebagai Plt Bupati, Sekda tidak pernah berkordinasi dengannya. “Sekda hanya menjalankan tugas administrasi dan memaraf surat.” Dijelaskannya, terakhir dia memberikan tugas kepada Sekda mengikuti rapat Sekda se-Sumut, namun rapat tersebut tidak bisa diikutinya karena Sekda tiba-tiba

sakit. Sementara panggilan dari TipikorsampaikepadaSekdaJumat (22/6) lalu. Kemudian, Sekda menerimasendiripanggi-lankedua sebagaitersangkapengadaanmobil fiktif pada Rabu (27/6). “Semoga Pak Sekda segera sembuh agar dapat memberikan keteranganmengenaipengadaan mobil tersebut,” ujar Bupati Sedangkan kelancaran administrasi pemerintahan tetap berjalan dan tidak terkendala meski Sekda Padanglawas (Palas) Drs. Gusnar Hasibuan ditetapkan sebagai tersangka dugaan korup-

Pembentukan BPA Madina Dipertanyakan PANYABUNGAN (Waspada): Pembentukan Pengurus Badan Pemangku Adat (BPA) Kab. Mandailing Natal (Madina) menjadi bahan perbincangan di kalangan pemangku adat atau harajaon di daerah itu. Pasalnya, pembentukan pengurus baru tersebut dinilai tidak sesuai prosedur yang sudah diatur di dalam AD/ADRT yang ada, bahkanpemilihanpengurusBPAdikatakanhanyamelibatkansebagian harajaon terdapat di kabupaten ini, sementara sebagian lagi dikesampingkan sehingga berpotensi menjadi polemik baru di sana. Hasanul Arifin Nasution, S.Sos dengan gelar Patuan Mandailing selaku Harajaon Hutasiantar (sekarang Kotasiantar) Kec. Panyabungan mengaku, sangat terkejut setelah mengetahui dibentuknya sekaligus dikukuhkannya pengurus baru BPA Madina. Sekalipun di dalam kepengurusan baru BPA Madina terdapat unsur yang dapat disebut sebagai utusan Harajaon Hutasiantar, pihaknya tidak pernah menerima surat permohonan atau pemberhentian tentang itu. “Jangankan mengeluarkan surat berupa rekomendasi formal penunjukan utusan BPA Madina, harajaon Hutasiantar pun sejauh ini belum menggelar sidang adat untuk mengevaluasi kinerja utusan sebelumnya dan penunjukan utusan yang akan diangkat untuk menduduki periode yang baru, saya merasa ada kesalah pahaman di sini,” katanya kepada wartawan, baru-baru ini. Ia menjelaskan, BPA boleh jadi mitra Pemkab Madina, apalagi tugassehari-harinyaadalahmemberikanmasukanterutamaberkaitan dengan kebudayaan kepada pemerintah daerah. “Namun, saya rasa tujuan itu akan kabur manakala cara-cara yang kita gunakan untuk menopang berdirinya BPA itu tidak sesuai dengan aturan main organisasi adat itu sendiri,” tambahnya. (a28)

Tiga Perwira Polres Tapsel Sertijab P. SIDIMPUAN (Waspada): Tiga perwira Polres Tapsel serah terima jabatan dalam suatu acara di Aula Mapolres, Jalan SM Raja, Padangsidimpuan, baru-baru ini. Tiga perwira menerima jabatan baru itu, AKP Siswandi SH, Sik sebagai Kasat Lantas menggantikan AKP SLWidodo SE, Kasat Intelkam AKP Romanus Sihotang sebelumnya dijabat oleh AKP Jauhari Lumbantoruan dan Kapolsek Batangtoru AKP Idris, sebelumnya AKP M Gunawan Pane. Kapolres AKBP Subandriya SH MH dihadapan sejumlah perwira setingkat Kapolsek, Kasat dan personel saat gelar Sertijab mengungkapkan, pergantian jabatan adalah hal wajar, sehingga jabatan yang baru kita pegang harus dapat dikreasikan untuk menunjang tugas melindungi masyarakat. ‘’Saya meminta kepada personil Polres Tapsel lebih mampu memeliharacitra Polri sebagai pelindung, pengayom dan memberikan pelayanan prima terhadap masyarakat,’’ ujar Kapolres. Sertijab dihadiri Wakapolres Zainuddin SAg, sejumlah Kabag, Kasat, Kapolsek serta Ibu-ibu pengurus Bhayangkari dan sejumlah personil Polres Tapsel. (c13)


KAPOLRES Tapsel, AKBP Subandriya SH MH menyematkan tanda pangkat ke Kapolsek dan Kasat yang baru di jajarannya saat serah terima jabatan di Aula Mapolres Tapsel, Jalan SM Raja, Padangsidimpuan.

Pencuri Dihajar Massa PEMATANGSIANTAR (Waspada): Seorang pria, Ta, 44, warga Jalan Rakutta Sembiring, Kel. Nagapita, Kec. Siantar Martoba, Kota Pematangsiantar diduga mencuri uang penjual nasi Rp 902.000. Akibatnya,Ta menjadi bulan-bulanan dan babak belur dihajar massa. Pencurian uang penjual nasi itu diduga dilakukan Ta terhadap korban Kiki, 45, di rumah makan milik korban di Jalan Akasia Raya, Perumnas Batu Enam, Kec. Siantar, Kab. Simalungun Rabu (4/7) pukul 16:30. Informasi dihimpun Waspada, Ta melakukan pencurian itu ketika hendak membeli nasi bungkus ke rumah makan korban. Saat itu, korban sedang duduk di samping warung sehingga Ta menggunakan kesempatan itu membuka laci uang milik korban dan mengambil dari dalamnya Rp 902.000. Sesudah mengambil uang itu, Ta segera melarikan diri Namun,korbanyangsempatmelihatperbuatanTasegeraberteriak, sehingga mengundang warga berdatangan dan segera mengejar Ta. Sesudah dikejar-kejar, Ta akhirnya berhasil ditangkap. Sejumlah warga secara bersamaan melayangkan bogem ke wajah dan tubuh Ta. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean, Kasat Reskrim AKP M.AdenanAS,SH,S.Ik,MHdanKapolsekBangunAKPHitlerSihombing, Kamis (5/7) menyebutkan,Ta masih dalam proses pemeriksaan. (a30)

Muhammadiyah P. Siantar Gelar Tabligh Akbar PEMATANGSIANTAR (Waspada): Majelis Tabligh, Tarjih dan Tajdid PD Muhammadiyah Kota Pematangsiantar akan menggelar Tabligh Akbar dalam menyambut bulan suci Ramadhan, bersamaan dengan Milad Aisyiyah ke-99 di aula Masjid Taqwa, Jalan Merdeka, Minggu (8/7) mulai pukul 09:00. Ketua Majelis Tabligh, Tarjih dan Tajdid PD Muhammadiyah Ahmad Fitrianto didampingi Sekretaris Fakhrudin Sagala, S.Pd.I menyebutkan, penceramah dalam Tabligh Akbar itu dua ustadz yakni Ustadz Irwansyah Putra dan Ustadz Maulana Siregar. Ustadz Irwansyah Putra MA yang merupakan Wakil Sekretaris PW Muhammadiyah Sumut akan menyampaikan ceramahnya dengan judul “Penentuan awal dan akhir Ramadhan melalui Hisab” dan Ustadz Maulana Siregar, MA yang merupakanWakil Ketua Majelis Tarjih danTajdid PW Muammadiyah Sumut menyampaikan ceramah dengan judul “Fiqih Ramadhan.” Ketua Majelis Pustaka dan Informasi Zulhanif Al menambahkan, pemberitaan melalui suratkabar merupakan undangan resmi kepada seluruh unsur pimpinan daerah, cabang dan ranting Muhammadiyah, Aisyiyah dan Orto, majelis, lembaga, anggota dan simpatisan Muhammadiyah serta masyarakat umum untuk menghadiri Tabligh Akbar dan Milad ke-98 Aisyiyah ke-98. (a30)

si pengadaan mobil fiktif senilai Rp1 miliar oleh Subdit II/Tipikor Dit. Reskrimsus Polda Sumut. Sejumlah kepala bagian di sekretariat kantor Bupati Padanglawasyangdijumpai Waspada, mengatakan, administrasi pemeritahan tetap berjalan dengan semestinya, apalagi sejak H. Ali Sutan Harahap diangkat sebagai Plt Bupati Padanglawas, Sekda tidak lagi benar-benar aktif menjalankan tugas. Staf Ahli Bupati Bidang Pertanahan Khoiruddin dan Staf Ahli BidangPerencanaandanSumber Daya Alam Irfan Soaduon Hasibuan tetap melaksanakan

rutinitas kerja. Kemudian, ketiga Asisten yakni Asisten Bidang Pemerihan, Asisten Ekbang dan Asisten Administrasi dan Umum juga tetap melakukan tugas masing-masing. HalinidibenarkanKabagTata Pemerintahan, Gunung Tua Hamonangan.Katanya,ketidakhadiran Sekda tidak berpengaruh terhadap bagian pemerintahan. Hanya saja, kata Kasubbag Protokoler Ali Anda Lubis, akibat Sekda yang sudah dua minggu tidak masuk kantor, menyebabkan gaji PNS yang berkantor di sekretariat kantor bupati tersebut baru terbayarkan hari ini, setalah ben-

dahara berangkat ke Medan menjumpi Sekda. “Karena Sekda sebagaikuasapenggunaanggaran (KPA) tidak masuk, gaji PNS di sekretariat baru terbayarkan hari ini,” ujar Ali Anda. Menurut pendapat sejumlah pimpinan SKPD, ketidakaktifan Sekdapascapernyataannyabeberapa waktu lalu yang menyebutkan, bila TSO diangkat menjadi Plt Bupati Palas, seluruh eselon II dan III akan mengundurkan diri dan hal ini tidak benar, karena hingga kini tak seorang pun pimpinan SKPD maupun bagian yang mengundurkan diri, termasuk dirinya sendiri. (a34)

Lagi, Mobil Terbalik Menuju Parapat PARAPAT(Waspada): Kecelakaan lalulintas (Lakalantas) kembali terjadi di ruas jalan menuju Parapat. Satu unit mobil L 300 BK 1355 terbalik ke sisi jalan dengan kondisi roda di atas, kemarin, yang mengakibatkan dua penumpang cedera serius. Informasi dihimpun Waspada di lokasi, Jumat (6/7), peristiwa naas ini terjadi di Dolokmarimbun, Kec. Tigadolok, Kab. Simalungun.Saatitu,L300denganempat penumpang meluncur dari Pematangsiantar menuju Parapat. Benturan keras saat mobil bergulingmengakibatkankorban terluka. Salah satu korban, Lusi br. Silalahi, 46, warga Tuktuk, Samosir mengalami luka robek

di kening dan harus mendapatkan jahitan, sedangkan Mesilawati,42,wargaSiantarmengalami sesak nafas setelah dadanya terbentur jok mobil. Kedua korban kini dalam perawatanintensifdirumahsakit. Sedangkan dua penumpang lainnya beserta sopir, hanya mengalami luka ringan. Menurut korban, kendaraan berangkat dari Pematangsiantar menuju Parapat. Mereka hendak berjualan. Selama dalam perjalanan, laju mobil tidak kencang. Tapi saat di Dolokmarimbun, mobil yang mereka ditumpangi tiba-tiba oleng dan terbalik. Salah seorang penumpang menuturkan, mobil terbalik

karena patah as. Peristiwa lakalantas ini sudah ditangani kepolisian setempat dan mobil telah diamankan. Peristiwa lakalantas terjadi ketiga kalinya dalam seminggu ini.Sebelumnya di Sibaganding menewaskan delapan jiwa penumpang, Tele-Pangururan mengakibatkan dua orang meninggal dan di Aeknauli terjadi lakalantas tidak ada korban jiwa. Salah seorang warga Parapat mengungkapkan, ini seharusnya menjadi PR bagi banyak pihak mengingat masih lemahnya pengamanan lalu lintas (ramburambu) bagi pengendara terutama di ruas lintas yang tidak aman dan berbahaya. (crn)

Alokasikan Anggaran Memadai Perbaiki Jalan Rusak PANYABUNGAN(Waspada): Pemprovsu dan Pemkab Madina diminta mengalokasikan anggaran lebih memadai untuk mengatasi problem jalan rusak di sejumlah kawasan Kab. Mandailing Natal. Menurut pengamatan Waspada, Jumat (6/7), buruknya insfrastruktur jalan masih merupakan salah satu persoalan cukup menonjol dihadapi masyarakat di Madina. Aksesjalankabupatenyangtidak nyamandipergunakanwargayakni jalanmenujukecamatanPakantan, PanyabunganTimur, Sibinail Kec. Muarasipongi, tujuh desa di Rura AekSingengu,AekMariandanGunungtuaKec.Kotanopan,Rao-rao Panjaringan Kec. Tambangan, Hutabaringin Julu Kec. Puncak Sorik Marapi. Kondisijalanrusakdanmem-

prihatinkan, juga ditemukan menuju berbagai desa di wilayah Pantai Barat Madina, khususnya jalan menghubungkan Kec. Natal dengan Sinunukan dan Batahan yanghinggakinimasihbelumbisa dicarikan pemerintah daerah solusinya agar kerusakan badan jalantidaklagimenjadipenderitaan berkepanjanganbagimasyarakat. Tapi yang jelas, akibat buruknya insfrastruktur jalan ke berbagai kecamatan dan desa di kabupaten ini, telah menyebabkan tingkat perekonomian warga sulit berkembang. Artinya, karena belum optimal akses jalan ke sebahagian besar desa, menjadi kendala utamamasyarakatuntuk bebas dari belenggu kemiskinan. Seperti halnya jalan menghubungkanKecamatanSinunukanBatahan, meski sudah belasan tahun berjalan atau sejak Madina

dipisahkan dari induknya Tapsel, kerusakan badan jalan menuju kawasan itu tampaknya belum juga dapat dituntaskan pemerintah perbaikannya. Pemkab Madina sudah sepantasnya memikirkan adanya dukungananggaranyangmemadai setiap tahun, sehingga dalam beberapa tahun ke depan problema buruknya insfrastruktur jalan di daerah ini dapat teratasi. Prasarana jalan sangat penting dalam mendorong ekonomi jangka panjang yang berkeadilan dan berkelanjutan. “ Tanpa dibangunnya prasarana jalan, upaya peningkatan sosial secara berimbangdanpertumbuhanekonomi yang tinggi tidak akan mampu memberikankesejahtraankepada masyarakat Madina ,” pinta Ahmad Efendi Lubis, salah satu tokoh pemuda setempat. (a28)

Saksi Kunci: Terdakwa Pemalsuan Dokumen Dizolimi P. SIDIMPUAN (Waspada): Dugaan manipulasi hukum pada perkara pemalsuan dokumen kayu di areal Izin Pemanfaatan Kayu (IPK) PT. Panai Lika Sejahtera (PLS), Kec. Angkola Selatan, Kab. Tapanuli Selatan, semakin terkuak di tiap persidangan yang digelar Pengadilan Negeri Padangsidimpuan. Pada persidangan perkara No: 201/Pid.B/2012/PN.Psp atas nama terdakwa HJ, Selasa (3/7) kemarin, saksi kunci Tom Sihar Silaen menyatakan, terdakwa HJ sebenarnyatelahdizolimi.Karena para saksi pelapor, Budianto dan Prianto, tidak pernah dikenal dalam pengurusan kayu IPK PT. PLS. “Memang benar Budianto alias Aseng Naga dan Prianto merupakan komisaris dan direktur utama PT.PLS. Tapi mereka tidak berhak atas kayu-kayu stok opnam di IPK PT. PLS, karena sebelumnyasudahadaperjanjian bersama yang menyatakan kayu itu milik terdakwa HJ,” kata

mantan Kuasa Direktur PT. PLS ini. Ditegaskannya, terdakwa HJ lah pemilik kayu-kayu hasil produksi IPK PT.PLS yang sebelum ini dijalankan Tomsihar Sihar Silaen. Hal itu dibuktikan dengan semua operasional pengurusn IPK dan operasional produksi, seluruhnya dibiayai HJ. Bahkan HJ jugalah yang membayar semua pajak PSDH-DR kayu itu ke negara. Terdakwa HJ melakukan itu karena sudah ada Perjanjian No. 361 tahun 2008 dengan Budianto dan Prianto. Tapi setelah semuanya hampir rampung, tiba-tiba Budianto dan Prianto mencoba mengambil alih usaha itu dengan membatalkan perjanjian secara sepihak. Bahkan kuasa direktur PT. PLS ke Tom Sihar Silaen juga dicabut mereka. “Benar Pak Hakim, yang membiayai seluruh pengurusn izin-izin IPK PT.PLS, biaya produksi, dan pajak ke negara adalah uang milik terdakwa HJ, bukan

Budianto ataupun Prianto. Terdakwa membayarnya karena sudah ada perjanjian yang intinya HJ dibebankan biaya seluruh kegiatan maupun izin serta pajak negara atas izin IPK PT. PLS,” jelasnya. Pada persidangan dengan majelis hakim diketuai Faisal SH.MH, pensehat hukum terdakwa, Irvan Hakim Harahap dari Kantor Hukum Marwan Rangkuti dan Rekan, menambahkan, bukti lain yang menyatakan bahwa klaim Budianto ataupun Prianto tas kepemilikan kayu di IPK PT. PLS itu adalah bohong. Kemudian mantan Kadis Kehutanan Tapsel, Ir Syahgiman Siregar, dalam kesaksian di persidangan itu juga menyatakan bahwa bahwa selama kegiatan produksi IPK PT.PLS tidak pernah mengenal Budianto ataupun Prianto, kecuali hanya Tomsihar Silaen dan HJ. Katanya, selama inipun negara menagih pajak kayu di IPK PT. PLS hanya kepada HJ. (a27)

Kompolnas Sikapi Kinerja Polri SIBUHUAN (Waspada): Plt Bupati Padanglawas H. Ali Sutan Harahap (TSO) mengatakan Komisi Kepolisian Nasional (kompolnas)yangberkedudukan di bawah presiden dibentuk untuk menyikapi kinerja Polri. “Kompolnas merupakan salah satu jalan keluar terbaik dalam menyikapi ulah oknum kepolisian yangmenyimpangdari aturan,” ujar TSO dalam acara

syukuran atas terpilihnya warga PalasDrsEdiSyahputraHasibuan sebagai anggota Kompolnas, di Sibuhuan, Rabu (4/7). Salah satu fungsi dari Kompolnas adalah sebagai pengawas fungsional kinerja Polri untuk menjamin profesianalisme dan kemandirian Polri. “Hal ini tentu sejalan dengan harapan masyarakat yang menginginkan pelayananterbaikdariaparatKepolisian,”

Waspada/Syarif Ali Usman

ANGGOTA Kompolnas Drs Edi Syahputra Hasibuan bersama Plt Bupati Padanglawas dan Ketua DPRD Palas HM Ridho Harahap dalam acara syukuran dilaksanakan di halaman Perguruan Abdi Utama Sibuhuan.

terang TSO. Kompolnas juga berwenang menerima saran dan keluhan masyarakat, hal ini menyangkut penyalahgunaan wewenang, dugaankorupsi,pelayananburuk, perlakuan diskriminasi dan penggunaan diskresi yang keliru. Kepada Edi Syahputra, Bupati berpesan agar menjalankan tugas dengan baik sesuai peran danfungsinya,mengabdilahdemi kemajuan seluruh rakyat Indonesia. Khusus kepada daerah Palas, Bupati berharap agar Edi Syaputra dapat mengukir nama baik daerah di tingkat nasional. Anggota Kompolnas Edi Syahputra Hasibuan dalam kesempatanitu mengatakanakan menindaklanjutiharapanmasyarakat yang berharap agar adanya Polres Palas. Menurutnya, di daerah Palas memang sudah sangat membutuhkan adanya Polres. Hadir dalam kesempatan Tokoh Pemekaran Padanglawas H. Marahadi Hasibuan, Ketua DPRD Palas HM Rido Harahap, mewakili Kapolres Tapsel, mewakili Dandim 021/ TS, para anggota dewan, Pimpinan SKPD Pemkab Palas dan ratusan warga. (a34)

Waspada/Sukri Falah Harahap

PLT Gubsu H. Gatot Pujo Nugroho bersama undangan, pengurus Pujakesuma Sumut, serta pengurus Pujakesuma Padangsidimpuan dan Tapsel yang baru dilantik di aula MAN 2 Padangsidimpuan.

Plt. Gubsu: Padukan Filosopi Masyarakat Batak Dan Jawa P. SIDIMPUAN (Waspada): Plt. Gubernur Sumatera Utara, H Gatot Pujo Nugroho ST, menyebut setiap suku itu memiliki kearifan tersendiri dalam menjalani kehidupan. Biasanya, kearifan itu tercermin dalam filosopi-filosopi yang diturunkan leluhur. Masyarakat Batak memiliki filosopi Dalihan Na Tolu yang tediri dari unsur mora (saudara sedarah dari istri atau ibu), kahanggi (saudara sedarah kita), dan anakboru (saudara perempuan sedarah kita atau pihak suaminya). Tiga unsur ini menjadi tonggak utama dalam kehidupan dan tidak boleh pincang. Masyarakat Jawa memiliki filosofi ing ngarso sung tulodo (di depan memberi contoh), ing madyo mangun karso (di tengah memberi semangat), tut wuri handayani (di belakang memberi dorongan”). Semboyan ini diciptakan Ki Hajar Dewantara dan masih dipakai dalam dunia pendidikan kita. “Rakyat Sumut terdiri dari berbagi suku. Masyarakat Jawa di wilayah Tapanuli, saya minta bijak dan mampu mengkolaborasikan filosopi

masyarakat Batak dan Jawa ini dalam kehidupan sehari-hari. Jika itu terjadi, maka dijamin Sumut akan sejahtera dan pelayanan pemerintahan akan lebih baik,” pintanya. Permintaan itu disampaikan Plt. Gubsu pada pelantikan DPD Paguyuban Kelargan Besar (PKB) PujakesumaKotaPadangsidimpuandanDPDPKB Pujakesuma Kabupaten Tapanuli Selatan di aula MAN 2 Padangsidimpuan, Selasa (3/7) malam. Hadir Ketua DPW PKB Pujakesuma Sumut Kol Inf Ahwan Ismadi, Sekretaris Sulasno Sumarto, Dewan Pakar Prof. Sri Sulistiawati, Majelis Pertimbangan AKBP H Rusbandi, Kadisbun Sumut Aspan Sopian Batubara, Kadistan Sumut Muhammad Room, Kadisdik Sumut Syaiful Syafri, Sekda Kota Sidimpuan Sarmadhan Hasibuan, Ketua DPRD Kota Sidimpuan Azwar Syamsi, Pengurus DPD PKB Pujakesuma Kota Padangsidimpuan yang dilantik antara lain, Ketua Suharsono SPd, Sekretaris Gendut Alcarno, Bendahara Ahmad Nancy. DPD PKB Pujakesuma Tapsel, Ketua Drs. Yamin, Sekretaris Nasib, dan Bendahara Sari Gunawan. (a27)

Plt. Gubsu Manortor Di Paluta, Serahkan Tunjangan Profesi Guru GUNUNGTUA (Waspada): Pelaksana Tugas (Plt) Gubernur Sumatera Utara ( Gubsu) H Gatot PujoNugrohoSTmanortordalamkunjungankerja di Padanglawas Utara (Paluta), Rabu (4/7). Plt Gubsu menyerahkan secara simbolik tunjangan profesi, fungsional dan kualifikasi bagi 22 perwakilan guru mulai tingkat SD sampai SMA se-Paluta, saat acara silaturahmi dan kunjungan kerjadiKab.PadanglawasUtaradiAulaSerbaguna kantor Bupati, Jalan Lintas GunungtuaPadangsidimpuan, Kec. Padangbolak. Penyerahan secara simbolik kepada perwakilan guru tersebut disaksikan Bupati Padanglawas Utara, Drs H Bachrum Harahap, Ketua DPRD Paluta Muchlis Harahap, Muspida Plus Paluta, Kepala Dinas Pendidikan Sumut Syaiful Syafri, Kadis Infokom Sumut Dr H Asren Nasution MA dan sejumlah pejabat di lingkungan Pemprovsu yang ikut mendampingi Plt Gubsu di Paluta.

Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho ST manortor ria adat Tapanuli Selatan bersama para Naposo Nauli Bulung (NNB) usai acara sebagai tari persembahan dan penghormatan dari Naposo Nauli Bulung Kab. Padanglawas Utara atas kehadiran H Gatot Pujo Nugroho yang merupakan orang nomor satu di lingkungan Pemerintah Sumatera Utara. Plt Gubsu yang saat itu memakai baju safari berlengan panjang terlihat begitu bersemangat manortor yang turut serta diikuti Bupati Padanglawas Utara Drs H Bachrum Harahap didampingipejabatlainnyabaikdariPalutamaupun dari Pemprovsu. Tak tanggung-tanggung, Plt Gubsu juga menyumbang uang kepada Naposo Nauli Bulung yang mendampinginya. Ribuan Guru dan undangan lainnya dari berbagai kalangan yang hadir dalam acara tersebut terlihat terkesima menyaksikan sang pemimpinnya manortor. (a35)

Bupati Dairi Lantik 144 Pejabat

Kesombongan Awal Kehancuran SIDIKALANG (Waspada):Kesombongan adalah jalan to l menuju kehancuran. Kalau mau sukses hindarkan kesombongan. Demikian Bupati Dairi KRA Johnny Sitohang Adinegoro, saat melantik 144 orang pejabat struktural dan pejabat fungsional, di hadapan unsur Muspida di Balai Budaya Sidikalang, Jumat (6/7). Johnny mengimbau kepada para pejabat yang baru dilantik,agar menjauhi sifat arogansi dan kesombongan kalau ingin sukses dalam segala aktifitas, terutama saat melayani masyarakat. “Pejabat bukan untuk dilayani,tetapi harus menjadi pelayan.” Dikatakan, pelajar dari Dairi,sering menjadi duta Provinsi Sumatera Utara untuk mengikuti lomba olimpiade ke tingkat nasional. Hal itu

memang membanggakan.Tetapi yang paling di inginkan, semua pelajar di Dairi pintar.Untuk apa satu orang pintar, tetapi selainnya bodoh. “Kita bangga, pelajar Dairi sering duta Sumut.Tetapi lebih membanggakan lagi, kalau semua anak didik Dairi pintar, rata-rata poin delapan,” ujarnya. Sektor pendidikan, salah satu pilar pembangunan Pemkab Dairi. Semua guru (pejabat fungsional),harus lebih gigih dalam mentransfer ilmukepadaanakdidikagarmenjadipintar.”Orang pintar, kemana saja pun pergi pasti kenyang.Tidak ada orang pintar kelaparan,” sebutnya. Pejabat yang dilantik tersebut, terdapat beberapa di antaranya menduduki jabatan eselon II, III dan IV.Seperti Kadis Pendidikan, PUCipta Karya, Perindagkop dan lainnya. (a20)

Meningkatkan Goleklemah Program Utama Pujakesuma P. SIDIMPUAN (Waspada): Masih banyaknya putra/i Jawa kelahiran Sumatera (Pujakesuma) kurang beruntung, sehingga program utama kedepanmeningkatkangolonganekonomilemah (Goleklemah). ”Program utama pengurus Pujakesuma untuk meningkatkan taraf hidup golongan ekonomilemah(Goleklemah)khususnyaanggota Pujakesuma,’’ujarKetuaDPWTkISumut,Kolonel Inf Ahwan Ismadi Spdi MH didampingi Wakil ketuaMajelisPimpinanOrganisasi(MPO)wilayah dan penasehat Pujakesuma Kota Padangsidimpuan, H Ilham Suhardi SH MH, Sekjen DPW, Sulasno Sumarno, Bendahara, Samsul Bahri serta anggota lainnya di Aula Hotel Jalan SM Raja, Kota Padangsidimpuan, Rabu (4/7). Kolonel Ahwan melihat kondisi warga

Pujakesuma yang ada di Sumatera Utara (Sumut) masih banyak di garis kemiskinan, apalagi yang berada di pesisir pantai timur. Pernyataan Kolonel yang bertugas di Kodam I Bukit Barisan itu disampaikan kepada wartawan usai melantik pengurus DPD Kota Padangsidimpuan dan Tapsel Priode 2012-2017 digelar di Aula MAN 2, Selasa (3/7) malam. Kolonel Ahwan juga menegaskan Paguyuban Pujakesuma dalam Pemilihan kepala daerah (Pemilukada/Pemilu) tidak ada mendudukung salah satu calon, sikap Pujakesuma netral. YangdilantikantaralainKetuaDPDPujakesuma Kota Padangsidimpuan Suharsono Spd, Sekretaris Gendut Alcarno beserta 107 pengurus dan Ketua Tapsel,DrsYahminSekretarisnya,DrsNasibdengan puluhan pengurus lainnya. (c13)

Karang Taruna Harus Jadi Pelopor Pembangunan SIBUHUAN (Waspada): Karang taruna Padanglawas ke depan harus mampu menjadi pelopor pembangunan demi meningkatkan taraf hidup masyarakat Kab. Padanglawas (Palas). Demikian Ketua Karang Taruna Provsu, H. Solahuddin Nasution, SE diwakili Hoiruddin Pandapotan dalam Temu Karya Pertama Karang Taruna Kab. Palas di Sibuhuan, Kamis (5/7). Dikatakannya, Karang Taruna merupakan wadah pemuda kreatif, produktif dan aktif dalam kegiatan pembangunan sosial kemasyarakatan, sehingga mampu mengangkat harkat dan taraf hidup masyarakat Untuk itu, diharap agar pengurus Karang Taruna, baik di tingkat kabupaten maupun di kecamatan harus mampu mengembangkan KarangTaruna dalam berperan aktif dalam proses dan pelaksanaan pembangunan sosial ekonomi

masyarakat. Plt Bupati Padanglawas H. Ali Sutan Harahap diwakili Asisten II Samsul Bahri Batubara didampingi Kabid Pemuda Drs. Ali Aceh mengharapkan, dengan Temu Karya I Karang Taruna Kabupaten Padanglawas ini ke depan mampu membantu meningkatkan taraf hidup masyarakat. Ir. H. Lukman Nasution, tokoh masyarakat mengharapkan, melalui Temu Karya Karang Taruna bisa menentukan sikap dalam memajukan Karang Taruna di Palas. Ketua DPRD Palas, HM. Rido Harahap juga sangat berharap agar program Karang Taruna bisa berjalan baik sebagai mitra pemerintah, dan sebagai pelopor pemuda produktif. Untuk itu diharap jangan ikut berpolitik, harus independen, demi memajukan perekonomian masyarakat.(a33)



Tim Pusat Rawa Tripa Di Udara

Menunggak, PLN Putus Lampu Jalan Kota Sigli SIGLI (Waspada) : PT PLN Wilayah Sigli memutus lampu penerangan di Jalan Lingkar Kota Sigli, Kabupaten Pidie. Akibatnya, kawasan yang biasanya diterangi lampu jalan itu gelap gulita saat malam hari. Manager PT PLN Sigli Taufik Hidayat mengatakan, pemutusan merupakan upaya terakhir pihaknya karena terhitung sejak Februari hingga Juni, tagihan lampu untuk fasilitas umum itu belum dibayar Pemkab Pidie. “Kami sudah ke bagian umum, tapi kata mereka untuk untuk lampu jalan kawasan ini belum ada anggaran karena belum masuk dalam data,” kata Taufik Hidayat didampingi staf pelayanan Sulaiman, Jumat (6/7). Sebelumnya, kata Taufik, pihaknya sempat menanyakan perihal tagihan ke Dinas Bina Marga dan Cipta Karya (BMCK) Pidie, karena dinas dimaksud sempat keberatan melunasi tagihan karena lampu di jalan lingkar tersebut masih tanggungjawab pihak rekanan. (cb06)

Dua Pemuda Asal Tapanuli Ucapkan Syahadat KUTAMAKMUR (Waspada) : Dua pemuda asal Tapanuli dari non-muslim atas kesadaran sendiri mengucapkan dua kalimah syahadat di Balai Masjid Nasrudthalibin, Dusun Tanjing Mulia, Gampong Sidomulyo, Kuta Makmur, Aceh Utara belum lama ini. Kedua pemuda tersebut adalah, Dhani Situmorang, 20, dan Wahyu Aritonang. Namun setelah mengucapkan kalimah tauhid Islam, nama keduanya diganti dengan Muhammad Dhani untuk Dhani Situmorang dan Muhammad Wahyu untuk Wahyu Aritonang. Adapun proses keduanya mengucapkan dua kalimah syahadat dituntun dan dibimbing Tgk Imum Syiek masjid setempat yang disaksikan Tgk Imum Imum Masjid Baiturrahman, Alue Sagoe Weng dan Imum Masjid Alu Mbang dan sejumlah warga kawasan tersebut. Informasi yang diperoleh, Jumat (6/7), dua pemuda itu yang disebut-sebut datang dari Sumut untuk menangkap babi hutan di kawasan tersebut. “Setelah mereka masuk Islam esoknya langsung minta dikhitan dan masa penyembuhannya mereka tinggal di rumah Zakaria Mustafa, warga Dusun Tanjong Mulia setempat,” katanya. (cb02)

GaSAK Bireuen Buka Posko Pengaduan BIREUEN (Waspada) : Sebagai bentuk partisipasi masyarakat dalam penyelenggaraan pendidikan yang baik, benar dan bermutu serta bebas dari tindakan manipulatif untuk tahun ajaran 2012-2013, Gabungan Solidaritas Anti Korupsi (GaSAK) Bireuen membuka posko pengaduan seputar Penerimaaan Siswa Baru (PMB) mulai SD sampai perguruan tinggi mulai 2 Juli30 September. “Orangtua murid berhak menyampaikan keluhan pada media cetak, elektronik, online serta tidak dipungut biaya serta perkembangannya dapat terus dipantau,” kata Kepala Divisi Advokasi dan Kampanye Muhajir Juli, Jumat (6/7). Begitu juga dengan lembaga, katanya, ada hak membuka posko pengaduan, atau melaporkan pada DPRD, Ombudsman RI, inspektorat atau lembaga lain yang memiliki wewenang untuk menindaklanjuti laporan pengaduan tersebut. “Larangan memunggut biaya operasi juga berlaku bagi sekolah yang diselenggarakan masyarakat yang mendapatkan bantuan biaya dari pemerintah, sedangkan untuk sekolah swasta mandiri, pemerintah melarang memungut biaya yang dikaitkan dengan persyaratan akademik seperti biaya pendaftaran, ujian, dan kelulusan dam juga dilarang melakukan pungutan kepada peserta didik, orang tua dan wali yang tidak mampu secara ekonomi,” terangnya. (cb02)

Yonif-113/JS Gelar Donor Darah BIREUEN (Waspada) : Dalam rangka menyambut kedatangan bulan suci Ramadhan dan HUT Kemerdekaan RI 17 Agustus, Batalyon Infantri-113/Jaya Sakti Juli Bireuen melaksanakan bakti sosial berupa donor darah dan gotong royong membersihkan rumah ibadah Meunasah Desa Pulo Kiton, Jumat (6/7). Dan Yonif-113/JS Mayopr Inf Ariful Mutta-qin di sela-sela kegiatan donor darah dan gotong royong membersihkan rumah ibadah Meunasah di Desa Pulo Kiton, Kec. Kota Juang mengatakan, kegiatan donor darah dan gotong royong membersihkan rumah-rumah ibadah di desa sudah menjadi program rutin Yonif-113/JS. Dalam kegiatan donor darah diprakarsai Dan Yonif-113/ JS bekerjasama dengan Unit Transfusi Darah RSUD Dr Fauziah dan PMI Cabang Bireuen, beberapa anggota masyarakat setempat juga ikut mendonor darahnya ber-sama anggota TNI Yonif-113/JS. (b12)

Nelayan Kuala Cangkoi Keruk Kuala LAPANG (Waspada) : Sedikitnya 80 nelayan Desa Kuala Cangkoi dan Desa Matang Baroh, Kec. Lapang, Aceh Utara, bergotong-royong mengeruk Kuala Cangkoi dengan menggunakan alat sederhana, termasuk cangkul, Jumat (6/7). Kegiatan bakti sosial ini sekaligus sebagai bentuk protes nelayan terhadap pemerintah karena tak kunjung mengeruk kuala tersebut. Padahal kuala ini sudah dangkal sejak lima tahun lalu dan nelayan sudah berulangkali mengeluhkan masalah itu ke dinas terkait, baik di tingkat kabupaten maupun provinsi. “Kondisi kuala yang dangkal sangat merugikan nelayan. Boat tidak bisa merapat ke dermaga lantaran kedalaman kuala sudah dangkal. Bahkan dalam tiga bulan ini saja sedikitnya ada 5 boat rusak karena kandas,” kata Mansur Abdullah, 35, salah seorang nelayan. Kadis Kelautan dan Perikanan Aceh Utara, Saiful Bahri menjelaskan, Kuala Cangkoi termasuk salah satu dari empat kuala yang diusul pengerukan dan pemasangan jetty ke pemerintah pusat, awal 2012 lalu. Tiga kuala lainnya yakni Kuala Samudera, Tanah Jambo Aye, dan kuala di Kecamatan Muara Batu. (b19)

Sabtu 7 Juli 2012

20 Km Jalan Lingkar Didesak Segera Diaspal

Petani Ditangkap Kasus Sabu ALUE IE PUTEH (Waspada) : AA, 25 petani asal Desa Matang Kelulayun, Kec. Baktiya, Aceh Utara, ditangkap polisi karena terbukti membawa satu paket kecil sabu-sabu dan alat hisap. AA ditangkap anggota Polsek Baktiya bersama teman sekampungnya RR, 21, di jalan Desa Cot Kumbang, Kec. Baktiya, Aceh Utara, Rabu (4/7) dinihari sekitar pukul 01:00. “Malam itu, dua anggota saya sedang patroli. Setiba di Desa Cot Kumbang, berpapasan dengan tersangka. Mereka naik sepedamotor RX King,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Baktiya, Ipda Zulfitri, Jumat (6/7). Karena curiga, sambung Kapolsek, petugas yang berpakaian sipil itu lalu menyetopnya dan setelah digeledah, dalam saku celana AA ditemukan barang bukti satu paket kecil SS, kaca pyrex, korek api dan jarum dari kertas timah rokok. (b19)

NAGAN RAYA (Waspada) : Tim terpadu yang terdiri dari empat unsur memantau Rawa Tripa melalui udara untuk melengkapi beberapa kekurangan menyelesaikan kasus Rawa Tripa. Keempat unsur tersebut yakni, Unit Kerja Presiden Bidang Pengawasan dan Pengendalian Pembangunan (UKP4), Mabes Polri, Kementerian Lingkungan Hidup dan Kementerian Kehutanan. Kedatangan tim tersebut disampaikan Nirarta Samadhi, Deputi V UKP4 untuk memantau lewat udara keadaan Rawa Tripa terkini guna dilakukan penyelesaian. “Kita memantau kondisi terkini keadaan Rawa Tripa,” kata Nirarta, Jumat (6/ 7). (cb07)


Waspada/ Muji Burrahman

KETUA KIP Nagan Raya T Abdul Rasyid saat membaca surat pembatalan penghitungan suara, Jumat (6/7).

Penghitungan Ulang Suara Dibatalkan KIP Nagan Raya NAGANRAYA (Waspada) : Ratusan pendukung Ampong Bang menyerbu kantor KIP Nagan Raya meminta KIP setempat untuk membatalkan penghitungan suara. Massa yang yang bertahan di KIP, Jumat (6/7) dini hari mendapat penjagaan ketat aparat kepolisian, KIP Nagan Raya bersama Pj Bupati, Panwaslu, Dandim, Kapolres dan Muspida bernegosiasi untuk memutuskan tentang surat rekomendasi pembatalan penghitungan suara ulang tersebut,

meskipun begitu lama dilaksanakan di ruang Ketua KIP, massa tetap menunggu hasil tersebut. Dari pengamatan Waspada sampai pukul 24:00, massa dari tim pemenangan HTZ- HMJI terus berdatangan ke KIP, bukan itu saja massa ini juga membuat teratak di depan KIP, ratusan polisi di turunkan ke KIP untuk mengaman keamanan, 4 anggota DPRK Nagan Raya juga ikut dengan massa Setelah 6 jam mereka menunggu, akhirnya KIP Nagan Raya mengeluarkan surat rekomendasi pembatalan penghitungan ulang suara tersebut. Ketua KIP Nagan Raya T Abdul

Rasyid di depan para pendemo mengumumkan keputusan KIP No: 514/KIP-NR/VII/2012 tentang pembatalan surat KIP No : 513/KIP-NR/VII/2012 tentang permintaan kepada PPK untuk membuka kotak suara dan melaksanakan perhitungan ulang kertas suara. Koordinatot Tim Pemenangan T Zulkarnaini-M Jamin Idham (HTZ-HMJI) T Ridwan di sela- sela keramaian massa mengatakan sangat berterima kasih atas dikeluarkannya surat rekomendasi tentang pembatalan buka kotak suara ulang serta kepada kawan- kawan yang setia menunggu demi kebaikan bersama. (cb07)

IDI CUT (Waspada): Masyarakat dalam beberapa desa di pedalaman Idi Cut, Kecamatan Darul Aman mendesak Pemkab Aceh Timur untuk mengusulkan ke Pemprov agar segara dilakukan pengaspalan jalan lingkar dari Desa Aluluddin Sa hingga Desa Alue Meurbo. Hal itu dinilai mendesak mengingat jalan sejak merdeka hingga kini belum tersentuh pengaspalan, sehingga pengerasan demi pengerasan yang dilakukan Pemkab setempat membuat pengguna jalan harus menghirup debu saat melintas. Tak hanya itu, akibat banyak pengguna jalan yang terperosok ke parit jalan akibat terpeleset akibat kerikil yang berserakan. Pantauan Waspada, jalan di perbukitan Desa Aluluddin Sa Idi Cut sudah dilakukan pengaspalan mulai dari jalan negara hingga ke Meunasah (surau—red) setempat. Sementara selebihnya hingga melingkari beberapa desa hingga kini belum terpaspal. Warga telah lama mengusulkan ke pihak kecamatan untuk segara diaspal, namun hingga kini belum ada tanda-tanda akan dibangunnya jalan itu secara permanen. “Jalan ini melingkari desa Aluluddin Sa,

Seuneubok Teungoh, Jungka Gajah, Alue Dalam hingga tembus ke Desa Alue Meurbo. Panjangnya sekitar 20 kilometer. Kita harap tahun ini Pemkab Aceh Timur bisa mengusulkan ke Pemprov agar segera diaspal,” kata Geuchik Seuneubok Teungoh Idi Cut, M. Isa kepada Waspada, Kamis (5/7). Dia mengatakan, selama jalan penghubung antar desa belum diaspal maka tidak mustahil tiap tahun putus disejumlah titik akibat bebatuan dari pengerasan jalan hanyut ke persawahan dan jalan putus, seperti di depan Masjid Seuneubok Teungoh dan di kawasan areal persawahan. “Sudah selayaknya pemerintah memikirkan nasib masyarakat di pedalaman, karena selama terpinggirkan dari segala bentuk pembangunan,” kata Geuchik M Isa. Camat Darul Aman M. Nasir SP saat dimintai keterangan kepada Waspada kemarin mengakui pihaknya belum mengusulkan jalan ke Pemkab dan Pemprov Aceh. “Jalan lingkar mulai dari Aluluddin Sa hingga ke Alue Meurbo perlu pengaspalan dan tahun ini kita akan usulkan ke Pemkab untuk diteruskan ke Pemprov Aceh,” tandasnya. (b24)

Peringati HBA, Pegawai Kejati Aceh Donor Darah BANDAACEH (Waspada) : Kejaksaan Tinggi Aceh menggelar donor darah dalam rangka memperingati Hari Bhakti Adhyaksa ke-52, Jumat (6/7) di kantor Kejati Aceh. Kegiatan donor darah itu diikuti seluruh pegawai Kejaksaan Tinggi Aceh. Wakil Kepala Kejaksaan Tinggi Aceh Hermut Achmadi mengatakan, kegiatan donor darah untuk membantu Palang Merah Indonesia (PMI) mendapatkan darah dari masyarakat menjelang Ramadhan 1433 Hijriah karena pada bulan itu pasokan darah biasanya akan berkurang. Lebih lanjut Hermut mengatakan, donor darah ini merupakan rangkaian kegiatan Hari Bhakti Adhyaksa ke-52, selain kegiatan Pekan Olah Raga (POR). “Masyarakat umum juga bisa mendonorkan darahnya jika ingin meramaikan

kegiatan ini,” katanya. Donor darah yang dilakukan sekitar tiga jam sejak pukul 09:00 itu, diikuti seluruh pegawai dan staf Kejaksaan Tinggi Aceh. Darah yang terkumpul dalam kesempatan itu sebagian besar memiliki golongan O dan A dan B. Dalam kegiatan itu,Wakil Kepala Kejaksaan Tinggi Aceh Hermut Achmadi juga turut menyumbangkan darahnya. Setelah kegiatan donor darah, diagendakan Kejati Aceh akan berkunjung ke panti asuhan dengan pemberian santunan dan rombongan Kejati Aceh juga berkunjung ke pensiunan pegawai tata usaha dan purnajaksa. Kegiatan ini sebagai bentuk perhatian dan ungkapan terima kasih atas jasa-jasa serta sumbangsih mereka saat masih aktif bertugas di kejaksaan. (cb01)

Gara-Gara Parkir, Pemuda Tusuk Kawan LHOKSUEMAWE (Waspada) : Gara-gara tidak sependapat dalam pembagian uang parkir, pemuda Lancang Garam, Kecamatan Banda Sakti, Lhokseumawe menusuk kawannya dengan gunting cukur, Kamis (5/7). Hingga kemarin korban masih dirawat di RS PMI Lhokseumawe. Erik, 20, teman korban, Jumat (6/7) mengatakan, pemuda Gampong Lancang Garam setiap ada kegiatan massa dilakukan di kampungnya, mereka sepakat menjadi juru

parkir. Hari itu kebetulan sedang dilakukan tes tulis ujian PKH Tenaga Kerja dan Mobilitas Penduduk Aceh Utara. Saat siang hari, korban bernama Dekbit diminta TS sebagai pelaku agar membagikan uang hasil parkir, sedangkan acara tes tulis PKH belum selesai. Spontan saja Dekbit tidak mau membagikan dulu, sementara tugas belum selesai. Akibatnya, TS marah kepada Dekbit yang menjadi koordinator parkir. “Saat TS marah, dia lang-

sung menusuk Dekbit dengan gunting cukur lima kali, empat kali di bagian perut dan satu kali di bagian punggung. Kebetulan ada polisi yang pengamanan langsung menangkap pelaku dan Dekbit dilarikan ke RS PMI,” ujar Erik. Erik yang menjadi saksi, kemarin telah diperiksa kepolisian bersama rekannya yang menjadi juru parkir. Sementara Kapolsek Banda Sakti Lhokseumawe saat dihubungi belum berhasil meskipun telah dicoba berkali-kali. (cmk)

FOBA Tak Terlibat Dalam Pilkada DKI JAKARTA (Waspada): Found Bantuan Aceh (FOBA) yang bermarkas di Jakarta membantah isu yang menyatakan organisasi itu terlibat dalam Pemilihan Kepala Daerah (KDh) Daerah Istimewa Ibukota (DKI) Jakarta, 11 Juli mendatang. Ketua Umum FOBA melalui Kabid Olahraga Mawardi Nur, Jumat (6/7) menjelaskan, menjelang Pilkada DKI Jakarta kini di kalangan Wisma FOBA di Jakarta berhembus isu bahwa organisasi FOBA ikut terlibat dalam mendukung salah satu kandidat Gubernur/Wagub DKI Jakarta. “Ada isu Wisma FOBA di

Jakarta didatangi salah satu kandidat dengan tujuan meminta dukungan dalam pemenangan itu dan isu yang berkembang bahwa para mahasiswa Aceh disini juga mendukung kandidat itu. Tapi perlu diketahui bahwa FOBA sama sekali tidak mendukung dan tak pernah terlibat dalam politik serta membantah keras isu itu,” kata Mawardi Nur yang akrap disapa Ardi. Dia juga menegaskan, FOBA menolak keterlibatan asrama mahasiswa Aceh ke dalam ranah Pilkada DKI. “FOBA tidak pernah memberi dukungan dalam bentuk apapun

kepada salah satu calon manapun,” tegas Ardi seraya menambahkan, pihaknya sama sekali tidak setuju kandidat manapun menjadikan lembaga FOBA sebagai ajang kampanye. Ardi melanjutkan, FOBA bukan untuk dimanfaatkan dalam kepentingan elit politik dan persoalan pilihan kembali kepada pilihan masing-masing. “Kami di sini mahasiswa utusan daerah untuk belajar guna meraih cita-cita demi meraih gelar sarjana untuk nantinya kami bangun daerah masing-masing. Bukan untuk berpolitik,” kata Ardi.(b24/cmh)

Waspada/Gito Rolies

WAKIL Kepala Kejaksaan Tinggi Aceh Hermut Achmadi sedang menyumbangkan darahnya dalam rangka memperingati Hari Bhakti Adhyaksa ke-52, Jumat (6/7) di kantor Kejati Aceh.

