Page 1

Harga Eceran Rp2.500,-

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

SABTU, Wage, 25 Mei 2013/15 Rajab 1434 H

No: 24233 Tahun Ke-67

Terbit 20 Halaman

Bayern Atau Dortmund LONDON (Waspada): Markas besar sepakbola Inggris segera dipenuhi teriakan-teriakan khas Jerman, ketika Bayern Munich dan Borussia Dortmund bertarung pada final Liga Champions di Stadion Wembley. Hanya berselang dua tahun sejak Barcelona menaklukkan Manchester United di tempat sama untuk merajai Eropa, cara Bayern dan Dortmund musim ini memperlihatkan peta

kekuatan Benua Biru telah bergeser. Jerman sekarang berkuasa, menepikan dominasi Spanyol dan Inggris. FC Hollywood menghancurkan Barca agregat 7-0 di semifinal, Dortmund menyingkirkan Real Madrid agregat 4-3 di etape sama. Riwayat klub Inggris malah hanya sampai babak 16 saja saja. Lanjut ke hal A2 kol. 7

design by Marwan

Disdiksu Revisi Hasil UN 2013

SMA/SMK Eria Lulus 100 Persen, Juga Shafiyyatul Amaliyyah, Harapan I, Al Azhar Bandar Narkoba Tewas Ditembak MEDAN (Waspada): Polisi menembak mati seorang pria diduga bandar narkoba berinisial BS di Jalan Djamin Ginting, Pancurbatu, Sibolangit, Jumat (24/5) dinihari. Penembakan itu terjadi ketika aparat menyergap tersangka bersama tiga temannya di sebuah rumah. Kabid Humas Poldasu Kombes Raden Heru Prakoso didampingi Waka Polresta AKBP Pranyoto dan Kasat Reserse Narkoba Kompol Dony Alexander kepada wartawan di RS

Bhayangkara Medan mengatakan, peristiwa terjadi sekira pukul 03:00 di Jalan Djamin Ginting Medan persisnya 200 meter dari sebuah rumah makan. Menurut Heru, pada dinihari itu jajaran Reskrim Polsekta Pancurbatu melakukan Operasi Antik Toba 2013 di kawasan Pancurbatu yang terindikasi sebagai sarang narkoba dan perjudian. Lanjut ke hal A2 kol. 6

MEDAN (Waspada): Dinas Pendidikan Sumut, Jumat (24/5) malam, merevisi hasil Ujian Nasional (UN) 2013. “Data pengumuman hasil UN disampaikan kemarin itu, salah karena belum dihitung secara utuh, masih bolongbolong. Untuk itu, hari ini data itu kami revisi,” kata Kepala Dinas Pendidikan Sumut (Kadisdik) Muhammad Zein kepada wartawan di Dinas Pendidikan Sumut. Didampingi Sekretaris Pendidikan Sumut, Hendri Siregar dan Ketua Panitia UN Sumut Yusri, SH, Muhammad Zein menegaskan setelah merekapitulasi secara manual

jumlah siswa yang tidak lulus UN tidak sebanyak jumlah yang diberitakan berbagai media massa.. Dia mengatakan berdasarkan hasil penghitungan secara akurat dari jumlah peserta 117.461, siswa tidak lulus UN 2013, hanya 253 orang atau sekitar 0,22 persen. ” Persentase kelulusan UN Di Sumut sekitar 99,78 persen. Pencapaian ini melebihi persentase kelulusan secara nasional,” kata Zein.

Presiden Prihatin Soal Intoleransi JAKARTA (Antara) : Presiden Susilo Bambang Yudhoyono berbagi keprihatinan yang sama dengan sejumlah kalangan tentang masalah intoleransi dalam masyarakat. Presiden, seperti dikatakan Staf khusus Presiden bidang Komunikasi Politik Daniel Sparringa, di Jakarta, Jumat (24/5) melalui pesan tertulisnya, berpandangan bahwa semua kelompok yang berbeda faham dan keyakinan memiliki tanggung jawab yang sama untuk

memelihara harmoni sosial. “Semua orang hendaknya mencegah dirinya terlibat dalam pengabaian akan pentingnya menghormati keyakinan yang dimiliki kelompok lain,” kata Presiden. Pernyataan init terkait polemik pemberian award dari Appeal Conscience Foundation kepada Yudhoyono. Disebutkan, kesaling-pengertian dan

Lanjut ke hal A2 kol. 6

Lanjut ke hal A2 kol. 3

Menkominfo: Tingkatkan Komunikasi Humas Pemerintah Dengan Media

Waspada/Surya Efendi

SEJUMLAH siswi SMA Negeri 1 Medan gembira usai menerima surat lulus Ujian Nasional (UN), Jumat (24/5).

Dua Anggota Polisi Nyabu Ditangkap MEDAN (Waspada): Dua anggota polisi bertugas di Polres Labuhanbatu tertangkap tangan saat berpesta sabu bersama empat orang lainnya di satu rumah Jl. Kampung Baru, Kompleks Puri, Rantauprapat, Kab. Labuhanbatu. Kedua polisi itu, Brigadir FC dan Brigadir TN. “Dari keterangan warga, sudah hampir setahun rumah yang ditempati Brigadir FC itu selalu ramai dikunjungi tamu, sehingga dicurigai ada kegiatan peredaran narkoba,” kata Direktur Dit Res Narkoba Poldasu Kombes Pol. Toga H Pan-

jaitan, Jumat (24/5). Berdasarkan informasi itu, tim bentukan Dit Res Narkoba Poldasu melakukan penyelidikan, kemudian menangkap keduanya itu bersana empat warga sipil yaitu AH, 27, IFFS, 30, CSN, 30 dan A, 30. Mereka ditangkap pada Kamis (23/5). Dari lokasi penggerebekan, ditemukan barang bukti dua paket kecil sabu seberat 0,89 gram dan 0,77 gram. Juga ditemukan alat isap sabu (bong) dan dua mobil yakni Toyota Avanza dan Daihatsu Xenia. “Seluruh barang bukti sudah diamankan di Poldasu,” ujar

Al Bayan

Air Mata

Oleh: Tgk. H. Ameer Hamzah MAHA Pencipta Allah Jalajalaluh menciptakan mata manusia begitu indah, diletakkan dalam lubang yang terlindung. Kelopak mata yang seperti berpagar, juga kedipannya yang cepat dapat melindungi dari anasir-anasir yang masuk seperti nyamuk, serangga dan sebagainya. Kelopak mata yang mudah dibuka dan dikatup, di pinggirnya tumbuh bulu-bulu yang indah (bulu mata) adalah untuk mempercantik wajah. Juga bulu kening (alis) yang tumbuh serasi di atas dua mata. Struktur mata memiliki tujuh lapisan, setiap lapisan berfungsi untuk penglihatan. Jika salah satu lapisan itu rusak, manusia tidak bisa melihat lagi. Allah juga menciptakan air mata yang berfungsi untuk membersihkan mata dari kotoran. Air mata mengandung zat asin yang bisa menyapu zat luar yang masuk ke mata. Lanjut ke hal A2 kol. 3

Panjaitan. Saat ini polisi masih melakukan pengembangan asal sabu tersebut, termasuk “melacak” keberadaan bandarnya. “Dari keterangan para tersangka, kita menyimpan satu nama berinisial F, kemungkinan dia masih di Labuhanbatu,” sebutnya. Petugas, kata Panjaitan, juga menyelidiki kemungkinan adanya anggota polisi lainnya yang terlibat dalam kasus tersebut. Sedangkan tes urine yang dilakukan, terbukti seluruh pelaku yang ditangkap postif menggunakan narkoba.(m27)

MEDAN (Waspada): Menteri Komunikasi dan Informasi Tifatul Sembiring menyebutkan, komunikasi Humas pemerintah dengan awak media baik itu kepada wartawan atau pun Pemrednya masih perlu ditingkatkan. Hal tersebut dalam upaya meningkatkan pemberitaan positif dan prestasi kinerja pemerintah. Demikian diungkapkan Menteri Komunikasi dan Informatika (Menkominfo) RI H Tifatul Sembiring saat membuka pertemuan Bakohumas Regional Barat di Hotel Grand Aston Medan, Jumat (24/5). Turut hadir Wakil Menteri Pemberdayaan Aparatur Negara dan Reformasi Birokrasi Prof. Dr. Eko Prasojo, SIP, Gubsu

Gatot Pujo Nugroho, pejabat eselon I dan II di jajaran Kementerian Kominfo, utusan Perguruan Tinggi Negeri dan ratusan utusan Humas Provinsi, Kabupaten dan Kota se Indonesia Regional Barat. Tifatul dalam arahannya menegaskan pentingnya kompetensi kehumasan pemerintah. Kurun waktu terakhir dalam pantauannya media terkesan kehilangan idealisnya. “Kita melihat satu orang miskin yang tidak mampu sekolah beritanya tayang sampai 24 jam. Bukan kita tidak menghargai itu tetapi coba lihat begitu banyaknya kerja pemerintah dan torehan prestasi yang diraih itu kurang diekspos,” sesalnya. Lanjut ke hal A2 kol. 5

Pesawat Tabrak Burung, Bandara Heathrow Ditutup LONDON, Inggris (Waspada): Landasan pacu Bandara Heathrow, London, Inggris, ditutup setelah satu pesawat maskapai British Airways mendarat darurat akibat mesinnya rusak berat, diduga setelah menabrak sekawanan burung di udara. Menurut IBTimes, Jumat

(24/5), pesawat itu baru saja tinggal landas dari Heathrow menuju Oslo sebelum putar balik dan kembali mendarat. Pemadam kebakaran kota London dikerahkan untuk memadamkan api pada salah satu mesin pesawat.

Lanjut ke hal A2 kol. 6


MENTERI Kominfo Tifatul Sembiring memukul gong tanda dibukanya pertemuan Bakohumas Regional Barat di Hotel Grand Aston Medan, Jumat (24/5).

KPK Dalami Aliran Dana Fathanah Ke Anis J A K A RTA ( Wa s p a d a ) : Komisi Pemberantasan Korupsi (KPK) mendalami aliran dana tersangka Ahmad Fathanah ke petinggi Partai Keadilan Sejahtera, seperti ke Presiden PKS Anis Matta dan Menteri Pertanian Suswono. Fathanah merupakan tersangka kasus dugaan korupsi dan pencucian uang kuota impor daging sapi yang disebut-sebut sebagai makelar atau calo proyek. “Yang untuk ke Anis Matta, perlu didalami dan sedang didalami. Sama saja yang untuk ke Pak Suswono,” kata Busyro, dalam perjalanan menuju Loka-

karya Media di Cijeruk, Bogor, Jawa Barat, Jumat (24/5). Busyro melanjutkan, keterangan Suswono dan Anis sebagai saksi selama ini perlu didalami dan dibandingkan dengan bukti-bukti lain. “Bisa dengan saksi, bisa bukti suratsurat, rekaman-rekaman,” ujarnya. KPK pernah memeriksa Anis dan Suswono sebagai saksi terkait penyidikan kasus dugaan korupsi dan pencucian uang kuota impor daging sapi yang menjerat mantan Presiden PKS, Luthfi Hasan Ishaaq; serta Fathanah. Seusai dipe-

Peraih Nilai UN Tertinggi Ingin Kuliah Kedokteran Jarang Nonton TV Dan Ber-HP Ria Helena Peringkat ll UN

DENPASAR (Antara): Ni Kadek Vani Apriyanti (foto), siswa SMAN 4 Denpasar, peraih nilai ujian nasional murni tertinggi jenjang SMA di Tanah Air mengaku ingin melanjutkan kuliah di Fakultas Kedokteran Universitas Udayana. “Saya masih belum ada kepastian akan masuk Fakultas Kedokteran lewat tes atau tidak setelah berhasil meraih nilai UN tertinggi ini,” katanya di Denpasar, Jumat (24/5). Sebelumnya Mendikbud M Nuh mengatakan Bali meraih prestasi gemilang dengan berada di posisi teratas untuk sekolah dan siswa dengan nilai rata-rata UN murni terbaik. Untuk kategori sekolah, SMAN 4 Denpasar menjadi yang terbaik dengan nilai rata-rata UN mencapai 9,17 dan kategori siswa Ni Kadek Vani Apriyanti dari SMAN 4 Denpasar juga berada di urutan teratas dengan nilai rata-rata 9,87.

PENGUMUMAN kelulusan UN (Ujian Nasional), Jumat (24/5), menjadi saat membahagiakan bagi Helena Marthafriska Saragi Napitu, pelajar SMA Swasta Methodist 2 Medan. Ia tercatat sebagai siswa yang menduduki rangking kedua nasional, dengan nilai rata-rata UN Murni 9,78. Bertemu dengan Helena di sekolahnya, kemarin, ia nampak sangat bahagia dan bercerita bagaimana dia mampu meraih nilai terbaik ini. Meski sekolah di lingkungan yang siswanya kebanyakan etnis Tionghoa, ternyata tidak menggugurkan niatnya untuk bertahan di sekolah ini.

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 3

riksa, Anis mengakui ada salinan sertifikat lahan miliknya yang ditemukan penyidik KPK dalam tas Fathanah saat orang dekat Luthfi itu ditangkap KPK pada 29 Januari 2013. Meski demikian, Anis mengaku tidak begitu mengenal Fathanah. Menurut Anis, lahan miliknya itu dikelola adiknya, Saldi Matta. Anis mengatakan bahwa Fathanah pernah menawar lahan itu kepada Saldi, tetapi transaksi jual beli di antara kedua belah pihak tidak pernah terjadi.

Lanjut ke hal A2 kol. 6

Ada-ada Saja Mengaku Koruptor Agar Hidup Tenang BERMODAL kejujuran dan mau menerima risiko dari perbuatannya, mantan Kepala Desa Klodran, Colomadu, Karanganyar, Endah Rahmanto Hermansyah ,42, mengakui

Lanjut ke hal A2 kol. 2

Serampang Waspada/Anum Saskia

HELENA Marthafriska Saragi Napitu bersama orang tuanya saat mengambil tanda kelulusan di sekolahnya SMA Methodist 2 Medan, Jumat (24/5). Lanjut ke hal A2 kol. 2

- Syukurlah nggak jadi meraung - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SABTU, Wage, 25 Mei 2013/15 Rajab 1434 H z zNo: 24233 * Tahun Ke-67

Terbit 20 Halaman

Adu Statistik Bayern Muenchen dan Borussia Dortmund sama-sama dikenal sebagai klub yang memiliki banyak variasi serangan. Terbukti, sampai babak final, Bayern sudah menghasilkan 29 gol, sementara Dortmund menjaringkan 23 gol. Partai final Liga Champions yang akan berlangsung di Stadion Wembley, Sabtu (25/5) waktu setempat atau Minggu (26/5) pkl

01.45 Wib, juga kemungkinan terhindar dari kartu merah. Pasalnya, sepanjang turnamen musim ini digelar, hanya Jerome Boateng (Bayern Muenchen) yang sudah menerima kartu merah. Belum ada satu pun pemain Dortmund yang diusir keluar lapangan. Lanjut ke hal A2 kol. 6

design: Marwan

Bandar Narkoba Tewas Didor Dua Oknum Polisi Nyabu Ditangkap MEDAN (Waspada): Dua oknum polisi bertugas di Polres Labuhanbatu tertangkap tangan saat berpesta sabu bersama empat orang lainnya di satu rumah Jl. Kampung Baru, Kompleks Puri, Rantauprapat, Kab. Labuhanbatu. Kedua oknum polisi itu, Brigadir FC dan Brigadir TN. “Dari keterangan warga, sudah hampir setahun rumah yang ditempati Brigadir FC itu

selalu ramai dikunjungi tamu, sehingga dicurigai ada kegiatan peredaran narkoba,” kata Direktur Dit Res Narkoba Poldasu Kombes Pol. Toga H Panjaitan, Jumat (24/5). Berdasarkan informasi itu, tim bentukan Dit Res Narkoba Poldasu melakukan penyelidikan, kemudian menangkap kedua okum itu bersana empat warga sipil yaitu AH, 27, IFFS, 30, CSN, 30 dan A, 30.

Mereka ditangkap pada Kamis (23/5). Dari lokasi penggerebekan, ditemukan barang bukti dua paket kecil sabu seberat 0,89 gram dan 0,77 gram. Juga ditemukan alat isap sabu (bong) dan dua mobil yakni Toyota Avanza dan Daihatsu Xenia. “Seluruh barang bukti sudah diamankan di Poldasu,” Lanjut ke hal A2 kol 1

MEDAN (Waspada): Seorang anggota Reskrim Polsek Pancurbatu Bripka Tumpak Sihombing terpaksa menembak seorang lelaki diduga bandar narkoba, setelah lelaki tersebut nekat menikam Sihombing saat duel satu lawan satu di Jl. Djamin Ginting Medan-, Pancurbatu, Sibolangit, Jumat (24/5) dinihari. Lelaki tersebut, BS tewas di tempat kejadian.Mayatnya dievakuasi ke RS Bhayangkara untuk keperluan visum. Sedangkan Bripka Tumpak Sihombing menderira luka di kepala akibat pukulan benda keras dilakukan BS, dan

tangannya menderita luka tikam. Kabid Humas Poldasu Kombes Raden Heru Prakoso didampingi Waka Polresta AKBP Pranyoto dan Kasat Lanjut ke hal A2 kol 6

Presiden Prihatin Soal Intoleransi JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono berbagi keprihatinan yang sama dengan sejumlah kalangan tentang masalah intoleransi dalam masyarakat. Presiden, seperti dikatakan Staf khusus Presiden bidang Komunikasi Politik Daniel Sparringa, di Jakarta, Jumat (24/5) melalui pesan tertulisnya, berpandangan bahwa semua kelompok yang berbe-

da faham dan keyakinan memiliki tanggung jawab yang sama untuk memelihara harmoni sosial. “Semua orang hendaknya mencegah dirinya terlibat dalam pengabaian akan pentingnya menghormati keyakinan yang dimiliki kelompok lain,” kata Presiden. Pernyataan init terkait polemik pemberian award dari Appeal Co n s c i e n c e Fo u n d a t i o n

kepada Yudhoyono. Disebutkan, kesalingpengertian dan kesaling-penghormatan adalah norma dasar dalam masyarakat majemuk. “Intoleransi adalah tantangan masyarakat majemuk yang harus kita menangkan dengan membangun dialog yang setara, bukan dengan menyebarkan permusuhan dan Lanjut ke hal A2 kol 3

Zaini Sedih, Aceh Terbanyak Tak Lulus UN BANDA ACEH (Waspada): Gubernur Aceh Zaini Abdullah menyatakan sedih mendengar hasil kelulusan Ujian Nasional (UN) tahun 2013 untuk jenjang pendidikan SMA/MA dan SMK di daerahnya yang menduduki rangking satu nasional. “Sedih juga kita dengar Aceh nomor satu paling banyak tidak lulus,” ujar Gubernur Aceh Zaini Abdullah menjawab wartawan tentang banyaknya pelajar jenjang pendidkkan SMA/MA dan SMK tidak lulus UN tahun 2013, Jumat (24/5) di Banda Aceh. Sebagaimana diumumkan Mendikbudnas Muhammad Nuh, hasil UN tahun 2013, Provinsi Aceh paling banyak tidak lulus yang mencapai 3,11 persen dan berada di urutan pertama nasional, disusul Papua 2,85 persen, Sulteng 2,32 persen dan Maluku 2,21 persen. Lanjut ke hal A2 kol 5

Waspada/Mustafa Kamal

PETUGAS pemadam dan warga menyemprot air ke kobaran api saat terjadi kebakaran di Lorong I, Desa Hagu Selatan, Kecamatan Banda Sakti, Lhokseumawe, Jumat (24/5).

Pemko Lhokseumawe, satu jam kemudian. “Saya sedang lelap tidur, tiba-tiba mendengar teriak orang meminta tolong. Kami sekeluarga hanya sempat mengambil beberapa pakaian,” ujar Absah, 46, sambil menetes air mata melihat puing-puing rumahnya di Lorong I, Jumat (24/5).

ACEH UTARA (Waspada): Sebanyak 253 dari 6.191 siswa SMA/MA di Kab. Aceh Utara tidak lulus Ujian Nasional (UN).. Persentase kelulusan UN SMA sederajat di Aceh Utara tahun ini 95,88 persen.Tahun lalu 99,30 persen. Di Kota Lhokseumawe , jumlah siswa tidak lulus hanya 5 orang, dengan persentase kelulusan 99,9 persen. Azhari, Ketua Panitia UN Aceh Utara, Jumat (24/5) di ruang kerjanya menjelaskan, karena banyaknya jumlah siswa tidak lulus, maka 9 sekolah di Aceh Utara, pengumuman kelulusan harus ditempelkan di Mapolsek dari kecamatan masing-masing. Ke sembilan sekolah tersebut yaitu SMAN I Dewantara, SMAN I Tanah Luas, MAN Matangkuli, MAN Sumbok SMAN I Lhoksukon, SMAN I Langkahan, MAS Seunuddon, SMAN I Meurah Mulia, dan SMAN I Baktya Barat. Dari 9 sekolah tersebut, yang paling banyak peserta

Lanjut ke hal A2 kol 4

Lanjut ke hal A2 kol 6

24 Rumah Nelayan Terbakar LHOKSEUMAWE (Waspada): Sebanyak 24 rumah milik nelayan di Gampong Hagu Selatan, Kec. Banda Sakti, Lhokseumawe ludes terbakar, Jumat (24/5) dinihari. Tidakada korban jiwa, namun kerugian miliaran rupiah, termasuk empat rumah kosong. Penyebab sementara karena korsleting arus listrik. Pantauan Waspada, sekitar 20 menit setelah kejadian,

nampak api sudah membesar, dan telah menjalar. Sementara mobil pemadam yang terlebih dulu tiba di lokasi kejadian mencoba memadamkan api, meskipun terjadi beberapa kendala seperti susah membawa fire hose (selang pemadam) ke titik api karena jauh dengan jalan sekitar 100 meter dan air macat. Api baru dapat dipadamkan tujuh armada pemadam kebakaran milik

Al Bayan

Air Mata Oleh: H. Ameer Hamzah MAHA Pencipta Allah Jalajalaluh menciptakan mata manusia begitu indah, diletakkan dalam lubang yang terlindung. Kelopak mata yang seperti berpagar, juga kedipannya yang cepat dapat melindungi dari anasiranasir yang masuk seperti nyamuk, serangga dan sebagainya. Kelopak mata yang mudah dibuka dan dikatup, di pinggirnya tumbuh bulu-bulu yang indah (bulu mata) adalah untuk mempercantik wajah. Juga bulu kening (alis) yang tumbuh serasi di atas dua mata. Struktur mata memiliki tujuh lapisan, setiap lapisan berfungsi untuk penglihatan. Jika salah satu lapisan itu rusak, manusia tidak bisa melihat lagi. Allah juga menciptakan air mata yang berfungsi untuk membersihkan mata dari kotoran. Air mata mengandung zat asin yang bisa menyapu zat luar yang masuk ke mata. Ketika manusia senang (tertawa) atau sedih air mata Lanjut ke hal A2 kol 2

Di Aceh Utara 253 Siswa Tidak Lulus


TAS DIDUGA BOM DI KEJAGUNG. Anggota penjinak bom mendeteksi tas hitam yang diduga berisi bom di depan kantor Kejaksaan Agung, Jakarta, Jumat (24/5). Setelah diperiksa tim penjinak bom, tas tersebut hanya berisi sebuah laptop, kitab suci Alquran, dan beberapa potong pakaian.

KPK Dalami Aliran Dana Fathanah Ke Anis

JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) mendalami aliran dana tersangka Ahmad Fathanah ke petinggi Partai Keadilan Sejahtera, seperti ke Presiden PKS Anis Matta dan Menteri Pertanian Suswono. Fathanah merupakan tersangka kasus dugaan korupsi dan pencucian uang kuota impor daging sapi yang disebut-sebut sebagai makelar atau calo proyek.

“Yang untuk ke Anis Matta, perlu didalami dan sedang didalami. Sama saja yang untuk ke Pak Suswono,” kata Busyro, dalam perjalanan menuju Lokakarya Media di Cijeruk, Bogor, Jawa Barat, Jumat (24/5). Bu s y ro m e l a n j u t k a n , keterangan Suswono dan Anis sebagai saksi selama ini perlu didalami dan dibandingkan dengan bukti-bukti lain. “Bisa

Peraih Nilai UN Tertinggi Ingin Kuliah Kedokteran

Helena Peringkat ll UN Yang Jarang Nonton TV Dan BerHP Ria

NI KADEK Vani Apriyanti, siswa SMAN 4 Denpasar, peraih nilai ujian nasional murni tertinggi jenjang SMA di Tanah Air mengaku ingin melanjutkan kuliah di Fakultas Kedokteran Universitas Udayana. “Saya masih belum ada kepastian akan masuk Fakultas Kedokteran lewat tes atau tidak setelah berhasil meraih nilai UN tertinggi ini,” kata Ni Kadek Vani Apriyanti (foto) di Denpasar, Jumat (24/5). Sebelumnya Mendikbud M Nuh mengatakan Provinsi Bali meraih prestasi gemilang dengan berada di posisi teratas untuk sekolah dan siswa dengan nilai rata-rata UN murni terbaik. Untuk kategori sekolah, SMAN 4 Denpasar menjadi yang terbaik dengan nilai rata-rata UN mencapai 9,17 dan kategori siswa Ni Kadek Vani Apriyanti dari SMAN 4 Denpasar juga berada di urutan teratas dengan nilai ratarata 9,87. Terkait kesuksesannya menjadi peraih nilai UN tertinggi, siswa program IPA asal Gianyar ini mengatakan makin mengintensifkan belajar mendekati UN.

PENGUMUMAN Ujian Nasional, Jumat (24/5), menjadi saat membahagiakan bagi Helena Marthafriska Saragi Napitu (foto), pelajar SMA Swasta Methodist 2 Medan. Ia tercatat sebagai siswa yang menduduki rangking kedua nasional, dengan nilai rata-rata UN Murni 9,78. Bertemu dengannya di sekolahnya, kemarin, Helena nampak sangat bahagia dan bercerita bagaimana dia mampu meraih nilai terbaik ini. Meski sekolah di lingkungan yang siswanya kebanyakan etnis Tionghoa, ternyata tidak menggugurkan niatnya untuk bertahan di sekolah ini. Sejak kecil, Helena memang tertarik dengan sekolah yang dikenal sangat disiplin dengan berbagai peraturan dan sistem pembelajaran dan siswanya selalu juara dalam berbagai lomba. Helena sendiri mengakui jika awalnya sulit beradaptasi dengan teman sebayanya yang selalu berbahasa etnis Tionghoa dengan bahasa Hokkian. Tetapi sebagai anak yang tidak mau menyerah dengan keadaan, Helena akhirnya berusaha untuk belajar menyesuaikan diri dan bisa menjadi siswa yang terpandai di sekolahnya. Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 2

dengan saksi, bisa bukti suratsurat, rekaman-rekaman,” ujarnya. KPK pernah memeriksa Anis dan Suswono sebagai saksi terkait penyidikan kasus dugaan korupsi dan pencucian uang kuota impor daging sapi yang menjerat mantan Presiden PKS, Luthfi Hasan Ishaaq; serta Fathanah. Seusai Lanjut ke hal A2 kol 1

Ada-ada Saja

Mengaku Koruptor Agar Hidup Tenang

BERMODAL kejujuran dan mau menerima risiko dari perbuatannya, mantan Kepala Desa Klodran, Colomadu, Karanganyar, Endah Rahmanto Hermansyah ,42, mengakui segala tindakannya menyelewengkan uang Anggaran

Lanjut ke hal A2 kol 4

Serampang - Awak pegang Munchen - He.... he....he....

Berita Utama


KPK Dalami ....

diperiksa, Anis mengakui ada salinan sertifikat lahan miliknya yang ditemukan penyidik KPK dalam tas Fathanah saat orang dekat Luthfi itu ditangkap KPK pada 29 Januari 2013. Meski demikian, Anis mengaku tidak begitu mengenal Fathanah. Menurut Anis, lahan miliknya itu dikelola adiknya, Saldi Matta. Anis mengatakan bahwa Fathanah

DuaOknum ....

ujar Panjaitan. Saat ini polisi masih melakukan pengembangan asal sabu tersebut, termasuk “melacak” keberadaan bandarnya. “Dari keterangan para tersangka, kita menyimpan satu nama berinisial F, kemungkinan dia masih di Labuhanbatu,” sebutnya. Petugas, kata Panjaitan, juga menyelidiki kemungkinan adanya oknum polisi lainnya yang terlibat dalam kasus tersebut. Sedangkan tes urine yang dilakukan, terbukti seluruh pelaku yang ditangkap postif menggunakan narkoba. (m27)

Helena Peringkat II ....