Putusan MK Jilid Dua Kembali Dipolitisir BLANGKEJEREN (Waspada) : Keputusan Mahkamah Konstitusi terhadap sengketa Pilkada Gayo Lues jilid dua, Selasa (3/7) kembali dipolitisir. Isu yang beredar di kalangan masyarakat masih menuai kontroversi. Pasalnya, isu itu mengatakan Pilkada Gayo Lues batal demi hukum, karena MK menolak eksepsi termohon KIP Gayo Lues. Sehingga ketika eksepsi termohon ditolak MK, maka seluruh keputusan/penetapan kebijakan KIP dalam pelaksanaan Pilkada Gayo Lues 2012 ditolak MK. Secara otomatis, seluruh keputusan KIP batal demi hukum, artinya Pilkada Gayo Lues 2012 batal. Dan ketika MK menyatakan permohonan pemohon keliru karena judul tuntutan salah, tidak sesuai dengan BAP dan saksi yang diperiksa. Maka dengan sendirinya MK mengabulkan eksepsi terkait. Sehingga, berbagai pihak yang mempolitisir, keputusan MK ini mengacu pada Qanun Aceh nomor 5, pasal 74 tahun 2012. Artinya akan terjadi sejarah baru, yakni Pilkada ulang untuk Gayo Lues. Konon, ternyata isu ini sudah mulai merebak di Black Berry Masangger (BBM) di Group “Jamur Ton Begegure”, yang sebelumnya juga sempat dipolitisir di jejaring sosial facebook group“ Pilkada Gayo Lues”, ketika MK memutuskan sengketa Pilkada Gayo Lues jilid pertama, Senin (4/6) bulan lalu. “Isi dari eksepsi terkait adalah seluruh beban yang dituduhkan pemohon, artinya pihak

terkait selamat dari gugatan pemohon yang mengajukan sekian ratus kasus. Dan pihak terkait selamat dari ancaman hukuman yang digugat pemohon, bukannya dikabulkan sebagai pemenang Pilkada Gayo Lues,“ jelas Meurah Gayo melalui BBM, Selasa (3/7). Dikatakannya lagi, jika terjadi sebaliknya. MK mengabulkan permohonan pemohon, eksepsi termohon ditolak dan eksepsi terkait juga di tolak. Maka akan terjadi diskualifikasi. Jika MK memutuskan permohonan pemohon ditolak, eksepsi termohon diterima, eksepsi terkait juga diterima maka yang terjadi pembenaran keputusan KIP dan kandidat nomor 3 menang. Namun pengertian isu miring ini dibantah Tengku Syamsir Ali, Ketua Gerakan Nasional Pemberantasan Korupsi (GN-PK) Provinsi Aceh. Permohonan pemohon dalam perkara perselisihan hasil pemilihan umum (PHPU) kepala daerah Kabupaten Gayo Lues dinyatakan tidak dapat diterima MK. Menurut MK, permohonan pemohon salah objek. Sehingga kedudukan hukum (legal standing) tenggang waktu pengajuan permohonan dan pokok permohonan tidak dipertimbangkan. Seharusnya, berdasarkan pasal 4 ayat (1) PMK 15/2008 permohonan pemohon adalah mengenai rekapitulasi hasil penghitungan suara dalam pemilihan umum kepala daerah Kabupaten Gayo Lues. (cjs)

Afizi, Aceh Negeri Leluhurku... DI basemen tower Menara Kembar Petronas, Malaysia, Afizi menonton kedahsyatan Tsunami Aceh lewat televisi. Pikiran lelaki kekar itu menerawang jauh ke tanah leluhurnya. Kesibukan membuat kakinya tak bisa beranjak jauh ke luar negeri, meski cuma dipisahi Selat Malaka. Warga Malaysia keturunan Aceh ini cukup lama memendam hasrat agar bisa tiba di kampung endatunya. Ayah lima putra-putri ini harus menunggu hampir delapan tahun lamanya. Kisah-kisah tentang tsunami hanya dilihat dari televisi dan cerita para karyawannya yang baru kembali dari Aceh. Begitu mendapat kesempatan berkunjung langsung, maka Afizi bin Amudi melihat bibir pantai Ule Lheue, tempat di mana jilatan pertama gelombang air menyapa daratan pada 26 Desember 2004 silam. “Subhanallah,” ujarnya usai menatap rumah Allah yang masih berdiri megah di kawasan Ule Lheue. Terakhir sekali dia melihat Masjid Baiturrahim itu sekira

20 tahun lalu. “Saat saya masih berumur 17 tahun pada 1992 pernah pulang ke Aceh. Baru tahun ini pulang lagi setelah 20 tahun lewat,” katanya dalam logat Melayu Malaysia. Puas melihat kawasan yang kini sudah berubah total itu, Afizi langsung terbayang kapal apung. Dia ingin melihat efek kedahsyatan tsunami lainnya. Tiba di kompleks PLTD Apung, Punge Blang Cut, Afizi merasa makin ciut. Dalam bahasa Inggris dialek Melayu dia mengungkapkan keagungan Sang Khalik. Suami Sharis Haiza Binti Ismail yang sudah dikaruniai lima buah hati seakan tak percaya melihat kapal raksasa berlabuh di darat. Dia mengaku sungguh melihat sebuah keajaiban di darat Aceh. Kepada Waspada Afizi yang baru Rabu lalu di Banda Aceh, mengaku ke tanah leluhurnya untuk kunjungan beberapa hari saja. “Saya tidak lama, cuma sampai Ahad ini saja,” ujar pria 37 tahun ini. Namun, setelah melihat beberapa objek wisata tsunami di Banda Aceh, rasanya dia ingin

kembali lagi suatu saat nanti dengan memboyong keluarganya. Dia juga ingin mengajak putrinya sulung yang diberi nama Cut Intan Umairah. Meski warga Malaysia, Afizi mengaku begitu mencintai tanah leluhurnya. Dia lahir di Negeri Kedah, tepatnya KampungYan. Darah Aceh mengalir dari ibunya, Fobiyah Binti Saad yang asli Pidie. Ayahnya Amudi, seorang pensiunan tenaga medis di Kedah. Dia anak pertama dari lima bersaudara. Kendati lahir dan hidup di negeri Jiran, dia mengerti bahasa ibunya. “Lon jeut bahasa Aceh, tapi bacut-bacut, kalau mendengar percapakan saya tahu, tapi tapi bisa menjawab dengan lancar,” katanya. Afizi adalah satu dari ribuan wisatawan Malaysia yang kerap berkunjung ke tanah Rencong. Turis asal Malaysia bukan satusatunya negara yang mendominasi daftar kunjungan wisatawan ke Aceh. Pria berdarah Aceh ini adalah salah satu konsultan di Kuala Lumpur Convention Centre. “Saya sudah 15 tahun men-

jadi konsultan di KLCC yang menangani exsternal service. Pekerja saya banyak orang Aceh dan beberapa warga Indonesia lainnya juga,” papar Afizi. Ke depan, dia juga berharap akan banyak warga negaranya yang melancong ke Aceh. Dia juga berharap Pemerintah Aceh bisa mempromosikan lebih gencar lagi potensi pariwisatanya ke luar negeri. “Kalau dikelola dengan baik, saya pikir potensi wisata di Aceh cukup bagus, karena objek wisata tsunami itu tak ada di tempat lain. Mungkin hanya di Jepang yang juga ada. Ini potensi yang sangat luar biasa, jadi harus dimanfaatkan untuk menarik kunjungan wisatawan ke Aceh,” saran Afizi lagi. Mengacu pada catatan yang dipublikasi Banda Pusat Statistik (BPS) Aceh, hingga Mei 2012, disebutkan, kunjungan turis asal negeri jiran mencapai 3.455 orang. Lalu, juga tercatat 609 turis asal Jerman, disusul Cina sebanyak 389 orang, Inggris sebanyak 199 orang, Amerika 185 orang. Kemudian turis asal Aus-

Waspada/Munawardi Ismail

AFIZI Amudi, turis asal Malaysia sedang diabadikan di depan Kapal Apung, Punge Blang Cut. tralia 165 orang, Perancis 149 orang, Singapura 137 orang, Belanda 97 orang dan Korea 64 orang. Data BPS juga merincikan, jumlah kunjungan wisatawan sepanjang 2012 per bulan

yakni, Januari sebanyak 1.035 orang, Februari 1.194 orang, Maret 1.789 orang, April 1.142 orang dan Mei sebanyak 1.006. Munawardi Ismail


WASPADA Sabtu 7 Juli 2012

Muzakir: Jauhi Narkoba

Investasi Tanah Picu Penambahan Lahan Tidur SIGLI (Waspada) : Menaikkan tarif pajak dinilai efektif mencegah semakin luasnya lahan tidur atau tidak produktif di Kabupaten Pidie yang luasnya mencapai ribuan hektare. Solusi menaikkan pajak juga dinilai akan mendongkrak ekonomi masyarakat khususnya petani. “Karena mereka akan mengaktifkan kembali lahan tidur tadi dan secara otomatis berdampak pada ekonomi masyarakat yg lebih baik,” kata Kepala Badan Pelaksana Penyuluhan Dan Ketahanan Pangan (BPPKP), Pidie T Sabirin, Jumat (6/7). Hal itu disampaikan Sabirin terkait alasan sejumlah petani di kabupaten itu, yang masih memilih menanam padi meski musim kemarau (Gadu). Padahal, kata Sabirin, di saat musim kemarau, petani dapat beralih ke tanaman palawija yang tidak sepenuh bergantung pada air, dengan memanfaatkan lahan tidur selain persawahaan. “Masih ada sebenarnya yang bisa dilakukan petani kita saat musim kemarau, apalagi banyak lahan tidur di Pidie sekarang. Jumlahnya ribuan hektare,” kata Sabirin. Sabirin mengatakan, investasi dalam bentuk tanah ikut menyumbang semakin luasnya lahan tidur di Pidie. Di mana lahan dibiarkan begitu saja tanpa ditanami dan akan dijual saat harganya tinggi.“Ini umumnya dilakukan mereka dengan taraf ekonomi menengah ke atas. Diminta tanami juga tidak boleh, jadi hanya menunggu harga tinggi,” katanya. (cb06)

Tarmilin: Hargai Pekerjaan Jurnalistik BANDAACEH (Waspada) : Ketua PersatuanWartawan Indonesia (PWI) Cabang Aceh, Tarmilin Usman, meminta semua pihak untuk saling menghargai profesi masing-masing, termasuk pekerjaan jurnalistik yang dilaksanakan para wartawan dari berbagai media massa di Aceh. “Wartawan bersama komponen masyarakat lainnya juga ikut membangun Aceh yang lebih baik, jadi hargailah profesi wartawan dalam menjalankan tugas jurnalistiknya,” kata Tar-milin Usman, Ketua PWI Cabang Aceh, Jumat (6/7) di Banda Aceh. Menanggapi insiden pengusiran wartawan yang sedang melakukan wawancara dengan Gubernur Aceh Zaini Abdullah, Kamis (5/7) di Lhokseumawe, Tarmilin berharap kasus seperti itu tidak terulang lagi. “Kita berharap tidak ada pihak manapun yang arogansi terhadap wartawan,” tegasnya. (b06)

Kompensasi Pencemaran Lingkungan Masih Menunggu SUBULUSSALAM (Waspada) : Pemenuhan kompensasi pencemaran lingkungan menyusul pecahnya kolam limbah Pabrik Kelapa Sawit (PKS) Bangun Sejahtera Lestari (BSL) di Desa Sikelondang, Kec. Simpang Kiri, Subulussalam dengan sejumlah warga desa di Kec. Rundeng dan Kec. Simpang Kiri itu, pekan silam masih menunggu keputusan Medan. Supriadi Boangmanalu, Ketua Komisi C DPRK Subulussalam, Jumat (6/7) menjawab kesimpulan dengar pendapat pihak PKS BSL dengan warga terkait di ruang rapat gedung DPRK setempat mengatakan, sidang yang berlangsung alot belum menyimpulkan kesepakatan karena masih menunggu rapat intern PKS BSL di Medan dalam waktu dekat. “Pihak PKS Bangun Sempurna Lestari berjanji membawa tuntutan warga pada rapat intern di Medan,” tutur Supriadai seraya menyebutkan, H Ali Hasan dan Chandra Ginting, perwakilan PKS BSL dalam dengar pendapat. Dikatakan, perwakilan masyarakat minta kompensasi bagi 253 KK, masing-masing Rp2 juta per KK dari yang sebelumnya Rp3,5 juta, sedangkan PKS BSL bersedia berupa 38 kg beras, 1 kg minyak goreng, 2 kartun mi instan, 1 kg gula pasir, 0,5 kg kopi dan 2 papan telur per KK. Pada sidang rapat dipimpin Jamasa Cibro, Ketua BKD DPRK Subulussalam bersama Ketua Komisi C Supriadi Boangmanalu, mewakili Komisi B Netap Ginting dan sejumlah anggota, mewakili PKS BSL H Ali Hasan dan Chandra Ginting, Camat Rundeng dan Simpang Kiri, kepala desa terkait dan unsur LSM Berkah dan KMPA. (b28)

Setiap Hujan, Jalan Selalu Banjir BLANGKEJEREN (Waspada) : Sejumlah warga pengguna jalan lintas Blangkejeren-Kutacane, menunggu komitmen pemerintah dalam memperbaiki jalan berlubang dan drainase yang tersumbat di daerah itu. Ketua LSM Perlahan, Syukran mengatakan, komitmen pemerintah itu ditunggu sesuai janji-janji Pemkab Gayo Lues. “Karena saya perhatikan, bila hujan datang parit di sepanjang Desa Gele-Raklunung tersumbat, tentu saja air paritnya tumpah ke jalan ketika hujan turun, hal ini sangat mengganggu pengguna jalan,“ ujar Sukran, Jumat (6/7). Ditambah lagi, pemandangan sepanjang jalan Kutacane Blangkejeren itu masih ada yang berlubang, tepatnya di sepanjang jalan desa gele dengan lubang yang menganga berdiameter 2x3 meter. Menurutnya, warga Blangkejeren menyambut baik perbaikan yang dilakukan saat ini, seperti penambalan jalan yang berlubang dan pengerukan drainase. Tapi warga kecewa ketika pemerintah hanya setengah hati menambal lubang jalan, karena kualitasnya hanya bertahan selama 3 bulan sudah hancur lagi. PantauanWaspadadisepanjangjalanbesarnegara,AihOngkap, Mangul, Gele, Raklunung dan Penampaan, apabila datang hujan sangat meresahkan warga pengguna jalan yang melintas. Pasalnya, jalan tersebut digenangi air hujan setinggi 20-30 cm. (cjs)

Pistol Penembak Bongkeng Ke Puslabfor LHOKSEUMAWE (Waspada) : Untuk membuktikan apakah selongsong yang ditemukan di lokasi kejadian itu milik Muttaqim ataubukan,polisimembawasepucukpistolFNdan28butiramunisi serta 4 selongsong ke Puslabfor, Medan, Sumatera Utara, Jumat (6/7). Muttaqim salah satu penembak Bongkeng, kader PA, di Gampong Paloh Lada, Muara Satu Lhokseumawe, 4 Juni 2012. Sebelumnya, polisi juga telah menangkap Dedi, pada 21 Juni 2012, sedangkan Muttaqim, 33, warga Paloh Punti, Kecamatan Banda Sakti, Lhokseumawe ditangkap di Gampong Blang Mane, Peusangan, Bireun, pada 4 Juni 2012, bersamanya polisi menyita sepucuk pistol jenis FN, dan 28 butir amunisi. “Sebelumnya kita juga mengirim satu jenis pistol colt berserta 29 butir amunisi yang disita dari tangan tersangka Dedi ke Puslabfor. Sehingga nantinya penyidik bisa membawa pulang hasil uji balistik untuk perampungan berkas,” kata Supriadi, Kasat Reskrim Polres Lhokseumawe. Dalam pemeriksaan, para tersangka mengaku tidak tahu tembakan pistol siapa yang mengenai Nasrul Mahyar, 28, pada 4 Juni 2012, di Gampong Paloh Dayah. Pasalnya, saat itu secara bersama-sama melepaskan tembakan saat melihat Bongkeng, setelah itu keduanya kabur. (b18)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.



BANDA ACEH (Waspada) : Wakil Gubernur Aceh Muzakir Manaf mengingatkan anggota Gerakan Pramuka Aceh untuk menjauhkan diri dari penggunaan dan penyalahgunaan narkoba, karena barang haram itu dapat merusak masa depan dan menjadi sampah masyarakat. “Jauhkan diri kalian dari narkoba karena dapat merusak diri dan keluarga,” ujar Wagub Muzakir Manaf saat melepas kontingen Kwarda Gerakan Pramuka Aceh ke lomba tingkat regu pramuka penggalang nasional, Kamis (5/7) di lobi kantor gubernur di Banda Aceh. Menurut Muzakir, kalau sudah terlibat dalam penggunaan dan penyalahgunaan narkoba, maka tidak akan berguna lagi hidup ini dan menjadi sampah masyarakat. “Kalau itu terjadi anda tidak akan berguna lagi dalam keluarga dan anda akan menjadi sampah masyarakat,” katanya. Pemerintah Aceh, katanya, akan terus berupaya mendukung kegiatan gerakan pramuka Waspada/Muhammad Zairin

DIREKTUR Utama Makarim Group, Muhammad Zairin Aref dari Arab Saudi menerima plakat Pemerintah Aceh dari Wagub Muzakir Manaf, Kamis (5/7) di kantor gubernur di Banda Aceh. Muhammad Zairin Aref yang hadir bersama Muhammad Fauzan Kamil, perwakilan Makarim Group Indonesia membahas rencana investasi Makarim Group di Aceh yang dimulai 2013 mendatang.

Pembayaran Gaji Ke-13 Di Agara Masih Mengambang KUTACANE (Waspada) : Ribuan PNS di lingkungan Pemkab Aceh Tenggara mengaku merasa cemas, pasalnya meski telah memasuki Juli 2012, pembayaran gaji ke-13 yang sangat diharapkan, belum juga menunjukkan titik terang. Padahal pembayaran gaji ke-13 itu sangat bermanfaat bagi ribuan PNS di Agara, terutama untuk menutupi kebutuhan sehari-hari yang semakin meningkat dan kebutuhan untuk biaya masuk sekolah bagi siswa di tahun ajaran baru ini. Bagi pejabat, kata Andin seorang PNS, untuk biaya dan kebutuhan anak masuk sekolah, biaya pakaian dan buku yang diperlukan, memang tidak terlalu terasa, namun lain lagi bagi pns rendahan, biaya untuk kebutuhan anak sekolah jelas sangat terasa dan memberatkan. Apalagi, bila dalam satu ke-

luarga ada beberapa anak yang masuk sekolah di jenjang tingkat atas seperti SMA, MAN dan SMK, biaya yang dikeluarkan jelas sangat besar dan memberatkan, sebab itu bila gaji ke-13 belum dibayarkan Pemkab Agara jelas akan membuat orangtua wali murid yang ingin menyekolahkan anak merasa kewalahan dan kebingungan. “Untuk biaya membeli seragam baru anak sekolah saja, rasanya sudah sulit, mengingat semakin sulitnya perekonomian masyarakat saat ini, apalagi bila harus membayar biaya lain untuk anak sekolah di tingkat SMA,MAN dan SMK,” tutur PNS lainnya. Sebab itu, kami selaku PNS berharap agar pemkab menaruh kepedulian yang tinggi terhadap pencairan gaji ke-13 bagi PNS di bumi Sepakat Segenep karena tanpa pembayaran gaji

ke-13 diperkirakan akan menambah kesulitan bagi orangtua wali murid yang ingin menyekolahkan anaknya, terutama di tingkat atas, sebab di sekolah tingkat atas tak ada program pemkab menggratiskan biaya pendidikan. Diakui sejumlah PNS di Agara, belum dibayarkannya gaji ke-13 memang membuat orangtua wali murid kebingungan, masalahnya kendati sudah mendekati tahun ajaran baru , namun belum ada khabar pasti tentang pencairan gaji ke13. Kadis Pengelolaan, Keuangan dan Kekayaan Daerah Agara Suhailuddin terkait masih mengambangnya pembayaran gaji ke-13 di lingkungan Pemkab Agara, Jumat (6/7) tak menjawab sms yang dikirimkan Waspada. (b26)

TNI Sisihkan Gaji Sumbang Bangun Masjid Islamic Center LHOKSEUMAWE (Waspada) : Tindakan yang patut ditiru ketika anggota TNI di jajaran Korem 011/LW dan Kodim 0103 Aceh Utara rela menyisihkan uang dari gaji ke-13 guna menyumbang untuk pembangunan Masjid Islamic Center Kota Lhokseumawe. Jumlah sumbangan yang digalang TNI itu mencapai puluhan juta rupiah yang diterima Wali Kota Lhokseumawe Suaidi Yahya, Jumat (6/7) usai melaksanakan shalat Jumat di Masjid Islamic Centre setempat.

Sumbangan dari Kodim senilai Rp33.625.000 diserahkan Kasdim 0103 Aceh Utara Mayor Kav Yusri. Sedangkan sumbangan dari Korem 011/LW dana sebesar Rp31.325.000 juta diserahkan Kabintal Korem 011/LW Kapten Zulkifli. “Semua dana tersebut disisihkan dari gaji ke-13 anggota TNI di jajaran Kodim ataupun Korem. Sedangkan sumbangan ini merupakan wujud nyata kepedulian para anggota TNI untuk berpartisipasi terhadap pembangunan Masjid Agung

Islamic Center,” jelas Mayor Kav Yusri. Wali Kota Lhoskeumawe Suaidi Yahya yang baru saja dilantik menyampaikan ucapan terimakasih atas sumbangan yang telah digalang anggota TNI dari Korem 011 / Lilawangsa dan Kodim 0103. Lebih lanjut dikatakana, sumbangan tersebut sangat berarti dan dibutuhkan dalam upaya mempercepat selesainya pembangunan Masjid Islamic Center. (b16)

Gubernur Aceh: Daerah Penghasil Gas Masih Miskin LHOKSEUMAWE (Waspada) : Gubernur Aceh Zaini Abdullah menilai Aceh Utara sebagai penghasil gas masih termasuk daerah miskin di Provinsi Aceh. Dalam pelantikan Bupati Aceh Utara, Kamis (5/7) dia meminta pasangan Muhammad Thain dan M.Jamil mampu melibatkan diri dalam industri gas yang akan dikelola oleh Pertamina. Dalam sambutannya di hadapan undangan di gedung DPRK Aceh Utara, Zaini menga-

takan, kabupaten penghasil gas alam ini memiliki potensi tinggi. Selain dari Migas, hasil laut juga berpotensi di kabupaten bekas kerajaan Malikussaleh. “Ironisnya, Aceh Utara masih merupakan daerah miskin,” ungkap Gubernur Aceh. Untuk itu, pemerintah daerah ke depan harus mampu melibatkan diri dalam pengelolaan industri gas. Menjelang pengalihan gas (dari pabrik pengolahan gas PT Arun menjadi terminal gas), Pemerintah Aceh dan

Pemkab Aceh Utara berkesempatan melibatkan diri dalam memanfaatkan industri gas. Vice Presiden Director PT Arun Fuad Buchari yang ikut dalam pelantikan Bupati Aceh Utara Muhammad Thaib-M Jamil menjelaskan, partisipasi daerah berpeluang dalam industri gas melalui perusahaan daerah. “Nanti penanganan Pertamina, daerah bisa berpartisipasi melalui perusahaan daerah,” ungkap Buchari. (b15)

Penderita Cacat Harap Bantuan Pemerintah NAGANRAYA (Waspada) : Tidak banyak yang dapat dilakukan Iwan, warga Desa Kubang Gajah, Kec.Kuala Pesisir, Nagan Raya menghabiskan waktu di atas sepeda yang telah dia rombak menjadi becak. Hal itu disebabkan, kedua kakinya mengecil sehingga Iwan tidak dapat berjalan dengan normal. Untuk menuju tempat yang dia inginkan, Iwan harus mengayuh sepeda itu dengan tangan kanannya. Dan itu bukan hal mudah tentunya. Namun, itulah yang harus dilakukan Iwan, tidak ada pilihan lain. Kendati di bawah terik matahari, dengan sabar dia kayuh dengan perlahan sepeda itu. “Upaya ini yang dapat saya lakukan, jika tidak berarti saya haris berdiam diri di rumah, jauh dari dunia luar, tentunya itu bukan pilihan yang tepat,” ujarnya. Kepada Waspada, Jumat (6/ 7) Iwan mengaku, cacat yang dideritanya itu akibat salah suntik saat usianya 4 tahun. “Kata keluarga, saat usia empat tahun kaki saya normal dan dapat berjalan normal seperti anak lainnya,” ucapnya. Dengan kondisinya saat ini,

yang dilaksanakan di daerah. Karena semua kegiatan itu sangat baik untuk membina kepribadian generasi muda Indonesia, khususnya gerakan pramuka Aceh. “Beberapa hari lalu, kita sudah melepaskan pramuka santri Aceh ke perkemahan pramuka santri tingkat nasional di Kepulauan Riau, sebelumnya juga kita kirim untuk tingkat nasional dan internasional. “Yang jelas jika memang bermanfaat untuk pembinaan generasi muda, tidak ada alasan untuk tidak mendukung aktivitas pramuka di Aceh,” tegas Muzakir. Karena itu, wagub berharap kontingen pramuka Aceh untuk mengikuti lomba tingkat nasional itu dengan baik. Kontingen Kwarda Gerakan Pramuka Aceh mengirim satu regu putra dari Kwarcab Aceh Utara dan putri dari Kwarcab Banda Aceh untuk mengikuti lomba tingkat regu Pramuka penggalang tingkat nasional tahun 2012, yang dilaksanakan di Cibubur, Jakata. (b06)

Warga Tak Sabar Menanti Pelantikan Ibnu - Adam BLANGKEJEREN (Waspada) : Ketua Divisi Investigasi LSM – Gamuse, Mustafa Kamal mendesak Gubernur Aceh agar segera melantik bupati terpilih Gayo Lues Pasca putusan Mahkamah Konstitusi terhadap sengketa PHPU jilid dua, Selasa (3/7). Desakan ini, seiring sebagian masyarakat Gayo Lues sudah tak sabar menanti pelantikan kepala daerah yang terpilih. Apalagi baru – baru ini, sebagian kepala daerah di Provinsi Aceh sudah dilantik. Jadi sudah seharusnya di Gayo

Lues dan beberapa kepala daerah lain yang tidak menuai konflik secepatnya dilantik. “Kami atas nama masyarakat Gayo Lues meminta Gubernur Aceh agar secepatnya melantik bupati/wakil bupati terpilih pada pertengahan Juli ini,“ kata Mustafa, Kamis (5/7). Menurut Mustafa, pelantikan tersebut tidak perlu menunggu hasil pilukada dari daerah lain, karena ada beberapa daerah yang masih berkecamuk. Misalnya, seperti Aceh Tenggara, Nagan Raya serta daerah lain. (cjs)

400 Peserta RSBI SMKN-1 Bireuen Ikuti Masa Orientasi BIREUEN (Waspada) :400 Calon siswa Rintisan Sekolah Bertaraf Internasional SMKN-1 Bireuen mengikuti masa orientasi penerimaan peserta didik baru 2012-2013 di halaman SMKN setempat. Orientasi penerimaan calon siswa peserta didik baru berlangsung dalam suatu upcara ditandai dengan pengalungan badge calon siswa oleh Kepala SMKN-1 Bireuen Darmawan. Dalam amanatnya Darmawan antara lain menegaskan, orientasi siswa PPTD (Penerimaan Peserta Dididk Baru) selama tiga hari 6 – 8 Juli 2012 untuk menempa disiplin para calon siswa dalam menuntut ilmu di Waspada/H AR Djuli SMKN-1 Bireuen serta mematuhi segala peraturan se- KASEK SMKN-1 Bireuen Darmawan sedang mengalungkan badge kolah. Bagi calon siswa PPTD secara simbolis kepada tiga calon siswa danm dua calon siswi yang melanggar peraturan peserta peserta orientasi PPTD RSBI SMKN-1 Bireuen Senin (6/ sekolah selama mengikuti 7). orientasi namanya akan dicoret tidak diterima sebagai calon siswa rikan kepada para calon siswa PPTD antara lain, SMKN-1 Bireuen. pengenalan sekolah, tata tertib sekolah dibeKasek berharap 400 peserta orientasi PPTD, rikan Wakasek kesiswaan Muslim, pengarahan 25 peserta di antaranya calon-calon siswa-siswi praktik kerja industri diberikan Sukardi, pengeterbaik akan dapat mengikuti masa orientasi nalan kampus M Yasin bersama panitia dan dengan baik. bakti kampus bidang Humas. Wakil Kepala Sekolah Imran tutor Instruktur PBB, upcara bendera, bela negara dengan Pendidikan Karakter Kebangsaan SMKN-1 instruktur anggota TNI Yonif-113/JS dan penBireuen dan M Yasin selaku panitia penyeleng- didikan kebangsaan diberikan Wakasek Imran gara orientasi mengatakan, materi yang dibe- bertsama anggota TNI Yonif-113/JS. (b12)

Massa Ampon Bang Bermalam Di KIP NAGANRAYA (Waspada) : Setelah sebelumnya tim pendukung Asib Amin-Jasmi Has mendatangi Kantor Komisi Independen Pemilihan (KIP) Nagan Raya untuk meminta penghitungan ulang hasil Pilkada, kini giliran pendukung T Zulkarnaini (Ampon Bang)-Jamin Idham menggelar aksi bermalam di Kantor KIP, Kamis (5/7). Kedatangan massa itu untuk memprotes surat keputusan KIP nomor 513/KIP-NR/VII/ 2012 yang menyetujui dilakukan penghitungan ulang di setiap kecamatan berdasarkan tuntutan massa dan rekomendasi Panwaslu Nagan Raya. Salah seorang tim sukses Ampong Bang me-

ngatakan, pihaknya keberatan jika penghitungan harus diulang karena dianggap telah selesai dilakukan. Untuk itu, mereka telah mengirimkan surat keberatan atas kebijakan KIP itu. “Kebijakan itu melanggar aturan karena tepat dikeluarkan surat tersebut merupakan hari dilaksanakan pleno di PPK berdasarkan tahapan Pilkada Nagan Raya,” katanya. Sementara kantor KIP Nagan Raya dijaga ketat oleh pihak kepolisian dan Brimob bersenjata lengkap serta dibantu TNI dari satuan Kodim 0116 dan TNI Kompi BYonif 116/GS Nagan Raya. (cda)

Toko Ramai Terbakar BANDAACEH (Waspada) : Toko Ramai di Jalan Diponegoro, Banda Aceh, Kamis (5/7) malam terbakar. Kobaran api juga membakar sejumlah bangunan toko di sebelahnya, antara lain Toko ATK Cemerlang dan Toko Pecah Belah Sejahtera. Informasi yang diperoleh, kobaran api pertama sekali terlihat sekira pukul 20:45 saat pembeli sedang ramai berbelanja di toko tersebut. Namun, hingga saat ini belum diketahui secara pasti sumber api yang membakar salah satu toko swalayan terbesar di Ibukota Provinsi Aceh itu.

Sejumlah saksi mata di lokasi kejadian menyebutkan, kobaran api cepat menjalar ke toko yang lain karena di dalam toko tersebut terdapat barang-barang yang mudah terbakar. Saat berita ini dikirim, petugas pemadam kebakaran Kota Banda Aceh dibantu petugas pemadam kebakaran Pemkab Aceh Besar dan PT SAI sedang berusaha memadamkan api yang terus berkobar. Pihak kepolisian hingga saat ini masih menyelidiki penyebab kebakaran tiga toko di Jalan Diponegoro, depan Masjid Raya Baiturrah-man, Banda Aceh, Kamis (5/7) malam. (b05/b08)

Hujan Dan Angin Landa Perairan Bireuen Waspada/Didit Arjuna

IWAN, warga Desa Kubang Gajah, Kecamatan Kuala Pesisir, Nagan Raya ketika di Bandara Cut Nyak Dhien. dia berharap, Pemda dapat memperhatikan dan memberdayakan orang cacat seperti dirinya sehingga tidak hanya berpangku tangan. “Saya berharap pemerintah dapat menyalurkan bantuan modal untuk membuka usaha,” katanya. Diakuinya, dirinya berkeinginan untuk membuka kios kecil, sebagai usaha dan aktivitas sehingga tidak lagi harus mundar-mandir dengan aktivitas yang tidak jelas seperti belakangan ini.

Diakuinya, karena kondisinya itu, dirinya hanya mengenyam pendidikan SD. Tentu dengan latar belakangan pendidikannya tersebut, dirinya tidak dapat berbuat banyak. “Bisa apa dengan latar belakang pendidikan sekolah dasar,” akunya. Bahkan dirinya mengaku, jika ada program pelatihan bagi orang cacat, dirinya siap untuk mengikuti program tersebut, untuk menambah pengalaman maupun keterampilan. (cda)

BIREUEN (Waspada) : Cuaca yang tidak bersahabat selama beberapa hari terakhir, hujan disertai angin kencang menghambat kerja nelayan di sejumlah wilayah di Kabupaten Bireuen. Hal ini mengakibatkan langkanya ketersediaan ikan segar di pasar. “Sudah beberapa hari nelayan di sini tidak melaut, gelombang laut besar yang disertai hujan dan angin,” ungkap Malek, nelayan di Kuala Jangka Kecamatan Jangka, Bireuen, Kamis (5/7). Malek menjelaskan, kondisi ini tidak hanya di alami nelayan di Kuala Jangka, namun hal senada juga terjadi pada nelayan lain di Bireuen. “Hampir semua nelayan tidak melaut, apalagi sekarang pada musim barat,” tutur Malek. Lebih lanjut dia menjelaskan, kadangkadang sebagian nelayan boat pancing yang hendak menerobos ombak dan angin untuk melaut, namun ini hanya sia-sia.“Belum sempat memancing mereka harus pulang,” ucap Malek. Kondisi ini, jelasnya, membuat para nelayan pendapatan nelayan menurun drastis. “Cukup prihatin kita melihat nelayan di Jangka. Apalagi memasuki tahun ajaran baru sekolah dan per-

siapan menjelang bulan puasa,” kata Malek. (b17)

Jangan Gunakan Fasilitas Umum Untuk Pribadi LHOKSEUMAWE (Waspada) : Pemimpin Aceh yang baru terpilih serta dengan pejabatpejabatnya diminta tidak menggunakan fasilitas umum untuk kepentingan pribadi. “Seorang pemimpinyangwarak,yangpaham dan patuh terhadap syariat Islam tidak akan menggunakan fasilitas pemerintah ataupun milik titipanrakyatituuntukkepentinganpribadi,”tegas TgkMasyurilpadakhutbahJumat(6/7)diSyuhada Kemukiman Gampong Jawa, Lhokseumawe. Biasanya para pemimpin dan pejabat sering memanfaatkan fasilitas negara, sebagaimana mobil dan pendukung lainnya untuk kepentingan pribadi. Tgk Masyuril mengatakan bahwa pemimpin Islam yang warak, sebagaimana Umar bin Khattab pantang melakukan itu. (b14)



Anggota Dewan Pantas Gusar Soal Anggaran


engejutkanjikamelihatpelaksanaanMTQtingkatSumutyangdigelar di Serdang Bedagai beberapa waktu lalu. Ternyata dana Rp7 miliar yang dianggarkan untuk pelaksanaan event tersebut belum dibayar Pemmprovsu (baca Harian Waspada, Jumat 6/7). Kadis Tarukim Kab. Serdang Bedagai Herman Sitorus sebagai seksi mimbar tilawah memberikan keterangan tersebut. Menurutnya, dana itu sama sekali belum diselesaikan oleh Pemprovsu. Kadis tersebut menyatakan keterlambatan pembayaran anggaran itu bisa jadi karena masalah di bendahara Bansos Pemprovsu. Itu salah satu nukilan betapa sulitnya sekarang pemerintah daerah hingga pusat mengelola anggaran. Kondisi seperti itu pula yang seringkali membuat tuduhan mengalir kemana-mana. Kalau di zaman orde baru dulu menurut begawan ekonom kebocoran anggaran bisa mencapai 30 persen. Sebab banyak dana yang kemudian tak tepat sasaran. Itu baru satu case untuk Sumut. Lalu lihat pula komentar selanjutnya dengan anggota DPR RI yang gusar terhadap persiapan PON Sumut yang terkendala anggaran. Anggota DPR RI Komisi X mengungkapkan kegusarannya atas kondisi tersebut. Kalau kemudian itu berhubungan dengan kepentingan politik menurutnya sangat tidak wajar. Lalu statement serupa muncul dari Nasril Bahar yang juga anggota DPR RI. Kondisinya sama saja. Kedua kondisi tersebut membuat kita semakin banyak pertanyaan terhadap kapabilitas Pemprovsu mengelola anggaran. Dari situ lihat juga hasil kajian BPK terhadap anggaran Pemprovsu. Intisari Badan Pemeriksa Keuangan (BPK) Perwakilan Sumatera Utara, menyampaikan laporan hasil pemeriksaan (LHP) Jangan bermain-main laporan keuangan Provinsi Sumut dengan anggaran, itulah atas 2011 di gedung DPRD Sumut, Senin lalu kesimpulannya. dengan sejumlah temuan yang memengaruhi kewajaran penyajian laporan itu. BPK memberikan predikat wajar dengan pengecualian (WDP). Temuan yang memengaruhi kewajaran penyajian laporan keuangan tersebut, diantaranya, realisasi belanja pegawai 2011 disajikan sebesar Rp915,91 miliar dan belanja barang sebesar Rp1,05 triliun. Nilai tersebut termasuk belanja honorarium pegawai honorer/tidak tetap dan belanja jasa pihak ketiga pada Badan Kesbangpolinmas sebesar Rp15,27 miliar dan Rp7,41 miliar untuk hibah/dana pembinaan berupa uang kepada ormas/LSM. Selain itu, realisasi belanja honorium pegawai honorer/tidak tetap dan jasa pihak ketiga diantaranya termasuk belanja yang kegiatannya tidak dilaksanakan oleh penerima dana, sebesar Rp2,94 miliar dan belanja hibah yang tidak seluruhnya diterima oleh penerimannya, sebesar Rp1,14 miliar. Kemudian, saldo kas di bendahara pengeluaran per 31 Desember 2011 disajikan sebesar Rp15,27 miliar. Nilai tersebut diantaranya kas bendahara pengeluaran yang uangnya tidak ada, yaitu pada Biro Umum sebesar Rp9,02 miliar, Badan Kebangpolinmas sebesar Rp787,71 juta dan PPKD Biro Umum sebesar Rp916,50 juta. BPK RI juga menemukan permasalahan yang sama dengan tahun sebelumnya, antara lain pengelolaan keuangan yang tidak tertib atau dilakukan tidak sesuai dengan ketentuan, realisasi belanja yang berindikasi kerugian daerah. Kemudian pelaksanaan pekerjaan tidak sesuai dengan ketentuan /kontrak dan denda keterlambatan belum dikenakan. BPK kemudian memberi tenggat waktu kepada Pemprovsu, mengembalikan dana yang tidak bisa dipertanggungjawabkan tersebut selama enam bulan ke depan. Semua itu menunjukkan pengelolaan anggaran yang jauh dari prinsip good corporate governance. Kalau mau melihat peringkat FITRA (forum Indonesia untuk transparansi anggaran) mata kita akan semakin terbelalak dengan peringkat Sumut. Ternyata di tengah upaya untuk melanjutkan anggaran yang sehat dan efisien masih banyak hambatan. Dengan kondisi seperti ini bukan tidak mungkin semakin banyak pejabat kita yang harus berhadapan dengan kejaksaan atau KPK (komisi pemberantasan korupsi). Jangan bermain-main dengan anggaran, itulah kesimpulannya.*


Faks 061 4510025

Facebook Smswaspada

+6285761490476 *Menurutku* Ada sekian manusia yang percaya kalaw cinta itu “tidak harus memiliki”. Dan mereka juga mengaku kalaw mereka akan bahagia jika melihat orang yang di “cintanya juga bahagia dengan orang lain”. Tapi, menurut aku kalau “cinta itu harus memiliki” . Karena, rasanya sakit kalau melihat orang yang kita “sayang bahagia dengan orang lain”. Pastinya, kita ingin dia hanya “tersenyum karena kita” bukan karena orang lain . Jadi, “kejar dan raih terus cintamu” jangan biarkan dia bahagia dengan yang lain . #ingat friend “love is you” +6285664065635 Jangan Berita Besar saja yg dipampangkan dong. Berita Kecil juga..!! Hmm.. +628163179293 Yth. Waspada. Di tempat. mohon krnya utk.pengundian kuis tebak juara, agar yg pengirim 1 kuis 1 kaleng teangin yg di utamakan. Daripada 1 kaleng tapi lebih dari 1 kupon.dan yg tidak memenuhi per syaratan dibatalkan.agar nanti pemenang betul2 yg memang memenuhi persyaratan dan tdk ada rekayasa. Terima kasih. Semoga Waspada tetap dalam semboyan.demi kebenaran dan keadilan. +6281397209988 Aku heran bin aneh,ketika aku membayar rekening listrik yg tertunggak ,petugas PLN menyuruh membayar dibank Sebelah kantor PLN Jalan listrik. Selain dikenakan denda juga dikenakan biaya administrasi RP 2500.kenapa PLN memberatkan pelanggan dan tdk mau menerima pembayaran dr pelanggan,ketika listrik padam pelanggan tdk mendapatkan kompensasi hanya mau untung sendiri, mohon perhatian dan tindakan dari komisi di DPRDSU yg bermitra dgn PLN?,berapa keuntungan dari bank dalam hal ini, berapa kerugian masyarakat yg ditimbulkan dari kebijakan ini. +6282167933351 Yth Bapak Kapolres Kab Pakpak bharat... Kami atas nama masyarakat Kec stuje he...yakin dan percaya bapak bisa menertibkan warung remang-remang di dusun buluh didi.yang mana selama ini warung tsb di jadikan tempat mangkal PSK atau tempat praktek prostitusi dan peredaran narkoba...atas perhatian bapak trima kasih ... Selamat HUT bhayangkara ke 66 semoga Polri tetap jaya..... .....njuah njuah..... +6282165020382 Kami guru2 MDTA di Deliserdang tidak akan pernah mendukung pak Bupati menjadi orang no 1 di Sumut karena enggak ada perhatiannya sama guru2 agama di MDTA Deli serdang +6281396244485 Selamat HUT Bhayangkara ke 66, semoga masyarakat menjadi sayang pada Polisi, bukan sebaliknya.. +6287749488396 Kepada yth : Bapak Kapoldasu, mohon ditertibkan perjudian kartu dan penjualan togel diwarung2x diperdagangan Kec. Bandar Kab. Simalungun yg hanya menimbulkan status pidana gugatan dimasyarakat yg mengadakan pengakuan saksi hukum dimasyarakat yg beraneka ragam agama dan suku yg percaya ‘ Tuhan Yang Esa ‘ dengan upaya tipu muslihat hukum dimasyarakat untuk penggelapan bukti2x hukum perundang2xan dimasyarakat untuk memperkaya diri dari jabatan dan orang lain adalah tindak pidana korupsi yg merugikan bangsa negara yg percaya ‘ Tuhan Yang Maha Esa ‘.

WASPADA Sabtu 7 Juli 2012

Bachtiar Syahruddin Dan PTPN II Oleh Arfanda Siregar Tanah negara yang seharusnya“haram”diperjualbelikan karenahanya dipinjam pakaikan kepada PTPN II untuk lahan perkebunan—ternyata diperjualbelikan kepada sebuah yayasan di Tanjungmorawa.


achtiar Syahruddin, mungkin Anda tak mengenalnya. Beliau hanyalah pensiunan pegawai biasa dari PTPN II yang tinggal di pinggiran Tanjungmorawa, Deliserdang. Beliau bukan orang terkenal yang layak dijadikan berita utama di media massa. Menariknya sosok renta itu sehingga perlu saya ungkapkan melalui tulisan adalah keberanian dan konsistensi beliau memerjuangkan hak-hak pensiunan PTPN II. Di usianya yang mendekati uzur (70 tahun), beliau bersama para pensiunan PTPN II lain tetap teguh memertahankan tanah yang sudah dihuninya berpuluh tahun, sejak masih berkerja sebagai pegawai rendahan di PTPN II. Perjuangannya bersama pensiunan PTPN II yang lain memertahankan sepetak tanah yang bertahun-tahun ditempati layak menjadi inspirasi, terutama bagi anak bangsa yang senasib dengan beliau. Protes Rakyat Beberapa kali saya membaca curahan hati beliau di Surat Pembaca Harian Waspada tentang betapa tertindasnya nasib pensiunan PTPN II. Beliau menjeritkan suara hatinya dalam untaian kata yang menggugah perasaan. Beliau menulis bahwa dulu ketika fisik pensiunan masih segar bugar, mereka dipaksa berkerja keras dengan gaji sekepang. Setelah pensiun, bukannya mendapatkan penghargaan, malah tanah yang telah lama mereka tempati dijual secara sepihak oleh PTPN II tanpa pernah berdiskusi dengan mereka. Hati siapa yang tak hancur dengan arogansi pimpinan PTPN II yang bak tuan tanah seperti masa feodal Perancis tempo dulu. Setelah 67 tahun merdeka, mental penjajah masih bercokol di dada para pimpinan PTPN II yang memiliki kuasa. Sikap, tingkah laku, dan perasaan tak ubahnya bangsa penjajah. Pensiunan dianggap sampah dan kotoran kuda yang tak layak memiliki tempat tinggal pribadi. Para pensiunan ibarat budak yang dibayar murah ketika masih memiliki tenaga dan setelah pensiun disuruh menggelandang. Demikian Bachtiar Syahruddin menuangkan isi hati di Surat Pembaca Waspada (Waspada, 19 Juni 2012).

Protes Bachtiar Syahruddin berawal pada 9 Juni 2000, HGU ( Hak Guna Usaha) yang dipegangoleh PTPN II atas tanah seluas 75,11 Ha, di Desa Dagang Kerawan, Tanjungmorawa, Deliserdang berakhir masa berlaku. Berdekatan dengan tanah itu, tinggallah Bachtiar Syahruddin bersama puluhan pensiunan PTPN II lainnya sejak berpuluh tahun lalu. Tanah negara yang seharusnya “haram” diperjualbelikan karenahanya dipinjam pakaikan kepada PTPN II untuk lahan perkebunan— ternyata diperjualbelikan kepada sebuah yayasan di Tanjungmorawa. Saat itu, Dirut PTPN II Suwandi berdalih bahwa yayasan tersebut telah memeroleh persetujuan dari Camat Tanjungmorawa, Bupati Deliserdang, dan Gubernur Sumatera Utara untuk pengembangan Tanjungmorawa menjadi sebuah kota. Benarlah kata orang bijak, sekali orang berdusta, maka disusul dusta lainnya. Tidak hanya berdusta masalah jual beli, dusta dilanjutkan dengan manipulasi luas tanah. Pihak yayasan mengklaim lahanyang mereka beli seluas 78,16 Ha. Padahal sesuai dengan kesepakatan awal dengan PTPN II luas tanah yang mereka beli hanya 75,11 Ha. Entah bagaimana jalan ceritanya sehingga angka tersebut bisa berubah dengan seketika. Yang pasti, kisah korupsi selalu identik dengan manipulasi dan kongkalikong antara pihak yang terkait. Ukuran, jumlah, besaran, dan nilai bukan sesuatu yang sulit mengubahnya. Watak koruptor yang culas selalu mampu mencari celah untuk memuluskan niat serakah. Gara-gara manipulasi angka itulah perjuangan Bachtiar Syahruddin berawal. Penggelembungan luas lahan sebesar 19,16 Ha tersebut telah “mencuri” secara langsung rumah penduduk (pensiunan PTPN II). Jika awalnya transaksi ilegal tersebut tidak menyertakan rumahnya, namun setelah penggelembungan itu, rumah yang mereka tempati berpuluh tahun berpindah tangan kepada pihak yayasan. Pelanggaran Kosntitusi Ada ribuan pensiunan PTPN lain yang bernasib malang seperti Bachtiar Syahruddin.Sepertinya, halaman Gedung DPRD Sumut terlalu sering kedatangan para pensiunan PTPN II yang

berunjuk rasa agar hak-hak mereka sebagai warga negara diperhatikan oleh wakil rakyat. Namun, sampai sekarang dari sekian banyak persoalan tanah yang mengancam masa depan pensiunan pegawai PTPN II tak satupun yang kelar. Di usia mereka yang sepuh bukan ketenangan yang mereka terima dari perusahaan. Padahal jasa mereka kepada perkebunan tak terperi. Tangan merekalah yang menyulap hutan belantara sehingga menjadi perkebunan produktif dan profit. Habis manis sepah dibuang. Bedangkik, demikian ungkapan Jhon Tabu Ritonga mencaci PTPN II dalam salah satu tulisannya menanggapi persoalan tanah pensiunan itu. Bagaimana tidak bedangkik, jika dengan mantan pegawainya yang banyak berjasa mencetak keuntungan bagi perusahaan mereka bedangkik, sementara kepada investor dan developer mereka sangat baik dan bersahabat (Waspada, 17 Juni 2012). Coba saja lihat harga tanah yang dijual kepada pihak yayasan di Desa Dagang Kerawan, Tanjungmorawa, hanya dijual seharga sekitar Rp. 11.500,-/m. Begitu juga dengan penjualan aset lain meliputi RS Tembakaudeli, Lahan HGU/ Eks HGU di Langkat, Medan dan Deliserdang semuanya dijual dengan harga di bawah harga normal. Jika menjual tanah semurah itu, me-

ngapa tidak dijual saja kepada pensiunan perkebunan? Apalagi, sesuai dengan Surat Keputusan Menteri Keuangan No.89/KMK.013/1991, tanggal 25 Januari 1991 mengatakan bahwa karyawan/ pensiunan lebih diutamakan membeli/ menggantirugi rumah dinas karyawan. Bahkan, mengacu kepada UU perkebunan Nomor 81, lahan yang lepas HGU tak boleh diperjualbelikan kepada pihak ketiga. Juga berdasarkan pasal 33 ayat 3 UUD 45, negara sebagai organisasi kekuasaan seluruh rakyat mempunyai hak menguasai dari negara atas bumi air serta ruang angkasa dan hak tersebut wajib digunakan dalam rangka mencapai sebesar-besarnya kemakmuran rakyat. Maka atas kalimat penggunaan kata hak pada konstitusi tersebut, negara wajib memerhatikan kesejahteraan rakyat banyak. Dengan perlindungan konstitusi sekuat itu, mengapa orang-orang seperti Bachtiar Syahruddin harus terus disiksa dan diancam keberadaannya di atas tanah yang bertahun-tahun ditempatinya. Kemanakah hati nurani wakil rakyat dan eksekutif membiarkan pimpinan PTPN II bergaya tuan tanah mengusiri para pegawainya yang pernah berjasa. Apakah sudah tak punya nurani lagi sehingga membiarkan angkara murka yang pongah menindas rakyat kecil seperti Bachtiar Syahruddin? Penulis adalah Dosen Politeknik Negeri Medan.

Negeri Para Preman Oleh Arfan Adha Lubis Ironinya akar permasalahan mengapa orang menjadi preman,tidak lagi sebatas alasan klasik seperti kemiskinan.


akta teranyar menunjukkan aksi dan pemakaian jasa preman semakin marak dipesan plus dilakukan untuk menyelesaikan beragam persoalan dan urusan. Ranah bisnis, penagihan hutang, sampai soal jasa keamanan kini kerap memakai tenaga preman. Maka jangan heran profesi mendapatkan stigma negatif ini telah tumbuh menjadi paham (isme) bagi sebagian orang. Tak perlu Diklat apalagi pendidikan akademik untuk menggeluti dunia premanisme. Cukup punya nyali dan bertindak brutal untuk menunjukkan eksistensi. Agar lebih ditakuti, kalau bisa berperawakan seram dan punya modal bertubuh kekar. Keberadaan premanisme kian tak terbantahkan di setiap segi kehidupan. Dibenci, ditakuti, namun tak jarang dipakai untuk menyelesaikan masalah. Fakta empiris menggetarkan hati, aksi brutal sekumpulan preman menyerang Rumah Sakit Pusat TNI AD (RSPAD). Aksi bar-bar pembawa petaka, merenggut 2 nyawa dan 4 korban terluka di RSPAD. Serta merta keamanan menjadi barang langka di republik ini dibalik aksi kekerasan yang meningkat secara signifikan. Ironinya akar permasalahan mengapa orang menjadi preman, tidak lagi sebatas alasan klasik seperti kemiskinan. Tetapi sudah menjadi profesi untuk meraup pundi-pundi secara instan. Adalah sangat fantastis gaji dan bonus yang diterima preman sebagai tenaga jasa keamanan baik dalam sengketa lahan, maupun yang dipakai sebagai garda terdepan dalam urusan “bermasalah” lainnya. Bisa kisaran ratusan juta bahkan miliaran. Bukan main.! Paling konyol sekaligus memuakkan aksi dan pola-pola tindakan premanisme pun telah mengkontaminasi dunia pendidikan. Mengkooptasi kepentingannya dengan modus aksi ancam mengancam untuk kepentingan pribadi. Lihat saja tikus-tikus pendidikan melakukan pungli di ranah pendidikan. Oknum tikus-tikus pendidikan ini punya kewenangan, sehingga pola-pola aksinya yang mengancam bawahannya untuk kepentingan pribadi, kerap tidak terekspos ke publik. Padahal ia mengkooptasi kepentingan pribadinya dengan cara-cara premanisme pula. Alhasil disini preman, disana preman. Dimana-mana ada

tindakan premanisme. Baik di lembaga pemerintah disebut preman berdasi, di bidang ekonomi ada preman ekonomi, dan di bidang pendidikan termasuk berpartisipasi melakukan aksi premanisme, yaitu tikus-tikus pendidikan dengan cara melakukan pungli dan main ancam-mengancam. Pengertian Preman & Kejahatan Abdul Hakim Siagian dalam makalahnya mengatakan, istilah preman berasal dari Medan kemudian dipakai secara nasional. Dunia preman mempunyai kelompok-kelompok, hal itu didasarkan pada prinsip hidup yang sama, di dalam satu jaringan preman biasanya muncul star/bos dan dalam jaringan itu lahir aturan norma yang mereka buat sendiri. Sehingga bila antara kelompok preman satu dengan lainnya bermasalah, mereka akan menyelesaikan sendiri dengan norma mereka. Kesetiakawanan di antara preman cukup baik, hal ini mungkin karena prinsip hidup yang sama. Tingkat senioritas dikenal dan cukup dijunjung tinggi. Ikatan cukup kuat di antara sesama preman jelas terlihat, dalam hal suka cita maupun duka cita (A. Hakim Siagian, disampaikan sebagai makalah dalam diskusi Himpunan Mahasiswa Jurusan Hukum Pidana, Fakultas Hukum, UMSU, pada tanggal 13 April 1996). Sampai kini belum ada definisi tepat plus kata sepakat untuk memberikan arti preman. Di titik asal katanya preman berasal dari Bahasa Inggris, yakni patah kata “free” dan “man”. Menurut Asma Affan, preman adalah manusia yang tidak mau terikat pada segala macam institusi, menginginkan segalanya berjalan sesuai dengan kemauannya dan terlepas dari peraturan yang mengikat. Sedangkan definisi kejahatan menurut W.A. Bonger, adalah perbuatan yang sangat anti sosial, yang oleh negara ditentang dengan sadar. Menurut B. Simanjuntak dalam bukunya Pengantar Kriminologi dan Patologi Sosial, kejahatan dirumuskan sebagai suatu tindakan anti sosial yang merugikan, tidak pantas, tidak dapat dibiarkan, yang dapat menimbulkan kegoncangan dalam masyarakat. Berangkat dari pendapat kedua pakar di atas, maka premanisme jelas termasuk ruang lingkup kejahatan.

Solusi Memberantas Premanisme Wacana kekerasan di negara ini kembali dibangunkan dengan aksi barbar oleh tindakan preman. Untuk mengantisipasinya jangan terulang diperlukan penanganan secara komprehensif dan lintas sektoral. Pendekatan persuasif plus preventif dengan mengelaborasi seluruh instansi dan elemen terkait tak salahnya lebih ditingkatkan. Tapi jangan sekedar lip service dan musiman. Memberantas preman dengan cara mencoba menghidupkan kembali penembak misterius (petrus) adalah merupakan aib dan tindakan biadab notabene bagi negara yang mengklaim sebagai negara hukum. Terlebih dari itu penanganan yang dilakukan secara kekerasan, akan berpotensi melahirkan embrio kekerasan pula. Selain itu merupakan pengingkaran terhadap nilai-nilai Hak Asasi Manusia (HAM). Lebih baik wujudkan hukum sesuai dengan fungsinya menciptakan ketertiban dan keadilan di tengah masyarakat. Bukan malah sebaliknya menciptakan kekacauan dan ketidakpercayaan, serta pendistorsian hukum. Untuk itu sesuai tugas dan wewenang kepolisian, kita minta untuk lebih meningkatkan kinerjanya dalam memberikan perlindungan, pengayoman, dan pelayanan kepada masyarakat. Bersikaplah proaktif dan profesional dalam menyikapi pengaduan masyarakat. Jangan sampai rakyat bertindak sendiri dan peradilan jalanan menjadi alternatif dipilih. Selain itu paling penting, sejatinya penegak hukum jangan mencontohkan dengan memakai cara-cara preman dalam mensikapi aksi anarki. Karena kalau tidak kekerasan akan membudaya di setiap nadi kehidupan kita. Solusi lain yaitu perlu seleksi lebih ketat dalam mendirikan suatu organisasi kemasyarakatan (Ormas). Notabene UU No. 8 Tahun 1985 tentang Ormas akan diubah. Penutup Pasal 13 UU No. 2 Tahun 2002 tentang Kepolisian, berbunyi “Tugas pokok kepolisian Negara Republik Indonesia adalah: a. memelihara keamanan dan ketertiban masyarakat; b. menegakkan hukum; dan c.memberi perlindungan pengayoman, dan pelayanan kepada masyarakat. ”Lebih lanjut Pasal 3 ayat (1) UU No.2 Tahun 2002, berbunyi “Pengemban fungsi Kepolisian adalah Kepolisian Negara Republik Indonesia yang dibantu oleh: a. kepolisian khusus; b. penyidik pegawai negeri sipil; dan/atau, c. bentukbentuk pengamanan swakarsa”. Menelaah bunyi Pasal 13 UU No. 2

Tahun 2002, jelas polisi mempunyai otoritas dalam memberikan rasa aman plus pengayoman. Sedangkan menelaah bunyi Pasal 3 ayat (1) UU No. 2 Tahun 2002, jelas dikatakan di situ tidak ada istilah preman untuk jasa pengamanan. Tapi realita di lapangan, kerap aksi preman berlangsung, atau bahkan terindikasi oknum polisi sendiri berlakon dan bertindak ala preman. Alhasil preman berhasil dijaring preman jalanan. Notabene melakukan kejahatan karena sekedar urusan klasik, kemiskinan. Sedangkan preman berdasi termasuk para koruptor, yang berlindung di balik safari, atau organisasi, kerap tak tersentuh dengan alasan klasik, tak cukup kuat alat bukti. Penulis adalah Alumni FH-UMSU, Kandidat Magister PPs Ilmu Hukum UMSU, Dosen FH-UNPAB.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Pemerintah harus peduli budaya dan adat - Terutama budaya malu * Anggota DPR gusar, persiapan PON terkendala - Kalau cuma gusar, awak pun begitu, he...he...he * Pengolahan semen curah kembali beroperasi - Kayak ngelece!


D Wak

Ekonomi & Bisnis

WASPADA Sabtu 7 Juli 2012



Armin Nasution Redaktur Ekonomi

RUPSLB Ulangan SAYA baru menitu yang disampaikan komisaris utamanya dapatkan informasi dengan menggunakan UU PT. Aneh kalau terbaru tentang mereka menggunakan UU PT untuk RUPSLB (rapat perbankan. Sebab UU PT hanya bisa umum pemegang saham luar biasa) Bank dipakai untuk perseroan terbatas. Tapi Sumut yang digelar pertengahan bulan lalu untuk perbankan tidak bisa sebagai dasar. dan kemudian bermasalah. Mungkin Karena bank harus tunduk pada Peraturan informasi ini juga BI. Ada peraturan belum sepenuhnya yang lebih khusus tercium kawan(lex specialist) soal Maka wajar dengan melihat kawan media. bank, yakni alasan-alasan itu kemudian Ternyata BI Peraturan BI. sudah memutuskan Pelanggaran RUPSLB Bank Sumut harus RUPSLB tersebut Peraturan BI itu digelar lagi untuk mengangkat mesti diulang adalah soal Plt dengan menguDireksi yang dipilih direksi sebelumnya yang kuhkan direksi lama pemegang saham menjabat. Kita tunggu saja apa untuk menjabat. (pengendali). Tiga kata para pelaksana direksi dan Informasi itu saya orang yang diangkat, dapatkan dari untuk jabatan komisaris di Bank Sumut. Saya berbagai sumber. Direktur Utama, yakin mereka tak akan berani buka Direktur Pemasaran Jadwal RUPS ulangan harusnya dan Direktur Umum, suara. Paling hanya menjawab: sudah digelar pekan belum diuji silakan tanya ke BI. ini. kelayakan dan Namun kepatutan oleh BI. kemudian ditunda Peraturan BI oleh komisaris mengharuskan itu. utama dan pemeZenilhar yang gang saham diangkat sebagai Pjs pengendali. Secara Direktur Umum hukum memang harus mengikuti lagi seharusnya RUPSLB uji kelayakan dan itu batal demi kepatutan untuk hukum jika jabatan itu. Sebab mengikuti sebelumnya dia Peraturan Bank Direktur Pemasaran. Indonesia (PBI). Sementara Pjs Hanya saja Dirut Bank Sumut seperti biasa, BI Rizal Fahlevi Medan tetap tidak Hasibuan, memang mau memberikan keterangan yang benar sudah diuji kelayakan dan kepatutan oleh kepada media. Mereka selalu diam dan BI. Namun konteks pengujian itu adalah memberi kesempatan kepada ruang-ruang sebagai Komisaris Independen bukan Pjs publik menilai kasus RUPSLB ini sesuai Dirut. Maka untuk jabatan itu dia harus persepsi masing-masing. menjalani uji kelayakan dan kepatutan Pun informasi yang menyebutkan lagi. Rudi Dogar juga tidak pernah diuji sebelum RUPSLB sudah dua kali Nasser untuk jabatan Pjs Direktur Pemasaran. Itu Atorf bertemu dengan pejabat penting di baru satu pelanggaran. Sumut untuk mendudukkan para direksi Pelanggaran lain adalah pengangkatan dan komisaris yang sekarang, tak bisa Plt direksi dengan mekanisme yang diatur disangkal BI. Peraturan BI, yakni melalui Komite Walau nama Nasser Atorf sudah terbaNominasi dan Remunerasi Bank Sumut. wa-bawa ke permukaan tetap saja mereka Di mana isinya adalah Komisaris Utama, tak mau menjawab jika sudah ditanyakan dua Komisaris Independen, dan Kepala RUPSLB Bank Sumut. Sasaran terakhir Divisi SDM PT Bank Sumut. adalah melempar kasus ini ke BI Jakarta. Sebelum RUPSLB, jabatan dua BI Medan menyatakan untuk masalah Komisaris Independen masih kosong. Dan ini silakan ditanyakan ke Jakarta. Melihat baru saat RUPSLB itu jabatan itu diisi kondisi yang terjadi dan sikap BI Medan dengan nama yang sudah diserahkan BI yang terus bungkam sebenarnya saya pada pemegang saham pengendali. sudah sempat menghubungi Difi A Kenapa baru saat RUPSLB itu nama Johansyah. komisaris independen diumumkan Melalui telefon dan pesan singkat saya padahal sudah lama diserahkan. coba hubungi yang bersangkutan untuk Dua nama itu adalah Rizal Fahlevi mendapatkan informasi lebih jelas soal Hasibuan dan Burhan Rangkuti. Tapi keputusan RUPSLB yang diulang. Awalnya kemudian kenapa Brata Kesuma yang Humas BI ini mau merespon. ditunjuk. Padahal yang bersangkutan tidak Tetapi setelah diminta penjelasan soal ikut diuji BI. Makanya jabatan Brata itu Bank Sumut dia diam. Jadi ini kembali pelaksana Komisaris Independen tidak mengingatkan saya pada Rusli definitif. Simanjuntak yang dulu Humas BI dan Maka wajar dengan melihat alasansekarang ditahan KPK. Rusli-lah yang alasan itu kemudian RUPSLB Bank Sumut memulai era keterbukaan BI. harus digelar lagi untuk mengangkat Namun kemudian di tangan Difi dan direksi sebelumnya yang menjabat. Kita kawan-kawannya di BI Medan tunggu saja apa kata para pelaksana keterbukaan kepada media itu menjadi hal direksi dan komisaris di Bank Sumut. Saya sulit. Banyak sebenarnya yang mengganjal yakin mereka tak akan berani buka suara. RUPSLB Bank Sumut. Paling hanya menjawab: silakan tanya ke Lihat misalnya peraturan pelanggaran BI.


SITA PRODUK PALSU: Petugas Direktorat Jenderal Hak Kekayaan Intelektual (Dirjen HKI) dan petugas kepolisian memperlihatkan barang sitaan berupa pensil dan rautan bermerk Exam Grade di sebuah gudang di Bandung, Jawa Barat, Kamis (5/7). Pemalsuan merk tersebut mengakibatkan kerugian negara senilai Rp3 miliar dengan jumlah barang rautan pensil sebanyak 54.000 buah dan pensil sebanyak 832.752 buah.

Kebutuhan Daging Sapi Sambut Meugang Di Agara 300 Ekor KUTACANE (Waspada) : Kepala Dinas Peternakan Aceh Tenggara (Agara) Sragafa menyebutkan menyambut bulan Ramadhan 1433 H dan meugang, pihaknya akan menurunkan petugas di kecamatan untuk mengantisipasi agar sapi bantuan pemerintah tahun 2010-2011, tidak disembelih oleh warga. Berbicara, Kamis (5/7), dia sebutkan kebutuhan daging sapi menyambut meugang pada bulan Ramadhan ini diperkirakan mencapai 300 ekor. Dipastikan stok untuk pemenuhan daging sapi ini bisa dipenuhi sapi lokal tanpa perlu mendatangkan daerah luar Aceh Tenggara. Pasalnya, sapi pembagian pemerintah tahun 2008-2009 sebagian telah bisa dimanfaatkan masyarakat, ditambah lagi sapi yang dimiliki

pribadi oleh masyarakat, stok cukup, kata Kadis Peternakan. Kecuali dijamin ketersediaan kebutuhan daging sapi bagi rakyat Agara ini, Sragafa juga menyebutkan, pihaknya akan menurunkan tim kecamatan memantau serta mengantisipasi agar sapi pemerintah yang dipelihara masyarakat yang belum dilengkapi administrasi pelepasannya menjadi milik masyarakat, terutama sapi yang disalurkan pada tahun 20102011, ditegaskan, tidak boleh disembelih. Bila ada yang nekad memanfaatkan disembelih pada Ramadhan 1433 H, Meugang, ini, mereka akan bersinggungan dengan hukum, sesuai perjanjian penerima bantuan sapi. Sragafa menyebutkan sapi bantuan bersifat revolving tahun penyaluran 2008-2009. Me-

mang telah ada yang bisa dimanfaatkan penerima, artinya sapi yang mereka terima dulu, anaknya telah digulirkan pada penerima berikutnya, maka induknya sah menjadi milik mereka, dengan melengkapi berkas pelepasan kepemilikan dari Dinas Peternakan Agara. Sedangkan bantuan sapi penyaluran tahun 2010-2011, sekira 600 ekor, tidak ada satupun yang bisa disembelih warga penerima bantuan. Pasalnya, sapi-sapi itu, belum ada yang beranak, untuk digulirkan pada penerima bantuan berikutnya. Diperkirakan tiga hingga empat tahun ke depan, sapi bantuan pemerintah tahun 2011, baru bisa dilepas menjadi milik penerima bantuan, setelah digulirkan anaknya pada warga lainya. (b25)



Menkokesra Agung Laksono (tengah) bersama Ketua LPPOM MUI Lukmanul Hakim (kiri) Ketua MUI Amidhan (Kanan) mendapat penjelasan dari PR Head GarudaFood Group, Agus Nadi di stand GarudaFood dalam acara Indonesian Halal Expo (INDHEX 2012) di Jakarta, Kamis (5/7) . GarudaFood Group merupakan salah satu perusahaan makanan dan minuman terdepan di Indonesia yang terus concern dan berkomitment pada kehalalan produk, untuk pasar global, GarudaFood melebarkan bisnisnya ke lebih dari 30 negara di Asia, Eropa, Afrika, Australia dan Timur Tengah.

Jelang Ramadhan, Pedagang Mulai Stok Barang MEDAN (Waspada) : Menjelang Ramadhan, para pedagang bahan pokok di Medan sudah mulai nampak melakukan stok barang dagangannya. Hal ini dilakukan untuk mengantisipasi lonjakan permintaan konsumen yang biasanya terjadi pada bulan puasa. Pantauan Waspada, Jumat (6/7), sebagian besar pedagang dibeberapa pasar tradisional mulai melakukan persiapan dengan menambah jumlah stok barang. Kebanyakan barang yang ditambah tersebut berupa kebutuhan pokok, seperti beras, minyak goreng, tepung, sayuran dan sejumlah kebutuhan pokok lainnya. Hal ini pun seperti yang dilakukan Ginting, pedagang bahan pokok di Pusat Pasar Medan. Dia mengaku jelang Ramadhan kali ini dirinya sudah

menambah stok dagangannya sekitar 20 persen hingga 40 persen lebih banyak dari stok biasanya. Menurutnya, hal ini sengaja dilakukan agar tidak kesulitan melayani permintaan konsumen yang terus meningkat selama bulan puasa hingga Lebaran nanti, selain itu juga sebagai upaya mengantisipasi lonjakan harga. “Kita memang sudah melakukan stok barang seperti gula pasir, minyak goreng, beras, tepung, dan lainnya. Sebab

kalau tidak dilakukan dari sekarang, ditakutkan jelang Ramadhan nanti harga akan semakin tinggi. Inilah salah satu upaya kami untuk mengatasi lonjakan harga tersebut,” ujarnya. Ditambahkannya, untuk beras misalnya, saat ini dia memasok 20 goni setiap minggunya, sementara biasanya dia hanya memasok 15 goni. Walaupun tidak semuanya habis terjual, lanjutnya, beras yang sisa tersebut bisa diperlukan sebagai cadangan untuk mengantisipasi permintaan yang lebih tinggi lagi menjelang Lebaran nanti. Saat ini, menur utnya kenaikan harga sudah mulai terjadi, namun kenaikan harga tersebut tidak terlalu tinggi. Dia mengaku hampir setiap barang seperti beras, minyak goreng, dan gula pasir mengalami kenaikan Rp500 per kilonya.

BI Temukan Uang Palsu Rp71.090.000 M E D A N ( Wa s p a d a ) : Sepanjang 2012 (Januari-Juni), Bank Indonesia (BI) menemukan uang palsu melalui transaksi di perbankan dan laporan masyarakat sebanyak 1.166 lembar dengan nilai Rp71.090.000. Sedangkan selama Juni 2012, temuan uang palsu sebanyak 221 lembar senilai Rp13.170.000. “Temuan uang palsu pada Juni mengalami peningkatan dibandingkan bulan sebelumnya yang tercatat sebesar Rp11.005.000. Uang palsu tersebut ditemukan melalui transaksi pembayaran di perbankan dan laporan dari masyarakat,” kata Deputi Direktur Divisi Ekonomi Moneter Kantor Perwakilan BI Wilayah IX Sumut dan Aceh Mikael Budisatr io, kemarin. Mikael menyebutkan temuan uang palsu Juni 2012 sebanyak 221 lembar dengan rincian 50 lembar pecahan Rp100.000, 160 lembar pecahan Rp50.000, 7 lembar pecahan Rp20.000, 2 lembar pecahan Rp10.000 dan 2 lembar pecahan Rp5.000 dengan total nilai nominal sebanyak Rp13.170.000.

Sebelumnya Deputi Direktur Divisi Sistem Pembayaran Kahfi Zulkarnaen mengingatkan kepada masyarakat untuk mewaspadai peredaran uang palsu di tengah masyarakat. Sebab, bila dilihat dari statistik temuan uang palsu tersebut, masih banyak beredar uang palsu di masyarakat. Apalagi, kata Kahfi, menjelang bulan puasa dan Idul Fitri masyarakat harus lebih waspada terhadap peredaran uang palsu tersebut, sebab, biasanya peningkatan uang palsu kerap terjadi menjelang hari-hari besar dan kondisi tersebut bisa mencapai 100 persen. Oleh karena itu, katanya, masyarakat diminta untuk berhati-hati dalam menerima uang tunai atau melakukan transaksi dengan uang tunai. “Karena uang palsu tidak dilakukan penggantian oleh BI, sehingga masyarakat yang akan dirugikan dengan adanya uang palsu tersebut. Selain itu, uang palsu juga dapat mengganggu kegiatan perekonomian,” katanya. Dia mengimbau kepada

masyarakat, jika menemukan adanya uang palsu jangan takut untuk melaporkan ke kepolisian atau ke BI. Dengan masyarakat melapor, itu akan membantu meminimalisir beredarnya uang palsu, juga membantu aparat terkait dalam rangka menanggulangi peredaran uang palsu. Untuk meminimalisir terjadinya pemalsuan uang, katanya, BI tetap melakukan upaya-upaya preventif untuk mencegah peredaran uang palsu dengan memberikan sosialisasi kepada masyarakat dan membuat training of trainer kepada petugas bank untuk menyaring uang yang masuk ke perbankan. “Di samping melakukan kegiatan sosialisasi, kita juga melakukan penelitian terhadap uang tersebut maupun terhadap teknologi yang dipergunakan terhadap pemalsuan uang tersebut. Kita juga mengimbau kepada masyarakat untuk berhati-hati dengan melaksanakan program ‘3 D’, dilihat, diraba dan diterawang,” ujarnya. (m41)

Ekonomi Sumut Masih Stabil MEDAN (Waspada): Kondisi perekonomian di Sumatera Utara stabil, meskipun terjadi perlambatan ekspor yang diakibatkan ketidakpastian pemulihan ekonomi global. Hal ini ditunjukkan dengan kinerja perbankan yang menunjukkan peningkatan dan pertumbuhan aset. Tercatat, aset perbankan di Sumut Mei 2012 sebesar Rp167,36 triliun, meningkat 1,08 persen dibandingkan bulan sebelumnya. Tren peningkatan aset perbankan dipicu pertumbuhan Dana Pihak Ketiga (DPK) dan penghimpunan kredit perbankan.

“Secara tahunan perkembangan aset perbankan menunjukkan peningkatan 16,44 persen (yoy). Secara umum, kinerja perbankan di Sumut menunjukkan tren yang meningkat. Hal ini menunjukkan masih stabilnya kondisi perekonomian daerah di tengah perlambatan ekspor akibat ketidakpastian pemulihan ekonomi global,” kata Deputi Direktur Ekonomi dan Moneter Bank Indonesia Wilayah IX Sumut-Aceh Mikael Budisatrio, di Medan, kemarin. Mikael menyebutkan, penghimpunan DPK perbankan di Sumut mengalami

peningkatan sebesar 0,26 persen (mtm) menjadi Rp129,57 triliun. Pertumbuhan ini tidak terlepas dari peningkatan pada komponen DPK terutama giro yang meningkat sebesar 2,15 persen (mtm) dibandingkan bulan sebelumnya. “Hal ini menunjukkan bahwa kegiatan usaha di Sumut masih menunjukkan peningkatan yang tercermin dari peningkatan penghimpunan giro perbankan,” ujarnya seraya mengatakan, hal ini juga terjadi dalam penghimpunan tabungan yang juga menunjukkan peningkatan sebesar 0,24 persen. (m41)

“Saat ini saya jual beras untuk jenis IR 64 Rp8.500 dari sebelumnya Rp8.000 per kg, minyak goreng Rp11.000 dari sebelumnya Rp10.500 per kg, gula pasir Rp13.500 dari sebelumnya Rp13.000 per kg,” ujarnya. Ditempat terpisah, Romi, pedagang sayuran di sana juga melakukan hal yang sama. Saat ini dia berusaha mencari pengumpul sayuran yang lain dari beberapa daerah untuk me-

nambah jumlah pasokan barangnya. “Biasanya saya hanya mengambil barang dari pengumpul yang datang dari Berastagi dan Padang Sidempuan, sekarang saya berusaha mencari pengumpul lain lagi untuk menambah pasokan. Sebab jelang Ramadhan permintaan konsumen dipastikan akan meningkat, hal ini seperti yang terjadi pada tahun sebelumnya,” ujarnya. (cdu)

Pegadaian Realisasikan UP 38,86 Persen MEDAN (Waspada): PT Pegadaian (Persero) Kanwil Medan menjelang semester I tahun 2012 berhasil merealisasikan penyaluran Uang Pinjaman (UP) sebesar Rp2,2 triliun atau 38,86 persen dari target tahun 2012. Target UP 2012 sebesar Rp5,79 triliun. “Dari realisasi tersebut, maka pertumbuhan penyaluran UP secara konvensional tingkat pertumbuhannya mencapai 47,38 persen dibandingkan tahun lalu sebesar Rp1,5 triliun,” kata Pimpinan Wilayah Pegadaian Medan Agus Priyambodo melalui Kepala Humas Lintong P Panjaitan, kemarin. Lintong menjelaskan realisasi pencapaian target tertinggi UP se Kanwil Medan terbesar diraih KCP Medan Utama sebesar 45,90 persen, disusul CPP Labuhan Ruju 43,50 persen, Padangsidimpuan 42,93 persen. Sedangkan CPP pencapaian terendah terdiri dari CPP Sei Rampah 33,64 persen, CPP Medan Pringgan 35,84 persen dan CPP Helvetia sebesar 36,19 persen. Untuk Unit Pelayanan Cabang (UPC), pencapaian omset di bawah Rp500 juta ada tujuh unit. Ketujuh UPC tersebut adalah UPC Suprapto Sibolga Rp138,5 juta, UPC Natal Rp144,2 juta, UPC Kuala Tanjung Rp300,4 juta, UPC Sumbul Sidikalang Rp400,3 juta, UPC Pinangsori Sibolga Rp417,7 juta, UPC Kelumpang Kp. Lalang Rp459 juta dan UPC Hamparan Perak Labuhan Deli Rp460,4 juta. Sedangkan UPC dengan realisasi di atas Rp1 miliar terdiri dari UPC Pasar Garuda Medan Mandala Rp6,7 miliar, UPC Siantar Plaza Rp3,4 miliar, UPC Marihat Siantar Rp3,2 miliar, UPC Delitua Rp3,2 miliar dan UPC Marindal Rp2,9 miliar. (m41)

Falsafah Koperasi Sudah Dibuang PEUSANGAN (Waspada): Koperasi adalah satu organisasi otonom telah diakui diseluruh dunia yang dapat meningkatkan ekonomi masyarakat. Namun, selama ini banyak pengurusnya telah membuang falsafah atau tidak lagi digunakan, sehingga aktivitas organisasi tersebut tidak berjalan sebagaimana diharapkan. “Banyak pasal yang mengatur koperasi, bahkan di beberapa negara lain koperasi begitu berkembang karena mereka menjalankannya sesuai dengan falsafah koperasi, namun kita sebaliknya,” kata pembina Dekopin Aceh Muhammad Hanafiah dalam pelantikan pengurus KUD Karya Baru Peusangan, Bireuen, Kamis (5/7) diikuti pembina mantan pengurus lama dan pengurus yang belum lama terbentuk. Acara yang berlangsung secara kekeluargaan HM Hanafiah yang langsung dipersilakan untuk melantik pengurus baru KUD Karya Baru, namun sebelumnya, dia berpesan kepada pengurus baru, di antaranya supaya menjalankan organisasi tersebut sesuai ketentuan dan tidak meninggalkan lagi falsafah koperasi. “Laksanakan rapat setiap sebulan sekali dengan sesama pengurus dan anggota dan utamakan transparansi dalam organisasi ini, supaya ke depan KUD Karya Baru Matang Geulumpangdua ini menjadi contoh bagi KUD lain yang ada di Aceh yang selama ini telah banyak yang kurang berjalan,” pesannya. Terkait pelantikan pengurus, Hanafiah mengatakan bukan dirinya yang melantik namun semua pengurus dan anggota serta pembinannya dengan secara bersama-sama, setelah pengurus membaca butir-butir janjinya. “Beginilah yang sebenarnya pelantikan pengurus KUD dilakukan, jadi bukan pihak Dekopin yang melantik, namun anggotanya. Sedangkan pihak Dekopin hanya menyaksikan atau menuntunnya saja acara pelantikan seperti ini,” katanya. Setelah itu, Hanafiah, mempersilahkan, pengurus baru, yaitu Ibrahim Hasjmy, ketua, Azhari, sekretaris, Khaidar, bendahara, untuk membaca janjinya yang tertulis secara bersama. Lalu ketiganya meminta menanganinya berita acara ucapan janjinya yang disaksikan para pembinannya. Kemudian, diminta kepada anggota dan pembina yang hadir untuk melantiknya bersamaan mengucapkan selama menjalankan tugasnya. (cb02)



WASPADA Sabtu 7 Juli 2012

Waspada/Arianda Tanjung

PENGENDARA sepeda motor melewati kantor Gus Irawan Center di Jl S Parman Medan, Kamis (5/7). Seperti diketahui Gus Irawan yang juga Ketua KONI Sumut termasuk salah satu calon Gubernur Sumatera Utara.

Pemimpin Sumut Nantinya Harus… TAK lama lagi, masyarakat Sumut akan menggelar pesta demokrasi memilih Cagubsu (Calon Gubernur Sumatera Utara) untuk kedua kalinya. Tentu dibutuhkan ketelitian, karena pilihan kita akan menentukan kondisi kehidupan seluruh masyarakat Sumut untuk beberapa tahun ke depan. Pilihan yang tepat akan memunculkan pemimpin berkualitas serta memiliki visi misi yang jelas demi kemajuan provinsi tercinta ini. Sebaliknya, jika salah memilih, bukan mustahil akan memperburuk keadaan yang telah semrawut.

Bagi sebagian masyarakat yang masih hidup dalam garis kemiskinan dan serba kekurangan, akan sulit menentukan pilihannya secara bijaksana. Ini karena umumnya yang mereka dukung adalah Cagubsu yang rajin “menghamburhamburkan” uang, makanan atau kebutuhan pokok saat kampanye. Tapi mendukung belum tentu memilih lho... Hal ini juga dikarenakan pendidikan politik yang belum menyentuh lapisan bawah masyarakat, sehingga mereka kurang memiliki kesadaran pentingnya hak politik sebagai pemilih untuk menentukan calon pemimpin Sumut masa depan. Terlepas dari itu, kita harus optimis dapat menggugah kesadaran masyarakat khususnya pemilih pemula bahwa pilihan mereka amat menentukan kemajuan Sumut ke depan, sehingga harus sesuai hati nurani dan mempertimbangkan secara teliti sebelum memilih. Tak banyak yang diharapkan, dengan memberikan warna baru bagi kehidupan masyarakat Sumut di segala

aspek merupakan dambaan yang sangat dinanti. Bila kita menoleh ke belakang, potret kehidupan anak-anak Sumut yang juga generasi bangsa ini banyak mengalami masalah dalam lingkungannya, sebagian besar dikarenakan masalah ekonomi. Sesuai hasil temuan Kreasi melalui data Komisi Perlindungan Anak Indonesia (KPAID) Sumut, sejak tahun 2010 daftar kasus pengaduan meningkat. Bila tahun 2010 daftar pengaduan mencapai 153, maka di tahun 2011 bertambah menjadi 163. Di tahun 2012 sampai akhir Juni lalu daftar pengaduan sudah mencapai di angka 90. Pengaduan yang dilakukan juga bervariasi seperti penganiayaan, pencabulan, trafficking dan hak asuh anak. Melihat fakta-fakta di atas maka sudah seharusnyalah mereka peka akan masalah tersebut. Untuk itu, visi misi Cagubsu penting. Jangan mudah terpukau sederetan visi yang tampak menjanjikan kesejahteraan dan kemakmuran masyarakat. Pilihlah yang memiliki visi realistis sesuai

kebutuhan Sumut. Prioritas utama Sumut 1 adalah kemiskinan dan dunia pendidikan yang terkesan “asal-asalan”. Terbukti setiap menjelang Penerimaan Siswa Baru (PSB) istilah bangku gelap selalu menghantui siswa beserta orangtua. Bagi mereka yang punya uang, bisa memilih sekolah yang mereka inginkan. Sadar atau tidak, fenomena ini mengajarkan mereka berbuat curang. Jika praktik ini berlanjut, tidak menutup kemungkinan mereka memiliki mental bak koruptor nantinya. Nah, sekarang kita tinggal menunggu saat-saat penentuan sang pemimpin Sumut mendatang. Harapan demi harapan sudah digantungkan oleh masyarakat kepada pemimpin yang baru. Kita berharap siapapun yang bakal memimpin Sumut nantinya adalah sosok pembawa amanah masyarakat. Tapi ingatlah wahai pemimpin, jika bukan rakyat yang memilih, kalian bukan apa-apa! *Arianda Tanjung

Siapkan Diri Untuk Sambut Ajaran Baru NGGAK terasa, genap dua minggu siswa SD, SLTP, dan SLTA mengistirahatkan tenaga dan pikiran selepas ujian semester. Liburan panjang akan segera berakhir dan hari pertama sekolah pada Senin (9/7) lusa sudah di depan mata. Otomatis berbagai hal dilakukan untuk menghadapi tahun pelajaran baru. Kelas, guru bahkan suasana baru siap menyambut kita. Ada yang masih santai dengan segala kegiatan liburannya, tapi ada juga yang sudah mempersiapkan diri menjelang hari pertama nanti. Ada yang sudah

mempersiapkan seragam dan peralatan sekolah lainnya, tapi itu semua bukanlah hal yang terlalu penting. Yang terpenting adalah siswa dapat mempersiapkan dirinya untuk menghadapi ajaran baru seperti mempersiapkan wawasan yang luas dengan membaca atau berdiskusi dengan teman. Ajaran baru, segala rutinitas sehari-hari pun mulai kembali dilaksanakan kayak bangun pagi, berangkat sekolah, kena macat di jalanan, mengerjakan Pekerjaan Rumah (PR), dan

Tiffany Mufty USU “Bagiku, siapapun yang terpilih sebagai gubernur nantinya harus mengetahui masalah yang sedang dihadapi masyarakat Sumut, seperti pendidikan dan kemiskinan. Karena kedua hal tersebut merupakan masalah penting yang harus segera diselesaikan dan dicari solusinya. Ditambah lagi, seorang pemimpin harus mampu berkomunikasi dengan rakyat yang dipimpinnya.”

seterusnya. Bagi sebagian siswa, kembali ke sekolah bisa membuat mereka merasa takut atau was-was, terutama siswa yang harus menempati sekolah baru. Biarpun liburan itu menyenangkan, yang namanya aktivitas di sekolah nggak bakal terlupakan. Rasanya pengen banget cepat kembali sekolah. Ketemu teman lama dan baru, nyari ruang kelas, lokasi bangku yang strategis bahkan ngeliat sekolah ataupun adik kelas yang baru. Tapi untuk sebagian orang, menghadapi hari

pertama sekolah membuat diri mereka resah karena perubahan yang akan dirasakan sangatlah besar. Seperti kalian yang bakal masuk ke jenjang SLTA, segala sesuatu yang penah dirasakan waktu di SLTP tidaklah sama, misalnya mata pelajaran yang pasti berbeda dan tambah ‘berat’. Semua itu, bukanlah alasan untuk kamu pesimis menghadapi ajaran baru. Persiapan yang matang, mulai peralatan sekolah hingga wawasan yang luas, merupakan modal kamu untuk menghadapi ajaran baru. So, good luck… *Arianda Tanjung


SEJUMLAH pembeli tampak mengunjungi toko buku dan peralatan sekolah lainnya di Jl Palangkaraya Medan. Memasuki Tahun Pelajaran baru, orangtua dan siswa sibuk mempersiapkan berbagai keperluan sekolah, seperti buku tulis, seragam, dan perlengkapan lainnya.

Apa Kata Mereka?? Sartika Sari Unimed “Aku ingin sosok gubernur yang jujur, adil, dan tawakal serta sehat jasmani maupun rohani. Kebanyakan masalah korupsi yang terjadi di provinsi dilakukan oleh pemimpin karena dirinya tidak sehat secara rohani. Selain itu, Sumut kaya akan budayanya karena terdiri atas masyarakat yang heterogen, jadi sudah seharusnya Gubsu terpilih peduli dengan kebudayaan yang ada di daerah pimpinannya.”

Tiffany Nasution STIK-P Medan “Di tahun 2013 nanti, aku mengharapkan gubernur yang memiliki visi mampu mengoptimalkan SDM dan SDA yang ada di Sumut. Selain itu, sanggup membangun solidaritas bangsa bukan untuk partai atau diri sendiri serta mampu menyelesaikan masalah, bukan menghindar dari masalah. Jangan lupa, janji-janji saat kampanye jangan sebatas mencari massa, tapi benar-benar direalisasikan.” Foto & Teks: Arianda Tanjung

M Jamil Siagian UMSU “Melihat kondisi sekarang aku berharap Sumut mampu menjadi provinsi yang lebih maju lagi, mengingat Sumut merupakan salah satu provinsi yang memiliki kekayaan alam yang banyak. Untuk itu, masalah paling urgent yang dihadapi Sumut 1 sekarang adalah pengangguran yang terus ada. Ingat bahwa pengangguran musuh utama generasi muda, sedangkan peserta kampanye kebanyakan adalah generasi muda.”

WASPADA Sabtu 7 Juli 2012

1121110327 1121110350 1121110482 1121110770 1121110916 1121110983 1121110315 1121111328 1121111575 1121111973 1121112040 1121112483 1121110456 1121111253 1121111531 1121111803 1121112160 1121112171 1121110178 1121111613 1121111652 1121111948 1121112442 1121112477 1121111698 1121111718 1121111719 1121111772 1121112019 1121112443 1121508014 1121511877 1121702367 1121703914 2121110245 2121110317 1121110202 1121110274 1121110386 1121110692 1121111224 1121112096 1121110193 1121110634 1121110870 1121111059 1121111257 1121111459 1121112476 1121403121 1121504927 1121708437 2121110219 2121110373 1121110031 1121111630 1121111696 1121111775 1121111920 1121112557 1121113221 1121120070 1121401702 1121403725 1121500217 1121507434 1121110025 1121110195 1121110223 1121110273 1121112056 1121112098 1121112509 1121112911 1121113035 1121706583 2121110217 2121110222 2121110745 2121110787 2121111414 2121111718 2121400466 2124606436 1121112541 1121112744 1121113117 1121120145 1121120279 1121507018 1121111677 1121111843 1121112253 1121112413 1121113023 1121113454 1121112130 1121112268 1121112334 1121112454 1121112797 1123414271 2121110556 2121110733 2121111638 3121110301 3121110697 3121111154 1121111357 1121111424 1121111703 1121111806 1121111955 1121112070 1121110446 1121110475 1121111136 1121111491 1121111691 1121111781 1121112658 1121113165 1121510258 1121701166 1121707043 1121710001 2121110050 2121110360 2121110884 2121111251 2121112114 3121110061 1121110422 1121110582 1121112234 1121112256 1121112331 1121112471 2121111452 2121111624 2121111666 3121110874 3121111166 3121111185 1121112225 1121112629 1121112745 1121113128 1121508579 1121704126 3121110194 3121110195 3121110471 3121110692 3121111120 3121111644 1121111252 1121111517 1121113175 1121504312 1121709484 1122304154 1121510039 1121702159 2121110074 2121110244 2121110501 2121110672 1121111132


Hasil SNMPTN Unsyiah 2012 1121111745 1121400919 1121501698 1121501756 1121506545 2121110692 2121111086 2121111125 2121111918 2121112163 2121120061 3121111214 3121112014 3121114087 3121114289 3121115001 3121115350 1121120439 1121703576 1123821833 2121110010 2121110025 2121110641 2121110784 1121112088 1121112175 1121112280 1121112336 1121112619 1121510504 1121111876 1121112015 1121112064 1121112150 1121112473 1121112613 1123408743 2121110058 2121110087 2121110131 2121110280 2121110891 1121110741 1121110831 1121111065 1121111844 1121111952 1121112151 3121110371 3121110841 3121111652 3121112398 3121112492 3121112619 1121111077 1121111200 1121111312 1121111520 1121111758 1121111966 1121508409 2121110042 2121110343 2121110344 2121110492 2121110941 3121112111 3121113664 3121113733 3121114363 3121114493 3121114617 2121112020 3121110005 3121110112 3121110362 3121110800 3121111677 1123010793 2121111037 2121111781 2121111938 3121110651 3121110781 2123010057 3121110503 3121111274 3121111275 3121111813 3121112335 3121115851 3121116000 3121117862 3121508633 1121707823 2121110073 2121110560 2121110632 2121110857 2121111428 1121111287 1121111512 1121111657 1121111962 1121112071 1121113122 2121111937 2121404100 2121509318 2121703755 3121110035 3121110092 1123406283 2121110823 2121110996 2121111188 2121111423 2121500427 3121111891 3121111991 3121112555 3121112574 3121112625 3121112965 1121112519 1121112585 1121112781 1121113092 1121113112 1121113148 1121110035 1121111727 1121111894 1121112393 1121112553 1121113156 1121112677 1121113104 1121502443 1121509624 1121703084 1121706639 3121112826 3121113289 3121113296 3121113779 3121114399 3121114485 1121110123 1121110742 1121110765 1121111086 1121111209 1121111515 2121110978 2121111027 2121111217 2121111300 2121111517 2121111642 2121111773 1121110701 1121111665 1121112005 1121112288 1121112671 1121113422 1121112097 1121112261


1121112369 1121112564 1121112825 1121403271 1121110235 1121110256 1121110813 1121111753 1121112024 1121112057 3121111100 3121111142 3121111244 3121111637 3121111804 3121111905 3121112436 3121112541 3121112655 3121113103 3121113603 3121114135 3121110215 3121110247 3121110326 3121111359 3121111362 3121111586 3121112465 3121113029 3121113414 3121114444 3121114910 3121116385 1121112456 1121112535 1121112727 1121112731 1121113015 1121113058 3121110470 3121110653 3121111622 3121111655 3121112782 3121112929 2121110145 2121111031 2121111321 2121111538 2121111682 2121112137 3121114971 3121115571 3121115659 3121116388 3121116952 3121117977 2121111271 2121111308 2121111384 2121703212 3121110676 3121110846 3121112997 3121113218 3121113420 3121113663 3121113721 3121114132 1121110066 1121110564 1121110622 1121110874 1121111222 1121111279 2121110825 2121110925 2121111466 2121111525 2121111596 2121111864 1121113363 1121402203 1121901602 2121110061 2121110272 2121110322 3121111091 3121111571 3121111997 3121112208 3121112726 3121112862 1121110191 1121110514 1121110860 1121111108 1121111178 1121111301 1121110501 1121110517 1121110737 1121110857 1121111567 1121111784 1121111820 1121111858 1121112299 1121112542 1121112728 1121709470 1123009795 2121110715 2121111020 2121507231 3121110168 3121110250 3121114514 3121114659 3121115107 3121115353 3121115483 3121115508 2121112098 3121110245 3121110847 3121111063 3121111104 3121111341 3121118028 3121405151 3121502582 3121507024 3121110058 3121111593 3121111616 3121112746 3121113813 3121113814 1121110700 1121110749 1121110975 1121111149 1121111853 1121112655 1121110184 1121110358 1121111437 1121111935 1121112497 1121112592 1121110322 1121111411 1121111455 1121111848 1121112101 1121112166 1121112615 1121120451 1121505736 1121700455 2121110954 2121111256 1121707944 2121110739


2121111136 2121111731 2121508100 3121110048 1121110100 1121110190 1121111956 1121112041 1121112257 1121404004 3121111608 3121111620 3121111974 3121112172 3121112269 3121112390 3121113014 3121114044 3121114137 3121114165 3121114459 3121114909 1121110019 1121110320 1121110394 1121110455 1121110911 1121111309 1121110440 1121110559 1121110606 1121110665 1121111277 1121111463 1121111815 3121116938 3121117244 3121121071 3121501675 3121508403 3121508939 1121110261 1121111446 1121112067 1121112738 1121112791 2121110143 3121113549 3121113875 3121114542 3121114568 3121114851 3121115925 1121110309 1121110399 1121111062 1121111081 1121111100 1121111924 1121402750 1121501922 1121508545 1121510750 2121110490 2121110818 1121110629 1121110698 1121111628 1121111783 1121111886 1121112161 1121110384 1121110597 1121111024 1121111211 1121111637 1121111689 1121110489 1121110887 1121110928 1121110978 1121111088 1121111453 1121110461 1121111743 1121112167 1121112556 1121112829 1121504241 1121111018 1121111167 1121111230 1121111505 1121111620 1121111903 3121114265 3121114373 3121114530 3121114712 3121114767 3121114991 1121110435 1121111164 1121111318 1121112340 1121112457 1121112510 1121113459 1121120199 1121120490 1121500845 1123013395 2121110320 2121110497 1121111733 1121111943 1121507207 1121706185 1121709291 1123320076 1121110563 1121110715 1121110801 1121110956 1121111831 1121111963 1121111988 1121110378 1121110767 1121111189 1121111373 1121111519 1121111614 1121111573 1121111627 1121111680 1121111838 1121111872 1121112665 1121110005 1121110445 1121110803 1121112045 1121112102 1121112262 3121116713 3121116741 3121116830 3121118177 3121120603 3121511159 1121110015 1121110493 1121111425 1121111818 1121112087 1121502233 1121112399 1121112468 1121112587 1121120331 1121706805 1123321010 2121110351 1121110257 1121110591 1121111019 1121111172 1121111217


1121111218 1121110064 1121110210 1121110458 1121110750 1121110764 1121110954 1121110149 1121110657 1121110871 1121111291 1121111292 1121111554 1121110736 1121112050 1121112183 1121112228 1121112263 1121112809 1121110689 1121110778 1121110890 1121111124 1121111140 1121111225 1121110965 1121111353 1121111926 1121112066 1121112227 1121112386 1121110205 1121110527 1121110599 1121111119 1121111192 1121111684 1121111064 1121111203 1121112010 1121112032 1121112115 1121112351 1121110208 1121111033 1121111708 1121111747 1121112004 1121112058 1121110649 1121110836 1121110903 1121111356 1121111646 1121112313 1121110227 1121110429 1121110479 1121110866 1121111101 1121111399 1121110221 1121110676 1121112042 1121112427 1121112704 1121120185 1121110392 1121111862 1121112021 1121112116 1121113040 1121113384 1121110252 1121110302 1121111280 1121111563 1121111814 1121111833 1121112204 1121110165 1121110300 1121110806 1121111109 1121112292 1121112661 1121110621 1121110995 1121111241 1121111694 1121112052 1121112152 1121400717 1121701529 1121702874 1121704470 1121707907 2121110115 1121110406 1121111263 1121111731 1121111840 1121111991 1121505897 1121110009 1121110207 1121110297 1121110424 1121110474 1121111324 1121110592 1121110807 1121111358 1121111842 1121112248 1121112287 2121110174 2121405473 3121110140 3121110370 3121111160 3121111965 1121120515 1121401257 1121503153 1121512398 1121703019 1123007386 1121112325 1121112347 1121112419 1121112673 1121113011 1121509244 1121510023 3121112015 3121112298 3121112911 3121113268 3121113912 3121114024 2121110381 2121110457 2121110871 2121111100 2121111332 2121508121 2121111195 2121111284 2121111443 2121111508 2121111668 2121111931 3121114857 3121114864 3121115259 3121115437 3121115941 3121117356 3121111395 3121111505 3121111819 3121112301 3121112584 3121112660 2121112206


2121112267 3121110261 3121110720 3121110816 3121111361 3121503447 3121112720 3121113023 3121113375 3121113599 3121113956 3121113966 3121112017 3121112071 3121112645 3121112855 3121112964 3121113843 2121110165 2121110646 2121110731 2121111000 2121111245 2121111253 1121112250 1121112400 1121120343 1121402343 2121110625 2121110772 3121114030 3121114770 3121114889 3121115020 3121115075 3121116156 2121111360 2121111530 2121401824 3121110093 3121110483 3121110767 2121111273 2121111365 2121111622 2121112123 2121112160 2121407601 3121116259 3121117359 3121117485 3121117895 3121402447 3121508477 3121111179 3121111283 3121111373 3121111735 3121111818 3121113081 1121511489 1121706526 2121110147 2121110440 2121111066 2121111479 3121113312 3121113677 3121113978 3121114279 3121114311 3121114641 3121112972 3121113260 3121113362 3121114672 3121114882 3121115135 3121114102 3121114191 3121114532 3121114879 3121115059 3121116046 2121110514 2121110552 2121111319 2121111376 2121111409 2121111442 3121116027 3121116750 3121116923 3121117854 3121121147 3121403380 3121116190 3121116327 3121116935 3121116982 3121117256 3121117494 3121706763 3121710042 3122700119 3123005396 1121111757 1121112084 1121112246 1121112562 1121112924 2121110292 1121113006 1121113061 1121113118 1121120041 1121507068 2121110243 3121114111 3121115507 3121116012 3121116545 3121117669 3121118091 1121112761 1121113140 1121502975 2121111694 2121111729 2123311298 1121112180 1121112472 1121112559 1121112851 2121110371 2121110465 2121110905 2121111649 2121111890 2121112124 2121402580 3121111304 2121111681 2121111926 2121406748 2121500651 3121110382 3121110518 3121115648 3121116369 3121116555 3121117211 3121117472 3121118322 3121115585 3121115680 3121115768 3121115824 3121116058 3121116520 1121112751 1121112817 1121112821 1121113043 1121505972 1121508382


B9 2121111889 3121110046 3121110052 3121110145 3121110813 3121111070 3121113124 3121114225 3121114424 3121114727 3121114753 3121115037 1121508584 1121701268 1123312956 2121110089 2121111028 2121111085 1121112860 1121507205 1121511218 2121110161 2121111199 2121111381 3121115493 3121403122 3121502848 2121110453 2121110476 2121110892 2121111009 2121111262 2121111494 3121114981 3121115313 3121115812 3121115837 3121115885 3121116453 2121503685 2121506751 3121110008 3121110560 3121111199 3121111269 1121111656 1121111982 1121112271 1121113056 1121506602 1121706477 3121116576 3121116583 3121117258 3121404367 1121112684 1121112978 1121112980 1121113106 1121120121 1121505772 3121116622 3121116901 3121400820 3121505799 3121507961 3121508180 3121112006 3121112034 3121112372 3121113127 3121113134 3121113357 1123011821 2121110252 2121110384 2121110406 2121110511 2121110585 1121111739 1121111893 1121112013 1121112123 1121113055 1121113173 1121401740 3121113461 3121114377 3121114929 3121114961 3121115321 3121115798 3121116095 3121116123 3121116635 3121116671 3121117078 3121117276 3121117585 3121121081 3121402491 3121507005 3121507688 2121111577 2121111613 2121111630 2121111943 3121110732 3121110867 1121111632 1121112054 1121112365 1121112502 1121112645 1121112943 1121111649 1121111749 1121112214 1121112247 1121112596 1121112864 1121700004 1121701975 1123322025 2121110279 2121110723 2121110921 1121112342 1121112478 1121112511 1121112530 1121112676 1121112770 3121118414 3121120077 3121708306 1121504285 1121508675 1123320853 2121110185 2121110202 2121110424 2121110819 3121111547 3121111903 3121112920 3121114113 3121114361 3121114881 3121111981 3121111996 3121112623 3121112763 3121113008 3121113091 2121110936 2121111410 2121112075 3121110143 3121110942 3121111000 1121112492 1121112697 1121113078 1121502639 1121506965 1121508294 2121111541


Hasil SNMPTN Unsyiah 2012

B10 2121111765 2123312565 3121110449 3121111405 3121111440 1121113298 1121120010 1121704924 1124204017 2121110795 2121112119 2121501440 2121111985 3121110031 3121110123 3121110502 3121111356 3121111809 1121505524 1121702611 1121703798 1123810840 3121110312 3121110419 1121112188 1121112368 1121112550 1121113113 1123322268 2121110240 2121110264 2121110924 2121111063 2121111167 2121112055 2121112235 2121503727 3121110588 3121110705 3121111872 3121111889 3121112088 3121112170 3121113135 3121113687 3121114296 3121114486 3121114795 3121114888 3121111564 3121111585 3121111678 3121113604 3121113739 3121114264 3121110424 3121110778 3121112265 3121112356 3121112461 3121112637 3121112444 3121113115 3121113252 3121113340 3121113618 3121113632 1121111712 1121112074 1121112414 1121112486 1121113081 1121701341 3121115082 3121115122 3121115298 3121115482 3121116048 3121116195 2121110380 2121110813 3121110553 3121112392 3121112591 3121113017 3121116379 3121116437 3121116649 3121116984 3121117468 3121401055 2121111581 2121111661 2121111717 2121111723 2121111974 2121112110 3121113786 3121114318 3121114729 3121114836 3121115178 3121115589 3121112765 3121112898 3121112899 3121113402 3121113744 3121113888 1121112014 1121112390 1121112896 1121113346 1121402862 1121509129 3121113318 3121113725 3121113792 3121113807 3121114292 3121114898 1121111901 1121112099 1121112258 1121112352 1121112446 1121113340 3121112075 3121112709 3121112971 3121113406 3121113422 3121113490 3121113992 3121114002 3121115351 3121115443 3121116331 3121116657 3121113543 3121114199 3121114501 3121114811 3121114899 3121115045 1121503211 1121706045 1121706792 2121110865 2121111041 2121111094 1121111600 1121112006 1121112090 1121112195 1121112264 1121112356 1121709029 1123323592 2121110458 2121111134 2121111369 3121110690 1121112417


1121112610 1121112996 1121120207 1121120297 1121501543 3121115765 3121116511 3121116663 3121116961 3121117203 3121117672 3121110967 3121111043 3121111803 3121112319 3121112704 3121112783 3121118077 3121120869 3121504759 3121506650 3121507515 3121114201 3121114798 3121114823 3121115237 3121116097 3121116434 3121117265 3121117403 3121117525 3121117640 3121117955 3121120832 3121113756 3121113803 3121114022 3121114422 3121114457 3121115137 3121116623 3121116697 3121117163 3121117663 3121117814 3121118055 3121115066 3121115219 3121115265 3121115542 3121115576 3121115688 3121115422 3121115424 3121115490 3121115524 3121115806 3121115811 3121507475 3121115796 3121116053 3121116313 3121116374 3121117019 3121117700 1121112315 1121112328 1121112664 1121113098 1121500554 1121507677 2121111390 2121400941 2121501202 2124201785 3121110190 3121110996 1121112626 1121402931 1121502714 2121110952 2121110964 2121111374 3121118137 3121118433 3121501795 3121502572 3121709846 1121112767 1121113153 1121705170 1121708481 1123403499 2121110512 2121110521 2121110991 2121111084 2121111672 2121111819 2121111946 3121110623 3121111999 3121112581 3121112813 3121113123 3121113445 2121110403 2121111821 3121110306 3121110825 3121111096 3121111340 3121115141 3121115527 3121115543 3121115560 3121115619 3121115625 3121111042 3121111656 3121112295 3121112417 3121112601 3121112733 1121111965 1121112023 1121112207 1121112269 1121112580 1121120202 3121115988 3121117236 3121117608 3121117686 3121117885 1123005212 1123014452 1123312607 2121110583 2121110762 2121110962 3121115970 3121116296 3121116455 3121116535 3121117554 3121118108 1121111792 1121112148 1121112208 1121113079 1121113193 1121709303 1121503854 1121505223 1121508067 1121702573 2121110349 2121110660 2121110557 3121110785


3121110848 3121111006 3121111173 3121111722 1121120524 1121509575 1121708930 1121904641 2121110104 2121110452 2121110792 3121115877 3121116034 3121117323 3121117724 3121117842 3121117982 3121112076 3121112734 3121113047 3121113094 3121113266 3121113755 3121111605 3121111701 3121111863 3121112597 3121112792 3121113545 2121111225 2121111238 2121111645 2121505846 3121110755 3121111259 2123019464 3121110941 3121111192 3121112185 3121113144 3121113166 3121404787 3121405759 3121501473 3121502103 3121507709 3121702740 1121904154 2121110047 2121110986 2121111532 3121110084 3121110128 3121113231 3121113454 3121114474 3121114933 3121115106 3121115113 3121113561 3121113844 3121115175 3121115372 3121115610 3121115894 3121121240 3121510229 3121507180 3121115114 3121115489 3121115523 3121115584 3121117079 3121118221 3121111158 3121111325 3121111658 3121111743 3121112231 3121112486 3121506183 3121706698 3123310867 3121113143 3121113616 3121113635 3121114768 3121114824 3121115144 3121110524 3121110709 3121111423 3121112050 3121112284 3121114197 3121405341 1121112105 1121403305 1121502480 1121513277 1121700010 2121110001 3121404653 3124601806 2121111061 2121111477 2121111626 2121111665 2121112415 2121401216 3121110912 3121111167 3121111297 3121112282 3121112508 3121112582 2121111528 2121111625 2121111900 2121112014 2121112219 3121110304 2121110103 2121110141 2121110341 2121110539 2121110763 2121111320 3121111467 3121111753 3121112116 3121112592 3121112695 3121113192 1121511224 1121706847 2121110020 2121110326 2121110602 2121110737 3121113160 3121113212 3121113670 3121113943 3121113944 3121114355 2121110994 2121111202 2121120121 2121502316 2123001109 2123009588 3121114598 3121114603 3121114656 3121114997 3121115047 3121115073 3121112685 3121113800 3121114371 3121114438 3121114653 3121114785 2121111220 2121120179 2121403791 2121505935


3121110328 3121110682 3121113765 3121114557 3121114583 3121114775 3121115010 3121115039 2121112343 2121406009 3121110178 3121110574 3121110677 3121110835 3121120081 3121501421 3121506250 3121506783 3121509059 3123004594 3121115145 3121115286 3121115473 3121115642 3121115834 3121116634 3121115159 3121115471 3121115670 3121115804 3121116138 3121116139 2121111325 2121111588 2121111685 2121406126 3121110614 3121111222 1123311706 2121110259 2121110288 2121110422 2121110587 2121110643 2121110874 2121111112 2121111240 2121111778 2121112011 2123001866 3121117498 3121117527 3121117742 3121110935 3121112474 3121113439 3121113686 3121114259 3121114781 3121116209 3121116363 3121117426 3121117661 3121117900 3121705651 1121111416 1121111868 1121112285 1121112894 1121113301 1121701062 3121118241 3121120307 3121121321 3121404117 3121505216 3123407120 1121111700 1121111919 1121112002 1121112157 1121112278 1121112372 2121404938 3121110020 3121110207 3121110285 3121111724 3121112165 2121111032 2121111317 2121111318 2121111789 2121111961 2121504565 3121114248 3121114308 3121114385 3121114403 3121114913 3121115476 2121403913 3121110025 3121110133 3121110932 3121111152 3121111254 1121112333 1121112415 1121112452 1121112946 1121113417 1121508071 3121110968 3121110969 3121111118 3121111130 3121112545 3121112626 3121110074 3121110852 3121111413 3121111660 3121112313 3121112661 3121113330 3121114027 3121114337 3121114431 3121114506 3121114579 3121110420 3121110521 3121110780 3121112612 3121112638 3121112900 3121110562 3121111095 3121111837 3121111938 3121113354 3121113832 3121112945 3121113042 3121114029 3121114327 3121114941 3121115534 3121115086 3121115352 3121115836 3121116317 3121116411 3121116853 3121110076 3121110271 3121110494 3121111514 3121111674 3121112305 1121511157 2121110076 2121110449


2121110995 2121111092 2121111563 3121116424 3121116615 3121116683 3121116973 3121117281 3121117306 2121110157 2121110781 2121110957 2121111148 2121111350 2123000328 3121112801 3121114754 3121115315 3121115343 3121115381 3121115403 3121500725 3121503162 3121506887 1121702693 2121110504 2121110789 2121110927 2121111126 2121111257 3121110539 3121111565 3121111785 3121111801 3121111901 3121112819 2121111721 2121112190 3121110205 3121110515 3121110807 3121111258 3121113225 3121113502 3121113727 3121114269 3121114368 3121114612 3121111377 3121112053 3121113201 3121113245 3121114312 3121114752 1121112611 1121509784 1121511808 1121705888 2121110355 2121111175 3121112871 3121113827 3121114045 3121114345 3121114645 3121114974 3121115689 3121116144 3121116496 3121116642 3121117117 3121117542 3121114858 3121115117 3121116261 3121116293 3121116401 3121116960 3121113532 3121114053 3121114472 3121114652 3121114892 3121115154 3121115976 3121116011 3121116469 3121116604 3121118023 3121501196 3121111683 3121112798 3121114117 3121114772 3121114863 3121114980 3121113577 3121114012 3121114324 3121114447 3121114804 3121114805 3121116591 3121117113 3121117213 3121117415 3121117989 3121118100 3121117756 3121117914 3121118020 3121501702 3121502840 2121111230 2121111282 2121111657 2121111856 2121111914 2121120281 3121115015 3121115036 3121115043 3121115667 3121115766 3121115875 3121117654 3121117733 3121508347 3121114001 3121114343 3121114717 3121115246 3121115272 3121115374 1121402403 1121511724 2121110460 2121110647 2121110766 2121110940 3121110523 3121110723 3121110810 3121111972 3121111989 3121112134 3121114990 3121115276 3121115293 3121115526 3121115617 3121115799 2121111326 2121111677 2121112130 3121110038 3121110246 3121110746 1121704066 1121704926 1121904768 1123822237 2121110201 2121110637 3121506245 2123013104


3121110748 3121110851 3121110883 3121111223 3121111878 3121114916 3121114992 3121115189 3121115419 3121115444 3121115831 3121111248 3121111411 3121111751 3121111915 3121112227 3121112364 3121113021 3121113544 3121113555 3121113918 3121114427 3121114678 1121112450 1121112517 1121700780 1122100113 1123003240 1123016409 3121115245 3121115256 3121115297 3121115305 3121115522 3121115880 3121114790 3121115092 3121115815 3121116136 3121116637 3121117729 3121116334 3121116644 3121116781 3121116829 3121117530 3121117731 3121116117 3121116817 3121116911 3121118074 3121120709 3121508126 3121117882 3121503433 3123321881 3121118147 3121120241 3121403586 3121404075 3121700787 3121708684 3121114734 3121115242 3121115438 3121115781 3121116425 3121116904 3121113818 3121114242 3121114483 3121115162 3121115355 3121115551 3121117760 3121117800 3121118211 3121118265 3121121176 3121400019 2121111597 3121110534 3121110545 3121111090 3121111287 3121111596 3121114866 3121115301 3121115558 3121115666 3121116645 3121116681 3121110103 3121110902 3121110933 3121111044 3121111122 3121111343 3121118030 3121118314 3121120876 3121501997 3121114687 3121115032 3121115432 3121115984 3121116515 3121117124 1121112904 1121112923 1121113434 1121505684 1121700221 1123004360 1123822561 3121115888 3121116041 3121116166 3121116269 3121116356 3121116397 3121117399 3121117551 3121117874 3121117984 3121504664 3121112102 3121112264 3121113247 3121113925 3121114819 3121115797 3121114903 3121115058 3121115218 3121115635 3121115745 3121116049 2121110464 2121110742 2121110989 2121111045 2121111231 2121111243 3121117122 3121117259 3121502773 3121506479 3123004796 2121110622 2121110753 2121110881 2121111750 2121111785 2121111866 2121110544 2121111012 2121111182 2121112178 2121502311 2121507813 3121112663


WASPADA Sabtu 7 Juli 2012

3121112880 3121112893 3121113423 3121114733 3121115197 3121110179 3121110713 3121111465 3121111994 3121112109 3121112391 3121115748 3121115946 3121115991 3121116001 3121116155 3121116352 3121112135 3121112596 3121114251 3121115464 3121116258 3121116849 2121110879 2121111486 2121111860 3121110516 3121110555 3121111065 1123322429 2121111082 2121111264 2121111435 2121111593 2121112121 3121117050 3121117147 3121117501 3121118062 3121121113 3121404273 3121111351 3121111728 3121111909 3121113055 3121113125 3121113216 3121111434 3121111443 3121111684 3121111869 3121112216 3121113408 2121401433 2121713534 3121110321 3121110440 3121110496 3121110706 3121113641 3121113999 3121114173 3121114425 3121114744 3121114842 1121503593 1121504499 1121509522 1121512264 1121706366 1123001609 2121120073 3121110049 3121110973 3121111204 3121111882 3121112583 3121116254 3121116757 3121116945 3121118059 3121120785 3121121233 1125509294 2121110057 2121110581 2121110683 2121110713 2121110911 3121500922 3121506505 3121507287 3121117445 3121118015 3121511136 3121111102 3121111727 3121112633 3121113102 3121113478 3121113852 3121111883 3121112177 3121112220 3121112291 3121112322 3121112402 3121113861 3121114747 3121115074 3121115091 3121115105 3121115151 3121115583 3121115626 3121115743 3121116361 3121116785 3121117125 3121111638 3121111904 3121112680 3121112728 3121112847 3121113196 3121117190 3121117228 3121120948 3121116151 3121116413 3121116481 3121116553 3121116584 3121116765 3121403436 3121509726 3123820122 3121117130 3121117181 3121117340 3121120096 3121502943 3121505223 3121117393 3121117561 3121117892 3121117975 3121118141 3121501398 3121502197 3121709705 3122102128 1121111392 1121111527 1121112586 1121112827 1123006441 2121111313 2121111135 2121111753 2121111762 2121112003


WASPADA Sabtu 7 Juli 2012

3121110372 3121110428 3121114387 3121114701 3121115161 3121115563 3121115600 3121115645 3121111011 3121111228 3121111322 3121111428 3121112396 3121112528 3121116113 3121117026 3121117035 3121117245 3121117844 3121121487 3121405971 3121511321 3121709803 1123010568 2121111022 2121111460 3121110434 3121110908 3121111542 3121115244 3121115953 3121116422 3121502058 3121505301 3123004598 3121116423 3121116491 3121116499 3121116512 3121116710 3121117085 3121113308 3121113610 3121113672 3121114266 3121115690 3121115701 2121120155 2121509133 3121110288 3121110307 3121110468 3121110625 3121112531 3121112980 3121113015 3121114302 3121114344 3121114975


Hasil SNMPTN Unsyiah 2012 3121115954 3121116824 3121117140 3121117563 3121117964 3121507394 3121110799 3121110823 3121111054 3121111193 3121112549 3121113050 2121111187 2121111305 2121111440 2121111680 3121110196 3121110631 3121113099 3121113621 3121114136 3121114326 3121114460 3121114922 3121111783 3121111784 3121112137 3121112181 3121112908 3121113106 3121112627 3121113152 3121114183 3121114475 3121114642 3121114861 3121115349 3121115365 3121115739 3121115891 3121115892 3121115928 3121113278 3121113546 3121113902 3121114330 3121114821 3121115183 3121115964 3121116403 3121120063 3121120776 3121502210 3121503606 3121111841 3121112081 3121112101 3121112345


3121710484 3123001485 2121111483 2121111639 3121110334 3121110386 3121110485 3121111879 3121506661 3121113339 3121113520 3121113707 3121113871 3121114294 3121114404 3121118341 3121506202 3121115785 3121116023 3121116133 3121116721 3121116862 3121117624 3121114716 3121115098 3121115129 3121115260 3121115755 3121115788 3121112038 3121112662 3121113636 3121113840 3121114021 3121114484 3121116809 3121120860 3121700970 3121703191 3121115949 3121115995 3121116893 3121117341 3121118001 3121502425 3121114762 3121114875 3121114886 3121115002 3121115021 3121115754 3121117761 3121400070 3121403676 3121504997 3121113693 3121113761 3121113762 3121113903


3121113980 3121114090 3121703402 3121712719 3121116586 3121116822 3121117004 3121117641 3121401864 3121402557 3121503672 3121703009 3121114335 3121114559 3121114640 3121115146 3121115782 3121116171 3121503111 3121506248 3121706105 3121116646 3121117225 3121117462 3121117524 3121117838 3121117929 3121113571 3121113628 3121114213 3121114375 3121114782 3121114816 3121114902 3121115699 3121115702 3121115981 3121116575 3121116670 3121501413 3121121356 3121506037 3121506647 3121507871 3121703366 3121115514 3121115593 3121115757 3121115994 3121116009 3121116177 3121111161 3121111902 3121112080 3121112653 3121112866


3121113155 3121116614 3121116685 3121116905 3121117007 3121117496 3121118300 3121113431 3121114430 3121114502 3121114586 3121115322 3121115494 3121115646 3121115958 3121116568 3121116962 3121117029 3121117545 3121117025 3121117045 3121118071 3121120859 3121113440 3121113683 3121113981 3121114232 3121114538 3121114870 3121113743 3121113774 3121114721 3121114810 3121114906 3121115123 3121115721 3121115918 3121116022 3121116060 3121117537 3121118105 3121115133 3121115222 3121115324 3121115362 3121115555 3121115604 3121115307 3121116204 3121116521 3121116592 3121116641 3121117219 3121117968 3121510481