“Sejak kecil saya sudah tertarik dengan sekolah ini. Siswanya tercatat sebagai orang yang berhasil dengan prestasi yang memuaskan. Bahkan kakak saya yang kini kuliah di Universitas Indonesia kini semester IV lulusan sekolah ini. Kami banyak kesempatan untuk ikut kompetisi agar selalu mengasah kemampuan. Di sekolah ini, kami mendapat kesempatan bimbingan secara gratis, sehingga kami lebih mudah mendapatkan berbagai ilmu pengetahuan. Sebelum UN ada bimbingan gratis bersama guru mata pelajaran, sehingga usaha tidak sia-sia. Saya juga ikut Bimbel di Ganesha dan selalu meraih nilai terbaik,” kata Helena yang mengaku sangat sering bertanya pada

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Ke6+, Rh7. 2. Bxf7+, Rg8. 3. Bf8+, Rh7. 4. Bd7+mat. (Atau 3. Bg7+, Rh8. 4. Bd8+mat). Jawaban TTS: TTS Topik

Musik & Filem

pernah menawar lahan itu kepada Saldi, tetapi transaksi jual beli di antara kedua belah pihak tidak pernah terjadi. Saat dikonfirmasi soal sertifikat lahan ini, Busyro mengatakan bahwa hal itulah yang sedang didalami KPK. “Itu yang sedang didalami terus,” ucapnya. Sementara itu, Menteri Pertanian Suswono terungkap pernah mengadakan pertemuan dengan Fathanah. Tim jaksa KPK memiliki bukti fotofoto yang menunjukkan Suswono satu meja dengan Fathanah. Menurut Suswono, dia memang beberapa kali bertemu dengan Fathanah. Selain pertemuan di Medan, Suswono bertemu Fathanah di Takalar dan di rumah Wali Kota Makassar. Saat di Takalar, menurut Suswono, Fathanah tengah bersama Anis Matta. Sementara itu, pertemuan di Medan, katanya, difasilitasi Luthfi. Suswono mengaku dipertemukan dengan D irektur Utama PT Indoguna Utama Maria Elizabeth Liman oleh Luthfi di Medan. (kcm)

8 6 9 0 1 4 3 2 5 7

4 2 8 7 5 6 0 9 1 3

7 5 6 3 0 9 8 1 4 2

1 9 2 4 7 3 6 5 0 8

9 7 4 2 6 5 1 3 8 0

3 1 0 6 8 2 4 7 9 5

6 4 7 5 3 0 9 8 2 1

2 8 1 9 4 7 5 0 3 6

5 0 3 8 9 1 2 6 7 4

kebencian”. Presiden SBY menegaskan kembali bahwa Negara menjamin sepenuhnya kebebasan warga negara menjalankan ibadahnya sesuai dengan kepercayaan dan keyakinannya. Adalah peran tokoh masyarakat dan agama untuk menyemaikan perdamaian dan kerja sama di antara kelompok kelompok yang berbeda kepercayaan dan keyakinannya” Daniel mengatakan Presiden SBY juga akan senantiasa bekerja dengan seluruh kekuasaan dan kewenangan yang diberikan konstitusi kepadanya untuk memastikan diakhirinya semua bentuk intimidasi dan agitasi termasuk yang melibatkan kekerasan, perusakan, dan atau penyerangan terhadap rumah ibadah dan atau terhadap keselamatan harta dan jiwa penganutnya. Meskipun diakui bahwa tidak selamanya upaya itu berhasil, Presiden SBY tidak

akan pernah surut melakukan semua upaya yang mengancam hak-hak warga negara untuk menjalankan ibadahnya dalam suasana aman, terbebas dari rasa takut. Presiden memerintahkan seluruh jajaran pemerintahan di pusat dan di daerah untuk menjalankan amanah undang-undang dan konstitusi dengan penuh tanggung jawab. Presiden juga telah menginstruksikan agar aparatur kepolisian memberikan jaminan agar semua kelompok dapat memenuhi penggilan ibadahnya. Polri harus mampu memelihara kemanan dan ketertiban umum, siang dan malam. Mengenai penghargaan, Daniel mengatakan, menerima penghargaan bukan dan tidak pernah menjadi tujuan Pemerintahan SBY. Ia hanya memiliki kehendak untuk melakukan yang terbaik yang ia bisa berikan kepada rakyat dan negerinya. De n g a n s e g a l a k e k u rangannya, baik sebagai manusia biasa maupun sebagai pemimpin, SBY ingin memenuhi komitmen konstitusional dan personalnya untuk menjaga kebhinekaan sebagai bangunan dasar dari Republik ini. “Penghargaan tidak akan membuatnya silau. Cacian juga tidak akan membuatnya

berkecil hati untuk menjalankan amanah dalam sisa masa kepemerintahannya,” kata Daniel. Ia hanya meminta agar semua pihak paham bahwa kemajemukan adalah sebuah berkat sekaligus tantangan. “Kita perlu merayakan sekaligus mengelolanya. Kita perlu konstitusi dan hati yang besar untuk memajukan Indonesia”

24 Rumah ....

warga mencapai Rp1 miliar lebih. Rumah sewa ini pemiliknya meliputi, Azharoen, 46, Absah, 46, Riawan, 42, Jamaluddin, 32, Halimah, 75, M. Nur, 42, Syahrul Syah, 45, Yusri, 29, Irvan, 38, Agustiar, 29, Rasmia, 45, Abdullah, 50, Zahlul, 36, Saifullah, 45, Nazariah, 27, Zakir, 36, Dinnur, 42, Sabariah, 38, Azwir, 31, Noval, 35, Asmawati, 48, Nurdin, 50, Hanafiah, 33, Salahuddin, 35, dan Zainuddin, 28. Sementara bantuan, sampai kemarin siang baru diterima korban diserahkan Wa l i K o t a S u a d i Ya h y a . Kemudian sembako dar i Baitulmal, dan pakaian dari masyarakat sekitar. (cmk)

Peraih Nilai ....

saya belajar terus sampai titik jenuh saya tercapai,” ucap anak kedua dari tiga bersaudara itu. Tak hanya meraih prestasi di UN, Vani sebelumnya sempat meraih medali perunggu pada Olimpiade Sains Nasional di Jakarta. Selain Vani, ada empat siswa dari Bali lainnya yang menembus daftar 12 besar peraih nilai rata-rata UN terbaik nasional.

Pendapatan dan Belanja Desa (APBD) sebesar Rp 285,9 juta di depan persidangan. Saat ditemui di rumahnya di Desa Klodran RT 2/RW1, Colomadu, Karanganyar, Jawa Tengah, Endah menceritakan pergulatan batin dirinya saat terbongkarnya kasus korupsi hingga menjalani masa pidana selama satu tahun dua bulan. Dia divonis pada 14 Maret 2011 dan bebas pada Januari 2012. “Selama tujuh bulan pertama di bui dan proses persidangan mulai berakhir, banyak orang mencoba menasihati saya untuk menyewa pengacara dan “nyokot” orang-orang yang diduga terlibat. Namun, saya memilih untuk tidak melakukannya dan mencoba untuk menanggung sendiri risikonya,” katanya, Rabu (23/5). Kepala Desa Klodran masa jabatan 2007-2013 tersebut

tertawa dan menangis”(QS. Annajmu:43). Dalam hadis dari Ibnu Mas’ud, beliau mendengar Rasulullah bersabda: Mata yang menangis karena takut kepada Allah dan mata yang terjaga untuk kepentingan di jalan Allah. (HR:Tarmizi). Dalam hadis lain disebutkan; menangis karena terharu, misalnya dalam berdoa, membaca Alquran, hadis, tentang ayat-ayat azab dalam neraka, orang seperti itu juga mendapat fahala dari Allah.

(HR. Ibnu Majah. Bagaimana dengan istilah air mata buaya? Berpura-pura menangis karena ingin mengambil simpati orang lain, purapura berduka cita, menangis dalam drama, semua itu adalah sandiwara belaka dan tidak punya pahala. Malah ada menangis yang mendatangkan dosa, misalnya membuat orang supaya menangis, baik dalam berceramah, membaca doa maupun ketika membaca Alquran. Pokoknya yang direkayasa tidak akan mendapat pahala.

Albayan ....

0 3 5 1 2 8 7 4 6 9

Presiden Prihatin ....

puterinya ini tidak mudah menyerah dengan pembelajarnnya yang mungkin mengalami kendala. “Sejak TK, saya mengantarkan Helena ke sekolah. Saya selalu sabar mendengarkan ceritanya tentang lingkungan sekolah terutama teman-temannya. Saya juga bangga pada guru di sekolah ini yang selalu menceritakan bagaimana Helena mengikuti pelajaran. Saya selalu nasehati dia agar termotivasi untuk belajar bahasa Hokkian seperti teman sebanyanya. Hasilnya memang luar biasa, puteri saya mampu berbahasa yang sama dengan teman-temannya dan sebagai puteri dari keluarga Batak, dia bisa beradaptasi. Saya bangga dengan Helena,”kata Marolop yang mengaku di sekolah ini pendidikan karakter pada anak cukup baik terutama sikap toleransi terhadap sesama siswa beda agama dan beda adat serta tradisi. Sangat Bangga Kepala Sekolah SMA Swasta Methodist 2 Medan, Pdt Paulus Subyanto STh mengaku bangga dengan prestasi Helena. Meski sesungguhnya di sekolah ini banyak siswa yang cerdas dan kemampuan mereka dalam berkompetisi terhadap siswa lainnya. “ Helena Marthafriska Saragi Napitu memang siswi yang dipintar. Sejak Kelas X Helena selalu menjadi juara umum. Helena pribadi yang baik, rajin beribadah, dan mudah bergaul sesama rekannya,” katanya sembari menyebutkan siswanya ini tercatat sebagai siswi kelas XII IPA 5, di mana kelas tersebut merupakan kelas unggulan. (m37)

Vani mengemukakan, ia mempunyai motivasi yang tinggi untuk belajar. “Kalau memang dengan belajar saya bisa dapat nilai UN tinggi, ya

Jawaban Sudoku:


PERTEMUAN HUMAS PEMERINTAH. Menteri Komunikasi dan Informatika, Tifatul Sembiring(kanan) bersama Gubernur Sumut Gatot Pujo Nugroho (kiri) menghadiri pembukaan pertemuan Badan Koordinasi Humas (Bakohumas) di Medan, Sumatra Utara, Jumat (24/5). Pertemuan Bakohumas regional bagian barat yang diikuti pejabat humas daerah tersebut bertujuan untuk penguatan kompetensi humas pemerintah melalui standarisasi profesi.

guru mata pelajaran jika dia belum paham tentang materi yang diajarkan. Apa yang membuat Helena cerdas ? Dia menyebutkan setiap orang punya kesempatan untuk cerdas. Setiap orang punya potensi diri dan setiap anak Indonesia punya hak dan kesempatan yang sama untuk jadi yang terbaik. Yang penting, kata Helena, dalam belajar perlu disiplin , berani meninggalkan hal yang kurang bermanfaat seperti nonton TV, menggunakan HP jika tidak penting, bermain BBM atau hal-hal yang mengganggu konsentrasi dalam belajar. “Ya, saya akui dengan giat belajar dan menegakkan disiplin diri untuk menjadi yang terbaik, harus berani meninggalkan hal-hal yang bisa mempengaruhi pembelajaran. Saya termasuk jarang nonton TV dan berHP ria. Saya fokus belajar dan banyak menaruh harap pada kehendak Tuhan. Kalau kita punya citacita dan harapan, kemudian berusaha dengan benar, pasti Tuhan memberikan kemudahan. Saya selalu mendapatkan motivasi dari orang tua,”kata Helena yang ingin lulus di Fakultas Kedokteran UI seperti kakaknya. Punya Peran Papa Helena, Marolop Napitu yang bekerja di Pemkab Simalungun bersama ibunya Elis Tambunan merasa b a n gga d engan prestasi puterinya. Keduanya mengaku memberikan dukungan buat anaknya, bukan hanya pada materi untuk kelancaran sekolahnya. Tetapi dukungan kasih sayang dan perhatian serta motivasi khusus agar

“Dekat-dekat pelaksanaan UN, saya lebih banyak latihan soal dan belajar kelompok. Di samping pihak sekolah juga mengadakan belajar intensif untuk siswa-siswa terbaik di program IPA,” ujarnya.

juga keluar. Saat manusia menangis, air mata lebih banyak tercurah. Seorang beriman yang baru melihat Ka’bah ketika memasuki Masjidil Haram pasti dia akan menangis, begitu juga ketika mereka berada di Raudhah dan Makam Rasulullah SAW. Orang-orang yang kusyuk dalam Shalat Tahajjud juga berlinang air mata. Air mata itu dapat menyehatkan mata dan melunakkan hati. “Dialah (Allah) yang menjadikan

Sabtu 25 Mei 2013

Siswa Korban Penganiayaan Dipecat Dari Sekolah

Nyabu Dan Berjudi, 4 Wanita 2 Pria Diamankan LHOKSEUMAWE ( Waspada): Aparat Polresta Lhokseumawe, Jumat (24/5) pagi menggerebek sebuah rumah kos-kosan di Gampong Blang, Kemukiman Kandang, Kec. Muara Dua, Lhokseumawe. Dalam penggerebekan itu, polisi menangkap 4 wanita dan dua pria. Dari salah seoarang tersangka petugas menemukan 1 paket sabu.Keenam tersangka ditahan di Mapolresta Lhokseumawe untuk pengembangan lebih lanjut. Menurut informasi, warga sekitar selama ini menduga, kos-kosan itu dijadikan lokasi mesum. Dari enam tersangka satu di antaranya seorang guru. Keenam tersangka itu yakni pemilik kos CY,18, asal Desa Meunasah Mesjid, Kec. Muara Dua, Su, 25, asal Meunasah Teungoh, Kec. Pate Bidari, Aceh Timur, EN, 50, asal Desa Mee, Kec. Muara Dua dan An, 20, asal Darussalam, Hagu Selatan, Kec. Banda Sakti Lhokseumawe sedangkan dua pria yakni S, 47, asal Meuse, Kutablang, Bireuen dan seorang guru di Kec. Banda Baro, Aceh Utara, Af. Selain menemukan 1 paket sabu, petugas mendapatkan barang bukti lain berupa batu domino, kartu joker, dan uang Rp40 ribu diduga hasil judi. “Hasil pemeriksaan sementara kita menetapkan seorang sebagai tersangka narkoba karena dari dia kita dapati sabu, dan lima lainnya sedang dalam pemeriksaan,” kata Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kasat Narkoba Iptu Poeloeng. (b18)


Geuchik Hagu Selatan, Masykur mengatakan, pihaknya melalui bantuan Taruna Siaga Bencana (Tagana) kota setempat telah mendirikan tenda di lokasi. Namun, tenda ini dengan jumlah 24 kepala keluarga dan 89 jiwa pengungsi, tidak mungkin muat, apalagi bercampur antara laki-laki dan perempuan. Disinggung kerugian, Geuchik memberi gambaran, rumah-r umah yang rata dengan tanah ukuran 5x7 meter dengan konstruksi papan. Beberapa kendaraan bermotor juga ludes, satu diantaranya sepeda motor plat merah merek Honda Supra 125 milik KIP Aceh Utara nomor polisi BL 2001 Q. Maka kerugian ditaksir beberapa

Ada-ada Saja ....

Zaini Sedih ....