3121121021 AUDI MALDINI 3123002474 NUR IKHSANI RAHMATIK 3121117734 M. QYAZ AULIA RYZKI 3121121480 LUSSI MAUNIRA 3121510255 HENGKI HERMAWAN 3121511439 ATTHAARIQ RAJOHI 3123320296 TJUT AQSHA ANNATASYA 3121117753 FITRI HANDAYANI 3121117910 AIDIL FIQRI 3121121326 NANDA SAFIRA 3121404362 SITI AISYAH 3121507592 DIAN PERTIWI HSB 3121508421 GUNTARI 3121116017 NURZAHRI 3121116371 MUARIF 3121116725 IRHAMIATI 3121116767 M. REZA SYAHPUTRA 3121117132 SITI MAISARAH 3121117539 MUHAMMAD ZAKI 3121506567 ANGGI AULIA NASUTION 3121509080 AMALUDDIN 3121507469 UMMI CAHAYA 3121509812 M.ALIEF GIFFARI A.S 3121115255 ARMIA 3121115278 KHAITRUL AKBAR 3121115486 SUCI TEBA MAULIRA 3121115948 MUZAKKI 3121116121 RESTU AULIA SAIFUL 3121116408 EVI MAHDALENA 3121118198 FITRIA 3121118199 FAJROEL HAYAT 3121118403 HANIF SUKMA 3121507631 YUNA YUSNITA 3121700791 IZZATUR RAHMI 3121116465 RAHAYU F. HARMAS 3121116894 MUHAMMAD FURQAN 3121117179 RIFKI MARZANI 3121118029 MUJI ILHAMDI 3121118349 YENNI P. GINTING 3121120630 MIRLA SARAH M 3121114986 MAWADDAH 3121115546 RIAN DWIKA YURIKI 3121116277 RICHO SUMARDANA 3121116883 ILLIYINAL MUTTAQIN S 3121117322 MARDHATILLAH 3121117533 NUR AKMAL 2121111640 PUTRI SISCA 2121111702 RIZKI ARINALDY 2121112074 FADLUN RIZA 2121500840 M. FURQAN ALFINDRA 3121110461 NURUL FADHILLAH 3121110520 DESI LOVIANA 3121120915 USMAN 3121404020 AYULANNINGSIH 3121505083 KHAIRUL SALEH 3121508367 DANA DWI PRASETYO 3123004607 EDI KURNIAWAN 3121117622 DEDI IRMANSYAH P

B11 3121117803 3121118397 3121705166 3123004436 3121110532 3121110879 3121110965 3121111829 3121112310 3121113138 3121113377 3121113650 3121114536 3121114692 3121115055 3121115205 3121115428 3121115552 3121115613 3121115849 3121116075 3121116199 3121116382 3121116541 3121117773 3121117985 3121504050 3121507979 1121500731 1121503695 1121504290 2121110563 2121110710 2121110826 3121110157 3121110164 3121110378 3121110567 3121110686 3121110916 3121111525 3121111749 3121111810 3121112377 3121112381 3121112749 3121113676 3121114101 3121114673 3121115063 3121115532 3121115596 3121115879 3121116414 3121507278 3121507572 3123404735


Hasil SNMPTN Unimal 2012 1121111383 1121120286 1121120302 1121120465 1121120492 1121120508 1121120040 1121110702 1121512426 1121512517 1121120293 1121120488 1121509121 1121700620 1121700881 1121506911 1121120364 1121120406 1121120496 1121120048 1121120074 1121120110 1121120153 1121120437 1121120470 1121120156 1121120187 1121120208 1121110760 1121120235 1121120298 1121120416 1121506417 1121404079 1121120482 1121500506 1121112866 1121110118 1121120264 1121120306 1121120396 1121120423 1121120431 1121120473 1121120032 1121120404 1121120475 1121120494 1121111499 1121120047 1121120089 1121120179 1121112612 1121120016 1121120050 1121120193 1121505119 1121400389 1121110789 1121404127 1121120288 1121510742 1121506526 1121120009 1121120023 1121111412 1121120244 1121120311 1121120539 1121112119 1121120056 1121120108 1121403612 1121704569 1121904250 1121110728 1121120055 1121505940 1121504003 1121120154 1121120218 1121120292 1121120360 1121120503 1121120537 1121903448 1121120228 1121120257 1121120281 1121120540 1121404564 1121120013 1122305917 1121120323 1121120340 1121120373 1121120394 1121120480 1121512443 1121904382 1121120159 1121120397


1121120413 1121120450 1121110929 1121110364 1121120242 1121120310 1121505931 1121120030 1121120077 1121120102 1121120309 1121120499 1121400281 1121110427 1121120006 1121120049 1121507361 1121120352 1121120367 1121120375 1121120452 1121120517 1122306883 1121505351 1121120427 1121120460 1121111940 1121510433 1121120051 1121120259 1121120344 1121120468 1121120522 1121707224 1121111482 1121120210 1121502605 1121120088 1121120101 1121120191 1121120318 1121120461 1121120256 1121120263 1121120314 1121120446 1121120090 1121506230 2121120225 1121120384 1121120449 1121120463 1121120022 1121120072 1121120167 1123013744 1121120251 1121120356 1122306476 2121120214 2121120270 1121511188 1121120504 1121111188 1121704939 1121120037 2121120059 1121906181 1121120324 1121120351 1121120457 1121506353 1121120038 1121120065 1121120294 1121120361 1121511100 1123322537 2121120320 2121120410 2121120439 1121120299 1121120385 1121110660 1121110678 1121120209 1121706555 2121120005 1121512716 1121120252 1121509734 1121120183 1121705742 2121503108 2121120112 1121120296 1121120418 1121501579 1121120031 1121120206


2121509530 2121120143 1121110658 1121709787 1121120369 1121506034 1121508111 2121120157 2121120211 2121120244 2121120291 2121120364 2121112253 2121120023 2121120039 1121503215 1121120258 1121120509 1121112865 1121120105 1121120163 2121120017 1121120036 1121120268 1121120319 1121120486 1121404607 1121710028 2121120338 1121120243 1121120400 1121120405 1121120438 1121120526 1121501901 1123012549 1121120536 1121510837 1121112805 1121120019 2121120248 2121120261 1121404455 1121509961 1121120136 1121120170 2121120258 2121120390 1121120271 1121120326 1121120380 1121706988 1121508944 1121112577 2121120069 1121120054 1121111511 1121120274 1121120300 1121120390 1121120462 1121120521 1121120308 1121401912 1121505585 1121508009 1121120020 2121508694 2121120096 1121120126 1121120160 1121120346 1121120511 2121120035 2121120340 1121120269 1121120063 1121402384 1121509115 1121112343 1121710027 1121504897 1121120220 1121120247 1121110565 1121120138 2121506668 2121120308 1121120261 1121120278 1121502538 1121120131 1121403196 2121120217 1121404180 1121901969 1121120255 1121120447


1121120152 1121112244 1121501284 1121120033 1121507085 1121120246 1121112576 2121120219 2121120230 1121120338 1121120365 1121505037 1121120093 1121120122 2121120053 1121120162 1121120212 2121404408 2121120001 2121120019 2121120106 1121706588 2121120303 2121120120 2121120125 2121120154 2121120183 1121111723 1121113241 1121120100 1121120115 1121120190 2121508461 1121509579 1121120203 1121500498 2121120356 2121120494 2121500536 2121407297 1121120401 1121508657 1121402003 1121402194 1121512935 1121120180 2121503801 1121120158 1121120353 2121120237 2121120266 2121110448 2121120103 2121120142 1121120290 1121501989 1121503253 1121120079 1121120151 1121120200 2121112154 1121110288 1123010406 1121120005 1121120095 1121507851 2121111913 1121508199 1121112291 1121509702 2121120280 2121120318 2121120373 2121120402 1121120388 1121120523 1121120001 1121120149 1121505797 1121500811 2121111922 1121112956 1121504047 1121120348 1123017117 2121120051 2121120060 1121120280 1121120312 1121120432 1122304212 2121120176 2121120249 1121120403 1121403468 1121120107 1121403000 1121510037 2121402831 2121120031


1121120225 1121120481 1121404475 1121510648 2121120321 2121120347 2121120409 1121404006 1121120428 1121505844 2121120456 2121120478 2121120070 2121120124 1121120328 1121510466 2121110192 2121504531 2121120222 2121707424 2121110875 1121120350 2121120323 2121120337 2121120498 2121508648 2121509076 1121120266 1121120443 1123401483 1121120147 2121505838 2121120227 2121120276 1121120213 1121402657 1122301670 2121120200 2121120236 2121120094 2121120048 2121120091 2121120443 2121120449 2121120482 3121120921 3121120956 2121120429 2121120470 2121120083 2121120185 3121120920 3121120992 1121120507 2121407527 2121120286 2121120413 2121120140 2121120168 2121904819 2121120113 2121120195 2121507079 2121120163 3121120868 3121121095 2121120199 2121120389 2121120405 2121120477 2121111362 3121120046 2121120082 2121120152 3121121029 3121121041 3121121442 3121121465 2121120205 2121120436 2121120003 2121120087 3121120026 3121120048 1121120097 1121120223 1121120273 1121503160 2121120386 2121120418 1121401557 1121120132 1121120143 2121701247 2121120033 2121120147 2121120184 2121120296 2121120371 2121120423


2121506431 3121120905 3121120941 3121120050 3121120214 3121120280 3121120954 3121120967 3121121063 2121120292 2121120396 2121112164 2121120077 3121400288 3121120945 2121120134 2121120383 2121111419 3121120903 3121120924 3121120996 2121120366 3121116218 3121120953 3121120974 3121121125 3121121222 1121705031 1121508648 2121110070 2121120257 2121120431 2121120442 1121112298 1121509945 2121120194 2121120317 2121120333 3121120881 3121121065 3121120895 3121120930 3121121069 3121121135 3121121153 3121121232 1121509282 2121120231 2121120339 2121120046 3121120872 3121120955 2121120392 2121120394 2121120415 3121120873 3121121138 3121121217 2121504688 3121120934 3121121017 3121121061 3121121110 3121121144 2121505305 2121502078 2121120148 3121503436 3121117446 3121120995 2121120246 2121120165 3121120017 3121120049 3121113130 3121120925 3121120991 3121121064 3121121148 3121121149 3121121173 3121121209 3121120068 3121120093 3121120115 3121502039 3121120892 3121121066 3121121039 3121121252 3121121528 3121121544 3121120313 3121120404 2121120136 2121120416 2121120459 3121120904 3121120987 3121121112 1121120127 2121704842


2121120239 2121120277 2121120489 3121121117 2121120170 2121120251 2121120263 2121120359 3121120935 3121120961 2121701628 2121120007 2121120133 3121121053 3121121484 3121121495 3121121198 3121121199 3121121241 3121121286 3121121432 3121121477 3121121058 3121121089 3121121150 3121121297 3121121402 3121121466 3121121027 3121121120 3121110960 3121120006 3121120038 3121120151 3121116728 3121120952 3121121013 3121121067 3121121105 3121121142 1121120104 1121120189 2121120229 2121120453 2121120159 3121507795 1121120184 2121120068 2121120419 3121113287 3121120083 3121120193 2121120189 2121120483 2121120492 2121407258 3121120950 3121120969 2121120438 2121112099 2121120025 2121120030 2121120067 2121120102 3121120966 1121120135 2121503787 2121120238 2121120372 2121120066 3121120040 3121120061 1121501707 2121112126 2121120117 2121120144 2121120167 3121120885 3121121160 3121121183 3121121194 3121121202 3121121378 3121121381 3121121524 3121121556 3121114959 3121120013 3121120045 3121120123 2121120158 2121111465 3121503570 3121121049 3121121230 3121121330 1121510832 2121120080 2121120363 2121120434 3121120002


Hasil SNMPTN Unimal 2012

B12 3121120090 1121120061 1121120139 1121120144 2121120462 2121120476 3121120964 2121120381 2121120417 2121120467 3121120937 3121121008 3121121090 2121120141 2121120241 2121120454 2121506518 3121115947 3121121000 3121121026 3121121077 3121121078 3121121084 3121121204 3121121246 3121120191 3121120270 3121120293 3121120299 3121120520 3121120602 3121120999 3121121301 3121121426 3121121430 3121121485 3121120057 3121120150 3121120173 3121120198 3121120371 3121120483 3121120926 3121120168 3121120291 3121120325 3121120519 3121120540 3121120545 3121121023 3121121115 3121121172 3121121189 3121121212 3121121244 2121120004 2121502390 3121120938 3121120951 3121120972 3121121134 2121120020 2121120380 3121120970 3121121073 3121121074 3121121119 3121121145 1121112378 1121706305 1121120087 1121120211 2121120398 2121120435 2121502629 2121120164 2121120271 2121120341 2121120379 3121120980 3121121034 2121120421 2121120495 3121120104 3121120153 3121120166 3121120469 1121120073 2121120228 2121120250 1121500805 2121120128 2121120300 3121110641 3121121264 3121121289 3121121298 3121121404 3121121418 3121121489 2121120193 2121120378 3121120037 3121120076 3121120111 3121121224 3121501691 3121113041 3121120902 3121121087 3121121107 3121121180 1121506943 1121403182 2121111814 2121120064 2121120151 2121120432 2121502695 3121121268 3121121396 3121121538 3121121546 3121120099 3121120108 3121121093 3121121316 3121120020 3121120128 3121120413 3121120440 3121120086 3121120217 3121120324 3121120356 3121120388 3121120462 1121706356 1121703835 2121120006 2121120153 2121120297 3121120871 2121401579 3121114220 3121120251 3121120267 3121120420 3121120446 2121701346 3121120890 3121120942 3121121003 3121121348 3121121438 3121120109 3121120136 3121120178 3121120285 3121120439 3121120571 1121120044 1121120091 1121120240 1121120408 2121120198 2121120264


2121120358 3121120928 3121120986 3121121082 3121121151 3121121416 3121121479 2121120215 2121120265 2121120098 2121120181 3121120067 3121120137 2121404085 3121120907 3121120977 3121121025 3121121047 3121111293 2121120311 2121120444 2121120487 2121120024 2121120049 2121120138 3121116299 2121404579 2121403756 2121120197 2121120259 2121120403 2121120471 2121120109 3121121091 3121121140 3121121159 3121121191 3121121205 3121121305 3121121161 3121121388 3121502349 3121112271 3121120030 3121120088 3121120085 3121120162 3121120384 3121120479 3121120750 3121120833 3121121507 3121120010 3121120107 3121120118 3121120125 3121120163 3121121051 3121121052 3121121221 3121121279 3121121395 3121121552 3121120117 3121120138 3121120250 3121120372 3121120505 3121120531 3121121318 3121121424 3121121525 3121120220 3121120242 3121120294 1121120052 2121120375 2121120440 2121120037 3121120897 3121120981 3121121215 3121121310 3121121315 3121120031 3121120229 3121120252 2121120156 2121120221 2121120295 2121120384 3121120960 3121118128 3121120082 3121120323 3121120537 3121120556 3121120634 3121121016 3121121518 3121120133 3121120331 3121120392 3121120408 3121120620 3121120978 3121121018 3121121019 3121121062 3121121358 3121113487 3121120231 3121120391 3121120882 3121120939 3121121035 3121121128 2121705250 3121120998 3121121007 3121121055 3121121234 3121121363 2121120084 2121120104 2121120172 2121120283 3121120878 3121120883 3121121371 3121121409 3121121433 3121507730 3121120171 3121120228 3121120958 3121120979 3121121423 3121120094 3121120248 3121121444 3121115230 3121121223 3121121265 3121121342 3121121360 3121121420 3121121163 3121121344 3121121417 3121121435 3121120042 3121120064 3121121106 3121121386 3121115746 3121116040 3121507068 3121502690 3121121121 3121121184 3121506112 3121500439 3121121377 3121121494 3121121162 3121121260


3121121408 HUSNA WIRA 3121503879 NURUL MAULIDYA 3121120056 FITRIANI 3121120336 SUNITA 3121121450 HERDIANA 3121121521 REZA YUZANNA 3121121535 ISFAN SAPUTRA 3121115017 EFRIZAL 3121506156 NURMALA SARI 3121501842 ARY SUNANDAR 3121120135 KHAIDIR 3121120190 MHD ARIEF DIANA 3121120349 NUR AKMALIA 3121120508 JULIADI 3121120527 DELLA PUTRIYANA 3121121218 HIDAYAT 3121121136 ZULVITA RISKIAH 3121121203 NURUL AULIA PUTRI 3121501186 KIKI SRI REZEKI 3121121327 EVA JULIANA 3121121457 DIAN SAVIRA 3121121464 SANDI AGUSTIAR 2121120350 CHAIRUNNISA 2121508285 MUHAMMAD ALGI VARI 2121501938 DESI NATALIA SIAHAAN 3121120015 KHAIRUL RAHMI 3121120053 ZULKARNAINI 3121120314 MUHAMMAD ROZI 3121120988 ISMAIL 3121121028 RINI SUFIANI 3121121152 MOCH.REVI AFSANJANI 3121121208 RIFQA YANI 3121121250 REZA AULIA 3121121350 AGUSTINA 3121121038 IRFAHMI 3121121122 ERNAWATI 3121121130 ABDUL HAKIM 3121110668 NUR AISYAH 3121110791 AHYAUL MUBARAK 3121121214 SAFITRI ARISKA 2121120448 VINA VEBRIANI 2121120481 WARDANI 2121406460 INDAH STAMPUBOLON 3121121179 RISKAL HAYATI 3121121219 RACHMAT SHALEH 3121121281 MUHAMMAD ISMAIL 3121120627 IMAM FALUTI 3121120906 SAFARI 3121120917 RAFIKA MULIANI 3121121168 NURMASYITTAH 3121121211 TAWAKKAL 3121121337 AINUR RIDHA 3121117822 ALDIAN 3121405240 NIKMATIR RAFIKA M 3121116585 MISNA DEWI 3121120008 ANDREAS BASUDEWA 3121120079 INTAN SAFITRI 3121120114 RISNA ANGGRAINI 1121705226 RIZA NURAFNI 2121120240 CHAIRUL NAZAMI 2121120427 JULIA 2121120116 AMALIA 3121120889 DODI AL FAJAR 3121120940 MUSDARIANDI 2121120256 MAULINA PUTRI FUNNA 2121120299 MUHAMMAD NUR 2121120301 FHADIL 2121111348 NURHADISAH 3121511500 HAFIZ RINALDY SYAM 3121116845 NURUL IRA PRATIWI 2121120447 SAYUTI 2121120490 RIDHA AULIA 3121404197 ALJADSIAH 3121505519 FANNY SUSANTI 3121120910 IKRAMULLAH 3121120993 YUNISA 2121120346 MAISURA 2121120446 ADE BARATA 3121114893 FARIZTAMANUGRAHA.NF 3121120216 ZAKARIA MALIK 3121120288 AULIA RAHMAN 3121120332 SAFIRA ADANI FAISAL 3121120588 DELI SAPUTRA 3121120683 AGUS SARI 3121120742 TAQY SUBKI 3121120813 NAZARULLAH 3121120814 MUHAMMAD YUNUS 3121115491 PUTRI ANASARI 3121120259 ERNAWATI 3121120278 SUPRIANTO 3121120308 LINDA FITRI 3121120327 ZULBAHRI 3121120363 HERLINDA YATNA 3121120452 DESTIAN AKBAR 2121120304 RIZKI DARAPHONNA 2121120074 MIRNAWATI 2121120118 AL FADIL 3121116016 KHARMI JUNI YANTI 3121507039 M.PRIHARDANI S 3121111561 ISRA WULAN SARI 2121120191 YOUMIL MIARSI 3121115282 RIZKI RAHMAT 3121402820 IQBAL MAULANA SHTG 3121121006 ABDUL HARRIS 3121121275 YUSRIYANI 3121121287 SAUFA JAMIL 3121503527 DHEDY SYUAIB LUBIS 3121120894 DENI ARI SANDI 3121121043 MUHAMMAD HARRIST 3121121178 FATAHILLAH 3121121190 KAMAL FAJRI 3121121207 NURHIDAYAH 3121121474 HUSNUL KHATIMAH 3121121509 MARDIFAL 3121504347 RETNO WULANDARI 3121120003 M.NUZUL 3121120196 DORA YUMAIDA 3121120237 WANDRI 3121120466 DARA CHAIRUNNISA 3121120521 IRFAN 3121120594 RISKY ANANDA PHONNA 3121120654 ABDUL RAZAK 3121114655 NANDA ARIF JARUSMAN 3121121379 SYARIFAH TUSANNA L 2121120460 RISNAWATI 2121120078 JUWARNA 3121120891 JAMALIAH 3121121339 ARIF HIDAYAT 3121112829 YOLANDA DEFIKA PUTRI 3121120028 SUJADMITA AMRITA 3121121109 RIZKIANA 3121121311 MISWAN WAGITA 3121121359 VERY FERNANDA 3121121368 CUT SHINTA LIANA 3121121387 ANDI SYAHPUTRA S 3121121471 ZAHRATULLAILI 3121120834 LENI MASZURA 3121403771 KURNIAWAN 3121120887 MISRAWATI 3121120888 MUSLEM 3121120997 NOFI RAHMAYANI 3121121015 M.YUSUF 3121502142 ARINI RAMADHAYANTI 3121506638 FAZRIA RIZKY ARDINI 3121118400 ZAMZAMI 3121120047 RAHMIWATI 3121120158 AKMAL 3121120159 CUT AULIA 3121501640 TESSA MANGGALA PUTRI 3121120973 DAHLIA YUSRIANA 3121121070 NURMAWADDAH 3121121127 NURLIS SEPTIYANI 3121121269 MUHAMMAD ZAMZAMI 3121121437 M. HAZIZI SYAHRIYAL 3121121504 EKA MAULIDA 3121115164 RACHMANDA MITA R 3121116656 MUTAWALIANNUR 3121111113 MUAZZIN 3121120246 RAHMATUL AHYA 3121120375 SAYUTI 3121121193 ULI SURYANSYAH 3121121254 DEDI SAPUTRA 3121121367 SUTAN CAHAYA IMAN 3121121391 SAID HANAFIAH 3121121514 REZA IKHSAN MAULANA 3121117413 SRI RAHMAYANI 3121121328 ANDIKA HERMAWI 3121121559 ISLAHUL UMAM 3121120121 MURIZAL

3121120144 3121120274 3121120494 3121113148 3121121111 3121121166 3121121336 3121121512 3121511450 3121120194 3121120202 3121120272 3121120419 3121120421 3121120513 3121121031 3121121032 3121121349 3121121491 3121115108 3121120014 3121120007 3121120078 3121120080 3121120188 3121120195 3121120240 3121120561 3121120600 3121120632 3121402533 3121503327 3121114994 3121121266 3121121312 3121121338 3121121370 3121121529 3121117905 3121121554 3121120011 3121120065 3121120143 3121120224 3121120290 3121501032 3121120084 3121120222 3121120659 3121120691 3121120701 3121121285 3121121343 3121121366 3121121380 3121121394 3121120213 3121111058 3121120899 3121120908 3121121278 3121112741 3121120164 3121120100 3121120132 3121120261 3121120292 3121120330 3121120621 3121120976 3121121146 3121121169 3121121195 3121112309 3121120029 3121120147 3121120262 3121120427 3121120481 3121120509 3121120579 2121120458 2121120029 2121120041 3121121143 3121121341 3121121473 3121120474 3121120488 3121120570 3121120575 3121115636 3121505905 3121121213 3121120312 3121120397 3121120468 3121120475 3121120555 3121120968 3121121075 3121121118 3121121123 3121121511 3121120073 3121120629 3121120646 3121120657 3121120680 3121120764 3121120788 3121120052 3121120215 3121120282 3121120463 3121120504 3121120611 3121120303 3121120584 3121120744 3121120855 3121502598 3122101792 3121121508 3121509347 3121112546 3121120127 3121120160 3121120183 3121120321 3121120416 3121400178 3121400610 3121120695 3121120712 3121121351 3121121414 3121121428 3121114221 3121402714 3121120106 3121121517 3121121533 3121121541 3121502603 3121120018 3121120134 3121120933 3121120944 3121121096 3121121157 3121121398 3121121436 3121120265 3121120411 3121120497 3121120743 3121120775 3121120801 3121120562 3121120717 3121120809 3121120949 3121120985 3121121177 3121505088 3121405930 3121113837 3121116805 3121120385


3121120423 3121120340 3121120358 3121120362 3121120377 3121120597 3121120694 3121121114 3121121171 3121121333 3121116364 3121115243 3121120036 3121120341 3121120364 3121120453 3121120867 3121501511 3121701614 3121120879 3121120911 3121121104 3121121196 3121121542 3121115869 3121121353 3121121427 3121121440 3121116024 3121711928 3121120651 3121121446 3121121469 3121111246 3121406113 3121120055 3121120367 3121501456 3121704917 3121120089 3121120157 3121120234 3121120243 3121121226 3121121303 3121121346 3121121369 3121121447 3121115009 3121121126 3121121139 3121121357 3121121429 3121121478 3121121486 3121120062 3121120119 3121120200 3121120232 3121120244 3121120322 3121120422 3121120471 3121120501 3121120544 3121120566 3121120697 3121116311 3121120054 3121120443 3121120506 3121120857 3121120863 3121120326 3121120514 3121120581 3121120766 3121120773 3121402086 3121120113 3121120197 3121120311 3121120450 3121120567 3121120723 3121121261 3121121284 3121121293 3121121534 3121503315 3121111781 3121120417 3121120445 3121120637 3121120686 3121120747 3121120758 3121121080 3121121262 3121121277 3121121362 3121121448 3121121455 3121120369 3121120456 3121120538 3121120547 3121120576 3121120633 3121120947 3121121022 3121121030 3121121415 3121121522 3121121547 3121120880 3121120943 3121121036 3121114273 3121120186 3121120275 3121120192 3121120219 3121120329 3121120412 3121120662 3121120687 3121121156 3121121283 3121121340 3121121553 3121508908 3121111491 3121121523 3121121540 3121110234 3121120016 3121120095 3121120155 3121507115 3121120206 3121120386 3121120405 3121120707 3121120735 3121120378 3121120512 3121120585 3121120606 3121120734 3121120823 3121403630 3121117555 3121120012 3121120027 3121120130 3121120156 3121121375 3121121393 3121708915 3121120001 3121120072 3121120110 3121121294 3121121331 3121121513 3121116610 3121501692 3121506357


3121120059 3121120145 3121120181 3121120264 3121120277 3121120283 3121120126 3121120319 3121120347 3121120467 3121120523 3121120700 3121121220 3121121276 3121121399 3121121506 3121509584 3121120154 3121121001 3121121059 3121121228 3121121313 3121121364 3121121502 3121404626 3121405771 3121121403 3121121537 3121120328 3121120472 3121502377 3121505835 3121120023 3121120039 3121120247 3121120316 3121121102 3121121158 3121121200 3121121335 3121121451 3121505725 3121120301 3121120489 3121120491 3121120516 3121120583 3121120622 3121120333 3121120407 3121120414 3121120510 3121120515 3121120582 3121117153 3121120486 3121120577 3121120625 3121120653 3121120674 3121120199 3121120400 3121120436 3121120546 3121120587 3121120669 3121121456 3121121531 3121120309 3121120464 3121120485 3121120560 3121120201 3121120287 3121120318 3121120379 3121120394 3121120532 3121120169 3121120187 3121120203 3121120444 3121120647 3121120670 3121120273 3121120296 3121120383 3121120402 3121120418 3121120779 3121120122 3121120289 3121120306 3121120320 3121120342 3121120399 3121120165 3121120437 3121120476 3121120493 3121120643 3121120802 3121120426 3121120552 3121120648 3121120650 3121120722 3121120759 3121120884 3121121004 3121121186 3121121227 3121121372 3121111797 3121118271 3121120004 3121120066 3121120091 3121120236 3121120368 3121120374 3121120490 3121120740 3121120807 3121500638 3121505907 3121120780 3121120796 3121120812 3121120848 3121120852 3121120864 3121500626 3121115378 3121120741 3121120752 3121120817 3121121256 3121121412 3121121460 3121120675 3121120762 3121120862 3121506591 3121120517 3121120614 3121120711 3121120730 3121120840 3121120586 3121120751 3121120810 3121712226 3121115254 3121115414 3121120786 3121121443 3121115498 3121120245 3121120428 3121120459 3121120553 3121120850 3121120672 3121120845 3121121374 3121121449 3121121543 3121120799 3121711835


WASPADA Sabtu 7 Juli 2012 3121509205 3121120607 3121120652 3121120210 3121120227 3121120284 3121120628 3121120677 3121120841 3121120353 3121120431 3121120589 3121120715 3121120749 3123820079 3121120783 3121120811 3121710630 3121509185 3121117033 3121112843 3121120824 3121404248 3121111812 3121120851 3121120790 3121120822 3121120861 3121114222 3121509940 3121120635 3121120736 3121507954 3121121182 3121121216 3121121255 3121121280 3121120610 3121120699 3121120530 3121120535 3121120827 3121120828 3121120765 3121121558 3121120624 3121120658 3121120721 3121120768 3121120843 3121708052 3121404783 3121111554 3121111967 3121120022 3121120044 3121120266 3121120465 3121120847 3121120853 3121120820 3121120842 3121120455 3121120757 3121120770 3121120844 3121707611 3121117455 3121112906 3121509751 3121120726 3121120771 3121113809 3121405487 3121120337 3121120409 3121120568 3121120573 3121120663 3121120800 3121121076 3121121332 3121121548 3121110336 3121111741 3121120760 3121120732 3121120781 3121120601 3121120746 3121502960 3121111563 3121120837 3121510118 3121120381 3121120433 3121120793 3121120805 3121120821 3121120794 3121120599 3121120681 3121110113 3121118118 3121120642 3121120704 3121120774 2121404458 3121506207 3121120595 3121120729 3121900906 3121120612 3121121167 3121121225 3121121291 3121121325 3121121550 3121120865 3121503317 3121115232 3121114412 3121120549 3121120705 3121120623 3121120678 3121121501 3121511830 3121502369 3121503292 3121120487 3121120856 3121120477 3121120482 3121120617 3121120829 3121120846 3121117248 3121120791 3121120804 3121120849 3121117192 3121510243 3121120866 3121120738 3121117161 3121506182 3121120816 3121120389 3121120649 3121120666 3121120702 3121120667 3121120688 3121120739 3121511413 3121511799 3121121539 3121120092 3121120304 3121120350 3121120808 3121505772 3121120831 3122703746 3121901954 3121120754


WASPADA Sabtu 7 Juli 2012

PENDIDIKAN DOKTER 112-11-11432 VERA ANGRAINI 112-14-00219 MICHAEL R I SILABAN 112-14-00261 LANDONG SIHOMBING 112-14-01035 DEBBY CLAUDI 112-14-01415 ZAINAL N 112-14-01439 RAUDHAH SARI 112-14-01741 BUDIMAN 112-14-01985 MEYVA SASMITA 112-14-02074 ANDRE PATAR SAROHA S 112-14-02278 BENNY 112-14-02420 HARTATI PANJAITAN 112-14-02466 FEBRINA SETIAWAN 112-14-02551 ASTRI FEBRIANTI S 112-14-03137 BURHAN 112-14-03802 FADILA ASWITALIA 112-14-04629 DINA KHAIRINA 112-15-00014 TANIA S ALEXANDRA 112-15-00115 CLARA DEVINA 112-15-00151 MARIA ANASTASIA 112-15-00159 DEBORA SANNY TIO 112-15-00179 FARID MAULANA NST 112-15-00324 FETRA S 112-15-00364 DESTI LAURA 112-15-00431 BRYAN FRANCO GM 112-15-00442 JESIKA ANDREA S N 112-15-00660 YONIS 112-15-00688 SARAH ANNISATUL M 112-15-00748 ANGELIA CHANDRA 112-15-00898 SRI RATU NOVENI 112-15-00902 GETSY DAONY 112-15-00969 DINDA NATASYA 112-15-01089 ANDREA AGITHA T 112-15-01123 BEBIE AYURA 112-15-01138 AGNESIA DAME ULI 112-15-01158 MONALISA SIMBOLON 112-15-01187 YOLANDA OCTAVIANA 112-15-01209 YENTY OKTAVIASUTANTO 112-15-01238 YOEL RAY SORGIA S 112-15-01357 FEBRINA FAJRIA 112-15-01450 VINSON 112-15-01463 KIKI FERNANDO TUA S 112-15-01484 HIZKIA P 112-15-01658 RAUZATUL FITRI 112-15-01692 ADELINE 112-15-01745 CLARISA MONICA 112-15-01888 RIZKY AYU W SIJABAT 112-15-02157 ASTRI GARTIKA 112-15-02204 WILSON 112-15-02335 SYUKRIA FITRI 112-15-02356 DESI GLORIA DAMANIK 112-15-02481 MAYA ASHARIE HRP 112-15-02523 JORDI S HASIBUAN 112-15-02525 AFRIANI C SILALAHI 112-15-02535 DEAR PUTRI 112-15-02657 ALFINYANTO UTAMA 112-15-02834 M YUSUF ADHIRA PUTRA 112-15-02850 MAYA DIANA S 112-15-02960 NIA STEFANI TAMBUNAN 112-15-03022 HAIZIL FUADI 112-15-03131 RIFHANI ATTHAYA P 112-15-03144 ANANDA SYAH PUTERA 112-15-03351 JESSLYN TAN 112-15-03439 WIDYA M SIRAIT 112-15-03473 EDY SUSANTO 112-15-03824 CORRY SIHOMBING 112-15-03870 ARTHA PRATIWI S 112-15-03932 LINDA MONITA 112-15-03968 UMAR AR RASYIDIN LBS 112-15-03993 RINI FITRI YANI 112-15-04067 APRILIA PRAFITA S R 112-15-04117 IMMANUEL DIO L T 112-15-04160 DELINA SEKAR ARUM 112-15-04210 DWI INGAN 112-15-04240 ESTER INTAN SINAGA 112-15-04289 AYU SRI A SIHOTANG 112-15-04330 HENNYTIA RIDHA F 112-15-04431 SANDI WASKITHO 112-15-04467 FENNY

Hasil SNMPTN USU 2012 112-15-04517 SHIERLY 112-15-04573 ORLANDO F M SINAGA 112-15-04576 LEO MARTHIN NDURU 112-15-04700 NISRINA KHAIRUNNISA 112-15-04701 ANDREW TIMANTA 112-15-04769 SITI HALIMAH NOVITA 112-15-04773 JUSTIN H DJUANG 112-15-04924 IVANA YAUVIRA 112-15-05021 RUMIANI MANURUNG 112-15-05271 FITRIYANI SARUMAHA 112-15-05331 ARIFA 112-15-05374 CATHERINE JUNUS 112-15-05534 ASTRIYANI BR KEMIT 112-15-05578 RUTH MANULLANG 112-15-05595 MUTIA MAYWINSIH J 112-15-05596 HANDOKO HARTANTO 112-15-05611 FEONA JAPAR 112-15-05676 AGUSTIN VIRAJATI N 112-15-05757 RONAULI AGNES M 112-15-05987 JOSHUA ASLEY 112-15-06267 LINA 112-15-06284 TENGKU MAFAZI FARUQI 112-15-06336 LUTHFI WAL IKRAM 112-15-06360 YOSE NATASA 112-15-06400 AYU DIANITA GINTING 112-15-06420 YENNY H. PURBA 112-15-06425 CHYNTIA OMEGA 112-15-06476 KEVIN EFFENDI 112-15-06554 HARTANTO 112-15-06608 MUHAMMAD LUTHFI 112-15-06664 YOSUA C R N 112-15-06686 RAHMAD ARIFIN HSB 112-15-06706 M FAKHRUR ROZI 112-15-07014 WILIANTO 112-15-07039 YULI BINTANG THRESIA 112-15-07097 ALEXANDER JOSETHANG 112-15-07227 MARTHIN ARDO P S 112-15-07447 DIDI ANTHONI WIRAWAN 112-15-07497 RICKY JONNA M K 112-15-07567 YOLANDA SINAGA 112-15-07761 RIJENA B 112-15-07817 TIONOTO SANTOSO 112-15-07895 JESSICA ARMINTA W 112-15-07925 PATRICIA 112-15-07999 NOVELIA CAROLIN 112-15-08115 TIFFANY 112-15-08129 SHERLY OCTAVIA 112-15-08204 DAMAN GREGORIUS M 112-15-08258 STEPHANIE JESSLYN 112-15-08519 ROIMAN P 112-15-08543 DIKA ASRIKA ASRUL 112-15-08639 CHARLES 112-15-08720 FERRY FHRANS V 112-15-08762 CHRISTEVEN 112-15-08894 DANIEL E T 112-15-08920 JOSEP LIMBONG 112-15-09162 RIO SIAHAAN 112-15-09411 WIDIA 112-15-09551 HANS ANDRE H S 112-15-09554 YOHANA R 112-15-09798 HERLITA PURBA 112-15-09866 HARDY 112-15-10018 RAHMA SARI 112-15-10196 ANGGREYANI D S 112-15-10318 YOSEPHINE M SITORUS 112-15-10335 HENDRI 112-15-10343 IVONIKE 112-15-10505 ANDRIAN NARDO 112-15-10799 CANDYS LIBIO 112-15-10840 HUMIKO HESTIRA 112-15-10853 KRISTIAN GERRY R S B 112-15-10888 LAVENIA 112-15-10905 ZAMILAH ASRUL 112-15-11033 RUTH DIAN GIOVANNI 112-15-11063 GRACIA PRICILIA 112-15-11074 ALVIN YAP 112-15-11131 SERGIO PRATAMA 112-15-11159 JENNY HOWARD 112-15-11347 CATERINE A M

112-15-11372 GEBI TOBING 112-15-11399 AHMAD FERIANSYAH LBS 112-15-11436 CHRISTIAN F G L 112-15-11711 DEDI KURNIAWAN NST 112-15-11721 STEVEN CHANDRA 112-15-11735 ZENNY WIJAYA 112-15-11790 JOHANES IRPAN 112-15-12411 ANDROCLES TAMPUBOLON 112-15-12457 MARWAH HERLIANI 112-15-13096 ANDY WILLIAM 112-15-13099 JERICHO ALBERTO S 112-15-13440 INRAWATI S 112-17-04437 RIZKI VELIA 112-17-05765 KHAIRATUL UMMAH 112-17-07309 FAKHRUR RAZI 112-17-07708 AFDHAL PUTRA 112-17-07929 NAHRIA HUSNA 112-19-01925 DEBBY CHESILYA W 112-19-02860 JUNIUS F.A SIMARMATA 112-19-03267 MUHAMMAD REYHAN 112-19-03825 SINGGIH EKA PRASETYO 112-19-04547 PASKA RIA ANGELA 112-19-05059 KHOLIDA ULFA 112-19-05278 RANTUNG SALINAS 112-19-05451 AMIRUDDIN H 112-19-06147 IAN RIMHOT S 112-21-00082 HARISA NOVALINA P 112-21-01539 CHANDRA MEILYN M 112-27-04246 IBNU GILANG SYAWALI 112-27-05130 ROBBY MARTIN S 112-30-00459 EMMANUELLA IRENE G S 112-30-01141 DARIUS HARTANTO 112-30-03765 MASNIARI SUNNY P 112-30-03972 RAHAYU SITUMORANG 112-30-05647 YESSICA C PASARIBU 112-30-06369 MIA RAISSA ULINA 112-30-06517 STEFINA VERONIKA 112-30-06801 SITI RAHMI NUR F 112-30-08807 ADRIANI SAKINA 112-30-09849 MASITHA AYUNI 112-30-09903 SAHITRA 112-30-11102 STELLA DORETHA GRACE 112-30-12149 DWINTA RIZKY RACHEL 112-30-13289 SEREPINA OKTAVIANI S 112-30-15261 HANSEL ARDY PARULIAN 112-30-15288 ELISABET PARDEDE 112-30-16154 PUTRI ITONAMI GAOL M 112-30-17547 GABRIELLA PASARIBU 112-33-14112 THEODORE GABRIEL 112-33-20178 ASTRID ANDREA P S 112-33-20955 WIRIANTO 112-33-21348 KEVIN H P 112-33-23457 FARIZKY 112-34-02070 RIZKY IVAN 112-34-02861 VERRA ANINDYA S.R 112-34-05502 INDRATI ASROFIANA PA 112-34-07712 TIARANI NUR A 112-34-08680 PAHYOKI WARDANA 112-34-09216 THERESIA MURNIWATI S 112-34-09253 YOLANDA RAHAYU M. SI 112-34-09805 FIONA YOSEPHINE 112-34-09816 ELSA ZULINA PUTRI 112-34-11834 ERNEST A.L SIMBOLON 112-42-05185 NANCY M NADEAK 112-46-02841 ADDINI NIMAZ S 112-46-08036 CHANDRA WIRAWAN 112-46-10039 NANDA SANTRIAYU 112-55-08833 KRISNA BUANA 312-11-14822 SUDIRMAN 312-14-02727 INDAH R LUBIS 312-15-00319 NAMORATTA RUMAHORBO 312-15-00481 NINDI INTAN APRIANDI 312-15-01233 SYARIFAH LUTHFIAH 312-15-01538 KAMELIA SITORUS 312-15-03222 CHRISTYN ELISABETH S 312-15-03226 VIDI RERE C PURBA 312-15-04089 MUTIA CHAIRANI 312-15-04190 DASTA SENORITA 312-15-04323 ADRIAN SUSILO -

312-15-04522 WILSEN 312-15-05365 GULTOM, VEDORA A 312-15-05751 GOMEDI 312-15-05934 ANGGI YOSEFIN P B 312-15-06702 ALEXANDER J Y S 312-15-07682 FITRI SIMANJUNTAK 312-15-08196 HOT NAULI SIMAMORA 312-15-08732 BETSY Y NADEAK 312-15-08839 NICHOLAS H SIBARANI 312-15-08902 RESKI N M N 312-15-09304 DANIEL HALOMOAN 312-15-09499 M YOGA ILHAMSYAH 312-15-09634 DANY PETRA P BARUS 312-17-00117 AZDKIA YOLANDA PUTRI 312-19-01522 DIAN PERMANA 312-27-03307 DEDI IMANUEL DEPARI 312-30-04851 AMELIA ERVINA 312-34-03322 FEBRYANTY JUSTYCYA 312-34-05783 PRIMADONA Y GULTOM 312-38-20656 RAHELINA PAREME 312-38-21028 JESSICA DEANATALIA P 312-42-02134 RUTH G MALAU 312-50-02220 SARI MEUTHIA DEWI TEKNIK ELEKTRO 112-14-00597 WIRATMAN 112-14-00988 ARIVIN ZEBUA 112-14-01342 DAVID 112-14-02249 LASRO M SIREGAR 112-14-03068 MUHAMMAD FADLAN ARIS 112-14-03952 JONATHAN C A S 112-14-03977 M LAZUARDI RANGKUTI 112-15-01230 ANDIKA YOGY PRADANA 112-15-01299 IBNU HAZAR 112-15-01490 IRA MELATI SILALAHI 112-15-01643 ANDIKA S ALFONSUS M 112-15-02014 MUADZZAH RAHMAT 112-15-02304 M. ROSO SUTRISNO 112-15-02483 RAY CALVIN S 112-15-03155 FAUZI ARIF PRATAMA 112-15-03203 DAVID CHRISTIAN H S 112-15-03781 JONNER S 112-15-03785 NAUFAL ARIF 112-15-03871 RIOVAN S 112-15-04027 RHIDO NAINGGOLAN 112-15-04909 MAHATIR MUHAMMAD 112-15-05262 KHAIRUL BASRI 112-15-05778 RENHARD S 112-15-06314 YOSE G 112-15-06323 NICOLAS HARTANTO 112-15-06691 NICHO E.S 112-15-07448 ANDRIEN PHOEBUS 112-15-08035 DANIEL YUS TRIANDI 112-15-08360 NOVAYANTI SIMALANGO 112-15-08385 M. RIDHO BARIDWAN 112-15-09897 SYAHRUL WAHYUDI 112-15-10326 JEFFRY NAEK SITORUS 112-15-10410 YOGI C SIMARMATA 112-15-11181 JUNIPAN C GULO 112-15-11625 ALBERTWAN B T 112-15-11699 ESRA C S 112-15-11734 LIPI JUNANDA SINAGA 112-15-11767 DIONSTRANO SIMAMORA 112-15-12058 MHD KHAIRUM ARIFIN BIDIKMISI 112-15-12250 RIO R. SIMANJUNTAK 112-15-13168 ANUGRAH H 112-15-13385 ROMARIO HUTAHAEAN BIDIKMISI 112-17-05738 MUHAMMAD KENNEDY 112-17-07822 ZULHAM JULIO 112-17-08951 MUHAMMAD ARIF 112-19-02005 WAHYU NUGRAHA 112-19-03509 WINDI WIRAWAN 112-19-04317 RIO HARAPAN P 112-19-04910 HANGGIEF SEPATAMA 312-14-03836 AGIL M. CAESAR BIDIKMISI 312-14-04159 JOHANNES SINAGA 312-14-05213 MARCO SILAEN 312-15-00637 BOBBY B KEWAS 312-15-01931 GOMGOM SIHOMBING -

312-15-03010 KORESY S 312-15-05247 IRWAN S S BIDIKMISI 312-15-06488 RICART J PARHUSIP 312-15-06793 STEPANUS KENA E P G 312-15-07125 ELYANI BR SURBAKTI 312-15-09719 ROYANSYAH PUTRA G BIDIKMISI 312-30-02800 VALENTINO TARIGAN TEKNIK MESIN 112-14-00765 JULIASTER GIRSANG 112-14-01898 JOHANNES PASARIBU 112-14-02251 REDMAN WIJAYA 112-14-03654 KEVIN T 112-15-00192 ALDI WIRA SYAHPUTRA 112-15-00332 AGUNG SANDI PRAKASA 112-15-00491 KYVLAN BIMO PUTRA 112-15-00824 RIZAL LAMBOK S 112-15-01196 TAMBANG M 112-15-01267 ENDA PRATAMA PUTRA 112-15-01332 AKBAR REZA PRATAMA 112-15-01805 IAN RAJ L. SEMBIRING 112-15-01867 FRENKY DAUD SITORUS 112-15-02274 EVAN A SIHOMBING 112-15-02766 FREMMY RAYMOND 112-15-03081 ROBERT SKEIN 112-15-03256 DANIEL CUACA 112-15-03347 SURYA 112-15-04048 BANTU H S BIDIKMISI 112-15-04143 RIZKI DWI RANDA 112-15-04314 ISRA HUTAURUK 112-15-04672 JERRY RONITUA S 112-15-05057 AHMAD FACHRIZAL 112-15-05067 MOHD. YAZID THARMIZI 112-15-05895 ADISAHPUTRA NABABAN 112-15-06762 JASON LAUZUARDY 112-15-06787 NIXON RANDY 112-15-06873 JAMES SINAMBELA 112-15-07244 SUNOTO 112-15-07631 BINSON MANURUNG 112-15-07887 DENNY WAHYUDI 112-15-07954 PUTRA CHANDRA 112-15-08039 EMZY SAFERI GINTING 112-15-08430 ANDREAS P M T 112-15-08897 FADLAN YUSRONULHAQ 112-15-08949 ERICK SUMARGO 112-15-09030 JUELF R AMBARITA 112-15-09082 SIGIT KURNIAWAN 112-15-09574 TIKKOS SIHOMBING BIDIKMISI 112-15-09651 NORDICK HUYWEN 112-15-10172 M RIZKY ANANDA 112-15-10357 BINTON SIMANGUNSONG 112-15-10838 SINTONG BUTARBUTAR 112-15-10980 ALBERTO M T 112-15-11106 DALE CARNEGIE 112-15-11244 LAMBOK SAMUEL 112-15-11467 ZULHARI RITONGA 112-15-11581 PERI SAMUEL K 112-15-11792 ERWIN NAINGGOLAN 112-15-11864 YUAN NAUFAL ILMAN 112-15-11961 EFENETUS FERNANDO 112-15-12082 PIETER 112-15-12713 TAMMAM MUDDIN ARIF 112-15-12885 ANDI SYAHPUTRA 112-15-13007 BAYU CHRISTIAN B 112-15-13068 HERDIANTO 112-17-00761 WILLI DESNANDA 112-17-01059 AQQIL LIMIANTO 112-19-01291 DIEN TRI A 112-19-03122 FERRY SIANTURI 112-19-03682 THOMAS ARBYANTO 112-19-03975 RANDY PUTRA S 112-21-00474 WASHINGTON SIANTURI 112-23-05944 JUNIVER SINAMBELA 112-25-01316 GERRY REIN F S 112-30-03808 RUBEN AM TURNIP 112-30-07870 FIRDAUS LIE JANSEN 112-34-06873 FITRANI KAMILA 312-14-04281 FABRI YOHANNES 312-15-00484 M NURUL AZHARI 312-15-01554 BATOAN M SITUMORANG 312-15-01602 GUNAWAN S. PONTI 312-15-03071 M RAMADHANSYAH PUTRA 312-15-03288 CHANDRA A NABABAN 312-15-03493 MARTIN A P 312-15-03905 FERRY PEPAYOSA S 312-15-05947 BILLY C MANURUNG 312-15-05984 CLARA ANGGI 312-15-06621 ZYKRIE YUDHI S 312-15-07635 DONNY MARFIN 312-15-07894 ASYBEL BONAR 312-15-08501 REYGERY SEMBIRING 312-15-08708 TOIRON MUSTAQIM 312-15-08877 IMMANUEL SIMANULLANG 312-15-09599 SEBASTIAN ELKANO 312-15-10499 BASTIAN WIJAYA N 312-15-11314 PUTRA MR SIANIPAR 312-15-11315 MARTGOMI SIMAJUNTAK 312-15-11716 RICKY M H PURBA 312-17-08677 NOFIQBAL ANISSA 312-19-00786 JUNTER S R SIHITE 312-34-06585 JANUAR DAVID S S TEKNIK INDUSTRI 112-14-02180 ZULAIKA 112-14-02356 MUHAMMAD ARIF LUBIS 112-14-02837 NIA YESIKA 112-14-03173 APRILIENE SIDABUTAR 112-14-04206 NENENG ISNAINI LUBIS 112-14-04485 RIAN MAULANA 112-15-00357 CONAN YUWONO LAUDEN 112-15-00485 RAHMAT SUTAMI 112-15-00500 TIVANI S TOGATOROP 112-15-01359 NOVIANDA BR GINTING 112-15-01812 TRISSA ADELA PURBA BIDIKMISI 112-15-01934 M. TEGOEH ADI 112-15-01967 TENGKU HENY KARTIKA 112-15-02722 HEBRON V GIRSANG 112-15-02997 DIKA AYU HARDIANTI 112-15-03115 PUJA SATRIA LIE 112-15-03151 MELISA -

112-15-03178 ANDY SURYADI 112-15-03491 KSATRIA F P L TOBING 112-15-03604 MEGA YUDIA L TOBING 112-15-03608 POLY P DAMANIK 112-15-03735 HARDI TAN 112-15-04147 REZA G 112-15-04479 DEWI SURYA TANIWAN 112-15-04543 JANUAR HANDOKO 112-15-04552 ASKARI MUFLIHIN 112-15-04571 SANGGRA GUNAWAN 112-15-04768 AGUS TARIDA 112-15-04856 FERDY SUSANTO P 112-15-05102 CHRISTY CIASINTA U 112-15-05389 ENY BERTY BR GINTING 112-15-05577 MIKE SENJAYA 112-15-05583 FADYLLA RAMADHANI P 112-15-05779 REGINE M N 112-15-05864 RONALD F SIDABUTAR 112-15-05920 ERIC HERTANTO 112-15-06026 SHAREN SEPTIANI 112-15-06092 M. ECHSENDY SUARI 112-15-06249 RORI RUMENDA 112-15-06415 RIA FRANSISCA S 112-15-06956 FREDDY 112-15-07124 SEHAT JANUAR BIDIKMISI 112-15-07190 DEFRI NAEL SIANIPAR 112-15-07951 ABDUL KADIR BATUBARA 112-15-08131 DESSY M MARPAUNG 112-15-08943 HORAS A S NAINGGOLAN 112-15-09077 GEBRINA A D BR T 112-15-09119 JONATHAN 112-15-09274 VERONICA 112-15-09562 JEVI MULYATI 112-15-09653 RIZKY MARINI RAMBE 112-15-09841 CHANDRA HADI P 112-15-09906 DEDE ARIFIN 112-15-09967 ANDRE SILABAN 112-15-10013 SRI ASTRIANI BIDIKMISI 112-15-10016 MARIA OKTAVINA S 112-15-10672 LIA ARMAYA 112-15-10711 TULUS SIDABUTAR 112-15-10720 ELISABETH NGL 112-15-10844 LAXHMI MAHESVARY 112-15-10998 STEVEN 112-15-11369 STIFEN TANKAS 112-15-11803 KHALID HABIB 112-15-12130 MIEN FEBRYA GIRSANG 112-15-13617 TIMBUL DANIELLO 112-19-03174 LORENZO ANDREAS BIDIKMISI 112-19-03969 NOVIZA HAYATINUR 112-30-06492 YOLANDA PANJAITAN 112-30-10871 BINTANG DENNY 312-11-15441 LUKFA ARINI 312-14-03796 SAVUDAN N SIHOMBING 312-14-04280 JOHANNES A. P GULTOM 312-15-00003 SONY CHANDRA L T 312-15-00363 M FAKHRIN AQRAN 312-15-00586 YOSUA J S HUTAGAOL 312-15-00657 CLAUDIA URSULA 312-15-01709 NAOMI A T 312-15-02083 REBECCA N. SIHALOHO 312-15-02203 THEOPHANIE. O.A.L.S 312-15-02338 MANASYE GRACIA 312-15-02483 FAJAR REZEKI NST 312-15-02921 AULIA MUHAMMAD S N 312-15-03019 JOEL CHRISTOPHER 312-15-03587 JOAS P SARAGIH 312-15-04179 BRYAN N I ARUAN 312-15-05031 JOSHUA SILAEN 312-15-05314 DEDI ISNANDAR PAKOLO 312-15-05857 RENY DARMITA 312-15-06649 KHAIRIAH HAFNI 312-15-07431 ALBERT 312-15-08287 MARLYN SERENIKA P 312-15-08611 HARDY PASARIBU 312-15-10634 IMAM WITTJAKSANA 312-15-11484 YEHESKIEL TARIGAN 312-17-03439 SARMIDA NOVIANNA P M 312-19-03322 LAURENT MONICA 312-30-03401 \ADITYA HALOMOAN TEKNIK KIMIA 112-14-00070 ALVIAN 112-14-00297 PUTRI DEFRISKA M S 112-14-01586 HADI KUSUMA 112-14-02221 IMAN TRI CAHYADI 112-14-03541 FITRI ERLIA 112-14-03955 ADIN NOVE BRIYAN S 112-14-04744 YOGI SOERIADINATA 112-15-00082 ANDRI RUSLI 112-15-00198 BAGUS A SUBAHENDRO 112-15-00312 RONNY AGUSTINUS 112-15-00559 SUKARDI 112-15-00572 INDRA PRAWIRA JULIUS 112-15-00836 YANTINE ARSITA P 112-15-01048 HAGAINA KASIH BR G 112-15-01684 ANDREW HANS PRIMA 112-15-01864 JOJO VIET BUNDER H 112-15-01968 ELDON TANAKA 112-15-02152 MHD.REZA RAHMADHAN 112-15-02377 RICKY KRISTIAN PURBA 112-15-02452 ASTRI DEVI Y S 112-15-02599 CHARLES 112-15-02650 KEVIN 112-15-04004 FADHIL AL FARUQ S 112-15-04088 PHELIPS PURBA 112-15-04259 RIANDO O SIHOMBING 112-15-04596 ANDREI FAJAR SIAHAAN 112-15-04693 YOSAFAT SIMAMORA 112-15-05240 KENRICK 112-15-05616 NOVENTA PRAMANA G 112-15-06014 GRACE SEVANYA 112-15-06017 MARASIL SITUNGKIR 112-15-06289 RIKY 112-15-06953 ROGER R.H PURBA 112-15-08079 CILCILIA MARLIANA D 112-15-08502 REGUEL NABABAN 112-15-08576 DEBBIE ADITIA R 112-15-08715 JAKARIA NASUTION 112-15-09489 MARIO SARAGI BIDIKMISI

C1 112-15-09617 JEFRY TURNIP 112-15-09736 JONATHAN DENGGAN MAN 112-15-10621 NIKE TARUNA 112-15-11349 ANDY JUNIANTO S 112-15-11737 ERIK WILIAN S 112-15-11763 ADELINA S PURBA 112-17-01435 LEONARDO INDRA 112-17-03679 FENI SARI PUTRI 112-17-03814 NILNA IQBAL 112-17-04595 AULIA FITRI BIDIKMISI 112-17-05090 M. ARIF ALHAMDI 112-17-05783 WALID AL ARFI BIDIKMISI 112-17-07987 RIZKA DWI HIDAYATI 112-17-08059 NICKO SANJAYA ADI P 112-17-09184 AULIA BISMAR PADUANA 112-19-00727 AGUS WINARTA 112-19-05227 MICHAEL PREDLY S 112-33-41610 MENTARI HARMAINI 112-33-60153 GRACE ANGELIN 112-34-08147 FRIST SILIA 112-34-11564 NUIM HAYAT BIDIKMISI 112-63-00780 BRIGITTA ALPHANTARIA 312-14-03727 FAHMI MAULANA YANUAR 312-15-00490 TRIO FEBRIANTA L T 312-15-00895 RIKKI ALANTA A BARUS 312-15-02031 RIKA ARISKA 312-15-02601 HISKIA ARAPENTA 312-15-04104 MORA SARTIKA 312-15-04249 BRYAN ONI SULISTIO 312-15-05183 CHANDRA SITORUS 312-15-05781 ANITA TIURMAIDA H 312-15-06790 SAMSUL BAHRI BIDIKMISI 312-15-06845 PIETY SIBAGARIANG 312-15-06885 FEDERIKO MARKUS L N 312-15-10430 ELFRIDA MARGARETHA 312-17-03234 RIMA RIANI BIDIKMISI 312-17-06782 SITI MAISARAH TEKNIK SIPIL 112-14-00242 WINSTON CHENNADY 112-14-00553 BAYU SANTOSO 112-14-01433 MUHAMMAD AL-AZHAR G 112-14-02053 VINCE Y ZENDRATO 112-14-02085 ZULFIKAR BIDIKMISI 112-14-02292 BAGUS HARIAWAN 112-14-04480 KAYAN ANDIKA 112-15-00084 SAHRI DANI 112-15-00694 MARSADA H M BIDIKMISI 112-15-00826 DANAN ANWA SALIM 112-15-01022 AULIA RAHMAN A 112-15-01285 ARIF RAHMAN LUBIS 112-15-01589 INDRA PRATAMA 112-15-01668 ELEAZER P SAMOSIR 112-15-02095 CLAUDYA B BENEDICTA 112-15-02172 ANDRE ANDIKA S 112-15-02338 THOMPSON KWAN 112-15-02366 HAFNI JAYANTI 112-15-02455 TADEUS SATRIA RAGEL 112-15-02610 PRASETYO RAMADHAN 112-15-02675 STEPHANUS SIMBOLON 112-15-02741 WIRA PERDANA S 112-15-03199 YAN ADELAILA RAMBE 112-15-03417 ABDIANSYAH PUTRA S 112-15-03516 FAHMI RAHMAN 112-15-03650 DOLY MANURUNG 112-15-04473 BENNY WIRAWAN 112-15-04627 SEPTIAJI PRATAMA 112-15-04710 LARRY DJONO 112-15-05575 LUCCAS ANTHONIO 112-15-05694 SARAH HUTABARAT 112-15-05953 MICHAEL 112-15-05968 KEVIN R G SINAGA 112-15-06338 JEFFRY 112-15-06478 ERIK 112-15-06494 RUDINI SIRAIT 112-15-07665 HENDRIK 112-15-07708 M.FADLI RITONGA 112-15-08221 RIDHO R SAGALA 112-15-08280 HARRY CHANDRA 112-15-08489 MICHAEL KEILSON 112-15-08726 SEYU FANI BR. KARO 112-15-09354 RANDY TANDIONO 112-15-09799 ROBBY JULIAN 112-15-09812 MICHAEL 112-15-10055 WENDI DAMANIK 112-15-10287 ASTRYA SIMALANGO 112-15-10442 MUHAMMAD ILHAM 112-15-10662 CHARLOS A P MARPAUNG 112-15-10895 HUMUNTAL A ZEIRO 112-15-11336 DAVID ROY SINAGA 112-15-11636 GEORGE S LBNTOBING 112-15-11647 MICHAEL 112-15-12910 JUVIANTO 112-15-13470 MITRA M.ARSYAD HTG 112-19-03180 YULISTIA HADI 112-19-04004 ADITYA PRATAMA 112-30-01292 EINSTEINIUS 112-30-07754 SININTIA ARISSA 112-30-10950 ADITYA F RANGKUTI 112-30-15614 NOVIA ARISANDI 112-38-21173 DEBORA AGNES SESARIA 312-15-01143 ALEX SIHOL B 312-15-01212 RICHARD A P MARBUN 312-15-01863 WENDY R S 312-15-01897 NAKKOK LUMBANRAJA 312-15-02824 ADE LAIA OLA MANIK 312-15-02895 RIZKY ANANDA 312-15-04167 DICKY YONGKO 312-15-04523 ERICK MANGAPUL 312-15-04867 DINI RIZKY UTARI 312-15-05141 EMELIA 312-15-05378 ADE INDRA UTAMA LBS 312-15-05710 KEVIN MAULANA 312-15-06123 SAPTINO S SINAGA 312-15-07201 FRANS S N 312-15-07221 JOSHUA MANGGALA 312-15-08465 HENDRA W S 312-15-10652 PRAMONO 312-17-05419 FANNY RUMINTHA BR. B 312-17-10533 IVAN AULIA AZHARI

C2 TEKNIK LINGKUNGAN 112-14-01928 KEVIN ARIANTO 112-14-03609 CHANDRA IRAMAWATI 112-14-04367 CHAIRANI SELVIANI 112-15-00993 ANDRE YOLANDA S 112-15-02340 DANIEL N SIAHAAN 112-15-02469 NOVI SERLIANA NP 112-15-02533 LAVENIA R NADAPDAP 112-15-02611 BOBBY SULIYANTO 112-15-04033 IAN RICKY TANIKATO 112-15-05187 CALVIN 112-15-05408 M FAJRURRAHMAN NST 112-15-06789 M. IQBAL Z BATUBARA 112-15-07056 DIAN KASIH 112-15-07213 ELAN PATRIANA S 112-15-08482 ABDUL HAFIDZ N 112-15-08622 DYAH WULANDARI 112-15-09009 REFRINA OLIVIA 112-15-09020 ANGGI OTARI SIHITE 112-15-10198 KARINA NURSYAFIRA A 112-15-10239 ICI S D HARAHAP 112-23-06656 ANDI PETRUS N 312-15-00284 MEIDINA ZULFA HANIE 312-15-05517 ARYA R PERANGINANGIN 312-15-07545 CRISTO MORI R M 312-15-07739 ANDIKA W PINEM 312-15-10102 MARISSA IVANA S 312-17-00023 ARIF I TISHAM 312-17-02545 SABIZA BAHRANI PENDIDIKAN DOKTER GIGI 112-11-12138 ANDISSI EKA PUTRI 112-14-00012 EKA SANSARI P 112-14-00135 ROBEN P 112-14-00364 MULIA DANIEL S 112-14-01007 OLIVIAN WIJAYA 112-14-01038 KEVIN 112-14-01350 CARVEN 112-14-03476 GITA M ZULFI 112-14-04077 MUSAB 112-14-04126 PRAJOGO H 112-14-04380 EKA GRASELLA 112-15-00277 RYANTI T A 112-15-00343 GRACE EVELYN PARDEDE 112-15-00415 ISHMAH NAJLA 112-15-00886 ANDREAN KHOSASI 112-15-01212 JENNIFER XAVIER O 112-15-01213 SHERLY 112-15-01701 JESSICA KOMALA 112-15-01822 IVANNA SUNDARY ONGKO 112-15-02143 LADY INDIRA AZMI HRP 112-15-02174 BUAHNA LUMBAN GAOL 112-15-02301 LINDA 112-15-02936 ERVINA 112-15-03133 VERONICA ONGGA 112-15-03469 RAHMA ANNIDA 112-15-03915 ANDI WIBOWO 112-15-04397 ANGGUN BUDI UTAMI 112-15-04601 ANJELINA PANJAITAN 112-15-04754 WINDI PRATIWI 112-15-04885 SANTY MONICA GOWASA 112-15-05265 NUR HARDIYANTI 112-15-05291 NATHANIA 112-15-05412 JOICE RUMONDANG 112-15-05571 CHRISTINAWATY SUTAN 112-15-05631 ADRIANA ANNISA THOHA 112-15-05946 DONNA RONAULI 112-15-06357 PRAJOKO YANTO 112-15-06413 LAMORA YOHANA 112-15-06421 VINCENT TANNIUS 112-15-06422 M RIFQY HALIM 112-15-06446 AGNES F R P MENDROFA 112-15-06533 M. ARIEF TOHARI 112-15-06578 KELVIN 112-15-06870 PRISCILLIA SITORUS 112-15-07779 TIFFANY HENRY P 112-15-07906 SARAH DEVINA 112-15-08000 SYAHFITRI SINAGA 112-15-08240 ANISA 112-15-08604 ALDORA PRIMA PUTRI H 112-15-09079 NOVIA 112-15-09092 TRY YUDHA TARIGAN 112-15-09604 YANTA S S KELOKO 112-15-10629 MUTIA TOFA ANGGRAENI 112-15-10974 SHINTA AGUSTINA 112-15-11504 SITI MUTHIATUN NAILA 112-15-12011 DEBBI ZULIANDA NST 112-15-12295 SONDANG MALAU 112-15-12823 LUNGGUK SITORUS PANE 112-15-13112 JESIKA B S 112-15-13117 CHARIN ZUDHISTIRA 112-17-00523 RISKI NOVIKA 112-19-01851 WULANDARI SAVITRI 112-19-04421 ULFA RAHMAWATY 112-19-04687 SITTI MAISARA AMANDA 112-19-05846 IVAN ALDINI 112-30-03394 LIDYA P ULIBASA 112-34-10995 ROTUANA MARISABETH B 312-14-05200 KRISTIANA SIMAMORA 312-15-00291 AINI RAMADHANI 312-15-00830 DORMINA B L H 312-15-00942 MENTARI SIANIPAR 312-15-01482 RIZKA MALISA SINAGA 312-15-01524 MHD ADJI WIBISONO 312-15-02192 ALMIRA NOVIANTY HRP 312-15-02979 OLDA PRISKILLA NAOMI 312-15-03826 MARIA NOVITA 312-15-04180 DEVI MANURUNG 312-15-04546 VIVI LANTRI P 312-15-05969 KEYKO A DARYA 312-15-07048 HARTATI F R P 312-15-08127 RUTH TONDANG 312-15-08159 FHEBY SARAGIH 312-15-09213 BENDVRI A SILITONGA 312-17-02659 IKHTARINA RAHIMA H 312-17-03428 FATHIA TUNGGA DEWI 312-17-07440 REVA OKTRIANI BIDIKMISI 312-17-12104 M RIDHA VERNANDA 312-30-01332 JEHAN ELFANDARI -

Hasil SNMPTN USU 2012 MATEMATIKA 112-14-00213 TESI ALMIA 112-14-01547 NOVIKA ELISABETH S 112-14-01562 WANDA SURIANTO 112-14-02039 DANIEL TS S 112-14-03326 CITRA IRA WATI 112-14-04719 MANOTAR PURBA 112-15-00013 ANTONI F TAMBUNAN 112-15-00496 DESI NATALIA SARAGI 112-15-00744 GOKLIM MUNTHE 112-15-00788 JURNALDO AMBARITA 112-15-00866 PUTRI WINDA SARI BB 112-15-01028 NURUL MAULIDA BIDIKMISI 112-15-02973 YOHANNES D.P.S 112-15-03840 RAHMAT HIDAYAT 112-15-04073 ARMANDO P R SAMOSIR 112-15-04464 SUDIRMAN R T 112-15-05924 SEPANYARIA S 112-15-06081 YOSEPHIN E P 112-15-06712 GRACIA MONALISA S 112-15-06869 FRANSISKUS ROMARIO S 112-15-08552 ARSITA PANJAITAN 112-15-08833 MUHAMMAD HANIF FAUZI 112-15-10308 KARSA SYUKUR ZALUKHU 112-15-11912 OCTAVIA LIONG 112-15-11955 ESTER LYTA LIMBONG 112-15-13249 RIDWAN PAKPAHAN 112-15-13368 HADID FADLILLAH 112-17-02569 MEGAYANTI NADAPDAP 312-15-00685 DIMAS AGUNG ALFATH 312-15-03435 BIMA SEBAYANG 312-15-03758 AAN FEBRIYANTO 312-15-04324 RISWAN ROY SIREGAR 312-15-04516 SERLI WASKITHA W 312-15-08822 RIZKA ADE SHAFANI 312-15-10715 SISKA J BIDIKMISI 312-19-03763 RISNA ILIN DASOPANG KIMIA 112-14-00019 AGNES THERESIA 112-14-00773 VIVIN ANGGRIA 112-14-00799 NOVI TRIANA 112-15-00367 LAURASIA TRYA BIDIKMISI 112-15-01766 SURYATI SIMAMORA 112-15-02399 CINTAKU PANJAITAN 112-15-03877 DEFRISTA BR PA 112-15-04789 SEVTY R SURBAKTI 112-15-06311 NINA HARTATI 112-15-07232 NIKMAH H S BIDIKMISI 112-15-07462 ANES OCTAVIANI 112-15-08291 YULY PUJIARTI 112-15-08506 MARCELINA PANGGABEAN 112-15-08864 JESSY MEDITA DEBORA 112-15-09052 EBENEZER P G 112-15-09380 CITA SITOHANG 112-15-10386 ANDRE TOBING 112-15-11634 AYU SYUFIATUN BIDIKMISI 112-15-13222 SAMIA SURURY LUBIS 112-15-13457 YOSAFAT MANULLANG 112-23-06246 CRYSTINA SIMANJUNTAK 112-33-60051 RAYMOND RINALDY 312-14-01267 MARIA NOVA SURYANI L 312-14-04219 KRISTIN ANASTASIA S 312-14-06160 BONIFACIUS DIAN K P 312-15-01608 ELFRIDA SINAMBELA 312-15-02237 JODI PRATAMA S 312-15-03728 MARLINA O S 312-15-04916 DEASY CM SEMB 312-15-06753 RISMA FAZILLAH 312-15-08304 RANDY HALASSON 312-15-08351 GEOFRY BONTOR 312-15-08640 ROVER MARBUN 312-15-09441 FITRI YATUL 312-21-01863 BELINDA ELICE N 312-33-20690 DIE AVE MINA LIA S FARMASI 112-14-00291 WENDY FEBRIO 112-14-00506 CINDY FEBRIANI 112-14-00606 VINCENT TRISTAN 112-14-01199 MANGAPUL SITANGGANG 112-14-03385 INDAH SUCI K LUBIS 112-15-00220 FERANTIKA SUDJANA 112-15-00526 WAHYUNI WINDY 112-15-01101 LEONARDO KESUMA 112-15-01353 HADY WIRAPUTRA 112-15-01731 DESI TRISNAWATI 112-15-01869 MICHAEL KHOSASIH 112-15-01927 RYAN WIJAYA 112-15-02613 LYVANA ISTIARAH 112-15-03039 DESSY ANDASARI SIR 112-15-03085 DEBI SARA MONICA 112-15-03233 NENENG SEPTIANI 112-15-03517 JENSYAFITRI SAMOSIR 112-15-03788 RIBKA MARTINA PURBA 112-15-04791 ENDANG R SARI HULU 112-15-05123 FRANSISCA WONGSO 112-15-05347 SAFRINA 112-15-05935 ANTHONY TIAS 112-15-06150 FADIL 112-15-06371 LULUAN MAGABE S 112-15-06406 IVANA 112-15-06704 GITA PERDANA 112-15-07109 MEGA SARI 112-15-07353 ITA MELLINA 112-15-07465 DIAN IKA PERBINA 112-15-07521 MARITO AISYAH DEWI 112-15-07544 CHRISTIN N. PURBA 112-15-08314 APRI WINENGSIH MANIK 112-15-08315 GITA DESIA RANTO 112-15-08365 ABRAHAM E.M 112-15-08525 ASRIKA MUTIARA 112-15-08717 AYU HARYANI P S 112-15-08729 ROMY T A TARIGAN 112-15-08816 JUMIATY 112-15-09008 BRYAN JUNIVAN S 112-15-09362 ANDRIANA 112-15-10528 HESTY J SIHOTANG -

112-15-10697 ISMITA SARI 112-15-11027 JANSEN B L 112-15-11158 DEWI HANDAYANI 112-15-11278 JUNITA C H 112-15-11587 ESTER LIA GULTOM 112-15-12290 ADE YOHANA 112-15-12808 WINA SIMALANGO 112-17-00047 NOVITA SARI 112-17-07062 M. FAJAR FIRMANSYAH 112-17-07216 HARYANI 112-17-07825 RIVALDO PERDANA P 112-17-08097 NOVAULI RENDI 112-17-09670 CONNY FEBIOLA BIDIKMISI 112-19-00315 FEBBI FENESIA 112-19-00907 ERIKSON SINAGA 112-19-03398 HAFIZAN BIDIKMISI 112-19-04901 HARYATI RICHIE HARNI 112-25-01377 PUTRI ANGGREINI 112-34-00755 CYNDI CRISTSANTANA 112-34-09695 NIA NATALIA SILALAHI 112-34-11074 KESUMA WAHNI SIREGAR 112-38-11579 KARINA ADIRRA I A 312-14-04828 FATHUL JANNAH 312-14-05275 ROMA SIDABUTAR 312-15-00412 ASTUTI REMALYA 312-15-00781 ELFRIEDE P S R M 312-15-01534 VIVIEN F. NAINGGOLAN 312-15-02010 DINDA MASITA 312-15-03038 NUR HIDAYATI 312-15-03468 LENI 312-15-05344 NOVIANA PRATIWI G 312-15-08529 ARIEF HIDAYAT Z BIDIKMISI 312-15-08584 KANGGA SRI WILYTA 312-15-09641 YULIA S SIGIRO 312-15-10392 RIZA UMAYAH FISIKA 112-14-01834 ISWADI 112-14-02193 ILHAMSAH LUBIS 112-14-02394 M TAUFIK BIDIKMISI 112-14-02682 CARMELITA O.S 112-14-03974 MUHAMMAD BALYAN 112-14-04245 MUHAMMAD IQBAL 112-14-04556 ELISABETH F SINAGA 112-15-00105 NOVIA FRANSISKA G 112-15-02145 KARYAMAN HARTO ZEBUA 112-15-02299 DEWI SURYANI 112-15-03228 DIEGO VAN CASTRO 112-15-04211 DANIEL BONOFFI 112-15-04733 ZEFANYA PARDOSI 112-15-08767 DODI ERIZA 112-15-09016 JOSAPAT SIMANGUNSONG 112-15-09343 M ARI FAHRIL 112-15-09654 LEONAR DO DA VINCI T 112-15-09680 MARTA MASNIARY N 112-15-09816 YOEL ORANDA S BIDIKMISI 112-15-10022 TIO ARMANDO 112-15-11789 JANE DEVI VIONITA G 112-15-11795 IVO ZOEL S 112-15-12169 FIRMAN YANUS HALAWA 112-15-12630 MIFTAH HABIBI 112-15-12657 WILS OSVALDO BANGUN 112-15-12860 FRANKI L A S 112-15-12967 ZIPPO B SIJABAT 112-19-04576 JEKSON SIAHAAN 312-14-00349 ERZA SETYA DANA 312-14-01560 HANIFAH 312-14-03838 KARTIKA ERMAWAN 312-14-05620 BENGET L HUTAGAOL 312-15-01271 LIONIE 312-15-02519 TOBY EXAUDY L BATU 312-15-06347 CYNDI ROINTAN P 312-15-07199 ROBY YETSUN JAYA 312-23-04025 LYANA AMIRANI ILMU KESEHATAN MASYARAKAT 112-14-00118 YULIANTI SIPAYUNG 112-14-00401 RATIH LESTARI 112-14-00567 LULU WIDAD ANHAR 112-14-01128 ASNAH 112-14-01692 NOFRIWATI S 112-14-01822 ANDRI D PASARIBU 112-14-01883 ADE ANGRAENI 112-14-02220 RACHMADHANI BR MGSNG 112-14-02261 ERISTA M O SIREGAR 112-14-02293 ULFA FATHONAH MUKTI 112-14-02388 ARRAHIM ALI P 112-14-02444 RIANCE 112-14-02473 CHRIS A P SINAGA 112-14-02506 DIAN KANESTI NADEAK 112-14-02576 FITRI WAHYUNI 112-14-02917 EVA A. SIHOMBING 112-14-03065 DIANA SARI SIREGAR 112-14-03540 LARAS LISTIARINI 112-14-03613 WINDA O TAMPUBOLON 112-14-03617 NOVIA RIZKY UTARI 112-14-03681 DANIATI SILALAHI 112-14-03982 ERNAWATY N 112-14-04021 SRI HARTINI 112-14-04523 BOBY A B SIHOTANG 112-15-00190 KHAIRUN NISA 112-15-00363 CITRA DAMAYANTI SRG 112-15-00379 PUTRI DAMAYANTY S 112-15-00411 RANTI SITORUS 112-15-00555 ELI SHEBA SIHOMBING 112-15-00687 IRFAN 112-15-00759 ARDIANTI HUSNA SARI 112-15-00853 LIZA MEILIDA NST 112-15-01103 LEONARDO SIMANJUNTAK 112-15-01172 DRIZKA RENINTHA 112-15-01269 ITA FITRIYANI LUBIS 112-15-01628 DEBORA YOSSI PUTRI P 112-15-01913 NURUL MAWADDAH PURBA 112-15-01974 IRMAYANI MANULLANG 112-15-02197 AGFANTI SIANIPAR 112-15-02208 MEYLINDA ASTUTI LBS 112-15-02309 DARA ASDALOLA HRP 112-15-02381 VALENCIA PURBA -

112-15-02498 MAWADDATUL HUSNA 112-15-02543 ANDREAS SIMANJUNTAK 112-15-02589 AINUN MARDIAH 112-15-02641 WAHIDATUL UKHRA A 112-15-02996 DINDA AZURA 112-15-03083 NISA ABDINA SIREGAR 112-15-03245 DIZZA APRILLIDA 112-15-03343 YUNI A T 112-15-03391 PUTRI ARIYANI P 112-15-03685 SITI NURMALA DEWI 112-15-03744 ELIESER TARIGAN 112-15-03778 FITRIA GUSTI S 112-15-03803 NUR MALIA MZ 112-15-03896 RIS E PURBA BIDIKMISI 112-15-03900 FRISYA ADDINA SARI 112-15-04261 NINGSIH WIDARI 112-15-04328 AGUNG SATRIO 112-15-04404 SUCI DEFAYANTI 112-15-04459 THERESIA S. MARPAUNG 112-15-04646 NOVITA SARI PAKPAHAN 112-15-05028 TINA MONALISA 112-15-05099 IRA LAUROMAITO G 112-15-05437 SOPYAN SAURI SIREGAR 112-15-05552 NOVA LARYSCA MANIK 112-15-05727 T SYARIFAH WAHYUNI 112-15-05767 HARYATI LUMBAN GAOL 112-15-05975 KHOIRUL SIMANJUNTAK 112-15-06071 ERDIANTA S 112-15-06145 DRIA AHRUNNISA LUBIS 112-15-06412 ESTER FLORANI P 112-15-06453 RIDWAN.Z 112-15-06477 SETRIANI SARAGIH 112-15-06479 FADLAN ATHFIN 112-15-06580 RIA E SINURAYA 112-15-06816 YENNI AFRIDAYANTI 112-15-06962 EVALINA SIMANGUNSONG 112-15-07002 ERNANDA G T TAMBUN 112-15-07020 ROMANA M TELAUMBANUA 112-15-07073 MULYANA AGUSTIN 112-15-07246 MASNITAULI ZEBUA 112-15-07292 NINA SAKINAH SIREGAR 112-15-07379 CHRISTINA SMJT 112-15-07388 NURUL SAFITRI 112-15-07432 DEWI S SIANIPAR 112-15-07551 DESSY MARIA 112-15-07641 DAVID JULIANTO BARUS 112-15-07773 FEBRI RAMADHANI 112-15-07781 NURUL AMALIA 112-15-07914 MAISARAH H 112-15-08304 ELISABET O SINAGA 112-15-08641 JUNIARTY PB SIMBOLON 112-15-08902 BINTANG DUMA ARTHA 112-15-08935 SYUKUR EMANUEL LAIA 112-15-09187 AYU MUTIA SYAHFITRI 112-15-09243 MEY SARI SIBARANI 112-15-09320 UTIYA MAHFUZHAH 112-15-09398 NADIYAH MAWARDAH 112-15-09399 LOLA SANTIA 112-15-09983 FRISKA F SINAGA 112-15-10105 RENTA P 112-15-10176 RUTH UTAMI SIANTURI 112-15-10192 ANDIN RIZQIKA ALIUNP 112-15-10330 M ZIKRI HABIBI 112-15-10362 MAYA ANGELINA 112-15-10376 KAISAR R B N S 112-15-10456 TIYA M DALIMUNTHE 112-15-10534 JENIKA H BIDIKMISI 112-15-10545 FREDDY V GULTOM 112-15-10593 TRYANA S SIHITE 112-15-10611 WAHYU IHSAN SIREGAR 112-15-10656 INA MULIYANI HARAHAP 112-15-10673 MERY SOFIANA P 112-15-11080 MARGARETHA PASARIBU 112-15-11119 AKNES R PANJAITAN 112-15-11137 JONSON ROMARIO S 112-15-11217 BINTANG 112-15-11312 KARL FRIZTS PASARIBU 112-15-11352 BOBBY PRAMANA -

112-15-11554 SYAFIAH MUKHLISHOH 112-15-11595 DWI YULI RAHMADINA 112-15-11781 HAWARIAN SUNNI 112-15-12360 S S VERA AMMALIA R 112-15-12697 CAHAYA E. RUMAPEA 112-15-12766 ELEN DINARTA BIDIKMISI 112-15-13055 PUTRI GERDA PARHUSIP 112-15-13490 SHULAIHA WAN NUR LBS 112-15-13491 DENNY ANDRIAN 112-17-00449 NINA ANNISA 112-17-00667 HANA NOVELINA S 112-17-01274 IRFANIA MARDHATILLA 112-17-05266 RIO FERDI YUANDRA 112-17-05536 FAUZIAH HASANAH 112-17-07100 SISKA MELATI SUKMA 112-17-07525 RANTI 112-17-08082 TRYANI WALNIZAM J 112-17-09006 RATI HANDAYANI BIDIKMISI 112-17-09793 ASRA HUSNA 112-19-01102 NURUL M RERY 112-19-01390 DEASY STEFANI T 112-19-01631 LISA SURYANI 112-19-02114 CHRISTINA S 112-19-02371 ZUCHAIRIAH ADRIANI L 112-19-02563 MEFRI DEBORA 112-19-02588 FRISTA NOVITA S 112-19-02748 DWI JAYANTI 112-19-03948 DESTYA DIAN LESTARI 112-19-04197 CHINTIAGUSTI AMELTA 112-19-04465 CUT VONNA INDRIA 112-19-04899 SITI AISYAH RAHMI 112-19-04926 PUTRI ISMI MASTURA 112-19-05708 JAMALAN HALIMI 112-19-06123 OCTAVIA RACHMAWATI 112-21-01071 IRA AMINAH PADANG 112-30-13398 ELYSABETH ELMINA 112-30-13577 ANDIKA PUTRI 112-33-14142 MELYARTA NATALIA 112-33-21089 RUT KRISTINA S 112-33-23244 DAMAYANTI NATALIA 112-33-30408 NOVIANTI AGISNI 112-34-07464 NURUL AULIA SEPTIANU 112-34-09358 NOVLIN RANIKA 112-38-10660 AKHMAD RAPIUDIN 112-44-02269 SURYA BUDIANTO 312-14-02091 MELISA 312-14-02893 SRI WINTA SIHOTANG 312-14-03201 RESKY ARISDA 312-14-04498 IANA TRESIA 312-14-04914 SRY YANNIE B.N 312-14-04958 FEBRINA V MUNTHE 312-14-05258 NOVITA E S P 312-14-05429 EVA F SITORUS 312-14-05524 TAMARA SISILIA S 312-15-00223 CHANDRA SARAGIH 312-15-00317 DINA RIZKI 312-15-00444 RUTH E D NADEAK 312-15-00545 FIRDA MANURUNG 312-15-01516 JOANITA DEBI C S 312-15-01981 CITRA CHRISTIN S 312-15-01990 ANDY DWI PUTRA 312-15-02053 NUR AZIZAH 312-15-02299 TIUR NOVELISAH. S 312-15-02595 SUSI S BUTAR BUTAR 312-15-02597 RISKA AULIA SIBUEA 312-15-02699 M ALFI S HSB 312-15-02917 RISKA JULIANA M 312-15-03409 JONNER FM SARAGIH 312-15-03415 DEVI YUSTIKA PURBA 312-15-03650 FITRI H LINGGA 312-15-03713 RISKY MALINDA 312-15-03778 VENNY VENNESIA G 312-15-03869 MIA PRATIWI BIDIKMISI 312-15-03941 MADYA CHKRISTINA D 312-15-04015 TONY KURNIAWAN 312-15-04199 HUDSON TUA MANURUNG 312-15-04257 WIDYA AINAL W S 312-15-04444 PETRINA NATASIA -

312-15-04813 WELSA MARANATHA M 312-15-04950 HENNY AFIKA 312-15-05123 NISA FITRI M 312-15-05260 QUIN DWI JAYANTI P 312-15-05604 RUTSEYLINA SINAMBELA 312-15-05862 YOLANDA OKTAVIA 312-15-05936 YOHANA NOVA T M 312-15-06059 KARTIKA SARI SITORUS 312-15-06113 ALEXIS F P 312-15-06184 KIKI NOVITA 312-15-06190 PESTARIA MAULI 312-15-06275 ROMICHAEL SETIADI S 312-15-06341 SUKMA RAHMADANI 312-15-06458 SYAFIRANEDLY R 312-15-06519 GONGNA SARI HARAHAP 312-15-06768 YAN RIDO GIRSANG 312-15-07449 SRI FANY M S 312-15-07625 MARIA LILIANA 312-15-07809 DEBORAH J 312-15-08155 ANNE A. SEBAYANG 312-15-08274 WIDYA F S 312-15-08984 IMELDA ZAHARA 312-15-08993 EDWINARTO SINAGA 312-15-09100 MASNAULI PRATIWI S 312-15-09207 BERNADI YOSIA D 312-15-09375 GRATIA H SIHOMBING 312-15-09566 YOSEPHIN GRACE 312-15-09824 NUR ALIYAH 312-15-09876 MARHANI PINANDA 312-15-10127 SILVIA MARTALENA 312-15-10406 HERWANDA TARIGAN 312-15-10793 HANBRAM A. HUTABARAT 312-15-11120 LELI M SIMANJUNTAK 312-15-11304 BONIC HABEAHAN 312-17-00434 FEBRI HAKIKI 312-17-01932 AFIFAH BIDIKMISI 312-17-04044 WIDYA EFIARIZA 312-17-04809 HESTI FAUZA 312-17-04838 TIA OKTARI 312-17-05425 ARIFFANDI TRI R 312-17-06834 TRI RANGGA SAPUTRA 312-17-07019 ELSA LUVIA HARMEN 312-17-07465 YULIA ASTRIA BIDIKMISI 312-17-08081 BLEDINA GENTINI 312-19-03905 DIAN RAMADHANI 312-27-04561 BEATRI H M 312-30-00784 EGITA GIOVANY 312-30-04689 YOLANDA MARIANA 312-30-04747 DINA AFRIANI BR T 312-71-03135 JAMES STEVEN FD KETEKNIKAN PERTANIAN 112-14-01634 MUHAMMAD IQBAL 112-14-03867 NIKO PAKPAHAN 112-15-02105 DARA DHAYANARA 112-15-02727 VANDY WINATA 112-15-03602 ANDREAS SEMBIRING 112-15-03916 ERJA R MARPAUNG 112-15-05141 M.ZAIM AL-ANSHARI 112-15-05264 SAFRIYANTO 112-15-05715 SRI APULINA 112-15-06464 HANDY KHAIRUL FIKRI 112-15-06493 DONI PANDAPOTAN S 112-15-06645 FEBRIN SITORUS 112-15-07502 JANITA PEBINA 112-15-07936 ULLI AGUS SUKMA 112-15-08394 DENNIS SATRIA 112-15-08839 SEJAHTERA SURBAKTI 112-15-09122 CHAIRUNNISA 112-15-09339 IVAN JONATHAN 112-15-10480 JEMIDO BARUS 112-15-10551 RICHARD ANDREW T 112-15-10577 ANANDA BOAS ZUWYSA S 112-15-11152 DANIEL SANDI S 112-15-13132 TRISNO YUDHA B 112-15-13170 ELVIANTY BRAHMANA 112-17-06677 ERMIDA YANTI 312-14-03885 IMADE SILABAN -

WASPADA Sabtu 7 Juli 2012

312-14-05282 SITI KHADIJAH 312-15-00125 RIKI RIKARDO SINAGA 312-15-06058 ANNISA PUTI ANDINI 312-15-06648 YOHANES B F TARIGAN 312-15-07080 DWI PUTRI CHININTYAS 312-15-07570 OLAN SINAGA 312-15-08386 SANDRA R HUTAHAEAN 312-33-21727 GERTRUDA OCTYA TEKNOLOGI INFORMASI 112-14-01116 M FAUZAN RINDRA P 112-14-02032 AGIL SUPRAPTO 112-14-02559 JOSUA A NAIBORHU 112-14-02984 MICHAEL PUTRA LOI 112-15-00029 NOVIA ELISHA HALOHO 112-15-00462 R AGUNG HERNOWO 112-15-01988 FRANCO BAGGIO 112-15-02193 MALIKI KHOIRUL ILMAN 112-15-03479 BENY NURMANDA 112-15-03707 EFRAIM EMDASTRA S 112-15-03996 EMI FENTINY BAKARA 112-15-04984 EKA PRATIWI GOENFI 112-15-05799 ELEIDER N ZAI 112-15-06496 JESSICA FLORENCIA 112-15-06939 HARYSA OCTAFINE 112-15-07239 ERIC SUWARNO 112-15-07426 MUHAMMAD ANDRIZAL S 112-15-07838 MUHAMMAD DIMAS A 112-15-08470 ELVIN YANDRIE 112-15-09226 EL ROY MIRACLE 112-15-09541 IRESTER IRMARETTHA S 112-15-09938 HENDRO PRASTYO 112-15-10269 FAZRIN ASHARI 112-15-10483 IQBAL REZA RANGKUTI 112-15-10520 ANTASARI TAUFIK HRP 112-15-10761 DENNIS 112-15-10863 GRACE US LUMANAUW 11215-10912 ANDRIAN JUNAIDI 112-15-11183 WINA OCTAVIANA NST 112-15-11887 ZUNRAFIQ QURDAWI R 312-14-01045 SITI HAZIZAH HARAHAP 312-14-03348 GABE R SITUNGKIR 312-15-02442 NOVIRA INDRYANI G 312-15-03449 TOMMY ROY SIRAIT 312-15-03801 HASNA SUSANTI STPL 312-15-04442 RANTI RAMADHIANA 312-15-06084 ATRAS NAJWAN 312-15-08302 TITO D PANDIANGAN 312-15-09144 ANDES PAHALA S 312-15-09183 ADHI KURNIAWAN 312-19-05207 GIANT C P A ILMU DAN TEKNOLOGI PANGAN 112-14-01672 MARDHATILLAH IQBAL 112-14-02714 M.BOBBY KURNIAWAN 112-14-04277 RENI JULIANA 112-15-01136 MELINCE SITUMORANG 112-15-03266 FEBRYOLA SIMANJUNTAK 112-15-03534 JOHANA HENNY E S 112-15-03992 TRIANA AULIA 112-15-05103 CHRISTINE L B D 112-15-05189 YOSEVA MAYA SITORUS 112-15-06456 RINI HAYATI HERMAN 112-15-07202 CHERLIN 112-15-08701 ARIHTA TUMANGGER 112-15-09685 EKO PALIAWKA 112-15-09996 ANGGELA 112-15-10596 AGUS S K 112-15-11083 BUNGA Y TAMBUNAN 112-15-12151 ROSPITA M S 112-15-13123 TRIKE SITANGGANG 112-19-00951 MARIA HEVLYN L 312-14-05559 ANITA C. P 312-15-01305 NEHEMIA PAUL MUNTHE 312-15-05005 HUSNA KHAIRIYAH 312-15-06149 MARI GUANINTA W.S 312-15-07623 WINDA WIDYASTUTI 312-15-09229 JUWITA TIARMA K L 312-15-11188 AYU LUMBANTORUAN -

WASPADA Sabtu 7 Juli 2012

ILMU KOMPUTER 112-14-00314 RAHMA ISNAINI MASYA 112-14-00912 VICI INDAH YANA 112-14-01884 M WAHYU FAATHIR 112-14-02962 ZUHRU FINTY 112-14-03347 NURHALIZA NASUTION 11215-00580 RICKY WIJAYA 112-15-00599 NURMARDIAH SIREGAR 112-15-00799 JABBAR A. PANGGABEAN 112-15-01261 NOVITA P DEWI 112-15-01634 JOHAN SURYA 112-15-02205 KEVIN IRFANDA 112-15-02470 AKBAR SYAHPUTRA LBS 112-15-03143 ILHAM RAMADHAN 112-15-04103 DEVY MATHELINEA 112-15-04163 LAILATUL ILMI SINAGA 112-15-04248 NENO RAMA DHIANITA 112-15-04500 NADHIRA DWI SABRINA 112-15-04940 SAID MUHAMMAD MAHFUZ 112-15-05178 AKHIRUDDIN NUR BIDIKMISI 112-15-06351 DEWI ZAHRA 112-15-06569 NOVI NURYANTI A 112-15-07013 BORIS MARIO 112-15-07062 MUSTAFA AHMAD REZA 112-15-07169 ALFITRA RAHMAN 112-15-07496 JUWITA P. PASARIBU 112-15-07657 ADE MUTIARA KARTIKA 112-15-08756 MAHESA LINGGA 112-15-09591 SUTRISNO AGUSSAPUTRA 112-15-10783 ANDIKA P HUTAURUK 112-15-13110 ELTON 112-17-04469 EDO ADITYA CHANDRA 112-17-08507 RIDHO ANUGRAH JAMAL 112-17-09529 PARLINDUNGAN S 112-17-09807 DICKY HAMDANI BIDIKMISI 112-19-04954 REVANDHY ISYA PUTRA 112-30-08598 TRISTANIA MARCELLINA 312-14-03292 M YUDHA SYUHADA 312-15-00379 LEO LAMDEARDO S 312-15-01097 FAISAL RIDHO 312-15-01541 EPHRAIM KESABA S 312-15-02434 RIZKY RIVANNI 312-15-02480 RODIYAH AINI M 312-15-03540 ROBES NUDSON PURBA 312-15-05571 WAN M FALDI 312-15-11126 EVELIN S C S BIDIKMISI 312-15-11581 HADRIAN B SIREGAR ILMU KOMUNIKASI 212-11-10651 NOVIA MARISKA 212-14-00386 RIRIS TAMPUBOLON 212-14-03857 RIOVALDO TODOAN S 212-14-05976 ANDRINA D P 212-15-00197 RESTA NAPITUPULU 212-15-00211 ALDILA INDRYATI 212-15-00326 INKA ADRINA P BR. K 212-15-00940 MARLIN SILALAHI 212-15-01436 WIDYA H TARIGAN 212-15-01506 JONATHAN PASARIBU 212-15-01591 M FAISAL HAFIZ 212-15-02121 YOSUA PUTRA V 212-15-02161 TERIA GINTING 212-15-02365 MIFTA HULZANNAH SRG 212-15-03067 AULIA MUHAMMAD 212-15-03076 HERBERT JUERGEN 212-15-03208 RR.DIAJENG FIERZA A 212-15-04133 APRILIYANA 212-15-04390 TIMOTHY ANDREW JO 212-15-04754 REVINA REZEKI SILAEN 212-15-05494 MHD DWIKI ARTITHO 212-15-05673 MEUTIA RACHMI Y 212-15-06574 RANDI YUSRAN BADRI 212-15-06893 JANE MATANARI 212-15-07134 SEPRI SIRINGORINGO 212-15-07555 MEISARAH ADHA ZULAD 212-15-07687 YUSTRY MAGDALENA S 212-15-07750 SERA GREEN DUBONNET 212-15-07848 EUNIKE STEPHANIE 212-15-08084 CATHERINE 212-15-08740 DEODO ANDREW SIAHAAN 212-15-08845 ARDO KHOMARUDIN 212-17-11582 YUSRA AINI 212-23-02748 SARAH MEIROSLIANA 212-30-18269 ZULICHSAN AZDIAN 212-30-19002 RAY GUNAYES 212-33-11513 KHAIRUNNAILI 312-14-03027 INGGIT LARASATI 312-14-03298 BAGUS PRAKASA 312-14-04687 CHRISTA M P 312-14-05400 ARY PRAYOGI 312-15-02253 MARGARET PASARIBU -

Hasil SNMPTN USU 2012 312-15-03302 MEILISA PUSPADINI 312-15-04273 TANTIKA RATNA SARI 312-15-04422 DEBY DESSARAH 312-15-04439 ADDINA ISLAMI U. SIR 312-15-05532 MELVA EMAGITA 312-15-06133 M HARIS NASUTION 312-15-06997 DHAIFAN ASYARI 312-15-07909 YASMIN MEISARAH A 312-15-08100 M FIQIE ARISTYO 312-15-08226 ARIYANTI PANDIANGAN 312-15-09264 NYIMAS CINTYA NIKE I 312-15-09488 RIBKA MAYANG SARI 312-15-10270 SITI SAFIRA MAYHARA 312-15-11614 SARA K SITORUS BIDIKMISI 312-17-06727 VELIN RAVELIANE 312-30-03741 FRISKA AVIOMEITA 312-34-07892 DWISYAH NABILA A S MANAJEMEN 212-11-11678 IRDA YANTI 212-14-01319 CHAIRUNNISYAH SRG 212-14-01909 NAZRUL BARI 212-14-02797 SETIA LESTARI PANE 212-14-02859 MARIA AGUSTINA MANIK 212-14-03385 AGATHA PUTRI L S 212-14-05041 METARIA SEPTIANA S 212-14-05265 VALENTINO B TAMBUNAN 212-14-06720 ANDIKO KUDADIRI 212-15-00025 ELISA WIJANARKO 212-15-00046 MELKY SARO B ZEBUA 212-15-00093 CHAIRUNIS 212-15-00144 RIO M I SIMANJUNTAK 212-15-00438 SHOFIATUL AINI 212-15-00440 MEYLIA GRASSELLA 212-15-00760 JUHANA GULTOM 212-15-00959 MICHAEL L F SINAGA 212-15-00981 ELITA 212-15-01012 RONALD LIMBONG 212-15-01244 ENDANG F S 212-15-01398 GERRY CHANDRA 212-15-01497 NONA FITRIANA 212-15-01513 OK. FAISAL HARLAN 212-15-01607 HARRI DWI ATMA 212-15-01799 EVAN ARI P SEMBIRING 212-15-02090 M RIDHO ASHARY 212-15-02170 RIZA FANNY MEUTIA 212-15-02239 YESIKA O MANURUNG 212-15-02241 NITA BENA AGUSTINA 212-15-02413 JUITA ERLISA B 212-15-02561 YOGI SAPTIKARA W 212-15-02667 HANIKO MARTIN TIO 212-15-02669 LUTHVIA SAFITRI S 212-15-02782 PUTRI E S 212-15-02920 M. EKY FALATEHAN NST 212-15-03473 ELMA NISSY 212-15-03526 WIDYA FRAMITHA 212-15-03549 WIDYA IRVINA RIZKY 212-15-03777 SAID DHUHA MODFA 212-15-03819 AGUNG PRATAMA 212-15-04102 PETRUS NAPITUPULU 212-15-04207 ARISTO 212-15-04282 REDHA LAZUARDY 212-15-04417 EVELYN FLORENCIA 212-15-04424 FRETTY RAWATY S 212-15-04443 AHMAD SHABRI P 212-15-04523 ROBBY SALIM 212-15-04937 SITI AISHA ANANDA 212-15-05608 KRISHNANDA 212-15-05808 JURI KIE 212-15-05809 VENY A CITRA 212-15-05847 EFA SURIATI HASIBUAN 212-15-05859 WILLY APRIADI 212-15-05939 MICHAEL OCTAVIANUS S 212-15-06117 RIO SAHPUTRA K 212-15-06269 SUMARDY SARAGIH 212-15-06528 FELIX 212-15-06654 KIKI I NASUTION 212-15-07683 GITA I F SIBURIAN 212-15-07762 FREDI TUPARSO OTNIEL 212-15-08045 DONALD FERDINANTA H 212-15-08169 SUPIA SARI BIDIKMISI 212-15-08459 TITIEN S P D 212-15-08556 M SULTAN NADAR 212-15-08866 M AZWAR WARLEN 212-15-08922 EVA L SIHOMBING 212-15-09140 GERPA PUGER 212-15-09220 FITRI TIOMA L TOBING 212-15-09323 ASTRID CAROLINA 212-15-09783 NOVITA SARI 212-17-02214 MAREZA SUTAN A 212-17-09368 RAFAEL WANDI S BIDIKMISI

212-19-01950 AGUSTINI 212-19-03619 DIKY ASYFARIYAL 212-19-03955 ISMAIL SINAGA 212-19-06532 SAMUEL PUTRA 212-21-00359 VERONIKA SARAGIH 212-23-00670 TARIDA RIANI T 212-30-00571 AGATHA MARIA 212-30-11510 JOHANNES P TAMBUNAN 212-30-19858 ERIKSON SIAGIAN 212-3312355 FRENGKI ANGGIAT MAJU 312-11-13366 WAWAN SETIAWAN PURBA 312-11-21181 MEUTHIA MURIAZI 312-14-01610 HERNAWAN WAHYU H 312-14-01677 AULIA RACHMAN 312-14-02567 IRVAN PASARIBU 312-14-02884 VERA M SAMOSIR 312-14-03697 LIA AGUSTIANA LUBIS 312-14-04399 RIRIN STEFANI S 312-14-05337 ANNAS ABDURRAHMAN 312-15-00195 DEWI YUNINA NINGSIH 312-15-00213 PINTA PURNAMASARI 312-15-00350 DWI YULLIANDA BR GTG 312-15-00446 RIANI M. S 312-15-00475 DEVINA C 312-15-00778 WILIS GUANDINATA 312-15-01105 ZAKARIA ZEBUA 312-15-01118 ROSALINA ANGGITA R 312-15-01363 ERVINA OCTAVYANI 312-15-01504 JULIA SITI SOLEHA 312-15-01828 TANIA UTAMI LUBIS 312-15-01965 NADIA ELSARACH 312-15-02194 SAYED REZHA 312-15-02430 ANDRI AULIA LUBIS 312-15-02733 DEWI MASDALENA 312-15-02912 RIRIN FAJRINA 312-15-03015 STEPHANIA 312-15-03051 MUHAMMAD RIZKI 312-15-03065 GRACE WIJAYA 312-15-03734 SYAHPUTRA G T 312-15-03780 NOVI V P TAMBA 312-15-04264 DWIKI AULIA FITRAH 312-15-04691 MARIO FRANSISCUS P 312-15-05362 CHRISTOPHER THEDY 312-15-05796 JUWITA SINAGA 312-15-05909 GEMALA SOPHIA S 312-15-06393 FITRI RIYANTI SOFYAN 312-15-06491 DAVID PRASETYO T 312-15-06983 SRI LAMTIAR LIMBONG 312-15-07008 BETHANIA FEBYOLETTA 312-15-07089 FAUZIAH DUMA SARI 312-15-07102 AGUSTINA HUTAHAEAN 312-15-07105 SARTIKA ESTERIA S 312-15-07238 EUNIKE MARETTA 312-15-07295 NETTY DESI 312-15-07550 VINCENT JIMANTO 312-15-07765 GRACE S PB SIHOMBING 312-15-07934 AGUNG ADITYA 312-15-08030 CHINDY FAIRUZ T HRP 312-15-08129 BINTANG P SIMARMATA 312-15-08231 KARSENDRA VARNA 312-15-09033 SALOMO H T PARDEDE 312-15-09277 ARIEF RAHMAN HAKIM 312-15-09333 CHRISTY M PAKPAHAN 312-15-09336 HARDO MANIK BIDIKMISI 312-15-09395 RUT F SIHOMBING 312-15-09572 BINTANG MELKI 312-15-09680 FREDDY H SITORUS 312-15-09776 BIMA JUNITA SARI 312-15-10055 JULIANTO HADY 312-15-10611 DODI SANTOSO 312-15-10645 RIRIN LD BIDIKMISI 312-15-10727 BONI TAMBUNAN 312-15-10766 PUTRI UTAMI 312-15-11506 LOUIS BERNARD 312-17-10653 TUTI SRI ENDRAWATI 312-19-03928 OKTRI SELVIKA 312-19-04891 HEDRI SYAFARUDDIN 312-23-01063 NEHEMIA D H SIANIPAR 312-38-10687 FINNY WINNA WAHDINI 312-71-00987 SAMUEL GERRY MARBUN ILMU KESEJAHTERAAN SOSIAL 212-14-00320 CHAIRANI 212-14-01496 DWI KURNIASARI 212-14-05144 COLOMBUS PURBA 212-15-00092 APRIL YANI 212-15-01221 SYAHRIN 212-15-02568 NIA WAHYUNI HARAHAP 212-15-02828 GADIS VANIA YASMINE 212-15-02953 ANDRENA SIMANJUNTAK 212-15-03085 MHD.AGUS PRATAMA HSB

212-15-03267 MHD DARY SUBANDI 212-15-04586 RIVAL HAKKIF 212-15-04979 FRANS I P SAGALA 212-15-05119 HERTINA P. SIAGIAN 212-15-05135 RANDA TANADI 212-15-05177 ENDANG SRI WAHYUNI 212-15-06370 SITI AISYAH 212-15-06849 SELVIA HANDAYANI 212-15-07156 BOMER F PASARIBU 212-15-07272 GERRY W HUTAHAEAN 212-15-08009 RUTH S 212-15-08131 DEBBI RIZKY ANANDA 212-15-08703 AMELIA ANNA N O L T 212-15-09173 RAIHANI SHIBA 212-17-10653 POETRI AZELA AISYAH 212-17-10883 AINUL FADILA 212-19-01138 ARUM KUMALA D.S 212-30-04374 FERNANDO JHONATTAN S 212-30-07622 LIZA AMALIA 212-30-14857 OSCAR GIDEON 312-14-01065 CHRISDA H. PARHUSIP 312-14-05907 SIMON J.V SILAEN 312-15-00221 RONY Y SEMBIRING 312-15-00739 AGNES M PANJAITAN 312-15-00917 JEKRI R SURBAKTI 312-15-02593 FARADILLA HARSYAH 312-15-02783 INDAH DESFRIANA HRP 312-15-03138 PRIMA PRANANTA M 312-15-03696 RITA ULINA BR TRG 312-15-07454 MAYA WULANDARI 312-15-08437 LIES A P S 312-15-10311 PAULUS KAKA 312-15-10466 MEILAN SELVIANA HULU 312-19-00604 HOTMA ULI PURBA ILMU KEPERAWATAN 112-14-01737 PUTRI J SIHOTANG 112-14-01828 AYU ELFANY SILAEN 112-14-02426 MAY CISKA SIJABAT 112-14-02648 APRIENI A. BATUBARA 112-14-03088 BAHARUDDIN YUSUF H 112-14-03490 RIZKY HANDAYANI RTG 112-14-03581 ANITA CAROLINA Y 112-14-03935 ANITA RUT SITUMORANG 112-15-00750 POPPY CRISTINA R S 112-15-00771 ITA S 112-15-01146 MUSTIKA DEWI PANE 112-15-01427 VITRI ROKHIMA 112-15-02112 MEI LANNIFA STM 112-15-02403 FATRICIA BR GIRSANG 112-15-02522 INES K PUTRI DAELI 112-15-02904 HELEN I S 112-15-03869 PARAMITHA TAMPUBOLON 112-15-03879 HELEN Y.C. LINGGA 112-15-03897 SRI WAHYUNI RAMBE 112-15-03962 EKLESI R OMPUSUNGGU 112-15-05296 ASTER PRIMAWATI S 112-15-06259 HANNA S T 112-15-06774 WIDY SANTRI NINGSIH 112-15-06971 YEMIMA PRAYER HIA 112-15-07089 LIA ANGGITA HARAHAP 112-15-07453 HENI ISMAYA 112-15-07841 CINDY ARIESTA S 112-15-08346 DHIAN PURBA 112-15-08562 YENNI E BR S 112-15-08596 ASNITA HULU 112-15-09096 MAHIRAH 112-15-09235 WENTY E.S 112-15-09406 FRANDRIEK K P ZEBUA 112-15-09796 ARTIA SARI SIDABUTAR 112-15-10184 CHYNTIA S S 112-15-10391 ANDHINI TIUR S 112-15-10425 FEBRIA SANTY 112-15-10689 HEZLIN M 112-15-10794 WIDYANINGSIH LIMBONG 112-15-11335 INTAN T SINAGA 112-15-12458 IMELTI NATALIA V

112-15-13035 YUSTINA M. S 112-15-13104 DESI SRIMARTA S 112-17-00644 ANISA SRI UTAMI 112-17-01514 ANA SAKINAH 112-17-02026 MASWARNI 112-17-02858 MEGA ELISA PUTRI 112-17-04523 RAHMADWITYA YULINAST 112-17-05039 POPPY NUS ASVIONITA 112-17-06836 ALBAZAR 112-17-07550 JENI NURSAADAH BIDIKMISI 112-17-07692 NADYA SAQINAH E 112-17-07776 ZEVERLY ZILVIA 112-21-01767 ADVENTY TERSANIA R 112-25-00632 AULIYATUNNISAA N 112-30-13380 DEBI YOHANA 312-14-00944 MELINA BR GULTOM 312-14-03750 RAMENIA M LUBIS 312-14-04673 MARIA N NAIBAHO 312-15-01297 RIZKI AMALIA 312-15-01584 BEBI WANDA S U 312-15-01606 DINA MANIK 312-15-01680 VIKI AFRIANI S 312-15-04665 MIFTAHUL HANDAYANI 312-15-05129 KIKI REZEKI TAUFIK R 312-15-05230 INDAH P. SARI LOMBU 312-15-06613 RANAFIKA BUTAR-BUTAR 312-15-06967 IIS MAY DWI MULYANA 312-15-07645 NURIDA 312-15-10233 MARTA TELAMBANUA 312-15-10665 ROSELINDA E MANURUNG 312-15-11624 TAZKIYATUN NISA LBS 312-15-11791 MIRA AFIFAH 312-17-02858 MASYITHAH FADHANI 312-17-08279 PUTRI WULANDARI 312-19-04192 ELFI MIZANI 312-19-04558 RESI AYU HARIANTI ILMU PERPUSTAKAAN 212-14-05326 CRISTIAN W SURBAKTI 212-14-07747 CHRISTINE NATALIA.P 212-15-02349 NATAL FERNANDO 212-15-03477 OKA SIMATUPANG 212-15-03554 PANCA NUGRAHA 212-15-03577 MHD. AGUNG TRIONO 212-15-04293 RODESRI MANURUNG 212-15-06015 MARIDUK GULTOM 212-15-06092 IREN C PURBA 212-15-06152 HORMAT AFRILANDO S 212-15-06720 NATAN MP. SIHITE 212-15-06750 BERTHA NOVITA 212-15-07404 IDA MAYASARI PURBA 212-15-07550 LELA MARIATI BANGUN 212-15-07573 DEWI SURIANI 212-15-07661 MARTUA D 212-15-08012 YULI NUR AFANI M 212-15-09027 ARAF ALI WIJAYA P 212-15-09414 MELISA ROSELINA 212-15-09808 LIDYA SARI N 212-17-00493 NURRAHMA YANTI 212-17-07521 FIRDA YENTI 212-19-06344 LAILA 212-30-20682 DEDY ANDREAS HARRY P 312-14-03513 SARAH WULAN DARI 312-14-03622 SEPTIAN PRAHYUDA 312-14-03728 DWI N SIRAIT 312-14-03925 AULIA RAHMA RITONGA 312-15-02116 KRISNA T Y 312-15-03489 AMI TRI ANANDA 312-15-04848 SRI FITRIANI 312-15-05213 ROZA ADELINA 312-15-05441 VINA FIRATIKA 312-15-06873 ELIANSER SIHOMBING 312-15-07493 WINDA KHARISMA 312-15-08704 ANDIKA P PASARIBU 312-15-10492 YUS IMA NAZARA 312-17-06017 FITRI NURANI 312-17-06459 NURWAHYU