Karena itu, Zaini Abdullah menyatakan ke depan akan meminta guru dan tenaga kependidikan di Aceh agar lebih hati-hati dalam mendidik anak muridnya. Sehingga tingkat kelulusan UN untuk semua jenjang pendidikan dapat diperbaiki dan lebih baik hasilnya. Dikatakan, anggaran yang besar belum tentu menghasilkan mutu kelulusan yang baik. “Kalau anggaran yang banyak tidak digunakan untuk program yang tepat, belum tentu menghasilkan peningkatan kualitas pendidikan Aceh yang lebih baik,” tuturnya. Ke depan, tegas Zaini, pendidikan Aceh harus fokus untuk peningkatan kualitas dan kelulusan. “Tahun depan kita fokus, dan akan kita pertanyakan kenapa banyak pelajar di Aceh banyak tidak lulus UN tahun ini,” katanya. (b06)

mengaku nekat menyelewengkan dana desa karena ingin membantu kampanye Bupati Karanganyar. Namun, setelah terpilih, dia tidak bisa mengembalikan uang yang sudah diambilnya tersebut. Seperti diberitakan sebelumnya, dalam persidangan tindak pidana korupsi di Semarang pada akhir 2011 dengan agenda pembelaan, Endah justru mengaku secara tegas sebagai koruptor dan meminta dihukum seberatberatnya atas perbuatannya menyelewengkan dana desa. Endah pun menolak dibela pengacara dan menyerahkan segala keputusan kepada majelis hakim. Endah divonis satu tahun dua bulan penjara dan denda Rp 50 juta subsider dua bulan penjara. “Saya justru bersyukur dianugerahi Tuhan untuk diteguhkan hati saya untuk berani jujur mengatakan apa yang memang saya lakukan. Dan saya bersyukur dengan anugerah ini saya bisa menjalani masa tahanan,” katanya. Setelah selesai masa pidananya, Endah sekarang bekerja sebagai agen CD musik milik sebuah perusahaan rekaman yang dulu pernah dia geluti. Bersama istri dan kedua anaknya, Endah merasa hidup tenang sudah melakukan perbuatan jujur. Dia tidak berharap menjadi pahlawan, tetapi berharap para koruptor mau mengakui perbuatannya. (kc/m09)

M E D A N ( Wa s p a d a ) : Edward, siswa SMA Panglima Polem, Rantauprapat, Kab. Labuhanbatu diperlakukan tidak adil. Dia yang menjadi koban penganiayaan dua temannya di sekolah itu, dipecat secara sepihak oleh pihak sekolah. Sementara dua pelaku penganiayaan sama sekali tidak diberi sanksi. Edward, siswa kelas 3 sekolah itu dipecat dar i sekolahnya pertengahan September 2012, setelah terjadi penganiayaan yang menyebabkan dia dirawat di rumah sakit. Dia menjadi korban pengeroyokan teman sekolahnya 31 Agustus, tahun yang sama. Ibu korban, Leny kepada Wa s p a d a , J u m a t ( 2 4 / 5 ) mengatakan, akan menuntut pihak sekolah, dalam hal ini kepala sekolah SMA Panglima

Polem Rantauprapat karena keputusan sepihak itu. “Anak saya menjadi korban penganiayaan, tetapi justru dipecat dari sekolah,” kata dia. Sementara dua pelaku penganiayaan Ricardo Ma n u r u n g d a n A l f a r a b i Hasibuan tidak diberi sanksi pemecatan. “Ini sama sekali tidak bisa diterima. Keputusan kepala sekolah memecat anak saya keputusan tidak berprikemanusiaan,” sebutnya. Akibat pemecatan itu, Edward yang sudah duduk di kelas III terpaksa dipindahkan ke sekolah lain untuk bisa mengikuti UN, karena saat itu sudah dekat dengan Ujian Nasional (UN). Sementara dua pelaku penganiayaan tetap bisa mengikuti UN di sekolah itu. Dikatakan , perkara

tersebut sudah diputuskan Pe n g a d i l a n Ne g e r i ( P N ) Rantauprapat yang memutuskan Ricardo Manurung dan Alfarabi Hasibuan bersalah melakukan penganiayaan terhadap Edward sesuai putusan pidana perkara Reg. No. 11/Pid.BA/2013/PNRap. Leny juga mengatakan sudah melaporkan kasus itu ke Diknas Labuhanbatu tetapi b e l u m d i p r o s e s , k a r ena sampai saat ini Kepsek belum diberi sanksi. Sebab itu, dia mengatakan akan menuntut Kepsek secara hukum, baik pidana maupun perdata. Kepala Sekolah SMA Panglima Polem Rantau Prapat Jessy Wijaya dikonfirmasi Wa s p a d a , Ju m a t m a l a m melalui telefon tidak mengangkat. Di SMS juga tidak membalas. (m27)

Mr X Tewas Tenggak Miras SIGLI (Waspada): Seorang lelaki paruh baya tanpa identitas ditemukan warga dalam kondisi mabuk berat dan tergeletak dalam saluran air (drainase) depan Kantor POS dan Giro, Kota Sigli, Pidie, Jumat (24/5) siang. Namun, lelaki Mister X ini, akhirnya meninggal dunia di Rumah Sakit Umum (RSU) Sigli sekira pukul 14:00. Kasat Pol PP dan WH Pidie Sabaruddin mengatakan, Mister X itu awalnya dilihat warga sedang berjalan sempoyongan.Setibanya di depan Kantor Pos dan Giro, Kota Sigli, ia terjatuh, hingga tubuhnya terguling ke dalam saluran air.

Selanjutnya datang petugas Sat Pol PP dan WH, membawanya ke Mapolsekta Sigli. Selanjutnya, Mister X itu dibawa ke Rumah Sakit Umum Sigli, guna mendapat perawatan. “Saat kita bawa ke RSU Sigli, kondisinya antara sadar dan tidak,” kata Sabaruddin. Kabid Pelayanan BLUD RSU Sigli Fajriman menjelaskan, Mister X itu saat diantar petugas Sat Pol PP dan WH bersama anggota polisi dari Polsekta dalam keadaan terhenti nafas dan tidak sadarkan diri, sekira pukul 12:15. setelah dilakukan resusitasi, pasien diyatakan meninggal

dunia. Mister X itu memiliki ciriciri kulit sawo matang, tinggi 165 cm dan ada parut bekas jahitan di bagian perut dekat pusar serta memiliki tato pada bagian punggung kanan bergambarkan wanita telanjang memakai sayap. “Selain itu, ditemukan lecet di tangan kiri serta punggung kiri. Diduga terjadi akibat benda tumpul,” jelas dr Fajriman. Mister X itu mengenakan celana jeans warna hitam merk luensky dan baju kaos kerah ber warna abu-abu merk volt come bermotif garis horisontal warna hijau dan hitam. (b10)

Di Aceh Utara ....

2013, jumlah kelulusan di Lhokseumawe mencapai 99,9 persen atau sebanyak 5 siswa yang gagal UN. Tidak Lulus Sebanyak 111 dari 2.844 siswa-siswi jenjang SMA sederajat di Pidie Jaya tidak lulus UN tahun 2012/2013. Jumlah tersebut menempatkan Pidie Jaya di urutan ke-7 dengan jumlah siswa terbanyak yang tidak lulus dari 23 kabupaten di Aceh. “Kelulusan siswa-siswi SMU sederajat untuk Pidie Jaya tahun ini mencapai 94,6 persen. Ada penurunan dibanding sebelumnya, mencapai 97 persen,” kata Ketua Panitia UN Pidie Jaya Syakban, Jumat (24/5). Ia mengatakan, sebagian besar siswa yang tidak lulus merupakan siswa-siswi jurusan IPS, disusul IPA. Adapun sekolah terbanyak tidak lulus yakni SMA 2 Bandar Baru dengan jumlah 30 siswa dan MAN 2 Mereudue dengan

jumlah 29 siswa. Data diperoleh dari Dinas Pendidikan Pidie Jaya, tahun 2013, jumlah siswa yang mengikuti UN di Pidie Jaya mulai jenjang SD sederajat hingga SMA sederajat serta paket C dan B mencapai 7.633 siswi. Untuk tingkat SMP sederajat mencapai 2.409 siswi sedang tingkat SMA sederajat mencapai 1.917 siswa. Lulus 100 Persen Selur uh peser ta yang mengikuti Ujian Nasional (UN) Sekolah Menengah Kejuruan (SMK) se- Kabupaten Aceh Timur lulus 100 persen. Sementara untuk SMA angka kelulusan 87 persen. Demikian dikatakan Kabid Dikmen Dinas Pendidikan Aceh Timur, Ridwan, Jumat (24/5). Menurutnya, angka kelulusan SMA se Aceh Timur tahun 2013 jauh menurun persentasenya dibandingkan dengan tahun-tahun sebelumnya. (cb06/b18/b24)

Bandar Narkoba ....

dan memukul kepala anggota kita. Bahkan BS yang membawa pisau mencoba menikam korban hingga mengenai lengan anggota kita,” jelas Heru dan menambahkan, Bripka Tumpak Sihombing yang mengalami luka tikaman dibagian tangan kiri dan kepala robek akibat hantaman batu berusaha membela diri dengan menembak korban hingga tewas. Peluru yang ditembakkan ke arah kening BS tembus ke kening sebelah kanan. Sementara itu tiga orang lainnya KT, KP dan AS diboyong ke Polsekta Pancurbatu. Bripka Tumpak Sihombing dilarikan ke RSUP Adam Malik Medan. Jenguk korban Waka Polresta Medan AKBP Pranyoto saat menjenguk anggota di RSUP Adam Malik Medan mengatakan, lokasi kos-kosan di kawasan Pancurbatu sudah menjadi target Operasi Antik Toba 2013. “Anggota kita sudah melakukan dua kali tembakan peringatan ke atas,namun tidak dihiraukan BS,’’ katanya. Bripka Tumpak Sihombing terpaksa melakukan tembakan kepada BS karena membahayakan nyawa anggota

kita. ‘’ Tersangka meninggal dunia dan jenazahnya di RS Bhayangkara Medan,” tandasnya. Bermain Judi Sebelum ditembak keempat orang tersebut, BS, 40, KT, KP dan AS sempat bermain judi di salah satu rumah koskosan di kawan jalan MedanBerastagi, Pancurbatu. Dari rumah yang dijadikan kos-kosan itu, petugas menyita barang bukti kartu joker dan satu set alat judi dadu. “Selain daun ganja kering sebanyak 5 kilogram yang disita dari tersangka BS, pihaknya juga menemukan barang bukti kartu joker dan satu set alat judi dadu,” katanya. Jadi kemungkinan besar keempat tersangka ini juga terlibat bermain judi dalam koskosan. “Hingga saat ini pihaknya masih menyelidiki siapa pemilik rumah kos-kosan. Kita belum tahu siapa pemilik kos-kosan ini. Masih kita selidiki pemilik rumah itu,” ujarnya. Sedangkan Bripka Tumpak Sihombing yang sebelumnya dirawat di RSUP Adam Malik dirujuk ke RS Bhayangkara Jl. Wahid Hasyim. Sedangkan jasad BS hingga sore masih berada di RS Bhayangkara Medan. (m39)

yang tidak lulus MAN Sumbok dengan jumlah 32 orang, urutan kedua MAS Seunuddon 29 orang. “Pengumuman kita tempelkan di Mapolsek untuk menghindari hal-hal yang tidak kita inginkan dari siswa yang tidak lulus,” kata Azhari. Ditanya berapa jumlah siswa SMA yang tidak lulus, Azhari mengaku masih ada 3 SMK dari 14 SMK di Aceh Utara belum dapat kiriman nilai dari Jakarta, dan pihaknya masih menunggu hasil UN dari internet. Data sementara peserta UN untuk SMK lulus 100 persen. Di Lhokseumawe Sementara itu, Rusli, Kadis Pendidikan, Pemuda dan Olahraga Kota Lhokseumawe mengaku puas dengan prestasi yang diperoleh pada UN tahun 2013, karena terjadi peningkatan kelulusan 0,1 persen dari tahun lalu. Tahun

Reserse Narkoba Kompol Dony Alexander kepada wartawan di RS Bhayangkara Medan mengatakan, peristiwa terjadi sekira pukul 03:00 di jalan Djamin Ginting MedanPancurbatu, Sibolangit, persisnya 200 meter dari Rumah Makan Andini. Menurut Heru, dinihari itu,jajaran Reskrim Polsekta Pa n c u r b a t u m e l a k u k a n Operasi Antik Toba 2013 di kawasan Pancurbatu yang terindikasi sebagai sarang narkoba dan perjudian. ”Saat petugas mendatangi salah satu rumah yang dihuni oleh empat orang, yakni BS, KT, KP dan AS, salah seorangnya yakni BS melarikan diri dari sergapan petugas sambil membawa 5 kilogram daun ganja kering dalam tas ransel,” jelas Heru. Selanjutnya, Bripka Tumpak Sihombing mengejar BS. “Polisi sempat melakukan tembakan peringatan ke udara dua kali, sehingga BS berhenti,” jelas Heru.Setelah itu, lanjut Heru, anggota kita mendekati BS untuk menangkapnya. Tetapi, BS melawan hingga terjadi perkelahian. “Saat itu BS mengambil batu yang ada di lokasi kejdian

Adu Statistik ....

Berikut statistik kedua tim di Liga Champions musim ini: Gol : Munchen (29 gol) - Dortmund (23 gol) Rata-rata gol per laga : Munchen (2,42 gol) - Dortmund (1,92 gol) Gol penalti : Munchen (1 gol) - Dortmund (1 gol) Gol sundulan : Munchen (5 gol) - Dortmund (2 gol) Gol dari dalam kotak penalti : Munchen (22 gol) - Dortmund (21 gol) Gol dari jarak jauh : Munchen (6 gol) - Dortmund (1 gol) Tendangan tepat sasaran : Munchen (104 kali) - Dortmund (107 kali) Tendangan melenceng : Munchen (84 kali) - Dortmund (55 kali) Jumlah umpan : Munchen (6952 umpan) - Dortmund (6549 umpan) Umpan sukses : Munchen (5263 umpan) - Dortmund (4349 umpan) Persentase umpan sukses : Munchen (76 persen) - Dortmund (66 persen) Umpan silang : Munchen (55 kali) - Dortmund (46 kali) Umpan silang sukses : Munchen (24 kali) - Dortmund (24 kali) Rata-rata penguasaan bola : Munchen (54 persen) - Dortmund (46 persen) Rataan menit penguasaan bola : Munchen (25 menit) - Dortmund (23 menit) Sepak pojok : Munchen (100 kali) - Dortmund (56 kali) Pelanggaran : Munchen (166 kali) - Dortmund (145 kali) Dilanggar : Munchen (174 kali) - Dortmund (136 kali) Kartu kuning : Munchen (28 kali) - Dortmund (13 kali) Kartu merah : Munchen (1 kali) - Dortmund (0). (kcm/m09)


Berita Utama

Siswa Korban Penganiayaan Dipecat Dari Sekolah MEDAN (Waspada): Edward, siswa SMA Panglima Polem, Rantauprapat, Kab. Labuhanbatu diperlakukan tidak adil. Dia yang menjadi koban penganiayaan dua temannya di sekolah itu, dipecat secara sepihak oleh pihak sekolah. Sementara dua pelaku penganiayaan sama sekali tidak diberi sanksi. Edward, siswa kelas 3 sekolah itu dipecat dari sekolahnya pertengahan September 2012, setelah terjadi penganiayaan yang menyebabkan dia dirawat di rumah sakit. Dia menjadi korban pengeroyokan teman sekolahnya 31 Agustus, tahun yang sama. Ibu korban, Leny kepada Waspada, Jumat (24/5) mengatakan, akan menuntut pihak sekolah, dalam hal ini kepala sekolah SMA Panglima Polem Rantauprapatkarenakeputusansepihak itu. “Anak saya menjadi korban penganiayaan, tetapi justru dipecat dari sekolah,” kata dia. Sementara dua pelaku penganiayaan Ricardo Manurung danAlfarabiHasibuantidakdiberi sanksi pemecatan. “Ini sama sekalitidakbisaditerima.Keputusan kepala sekolah memecat anak

saya keputusan tidak berprikemanusiaan,” sebutnya. Akibat pemecatan itu, Edward yang sudah duduk di kelas III terpaksa dipindahkan ke sekolah lain untuk bisa mengikuti UN, karena saat itu sudah dekat dengan Ujian Nasional (UN). Sementara dua pelaku penganiayaan tetap bisa mengikuti UN di sekolah itu. Dikatakan , perkara tersebut sudah diputuskan Pengadilan Negeri (PN) Rantauprapat yang memutuskan Ricardo Manurung dan Alfarabi Hasibuan bersalah melakukan penganiayaan terhadap Edward sesuai putusan pidana perkara Reg. No. 11/ Pid.BA/2013/PN-Rap. Leny juga mengatakan sudah melaporkan kasus itu ke Diknas Labuhanbatu tetapi belum diproses, karena sampai saat ini Kepsek belum diberi sanksi. Sebab itu, dia mengatakan akan menuntut Kepsek secara hukum, baik pidana maupun perdata. Kepala Sekolah SMA Panglima Polem Rantau Prapat Jessy Wijaya dikonfirmasi Waspada, Jumat malam melalui telefon tidak mengangkat. Di SMS juga tidak membalas. (m27)

Seratusan Warga DS Dukung Pilkada Damai DELISERDANG (Waspada): Seratusan warga membubuhkan tanda tangan di atas bentangan kain putih sepanjang 10 meter, di depan Kantor KPU Deliserdang di Jl. Karya Jasa Kompleks Perkantoran Pemkab Deliserdang, Jumat (24/5) siang. Aksi itu sebagai bentuk dukungan warga terhadap KPU Deliserdang, agar terselenggaranya Pilkada (Pemilihan Kepala Daerah) secara damai di Kab. Deliserdang yang akan digelar pada Oktober tahun ini.