312-19-05852 MUHAMMAD ZUHDI. S ILMU POLITIK 212-14-07599 AGUS SANI 212-15-00446 JOSEPH ALLAN. T 212-15-01070 MAULIDA ULFA 212-15-02352 DESPANRIS J SIDAURUK 212-15-02761 ANDRY ANSHARI 212-15-03925 PARIANG D SITINJAK 212-15-04090 GOLDY NAINGGOLAN 212-15-04898 ROSINTHA MANALU 212-15-05398 SYAHPUTRA HUTASOIT 212-15-06534 MARTHIN PANGGABEAN 212-15-06640 NASWIR 212-15-07679 NOVA DEWI L TAMBUNAN 212-15-08611 WIDYA AULIA 212-15-08750 RIEN ANNISA PUTRI 212-17-05414 HASNATUL DINA 212-17-05678 ANANDA GEMA PERKASA 212-23-03353 JULIUS CHARLOS S 212-30-02047 HENRY ANDREAS 212-30-12516 REGGY APRIDHA 212-30-18048 CLARA BELLA ARISA.N 212-34-00830 ARDIYA M AHADIYAT 312-14-02787 PASKO BRUTUS DAMANIK 312-14-02978 LEONARDO B 312-15-00708 DIAN INDAH A S 312-15-00848 ANDI S M 312-15-01108 PUTRI APRIANTIKA 312-15-02816 MBARN RADOVAN BARKER 312-15-03006 RISKA DEWI BR BARUS 312-15-07192 KRISTIAN P S 312-15-07523 MARTIN D S 312-15-08385 RYCARDO PRATAMA 312-15-08415 JAVIER WARGANDA

C3 312-15-09020 GIOVANI MASARO B 312-15-09497 FREDICK B E 312-15-10844 JESSI MONIKA ILMU SEJARAH 212-14-01365 ROY HARIANTO SITORUS 212-14-03824 MIA RATRI PERTIWI 212-14-04032 LISMAYANI 212-14-04792 M PURNAWAN 212-14-04799 EKA SYAHPUTRI A 212-14-05960 M. ARIF SYAHPUTRA 212-15-00088 REZA SEPTINO HADIGA 212-15-00145 ARI ANGGA P SITEPU 212-15-00595 SURYA DHARMA SITORUS 212-15-00768 DWI PUTRA PAKPAHAN 212-15-00929 M.H.D ARDIYANSYAH 212-15-03552 IQRAM FAUZAN 212-15-04560 FAJAR ARMINJA 212-15-04664 ELLEL LILIS S 212-15-05735 MAIDASARI MARPAUNG 212-15-06186 JAKOB SAIMA PUTRA P 212-15-06417 AGUNG ROY FANRI G 112-15-06970 DANIEL J T S 212-15-07769 MARIA KASUARINA 212-15-08274 HARAPAN SIMANIHURUK 212-15-08714 M. AZIS RIZKY LUBIS 212-21-02150 TIRTA UTAMA SINUHAJI 312-15-01741 JEFRI SIMBOLON 312-15-02021 HALIMAH 312-15-02074 TITI SUHAYA 312-15-04895 ZULI ARINY 312-15-08083 RIKA CHARIYANI 312-15-10382 M.SOFI ANWAR BTR BTR 312-15-10966 RAHMAD AFANDI 312-25-02477 MARTUA PARDOMUAN S

C4 KEHUTANAN 112-14-00171 ERNI DORA T SIHALOHO 112-14-01766 FIRZA HARDIAN 112-14-02184 KARTINI D. S TAMBUN 112-14-03321 HAFIDH 112-14-03744 IMAMUDIN 112-14-04765 VICHA DARA ANWAR 112-15-00385 JAN HERI S DAMANIK 112-15-00775 BUDI SATRIA SIHITE 112-15-01469 RATNA SARI 112-15-01791 AGNES TOBING 112-15-02153 SONDANG AMBARITA 112-15-02159 FRISKA G SIANTURI 112-15-02467 IRVAN SIRAIT 112-15-02584 PIKRI HADIN OLOAN R 112-15-02677 CHRISTOVORUS S S 112-15-03174 M. ZULMI PERDANA P 112-15-03234 JELLY NOVITA SARI S 112-15-03258 CHRYSTOFH A SIMBOLON 112-15-03866 INDRA ALEXANDER S 112-15-04182 ISMA JESIKA 112-15-04221 MHD TARIS RITONGA 112-15-04267 ATIKA NOVIANTY P R 112-15-04538 AGRIPA SIDABUTAR 112-15-04708 MARSEN PURBA 112-15-04739 DENIZEN BANUREA 112-15-04961 ADAM D A SIMANJUNTAK 112-15-06189 RIWAN TUMANGGOR 112-15-06500 TIA FADILLAH SUTA 112-15-06631 BRENTON C G S 112-15-07011 LINDAWATI SIHOMBING 112-15-07133 INDRA E P S 112-15-07428 JANGKON IVAN P S 112-15-08583 LUCKY S BRSINULINGGA 112-15-08765 WARREN CHRISTHOPER M 112-15-08899 ELISKA T SIANTURI 112-15-09050 JHON FRENDI BUKIT 112-15-09159 ALEX NAPITUPULU 112-15-09323 ANSENCIA MANULLANG 112-15-09401 PETRUS SIMBOLON 112-15-09478 OSCAR PARDOSI 112-15-09592 JOEL ELPINTA PRANATA 112-15-09611 BOSCO TARULI S 112-15-09767 ADI ANGGRAHA TARIGAN 112-15-10052 ROSLI D. BATUBARA 112-15-10149 SAFRIZAL S 112-15-10199 ARIEF AZHARI 112-15-10319 RIKSON TOBERKI MANIK 112-15-10387 ANDRE PRATAMA G 112-15-10402 H LESTARI P 112-15-10581 VENESIA HUTABARAT 112-15-10797 NARO PANDAONI N 112-15-10973 PRATAMA WINA F H 112-15-11036 ROSA HELEN 112-15-11497 MARISA DOSMA STG 112-15-11530 ELFRIDA ADLINA 112-15-11697 DEA ABIMANYU 112-15-11770 ALVIN ANDRIAN 112-15-12010 JOKO TRI WIJANARKO 112-15-12652 VERA SILALAHI 112-15-12920 ADI PARSAORAN SITEPU 112-15-13198 RIZKY AYU SAFITRI 312-14-03278 ARIMBI SITUMEANG 312-14-03359 CYNTHYA LESTARI 312-14-05032 DEWI ASTARI PURBA 312-15-00090 REZA FEBRI N 312-15-00192 EDRA SEPTIAN S 312-15-00505 DAVID RAYMOND SIRAIT 312-15-02311 HORAS SIMANJUNTAK 312-15-05217 FERNANDO IVANDY 312-15-05410 WINDY BRILLIAN N E T 312-15-05616 KRISDIANTO DAMANIK 312-15-06784 ADI PUTRA SINAGA 312-15-06802 FATHIN HANANA H 312-15-06805 AMALIA NADHILAH S 312-15-06884 ASELA ASTERIA BR B 312-15-07831 AMALIYAH PUTRI 312-15-07911 JONATHAN SIBURIAN 312-15-07996 ANDREAS SAKTI P 312-15-08515 IPAN 312-15-08560 YULIANTI RIA UTAMI 312-15-08983 RAPOLO LUMBANGAOL 312-15-09809 SYLVIA YULITA S 312-15-11497 TONGGI MULIA P 312-30-04063 STEVENN HUTAURUK MANAJEMEN SUMBER DAYA PERAIRAN 112-11-20039 TAWAKAL KUSUMA 112-14-02412 ALEXSANDER SEMBIRING 112-14-02633 RIZKY KHOLILA NST 112-14-04361 KRISTIAN G 112-14-04618 ALEX SUHERI SIANIPAR 112-15-00065 NURUL HIDAYATI D 112-15-00184 PUTRA S A SIHALOHO 112-15-00490 RUTH APRILYANTI 112-15-00613 SANGAP GINTING 112-15-01133 KEVIN AULIA S 112-15-02692 FADHIL MUHAMMAD A 112-15-04316 RONALD F TAMPUBOLON 112-15-05457 NOVITA SARI SIBORO 112-15-05603 TIUR NATALIA MANALU 112-15-05930 AUDYA RAHMAN 112-15-07991 ALI YUNUS 112-15-08672 ELY ERMAYANI 112-15-09144 SITI HAJAR 112-15-09915 EDO J TAMPUBOLON 112-15-10635 AULIA SATRIA 112-15-11482 RATNA D SINAGA 112-15-12728 DINARTA PARDEDE 112-15-13138 MIKHA FEBRYANA 312-15-02894 YESSY CHRISTANTY 312-15-02949 LORA LUITA ANJELINA

Hasil SNMPTN USU 2012 312-15-03089 GILANG PRADIFTA S 312-15-05305 HARRY MUDA HSB 312-15-05665 LULY NANDA ARISTA 312-15-06117 VINCES AGRIANI LASE 312-15-09766 FAJAR PRASETYA K PETERNAKAN 112-14-00958 MELIANA SAMOSIR 112-14-00987 AHMAD FAUZI NASUTION 112-14-02619 BITA S. TAMPUBOLON 112-14-02813 ALWI NASIR SIREGAR 112-14-04530 NOVRIANTO GINTING 112-15-01399 MARINI AFIFAH LUBIS 112-15-02127 IIN SUTIANINGSIH 112-15-05076 IWAN BERKAT S LASE 112-15-05710 IRVAN SABARKO BERUTU 112-15-07572 NOPRADANA 112-15-07590 KHAIRUN NAZLI 112-15-07868 TENGKU BAHDAR NOVIAN 112-15-07911 ALFIQRI IMAM B 112-15-08228 MARISABEL 112-15-08492 MUHAMMAD IBRAHIM 112-15-09863 FAHRIZA ZUHRI 112-15-09939 RIZKI CHAIRUNNISA 112-15-12358 PUTRI ANGGUN R LBS 112-15-12614 ARJUNA GINTING 312-14-03405 RANANDA SATRIA 312-14-05026 HIPAS HASUDUNGAN S 312-14-05545 RINA MARIANA 312-15-00296 PURNAMA KETAREN 312-15-02280 ANJU SONY PUTRA P 312-15-03059 CHARVIA INRIANI S 312-15-08497 YAUMIL RIZKA NASHUHA 312-15-10692 FARIDA ESTARIDA N 312-15-11681 RYAN TOBING PSIKOLOGI 212-14-01977 RIYAN KURNIA ASWARI 212-14-04329 HAGAR L. SITOMPUL 212-14-06310 IQBAL PURNANDANG 212-14-07393 M.ALI NURDIN 212-14-07705 IBRAHIM AZHARY HSB 212-15-00182 HENGKI FARNANDO 212-15-00483 LUCY G HUTAURUK 212-15-00822 RIBKA L 212-15-02848 NADELA TRULLY MARBUN 212-15-03551 DEVI ROSYANA PUTRI 212-15-04839 SITI ANNISA SURYANI 212-15-05318 JEFRY ANDI PIMANTA 212-15-05642 CLAUDIA G A 212-15-06392 MOHD. FAROUQ HASYMI 212-15-06403 ABELLA S 212-15-06660 YOSHINTA G E L B 212-15-07219 FAHMI IDRIS SITOMPUL 212-15-07287 BOY R. V. PASARIBU 212-15-07899 SABRINA AMRIL 212-15-08103 KHADHRA ULFAH 212-15-08736 JULIANA EKA PUTRI 212-19-06083 KHIRZUN NUFUS 212-30-12970 MARIANA 312-11-14237 SILVANDRIE ABRIYAN L 312-11-14487 ZAHRANI 312-14-00299 DARNA PRISTI 312-14-01509 VINA AULIA PRATIWI 312-14-01783 MEGAWATY M S 312-14-04001 IRMA ARFIANI LUBIS 312-15-00147 YOGI PRANATA GINTING 312-15-00228 HERLAMBANG MOHAMMAD 312-15-00357 FELIX T H SITANGGANG 312-15-00419 MARIA A SIMANJUNTAK 312-15-00802 FITRI NIRWANA SINAGA 312-15-02018 ARIFAH RAKATASYA S 312-15-02371 LASMA YULIANTI N 312-15-03855 MELVA FEBRINA N 312-15-04960 RAMOT HUTASOIT 312-15-05695 RAZANAH ISMA 312-15-07117 DEWI SUCI ARMADHANI 312-15-07151 CATHERINE FEBRIANTY 312-15-07844 ESTHER A GULTOM 312-15-07986 RINA Z GINTING 312-15-08422 BRENDA L M SARAGIH 312-15-08707 MAWADDAH NUR FADILAH 312-15-08747 SELLYMA NORA HSB 312-15-08802 NETOVA SIBUEA 312-15-09543 DENNY WAHYUDI 312-15-09687 MELFA Y SIMANJUNTAK 312-15-11047 IIN TRIANA DEVI A 312-19-03854 NURAINI 312-34-07358 KURNIA BOBY SAFAROV SASTRA ARAB 212-14-01311 HALIMATUSSAKDIAH 212-14-01752 M. ZULFIRMAN H.S.B 212-14-04858 NIMAS CHANDRA S A P 212-14-05073 FAISAL HABIBIY 212-14-05178 M. REZA KURNIAWAN 212-14-05449 NURUL AFRIZA 212-15-00286 NURLENA 212-15-03713 ADE FITRIA 212-15-04024 SABRINA SINULINGGA 212-15-08989 NINDI AYU SYAFITRI 212-17-12804 ALVAN SATRIA SHIDIQ 312-14-00217 AMELIA ANNISYA 312-14-01203 MUHAMMAD FAHMI 312-14-04183 WENI DWI WIJAYANTI 312-14-04604 DURROTUN NASHAH 312-15-00132 PANCA SYAHPUTRA P 312-15-01448 KHAIRIL HILMI 312-15-04549 FADILAH NURHIDAYAH 312-15-07004 PUTRI HUMAIRA 312-15-07541 AGUNG QOSYM YUS 312-15-07915 NUR MALA 312-15-08181 MUHAMMAD SYAIFUDDIN 312-15-08573 RAPITA ANGKAT

312-17-11672 TRISNA RAMA SASTRA DAERAH UNTUK SASTRA BATAK 212-14-00228 SEPRANS EDO A S 212-14-00821 FERTIKA SINAGA 212-14-00901 TRIHAMDANI PADANG 212-14-02238 OPEL MELKY MALAU 212-14-02390 RIANTI SIMBOLON 212-14-03425 NATALIA MANALU 212-14-05387 BOB VALENTINO .S 212-14-05825 TRY PUTRA R 212-15-00146 JONI PREDI SIREGAR 212-15-02171 RIA LESTARI SINAGA 212-15-02313 SUBUR NAIBAHO 212-15-05270 DORTUA SIMBOLON 212-15-06426 XAVERIUS G M MALAU 212-15-06529 JON HENDRIK SIPAYUNG 212-15-07197 TRI EMMY L SIKALIT 212-15-07970 RAHMAT T PASARIBU 212-15-08612 RAYMOND H NADAPDAP 212-15-09917 FAHEERA IMANIZA 312-14-00443 PIETER SIJABAT 312-14-02522 HENNI HERNIWATI .S 312-15-00837 DEWI S SIMANUNGKALIT 312-15-01745 RAMAYANTI SITANGGANG 312-15-02659 ASTINA O. S. NABABAN 312-15-06832 ROI ALMIGO SIKETTANG 312-15-08344 JEPRIANDO 312-15-08973 SRI ELSITA BR S 312-15-10719 DAVID F HUTASOIT 312-15-11529 RONI SIMBOLON SASTRA CINA 212-14-00010 WINONA J P SIBORO 212-14-03664 PUTRI F H SIRAIT 212-14-03848 KARTIKA WINDY 212-14-04322 ERNI RAVITASARI 212-15-00998 INDRIYANI 212-15-03913 DARWIS B PASARIBU 212-15-04846 YOSANTHI S HUTABARAT 212-15-05004 YULIE 212-15-05163 YUNI KRISWANTI D 212-15-05717 RESYA PUTRI AMANDA 212-15-05862 WIRA MAHYEKTI W 212-15-06387 TSURUOKA EDA R B 212-15-06669 ADOLF F SIGALINGGING 212-15-07139 RAPIKA BR KARO 212-15-07425 LARA FATMALA 212-15-09023 SELTICA ASSAKINA 212-15-09546 EMI LIYANA TARIGAN 212-17-00430 ROZALINA 212-30-05431 NURUL FITRI HRP 212-30-18061 MARGARETHA TIORIA 212-30-19975 ANDREAS HANS 312-14-03661 SUGAR DEFRI CHARLES 312-14-04013 RISKA C. SARTIADUS 312-14-04887 TAUFIQ RAMADHANI 312-14-04967 RIFAL JAELANI 312-14-05756 YULIA SYAHRINA LUBIS 312-15-00037 ANNISA AFRA 312-15-01013 ALEX ZULKARNAIN 312-15-02243 IVAN 312-15-02554 FIQHI NAHDHIAH MAKHM 312-15-03012 SELVIA JUWITA S 312-15-06153 FAENY ELVIRA 312-15-08216 L.HANA ALVINE GRACIA 312-15-08255 CHRISTINA 312-15-08599 M. FIQIH ANDRIKA 312-15-09524 ELSA BR KEMIT 312-15-09842 PUTRI SUMTIYU P S S 312-15-10415 DINA SHABRINA P SRG 312-15-10932 YOAN VIRERA .S 312-17-02477 SRI RAHMAYUNA 312-17-11013 SRI DILA FIRMADANI 312-19-05885 M.REZA HARIEDHI 312-27-02526 MIERIYANTI 312-34-06947 FEBRIYATI C S SASTRA DAERAH UNTUK SASTRA MELAYU 212-14-03915 IKA LIA ZULIANA 212-15-00418 MASWIRNA HUSNA 212-15-00525 BASRI NAWI PRADANATA 212-15-01063 RIFKI ARIF PANE 212-15-03177 AFDANA SYAKIRAH 212-15-03375 HENDRI ADI SIREGAR 212-15-03879 MUHAMMAD DEDI 212-15-04128 MAS AGENG PRABOWO 212-15-05339 FELLA KAULIKA 212-15-06996 SARAH ANGGRAINI 212-15-08191 MUHAMMADIQBALMARLIZA 212-19-06866 AMRULLAH 212-19-07429 RENNY PUSPA SARI 312-14-01008 MHD SYAHRI ARIF 312-14-03785 FADLI RANGKUTI 312-14-04443 NURLAILA ZAIRINA 312-15-04286 IVO ALEX HUTASOIT 312-15-05588 ARIYA ISNAIN 312-15-09729 DANIEL DAMARA 312-15-10955 NILOVA GIOSTINA 312-15-11634 ARDI SUTANTO SASTRA INDONESIA 212-14-00139 NOVITA SARAGI NAPITU 212-14-00980 ANDRIHI BRHEMA 212-14-04784 SARMA R SIPAHUTAR 212-14-06193 AHMAD FAUZI 212-15-00987 RAHMAT ZAKI SIRAIT 212-15-01088 MAYA ANGELIKA S 212-15-01322 IRA SAFITRI UJUNG 212-15-02247 TRYWANTY T 212-15-03789 M. SURYA HIDAYAT

WASPADA Sabtu 7 Juli 2012

212-15-04826 SOFIA INDAHSARI B 212-15-05209 KEZIA SEPHIA 212-15-07369 SURYANA 212-15-07496 RIKA KARTIKA 212-15-07577 MEYLANI C MANURUNG 212-30-02090 RICARDO YONATAN 212-33-11788 ACHMAD HATTA NUGRAHA 312-14-02119 HARIATI BR SEMBIRING 312-14-02228 DINNY NANDA PUTRI 312-15-00251 ELOVANI BR GINTING 312-15-00629 FITRI E SITUMORANG 312-15-02698 SRI LESTARI C.S 312-15-05109 ROTUA HC SILABAN 312-15-06227 DAME SILITONGA 312-15-07141 TRI SUCI RAMADANI 312-15-08204 IRWAN A SITUMORANG 312-15-08342 GRECELIA SINAGA 312-15-09241 FITRI DWI UTAMI 312-15-09263 MEILINDA PAKPAHAN 312-15-09369 UMI KALSUM 312-30-01858 ANDRIAN HIDAYAT SASTRA INGGRIS 212-11-10918 AGUS SALIM 212-14-00902 WIN WIN WIJAYA 212-14-03533 IRA ATIKA ZAHRA 212-14-04110 RINALDI RAMADANI 212-14-05661 WELLA JUITA PURBA 212-14-06306 DAVID SAMUEL 212-15-00030 ZAHARA SARI WARDHANI 212-15-00441 CHRISNA R PARDEDE 212-15-00549 SYAYU MUTIARA 212-15-01320 REHIA INDRAYANTI S 212-15-01867 DINI ANDIANI 212-15-02098 MIRANDA A NASUTION 212-15-02104 YOHANA MARGARETHA S 212-15-03843 MIN ADLINA 212-15-04297 MHD RAYHAN RIANDA N 212-15-06016 ANDREAS GOZALI 212-15-06189 WIDYA ARISKA 212-15-06224 DEBORA SIHOMBING 212-15-06964 RAPIKADURI MARPAUNG 212-15-07005 JESSICA 212-15-07380 SITI ALIFA S 212-15-08003 DAME DIARNITA 212-15-09487 CAROLINA 212-15-09540 KRISTIN SIREGAR 212-19-04895 FRISSILLIA AYESA 212-21-00375 RISKI VANESIA SIR 212-33-11201 NIEL MARULI TUA 312-11-20727 WAHYU MAULANA 312-14-00842 NIA S WAHYUNI BR.TRG 312-14-01581 GRACE NATALIA T 312-14-03483 ESRA JUNIATI PURBA 312-14-05770 NURFITRI 312-14-06217 IRVAN S.SIMBOLON 312-15-00094 THEODORIC SEBAYANG 312-15-00553 TIFFANI SARASWATI 312-15-00914 JAY SITA 312-15-07134 KEVIN BONATUA M 312-15-07311 ROSA FELESIA D T 312-15-07326 MUHAMMAD ADIMAZ P 312-15-07341 SUCI AZLINA 312-15-08518 INDAH PERMATASARI M 312-15-09025 MONICA LORA 312-15-09189 REVYANDHITA 312-15-09376 WINDO AGUSTIAN 312-15-09518 CHRISTOPHER 312-15-09764 DAVID CHANDRA 312-15-10204 KHAIRIAH 312-15-10271 GAYATRI OFISOWINA 312-15-10502 DANIEL SIBARANI 312-19-03995 ERNITA WIJAYANTI N 312-19-04657 JOLENA PUSPITA 312-19-04941 PUTRI JUNIARTI S 312-19-05671 MELIZZA ARMELIA Z 312-21-02726 ACHMAD HIDAYAT 312-21-02764 TONDI NAMORA SOSIOLOGI 212-14-03570 KARUNIA BINTANG 212-14-03893 YAYANG APRILIA 212-14-03994 FRENKI L C SAGALA 212-14-06060 FERNANDO SEMBIRING 212-14-07169 IVO ANDREAS SINAGA 212-14-07190 MARTINA N NAINGGOLAN 212-15-00157 JOY SAMUEL SOLIN 212-15-00313 FANI L SIMANJUNTAK 212-15-00587 SRI WAHYUNI RANGKUTI 212-15-00790 FEBY ANASTASYA G 212-15-01870 JULIANTI OMPUSUNGGU 212-15-02084 DANI RINALDI SITEPU 212-15-02402 INDRA MAULANA 212-15-02734 ANDRIE 212-15-03029 INDAH PERMATASARI 212-15-03244 MHD. MAY FAZRI 212-15-04386 LORINA PURBA 212-15-04788 RATNA ULI H SIREGAR 212-15-07106 PASKA WANI MANURUNG 212-15-07274 WALBER PRAKEVIN 212-15-07332 YUNI DWI HASTUTI 212-15-07584 DEDI ROY HUTAGALUNG 212-15-08136 MARTHA SIAHAAN 212-15-08347 ENDY TEMANA 212-15-08520 DEWI NIA ZENDRATO 212-15-08615 BINSAR SP L GAOL 212-30-00965 ESTINA ARITONANG 212-44-05281 SAMUEL NUGRAHA C 212-46-11973 ARGIFARY SOETICHNYO 312-14-03904 RIANA ASTRINDA S 312-15-03385 DESSYANI TRISNAWATI 312-15-07398 EVELINA SIAGIAN

The Cardigans

The Cardigans Konser Di Indonesia Grup musik asal Swedia, The Cardigans, dipastikan datang ke Indonesia untuk konser di Tennis Indoor Senayan, Jakarta 14 Agustus. Promotor Loud Production, Ridho Hafiedz juga gitaris Slank, mengatakan pihak The Cardigans sudah memasukkan Indonesia dalam rangkaian tour konsernya. “Ini kali pertama mereka datang ke Indonesia, penggemarnya banyak dan loyal jadi diharapkan bisa menjadi konser nostalgia bagi penggemar The Cardigans,” kata dia saat konferensi pers di Jakarta.

Mengenai perizinan konser, Ridho mengatakan pihaknya sudah mengajukan ke pihak berwenang. “Izin on progress, sudah beres semua, minggu depan bisa release,” kata dia Band beranggotakan Lars-Olof Johansson, Peter Svensson, Bengt Lagerberg, Nina Persson dan Magnus Sveningsson tersebut dikenal dengan single mereka “Love fool” menjadi soundtrack film Romeo and Juliet pada 1996. Perjalanan karir grub band ini dimulai tahun 1994 dengan debut album mereka Emmerdale (1994), Life (1995), First Band on The Moon (1996), Gran Turismo (1998), Long Gone Before Daylight (2003), Super Extra Gravity (2005), dan Best of Cardigans (2008).(ant)

IMB 3 Audisi Di Medan Syahrini dianggap pantas menjadi salah satu juri Indonesia Mencari Bakat (IMB-3) audisi di Medan berlangsung 7-8 Juli 2012 di Fakultas Farmasi Kampus USU Jl Dr Mansyur Medan. Yossy Saragih selaku produser IMB3 menyebutkan hal tersebut atas pertanyaan Waspada Jumat (6/7) sebelum temu pers dengan wartawan di Garuda Plaza Hotel Medan. Syahrini selain sukses meraih karirnya, juga mampu menjadi trensetter. Sekarang ini penyanyi tidak saja harus mampu menarik simpati masyarakat, tapi juga dia dituntut bisa menjadi trendsetter,ujarnya. Dia berharap, para peserta audisi di Medan bisa menampilkan ciri khas Sumatera Utara yang mampu mengangkat seni budaya daerah ini misalnya Gordang Sambilan, bila dikombinasikan dengan musik modern hasilnya seperti apa, itu yang kita inginkan dari sini, katanya menambahkan. Sementara Syahrini sendiri ketika ditanya wartawan di Jakarta menyebutkan, pertimbangannya. mau menjadi juri IMB 3 lantaran program televisi ini baik dan keterlibatannya merupakan bentuk dukungan nyata terhadap industri hiburan di Indonesia.

“Saya ingin memberi motivasi kepada para talent hasil audisi di tujuh kota besar,” kilah Syahrini kepada wartawan. Menurutnya, sebagai juri baru dirinya merasa tersanjung bisa duduk berdampingan dengan juri IMB berpengalaman - Addie MS, Titi Sjuman dan Sarah Sechan. Selain ingin memberi motivasi, secara pribadi Syahrini berharap mendapat banyak ilmu, baik dari talent mau pun para juri. “Ini pengetahuan sekaligus tantangan bagi saya untuk menjadi lebih baik. Saya pun bisa berbagi pengalaman lebih baik kepada juri-juri lain. Yang jelas berbekal pengalaman dan eksis sebagai penyanyi, saya akan fokus memberi motivasi agar lebih percaya diri dan berjuang keras menjadi diri sendiri,” tandasnya. Guna memberi kesempatan bagi bakat-bakat multi talenta di seluruh penjuru tanah air, IMB 3 melakukan audisi di 7 kota besar. Yogyakarta dan Makassar (23-24/6), Surabaya - Denpasar (30/6-1/ 7), Medan dan Bandung ( 7-8 Juli) terakhir di Jakarta (14-15 Juli). Peserta ingin mengikuti audisi di Medan masih dibuka kesempatan sampai hari Minggu (7/7) di lokasi tempat audisi berlangsung. * (m19/AgusT)

Hasil SNMPTN USU 2012

WASPADA Sabtu 7 Juli 2012

AGRIBISNIS 112-14-00767 BELLA PEBRIYANI P 112-14-01791 REZEKI RAHMAYANI SRG 112-15-00031 NADIA GINA HILLARYA 112-15-00468 EVA BERLIANA 112-15-01191 HANS PUTRA 112-15-01243 NADYA AULINA 112-15-01569 IKA SAPUTRI DEWI 112-15-01576 INDAH WIYANI PUTRI 112-15-01909 GOMAL P. MUNTE 112-15-02147 RENDI MANUEL 112-15-02595 REZA SUSANTO 112-15-03119 ANDRI KURNIAWAN 112-15-03137 KRISTINA HARIYANI 112-15-03263 FAIZ AHMAD S 112-15-03577 NAOMI PANJAITAN 112-15-03839 FITRI RIZKI ARMILIA 112-15-03908 GRACE ANASTHASYA 112-15-04166 SWIKING 112-15-04547 DAVID CHRIS 112-15-05203 M. RAIHAN AUFAR 112-15-05322 REZA MAULANA 112-15-05359 GRACE CYNTHIA M 112-15-05494 CITRA PARADITHA 112-15-05533 ZHONUTAMA S.I.S 112-15-05639 HAPPY FEBRIYANTI S 112-15-05708 FAUZY SATYA RESPATI 112-15-05999 BEATRICE INGRID D 112-15-06032 JOSUA SIMORANGKIR 112-15-06359 ASRI DELVIANA S 112-15-06572 YAN P DEPARI 112-15-06700 SERAFIKA PANJAITAN 112-15-06851 RIZKA FARADINA 112-15-07210 ALFREDO 112-15-07700 DHIENI MAGHFIRA 112-15-07928 HERBERT LEONARDY 112-15-08343 ASITA RAHMADHAYANTI 112-15-08404 WELLA GRACE SIHITE 112-15-09483 VERONIKA SITANGGANG 112-15-09488 KHOLIDA ZUHRI HRP 112-15-09529 RINI SILVIA DEWI 112-15-09788 BARANTA GINTING 112-15-09937 PURNAMA SARI SITORUS 112-15-10011 WILLY SALIM 112-15-10118 SWANDI HUTABALIAN 112-15-10298 VIVIN OKTAVIANI 112-15-10550 AGATHA SIREGAR 112-15-10769 DEA R A 112-15-11292 EKA KARTIKA SARI 112-15-11423 POPPY AMANDA SARI 112-15-11664 MAX JOVI A M 112-15-11706 TRI RAHMADANI 112-15-12567 LEO T 112-15-12876 FANDHY ACHMAD LT 112-15-13346 MARIA A SITUMORANG 112-17-09144 RAINAL SUNNY 112-19-04335 M RIDHO TURSINA 312-14-03103 RIA HUTABARAT 312-15-00222 ANDI W TAMBA 312-15-00313 NELSON J S 312-15-00923 ASWITA BR HALOHO 312-15-01354 AULIA HARFI S 312-15-02832 PUSPITA DAMAYANTI 312-15-02846 M RIZKI HELMI HRP 312-15-03070 KIRANA PRATIWI AZIS 312-15-03635 M ARIEF W G 312-15-04178 NINA ELBRASA BR BRS 312-15-05982 JOSIA SITUMORANG 312-15-06193 NURHASANAH SIREGAR 312-15-06354 ELISA PUTRI 312-15-06509 INDIRA ROSALYN TAMBA 312-15-08325 ASMUI G C 312-15-09240 RETNO ANGGITA PUTRI 312-15-10313 LIA OKTAFIA S 312-15-11588 FADLI AKBAR -

AGROEKOTEKNOLOGI 112-11-10496 FIRDAUS HAMIDI 112-14-00058 ASYRIANI SYAHFITRI 112-14-01286 RENZYA FATWA ALSAS 112-14-01320 RAGA TILOTTAMA 112-14-01871 AMRY MELINDRA 112-14-02730 MUHAMMAD RAMADHAN 112-14-02747 RISKI AULIA 112-14-02899 NIKSON SITINJAK 112-14-03102 LILI RAMADANI 112-14-03231 HARTONO P NDRURU 112-14-03378 LINDA FRISCILLA J H 112-14-03806 VORLY JUNESNA NADEAK 112-14-04230 R. AYU CHAIRUNNISYA 112-15-00459 WIKA W SYAHPUTRI 112-15-00622 BOY EDIKA 112-15-00816 RIZKY J P 112-15-00894 SOPA PUTRI TANJUNG 112-15-01160 RONAL F GINTING 112-15-01177 REJCHI PERDANA S 112-15-01671 PRENGKI SIREGAR 112-15-02234 DESY MUTIARA SARI 112-15-02337 IKHSAN RIZKY F S 112-15-02471 CHARLAN B LOMBU 112-15-02519 TOMY FADILLAH 112-15-02687 RADA KURNIATI HRP 112-15-02705 KEVIN ALVAISHA MTD 112-15-03362 WINDA NURAINI S 112-15-03597 WAHYU SYAHPUTRA 112-15-03693 DEA TRIASPITA Y GEA 112-15-03721 GILANG R 112-15-04021 SEFRIANSYAH PUTRA 112-15-04112 JAMAL H 112-15-04300 WAN RIZKI FITRA H 112-15-04518 MARIO ROBERTHO S 112-15-04540 MONICA YUNITA 112-15-04608 JERRY AFRIMSA S 112-15-04973 MATCHIUS SINULINGGA 112-15-05010 I WAYAN HIRAS SATAYA 112-15-05060 AMELIA SHABRINA 112-15-05817 MOHD FADLI LUBIS 112-15-05832 APRILAINI T 112-15-06180 STEVEN J.H. SIAHAAN 112-15-06385 EMA R SIPAYUNG 112-15-06654 M IKHFAN JUNIARA 112-15-06893 INDRA R MATONDANG 112-15-07293 SITI MAQDISAH 112-15-07344 IRVAN S PURBA 112-15-07383 BAYU SYAHPUTRA 112-15-07400 ANANDA B GINTING 112-15-07510 SAMUEL T Z PURBA 112-15-07542 IQBAL KOYOTO 112-15-07604 AHMAD RIDWAN LUBIS 112-15-07637 EDDY SUSANTO 112-15-07679 FUJI LESTARI GINTING 112-15-07826 ROMA RIO SEBAYANG 112-15-07915 SANTI 112-15-08042 IRENE P. S 112-15-08128 BERNANDO BASTANTA 112-15-08212 KHAIRUL NAIM 112-15-08254 RIZKI M.I. REZA 112-15-08516 GABRIEL K GINTING 112-15-08569 MUHAMMAD MAULANA S 112-15-08747 MICHAEL TOMRITO S 112-15-08772 DANIEL CRISTIANUS S 112-15-08919 NURUL HIDAYAH SINAGA 112-15-08996 ISPAN ARDI 112-15-09071 DOMAS MESIEKIEL 112-15-09133 ALBINUS RENDY S 112-15-09161 BAPTISTA OKTO SIGINT 112-15-09446 DONY PUTRA MANIK 112-15-09558 AULIA AGHNA 112-15-09578 MUHAMMAD IQBAL 112-15-09636 RICKY L TAMBUNAN 112-15-09694 ELFRIDE SINAGA 112-15-09700 VERDA K S TARIGAN 112-15-09924 WELLY ISMA SIMBOLON 112-15-09965 BERTRYDA HASTIPA M 112-15-10057 ARMADA KAROKARO 112-15-10235 VIJAY SITANGGANG 112-15-10244 BARITO ALIMUDDIN 112-15-10311 ALBERT DANA GINTING 112-15-10353 ANDIKA LEORENSIUS S 112-15-10576 YULITA SINAGA 112-15-10631 ATIQAH ASH ASHADIQAH 112-15-10818 GREDO O. M. PURBA 112-15-11089 BOBBY FRANS 112-15-11411 YULIA SINAGA 112-15-11439 MARIANA ROMINA MANIK 112-15-12108 SATBER NAIBAHO 112-15-12161 SETIANTO GIRSANG -

112-15-12304 RONI IGNATIUS H 112-15-12370 AGUSTARINA GINTING 112-15-13120 MOHAGA SITUMEANG 112-15-13139 ASEP FERDINAND S 112-15-13439 M AZWAR 112-19-02229 SUCI KHAIRANI S 112-30-08217 IVAN PRATAMA TARIGAN 312-14-01388 DITH CHENY G TURNIP 312-14-03260 AGUSTO SIMANJUNTAK 312-14-03304 MARIA Y S 312-14-03350 ANGGI NOVITA SARI 312-14-04214 REBI FIRMANSYAH 312-14-04292 SUTAN TARMIZI LUBIS 312-14-04368 TARA R NIDA BATUBARA 312-14-04622 RIZKY KURNIAWAN 312-14-04873 NIKEN KEMALA 312-14-05048 ONA S BANJARNAHOR 312-15-00058 M FADHIL ZAIN RAMBE 312-15-00452 LORITJEN SIHOTANG 312-15-00567 IMMERSON LIMBONG 312-15-01829 HELENA S SINAGA 312-15-02207 DOMINGGO NAINGGOLAN 312-15-02627 SRIMAHYUNI NAIBAHO 312-15-02689 FADHLAN RIAN D 312-15-03145 MHD ILYAS NAZRI 312-15-03304 ELLA Y E W SIMAMORA 312-15-03675 RIA ANINDI ANTIKA B 312-15-03880 YENI RAWATI HARIANJA 312-15-05906 SHELA LIA NIKA BR S 312-15-06003 TAMON ARIYANDI G 312-15-06010 INDRA MARIO STEFANO 312-15-06124 NELLA ANGELINA 312-15-06534 AMIRUN H NAPITU 312-15-06538 RADINAL ARIEF SINAGA 312-15-06582 EKA SETYA WULANDARI 312-15-06823 IRA T. S. DAMANIK 312-15-06945 VICTORIA M L G 312-15-07020 RIFKA HADODO.S 312-15-07264 HERMANTO PANJAITAN 312-15-07571 ANDREAS N 312-15-08074 CYNTIA B J PANJAITAN 312-15-08241 AHMAD BARKAH AL HAQ 312-15-08295 FACHRUL ROZY ARIANDY 312-15-09478 GUSTIYANSYAH I F 312-15-09583 BOY D P 312-15-09697 LORENTA REBEKKA 312-15-09989 SHARAH ALIFA HARAHAP 312-15-10440 POPPY RUT SILVIA S 312-15-10648 SONI SUI SUTRISNO 312-15-10997 YOGIE ARMANDA 312-15-11268 PUTRI KHAIRANI 312-15-11371 MARCEL C S 312-19-04322 CHYNTIA ARKESTI P 312-21-02256 RIONALDO PAULI SIREG -

AKUNTANSI 212-14-02684 BERTA G MANALU 212-14-02798 AKBAR HIDAYAT HRP 212-14-04310 ANDRI BIDIKMISI 212-14-04689 IHSAN AMDANNI 212-14-04743 MEILI YESINTA 212-14-05529 SULVIA PRASTIKA. S 212-14-05858 PRAYOGO 212-15-00020 REBECCA SEMBIRING 212-15-00203 W. NOVIANTY 212-15-00264 ZUBAIDILAH LUBIS 212-15-00407 ERIC DARMAWAN 212-15-00481 SELLY YUNITA 212-15-00593 KATHERIN HAMES 212-15-00609 ROSSY P S 212-15-00778 YEFTA JANUAR 212-15-00899 WINNER P SILALAHI 212-15-00902 CAROLINE 212-15-00994 REDO SENTOSA NAULI 212-15-01097 SINTA D NAINGGOLAN 212-15-01173 YOGA DONI S 212-15-01235 CHRISTINE 212-15-01448 CINTHYA NANDI PINTA 212-15-01700 CHAIRANI SAPUTRI RKT 212-15-01956 NONI FITRIANI 212-15-02236 BAYU ARONTATRA FAUZI 212-15-02261 INDAH MAYASARI 212-15-02351 RUMONDANG AMELIA LBS 212-15-02750 TOGIANA C S 212-15-02815 FREDERICK S L 212-15-02818 JECKSON S 212-15-02836 RISTAULI SIANTURI 212-15-02948 ASMARIANI 212-15-03105 M. HAFIZ KHAIRUNSYAH 212-15-03182 GUSTIANNA PASARIBU 212-15-03276 FITA CYNTHIA 212-15-03294 REVMIANSON NAIBAHO 212-15-03395 NERISSA ARVIANA 212-15-03654 GEBY AGNES L.GAOL 212-15-03906 WILYANA LIENARJO 212-15-04004 SALLY 212-15-04005 PRATANDA SETIAWAN 212-15-04053 PARJO RUSTAM P P 212-15-04068 BENYAMIN GINTING 212-15-04316 MHD NUGRAHA HARAHAP 212-15-04413 ICHAN IHUT NATAMA S 212-15-04594 AFENDRI LINGGA 212-15-04707 ESTER JUNITA 212-15-04893 HELENA T R MARPAUNG 212-15-04952 HAFIZHAN SIREGAR 212-15-05108 OSVALDO ARDINAL 212-15-05114 DWI KARTIKA 212-15-05167 INRI LIONI S 212-15-05261 ARNOLD P ARUAN 212-15-05348 TENGKU SHAHARA 212-15-05519 WIANA ONGKO ONG 212-15-05592 PUTRI C.M.S 212-15-05597 JESSICA HILARY S 212-15-05650 CITRA YUSTIKA P 212-15-05810 RYAN A. SINAGA 212-15-06171 PUTRI YULIYANTI S 212-15-06221 STEVEN TJENDRA 212-15-06227 RIDWAN ABDILLAH 212-15-06333 RUTH K M H 212-15-06380 YENNY 212-15-06749 SYLVIA 212-15-07292 STEWARD GANI 212-15-07917 JEPPRI PASARIBU 212-15-08195 ASTRID C S 212-15-09781 CHRISTINE LOIST 212-17-06141 VERONIKA PEBRIANI S 212-21-00739 MELATI YULIANA L 212-30-02852 YOSEF SATRIO WIBOWO 212-30-08069 REY EDWARD C.PANDIA 212-30-14324 GRISELDA MARIANA 212-33-22034 JELITA PUSPITA SARI 21234-07344 RIMMANIAR P 212-34-08556 AUDREY YOSEPHINE S 212-34-12392 GALUH A KHANSA 212-34-15027 JUMIANDO SIHOTANG 212-38-20977 CHICHI ANGGI S.S.P 312-11-12416 FAWZIA RACHMI 312-14-01256 MARIANCE B. NAIBAHO 312-14-01745 RAHIMI SOFYANA 312-14-01896 KRISTINA H 312-14-03300 MAROJAHAN SINAGA 312-14-03463 ABDUL FATTAH RIZKI A 312-14-04772 DIAN AYU LESTARI 312-14-05257 IRANI YOSEPA 312-15-00088 ANWAR BUDI HUSEIN 312-15-00141 ROTUA E R R HUTAURUK 312-15-00218 JESSY A MAHA 312-15-00268 MUHAMMAD FAHRULLAH 312-15-00659 ARISDIFA KURNIA K 312-15-00707 PEDRO V V SIMBOLON 312-15-01031 ANGGRENY C. SIAHAAN 312-15-01513 AMBROCIUS 312-15-01549 SABAR SIREGAR 312-15-02354 JAMES SARAGIH 312-15-02808 FEBY AUDINI BATUBARA 312-15-03093 EMELIA F. CORDIAZ 312-15-03264 SITTA SIMANJUNTAK 312-15-03553 PAULA TAMBA 312-15-03669 SALLY 312-15-03745 ANTON S SINURAYA 312-15-03821 RICKY HALOMOAN S 312-15-03916 ARIEL B S 312-15-04596 RIRIN ERIFANI MALAU 312-15-05048 DIMAS A. HERMAWAN 312-15-06164 IMELDA L T 312-15-06177 TONISY KARLA JOSUA S 312-15-06282 ANGGI NURSAADAH R -

312-15-06424 EKA ALFRED SAGALA 312-15-06881 RIZKY ADITYA PRATAMA 312-15-07018 IBRAHIMSYAH POHAN 312-15-07458 IVANA MARGARETH C H 312-15-07520 KHAIRINA AUDRINE 312-15-07863 ONDIAN CLAUDIUS S 312-15-07889 HAFIZHATUR R 312-15-08281 NAYUMI I SIMANJUNTAK 312-15-08316 YOSUA H F MANURUNG 312-15-08410 JUNITA SINAGA 312-15-08528 BUENA B K 312-15-08658 SILVIA YUNITA DEWI 312-15-08922 SRI BINTANG D T 312-15-09021 TONGGO SITORUS 312-15-09165 ROARGA R SIAHAAN 312-15-09378 DEVI ROSDAL YANT I 312-15-09631 YUNI MAHRANI HARAHAP 312-15-09759 BULAN DEWI SARI 312-15-10030 AGUNG ARDITYAS 312-15-10089 SHEILA KEIZIA 312-15-10330 ANGELINA SIHOMBING 312-15-11571 THEZAR FIQIH HIDAYAT 312-15-11664 GANESHA LKGS 312-17-05147 VICKY ABDILLAH 312-17-06060 BOY ANDRIO 312-19-03887 MUHAMMAD IDRAQ I T 312-19-05222 YULI MASRONA HITA 312-21-02114 DEVI DARNITA 312-33-10443 HANDI FAJAR M S 312-34-01392 PRISKILA SARAGIH 312-34-07108 RIRIEN NATHALIA A 312-38-20236 RIZKY HARTAWAN N -

ANTROPOLOGI SOSIAL 212-14-00920 MARTH 212-14-03209 KIKI INTAN 212-14-04139 SARI G SILALAHI BIDIKMISI 212-14-04594 RIZKI NANDA SAPUTRI 212-14-04874 MISRIANI SARAGIH 212-14-05378 HERLINA SIMANJUNTAK 212-14-05381 MADUN PURBA 212-14-06097 ANITA LUMBAN RAJA 212-14-06244 JUNIKE SIHOMBING 212-15-01130 FAJRIN FEBRIAN NST 212-15-01343 ERWIN SIMARMATA 212-15-01725 STEPANUS PURBA 212-15-03670 FITRIA ANGGINA 212-15-03735 ARIF AKBAR 212-15-03961 MARIANCE YUSTITI S 212-15-04226 ROY OTNIEL 212-15-04429 ERIKSON SILABAN 212-15-04537 BOBY WARSITO SORITUA 212-15-05361 TITO BHASKORO 212-15-06264 SARAH MEUTHIA HSB 212-15-06638 PANDE P S SITANGGANG 212-15-07355 WILDANI AGUSTINA 212-15-08174 SONDANG M M 212-15-09032 NATALIA K SINULINGGA 212-15-09033 WIDYA S BAKKARA 212-15-09239 JOSHSATRIA P R T T S 212-15-09437 MAY SAROH HARAHAP 212-15-09829 SUSI SUSANTI 212-17-10563 JOHN MAGER BAGARIANG 212-27-05001 LESTARI MEI A P 212-30-03388 INGRID ZERLINDA A 212-33-22461 FEBRIANA 312-14-05387 JELLA OKTARIA S 312-15-00418 DRIXEN A M 312-15-00930 SHOFWAN AL FAROQY H 312-15-02304 ARIF SETIANDI 312-15-03642 JOHANA PUS 312-15-04205 SAHALA NAIBAHO 312-15-06565 MUHAMMAD INDRA BAKO 312-15-07320 FRITZ OCTO SARAGIH 312-15-08313 DESMAN I NDRAHA 312-15-08551 TRIO WIJAYA BIDIKMISI

ARSITEKTUR 112-14-00731 ALBERT 112-14-01137 MIONA HUTAURUK 112-15-00143 CARISSA FEBRINI 112-15-01583 RIBKA A SIANIPAR 112-15-01648 MEINITA P TARIGAN 112-15-01926 YUNI LIUS 112-15-02035 KEVIN P S TAMPUBOLON 112-15-02323 JEFFRI YANTO 112-15-02986 AYU MULYALESTARI 112-15-03016 AUDREY 112-15-03333 BILLY CHENTHYAGO 112-15-03494 PUTRI GRACIA 112-15-03906 TRI SUCI WULANDARI 112-15-04029 WENNY WIDJAJA 112-15-04035 TENGKU HANNIZA HUSNY 112-15-04586 TARMIZI MUKHLIS 112-15-05001 M LUTFI R SIREGAR 112-15-05125 EDUARDO P TANJUNG 112-15-05140 DIYO AKMAL NUSYA 12-15-05842 DONNA RIBTA ALAM 112-15-05951 NAROSU SIREGAR 112-15-06062 TAMMY CLARISSA 112-15-06370 SOFIE NUGROHO NG 112-15-06983 LAVIANA 112-15-07186 SHIRLEEN 112-15-07221 FREDDY KIRANA 112-15-07352 DESY 112-15-07484 DEDEK A SITOMPUL 112-15-07620 VIVIAN MAKMUR 112-15-08043 WEWIN INGE 112-15-08061 JESSICA 112-15-08063 RUMINY MANURUNG 112-15-08451 TRY SUNANDA FATHANAH -112-15-08779 AYU NINDYA VABIN N 112-15-09402 KHUSUMA HALIM 112-15-09555 WILLIAM SAMIN 112-15-09764 PARTOGI PANDIANGAN 112-15-09838 RICHARD 112-15-10365 PATRICIA KAMAJAYA 112-15-10467 KATHERINE JAPARDY 112-15-11418 YOLANDA SIHOMBING 112-15-11818 ESTER SONIA J M 112-15-12066 JOULE SIREGAR 112-15-12460 NOVIA W 112-15-13592 MONICA ALYSIA 112-17-05824 ADRIAL MUHAMMAD A 112-17-06426 FITRI WULANDARI 112-19-03098 ERIC WYNALDA BIDIKMISI 112-30-04037 RONALDO IMMANUEL L 112-30-07356 EUNIKE OKTARIA 112-46-07722 ALDO LOUIS 312-14-00980 CHRISTINE ANGELA 312-14-05358 IBNU HADI RAMDHANI 312-14-05992 JEFRYNDO ENDIMER S 312-15-02233 RAYMOND HALIM 312-15-06541 MONICA TIRESNA LUBIS 312-15-06752 KHALIMAH LUBIS 312-15-09644 REBECCA RULIA N 312-15-10062 ROGER V MANURUNG 312-15-11310 R. A. DYAH ELLNE R 312-15-11613 KRISTOP TUMANGGOR -


112-19-04079 DIAH PUSPITA SARI 112-34-07680 RUMAISHA AFIFATUL H 312-14-00934 CUT SYARAH IMANDA 312-14-01204 FITRIANI MATONDANG 312-14-04028 SEPTRIANI HELDA R 312-15-00424 NAOMI C.PANGARIBUAN 312-15-03137 LIDYA R D 312-15-03771 NUR ASLAM SAKINAH 312-15-03791 MELDA AGNES 312-15-07593 SURTIKA BONDAR BIDIKMISI 312-15-08479 YOLANDA SYMARETHA C 312-15-09957 AGUS MINDIAWATI HRP -

EKONOMI PEMBANGUNAN 212-14-00282 RANI ERANICA 212-14-03470 PUSPA INDAH SARI 212-14-04059 AUGUSTO R PANJAITAN 212-14-04223 M. TEGUH PRANADA 212-14-04692 HARI YONO DAMANIK 212-15-00983 WILDA NANDA PRATIWI 212-15-01167 DANIEL M SIMAMORA 212-15-01305 ADRIAN HAWARI 212-15-01697 SRI AVESENA 212-15-01829 TIARMA SIALLAGAN 212-15-03470 ADE DWI PUTRI S 212-15-03808 DAVID SAHPUTRA S 212-15-03864 ANDITYA 212-15-03884 HELMAINI SINAGA 212-15-04036 JONESI A S 212-15-04045 ASWIN PERMADI HRP 212-15-04096 DICKY K SIMANULLANG 212-15-04158 MUHAMMAD ALI NST 212-15-04460 WIDYA SARTIKA HSB 212-15-04557 ELVI EVITASARI 212-15-04896 RIDHO REIHAN GINTING 212-15-04995 DENNIS ANDERSEN H 212-15-05362 RIFWAN FAHDDILA 212-15-05582 DESI LUSIANA TAMBUN 212-15-05891 AMAR MA RUF 212-15-05954 NATALIA SIPAHUTAR 212-15-06267 CITRA LUTFIANA M 212-15-06287 PESTA B RAJA S 212-15-06398 ANDI HARDIANSYAH 212-15-06586 LAMHOT SINAGA 212-15-07023 WINDA GEA 212-15-07033 FITRI MARPAUNG 212-15-07415 JOSEP JULIANTO M 212-15-07763 ADE PRATAMA 212-15-08487 DESY SYAHRENI HSB 212-15-08620 SANDRO LEYANDI G 212-15-09352 THALITA EKA KHARISMA 212-17-08899 VARADILA OKAYANDA 212-17-10359 AYU RAHMADANI BIDIKMISI 212-19-07420 DEBORA BR SILABAN 212-25-01841 SAUT PANDIANGAN 212-30-15020 NOVERTA AZELIA 212-30-24468 AYU LAURA 212-33-60186 LINA SURYA NINGSIH S 212-34-00035 M. FACHMI AULIA 312-11-21086 HILYAH FILZAH 312-14-02694 PRISKA M. SITORUS 312-14-03249 SURYA BRATA P 312-14-03266 SALOMO BRILLIANT H 312-14-03703 MATEUS PUTRA DINATA 312-14-04473 CINDY ARIESTA 312-14-06021 STELLA 312-15-00065 DWITA MONICA PUTRI 312-15-00169 BIRGITA RISULYNA 312-15-00675 ROHANI M SIBURIAN 312-15-01090 JUL SARIF 312-15-01870 ARYO AFIEF PALEGO 312-15-02352 ESRA SHINTIA D P 312-15-02357 VIVI SARAGIH 312-15-02368 RICKY ISHA K PURBA 312-15-02451 DIAN VIANY A 312-15-02711 ISABELLA SAGALA 312-15-03185 SUCI MONICA SINAGA 312-15-03353 RANGGA TRY PUTRA 312-15-03695 PEBRIANI BARUS 312-15-03908 IRAWATY AT 312-15-04354 YANTI A PURBA 312-15-04506 SITI HARIYATI 312-15-04726 SIGIT DIAN S.S 312-15-05154 RIZKI AMALIA T 312-15-05451 DEWI RATNA SARI S 312-15-05861 IRA LUJIANTI P 312-15-06158 JANSEN PASARIBU 312-15-06314 ROBET F J 312-15-06390 GINA DAMAYANTI B 312-15-06915 WIDURI ANNISYA PUTRI 312-15-06995 TENGKU ZAHARA W P 312-15-07296 ASNIAR 312-15-07677 LASMI S SIDABUTAR 312-15-07864 INDRIANI BR GINTING 312-15-08019 YUANDITA C C P 312-15-08076 KEVIN JEREMIA BANGUN 312-15-08163 TRECY KARTIKA 312-15-08580 DENISA ZAHARA 312-15-08635 EDO BILLY A TURNIP 312-15-08710 DEVI NASRIANI P 312-15-08867 ACKORY NATALIA MALAU 312-15-09236 TITO J D 312-15-09452 WARID FADHILLAH 312-15-10929 KANTARI ADZHANI 312-15-10963 ELISABETH MANURUNG 312-15-10994 PUTRI G BATUBARA 312-15-11192 IMMANUEL M SIREGAR 312-17-05108 DERI MARSAL 312-30-04599 MAY IRTIA SILALAHI -

ETNO MUSIKOLOGI 212-14-00697 LAWRENCE DA VARGA S 212-14-01339 TETI N SARI P 212-14-01567 BRAMA HUTAURUK 212-14-02697 M.RIVAI BAIQUNI 212-14-02824 MARIO YOSUA SINAGA 212-14-03767 ANDI MUHAMMAD AKBAR 212-14-05744 LUSIANA AMELIA BIDIKMISI 212-14-07558 FRIZTIAN RICHARD 212-15-00612 IVO DOLLA S 212-15-00757 BAYU TETA 212-15-00816 DANIEL H M PARDOSI 212-15-01094 ARDI BRENA G 212-15-01098 WAHYU W PURBA 212-15-01478 METRAIKAN N LAOLI 212-15-02008 MHD.SAYUTI 212-15-02294 ERWIN SIJABAT 212-15-03001 ERWIN D SIMBOLON 212-15-03104 HERBET SITOMPUL 212-15-03163 GOPAS VALENTINO 212-15-03724 NEVO KABAN 212-15-06095 INTAN AMALIA TASYA BIDIKMISI 212-15-06805 YOSEPH 212-15-07253 YOSUA S MARBUN 212-15-07308 HAPPY MAJESTY WARUWU 212-15-07340 ERIK EMANUEL TARIGAN 212-15-07628 ADE PUTRA P PASARIBU 212-15-07765 JHON NEHEMIA TARIGAN 212-15-07998 INGGRID S.M HUTAURUK 212-15-08299 DANIEL SIHOMBING 212-15-08639 TIMOTIUS AGI 212-15-08837 RIKA SEPTIANI MANALU 212-15-08933 VERONIKA SITEPU 212-15-09094 NIKO FREDI GINTING 212-15-09480 YUSUF N. SILABAN 312-11-16443 MUHAMMAD ZULFIKAR BIDIKMISI 312-14-05775 BERNAD MANIK 312-15-03130 PARIS LIMBENG 312-15-03367 GOMGOM JEFRY SILABAN 312-15-04184 PAHALA PASARIBU 312-15-04197 TOM M.P BUTARBUTAR 312-15-04663 OLIVIA HUTAGALUNG 312-15-07632 HARTI E SILITONGA BIDIKMISI 312-15-08660 TENGKU YUDI GUNTARA 312-15-08695 ELSHA DERBIN N S 312-15-10402 MARIHOT H M PURBA 312-15-10576 DEMALA M SIAGIAN 312-15-10834 ROLIES L NAIBAHO 312-15-11618 HENDRA E SIHOMBING