Selain membubuhkan tanda tangan, warga minta KPUD (Komisi Pemilihan Umum Daerah) selaku penyelenggara Pilkada, bersikap profesional dan proporsional dalam memverifikasi syarat dukungan bagi pasangan calon perseorangan. Dalam aksi yang dikoordinir Zulfikar, kalangan warga gabungan dari beberapa aliansi petani itu menyerahkan kain putih tersebut kepada seorang Komisioner KPU Deliserdang Agusnedi. (m11)

3 Nelayan Aceh Terdampar Di Pulau Rondo BANDAACEH (Waspada): Tiga nelayan asal Kota Banda Aceh terdampar di Pulau Rondo, sekitar 32 mil dari daratan Kota Banda Aceh, setelah terkatung-katung di laut lepas akibat kapal motor “Teluk Ratu” yang mereka gunakan mencari ikan rusak mesin setelah melaut sejak Selasa (21/5). Ketiga korban yang dievakuasi menggunakan Kapal Basarnas, yakni Tatan Hadiansyah, 30,Yus, 32 dan Edi, 32. Kesemuanya warga Asoe Nanggroe, Kec. Meuraxa, Banda Aceh. Tatan, satu dari tiga korban menuturkan, mereka terdampar di Pulau Rondo setelah kapal motor yang digunakan melaut mengalami kerusakan mesin pada Kamis, (23/5) pagi. “Karena rusak mesin, kapal kami terseret arus ke Pulau Rondo. Bekal makanan ada, tapi karena ombak juga besar, kita tidak bisa memasak,” kata Tatan kepada wartawan, Jumat

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Ke6+, Rh7. 2. Bxf7+, Rg8. 3. Bf8+, Rh7. 4. Bd7+mat. (Atau 3. Bg7+, Rh8. 4. Bd8+mat). Jawaban TTS: TTS Topik

Musik & Filem

Jawaban Sudoku: 0 3 5 1 2 8 7 4 6 9

8 6 9 0 1 4 3 2 5 7

4 2 8 7 5 6 0 9 1 3

7 5 6 3 0 9 8 1 4 2

1 9 2 4 7 3 6 5 0 8

9 7 4 2 6 5 1 3 8 0

3 1 0 6 8 2 4 7 9 5

6 4 7 5 3 0 9 8 2 1

2 8 1 9 4 7 5 0 3 6

5 0 3 8 9 1 2 6 7 4

(24/4) petang setelah tiba di Banda Aceh. Miswar, ketua kelompok nelayan Bungong Kareung Asoe Nanggroe mengatakan, ketiganya selamat setelah menghubungi rekannya memberitahu kerusakan kapal. Kapten Kapal Basarnas Aceh Supriadi mengatakan, informasi tentang ketiga korban telah diterima sejak Kamis malam, namun cuaca buruk membuat proses evakuasi baru dapat dilaksanakan Jumat. (cb06)

Ada-ada Saja ... segala tindakannya menyelewengkan uang Anggaran Pendapatan dan Belanja Desa (APBD) sebesar Rp 285,9 juta di depan persidangan. Saat ditemui di rumahnya di Desa Klodran RT 2/RW1, Colomadu, Karanganyar, Jawa Tengah, Endah menceritakan pergulatan batin dirinya saat terbongkarnya kasus korupsi hingga menjalani masa pidana selama satu tahun dua bulan. Dia divonis pada 14 Maret 2011 dan bebas pada Januari 2012. “Selama tujuh bulan pertama di bui dan proses persidangan mulai berakhir, banyak orang mencoba menasihati saya untuk menyewa pengacara dan “nyokot” orang-orang yang diduga terlibat. Namun, saya memilih untuk tidak melakukannya dan mencoba untuk menanggung sendiri risikonya,” katanya, Rabu (23/5). Kepala Desa Klodran masa jabatan 2007-2013 tersebut mengaku nekat menyelewengkan dana desa karena ingin membantu kampanye Bupati Karanganyar. Namun, setelah terpilih, dia tidak bisa mengembalikan uang yang sudah diambilnya tersebut. Seperti diberitakan sebelumnya, dalam persidangan tindak pidana korupsi di Semarang pada akhir 2011 dengan agenda pembelaan,Endahjustrumengaku secara tegas sebagai koruptor dan meminta dihukum seberatberatnya atas perbuatannya menyelewengkan dana desa. Endah pun menolak dibela pengacara dan menyerahkan segala keputusan kepada majelis hakim. Endah divonis satu tahun dua bulan penjara dan denda Rp 50 juta subsider dua bulan penjara. “Saya justru bersyukur dianugerahiTuhan untuk diteguhkan hati saya untuk berani jujur mengatakan apa yang memang saya lakukan. Dan saya bersyukur dengan anugerah ini saya bisa menjalani masa tahanan,” katanya. Setelah selesai masa pidananya, Endah sekarang bekerja sebagai agen CD musik milik sebuah perusahaan rekaman yang dulu pernah dia geluti. Bersama istri dan kedua anaknya, Endah merasa hidup tenang sudah melakukan perbuatan jujur. Dia tidak berharap menjadi pahlawan, tetapi berharap para koruptor mau mengakui perbuatannya. (kc/m09)

WASPADA Sabtu 25 Mei 2013

Pengangguran Tertinggi Dunia, Arab ‘Usir’ TKI Laporan Armin Nasution dari Jeddah, Arab Saudi PIHAK Kedutaan Besar RI (KBRI) di Jeddah sudah mendesak seluruh tenaga kerja ilegal yang di Arab Saudi memenuhi semua persyaratan untuk memperbarui dokumentasinya. Konsul Muda Penerangan Sosial Budaya KJRI Jeddah Nur Ibrahim menegaskan, kemarin, saat ini pihak konsulat masih akan berkonsentrasi memenuhi semua kebutuhan para tenaga kerja itu. “Ribuan orang harus kita layani sampai deadline yang sudah ditentukan pemerintah Arab Saudi. Doakan agar saudara kita di sini tidak mengalami masalah apa pun dan semua kita selesaikan sesuai prosedur,” jelasnya. Seperti diberitakan sebelumnya saat ini pemerintah Arab Saudi memberikan amnesti atau semacam dispensasi untuk memperbaiki status iqamah (perpanjangan visa kerja) atau pulang ke Indonesia sebelum tanggal 3 Juli 2013. Kepadatan di KBRI Jeddah menunjukkan banyaknya jumlah tenaga kerja ilegal di Arab Saudi. Saat berada di KJRI Jeddah, salah satu tenaga kerja Indonesia

Suryati yang ditemui mengaku sedang mengurus iqamah atau perpanjangan izin kerja. Selain perpanjangan visa kerja, satu opsi lagi adalah memulangkan para TKI ilegal itu. “Saya sudah bekerja enam tahun di sini tapi belum diberikan apa pun oleh majikan,” katanya. “Majikan bilang akan dibayar sekalian. Tapi saya merasa perlu mendapatkan visa kerja. Biar bisa tetap tinggal di sini,” katanya di depan KJRI Jeddah kemarin. Persoalan yang dialaminya nyaris sama dengan banyaknya tenaga kerja wanita lain yang terlihat berbaris rapi di depan kantor kedutaan. Untuk pengurusan visa kerja, KJRI Jeddah membuat tempat pengurusan berbeda. Satu loket untuk pria dan di sisi lain untuk perempuan. Keluhan pekerja Indonesia yang ‘menambang’ rial di Arab Saudi itu terungkap di depan KJRI. Berbagai keluhan pembayaran gaji dan repotnya mengurus dokumen mengemuka. Bahkan di bawah suhu panas yang berada rata-rata 40 derajat celcius dan sedikit intimidasi dari polisi setempat me-

reka tetap bertahan. Sebab kalau yang ilegal tidak mengurus dokumen akan dipenjarakan. “Opsi yang menyuruh TKI pulang sebenarnya sama dengan mengusir tenaga kerja kita dari sini. Sebab jumlah pengangguran di Arab Saudi sudah terlalu tinggi. Penduduk setempat pun kini ingin bekerja di sektor informal yang sudah lama dilakoni pekerja dari Indonesia,” kata M. Abdullah, supir taksi di Arab yang sudah 16 tahun. Bagi majikan yang mempekerjakantenagakerjailegaljuga cukup jelas hukumannya. Siapapun yang tertangkap menampung pekerja ilegal menghadapi penjara dua tahun dan denda maksimum 2.700 dolar AS. Pemberian amnesti ini merupakan perubahan yang paling besar dalam sejarah undang-undang ketenagakerjaan Arab Saudi. Data resmi menunjukkan saat ini terdapat sekitar delapan juta pekerja asing di Arab Saudi, sebagian besar tenaga kerja dengan gaji kecil. Data pihak imigrasi menyebutkan sekira 200.000 tenaga kerja dideportasi dalam tiga

bulan pertama tahun ini. Untuk mendorong percepatan amnesti itu, pemerintah Arab Saudi juga menggelar razia pekerja asing. Koran setempat memberitakan tenaga kerja asing yang bekerja di Arab Saudi secara massal langsung menjauh dari pusat perkantoran, sekolah, pertokoan, dan tempat kerja lainnya. Ini karena pemerintah Saudi telah melancarkan razia terhadap warga ilegal. Pihak berwajib telah merazia gedung perkantoran dan memeriksa dokumen di pos-pos pemeriksaan di jalan-jalan utama untuk mencari warga asing yang bekerja secara ilegal. Tindakan ini merupakan janji dari pemerintah Saudi yang menyatakan bahwa tahun ini akan mengurangi tingkat pekerja asing yang semakin banyak bekerja di sektor swasta dan membuat jumlah pengangguran kaum muda Saudi melonjak. Selama akhir pekan lalu pekerja asing telah menyebarkan info melalui media sosial terkait razia dan langsung mengubah banyak tempat kerja tidak beroperasi.

Jarang Nonton TV ...

hal yang bisa mempengaruhi pembelajaran. Saya termasuk jarang nonton Tv dan ber-HP ria. Saya fokus belajar dan banyak menaruh harap pada kehendak Tuhan. Kalau kita punya cita-cita dan harapan, kemudian berusaha dengan benar, pasti Tuhan memberikan kemudahan. Saya selalu mendapatkan motivasi dari orang tua,”kata Helena yang ingin lulus di Fakultas Kedokteran UI seperti kakaknya. Punya Peran Ayah Helena, Marolop Napitu yang PNS di Pemkab Simalungun bersama ibunya Elis Tambunan merasa bangga dengan prestasi puterinya. Keduanya mengaku memberikan dukungan buat anaknya, bukan hanya pada materi untuk kelancaran sekolahnya. Tetapi dukungan kasih sayang dan perhatian serta motivasi khusus agar puterinya ini tidak mudah menyerah dengan pembelajarnnya yang mungkin mengalami kendala. “Sejak TK, saya mengantarkan Helena ke sekolah. Saya selalu sabar mendengarkan ceritanya tentang lingkungan sekolah terutama teman-temannya. Saya juga bangga pada guru di sekolah ini yang selalu menceritakan bagaimana Helena mengikuti pelajaran,”kata Marolop . Sangat Bangga Kepala Sekolah SMA Swasta Methodist 2 Medan, Pdt Paulus Subyanto STh mengaku bangga dengan prestasi Helena. Meski sesungguhnya di sekolah ini banyak siswa yang cerdas dan kemampuan mereka dalam berkompetisiterhadapsiswalainnya.

“ Helena Marthafriska Saragi Napitu memang siswi yang dipintar. Sejak Kelas X Helena selalu menjadi juara umum. Helena pribadi yang baik, rajin beribadah, dan mudah bergaul sesama rekannya,” katanya sembari menyebutkan siswanya ini tercatat sebagai siswi kelas XII IPA 5, di mana kelas tersebut merupakan kelas unggulan. (m37)

Presiden Prihatin ...

Sejak kecil, Helena memang tertarik dengan sekolah yang dikenal sangat disiplin dengan berbagai peraturan dan sistem pembelajaran dan siswanya selalu juara dalam berbagai lomba. “Sejak kecil saya sudah tertarik dengan sekolah ini. Siswanya tercatat sebagai orang yang berhasil dengan prestasi yang memuaskan,’’ kata Helena dan menambahkan, kakaknya yang kini kuliah di Universitas Indonesia, kini semester IV juga lulusan sekolah ini. Sebelum UN, kata Helena, ada bimbingan gratis bersama guru mata pelajaran, sehingga usaha tidak sia-sia. ‘’ Saya juga ikut Bimbel di Ganesha dan selalu meraih nilai terbaik,” ujar Helena yang mengaku sangat sering bertanya pada guru mata pelajaran jika dia belum paham tentang materi yang diajarkan. Apa yang membuat Helena cerdas ? Dia menyebutkan setiap orang punya kesempatan untuk cerdas. Setiap orang punya potensi diri dan setiap anak Indonesia punya hak dan kesempatan yang sama untuk jadi yang terbaik. Yang penting, kata Helena, dalam belajar perlu disiplin, berani meninggalkan hal yang kurang bermanfaat seperti nonton TV, menggunakan HP jika tidak penting, bermain BBM atau hal-hal yang mengganggu konsentrasi dalam belajar. “Ya, saya akui dengan giat belajar dan menegakkan disiplin diri untuk menjadi yang terbaik, harus berani meninggalkan hal-

Peraih Nilai UN ... Terkait kesuksesannya menjadi peraih nilai UN tertinggi, siswa program IPA asal Gianyar ini mengatakan makin mengintensifkan belajar mendekati UN. “Dekat-dekat pelaksanaan UN, saya lebih banyak latihan soal dan belajar kelompok. Di samping pihak sekolah juga mengadakan belajar intensif untuk siswa-siswa terbaik di program IPA,” ujarnya. Vani mengemukakan, ia

Disdiksu Revisi ... Zein merinci siswa program IPA (SMA/MA) yang tidak lulus 68 orang atau 0,11 persen dari 64.682 siswa. Program IPS yang tidak lulus 185 orang atau 0,35 persen dari jumlah peserta 52.288 siswa. Jurusan Bahasa lulusan semuan dari peserta 55 siswa,sedangkanProgramAgama lulus semua dari 436 peserta. “Sementara SMK dari jumlah peserta 82.426 yang tidak lulus 38 orang atau sekitar 0,46 persen. Secara global tingkat kelulusan di Sumut mencapai 99,78 persen,” katanya mempertegas. Dia mengatakan dengan persentase kelulusan 99,78 persen, Sumut secara nasional menduduki ranking 7. Bahkan ada siswa Sumut dari SMA Methodist 2 meraih peringkat tiga terbaik.”Dari ranking kita naik, karena tahun 2012 posisi Sumut peringkat 11,” tegasnya. Sementara itu, kelulusan siswa tingkat SMA/SMK di Medan pada pengumuman kelulusan Ujian Nasional (UN) Jumat (24/5) cukup menggembirakan dari peserta mencapai 42.894 orang hanya 38 siswa yang tidak lulus, yakni 10 siswa SMK dan 28 siswa SMA. Prestasi menggembirakan Kepala Dinas Pendidikan Kota Medan Parluhutan Hasibuan menyebutkan hal ini seba-

Menkominfo: Tingkatkan ...

mempunyai motivasi yang tinggi untuk belajar. “Kalau memang dengan belajar saya bisa dapat nilai UN tinggi, ya saya belajar terus sampai titik jenuh saya tercapai,” ucap anak kedua dari tiga bersaudara itu. Tak hanya meraih prestasi di UN,Vani sebelumnya sempat meraih medali perunggu pada Olimpiade Sains Nasional di Jakarta. Selain Vani, ada empat siswa dari Bali lainnya yang menembus daftar 12 besar peraih nilairata-rataUNterbaiknasional.

Dikatakannya, hal itu disebabkan kurangnya komunikas Humaspemerintahdenganawak media baik itu kepada wartawan ataupun Pemrednya. Secara prestasi, Indonesia masih jauh lebih baik dari negara Eropa. Menurut Tifatul, pertumbuhan ekonomi kita 6 persen dan termasuk nomor dua terbesar setelah China. Di Spanyol penganggurannya 40 persen, Yunani kolaps, Amerika terseokseok bahkan Jerman yang katanya ekonominya paling kuat pertumbuhan ekonominya saja hanya 1 persen, namun prestasi tersebut tidak banyak diketahui masyarakat dan itu karena jalinan komunikasi kehumasan pemerintahnya masih kurang. “Saya berharap melalui pertemuan Bakohumas Regional Indonesia Barat ini semua masalah itu terjawab,” ujarnya. Pertemuan tersebut diikuti 200 Peserta yang terdiri pejabat Humas Propinsi, Kab/Kota, Perguruan Tinggi Negeri. Provinsi yang mengirim utusannya adalah Aceh, Sumut, Sumbar, Bengkulu, Riau, Kepri, Lampung, Sumsel, Babel, DKI Jakarta , Jabar dan Banten. Sementara Gubernur Sumatera Utara Gatot Pujo Nugroho meminta seluruh peserta pertemuan Bakohumas agar turut mempromosikan potensi Sumatera Utara. “Nah untuk itulah saya berharap bapak dan ibu sebagai perwakilan Humas dari daerah lain mau mempromosikan kemajuan dan kehebatan Sumatera Utara ini,” ujarnya. (m28)

gai prestasi yang menggembirakan bagi dunia pendidikan di Medan. “Hasilnya menggembirakan, “kata Parluhutan, kemarin. Pantauan Waspada, kemarin, orangtua siswa tampak antusias menanti pengumuman kelulusan. Apalagi masing-masing sekolah ada yang lulus 100 persen. Seperti di SMA/SMK Eria Jalan SM Raja Medan. Orang tua yang menantikan jadwal pembagian surat kelulusan sudah hadir pukul 14.00 WIB, padahal jadwal yang ditetapkan sekolah untuk mengambil surat kelulusan pukul 15.00 WIB. “Alhamdulillah siswa SMA/ SMK Eria lulus 100 persen,” kata Wakil Kordinator Perguruan Eria Drs H Rukzaidan kemarin. Dia menyebutkan, sebanyak 236 siswa di sekolah itu semuanya lulus. Bahkan tahun ini nilai mereka mengalami peningkatan dari tahun sebelumnya. Hal ini kata Rukzaidan tidak terlepas dari kegigihan siswa dalam belajar serta dukungan para guru yang selalu memberikan bimbingan dan pembelajaran secara khusus kepada semua siswa. PantauanlaindiRayonSMAN 1 Medan, seperti disampaikan Kepala SMAN 1 Ahmad Siregar, siswa rayon sekolah itu lulus 100 persen. Demikian pula Rayon SMKN 10 Medan seperti disampaikan Kepsek Dra Dahlia Purba siswa di sekolahnya dan rayon

SMKN 10 lulus 100 persen termasuk rayon sekolah ini SMK Kalam Kudus, SMK Centra Medika, SMK Katamso, SMK Bina Media, SMK Dharma Analatika,SMK Apipsu,SMK YPFSU, SMK Pharmaka dan SMK Telkom Shandi Putra . Demikian juga di SMKN 5 disampaikan Kepala Sekolah Maraguna Nasution siswanya lulus 100 persen. Hal yang sama di SMK Tritech Medan disampaikan Kepala Sekolah Supriyanto, siswa di sana lulus 100 persen. SMK Swasta BM Sutan Oloan Medan disampaikan Kepala Sekolah H Abdul Hadi SH, siswanya lulus 100 persen. Demikian juga SMKN 1 Medan disampaikan Kepala Sekolah, Asli Sembiring bahwa siswa di sana lulus 100 persen. Siswa di SMA Harapan 1 Medan, disampaikan Kepala Sekolah Sofyan Alwi kelulusan siswanya 100 persen. Laporan lainnya, SMA Shafiyyatul Amaliyyah, Rudi Sumarto,SSi menyatakan lulus seratus persen dengan nilai tertinggi 9,0 dan terendah 7,0. Sebelumnya Kepala SMA AlAzhar SMA Al-Azhar Medan Mayurid M.Si menyatakan rasa syukurnya karena berhasil mempertahankan tradisi lulus seratus persen baik SMA reguler SMA Plus dengan nilai rata-rata kelulusan diatas nilai rata-rata kelulusan nasional.(m49m37)

Al Bayan ... Ketika manusia senang (tertawa) atau sedih air mata juga keluar. Saat manusia menangis, air mata lebih banyak tercurah. Seorang beriman yang baru melihat Ka’bah ketika memasuki Masjidil Haram pasti dia akan menangis, begitu juga ketika mereka berada di Raudhah dan Makam Rasulullah SAW. Orang-orang yang kusyuk dalam Shalat Tahajjud juga berlinang air mata. Air mata itu dapat menyehatkan mata dan melunakkan hati. “Dialah (Allah) yang menjadikan tertawa dan menangis”(QS. Annajmu:43). Dalam hadis dari Ibnu Mas’ud, beliau mendengar Rasulullah bersabda: Mata yang menangis karena takut kepada Allah dan mata yang terjaga

untuk kepentingan di jalan Allah.(HR:Tarmizi).Dalam hadis lain disebutkan; menangis karena terharu, misalnya dalam berdoa, membaca Alquran, hadis, tentang ayat-ayat azab dalam neraka, orang seperti itu juga mendapat fahala dari Allah. (HR. Ibnu Majah). Bagaimana dengan istilah air mata buaya? Berpura-pura menangis karena ingin mengambil simpati orang lain, pura-pura berduka cita, menangis dalam drama, semua itu adalah sandiwara belaka dan tidak punya pahala. Malah ada menangis yang mendatangkan dosa, misalnya membuat orang supaya menangis, baik dalam berceramah, membaca doa maupun ketika membaca Alquran. Pokoknya yang direkayasa tidak akan mendapat pahala.

kesaling-penghormatan adalah norma dasar dalam masyarakat majemuk. “Intoleransi adalah tantangan masyarakat majemuk yang harus kita menangkan dengan membangun dialog yang setara, bukan dengan menyebarkan permusuhan dan kebencian”. Presiden SBY menegaskan kembali bahwa Negara menjamin sepenuhnya kebebasan warga negara menjalankan ibadahnya sesuai dengan kepercayaan dan keyakinannya. Adalah peran tokoh masyarakat dan agama untuk menyemaikan perdamaian dan kerja sama di antara kelompokkelompokyangberbeda kepercayaan dan keyakinannya” Daniel mengatakan Presiden SBY juga akan senantiasa bekerja dengan seluruh kekuasaan dan kewenangan yang diberikan konstitusi kepadanya untuk memastikan diakhirinya semua bentuk intimidasi dan

Bandar Narkoba ... ”Saat petugas mendatangi salah satu rumah yang dihuni empat orang yakni BS, KT, KP dan AS, salah seorangnya dari mereka yakni BS melarikan diri dari sergapan petugas sambil membawa lima kilogram daun ganja kering dalam tas ransel,” jelas Heru. Selanjutnya, anggota Reskrim Polsek Pancurbatu Bripka Tumpak Sihombing mengejar BS. “Polisi pun mengeluarkan tembakan peringatan ke udara dua kali, sehingga BS berhenti,” jelas Heru. Setelah itu, lanjutnya, Bripka Tumpak mendekati BS untuk menangkapnya. Tetapi, BS melawan hingga terjadi perkelahian. “Saat itu BS mengambil batu yang ada di lokasi kejadian dan memukul kepala anggota kita. Bahkan BS yang membawa pisau mencoba menikam

Waspada/M Edison Ginting

PARA pekerja Indonesia berusaha mengurus dokumen mereka di KJRI Jeddah kemarin. Tingginya pengangguran di Arab membuat sebagian besar TKI Indonesia akan dipulangkan ke tanah air. Kegiatan di Jeddah terlihat melambat sebab para pekerja di jasa angkutan asing takut dengan adanya pemeriksaan dokumen dan banyak yang mengurus iqamah. Sementara di Ibu Kota Riyadh, toko-toko yang bergerak di sektor retail dan kedai kopi hanya menempatkan satu pekerja di masing-masing toko. Arab Saudi saat ini memang menjadi negara paling banyak menerima tenaga kerja asing. Ternyata alasan Arab Saudi memperjelas status para pekerja itu untuk mengantisipasi

pengangguran di negaranya. Tingkat pengangguran di Arab tertinggi di dunia. MenurutOrganisasiBuruhSeduniaPerserikatan Bangsa-Bangsa (ILO), kondisi ini disebabkan beberapa faktor, salah satunya kebijakan di dunia Arab salah arah. Selain itu, pengangguran disebabkan meluasnya ketidakadilan sosial, dan selama dua puluh tahun terakhir liberalisasi ekonomi tidak tertata dengan baik. Di Arab pengangguran mencapai 23,3 persen. Sedangkan rata-rata dunia 13,9 persen.

agitasi termasuk yang melibatkan kekerasan, perusakan, dan atau penyerangan terhadap rumah ibadah dan atau terhadap keselamatan harta dan jiwa penganutnya. Meskipun diakui bahwa tidak selamanya upaya itu berhasil, Presiden SBY tidak akan pernah surut melakukan semua upaya yang mengancam hakhak warga negara untuk menjalankan ibadahnya dalam suasana aman, terbebas dari rasa takut. Presiden memerintahkan seluruh jajaran pemerintahan di pusat dan di daerah untuk menjalankan amanah undangundang dan konstitusi dengan penuh tanggung jawab. Presiden juga telah menginstruksikan agar aparatur kepolisian memberikan jaminan agar semua kelompok dapat memenuhi penggilan ibadahnya. Polri harus mampu memelihara keamanan dan ketertiban umum, siang dan malam. Mengenai penghargaan,

Daniel mengatakan, menerima penghargaan bukan dan tidak pernah menjadi tujuan Pemerintahan SBY. Ia hanya memiliki kehendak untuk melakukan yang terbaik yang ia bisa berikan kepada rakyat dan negerinya. Dengan segala kekurangannya, baik sebagai manusia biasa maupun sebagai pemimpin, SBY ingin memenuhi komitmen konstitusional dan personalnya untuk menjaga kebhinekaan sebagai bangunan dasar dari Republik ini. “Penghargaan tidak akan membuatnya silau. Cacian juga tidak akan membuatnya berkecil hati untuk menjalankan amanah dalam sisa masa kepemerintahannya,” kata Daniel. Ia hanya meminta agar semua pihak paham bahwa kemajemukan adalah sebuah berkat sekaligus tantangan. “Kita perlu merayakan sekaligus mengelolanya. Kita perlu konstitusi dan hati yang besar untuk memajukan Indonesia.”

korban hingga mengena lengan anggota kita,” jelas Heru. Bripka Tumpak Sihombing yang mengalami luka tikaman pada bagian tangan kiri dan kepala robek akibat hantaman batu berusaha membela diri dengan menembak kening BS hingga tewas. Sementara itu tiga orang lainnya KT, KP dan AS diboyong ke Polsekta Pancurbatu. Bripka Tumpak Sihombing dilarikan ke RSUP Adam Malik Medan. BS tewas di tempat kejadian. Mayatnya dievakuasi ke RS Bhayangkara Medan untuk keperluan visum. Sedangkan Bripka Tumpak Sihombing menderita luka di kepala akibat pukulan benda keras dilakukan BS dan tangannya menderita luka tikam. Jenguk korban Waka Polresta Medan AKBP Pranyoto saat menjenguk anggota di RSUP Adam Malik Medan mengatakan, lokasi kos-

kosan di kawasan Pancurbatu sudah menjadi target Operasi Antik Toba 2013. “Anggota kita sudah melakukan dua kali tembakan peringatan ke atas, namun tidak dihiraukan BS,’’ katanya. Tersangka, lanjutnya, meninggal dunia dan jenazahnya di RS Bhayangkara Medan. Bermain Judi Sebelum ditembak keempat orang tersebut, BS, 40, KT, KP dan AS sempat bermain judi di salah satu rumah kos-kosan di kawasan Jalan Medan-Berastagi, Pancurbatu. Dari rumah yang dijadikan kos-kosan itu, petugas menyita barang bukti kartu joker dan satu set alat judi dadu. Sedangkan Bripka Tumpak Sihombing yang sebelumnya dirawat di RSUP Adam Malik dirujuk ke RS Bhayangkara Jl. Wahid Hasyim. Sedangkan jasad BS hingga sore masih berada di RS Bhayangkara Medan. (m39)

KPK Dalami Aliran ...

Bayern Atau Dortmund ...

Saat dikonfirmasi soal sertifikat lahan ini, Busyro mengatakan bahwa hal itulah yang sedang didalami KPK. “Itu yang sedang didalami terus,” ucapnya. Sementara itu, Menteri Pertanian Suswono terungkap pernah mengadakan pertemuan dengan Fathanah.Tim jaksa KPK memiliki bukti foto-foto yang menunjukkan Suswono satu meja dengan Fathanah. Menurut Suswono, dia memang beberapa kali bertemu dengan Fathanah. Selain pertemuan di Medan, Suswono bertemu Fathanah di Takalar dan di rumah Wali Kota Makassar. Saat diTakalar, menurut Suswono, Fathanah tengah bersama Anis Matta. Sementara itu, pertemuan di Medan, katanya, difasilitasi Luthfi. Suswono mengaku dipertemukan dengan Direktur Utama PT Indoguna Utama Maria Elizabeth Liman oleh Luthfi di Medan. (kcm)

Ini berarti akan menjadi malam bersejarah bagi sepakbola Jerman. Namun kedua finalis memiliki motivasi sangat berbeda untuk memenangkan final di London, yang turut ditayangkan langsung SCTV dinihari nanti mulai pkl 01:45 WIB. Bagi Bayern, duel nanti menjadi kesempatan untuk menebus kekalahan menyakitkan pada final 2010 atas Inter Milan, teristimewa final 2012 ketika mereka kalah adu penalti dari Chelsea di markas sendiri, Allianz Arena. Sedangkan Dortmund termotivasi melakukan pembalasan, karena Die Roten terus berupaya menggembosi kekuatan mereka. Setelah memboyong gelandang kreatif Mario Gotze dengan nilai transfer 37 juta euro, Munich masih membidik striker Robert Lewandowski dan bek Matt Hummels. Gotze sedang cedera, sehingga absen melawan calon klub barunya. Harapan utama pelatih Jurgen Klopp di garis serang Die Borussens dengan demikian lebih bertumpu kepada Lewandowski dan winger Marco Reus. “Lewandowski striker terbaik di dunia saat ini. Tak akan mudah menjaganya, tapi kami bisa mengatasinya jika bermain rapat dan fokus,” ucap Dante Bomfim, bek sentral Bayern, seperti dikutip dari laman FIFA, Jumat (24/5). Lewandowski menjadi pemain pertama yang mampu mencetak empat gol alias kuatrik dalam satu laga semifinal Liga Champions. Penyerang Polandia berumur 24 tahun itu sekarang sudah mencetak 10 gol di kompetisi tertinggi antarklub Eropa. Namun Die Roten juga punya penyerang yang tak kalah tajam. Selain striker Kroasia Mario Mandzukic dan bomber Jerman Mario Gomez, pelatih Jupp Heynckes bisa berharap pada daya dobrak Thomas Mueller, Franck Ribery dan Arjen Robben. Melalui kebintangan mereka, FC Hollywood mampu membalikkan dominasi Dortmund, yang sempat lima kali beruntun mempermalukan pasukan Heynckes pada 2011 dan 2012. Bayern begitu kuat musim ini, dua kali menggebuk skuad Klopp di Piala Jerman serta bermain imbang pada laga kandang dan tandang Bundesliga. Dia Bavarians bahkan menjuarai Bundesliga dengan keunggulan 25 poin di atas tim peringkat dua Dortmund. Javi Martinez cs juga akan melakoni duel final Piala Jerman melawan VfB Stuttgart, 1 Juni mendatang. “Senang bisa bertemu Dortmund, semuanya besar dan sangat besar. Musim lalu kami tiga kali tampil sebagai runner-up, jadi kami tahu ke mana kami akan melangkah saat ini,” tutur Mueller. “Kami telah mengambil langkah besar menuju kesempurnaan, dan kami berniat tampil sempurna di final. Jika kami mengeluarkan semua potensi, sangat sulit bagi siapapun untuk menang dari kami,” klaim gelandang Bastian Schweinsteiger. (m15/ant/rtr/dpa/fifa) Prakiraan Formasi Pemain Bayern Munich (1-4-2-3-1): Manuel Neuer (kiper); Philipp Lahm (kapten), Jerome Boateng, Dante Bonfim Costa Santos, David Alaba; Bastian Schweinsteiger, Javi Martinez; Arjen Robben, Thomas Mueller, Franck Ribery; Mario Mandzukic. Pelatih: Jupp Heynckes Borussia Dortmund (1-4-2-3-1): RomanWeidenfeller (kapten/ kiper); Lukasz Piszczek, Neven Subotic, Mats Hummels, Marcel Schmelzer; Sven Bender, Ilkay Gundogan; Jakub Blaszczykowski, Marco Reus, Kevin Grosskreutz; Robert Lewandowski. Pelatih: Juergen Klopp Wasit: Nicola Rizzoli (Italia)

Pesawat Tabrak ... Jurubicara bandara mengatakan, sebanyak 75 penumpang dan awak dilaporkan selamat dan telah dievakuasi dari pesawat BA 762 itu. Dugaan sementara, mesin pesawat terbakar setelah menabrak burung. Seorang warga yang tinggal dekat bandara, Clive Cook, mengatakan, dia melihat pesawat itu mengeluarkan asap di mesin sebelah kanan. “Tiba-tiba suara mesinnya berubah drastis, suaranya seperti ledakan. Saya kira itu awan, ternyata asap dari mesin,” kata Clive. Saksimata lainnya, Jamie, mengaku mendengar suara ledakan. “Saya mendengar suara yangsangatkeras.Sepertipesawat jet tempur. Saya melihat mesin sebelah kanan terbakar, mengerikan sekali,” ungkap Jamie. Akibat peristiwa ini beberapa penerbangan dibatalkan dan tertunda seharian. Pihak keamanan transportasi Inggris akan menyelidiki penyebab kecelakaan tersebut.(vn/r-m10)

WASPADA Sabtu 25 Mei 2013

Medan Metropolitan


Extreme Off Road Competition 2013 Digelar Hidupkan Pariwisata Di Kota Medan KOTA Medan pernah menjadi pusat kegiatan otomotif untuk level Asia-Pasifik dan internasional. Namun untuk dunia off road, sepertinya sedikit adem ayem. Meski mobil-mobil off road dengan spek kompetisi terhitung cukup banyak, namun tidak dibarengi dengan event berskala besar. Rasanya tidak berlebihan jika event bertajuk Medan Bukit Barisan Extreme Off Road Competition 2013 jadi angin segar bagi dunia otomotif di Medan. Selain itu, event ini juga menghidupkan kembali industri pariwisata di Sumatera Utara khususnya Kota Medan. Betapa tidak, peserta yang datang bukan hanya dari regional Sumatera Utara saja. Off roader dari Aceh, Padang, Riau, Jawa Tengah ternyata juga turut meramaikan kegiatan ini. Penglepasan peserta dilakukan di Lapangan Makodam I/Bukit Barisan, Jln. Gatot Subroto km 7,5 Medan. Rombongan akan dilepas langsung Pangdam I/BB, hari ini (Sabtu, 25/5). Kemudian, seluruh peserta menuju ke lokasi Danau Alam Jaya Tuntungan yang berjarak kurang lebih 20 km dari tempat start. Kondisi trek yang harus dihadapi peserta, memang terbilang ekstrem. Pariwisata Pelaksanaankegiatanotomotifiniternyatamampumenghidupkan industri pariwisata di Kota Medan. Terbukti, para peserta off roader memenuhi beberapa hotel yang tidak jauh dari Makodam I/BB.

Seperti Anggrek Hotel di Jln. Binjai km 6,7 No. 229, Medan yang lokasinya tidak jauh dari Lapangan Makodam I/BB. Penginapan ini sering menjadi langganan para peserta lomba setiap tahunnya. Boy, 30, koordinator club off road Aceh mengatakan, mereka sengaja menginap di Anggrek Hotel karena dekat dengan lokasi event sehingga memudahkan para kru untuk memantau perkembangan terakhir kegiatan lomba tersebut. Selain itu, hotel ini dilengkapi dengan berbagai fasilitas, namun tarifnya terjangkau. “Saya dari club off road Aceh serta off roader dari daerah lain sengaja menginap di hotel ini karena dekat dengan lokasi event. Selain nyaman dan terjangkau, perkembangan kegiatan lomba mudah dipantau. Pengelola Anggrek Hotel Abdul Nasser Chan, 56, mengakui, event Medan Bukit Barisan Extreme Off Road Competition 2013 mampu menghidupkan industri pariwisata di Kota Medan. Terbukti, sejumlah hotel di sekitar Makodam I/BB dipenuhi para peserta yang datang dari berbagai daerah. Di Anggrek Hotel, lanjut Nasser Chan, banyak tamu yang menginap dari luar kota seperti Aceh. “Para tamu dari luar kota terutama dari Aceh sering menginap di sini. Tapi paling sering tamu dari Makodam I/BB,” ujarnya.(cay)

Waspada/Afli Yarman

PARA off roader dan kru foto bersama dengan pengelola Anggrek Hotel Abdul Nasser Chan, sebelum dilepas untuk konvoi keliling Kota Medan bersama peserta lainnya, Jumat (24/5).

Setelah Perbaikan Berkas

KPU Masih Temukan KTP Bermasalah Terminal Domestik Bandara Polonia Nyaris Terbakar MEDAN (Waspada) : Terminal keberangkatan dalam negeri (domestik) Bandara Polonia Medan nyaris terbakar lagi, Jumat (24/5) dinihari. Akibat korsleting arus pendek mesin pendingin (AC) yang menghubungkan ke ruang terminal keberangkatan penumpang. Sekira pukul 04:50, satu unit mobil pemadam kebakaran milik PT Angkasa Pura (AP) II Bandara Polonia Medan, tiba di lokasi melakukan penyiraman air dan busa ke asap yang sudah mengepul. “Nyaris terbakar atap bandara, namun cepat diatasi dengan menyiram busa dan air dari selang mobil pemadam kebakaran,” kata saksi mata. Riski Mediana, salah seorang karyawan mini market Indomaret yang bersebelahan dengan AC yang korsleting itu mengatakan, sekira pukul 08:00 masih banyak pegawai Angkasa Pura yang naik ke atas lantai memeriksa saluran pendingin AC yang sempat koslet itu. “Untung cepat datang satu unit mobil pemadam kebakaran, sehingga api dapat dijinakkan dan tidak sempat membakar bangunan ini,” ujar Riski. Sementara itu, Kapolpos Bandara Polonia Aiptu Saut Sihombing ketika dikonfirmasi mengakui adanya korsleting listrik pada bagian luar terminal keberangkatan dalam negeri. “Pihak keamanan APII cepat mengatasinya melalui mobil pemadam kebakaran, api dapat dijinakkan dan tidak menyala dan menjalar ke atap terminal,” tuturnya. Menurut cacatan, terakhir terjadi kebakaran pada terminal dalam negeri 1 Desember 2007, menghanguskan peralatan bandara di lantai II dan barang-barang dagangan puluhan kios pada lantai I. Ketika itu kerugian diperkirakan miliaran rupiah. (m32)

MEDAN (Waspada): Komisi Pemilihan Umum (KPU) Provinsi Sumatera Utara masih menemukan Kartu Tanda Penduduk (KTP) bermasalah saat melakukan pencuplikan sampel untuk verifikasi faktual. “Banyak fotocopy identitas ganda atau KTP yang habis masa berlakunya dimasukkan lagi oleh bakal calon DPD setelah perbaikan berkas,” kata Ketua KPU Sumatera Utara Surya Perdana dalam pertemuan dengan Ketua dan Sekretaris KPU

dari 33 kabupaten/kota di kantor KPU Provsu Jln. Perintis Kemerdekaan Medan, Jumat (24/5). Seyogianya, kehadiran unsur KPU dari seluruh kabupaten/kota se-Sumut tersebut akan menerima cuplikan sampel perbaikan berkas masingmasing Balon DPD RI untuk dilakukan verifikasi faktual di daerah masing-masing. ‘’Banyak berkas dukungan fotocopy KTP ganda maupun KTP yang berakhir masa berlakunya kembali dimasukkan bakal calon DPD pada masa perbaikan . Padahal, foto copy

KTP tidak layak tersebut telah disortir sebelumnya,’’ kata Surya Perdana. Jadi, lanjutnya, terpaksa harus diseleksi kembali. “Ada enam operator yang bekerja. Sementara, ada ribuan berkas dukungan yang hendak dicuplik atau diambil sampelnya. Jadi diperhitungkan baru akan bisa diserahkan pada Sabtu (25/5),” ucapnya. Surya menambahkan, hingga saat ini, masih dua berkas DPD yang selesai dicuplik, yakni Badikenita Br. Sitepu dan Dedi Iskandar Batubara. Sedangkan komisioner

KPU Sumut Rajin Sitepu menyebutkan, untuk mempermudah pemeriksaan berkas perbaikan DPD tersebut, telah coba dirumuskan dengan menggunakan komputer. ‘’Sayangnya, program yang digunakan juga ternyata tidak berjalan semestinya,’’ ujar Rajin. Menurut dia, KPU telah berusaha memformulasikan rumus dengan Program Exel, namun tetap sulit. “Sampel berkas dukungan Balon DPD yang bakal diserahkan ke KPU Daerah tersebut diambil secara acak 10 persen dari total berkas dukungan yang diserahkan

masing-masing Balon DPD dalam berkas pendaftaran. Dalam pertemuan muncul pertanyaan perihal dukungan foto copy KTP lama (manual) yang sekarang sudah e-KTP. Menurut Rajin Sitepu, sepanjang KTP lama (manual) dan e-KTP masih tetap sama nama, alamat dan tempat/tanggal lahirnya, kecuali hanya beda Nomor Induk Kependudukan (NIK), tidak masalah. Hal ini dapat dikategorikan Memenuhi Syarat (MS). Tunggu Ketua PN Secara terpisah, Kabag Tek-

nis dan Hubmas KPU Provsu Maruli Pasaribu yang ditanya tentang hasil kunjungan Tim KPU Sumut ke Pengadilan Negeri (PN) Medan, Jumat (24/5), mengatakan, pihaknya belum berangkat ke PN Medan, terkait status Tahan Manahan Panggabean. Menurut Maruli, tim harus bertemu dengan Ketua PN Medan serta majelis hakim yang mengadili perkara tersebut pada tahun 2010. Dia menambahkan, dijadwalkan, Senin (27/5) tim KPU Sumut akan ke PN Medan.(m34)

Jangan Salahkan Anak Tidak Lulus UN MEDAN (Waspada): Para orangtua diminta untuk tidak menyalahkan atau memarahi anak yang tidak lulus Ujian Nasional (UN). Menyalahkan dan memarahi anak bukanlah solusi atau bukan menyelesaikan masalah ketidaklulusan ini, melainkan anak akan semakin depresi. “Anak-anak itu sudah terhu-

kum dengan ketidaklulusan tersebut. Jadi tidak ada gunanya menyalahkan dan memarahi anak, karena itu tidak menyelesaikan masalah,” kata Direktur Psikologi Biro Persona Dra Irna Minauli Msi, kepada Waspada, Jumat (24/5), menanggapi dampak psikologis 2.519 siswa yang tidak lulus. Kata dia, siswa yang gagal