312-15-11432 TREEDOSOH RITONGA 312-15-11457 MELIN M MANIHURUK 312-15-11684 OKY CRISTOVANI SBR 312-15-11942 COLBERT JAN MARTUANI 312-19-02262 BONITA ESTHER F S 312-19-05227 JEFRI PARULIAN NAING 312-21-02010 EVAN SATRYA BRATA -

ILMU HUKUM 212-11-10028 DANDY RIZHA FHONNA 212-11-10083 NUZUL HELMI 212-11-12165 ROBBY IRSAN DAMANIK 212-14-00164 ROMAULI PURBA 212-14-00230 BOBBY HANRIADY 212-14-00280 RIZKY ARJUNA 212-14-01545 IRA B LUMBANTOBING 212-14-02351 HINDRIANA R S H 212-14-03672 SYLVIA V SINUHAJI 212-14-04538 SULASTHREE SIHOMBING 212-14-04567 SURYADI UJUNG 212-14-04593 SUNARYO R PANJAITAN 212-14-05001 AHMAD GUNAWAN M 212-14-05494 ERTAMA O PURBA 212-14-06863 LAMHOTMAN C LIMBONG 212-15-00081 MAREINA VALERIE 212-15-00154 YUKA IRMA PUSPITA 212-15-00190 HADIAN CHOLIDIN HP 212-15-00302 JESSICA LYDIA M S 212-15-00337 YONGGI BENHARD MALAU 212-15-00364 ERIN YOHANA S 212-15-00380 JEFFRIANDY RIO L M 212-15-00533 VERIN ANGELINE 212-15-00620 MANUMPAK L SIDABUTAR 212-15-00650 ANTHONI APS 212-15-00664 BELLA T BANGUN 212-15-00728 ARIQ ABLISAR 212-15-00918 AIDIL HAMDI 212-15-00936 KEVIN 212-15-00955 DEDEK MADINA NOVA I 212-15-00990 PRISCILLA STEVANY 212-15-01056 AUZY ARIFIN H 212-15-01166 ESTA PUTRI S 212-15-01308 IRMA MELISA S 212-15-01408 DEARDO S C MUNTHE 212-15-01651 FURIANTI -

Hasil SNMPTN USU 2012

212-15-01657 FANNI DAMARA ARIF 212-15-01748 SRI ENDANG K SINAGA 212-15-01818 OLIVIA INTAN MARIA S 212-15-01835 SAMUEL H SILALAHI 212-15-01837 RAY BACHTIAN R 212-15-02142 RIZAL G BANJARNAHOR 212-15-02158 DEVINA KHUSUMA 212-15-02265 FREDRIK R G GIRSANG 212-15-02281 YOHANNES HALIM 212-15-02394 JOYIES S KARO SEKALI 212-15-02419 GLORIA C TOBING 212-15-02449 FRISKA NOVANY S 212-15-02615 YOSUA OPALDI BANGUN 212-15-02659 JUDITH T 212-15-02868 SARAH FANNY A 212-15-02870 RANGGI RAMADHAN 212-15-02999 GRASIA T I 212-15-03030 ANDRI PINDONTA T 212-15-03155 ANDY 212-15-03184 ELDBERT MARBUN 212-15-03198 RICKI BERMANA P 212-15-03238 RIZKI ADITYA AGITA 212-15-03333 THEREWENSYA TIOVANNY 212-15-03389 TOHAP M TAMBUNAN 212-15-03391 RHANTY JUSMADI 212-15-03481 SHERLY SARI REZEKI S 212-15-03533 FELICIA 212-15-03752 DEBORAH 212-15-03792 MALIDYANI 212-15-03811 ABDIMAN 212-15-03886 WIDO B G SIHOMBING 212-15-03940 LESLEY 212-15-03949 INDAH T SARAGIH 212-15-03950 ANNISYAH 212-15-04051 KEVIN VAN SAMDOS S 212-15-04152 M. SIDIQ ERLANGGA 212-15-04261 MHD.SYAHPUTRA NST 212-15-04468 DELIMA ROITO P 212-15-04592 AMALIA IWANINA LUBIS 212-15-04672 RIYO WANTA GINTING 212-15-04740 RIZKI DWI PUTRA SRG 212-15-04802 RONI YAHYA MILALA 212-15-04919 APRINSYA PANJAITAN 212-15-05031 WAKIBOSRI SIHOMBING 212-15-05205 HENDRIK SIMBOLON 212-15-05245 DEISY C DUMAIS 212-15-05267 SIRILUS B V PURBA -

212-15-05274 DEDI ANSYAH PUTRA 212-15-05282 VANDI W H 212-15-05464 ANDI P S 212-15-05474 JIMMI WIJAYA 212-15-05481 PUTRI RUMONDANG S 212-15-05586 JANNES A S 212-15-05621 MORANDO A H S 212-15-05624 PARULIAN ANSTEIN H S 212-15-05629 IMMANUEL CARLOS Y 212-15-05848 RAPHITA IVONNE C 212-15-05910 PAMELA T TOGATOROP 212-15-06009 ROHANA Y DAMANIK 212-15-06019 YAHYA NAGORO GULTOM 212-15-06079 OCTRY VENY SIBARANI 212-15-06108 LINO F SIBARANI 212-15-06110 DEBORA SINTYA T 212-15-06160 YOSEPHINE I P 212-15-06172 MARIA TOBING 212-15-06280 VINAMYA AUDINA M 212-15-06338 MARDIANA SHANAZA 212-15-06420 FRANSISCA PAULINA 212-15-06588 STEVIA A T 212-15-06727 PRAWIRA KAMILA 212-15-06777 BEFRY SEMBIRING 212-15-06837 DORA V TAMBUNAN 212-15-06868 ARGA H. PASARIBU 212-15-06909 ZHENDA VINCENT MANIK 212-15-06931 JUNELPRI SARAGIH 212-15-07039 ALVIN 212-15-07044 RAJA R R S SIAHAAN 212-15-07135 DAMECSON SAGALA 212-15-07186 HARDY KUSUMA 212-15-07371 DOUGLAS HARD T 212-15-07410 SAMSWARDI SIHOTANG 212-15-07554 WILSON WIJAYA 212-15-07635 YOHANA DEVIKA GULTOM 212-15-07747 RICHI SIBAGARIANG 212-15-07884 BEBY FITRIA R 212-15-08051 ANDREAS AFUL.R.S 212-15-08255 SAIDIBOT P 212-15-08259 REZA PEPAYOSA 212-15-08344 VELIKA MUSTIKA 212-15-08463 FAJAR TRIAWAN 212-15-08518 ANDRAYANI SIDABUTAR 212-15-08699 PARADE SIDAURUK 212-15-08817 DICKY ARISANDI 212-15-08888 REGINA TOBING -

212-15-08898 SITI RACHWINA APRIZA 212-15-09130 SAHATA H MANURUNG 212-15-09703 DANIEL SILALAHI 212-15-09744 NURUL FATIMAH 212-15-09833 ANDERSON 212-15-09844 PUTRI J SIHOMBING 212-17-06545 RIFKI MUHAMAD ALQAF 212-19-00822 ARYA MULATUA 212-19-00825 M RIZKI MAHYUZAR 212-19-03244 GOKLAS SILALAHI 212-19-05868 ANGGARA FAISAL 212-19-06029 ADYMAY SIMANJUNTAK 212-23-00907 SISSY C AMBARITA 212-30-06144 WILLIAM RIYANDI 212-30-06925 MARDONGAN 212-30-08182 MEILINDA THERESIA 212-30-10821 TOMMY ARY S 212-30-10847 DIMAS SIDABAGAS S 212-30-12548 SYARIFAH MEUTIA.Z 212-30-12580 MAHARANY FITRI 212-30-13957 SARDORAJA SPASRU 212-30-14142 NANDA P. NABABAN 212-30-14316 HERU T.J SINAGA 212-30-14663 DOSDO JUAN MATIUS AN 212-30-17640 FEBRIAN 212-30-18124 PRATAMI AJENIA 212-30-18853 MUHAMMAD ARIEF 212-30-20849 SANDRA S APRILIA 212-30-21507 MARIA KRISTINA S 212-33-12352 YESSICA VALERINA S 212-34-02483 ESRA MAILANY SINAGA 212-38-11278 LAMHOT RITCARD A.T 212-38-21201 RUTH NELTA TAMBUNAN 212-46-09912 SORNICA ESTER LILY 312-11-10737 ASRA SAPUTRA 312-11-17264 AKBAR VELAYATI 312-14-00296 FINNA P SIREGAR 312-14-00459 ADILLAH RAHMAN 312-14-01062 BINSAR IMMANUEL S 312-14-02512 PUTRI RAMADHANI 312-14-02793 ARINI SULASTIWI 312-14-02946 DINA FADILLA 312-14-03325 JODIE IVAN RANDY 312-14-03497 M SYARIF HIDAYAT 312-14-03557 ANDI PEBRI 312-14-04347 DIKKI S 312-14-04587 RIZKA ARFITA -

Naomi Watts Perankan Lady Diana

Naomi Watts berperan sebagai Putri Diana dalam film berjudul Diana/rtr Perusahaan pembuat film Ecosse merilis foto Naomi Watts memerankan Lady Di dalam dalam film biografi berjudul Diana. Ecosse menyatakan dalam sebuah pernyataan film itu akan menjadi potret menarik dari Putri Diana selama dua tahun terakhir masa hidupnya. “Film itu memperlihatkan bahwa menemukan kebahagiaan sejati membuatnya mencapai kesuksesan. Ia berevolusi menjadi juru kampanye internasional dalam bidang kemanusiaan,” kata Ecosse dalam pernyataan. Spekulasi berkembang di media bahwa film itu bercerita kehidupan cinta Diana yang menyebabkan kecelakaan mobil di Paris tahun 1997, saat ia berusia 36 tahun. Menunggapi isu tersebut, Direktur Ecosse Robert Bernstein dan Douglas Raid mengatakan “Kami bermaksud membuat kajian yang benarbenar mendalam dan penuh kasih sayang tentang tahun-tahun terakhir Diana.” Sutradara asal Jerman, Oliver Hirschbiegel akan menggarap film yang semula akan diberi judul Caught In Flight. Oliver adalah nomine Oscar untuk film tentang Hitler berjudul “Downfall”. Diana akan memulai pengambilan gambar pekan ini, namun kapan film tersebut akan rilis belum diumumkan, seperti ditulis Reuters.(ant)

312-14-04761 ERWIN SIMBOLON 312-14-04842 JEREMIA SIPAHUTAR 312-14-04877 FRENGKY ARIANTO S 312-14-04889 RAFLY TIMOTHY S 312-14-05537 AWANIS 312-15-00370 FRANS WARDANA 312-15-00847 IQBAL FAUZAN 312-15-00869 NATALIA TAMPUBOLON 312-15-00888 NOVITA M A 312-15-00944 DWI BUNGA A S 312-15-01179 RIO ELFRADO H 312-15-01348 ALFIAN SYAHRI 312-15-01382 JANI I S SIDABUTAR 312-15-01401 MISSI P. SILALAHI 312-15-01417 SYAIFUL T H SIBURIAN 312-15-01445 ATIKA LUTHFIANI IFAN 312-15-01555 REINHARD R I SIDABAL 312-15-01582 LINTON HANS PRATAMA 312-15-01794 STEVEN SAMUEL M 312-15-01806 VANIE D. SIMAMORA 312-15-01905 TRI OKTOBER SINAGA 312-15-01906 EVI P Y SIBATUARA 312-15-01909 MAZMUR FERDINANDTA S 312-15-02019 RAJA FURQAN DIALEJA 312-15-02137 DYNA MINDAUGHTER S 312-15-02187 WILLIAM HUTABARAT 312-15-02267 MONICA RIA HUTABARAT 312-15-02271 IRHAMNA LUBIS 312-15-02290 CLINTON PRATAMA 312-15-02301 THERESIA G C S 312-15-02373 DEWI AULIA ASVINA 312-15-02427 ELGINA ANATASIA T 312-15-02469 ANDREANY PAOLA M.S 312-15-02488 BOY RIZKY TUMANGGOR 312-15-02545 VANIA CHANDRA 312-15-02899 BONA JOP CHRISTIAN 312-15-03030 KRISTIN JONES 312-15-03058 JANIEL J SITOMPUL 312-15-03182 RIKA AMBARITA 312-15-03539 YEREMIA PONOMBAN 312-15-03558 SYLVIA NATALIA P 312-15-03665 SONYA EVALIN S 312-15-03815 AMRUL MULIA DAULAY -

312-15-03914 JUANGGA SAPUTRA D 312-15-04520 PAUL Y.A.K. HUTAPEA 312-15-04557 ENIM P P M 312-15-04599 SATRIA LUTHFI 312-15-04621 MARGARETHA ALDILA F 312-15-04645 TENGKU IRNA CHAIRIA 312-15-04885 SABAN HUTAGAOL 312-15-04990 IRENE F P NAIBAHO 312-15-05025 MUHAMMAD FADLI 312-15-05250 YESSI GRENIA B 312-15-05833 DITA LESTARI 312-15-05957 INTAN ANDINI PUTRI 312-15-05999 ROBERTO B SITUMORANG 312-15-06006 JOSUA P L 312-15-06146 JESICA RULINA 312-15-06305 HILLARY NIASSY GULO 312-15-06306 NATHASYA C B 312-15-06346 PUTRI SEPTIKA S 312-15-06441 VERONICA JULITA S 312-15-06462 JULIAN LEONARDO M 312-15-06481 IRAYATA BR GURUSINGA 312-15-06546 RENI HARDIANTI T 312-15-06554 LARA TISA OKTASIA 312-15-06670 TAHI BERDIKARIS 312-15-06862 RIA RUMATA S 312-15-06866 TAMADO DONMES 312-15-07055 HARRY N 312-15-07157 ANDRYS SILALAHI 312-15-07329 PUTRI KHAIRANI 312-15-07382 JOSSEVALT A HALAWA 312-15-07404 RIZKI DWI PRASETYO 312-15-07429 BETRIC Y 312-15-07555 ATIKA S. SIMARMATA 312-15-07563 ESTER JP HUTAGAOL 312-15-07652 M RONNY MELIALA 312-15-07663 AISYAH N P SIDABALOK 312-15-07734 RICKY SIAHAAN 312-15-07953 RIZKI FAJAR BAHARI 312-15-08122 KURNIA RAMADHAN S 312-15-08154 TRI BOSCO IGNATIUS M 312-15-08183 HASWIN A SARAGIH 312-15-08273 EFRAIM SIHOMBING 312-15-08374 SAMUEL PEBRIANTO M -

WASPADA Sabtu 7 Juli 2012

312-15-08429 YARA OLIVIA 312-15-08445 MHD FACHRURROZI 312-15-08781 TERESIA PAKPAHAN 312-15-09036 PUTRI INDRA KHAIRUL 312-15-09086 JOHANNES SUPREDO S R 312-15-09245 MELVA JULITA S 312-15-09296 MEISURA D GIRSANG 312-15-09577 RUMONDANG SIAGIAN 312-15-09604 TRI SEPTA P PURBA 312-15-09708 LAMHOT D SAGALA 312-15-09763 YOLA ESKA AFRINA S 312-15-09782 EKA SARIATI SIBURIAN 312-15-09784 ERNITA AFRILIANY HRP 312-15-09813 RAPHITA SIBUEA 312-15-09818 GARY ANDRE SIDABUTAR 312-15-09924 RISKA RINA R.KALOKO 31215-10083 PASKAH M A PASARIBU 312-15-10099 MENTARI S REMBULAN 312-15-10447 BETTITERESYA 312-15-10635 IWAN J 312-15-10693 YERSA UMAR HASIBUAN 312-15-10848 NANDA YOLANDARI 312-15-10887 RACHEL H 312-15-11008 TANTRA KHAIRUL RIZAL 312-15-11244 BAMBANG GUNAWAN 312-15-11261 EVA C PARDEDE 312-15-11287 ASMAUL HUSNA 312-15-11460 JOHANNES LEO P S 312-15-11477 TRI ANDI SAHPUTRA 312-15-11686 GLEND FELIX 312-15-11702 RISWAN E HABEAHAN 312-15-11706 VYVIAN SIAGIAN 312-15-11783 RANDI ARI ARMADI 312-15-11807 FRANS B S SIAGIAN 2312-15-11818 WENNY OCTAVIANI M 2312-19-02723 ANDRY AGASI SITOHANG 2312-19-06528 IHSAN 312-23-05057 MARIYANI 312-30-06015 ANGGIS TIANA BR. SIT 312-33-20627 FEBRIYANI HELENA 312-33-21066 THERESIA RIZKA U S 312-34-00927 DANIEL SIAGIAN 312-34-03785 HABIBI KURNIAWAN 312-38-20844 PARULIAN SCOTT L T -

Erykah Badu Kecewa Video Klip Barunya Erykah Badu marah dengan Wayne Coyne dari Flaming Lips. Pasalnya, Badu bekerjasama dengan Coyne dalam merilis track baru mereka The First Time Ever I Saw Your Face. Melalui situs jejaring sosial Twitter penyanyi kulit hitam itu menumpahkan kekecewaannya pada Coyne ketika melihat perilisan video musiknya yang disebutnya sebagai video musik seronok menonjolkan Badu nyaris bugil. “Saya merasa sangat kecewa karena video klip itu tidak memiliki konsep dan motivasi. Klip menyuguhkan selera rendah dan tidak berarti”, ujarnya. Menurutnya, Coyne melakukan sesuatu yang salah. Awalnya ia mengajukan kepada saya konsep menarik untuk membuat video klip yang baik dan bermutu. Saya percaya itu, tapi rupanya saya salah memilih teman berkolaborasi, tuturnya lagi dengan nada kesal. Erykah menyebutkan, Coyne merilis video dalam versi tidak sesuai dengan keinginan saya. Ia tidak mengedit klip itu dan membuat tayangan tidak berguna. Sebelumnya Saya juga sudah mengajukan konsep klip lebih baik, namun Coyne berkilah ia memiliki sesuatu yang lebih baik lagi dari konsep yang saya miliki” ujar Badu kesal. Sementara Coyne tidak begitu reaktif menanggapi pernyataan Badu. Penyanyi itu tampak lebih tenang dan tidak emosi melihat reaksi Badu yang begitu marah terhadapnya. Coyne mengatakan ia tidak bermaksud apa-apa dengan pembuatan video itu. Semua menurutnya adalah kerja seni. ‘Rasanya saya sudah melakukan hal terbaik untuk membuat video musik itu”, katanya membela diri. Semua menurut saya adalah kerja seni yang tidak menonjolkan selera rendah. Saya merekayasa klip sesuai tema lagu The First Time I Ever Saw Your Face. Namun konsep saya rupanya tidak cocok dengan Badu. Sebelum klip dirilis saya berusaha mengedit kembali video agar sesuai dengan versi keinginan Badu, ujar Erykah Badu/ Coyne. Nur/thr

Hasil SNMPTN Unimed 2012

WASPADA Sabtu 7 Juli 2012

PENDIDIKAN MATEMATIKA 112-14-00512 112-14-00808 112-14-01060 112-14-01457 112-14-01652 112-14-01745 112-14-01788 112-14-01819 112-14-01868 112-14-02183 112-14-02228 112-14-02336 112-14-02545 112-14-02568 112-14-02645 112-14-02685 112-14-02755 112-14-02919 112-14-03288 112-14-03356 112-14-03371 112-14-03386 112-14-03505

NUR AZHARI HENDRIKSON PANJAITAN PANJI SAPTO SETYO DWI YAN MULATUA T ROMAITO SILALAHI SANFRISKA BR SITEPU RICHARD A P KHAIRUNNISA L. GAOL INDAH HARTATY TAMBA ARIFIN AZHARI HRP NOVI RYANTI SIAHAAN FRANS JUNI SUSANTO SATOTO GELAR SYUHADA JUNIAR GINTING RIA DZULFYANI AULIYA RAHMA LOLA VERONICA R H LEVANA HUTAGALUNG OLYVIA DESI TURNIP FAUZIAH NUR YULI H R SIDAURUK CHENLY MALAU DAUD R SIMANGUNSONG 112-14-03650 IRMA SINTIA DEWI 112-14-03716 SHINTA BELLA 112-14-03737 NOVIYENTY 112-14-03757 MARIANI MANIK 112-14-04390 SRI MILAWARNI TBN 112-15-01205 OVRYENNI P 112-15-01900 YUSUF C SIBURIAN 112-15-02738 DEDY APRIYADI G 112-15-03148 FADHLAN ALMURTADHO 112-15-03797 HERMANTO WARUWU 112-15-03957 DOKSEN SINURAT 112-15-04005 BANILAMEYWATI ` MARBUN 112-15-04059 RIZKY IKHWAN PERMANA 112-15-04333 IRAWATI 112-15-04554 ROY A P MANALU 112-15-04962 M RAHMATSYAH PUTRA 112-15-05007 PUTRI ISMILA A 112-15-05155 WULANDARI 112-15-05612 RISKI A S L MELAYU 112-15-05636 JAEN ERNIST 112-15-06392 KHAIRUL SIPAHUTAR 112-15-07619 MARIA C S 112-15-07731 AGNES AGUSTINA PURBA 112-15-08490 ROSA I N S 112-15-08998 NIRMAY S 112-15-09278 THEVRAN RUMAPEA 112-15-09803 YESSIKA PTAMBUNAN 112-15-09850 NURUL MAWADDAH 112-15-10090 BONI J. SINMBELA 112-15-11820 ELISA SINAGA 112-15-11841 PUTRI AYU SUCIATI 112-15-11893 SARIPA S 112-15-12213 TIMBUL PANJAITAN 112-15-13327 ARIYANTO 112-30-06748 DIAMONY SRI HANA S 112-30-13307 FEBRI YANTI 112-33-60016 SHINDYYUNN SINAGA 312-14-00708 WENNY ULIANDARI Y 312-14-02027 DEWI ANGGRAINI 312-14-03955 PHILIPS S 312-14-04150 KHAIRUN NISWAH 312-14-04237 MAISYA FITRI SIREGAR 312-14-04274 ADVENTRI C.P 312-14-04757 NAJAMUDDIN P SITOPU 312-14-05101 EFRILIANA 312-14-05135 GUNAWAN 312-14-05682 RIZKIA APRILIA UTAMI 312-15-00990 MEY LINDA SARAGIH 312-15-01235 AIDA SYAHFITRI 312-15-02952 INGGRI ADRIYATI 312-15-03832 MEYDAYANTI BR SITEPU 312-15-06221 IRMA SURYANI NST 312-15-06720 YUSRINA A B 312-15-07530 YULITARIA MARSELINA 312-15-07853 MUTIARA A NAIBAHO 312-15-08192 ELSI ABRI SARTIKA 312-15-08756 RIKARDO H 312-15-08819 HOTDITA P T 312-15-09790 ABDURRAHMAN 312-15-11227 RICHAN S 312-17-04515 SURTIANI 312-38-20700 EVA KARTIKA PENDIDIKAN BIOLOGI 112-14-00108 ROMASI GULTOM 112-14-00157 KHAIRUN NISA 112-14-00167 DIMAS NS 112-14-00285 RAHMAD H GULTOM 112-14-00305 RUTH NABABAN 112-14-00353 PUTRI HANDAYANI 112-14-00980 TUTI WARDANI BAKO 112-14-01064 ASNI SIBURIAN 112-14-01247 SHANTI 112-14-01584 DELA SAKINAH HARAHAP 112-14-01635 MERLIN P SIDABUTAR 112-14-02015 LAMHOT J.M. SIAGIAN 112-14-02165 JAFAR SIDDIK 112-14-02358 CHERYL G P R 112-14-02490 DINI ARLIZA LUBIS 112-14-02503 NUR AINUN 112-14-02557 NURBAITI SARINGIN 112-14-02614 CITRA REZKI KUSUMA 112-14-02634 SITI RAHMADANI HRP 112-14-02798 DURRIYAH 112-14-02849 ARNY PURBA 112-14-03046 MEYANTI S RUMAHORBO 112-14-03272 RICKY MAROJAHAN MLLG 112-14-03441 RIKA DIANA SARI 112-14-03624 EKA LESTARI KALOKO 112-14-03778 ARISAMALA L TOBING 112-14-04001 INDAH WIDIA A HSB 112-14-04106 WENDY PUTRA P 112-14-04319 IVAN F 112-14-04364 DWI SEKARINI 112-14-04689 ANNISA F.A 112-15-00152 DEVI FITRI ANGGRAENI 112-15-00931 LOLA VISTA F SINAGA 112-15-01516 SALMON SILALAHI 112-15-01542 DOSMA MARBUN 112-15-01558 WATI P SIAHAAN 112-15-01905 SUCI ANGGRAENI 112-15-02183 NOVITA D BR SIJABAT 112-15-02797 REHULINA BARUS 112-15-03091 ODI Y 112-15-03197 CORRY SEPVIA 112-15-03588 DEBBY OKTOBERLIANA S 112-15-03777 RIANA R SILALAHI 112-15-04420 LUCIA DAME U A LUBIS 112-15-05111 TAWARIA ANASARI BR B 112-15-05553 FRISKAY.TUMANGGER 112-15-05604 NOVITA E SIMANJUNTAK 112-15-05815 TIODORA G 112-15-06118 DONI DESMON SIRAIT 112-15-07164 YOHANA N S 112-15-07947 LISCA EIRENE SARAGIH 112-15-08116 ANNISA FADILAH TRG 112-15-08126 RENY M BR PANJAITAN 112-15-08181 HENI DESI SINAGA 112-15-08200 EVI H. J 112-15-09358 HENDRA FERDINAN S 112-15-09625 DEWI.I.T 112-15-09648 NISRINA SETIOWATI 112-15-10828 ADELYA I. MANALU 112-15-11343 KRISTIAN GINTING 112-15-11583 NEILY MAULIDA ULFA 112-15-11696 SAUDUR BERUTU 112-15-11772 HARNITA SIHOTANG 112-15-11825 PARINDUAN TAMBUNAN 112-15-11852 WILLYA M.K SIHOTANG 112-15-11949 KHARINA AREEISTY 112-15-12050 SEPTA SOPIANA 112-15-12296 MARIANA L. PAKPAHAN 112-15-13391 MARDIYANTI GAJA 112-17-03568 M.TASNIM 112-17-10033 ISMA TRINADYA RKT 312-14-00037 ANNISA 312-14-00548 HUSNIFA HASIBUAN 312-14-00915 SUHARYANISA 312-14-01453 WAHDER K SIMANULLANG 312-14-01525 CHAIRUNNISA 312-14-01555 LANNI FEBRIANI 312-14-01848 DEBORA BEATRIX S 312-14-02109 MEILAN ISNI SIREGAR 312-14-02545 IVAN S HASIBUAN 312-14-03877 ADVEND SIANTURI 312-14-04505 IRMA HIDAYATI

312-14-05102 312-14-06261 312-15-01935 312-15-02155 312-15-02252 312-15-03196 312-15-03633 312-15-05124 312-15-07072 312-15-07379 312-15-07833 312-15-08525 312-15-09109 312-15-09565 312-15-09967 312-15-10365 312-15-11175 312-19-04829


PENDIDIKAN FISIKA 112-14-00125 LINI ERYA SEMBIRING 112-14-00162 SARTIKA SILABAN 112-14-00185 VERONIKA SINAGA 112-14-00423 SITTY SUGMA ALDILA 112-14-00568 ALEKSANDER SIHOTANG 112-14-01112 DERLIN LUMBANTORUAN 112-14-01130 MASRIDA GULTOM 112-14-01165 HOTDI D SAMOSIR 112-14-01261 MUDA HARTINI SITORUS 112-14-01514 PUTRI SRIJAYANTI 112-14-01715 RAHIMAH ULFAH A.Z 112-14-01747 ERNILA SIRINGO RINGO 112-14-02167 ELIZA HARIYANTI 112-14-02705 RISMA S WIJAYA 112-14-02991 YUNI THERESIA KARO 112-14-03117 NURUL HUSNA 112-14-03184 ABDUL RAUF A S 112-14-03216 ZULVIANA O SARAGI 112-14-03375 DAVID PATAR MANURUNG 112-14-03636 MONIKA MOLINTA S 112-14-03674 RUHAINI HAMIDAH 112-14-03873 SULIS TYANINGSIH 112-15-00038 RIO CHAPWELL SINAGA 112-15-00718 NURUL HIDAYAH P 112-15-01065 AZHARI PARDOMUAN H 112-15-01234 SRI NOVITA 112-15-01896 ROY FERDI SIALLAGAN 112-15-02795 SITI ANNISA 112-15-03632 EVANI DOANA NABABAN 112-15-04030 NAIMAH HASANAH 112-15-04396 YEMIMA PURBA 112-15-04714 AIDA FITRI NST 112-15-05416 PRETTY SILABAN 112-15-07463 YUNIANTI P 112-15-07881 PUTRI M S 112-15-08302 RIKA UTAMI 112-15-08461 VICTORYA R E P 112-15-09054 VIVI NAINGGOLAN 112-15-09377 WILVAN MANALU 112-15-09388 YUDHISTIRA 112-15-09563 WALVENMARS 112-15-09704 NICO BERLINSON 112-15-09864 EKA PANJAITAN 112-15-09916 WINRO S 112-15-10344 NINGSIH E.R SIDAURUK 112-15-10683 METHARY ROSALINA 112-15-11144 GINDO DABUNGKE 112-15-11425 JENNI PUSPITA 112-15-11850 RAHMA KHAIRANI UTRI 112-15-12939 JOYS PRIMA P 112-15-13093 FEBRIN ADI PUTRA S 112-17-01271 FRANSISKA URHAYATI 112-30-09938 ALDO KALIAGA GINTING 312-14-00474 ROSIQOH 312-14-00713 GUNAWAN 312-14-01117 LIBRI SINAGA 312-14-01468 JESIKA NGALEMISA 312-14-01666 MARIA M. SILABAN 312-14-01857 UTAMI PUTRI 312-14-02328 AWAL MULIA REJEKIT 312-14-02991 PUTRI 312-14-03018 JULI BRIANA 312-14-03330 EUODIA SILAEN 312-14-03548 TAUFAN S. S. ZEBUA 312-14-03565 CHRIST I H 312-14-03682 RIZKY ULFA UMAIYAH 312-14-04118 RETNO UTAMI 312-14-04157 HIKMATUL WASILAH MRP 312-14-04232 JOYAKIN A.SITUMORANG 312-14-04239 PRATIWI NATASYA 312-14-04326 M. RIVAI 312-14-04571 WITA S PARDEDE 312-14-04734 SEFTIA AGAFE BR B 312-14-05304 MIRANTI INDRI H 312-14-05621 NAOMI NATASA SITORUS 312-14-05758 ROBINSAR 312-14-05947 EIRIN SIMANJUNTAK 312-15-00020 REKINA NATALIA 312-15-02387 CIHUR B K U 312-15-03307 PERES HANDERSON T 312-15-03486 HAMONANGAN B 312-15-06895 DIAN PURNAMASARI 312-15-07509 RANI NURZAINI HRP 312-15-07743 MEITA LILIS SITOMPUL 312-15-08458 RIZKI FADILAH 312-15-11281 FALDO RENATA HIA 312-15-11336 THERESIA M. MANIK 312-17-12142 RAHMAD ANDRIKO 312-19-04384 SARANA RIA GP PENDIDIKAN KIMIA 112-14-00053 MARLIANA FITRI 112-14-00296 MELIANA SIBARANI 112-14-00571 MEI Y SILITONGA 112-14-00613 RAFIKA HANNUM 112-14-00687 ARIA DARMAWAN 112-14-00971 JUWITA AYU MS 112-14-01683 NOVIA F D SILALAHI 112-14-01905 MUHAMMAD ILHAM 112-14-01958 RIAN RAHMANSYAH 112-14-02301 SITI KHOLILAH HSB 112-14-02461 SULASTRI PANDIANGAN 112-14-02683 DINA TRI AGUSTINI 112-14-02746 DWI ENDAH LARASATI 112-14-02890 FANNY NOVIYANTI 112-14-02932 ITA FRIMANTI S 112-14-03224 MARIANA MAGDALENA 112-14-03238 FEBRIANTO MANIK 112-14-03369 ARIF WARDIMAN LASE 112-14-03425 NANDA APRITA Y 112-14-03433 IBRANI ANTONY ARUAN 112-14-03573 HELMI FAUZIAH NST 112-14-03576 SETIA D 112-14-03611 NOVIARTA RAFIQAH P 112-14-03615 INDRA KAWASAN 112-14-03768 PUTRI LIANI PASARIBU 112-14-03772 RINNA AYU AFRIANI 112-14-03989 DERIN PUTRI S 112-14-04009 SRI J MANIHURUK 112-14-04072 JUDIKA S D L 112-14-04166 RINI YULIA SAMOSIR 112-14-04354 JOHANNES SORMIN 112-14-04595 IVANA MARGARETTA 112-14-04603 EVI RIANA S 112-15-00292 DINDA AMALIANDA 112-15-00697 M DINI EKA FAHMI 112-15-01449 TIARA DEWI SIBARANI 112-15-01866 DANIEL JAYAPUTRA S 112-15-02269 DEVI RATNA SARI 112-15-02495 SITI WULAN DARI 112-15-02558 FITIRANI NADAPDAP 112-15-02607 DESNANTA NATANAEL 112-15-03495 DEVI LESTARI 112-15-03952 MAULIDINI HARAHAP 112-15-04281 DWI APRYANDA 112-15-04590 DINI OKTAVIANTI 112-15-05061 RAJOKI OKTAVIANUS 112-15-05339 LAILA MAJNUN H 112-15-06142 YOANA SITUMORANG P 112-15-06229 RAFIDAH ALMIRA S 112-15-06418 DIAH AYU NINGRUM 112-15-06666 ANGGITA PURNAMA A 112-15-06885 MARTA SINAGA 112-15-07203 ERIKSON C L SIANTURI 112-15-07751 EGIA PUTRI KARINA S 112-15-08338 NOBELIA L M SIREGAR 112-15-09375 FEBIANA WULANDARI 112-15-09482 PUTRI SUNDARI 112-15-09856 DESCEY 112-15-10036 SAEMA

112-15-10127 112-15-10359 112-15-11098 112-15-11156 112-15-11759 112-15-12560 112-15-13196 112-15-13450 112-17-01914 312-14-02940 312-14-03232 312-14-03753 312-14-04284 312-14-04917 312-14-05018 312-15-01893 312-15-04154 312-15-04404 312-15-04666 312-15-04789 312-15-04865 312-15-05741 312-15-06176 312-15-06698 312-15-08691 312-15-08744 312-15-08853 312-15-09018 312-15-09290 312-15-11533 312-17-10193


PENDIDIKANTEKNIK BANGUNAN 112-14-00015 FADRIAL KAMIL AZHARI 112-14-00032 IMAM FAUZI SIREGAR 112-14-01171 RIKI SILABAN 112-14-02198 CHANDRA SYAHPUTRA 112-14-02414 WIDI HARAWI RIZQI N 112-14-02441 BENNI RAHMAN SINAGA 112-14-02510 RADITYA SAMODRA Y. N 112-14-02915 T. AULIA RAMADHAN 112-14-02927 THAHARA PUTRI MULYA 112-14-02996 JHESICA C PURBA 112-14-03059 SANTA MONICA T 112-14-03325 FRANSISKUS I HALAWA 112-14-04037 LASTA MARIA PURBA 112-14-04182 JEPRI TAMBUNAN 112-14-04384 RIDHO R PAKPAHAN 112-14-04509 LAURENSIUS ODING 112-15-01036 SUHARDI TAMBUNAN 112-15-01442 AGUS PRATAMA 112-15-01733 WINSON JUNG 112-15-02175 FERNANDO BANCIN 112-15-04011 DARY MURTADHA 112-15-04234 RIAMA LUBIS 112-15-05483 NASRUL ALI SILALAHI 112-15-06255 DESY PUSPA RANI 112-15-06495 PALTI SIAHAAN 112-15-07626 DAVID H MANALU 112-15-08570 DANIEL PANJAITAN 112-15-08728 M EDI GUNAWAN 112-15-09533 JOGI RONNY T PARDEDE 112-15-13004 DORIS SIMATUPANG 312-14-00149 AFRIDA 312-14-00968 DANIEL JUNI HERIANTO 312-14-01793 YUNI ANDRIANI 312-14-02405 SRI ROHMANI 312-14-02438 HESEKIEL P. SARAGIH 312-14-02725 ANDIKA J SITOHANG 312-14-03274 PANDU PRATAMA SINAGA 312-14-04014 IRFAN PASCAL SIMANGU 312-14-04793 WINDAWINKY S MANALU 312-14-04867 TESSA PARAMITHA 312-14-05433 HARTON H.S. SIREGAR 312-14-05652 KEVIN DONARO M 312-14-06392 ZAINAL ARIFIN SRG 312-15-00133 FALDI BONARDO GULTOM 312-15-00820 ANATOLI KLAUSKISKI 312-15-01823 CUT MAESELA 312-15-02255 KAREL IMMANUEL G 312-15-02809 JUSUF MARIO SIRAIT 312-15-03986 RIZAL W H SINAGA 312-15-04941 DEDY SURYA EDWARD 312-15-05678 RIZQI RAMADHANI 312-17-12352 KHAVITA JUWITA PENDIDIKAN TEKNIK MESIN 112-14-01522 OKMINTA GINTING 112-14-01838 JOEL B SIALLAGAN 112-14-03483 REDIKSON SIMBOLON 112-14-03834 PEMUDA Z 112-14-03838 YOCKY SIANTURI 112-14-04108 DANIEL MANIK 112-14-04152 BANGUN E. TAMPUBOLON 112-14-04167 ADITYA M SARAGIH 112-14-04715 WEDO EKO PUTRA S 112-15-00579 NIEL ALPREDO PURBA 112-15-00982 DAVID ROMULO NAIBAHO 112-15-02992 SEVENTINO JEGESHI S 112-15-03436 SISWOYO 112-15-03554 YOPENDRI PINEM 112-15-03902 TRI ABDI MANJA SETIO 112-15-04083 JHOY AROHMAN 112-15-06480 MIA AUDINA SYAHFITRI 112-15-06543 ALEX CHANDRA BOY S 112-15-09421 DONI ARDI YUNUS 112-15-10942 JOSHUA INDRA 112-15-11061 RUDI HARYANTO S 112-15-11180 ROBET AFALDO PURBA 112-19-05752 YOSRIANDI 112-21-00708 RENOL MENRI SIREGAR 112-34-07335 SEPTIAN MAULANA 312-14-02010 FAWZY AHMAD HASIBUAN 312-14-03757 GOGO SYAHPUTRA S 312-14-04217 EKI KURNIAWAN 312-14-04475 PARNINGOTAN S 312-15-00124 JON M B SIRAIT 312-15-04470 WARDIJON SAGALA 312-15-07851 MIKHAEL SIMATUPANG 312-15-07945 MARGANDA MALAU 312-15-10509 DODI PRANATA S P PENDIDIKAN TEKNIK ELEKTRO 112-14-00655 RAJA DUPANWAHYUDI 112-14-00663 JEREMIAS.SOLIN 112-14-00801 JIRE APRILYO S 112-14-00927 MHD FAUZAN HAMID 112-14-02044 JOSEP JANUARIXON H P 112-14-02119 M.IBNU RUSDI ROKAN 112-14-02397 JAN F.SILALAHI 112-14-02400 AGUSTINUS A P S 112-14-02656 IRWAN R.S.TAMBUNAN 112-14-02909 DONNY TRISNA 112-14-02970 AZWAR PUTRA 112-14-03155 YOPI HANDOKO 112-14-03698 ANDILAUYOKO SIRAIT 112-14-03735 DONNI MARSON NABABAN 112-14-03943 NOVA RIZAYANTI NST 112-15-01585 MUHAMMAD ARYFIN 112-15-02097 SANDY ARMANDO 112-15-02221 LASRO P SIHITE 112-15-02753 RIKSON SIBARANI 112-15-02793 MARCELIUS GINTING 112-15-03104 CHANDRA HARDI MT 112-15-05195 SERI BULAN 112-15-06292 IRHAM HANIF 112-15-06472 HERBET PANGARIBUAN 112-15-06514 JEFRYANTO HUTAURUK 112-15-08162 AHMAD S 112-15-12830 MICHAEL GULTOM 112-15-12973 JUSPRIN TAMPUBOLON 112-15-13204 INRAJAYA HALOHO PENDIDIKAN TEKNIK ELEKTRO 112-17-05118 112-19-00522 112-33-60257 312-14-00461 312-14-02960 312-14-02961 312-14-03299 312-14-03641 312-14-05179 312-14-05229 312-14-06236 312-15-09892 312-15-11163 312-15-11738


312-21-01823 SUDARMO A E SIANTURI 312-27-02165 REINHARD HUTABARAT KIMIA 112-14-02099 112-14-02116 112-14-02555 112-14-03164 112-14-03800 112-14-04568 112-15-00114 112-15-00749 112-15-02034 112-15-03389 112-15-03522 112-15-03653 112-15-08636 112-15-08733 112-15-08979 112-15-09264 112-15-09564 112-15-09890 112-15-11225 112-15-12025 112-15-12995 112-15-13321 112-15-13401 112-19-00957 312-14-00640 312-14-01115 312-14-02876 312-14-05071 312-15-00796 312-15-02970 312-15-07147


BIOLOGI 112-14-00065 DELLY MARIAM V SRG 112-14-00545 AJENG SILVIAYUNIZAR 112-14-02144 ZULFAHMI 112-14-02163 JELLY MARISKA SIRAIT 112-14-02443 RINDI ANTIKA 112-14-03161 RUTH SIMANJUNTAK 112-14-03189 YMELDA.A.C.MANURUNG 112-14-03445 RAFIKA KHAIRA 112-14-03472 SISKA BORU PANJAITAN 112-14-04408 BUANA H.M GURNING 112-15-03020 NURSITTA LAILY 112-15-04034 FRETTY JUNIARTI 112-15-04492 SITI SEKAR WANGI 112-15-06394 NIRA WATI 112-15-07151 AZUM RIZQI MUBAROK 112-15-07387 WIDDY 112-15-09568 YULI HARDIYANTI 112-15-09655 NISFA HANIM 112-15-09885 LAMHOT HARIANTO S 112-15-11451 M. RINDI ZULFAHRI 112-17-00855 REFNI SYAHLELI AFNI 312-14-01214 FATHIMAH NURFITHRI 312-14-02409 HASNI ANGGRAINI LTG 312-14-02444 MONALISA 312-14-03924 SITI HARDIYANTI 312-14-03942 RAHMA NUR ALIYAH 312-14-05256 QUISTINA SINAGA 312-15-04790 LELLY S SIHOMBING 312-15-05399 ZEBULON NAFTALIF. S 312-15-07664 AGUS HANDOKO 312-15-08885 CAKRA AULIA SEBAYANG 312-15-10922 DWI PUJI ASRIANI HRP 312-15-11449 PRITTI P. TAMBUNAN 312-34-00688 ANDI OBED S ILMU KEOLAHRAGAAN 112-11-12880 TAUFIKUR HAKIM R S 112-14-00180 ARISASTA SIHITE 112-14-00254 FAHRIATUNNISYAH H 112-14-00579 ASFANUDDIN DLM 112-14-00840 CANDRA JAFAR SIDDIK 112-14-01249 FERY JUANDA 112-14-01480 MANGASI MALATUA 112-14-02871 TULUS S SINAGA 112-14-02945 DANI HENDARAWAN P 112-14-02987 IVAN CHRISTIAN G 112-14-03033 JONATAN MUNTHE 112-14-03307 HERMANTO SIRAIT 112-14-03338 EVAN DURINHO GULTOM 112-14-04107 AYU JUNIDA SARI 112-14-04222 KRISTANTO NAINGGOLAN 112-14-04511 BENNY SWITO GULTOM 112-14-04702 ARI BARWANDI 112-14-04748 JEREMIA F SIRAIT 112-15-00663 BAGUS WARDANA UTAMA 112-15-02140 CHANDRO SINURAT 112-15-02788 M ILYAS SS 112-15-07444 MUHAMMAD SIDDIQ 112-15-08249 ROBIANSYAH 112-15-10135 SAMSUL BAHRI G 112-15-10904 ANDRI G TAMBA 112-15-12206 TRIMARTO SIGIRO 112-19-01690 SRI MUSLIANINGSIH 312-14-00797 ICHA ALVIONITA 312-14-02078 RISMAN HAREFA 312-14-04223 EKO SUSILO 312-14-05812 NILA SARI R SAGALA 312-15-00591 RISNA ULI S 312-15-05069 MUCHLIS ASHARI 312-15-06883 RISA F LUBIS 312-15-07902 NANDA SATRIAWIJAYA 312-15-09606 TOMMY P. HUTABARAT MATEMATIKA 112-14-00163 ESSA NOVALIA 112-14-02544 ISNAYANTI 112-14-02671 ADETRI KURNIA PURBA 112-14-02818 SRIWATI MANALU 112-14-03380 PENNY CHARITI LR 112-14-03454 SITI HAWA 112-14-03641 IRA S RUMASINGAP 112-14-03781 NINA DUMARIS 112-14-04216 ARDYPRASETYO SANTOSO 112-14-04623 ENDA SUBINA 112-15-00499 RIZKI ANANDA 112-15-02054 FAISAL ABDI 112-15-02082 SILVA HUMAIRA 112-15-03540 MIKA LAYAKANA 112-15-03799 SOLIHADI 112-15-04132 IRA FEBRIANY 112-15-05551 ALBERT PURBA 112-15-07675 VEEMONA ESTHER 112-15-11566 ANANTA Y 112-15-12249 MANALU GOPAS P 112-15-12987 FIRDAUS 112-15-13427 INTANYSARI S 112-15-13539 JULIUS S 112-15-13625 BRUCE P MANURUNG 112-15-13631 IMANUEL 312-14-01088 DARA ATIKA SURI 312-14-06459 JUFRIDHO AKHYAR 312-15-01677 DESY RIZKI T 312-15-07443 ESTERLINA Y S 312-15-10275 ROBIN SANJAYA 312-15-11030 ZARDI OKTAVERI 312-30-00612 TANYEL SINAGA FISIKA 112-14-00696 FADILLAH ULFA NST 112-14-02170 GLORIA SIMANGUNSONG 112-14-02362 PETER SIHITE 112-14-02677 INTAN S Y 112-14-02893 FAUZIAH HANDAYANI 112-15-00595 INTAN GRACE MANURUNG 112-15-00645 CLARA SINTA SARAGIH 112-15-01273 IRMA SURIYANI SRG 112-15-01539 IBRAHIM 112-15-01620 ANDY IMANUEL MAHA 112-15-01722 M RENO RINALDI 112-15-03353 ALPINO P SARAGIH 112-15-04642 M.REZA NURCHOLIS 112-15-04692 HENDRO JANSYA SINAGA 112-15-05018 ISRIN E NADEAK 112-15-05751 UKRIS S 112-15-10459 HERYANTO R SIHITE 112-15-12349 GORDON SILALAHI 112-19-04997 RITA DEBY 112-30-00689 REZA FAIRLYANSYAH 312-14-01030 ELVINA DEWI 312-14-03353 DINIE RAFIQIE 312-14-03949 SURYANI N J SIREGAR 312-14-05718 RENNY D P 312-15-01740 KONNI TAMBA

312-15-04792 312-15-06328 312-15-06370 312-15-07433 312-15-08692 312-15-08898

MASNIARI SIAGIAN DENNY PRATAMA MARTHIN H U SAGALA EVA YUNITA SIAHAAN THYO FANY S MARNALA A MANURUNG 312-15-10741 CINDY RAHMADANI PENDIDIKAN TEKNIK OTOMOTIF 112-14-00960 MUHAMMAD IRWANDANI 112-14-01461 CHANDRO PANGARIBUAN 112-14-02041 AHMAD KARIM NASUTION 112-14-02522 SYAHRI WAHYU HIDAYAT 112-14-03360 SAUT JUMADI S 112-14-03993 IGNATIUST K SINURAT 112-14-04579 FAISAL MARPAUNG 112-15-00035 AGUS SUNYOTO 112-15-00672 PARTOGIAN PASARIBU 112-15-01725 MARTOGI B 112-15-03395 JHON SAHAT P.S 112-15-05175 ELMO S 112-15-05589 UCOK U T SIPAHUTAR 112-15-06182 WATUL SALIM HUTAPEA 112-15-06358 WAHYU PANJAITAN 112-15-07098 FRANS A. SIHOTANG 112-15-07491 LARASATI 112-15-07975 WANNER M TAMBUNAN 112-15-08939 RIDHO FILANDOW S 112-15-10364 REFAEL E PURBA 112-15-10474 RAMADANSYAH 112-15-11239 RONY DIAN P T MANALU 112-15-11240 PIJAY RAHMAN S MANIK 112-17-02119 BUDI ALAM KASUMA 312-14-00329 MUHAMMAD IKHSAN 312-14-00722 ANDRY DWI PUTRA 312-14-01524 JAROD HARIADI 312-14-02667 HORAS HANSEL TAMRIN 312-14-03253 NURWATI 312-14-04492 DALVIN R SIMANJUNTAK 312-14-04699 HENGKY FRANDO L 312-14-04933 ERWIN SYAH 312-14-04940 ADOLF TUMANGGOR 312-14-05187 LANDEN LUMBANRAJA 312-15-02497 FERNANDO C LUBIS 312-15-06592 EDDY KINDIYA S 312-15-09720 DONI I. TAMPUBOLON 312-30-02724 MUHAMMAD SADAN F PENDIDIKAN KESEJAHTERAAN KELUARGA (PKK) 212-14-00608 MARIS SIBURIAN 212-14-00733 ANNISA AYU RAHMI 212-14-01572 ESRA ULITA SIRAIT 212-14-01729 SEPTIKA OLGA 212-14-02270 TARI FRISYIA DEWI 212-14-02385 GENIUNG YAN P 212-14-03187 ENDAH SUBEKTI 212-14-03325 SRI WAHYUNI 212-14-03365 RIDA WATI NINGRUM 212-14-04012 SALFIRA ANANDITA 212-14-04143 WINDY JESICA S 212-14-04729 TIURMA IDA SIAHAAN 212-14-05688 TAMARA SABRINA D S 212-14-05701 MARINTAN LUMBANGAOL 212-14-06519 EMMA NATALIA NAIBAHO 212-14-07138 HENNY LESTARI 212-14-07431 SRI MARIATI 212-15-00694 PATRISIA ATIKA SARI 212-15-00963 NELFRIDA TARIGAN 212-15-01419 ANDRO SIMORANGKIR 212-15-02421 SARJONO SINURAT 212-15-02871 NOVIANI RAHMAN 212-15-03505 AGUSTINI S 212-15-03517 IRNA NOVIANA DAMANIK 212-15-03781 KIKI EKA SINAGA 212-15-04311 SARI ANNA BR GINTING 212-15-04472 TANIA A D DAMANIK 212-15-04541 RUGUN MARIBETH A 212-15-06612 FADLIN SYAHPUTRA 212-15-07248 INTAN EISTIN SOFYA N 212-15-07632 ANNA PEHULISA BR G 312-14-00535 MARGARETHA OKTAVIANI 312-14-00716 PUTRI L N MUNTHE 312-14-00828 INGGRID D MANURUNG 312-14-01023 ROSINA H SIREGAR 312-14-01109 BAHRIAH HASIBUAN 312-14-02838 NOVA KRISTI 312-14-03287 RISKI KUMALASARI 312-14-03903 SURANI 312-15-02139 PRIMATIUS ZAI 312-15-03325 SELVIANNA BR MELIALA PENDIDIKAN SEJARAH 212-14-00765 ARIFIN W MANURUNG 212-14-01870 KARTINA SIMANJUNTAK 212-14-02027 IMAM SUHARYADI 212-14-02745 SUSANYOLANDA BR GTG 212-14-02881 WINDA TRI ASTUTI 212-14-03151 DAMSON SILABAN 212-14-03331 EDI PUTRA RASMAMANA 212-14-03375 JEFFRY PRANATA BARUS 212-14-03597 DEWI R.S 212-14-03605 MIKA ARMILA 212-14-04132 NENENG SUDARMI 212-14-04242 JATMIKO 212-14-04305 ELLANDA FITRI 212-14-05070 AVEDHITA AGEDYA 212-14-05316 SUCI ANDARI FITRI 212-14-05367 LELY SUSANA S 212-14-05445 SITI MADA YUSDINA L 212-14-05479 AULIA AKBAR 212-14-05986 INDAH SARI HASIBUAN 212-14-06150 LASTRIKA MARBUN 212-14-06797 SRY FANNY S 212-15-00353 TIARMA HUTASOIT 212-15-00642 NENSY STEPHANIE P 212-15-01304 DANIEL SINAGA 212-15-02397 GERY G SEMBIRING 212-15-02591 DYNA RONAULI 212-15-03576 ROYHAN NOVANDO 212-15-03603 VERONIKA S 212-15-03630 MUHAMMAD SYAHREZA S 212-15-03679 MHD. ARIFIN HARAHAP 212-15-04947 TRY JAKA SANJAYA 212-15-05200 WIDO DHINARDO M 212-15-06693 ROMI ANDREA BARUS 212-15-06776 SITI INDAH LESTARI 212-15-06923 METHA F BR SIHITE 212-15-07307 FRIYANSEN RAY N 212-15-08942 IKA 212-19-01870 BINCAR MOURIDC P T 212-21-00137 NIKO ADRIANO H 312-14-00150 ERICKSON SIBARANI 312-14-00577 NUARY NUR UTAMI 312-14-01021 ZEIN HASANAH 312-14-01033 SARWENDY S 312-14-01969 RAHMAT AMSARI P. LBS 312-14-02346 MESMIATI 312-14-03073 HENDRO ANDREW 312-14-03650 SISTER LINIER T 312-14-03704 DWI RIZKY ADELINA 312-14-03926 RIOBY TARIGAN 312-14-04547 MUHAMMAD AFANDI 312-14-04548 YOSEPHA L TURNIP 312-14-04968 NOVI SEPTIANA P 312-15-00278 TRIA DEVI AYUMI 312-15-01309 DHIAH RISTANTI 312-15-01659 WIRANDA R SIHALOHO 312-15-03108 NOVIKA SARI R 312-15-03644 FRIEDA BR PA 312-15-04722 WAWAN MULYANA 312-15-06105 TRI ARTATY 312-15-07337 IRAWATY S T 312-15-07421 OMY RAHMAYANI 312-15-07667 RAFIKA ARTHAULI P 312-15-08007 KENNEDY SILALAHI 312-15-09068 UNJUK KITA REMENDA 312-15-09997 FAJAR BAHARI. S 312-15-10106 JONNUEL HUTAHAEAN 312-15-11986 FERDINAN BERAHMANA PEND. PANCASILA DABN KEWARGANEGARAAN (PPKN) 212-14-00289 LAURENTUS H LBN GAOL 212-14-00361 MARCELINA SINAMBELA

212-14-00836 212-14-01146 212-14-01287 212-14-01529 212-14-01680 212-14-01722 212-14-01780 212-14-01806 212-14-02064 212-14-02421 212-14-02800 212-14-03015 212-14-03175 212-14-03243 212-14-03836 212-14-03971 212-14-04204 212-14-04902 212-14-05024 212-14-05388 212-14-05681 212-14-05799 212-14-06133 212-14-06383 212-14-06493 212-14-06561 212-14-06664 212-14-07102 212-14-07282 212-14-07381 212-15-01775 212-15-02013 212-15-02073 212-15-02773 212-15-02924 212-15-04056 212-15-04689 212-15-05038 212-15-05140 212-15-05376 212-15-06975 212-15-08053 212-15-08825 312-14-00406 312-14-00489 312-14-00815 312-14-01083 312-14-01166 312-14-01207 312-14-01209 312-14-01234 312-14-01370 312-14-02356 312-14-02552 312-14-02581 312-14-03270 312-14-03422 312-14-03520 312-14-04526 312-14-04748 312-14-04835 312-14-04846 312-14-05458 312-14-05552 312-14-06087 312-14-06090 312-14-06152 312-15-00017 312-15-00558 312-15-01617 312-15-02779 312-15-02865 312-15-04085 312-15-04940 312-15-05482 312-15-06662 312-15-06891 312-15-06904 312-15-07093 312-15-08024 312-15-08594 312-15-09331 312-15-11768