Ayah Aniaya Putri Kandung Diadukan Ke Polisi

Alat Berat Ilegal Diamankan

MEDAN (Waspada): Gara-gara sering memukuli putri kandungnya, seorang ayah berinisial BL, 37, dilaporkan istrinya Ariani Zamili, 35, warga Jln. Meterologi, Desa Laut Dendang, ke Polsek Percut Seituan, Jumat (24/5). Kepada polisi, Ariani Zamili menuturkan, pada Kamis (23/ 5) malam, putrinya Niki Bulele, 12, sedang tidur di dalam kamarnya. Tiba-tiba, suaminya BL pulang ke rumah diduga dalam keadaan mabuk. Melihat suaminya mabuk, Ariani Zamili menasihatinya, namun BL tak terima sehingga mereka terlibat pertengkaran. Usai bertengkar, BL langsung masuk ke dalam kamar putrinya itu. Di dalam kamar, BL langsung memijak-mijak kepala, wajah, dan tubuh korban hingga memar. Korban merintih kesakitan dan hanya pasrah dianiaya ayahnya. Mendengar suara gaduh dari dalam kamar, Ariani Zamili berusaha membuka pintu kamar putrinya, namun gagal karena dikunci suaminya dari dalam. “Saya gedor pintu kamar, tapi gak ada gunanya. Gak lama, suami saya keluar dari kamar dan saya menanyai dia apa yang telah dilakukanya kepada anak kami, tetapi dia diam saja dan pergi ke luar rumah. Saya langsung masuk ke dalam kamar anak saya untuk melihat keadaannya, ternyata anak saya sedang menangis dalam kondisi wajah, kepala, serta tubuhnya mengalami memar-memar,” tuturnya. Kata Ariani, perbuatan suaminya itu bukan kali ini saja, malah sudah sering menganiaya anaknya sendiri. “Saya mencoba untuk bersabar dan menunggu esok hari untuk mendengar penjelasannya, tetapi dia seolah-olah merasa tidak bersalah, makanya saya langsung melaporkannya dan membawa anak saya ke Polsek Percut Seituan,” sebutnya. Terpisah, Kanit Reskrim Percut Seituan AKP Faidir Chaniago saat dikonfirmasi membenarkan adanya laporan korban. “Laporan korban sudah kita terima, dan saat ini korban masih dimintai keterangannya di unit Perempuan dan Anak (PPA),” ujarnya. (h04)

MEDAN (Waspada): Satu unit alat berat jenis excavator diamankan petugas gabungan yang melakukan razia penertiban terhadap penambangan galian C tanpa izin (ilegal) di Desa Patumbak II, Kecamatan Patumbak, Jumat (24/5). Razia dipimpin Camat Patumbak Khairul S Siregar bersama Kapolsek Patumbak Kompol Triadi dan Kasatpol PP Deliserdang J Manurung dengan menurunkan90personeldariPolresta Medan, Polsek Patumbak, Satpol PP Deliserdang, Intel Kodam I BB, dan dibantu ratusan warga dan kaum ibu rumah tangga. Dalam penertiban itu, puluhan petugas bersama warga melakukan razia ke 10 titik di kawasan Desa Marendal, Patumbak II, Lantasan Lama, hingga sekitar kawasan Oma Deli. Namun, diduga razia telah bocor sehingga banyak galian C ilegal tidak beroperasi. Selain itu, petugas juga merazia truk tronton roda 10 yang melintas di pos terpadu Unit Lantas Polsek Patumbak, tetapi tidak ada truk yang melintas. Sekira pukul 15:00, petugas yang melakukan razia mene-

mukan satu alat berat jenis excavator yang ditinggal pengusahanya di lokasi galian C Pasar V, Desa Patumbak II, persisnya di belakang lokasi Kafe Pergaulan. Seorang penjaga lokasi galian C bermarga Sirait kepada petugas mengaku tidak mengetahui siapa pemilik alat berat tersebut. Selanjutnya petugas memboyong alat berat tersebut ke Pemkab Deliserdang, sedangkan kasusnya diproses di Polresta Medan. Sementara itu, Camat Patumbak Khairul S Siregar didampingi Kapolsek Patumbak Kompol Triady dan Kasatpol PP J Manurung mengatakan, belum diketahui siapa pemilik alat berat tersebut . Menurut Camat, selama razia penertiban galian C yang dilakukan pihak Kecamatan Patumbak bersama Polsek Patumbak dan Polresta Medan dengan mendirikan pos terpadu, dengan biaya operasional hingga Rp8 juta per bulan, aktivitas galian C menurun drastis. “Dari 10 titik galian C ilegal, hanya dua titik yang dijumpai sering beroperasi secara diamdiam,” ujarnya.(m40)

dalam UN akan terjadi penurunan harga diri karena akan dinilai orang lain tidak mampu menghadapi UN itu. “Sehingga mereka akan kurang percaya diri dan muncul rasa malas untuk kembali belajar karena kehilangan motivasi untuk bangkit,” sebutnya. Dampak psikologis yang paling parah, menurut Irna, adalah munculnya depresi dan berkeinginan untuk bunuh diri. “Ini harus dihindari, untuk itu

orangtua harus kembali memotivasi anak-anak yang tidak lulus, bukan malah menyalahkandanmemarahinya,”tuturnya. Irna mengatakan, memotivasi dan memberi semangat ini harus dilakukan, sehingga akan muncul kembali kesiapan mental mereka untuk menghadapi ulangan Paket C. “Pihak sekolah juga harus merangkul dan menyemangati siswa yang tidak lulus ini, sebab UN bukan akhir dari segalanya,” ujarnya.

Dia mengakui, saat ini UN dianggap sesuatu yang menakutkan dan tidak akan lulus jika tidak ada bocoran. “Saya lihat siswa-siswa ini seperti didoktrin bahwa UN itu sesuatu yang menakutkan, seolah-olah mereka tidak mampu jika tidak ada bocoran,” katanya. Untuk itu, semua pihak harus mendukung kesuksesan para siswa, mulai pemerintah daerah, guru, keluarga, dan utamanya orangtua harus menjadi

barisan terdepan untuk menjadi sosok penyemangat. “Pandangan UN menakutkan, maka harus diubah,” jelasnya. Apalagi, selama ini, pihak yang terkadang tidak siap menghadapi ujian akhir pendidikan adalah orangtua. “Selain siswa, mental orangtua juga harus disiapkan dalam menghadapi ujian nasional ini, jadi bukan sekadar mental siswa tetapi mental orangtua juga harus disiapkan,” tutur Irna Minauli. (h02)

Kemampuan Sains Siswa Madrasah Makin Diperhitungkan MEDAN (Waspada): Kemampuan sains siswa madrasah semakin diperhitungkan. Hal ini terlihat dari prestasi siswa Madrasah Ibtidaiyah Negeri (MIN) 1 Jln Pancing Medan, yang akan bersaing di Ajang Kompetisi Seni Olahraga dan Sains Madrasah (AKSIOMA) tingkat Provinsi, Senin mendatang. Lima siswa MIN 1 Medan yakni Muhammad Rizki Syahputra, Febrina Damayanti, Nabila Mahfuza, Pratama Aji Syah-

putra dan Muhammad Fachrianda Lutfi akan ikut kompetisi Matematika dan IPA. Demikian dikatakan Kepala MIN1MedanDra.DelianaRasyid Lubis, SAg didampingi wakilnya Zailani, SPdi, Jumat (24/5). Zailani menyebutkan, saat ini, siswa MIN memiliki kemampuan yang bisa diandalkan dalam berbagai bidang. Ilmu agama maupun ilmu umum seperti Matematika, Bahasa Inggeris dan IPA. Siswa di sekolah ini, telah

mendapatkan berbagai prestasi dalam perlombaan sains. Termasuk jadi juara dalam lomba digelar Bimbingan Belajar Ganesha 0peration pada April. Siswa sekolah ini atas nama, Pratama Aji Syahputra berhasil meraih nilai tertinggi pada bidang studi Matematika. Dia menambahkan, dalam memberikan bimbingan belajar kepada siswa, pihaknya selalu menekankan kedisiplinan diri dan selalu melaksanakan ibadah shalat wajib dan sunnah.

Para guru pembimbing di kelas unggulan juga menerapkan sistem belajar yang tidak menekan pada diri anak. Dengan demikian, anak belajar dengan nyaman dan terkesan sangat santai tetapi mampu menerima pembelajaran dengan baik, sehingga mereka bisa bersaing dengan teman sebayanya. “Kami berharap dalam event AKSIOMA tingkat provinsi Senin mendatang siswa kami bisa juara umum,” kata Zainuddin.(m37)

Prof. Dr. Nur Ahmad Fadhil Lubis, MA:

Pelantikan Terbesar Sepanjang Sejarah IAIN MEDAN (Waspada): Rektor Institut Agama Islam Negeri Sumatera Utara (IAIN SU) Prof. Dr. Nur Ahmad Fadhil Lubis,MA, melakukan serah terima jabatan hampir seluruh pejabat teras di perguruan tinggi itu, Jumat (24/5). Mereka adalah para wakil rektor, dekan, wakil dekan, ketua lembaga, kepala pusat koperasi, pejabat eselon III dan IV. Serah terima berlangsung di Kampus II IAIN SU Jln. Willem Iskandar, Medan Estate. Rektor mengatakan, pelantikan pejabat ini merupakan yang terbesar dalam sejarah IAIN SU. Sebab terjadi perubahan besarbesaran pada struktural organisasi IAIN SU sesuai dengan Peraturan Menteri Agama RI No. 14 Tahun 2013 tentang Organisasi dan Tata Kerja (Ortaker) IAIN SU. “Ortaker baru ini merupakan bagian dari pengembangan IAIN SU. Ada beberapa perubahan termasuk nama-nama fakultas, struktur organisasi dan sebagainya. Perubahan ini diharapkan dapat meningkatkan kinerja dan mengubah pola pikir serta wawasan kita semua,” tambahnya. Dengan Ortaker baru ini, rektor mengajak seluruh jajaran terus mengembangkan kerjasama (networking) dengan semua pihak dan mitra kerja, baik dalam maupun luar negeri. Pada kesempatan itu, rektor menyampaikan terimakasih atas pengabdian diri dan segala kontribusi dalam melaksanakan tugas pengembangan serta kemajuan IAIN SU. Pejabat yang dilantik yakni, Prof. Dr. Hasan Asari, MA (Wakil Rektor I), Prof. Dr. Dja’far Siddik, MA (Wakil Rektor II), Prof. Dr. Lahmuddin Lubis, M.Ed (Wakil Rektor III), Dr. Abdullah, MSi (Dekan Fak. Dakwah dan Komunikasi). Kemudian, Drs. Sahdin Hasibuan, MAg (Wakil Dekan I Fak. Dakwah dan Komunikasi IAIN SU), Drs. Al-Asya’ari, MM (Wakil Dekan II Fak. Dakwah dan Komunikasi IAIN SU), Drs. Abdurrahman, MPd (Wakil Dekan III Fak. Dakwah dan Komunikasi IAIN SU). Fakultas Ilmu Tarbiyah dan Keguruan IAIN SU Dr. Syafaruddin,M.Pd (Dekan), Dr. Mardianto, MPd (Wakil Dekan I), Dra. Rahmaini, MPd (Wakil Dekan II), Drs. Amiruddin Siahaan, MPd (Wakil Dekan III). Untuk Fakultas Syariah dan Ekonomi Islam IAIN SU Dr. Saidurrahman, MAg (Dekan), Dr. Azhari Akmal Tarigan, MAg (Wakil Dekan I), Dr. H. Muhammad Amar Adly, MA (Wakil Dekan II), Dr. Muhammad Yafiz, MAg (Wakil Dekan III). Fakultas Ushuluddin IAIN SU, Dr. H. Muhammad Sofyan, MA (Wakil Dekan I), Adenan, MA (Wakil Dekan-II), Drs. Kamaluddin, MA (Wakil Dekan III).

Sedangakan pejabat eselon III dan IV yang dilantik adalah Drs. Hambali Adlan, MM (Kabag Kerjasama dan Kelembagaan IAIN SU), Noval, SE (Kabag TU Fak.Tarbiyah dan Keguruan), Dra. Zainarti, MM (Kabag TU Fak.Ushuluddin), Harmansyah, (Kabag Keuangan dan Akuntansi Biro AUAK), Drs. Syahruddin Siregar, MA (Kabag Perencanaan Biro AUAK), Asnawi, SAg (Kabag Organisasi, Kepegawaian dan Hukum Biro AUAK), Drs. Makmun Suaidi Harahap (Kabag Umum Biro AUAK). Kemudian, Lies Utami Efni Syafitri, SE, MM (Kabag TU Fak. Dakwah dan Komunikasi), Drs. Syihabuddin (Kabag. TU Fak. Syariah dan Ekonomi Islam), Asniwati, SH (Kasubbag Hukum dan Kepegawaian dan Biro Hukum AUAK), Purwanto, SE (Kasubbag Data dan Informasi). Selanjutnya, Yunni Salma, SAg, MM (Kasubbag TU dan Kearsipan pada Bagian Umum Biro), Drs.Abdullah (Kasubbag TU Pada LP2M), Abdul Jousep Sitepu, SAg (Kasubbag Dokumentasi, Publikasi dan Kehumasan pada Bagian Umum), Arginta Muhammad, SAg (Kasubbag Adm. Umum Fak.Ushuluddin), Helmi Yusuf,SE (Kasubbag TU Bagian LPM), Ahmad Muaz, SE, MM (Kasubbag Kerjasama dan Kelembagaan). Prof. Dr. H. Abbas Pulungan (Ketua Lembaga Penelitian dan Pengabdian Kepada Masyarakat/LP2M), Drs. Parluhutan Siregar, MAg (Sekretaris LP2M), Drs. Rustam, MA (Kepala Pusat Penelitian dan Penerbitan LP2M), Dr. H. Hasan Mansur Nasution, MA (Kepala Pusat Pengabdian Masyarakat LP2M), Dr. Nurasiah, MA (Kepala Pusat Studi Gender dan Anak pada LP2M), Dr. Al Rasyidin, MAg (Ketua Lembaga Penjamin Mutu (LPM), Dr. Masganti Sit, MAg (Sekretaris LPM), Waizul Qarni, MA (Kepala Pusat Pengembangan Standar Mutu pada LPM). Selanjutnya, Dr. Abdillah, MPd (Kepala Pusat Audit dan Pengendalian Mutu pada LPM), Dra. Retno Sayekti, M.LIS (Kepala Pusat Perpustakaan), Muhammad Irwan Padli Nst, ST, MM (Kepala Pusat Teknologi Informasi dan Pangkalan Data), Dr. Phil H. Zainul Fuad, MA (Kepala Pusat Pengembangan Bahasa), Dr. Harun AlRasyid,MA (kepala pusat