PENDIDIKAN GEOGRAFI 212-14-00112 TAUFIK HIDAYAT SIR 212-14-00298 ALICIA WIRDATURRIZA 212-14-00334 IRVAN SIHOMBING 212-14-00504 LISMAWATI PASARIBU 212-14-01105 GIOVANNI ANDARESTA 212-14-02243 IRMA K 212-14-02711 RATNA DEWI 212-14-02981 MUHAMMAD ALI IBRAHIM 212-14-03206 ARI SEPTINI P 212-14-03717 NOVRIZAL USMAN 212-14-03731 RAKA WARDANA 212-14-03899 WENNY KESUMA AYU 212-14-04219 JULI HILDAYATI 212-14-04391 ATIKA M 212-14-04457 M. RIZKIANSYAH NST 212-14-04622 M.HAFIZH BAKRI R 212-14-04739 IRENA BR PURBA 212-14-04775 YEYEN WULANDARI L 212-14-05278 RACHMI JULYANI TBN 212-14-05474 MHD FAZRIN SALIM 212-14-06445 LEO ANJU P ARITONANG 212-14-07045 AGUSTINUS NAINGGOLAN 212-14-07364 ANDI PANCA PUTRA 212-15-00401 SYAHMIA P 212-15-00868 DEWINTA T HUTABARAT 212-15-00873 ZAKARIA RITONGA 212-15-01866 ELISA SIMBOLON 212-15-02556 BOY TURE SITANGGANG 212-15-02620 JENNI OKTAVIANI 212-15-03010 JOKOPRIANTO L.BATU 212-15-04110 SUHAILA 212-15-04253 FEBRITA OCTAVIA 212-15-05875 HERBIN A SIBAGARIANG 212-15-06210 DEDY HARIANJA 212-15-06296 SENTIANI T S 212-15-06395 DIEGO HUTABARAT 212-15-06548 ROMASTI BR TOHANG 212-15-06700 JAYA S M MARPAUNG 212-15-07173 AHMAD FADLI SIREGAR 212-15-08065 RIJAL SAPUTRA SAGALA 212-15-08372 EVI YANTI SITUMORANG 212-15-08454 ZEBLONSIUS BARASA 212-15-08721 ALDI HASUGIAN 312-14-00276 PURNAMA RAHMADHANI 312-14-00343 M UMRI RAJAMUDA 312-14-01319 REDOVA D. PURBA 312-14-02307 SITI RAHMI 312-14-02851 FITRI KARINA 312-14-03059 MALEAKI MARBUN 312-14-04332 JONATAN P SITANGGANG 312-14-05587 TRI W J 312-15-01092 KRISTINA MARLINA S H 312-15-03131 IRFAN DEDI SITOMPUL 312-15-03840 QADRUL FAHMI 312-15-03867 MULIATER SIGIRO 312-15-05523 SYLVIA ALDRIANI 312-15-05728 TOGU P BERUTU 312-15-06689 TANGKAS ROMARIO 312-15-07027 NOVAL ARIGA 312-15-07701 FRISLYN D HUTAPEA 312-15-08591 SANJANA M PANJAITAN 312-15-08950 FAISAL ADE M 312-15-09338 AFRIANA LESTARI NST 312-15-09805 EMMA C SIREGAR 312-15-10830 RIZKY H NAINGGOLAN 312-15-11161 DERISMAULI SORMIN 312-19-01434 MUHAMMAD HAZMI ABRAR PENDIDIKAN JASAMANI, KESEHATAN DAN REKREASI (PJKR) 212-14-00159 PERDANA SIHOTANG 212-14-00584 RISKI JONI PRANATA

C7 212-14-00649 FAHRIAL AZHARI 212-14-00731 HERI FIRDAUS 212-14-00777 MUHAMMAD OKPRIYANTO 212-14-00955 PUTRA SEPDA ANDRISKH 212-14-00971 ANTHONIO RINALDOT 212-14-01294 JUMIKA HALOHO 212-14-01332 AZRUN HABIB 212-14-01387 ARIF FADILAH PILIANG 212-14-01471 DAMIANUS SONI WESLI 212-14-01482 MHD.ZULKIFLI NST 212-14-01590 DONAL H SITUMORANG 212-14-01666 DARWIN SYAHPUTRA 212-14-01795 ROZY ZULKHAIRI 212-14-01836 ARIMANTO SIHOMBING 212-14-01975 ADILPAN HARAHAP 212-14-02072 GUANGSENG PURBA 212-14-02211 DHARMA RISDIAN 212-14-02239 RIDHO AKBAR SIREGAR 212-14-02294 TAUFIK SULAIMAN BARI 212-14-02363 TRI PUTRA NAINGGOLAN 212-14-02426 BAYU RAMADANA 212-14-02491 TRIA PAMUNGKAS 212-14-02605 RIZKI ANHARI SIREGAR 212-14-02690 DEA VALENCIA TARIGAN 212-14-02737 ANDRI BAWENA P 212-14-02746 WELDA P. DIEN PURBA 212-14-02765 ASLAN SUHERI LUBIS 212-14-02896 JESSY VAN TOMMY S 212-14-03088 AQMAL BIN ABDUL J 212-14-04062 ALI BASYAH SIREGAR 212-14-04346 DAVID CHRISTIAN S 212-14-04400 ARDHA HANIFAN 212-14-05035 NURIKA 212-14-05298 IKHSANUL HAKIM 212-14-05358 HERI KYSWANTO SRG 212-14-05382 PUTRI AULIA 212-14-05443 CHANDRA H 212-14-05509 CLINTON H.P.S 212-14-05623 HARMOKO PARDEDE 212-14-05685 RONGGUR H HARIANJA 212-14-05741 LUDOVIKUS PAKPAHAN 212-14-05931 NOPRIADI SIPAYUNG 212-14-06091 PETRICK P SIDABUTAR 212-14-06285 RIDHOAN JULIANSYAH 212-14-06661 ARMANDO SAMOSIR 212-14-06810 MARISSA ARMYZ 212-14-06926 ADI PRANATA P 212-14-07072 JARDI G BOANG MANALU 212-14-07407 GABE TUA LUMBANGAOL 212-15-00050 HENRY ANTONIO 212-15-00515 ERVAN PURBA 212-15-06020 JULI SYAHPUTRA 212-15-06680 RAMCES T MANURUNG 212-15-07408 IHSAN AZHARI 212-15-07667 MUHAMMAD HANAFI 212-15-08293 SEPRIANTO J M PURBA 212-15-09391 MANRI WANLI MANIK 312-14-00069 FAKHRUR RAZI 312-14-00140 M NUR PRABUDI 312-14-00259 ANDREAS TARIGAN 312-14-00468 AGUS SUWARNO 312-14-00508 REZA SEPTA PRAYUDA 312-14-00530 SEJAHTRA GINTING 312-14-00720 WINDI NAULLY 312-14-01372 MUHAMMAD KHAIRUZI 312-14-01568 RICKY HAZMI M 312-14-01587 AHMAD BAIHAQI MUAZ 312-14-01639 POLTAK M SARAGI 312-14-01786 LIBRA S.J. SEMBIRING 312-14-01853 ERWIN SEMBIRING 312-14-01964 MUHAMMAD KODRI 312-14-02039 ROKY CANDRA WIJAYA 312-14-02254 DEARMAN PURBA 312-14-02527 MHD. ANSHARI DAMANIK 312-14-02585 PERIAMAN 312-14-02682 PRAYOGI PANGESTU 312-14-02779 SUPRIADI HARIANTO. T 312-14-02783 JAMINGAN 312-14-02801 JACK M LUMBANTORUAN 312-14-02959 MARNO PURBA 312-14-03327 RIYAN M.L.TOBING 312-14-03605 ROBI HIDAYAT T 312-14-03831 CHRIS MARTIN BUTAR 312-14-04462 SYAPUTRA NABABAN 312-14-04566 CAHAYA UTAMI C ABBAS 312-14-05076 AYAKIMO R.GTINDAON 312-14-05551 ABDUL GONIUN 312-15-00347 LIHARSON SIMANJORANG 312-15-11087 ANTONIUS S 312-15-11520 KHAIRUNNISA SINAGA 312-15-11707 RIO MARCH TARIGAN PENDIDIKAN KEPELATIHAN OLAHRAGA (PKO) 212-14-00189 LASTORANG SIANTURI 212-14-00250 HARDY JONATHAN 212-14-00266 ARDI PUTRA 212-14-00628 OK.M.FAHRIZAL ICHLAS 212-14-00768 ANDRIAN RIZKY F NST 212-14-00886 SAMRI SALDI DAULAY 212-14-00893 PATAR L P SINAMBELA 212-14-01145 HERMAN LABERTO PURBA 212-14-01312 E ANDRAYANTO BARUS 212-14-01561 MASRIANA 212-14-01562 AZHAR EFFENDI 212-14-01596 KOORIMANDES SAGALA 212-14-01816 M. ZULKHAIDIR LUBIS 212-14-02063 ANDRIAN S. HUTASUHUT 212-14-02176 MUHAMMAD RIZKI RKT 212-14-02224 RAHAYU ANGGRAINI 212-14-02325 SURYA RAJAMIN NST 212-14-02335 MHD. RIZA PRANOPIK 212-14-02507 FEBRIAN MAULANA 212-14-02519 DIAN MANGANDAR S 212-14-03242 T. JULRIO PERDINAN P 212-14-04478 HELPI ARNI SIJABAT 212-14-04513 TEDDY RUDI HARTO .S 212-14-04624 NOVIZAR MAULINA 212-14-04790 JERLIN MATEUS 212-14-04869 ROGRES TARIGAN 212-14-05220 BENNY MARULITUA PJT 212-14-06054 HENDRIK SARAGI 212-14-06595 FRANSISKUS SARAGIH 212-14-07273 SHEILA MAULIDINA 212-14-07274 SHEILI MAULIDINI 212-14-07478 M AGUNG ALFIANTO 212-14-07583 HARRY SAKSENA.S 212-14-07627 SEPTIAN HADI PRATAMA 212-14-07649 JETRO JOSRI SILABAN 212-15-01724 ANDREY PURBA 212-15-03242 SANDI MAULIDIN 212-15-03964 IVAN ROLAS MANURUNG 212-15-05344 PUTRA KATAMSI SILAEN 212-15-05871 HEBER RARON S 212-15-06154 FELIX M.SIHOMBING 212-15-07317 JAHOLONG SIHITE 212-15-08672 FERRY HENDRA TUA 312-14-00012 NICOLAS L SIHOMBING 312-14-00346 SEPTIAN G HUTAGALUNG 312-14-01011 JANUARI MANALU 312-14-01289 ATIKA SWANDANA 312-14-01389 SURYA BUDI SATRIA 312-14-01791 ANDRY SYAWAL NST 312-14-01941 ARDI PRATAMA HSB 312-14-02017 RIDHO SAPUTRA S 312-14-02816 YONA SINAGA 312-14-02998 FAHRUROZI 312-14-04466 KHAIRUL NASUTION 312-14-05951 M NUR PANDRI 312-15-02796 YACOB M SIMANJUNTAK 312-15-03882 RICO ARITONANG 312-15-07246 RICKY S P N ZEGA 312-15-08958 PRATARMA P P TARIGAN 312-15-10578 HADI GUNAWAN 312-15-11309 SAHMAN T SIHALOHO PENDIDIKAN LUAR SEKOLAH (PLS)

C8 212-14-01570 212-14-01754 212-14-02741 212-14-03433 212-14-04912 212-14-06338 212-14-07006 212-14-07057 212-14-07336 212-15-01252 212-15-04379 212-15-04513 212-15-05139 212-15-05769 212-15-06343 212-15-07498 312-14-00365 312-14-00674 312-14-00809 312-14-01246 312-14-01491 312-14-02231 312-14-03112 312-14-04272 312-14-05917 312-14-05973 312-14-06018 312-15-05051 312-15-06717 312-15-07920 312-15-08666 312-15-09362 312-15-09855 312-15-10335


PENDIDIKAN EKONOMI 212-14-00170 ROMAULI NAINGGOLAN 212-14-00205 ANA PUTRI ANI 212-14-00269 RUTH GUSTINA S 212-14-00307 YOHANA I P M 212-14-00541 ANNAZMY HIDAYAH 212-14-00614 MESAK T SIMAMORA 212-14-00772 SUSANTO S.WARUWU 212-14-00778 RISZKYANA 212-14-00939 FITRIA AMARTA 212-14-00975 NITA FEBRINA SAMOSIR 212-14-01190 MARIA KRISMA J.M.S 212-14-01211 WARDHATUL AKMA 212-14-01307 JONNI SIAGIAN 212-14-01396 YENNI ERINAWATI 212-14-01516 RAIN HUMAIRA 212-14-01598 WIYAN SARI DITA P 212-14-01727 NURHASANAH PANE 212-14-01793 TRI ANSELLA SIREGAR 212-14-01950 DWI WULANDARI T 212-14-02187 SINTA MULIYANTI 212-14-02249 PARMAN MANALU 212-14-02269 RIDHO KURNIAWAN 212-14-02549 JESSICHA Y S 212-14-02643 RIBKA SULISTIYO WATI 212-14-02853 YESSI C SIMANULLANG 212-14-03016 TARULI HUTASOIT 212-14-03026 DESRI M SAMOSIR 212-14-03046 SUCI LESTARI 212-14-03177 DARTO P SIMANIHURUK 212-14-03218 LENNI NOVRIANTI P 212-14-03327 RINA AGUSTIN S P 212-14-03380 PUTRA H PURBA 212-14-03429 MELIANI APRODITA 212-14-03486 MHD. TANTOMI TANJUNG 212-14-03618 INSAN DANIEL 212-14-03787 PRISNA DESSY S 212-14-03904 MARLINA G E SITORUS 212-14-04011 DEDE ARTA GULTOM 212-14-04146 SUSIYANTI S 212-14-04150 FEBY MARLINA LUBIS 212-14-04386 MUTIARA ULFA 212-14-04422 KARTA BAHAGIA BARUS 212-14-04544 NOVITA SARI SIANTURI 212-14-04560 SRI AGUSTINA SINAGA 212-14-04621 FLORENSY GINTING 212-14-04636 FIKA DEVITA MAZIDAH 212-14-04748 ROBERT LARSON NEHE 212-14-05011 ONIE Y BRAHMANA 212-14-05051 HOLONG M 212-14-05321 DWI SRI SUGEH ARTI 212-14-05630 MERSI N. TELAUMBANUA 212-14-05665 DAVID HARUN SIANTURI 212-14-06063 MERI ANDANI 212-14-06242 M. FIKRI JAUHARY 212-14-06284 ERLINA SIMANJUNTAK 212-14-06545 DANIEL FEBRIAN P 212-14-06549 NURLITA SARI P 212-14-06785 PUJIADI 212-14-06800 NIKE INDRAYANI 212-14-06938 PERAWATI SILALAHI 212-14-07116 RUFMANA AMBARITA 212-14-07280 SUDIHARTONO GULTOM 212-15-00032 ALFIQA SYAFRIL 212-15-00194 ROMI IRAWAN S 212-15-00613 WINDY RAMADHANI LBS 212-15-00995 ARTA MELINDA N 212-15-01180 ANDI E P TANJUNG 212-15-01238 TRISNA HUTAURUK 212-15-01508 APRILENA BELLA V S 212-15-01855 LIDYA FEBRIDAYANA 212-15-02018 FRISKA HARUMNIA H 212-15-02131 EKA VERAWATY 212-15-02478 FEBRINA K SIREGAR 212-15-02542 DIAH M PUTRI 212-15-02670 RYAN PERMANA 212-15-02830 ARIHTA ESTERYA 212-15-03386 BONAR M S 212-15-03449 ANDRIO G SIHOMBING 212-15-03768 MAYA 212-15-04170 WIWIN RINI SIANTURI 212-15-04186 SUSI SUSANTI 212-15-04245 HATIANNA MUNGKUR 212-15-04603 FITRI Y SIHITE 212-15-04969 MEGA WATI 212-15-05287 AGUSTINUS S 212-15-05308 RITA ULY NAPITUPULU 212-15-05406 FAUZAN SIDDIK 212-15-05644 INDA PRADINDA HRP 212-15-05922 JURRAHMAH 212-15-06135 RENOVA SITORUS 212-15-06266 DWI VANY FRANSISKA D 212-15-06301 SANDRA DWI ANTI 212-15-06391 NOVITA C SITOMPUL 212-15-06726 RUME HAWAY W PURBA 212-15-07241 NOVITA SIREGAR 212-15-07323 FERNANDO 212-15-07353 MARIS VERAWATI 212-15-07491 RENY A SIMORANGKIR 212-15-07493 ROSMAULINA A A 212-15-07803 ESRA P.H. SITANGGANG 212-15-07851 MAFIROH FEBRIANTI RD 212-15-08126 NOVITA HUTASOIT 212-15-08562 ARINI CLOUDIA T 212-15-08563 AMON ANDREAS T 212-15-08915 YOSEF LEON PINSKER 212-15-09121 TIKA AYU ANDRIANI 212-15-09399 RIMSON RIVANTO S 212-15-09730 FUJI E. NAINGGOLAN 212-17-11086 LISMA THUWEL AF S 212-21-01604 IKA VERONIKA 212-30-16327 TRIHANI 212-30-21131 TIWARNI F P 212-38-12936 APRILIA MARBUN 312-14-00039 RIDUAN OMPUSUNGGU 312-14-00192 ERY D MANURUNG 312-14-00537 SARMATIO MANIK 312-14-00614 ARIEF FRADIANSYAH L 312-14-00807 ISMAN KORNELIUS N 312-14-01073 SUTAN P SIPAHUTAR 312-14-01332 NATANAIL P 312-14-01456 HANNA MANALU 312-14-01681 SYAHARDIANTY DAMANIK 312-14-02067 WIRA D ARITONANG 312-14-02141 EFSAH U. SIHOMBING 312-14-02707 FAISAL TANJUNG 312-14-02868 ISTI NST 312-14-03488 DESI MAYASARI 312-14-03693 MARTHA SIPANGKAR 312-14-03812 EKO SAPUTRA S 312-14-03853 PUTRI DWI LESTARI 312-14-03943 AHMAD SURYADI DAULAY 312-14-04258 SHELLA MIKHA P P S

Hasil SNMPTN Unimed 2012 312-14-04935 ONNY OKTAMI S 312-14-04996 CELIA V A PASARIBU 312-14-05082 EVI SYURIANI HRP 312-14-05538 RAHMA AZIZI 312-14-05832 MARIATUN 312-14-05994 ASER BUTAR BUTAR 312-14-06360 OPY TRIANSYAH 312-15-00063 WAHYU DIKA ARINDI 312-15-00166 ARTHA SIPAYUNG 312-15-00514 LESTARI PANJAITAN 312-15-00768 DEVI ELVINNA S 312-15-00946 FRESENIA 312-15-01694 LOLA S I 312-15-01923 INDRI I C SINAGA 312-15-02710 ACHMAD MUSTOFA 312-15-03387 ASNAWATI BR PA 312-15-03659 MARIA MAGDALENA S 312-15-04803 DIVARILA S ALIKA 312-15-05309 JOHN BUDIMAN BANCIN 312-15-05575 NOVA JULIANA NAIBAHO 312-15-06594 MARIA S HSB 312-15-07306 ANDREAS P 312-15-07323 NANDA R E S 312-15-07634 SARIA NETTATARIGAN 312-15-08606 UDE ANDREANIM G 312-15-08674 MONICA P S 312-15-09142 JESIKA ARTHA T S 312-15-09346 REPITAMIAN PARULIAN 312-15-09903 M FAUZI MURGANI R 312-15-10770 AMINUL RAUF LUBIS 312-15-10930 TIUR S MANAJEMEN 212-14-00104 ATIKA PUTRI SIREGAR 212-14-00151 GUNTUR AGUNG 212-14-00486 RIA ANGGELINA 212-14-00513 ICHWAN HAPIDZ 212-14-01304 IBRENA OCTAVIANI 212-14-01616 INTAN MARBUN 212-14-01686 NINDYA DEWI R 212-14-02075 DONA ELVIRA A.S 212-14-02151 YAN STEVEN GINTING 212-14-02168 NILARIGA PUTRI I 212-14-02173 MASDALENI 212-14-02616 MHD.KAMAL NAWAR 212-14-02962 JUMONO H LG 212-14-03041 NURHASANAH 212-14-03528 ZUL FADHLI 212-14-03547 MEDANI CAESAR P 212-14-04065 NICO DAMANIK 212-14-04089 APRIANDI SEMBIRING 212-14-04239 ERLAN BUDI SANTOSO 212-14-04981 RATINI S 212-14-05223 ADINDA AYU LAYLA 212-14-07096 SRI MANDRA GUNAWAN 212-14-07264 MALON O P S 212-14-07266 MHD TOUFIK POHAN 212-15-00551 RINA ANGELLA BARUS 212-15-00846 FLORIZKY N. S 212-15-01029 HAZRI FADILLAH HRP 212-15-01140 MEI ROITO SIANTURI 212-15-01403 NORMA YUNITA 212-15-02094 AZMINUR 212-15-02128 ISMED S 212-15-02534 NOVI SELVIANITA 212-15-02711 HENDRO SUTOMO G 212-15-03178 RIDHA UTAMI MTD 212-15-03520 RAMOS SIAGIAN 212-15-04197 NUR INDAH SARI SBR 212-15-05154 TONI HIDAYAT 212-15-06568 SELVI YULITA SARI 212-15-07265 GRACE LBN TOBING 212-15-08439 HERMANTO MANALU 212-15-09567 RIZKY ADITYA NST 312-14-00612 WINDA ARIANI 312-14-00813 KEVIN TJUATJA 312-14-02507 LATIFAH HANUM 312-14-02970 DOLLY MICHAEL S 312-14-03100 LOLITA SARI LESMANA 312-14-03101 PANCA R. SIMANJUNTAK 312-14-03346 MARINA ISTANTI 312-14-03671 RIKI F SINAGA 312-14-03776 LUSIA C SITUMORANG 312-14-03855 ALEX E NAINGGOLAN 312-14-03907 TIODORMA BR SIJABAT 312-14-05119 DEDI GUNAWAN 312-14-05238 GANI A. DAMANIK 312-14-06272 SISKA HARIANA 312-15-00014 RIO HUTABARAT 312-15-01760 EVY APRIL MANALU 312-15-01910 RAESHA SUHAEBRA 312-15-03344 AGUM HILKIA 312-15-03770 DIAN MEMORY 312-15-04604 DESY DINDASARI SBR 312-15-05470 RIO EVANS B.M.S 312-15-06914 KAROLINA SITUMORANG 312-15-07219 INDRI ARISTA 312-15-07761 YITRO HARIANJA 312-15-08052 JUNIVER SITANGGANG 312-15-08873 DEBORA PURBA 312-15-09242 KLARA D AGUSTINA 312-15-10281 ANASTASIA R S 312-15-10483 YULIANA S TUMULO 312-15-11913 M.PATIH SUHADA AKUNTASI 212-14-00257 ARJUNI RAHMI BARASA 212-14-00284 RIZKINA SHANTI HRP 212-14-00317 DODI P SITUMORANG 212-14-01799 ANDREAS N.A 212-14-02145 FAISAL FADLY PUL 212-14-02185 MELITA SARI LUBIS 212-14-02226 ENGGANTISA KABAN 212-14-02355 ASRIWATY TRICE S 212-14-03293 CHAIRUL RIZKA HRP 212-14-03360 NURCAHYONO 212-14-04682 NOVITA SIHOMBING 212-14-04974 REZA ALFURQAN 212-14-05310 CHERLYS FITRA 212-14-05437 INES LAPANGKASARI M 212-14-05757 MAHFUDZOH S 212-14-06200 LETICIA SIMANJUNTAK 212-15-00315 DECI F PURBA 212-15-00934 MANGATUR SITUMORANG 212-15-01352 WINDA EFRIANI 212-15-02245 FEBRINA MIRANTI 212-15-02348 IKA HAFNI NOVA 212-15-02483 ANDI GUSNANDA 212-15-02854 TESSA SNL TOBING 212-15-03181 ESTER S M SIHITE 212-15-03618 LENI LESTARI PURBA 212-15-03794 MUSA A H BUKIT 212-15-03890 WELIANUS JEGA 212-15-05439 LENNY BUTARBUTAR 212-15-05584 BOP S 212-15-06248 HELENA SIHOMBING 212-15-07136 JUANTI 212-15-07466 MARIA M MANAO 212-15-07698 LILIS A M 212-15-08929 RINI HANDAYANI 212-30-07861 ELSA DE BALQIS 212-30-15813 ROSATRESIA KRISTINA 312-14-00065 VANNY NABILA 312-14-00115 RAYMOND S 312-14-00520 BANIA PUTRI 312-14-00611 RINALDO SINAGA 312-14-01294 SAFWAN HADI UMRI 312-14-01942 FITRIN DINY M NST 312-14-02671 ROBI ABDULLAH 312-14-02786 JITO PRASTIKAWA 312-14-02799 SITI HARTINA 312-14-03434 DAVID M HUTAGALUNG 312-14-03564 AYU NOFRIANA SINAGA 312-14-04011 FITRI MARANTIKA 312-14-04913 A.M. PARULIAN 312-14-05239 ANDRI FEBRIAN 312-14-05413 DEBORA SRL T 312-14-05904 MUAMMAR PRAWIRA SRG 312-15-00513 SYARIFAH HANUM 312-15-00746 ALFARON CRISTIAN 312-15-00954 GRACE SILALAHI 312-15-01254 NISKAR B ZEGA 312-15-02007 VIVI AFRILIANI 312-15-05351 DWI AYU MAULITA 312-15-06634 YULIA AMANDA 312-15-09098 YUNI M PANJAITAN 312-15-09372 YENI RAHMAYANI 312-15-10221 DITA AFANDRIA 312-15-10522 MANNA TRIFENA S 312-15-10571 HERWIN JUNIOR PENDIDIKAN BAHASA, SASTRA INDONESIA DAN DAERAH 212-14-00256 NOVA YANTY 212-14-00272 RIZKY AMALIA LUBIS 212-14-00762 YUSTRIANDI 212-14-00960 HOTRIS SIMBOLON

212-14-01025 212-14-01106 212-14-01123 212-14-01373 212-14-02264 212-14-03648 212-14-03805 212-14-03901 212-14-04518 212-14-04834 212-14-05989 212-14-06004 212-14-07079 212-15-00258 212-15-00382 212-15-00518 212-15-00950 212-15-01509 212-15-02863 212-15-04264 212-15-05342 212-15-06289 212-15-06808


312-14-02565 DANNI BONNIEL NDRURU 312-14-02675 SARTIKA PURBA 312-14-02744 AKHLAKUL KARIMAH 312-14-03104 RIONANDO SIRAIT 312-14-03358 LAMTIAR SIBURIAN 312-14-03935 IRMA PLORENTINA S 312-14-04377 INDRA KUMALA DEWA 312-14-04833 RIZKI FADILA NST 312-14-05197 FAISAL RAMADHAN 312-14-06025 JUSIKA A.SITEPU 312-15-00230 SELY MORYANCE 312-15-00312 APRILYA A F GINTING 312-15-01819 HANY R NAPITUPULU 312-15-02241 ANDRI S SIMBOLON 312-15-03129 GEMINA JUNI EKA 312-15-03889 RIZKIA SYAHFITRI 312-15-03893 EMING PRAMITA 312-15-05754 CHATERINE S 312-15-05784 RIKA ANISA PUTRI 312-15-05837 IVANA SARAHT PURBA 312-15-06095 SURYANTA NABABAN 312-15-07113 RENTA LUBIS 312-15-09168 DINDA PUTRI N 312-15-09601 SELVI NENY BR.SITEPU 312-15-10014 ERWIKA DARA ISANTI 312-15-10138 RUMINDA FRANSISKA G 312-15-10456 NANDA NURUL HUDA 312-15-11427 LOLY WM PENDIDIKAN BAHASA JERMAN 212-14-01640 SRI WARDA NINGSIH 212-14-03184 CITRA ELISA 212-14-03616 ISNAINI HIDAYAH 212-14-05603 HARTONI 212-15-00662 MARIA M E HUTASOIT 212-15-00948 RINGGAS PANJAITAN 212-15-06071 AYATI RAHMAT 212-15-08653 ANNISA PUTRI K 312-14-00505 AGNES PANJAITAN 312-14-00760 SURYATI MANIK 312-14-01334 AYUWANDIRAH 312-14-03044 WIWIN PRATIWI 312-14-03071 DESY MARGARETHA 312-14-03523 NONNY WISANDA 312-14-04382 SANDY A SITUMEANG 312-14-05062 SARMIDA S SITOMPUL 312-14-05385 LOLA MIFTAHUL H N 312-14-05913 ARNI AFRILIKA 312-15-02379 CHRISTIANIYOHANNA H 312-15-02398 DWI MART SIMAMORA 312-15-03890 AIDIL SYAHPUTRA 312-15-04467 ESTER Y SIMANJUNTAK 312-15-04623 LYDIA A SITORUS 312-15-04788 RATNA SARI PELAWI 312-15-05328 CHRIST MARIA B.H 312-15-06826 RICE SIAGIAN 312-15-07423 HARIATY SARAGIH 312-15-08026 YUSNAINI HARAHAP 312-15-08043 NINDY IKA PUTRI 312-15-10294 NINDY KINANTI 312-15-11028 RABIATUL ALAWIYAH PENDIDIKAN SENI RUPA 212-14-00759 M EGI FIRMANSYAH 212-14-01422 MUHAMMAD RIZALI 212-14-01802 ONGKU FAHRIZAL 212-14-01812 N0VRIANA BR BANGUN 212-14-02328 PARSAORAN SINAGA 212-14-02550 RENENG MENTARI INDAH 212-14-03341 ANDRE MARULI TUA 212-14-03439 MUHAMMAD ADRIANSYAH 212-14-05528 ASMADINOTO 212-14-07109 MANTHES TOBING 212-14-07436 DIEGO ARMANDO 212-14-07496 WINARSO NAHAMPUN 212-14-07618 TINO ANDY WIJAYA 212-15-01948 IVAN O SIMBOLON 212-15-02925 LEXWAN T LBN GAOL 212-15-03904 DIAN ALEXIUS SINAGA 212-15-06178 EMIA G 312-14-00510 YENI AMELIA PURBA 312-14-01001 SITI RAHMADANI SRG 312-14-02683 RIKI HAMDANI 312-14-03324 SITI KHADIJAH NST 312-14-03356 FEBRICA SUCIANA S 312-14-04031 STEPHANIE L.W.S 312-14-04032 MOHAMMAD SOFYAN 312-14-05437 SAPUTRO LBN.TOBING 312-14-06063 GEMA RAHMADONI 312-14-06185 CITRA WAHYUNI 312-14-06244 BIMANTARA 312-14-06291 MASTINA 312-15-01714 FEBRINA STEVANIE 312-15-02947 MERRY MANURUNG 312-15-06060 RENITA RUSLI 312-15-07277 M. HASBY AMRI KHAIRI 312-15-09326 DEDE SATRIADY BANGUN 312-15-11242 SETYAWAN WIMA P HSB 312-15-11438 RINA ANDRIANI HSB 312-15-11811 IVO T SIADARI SASTRA INDONESIA 212-14-00625 M. RULLIANSYAH 212-14-00966 SIMON LAURENSIUS H 212-14-01476 NINDITA PUTRI 212-14-01867 SEPTI NUR ERLIANI 212-14-06371 GUNAWAN 212-15-07020 DEVIN H SIDABUTAR 312-14-01451 SUDIATI LUMBAN GAOL 312-14-02348 AHMAD RASOKI PASARIB 312-14-02627 PUTRI NADIA 312-14-03424 THARI FACHREZA 312-14-04919 MIASISKA BRTARIGAN 312-14-05401 IRFAN HUSAINI NST 312-14-05542 LAMTIUR SIMAREMARE 312-14-05560 HENY ANGGRAINI 312-14-05970 RIANAT SITANGGANG 312-15-01194 PRAYOGA F SITEPU 312-15-01264 DIAN TIARA 312-15-02559 WILLY MARIO PASARIBU 312-15-07464 DEWI SAHRINA S 312-15-08652 DONY HERMANTO MANIK 312-15-08955 MARSINGAL ROTUA SASTRA INGGRIS 212-14-02369 CHAIRI ICHWANA S 212-14-03265 FINKY S. SINAGA 212-14-04238 NINA MEISAHRINA 212-14-06632 JULI AYU DIAN K 212-14-07108 RICKY FIRMANDES 212-15-00379 M. RIDHO WIBOWO 212-15-01090 VALDY RIFZKI 212-15-01886 PRASETYO 212-15-02079 MARIA RIVERA P 212-15-03307 REZA SAPUTRA RAMBE 212-15-04107 DONNY JOHANNES P 212-15-05054 NURJANA 212-15-05264 NUZULIANDA FEBRINA P 212-15-05726 TRY SARI SILITONGA 212-15-07770 BOY ARIE SANDY 212-33-10523 FARIDA HANNUM S 312-11-16565 RYAN RYNALDO 312-14-00793 ANJAS PRASETIO 312-14-01638 DICKY ANDRIAN 312-14-01758 SYULIKA DAULAY 312-14-01862 DIAN SUKMA LESTARI 312-14-03043 ANGGREYNI T 312-14-03258 ANASTASIA MARANATA 312-14-03309 MHD SYAIFUL AMRI 312-14-03649 DONI S SITANGGANG 312-14-03741 HERIYANTO MANALU 312-14-04694 YUMI SANIAH LUBIS 312-14-05360 SONYA ARI DAME LUBIS 312-14-06163 RIO SITORUS 312-14-06389 SINTA SARI DEVI 312-15-01833 DEDE SYAIFUDDIN 312-15-02077 ADI KUSUMA 312-15-05434 AMI I BR TARIGAN 312-15-05473 HENDRO D SIMAMORA 312-15-06973 DARA YULLYANTI 312-15-07266 ELIZABETH ULIANA P 312-15-08006 REKHA KHAIRUNISA 312-15-08081 HESTINAWATI ZALUKHU 312-15-09787 MUTIA SURI 312-15-10333 WIDYA Y SIHOTANG 312-15-10388 WIRA BUANA MANALU PENDIDIKAN SENI DRAMA, TARI DAN MUSIK (SENDRATASIK) 212-14-00131 ADITIA BENI KARNANDA 212-14-00695 GANTI SIMBOLON 212-14-00892 LIDIA NIATIRAMA 212-14-01955 GESTI RIWANDA 212-14-02212 FADLAN ABDILLAH S 212-14-02237 RICKI A .HUTABARAT

212-14-02242 212-14-02256 212-14-02364 212-14-02729 212-14-02736 212-14-02767 212-14-02812 212-14-02839 212-14-03273 212-14-03310 212-14-03592 212-14-03872 212-14-03973 212-14-04055 212-14-04081 212-14-04115 212-14-04504

DANI ADE PUTRA LAMBOK BELLA.M SAIHOTANT. HARIANJA HARRY Y H S ENROW R HENI RATAM PASARIBU JULIO CHANDRA M.LR SIYEANNE MINEN HERMAN F.L MUNTE SYLVIA PURNAMA SARI HALMIKA PUTRA LEILA M DAMANIK PAULUS F LBNTOBING INVESTOR LAIA KIKI FRINANDO ALBERT UNEDO POPY FACHRUNISA YUS 212-14-04860 NURUL FAJRIA BB 212-14-05079 RELASI ARTHA N 212-14-05447 FAISAL FAHMI MRP 212-14-05584 MUTIARA CARISSA HSB 212-14-05657 CERIATI 212-14-05658 MUHAMMAD FAHMI 212-14-05686 AFNER JHON FERNANDO 212-14-05723 MANGARA TUA B 212-14-06174 NURUL USWAH 212-14-06316 UTARI SAFRINA 212-14-06869 IMMANENSIATAMBUN 212-15-00080 HELENA NATHALIA 212-15-00484 IMMANUEL P GULTOM 212-15-03191 MAENINTA BR GINTING 212-15-03990 ROMA ULY SIANTURI 212-15-05193 ANDI S SIMBOLON 212-15-06748 FADHIL ISMAIL 212-15-07024 SAHAT PUTRA HUTAURUK 212-15-07288 RISMANAULI PURBA 212-15-08643 SARA V S 212-15-08645 KEVIN JUSTINUS E 212-15-09013 IMMANUEL P 212-15-09040 HENDRA J 212-15-09199 MONICA S 312-11-14443 RIESKY NUGRAHA 312-14-00063 EDWARD SITORUS 312-14-00403 LATIFAH ANUM 312-14-00507 MARIA ARUAN 312-14-01017 SRY WAHYUNI 312-14-02178 NUR SARI RAHMADIANA 312-14-02568 SAHAT MARULI SIAHAAN 312-14-02574 LESTARI INDAH P 312-14-02717 PUTRI UTAMI 312-14-02730 DWI RETNO PURNAMA S 312-14-02879 ANNASHRI SOHIB 312-14-03130 RIZKI NURJANNAH 312-14-03530 MUHAMMAD FARID AFIQ 312-14-05210 DESMA ARMIDA 312-14-05636 CHATHERINE SIREGAR 312-14-05695 NURIPA HARAHAP 312-14-05843 PRIMA H SIHOMBING 312-14-06277 VIVI AULIA SIRAIT 312-14-06343 RAHMI DAMAYANTI 312-14-06446 SOLIHA 312-15-00648 BELLA CINDY JUWITA S 312-15-04833 FEBRINA S.U MUNTHE 312-15-05125 ARVIKA TARI 312-15-07811 DINI WUTSQA AMALIA 312-15-09007 JOSUA SITUMORANG 312-15-09108 RUTH MENAK S 312-15-10156 EDY RAPIKA P 312-15-10941 AULIA RIFKA PUTRI 312-17-06505 NORALISA PENDIDIKAN GURU SEKOLAH DASAR (PGSD) 212-14-00505 INTAN SYAHPUTRI 212-14-00656 IRA AMALIA SIREGAR 212-14-00837 RAMAHWATY BR LASE 212-14-00863 MEGA KOLOSE 212-14-01066 ASTRIANA SITUMORANG 212-14-01663 BINDES T SARAGIH 212-14-01825 RANGGA WIJAYA 212-14-02118 ATIKA KHAIRANI PUTRI 212-14-02268 MAYA ANGGREINI 212-14-02730 HARIATI MANIK 212-14-02898 SRI KHAIRANI S 212-14-02912 RIZKI ARDIANTI 212-14-03565 AYU PRADINI 212-14-03878 RAHAYU SYAH FITRI 212-14-03923 RAHMATUN AINI 212-14-04273 LEONITA R DAMANIK 212-14-04642 JIMMI APUL M MANALU 212-14-07125 FEBRYANTY SILITONGA 212-15-00329 SUSANNA BR GINTING 212-15-01378 EVY REDA P N 212-15-02250 RIO P NAPITUPULU 212-15-04645 NELLY SURABINA 212-15-05272 DESI R PANGGABEAN 212-15-05509 OCTAVIA RAMAYANTI P 212-15-06201 DICKY APRILLIANDA 212-15-08715 TAMBOS NAINGGOLAN 312-14-00171 DESI HARTINI D 312-14-00389 FENNY SILVIA 312-14-00767 DWI ERIKA YANTI 312-14-00841 ARIMBI SURA PRAMUKTI 312-14-01071 ALFI SYAHRIN NUR 312-14-01137 MARLEHON SIHITE 312-14-01169 SURYANA MENTARI HRP 312-14-01709 ENY MAYASARI 312-14-02033 GREIS C SIHOTANG 312-14-02347 RANY ELISA BR BARUS 312-14-02482 ALIANDI PURBA 312-14-02536 RINI SORAYA 312-14-02655 AYU KURNIASIH 312-14-02806 WYNDHA AULIA 312-14-02831 WINDA LESTARI 312-14-02844 ALIMIN SAMOSIR 312-14-02952 DIAN VITASARY 312-14-02956 MASDALINA 312-14-03301 ENDAH PERMATA SARI 312-14-03305 MUHAMMAD FEBRI RAFLI 312-14-03335 REWA ANGGRAENY 312-14-03589 MIRA PRATIWI HSB 312-14-03689 SRINOVIANTI 312-14-03708 MARHASIL TAMBA 312-14-04149 NUGRAHA NASUTION 312-14-04153 ERWINA RAHMAWATI 312-14-04172 NELISMA LUBIS 312-14-04305 ADRINA PENDIDIKAN GURU SEKOLAH DASAR (PGSD) 312-14-04348 SOFIA SITUMORANG 312-14-04591 WAHYU ANA PUTRI NST 312-14-04611 BAGARIEL BOBY 312-14-05509 FATIMAH SYAHFI 312-14-05580 MARTHA MEYLIANA 312-14-05627 SHELLA MIRANDA ZULVI 312-14-05852 NURIA NOVITA 312-14-05895 SWITRI INDAH PUSPITA 312-14-05962 LELYTA NMC PURBA 312-14-06013 NIA BINTANG LBN GAOL 312-15-00028 RAUDHOH SAMOSIR 312-15-00564 ADMIRA HALIM SIREGAR 312-15-00996 ELIANI MAHALNI 312-15-01344 PUTRI H S 312-15-01435 DEWI AYU CHAIRANI 312-15-01619 RANI NATALIA BR KARO 312-15-02923 FEBI LOLA.F.SIANTURI 312-15-03548 RIZKA NURMIZA 312-15-03698 TIARLAN SINAGA 312-15-04155 AYU R.S 312-15-04595 DIMAS WIJAKSONO 312-15-04653 MARIA SARI NAIBAHO 312-15-05147 PERIANTI BR SAGALA 312-15-05167 BERNADETTA SITORUS 312-15-05882 ENDANG WITA GULTOM 312-15-06335 KRISNA WIDIA S 312-15-06824 RUMINDANG 312-15-06870 SITI KURNIATY SUKMA 312-15-07071 JULIANA BR PGB 312-15-07207 RYAN SHARA A.N 312-15-07253 WILDA PUSPITA M.S 312-15-07313 RAHMAH

WASPADA Sabtu 7 Juli 2012

312-15-07668 LUSI ANA C SINAGA 312-15-07700 WANDA APRILIN S 312-15-07752 KEZIA G H SEMB 312-15-07823 TRIA HANDAYANI 312-15-08472 CENNY U L 312-15-08663 SISKA ENJELIN HULU 312-15-08682 DILLA NURMALITA SARI 312-15-09112 WIDYA SYAHFITRI 312-15-09507 MARYATI MANURUNG 312-15-09562 FYAN HERIANTO S 312-15-09864 HERU WIBOWO 312-15-09981 DEWI PUSPITA SARY 312-15-10885 NURHIDAYAH LESTARI S 312-15-11696 SANTA HELENA SINAGA 312-17-06306 RAHMA WULANDARI 312-33-22080 DOLA SARLITA

312-14-04313 PURNAMA SARI 312-14-04621 IRA GUSNITA PAKPAHAN 312-14-04639 RAHMAT 312-14-04947 SURYA DIRJA 312-14-05389 CHANRA ARLIANI 312-15-02348 NURCAHAYANTA M 312-15-04163 ERIKA ANDAYANI B 312-15-04860 GADIS ANASTASIA 312-15-05625 ELLY ERMAWATI SAGALA 312-15-06529 CHRISTIANY OVALIA 312-15-06571 ANDIKA SARAGIH 312-15-07067 RARAS YUDIRA 312-15-07755 DIAN ANGGRAINI S 312-15-09179 ARIES SIHOTANG 312-15-10101 FEBRISA M S

PENDIDIKAN TATA BOGA 212-14-00318 RANTI MELIANI SRG 212-14-00748 FRISKA SIHOMBING 212-14-01243 WAHYUNI SYAFITRI DLY 212-14-02716 ENDANG K. S 212-14-02808 GALIH PRASETYO W 212-14-03523 JUNI ARYANTI 212-14-04398 WINATA C PURBA 212-14-04428 NURHAYATI 212-14-05538 SUCI DWI ASYIAH 212-14-05695 DARA GUSNITA 212-14-05800 MERRIYULINITA BR. P 212-14-06322 SITI MASITHAH 212-14-07420 MHD RIZKI ANANDA 212-15-02137 BOBY WALDANI 212-15-02524 MONA NAPITUPULU 212-15-02749 MULIA ANGGIA MURNI 212-15-03953 YOSUA GULTOM 212-15-04638 MULIA SIPAYUNG 212-15-04810 KUSTIYAH 212-15-09561 DONDA.W.ARITONANG 212-17-13199 KHAIRINA HANDAYANI 212-38-13123 MARISSA AGESIMA S 312-14-00917 SRI LESTARI 312-14-00971 EKA RESTI BR TRG 312-14-02113 MASHUDI 312-14-02130 DESI WULANDARI 312-14-03339 TRI JULIANA 312-14-03370 DAVID A 312-14-04500 IDA MUTIARA SIAHAAN 312-14-04670 PUSPITA SARI 312-14-05191 RIKKI WANDY PURBA 312-14-05556 SAMUEL P SAMOSIR 312-15-01783 LULU FAJARWATI 312-15-02166 WIDYA AFRIDIANI 312-15-03761 KUMALA PONTAS 312-15-04097 DEWI APRINA 312-15-04099 AHMAD FARABIH HSB 312-15-04177 RUTMAYANTI SIHOMBING 312-15-06324 V. FITRIANA S 312-15-07621 VINA YUSMADANI 312-15-08619 RUSFIANDI A 312-15-08667 SELVIA CITRA A 312-15-09573 CHARLESYULIANTO N 312-15-09587 ALFRIADY S M 312-15-10457 AIFO K PURBA 312-15-11753 NURMILA SARY

PENDIDIKAN GURU PENDIDIKAN ANAK USIA DINI (PG PAUD) 212-14-00029 ANNISA RAHMA 212-14-00443 NURAFNI SINAGA 212-14-01258 SITI RAHMAH 212-14-01586 WAHYUNI 212-14-01828 LIZA SEPTIA ARIFIN 212-14-02388 DEFITA KABAN 212-14-03139 ULFA MARINA BR. LBS 212-14-04066 DEWI SHINTA BR.LUBIS 212-14-05015 JELITA PURBA 212-14-05414 RIDHA FAHNIZAR 212-15-00217 PATMAWATI DALIMUNTHE 212-15-05806 LASNI R SIMBOLON 212-15-06728 LESTARI E SIBURIAN 212-15-08438 YUNITA S 212-23-03605 UTARY MONADEVY 312-14-00074 RIZKI WINITRI 312-14-00957 CHOIRUN NISYA BB 312-14-01307 ZAKIAH DARAJAT BBARA 312-14-01650 NURHIDAYATI 312-14-01831 RAHMI WARDAH NINGSIH 312-14-01923 WIDYA AMANDA PUTRI 312-14-02036 QAULAN RANIYAH 312-14-02664 AMALIYAH NUR C. NST 312-14-04619 NUR QOMARIAH 312-14-05876 WAHYU PRATAMA HSB 312-15-05627 WINDA ASTRIA D S 312-15-07565 ZONA E. B. SAGALA 312-15-09328 NIKEN FARIDA 312-15-09437 ARTHA ANGGREINY N 312-15-10535 DATIA INDIRA PUTRI 312-15-11391 UTIA FADILAH 312-19-03674 KHAIRA ADDHINI

PENDIDIKAN TATA RIAS 212-14-00425 INTAN QUA VADIS S 212-14-01030 DEWI KEMALA SARI 212-14-01037 NANDA PUTRI HAMID D 212-14-01738 ASRI H NAINGGOLAN 212-14-02951 WIDYA PUSPITA W 212-14-03282 DEWI SRI HANDAYANI 212-14-04841 IRMA R SIHITE 212-14-05125 BALQIS HUSNA RIZKI 212-14-06230 ROSIDA MARBUN 212-15-00762 SRI ULINA GINTING 212-15-02428 ROWLYYUNI ARTHA S 212-15-02720 ISMAWATI SORMIN 212-15-03821 YUSTIKA S P 212-15-04321 ONMAYAKI R SARAGI 212-15-05128 ELLINA N. P. PURBA 212-15-05548 LERYSTY TAMZALY 212-15-05601 LAURA MONICA 212-15-06641 GUSTINI SITUMORANG 212-15-06790 NINDI ERIKA BANGUN 212-15-07677 SITI KHOLIZAH 212-15-08906 WAHYU LESTARI 212-15-09358 ITA NOVIANA BR BUKIT 312-14-00475 TRY RUCI DAINICA 312-14-00750 ULFA ALAWIYAH 312-14-01251 MARINI HADI 312-14-01271 WIDIA L.SARAGIH 312-14-03429 ISNI APRIZA 312-14-03501 WULAN DARI 312-14-04154 ANGGREINA W 312-14-05418 DIAN EKA 312-14-06229 LASRONIKA TURNIP 312-15-00836 ISMA MAISARAH R 312-15-00873 ADELINA E T GINTING 312-15-01427 SANTY SITI RUKMANA S 312-15-01969 SISKA SEPRIANI KABAN 312-15-03028 ELEN G Y SILABAN 312-15-03749 SUFI MAHYANTI HUTASU 312-15-05018 MULIA NOPALINA S 312-15-05029 LIDYA KERISTIANI 312-15-09126 NOVA TRI YENI 312-15-09564 MUTIA HUSNAH 312-19-05848 NOVARINA LUMBAN GAOL 312-23-02722 ELSA FITRI TARIGAN PENDIDIKAN ANTROPOLOGI 212-11-20040 ISLAMIYATI 212-14-00124 JUHAIRIAH UTARI SRG 212-14-00259 RIZQA MULYA SARI LBS 212-14-00877 NOVALITA SANDY 212-14-00937 HIASINTUS IPI MANALU 212-14-01770 JOITRI ANANTA PURBA 212-14-01927 LAILAN SAKINAH 212-14-02070 APRIANDO SAPUTRA 212-14-02138 ANWAR SOLEH PURBA 212-14-02522 YUSTRI SIMAMORA 212-14-02985 NURTATY SIANIPAR 212-14-03181 GRACELIA NOVIANTI R 212-14-03203 LESTARI WULANDARI 212-14-03256 RIDAWATI BANGUN 212-14-04267 RINI HESTI NASUTION 212-14-04371 LELI PITRIA 212-14-04419 HERDY FREDYANTO P 212-14-04887 HANNA MELINA SIBORO 212-14-05583 EVAN LUMBANTOBING 212-14-05964 REYNA HUTAPEA 212-14-06134 HIKAYAH R T 212-14-06160 NOVITA FRANSISKA S 212-14-06455 FITRAH HABIBULLAH L 212-14-07288 JANWILSON SITANGGANG 212-14-07492 DINA SRI REJEKI S 212-15-00289 MELITA RENATA NDURU 212-15-00299 NONI ALFANITA S 212-15-00638 DANIEL O L TOBING 212-15-01033 ISNAINI 212-15-01786 AI R C GINTING 212-15-02230 RADO ARTAMA P 212-15-02994 BILL JEFF PASARIBU 212-15-03560 AMANDA DIAN SUCIA 212-15-03605 ASNIKA PUTRI S 212-15-04589 YAN SARDO SARAGIH 212-15-05686 TRI HARDIANTI H 212-15-07165 LUKAS P SIMORANGKIR 212-15-07619 KRISNA ABADI G 212-15-07818 YOSSI G BR SEMBIRING 212-15-07875 RESKITA PRATIWI S 212-15-08414 TENNI SIPAYUNG 212-15-08503 TULUS SIMATUPANG 212-15-08832 HERIK SWANDI 212-15-09179 WESLY PRANALTA 212-19-04833 IDA AYU LANTI 212-27-03990 ADONIA HERMANTO M 312-14-00191 SYUHADY WITANA 312-14-01181 SRI NURJANNAH SARAGI 312-14-01803 MUHAMMAD FADLI 312-14-02625 SINTAULI SITUMORANG 312-14-03171 TUANY S.J. MANIHURUK 312-14-03184 JHON HEPRY SIHITE 312-14-04295 IIS SOLEHA

PENDIDIKAN BIMBINGAN DAN KONSELING 212-14-00462 ELIA N LBN GAOL 212-14-00650 NURJANNAH KHAIRANI 212-14-01143 ANNISA MAULIDA YUSTI 212-14-01691 NITA INDAH SARI M 212-14-01918 CUT RIZKY FADILLAH 212-14-02371 TIARA MAULIA ANDIKA 212-14-02528 WIWIK A M 212-14-03785 M. FEBRY ALRA 212-14-04076 UMMI KALSUM HARAHAP 212-14-05448 DIAN AULIA PUTRI 212-14-05552 EMELIA APRIANI DEWI 212-14-05980 DWI BANGUNITA 212-15-01604 HEPPY CIBRO 212-15-02329 AGUS TRIANINGSIH SRG 212-15-03149 NURHASANAH HARAHAP 212-15-03220 M.KHUZAIRI BATU BARA 212-15-04411 FARAHDINA S 212-15-08319 NATALIA LUMBANTORUAN 212-15-08581 MITSALINA MUMTAZ 212-15-08717 AIDA NURUL FAZMA HSB 312-14-02321 AZHAR FADLI DONGORAN 312-14-02332 ANGGIA RIZKI H N 312-14-02389 SARDA SYAFRIDA 312-14-02929 RISTRA SANDRA R 312-14-03948 INDRA SINAGA 312-14-04269 M RIZA DARWIN 312-14-04736 SEPTIA K 312-14-05354 RINEHART SIRAIT 312-14-06096 FIKRI NURHUDA DINUL 312-14-06154 STAR C S 312-14-06449 MAULIZA QORINA 312-15-03124 ALFREDO BARUS 312-15-03241 CITA ANNISA 312-15-04216 ANDINI RAIHAN 312-15-07315 GRACE N PANJAITAN 312-15-08260 DITA NADHILA PUTRI 312-15-09148 EVY LIDYA NINGSIH H 312-15-09243 JOHAN 312-15-09840 MUKHAIRANI PUTRI NST 312-15-10165 HANNA M BR GINTING PENDIDIKAN AKUTANSI 212-14-00816 SISKA AGUSRINA 212-14-01070 YESSY GESELLA TRG 212-14-01252 DONALD GEE LG 212-14-02753 HERMONISTA GINTING 212-14-03022 VIDAWINATA LIMBONG 212-14-03649 CLARA S 212-14-03800 HABIB SUDIRA 212-14-03864 SITI RAMA FITRI 212-14-04002 REZA ADITIA 212-14-04155 EVIYANA 212-14-04191 ROSMAULITA A 212-14-04278 DESI MELA SARI 212-14-04315 ANDI NOVRIANTO 212-14-04358 DIMAS HABIB 212-14-04451 DWI ATIKA ANGGRAINI 212-14-04476 MUZDALIFAH LUBIS 212-14-05426 PRASPITA SAMOSIR 212-14-05693 MARTHA MALAU 212-14-06149 ASSAD ALDIWA 212-14-06613 IRMA ANGGRAINI 212-14-06977 ADE IRMA SURYANA 212-14-07754 JUANDI 212-15-02788 NUR SAFURA 212-15-03660 RAJA RAMOS PURBA 212-15-03924 ARTIKA M.W. SINAGA 212-15-04794 DESI MENTARI SIJABAT 212-15-05225 OZI FEISAL PARDEDE 212-15-05700 SANTA MERY SITEPU 212-15-05986 DEBORA VRISKA S 212-15-06673 SYUKUR S HAREFA 212-15-07455 SILVIA C S 212-15-07992 ANGGONO 212-15-08273 ELVIMA TOGATOROP 212-15-08329 MAHARANI PRATIKA 212-15-08821 ASRI HASANAH H 212-15-08987 VINA ARMITARA S 212-30-11924 TOLU MAWAR YOLANDA 312-14-00746 LILY HAIRANY 312-14-00835 SANDRO ARGA SIGIRO 312-14-01845 MASRIYANITANJUNG 312-14-02413 LAMRIA MANULLANG 312-14-02600 SYADZWANA P. U. NST 312-14-03142 DIYAN HAKIM 312-14-03461 PUTRI M SITANGGANG 312-14-03772 NELLY SYAHRINDA 312-14-05222 KRISTIANITA SITOHANG 312-14-05510 FADIYAH HANI SABILA 312-15-06128 LOLLA SIMANJUNTAK 312-15-07132 DWI AYU SABRINA 312-15-07374 MONALISA 312-15-09251 FRANS WARREN STG 312-15-09582 HUSNUL ARIF 312-15-09794 WIDYA HARLITA 312-15-09849 ESTER L G 312-15-10794 DEWI SELFRANSISKA 312-15-11020 HAPRILA PUTRI G

Waspada, Sabtu 7 Juli 2012  

waspada daily

Waspada, Sabtu 7 Juli 2012  

waspada daily
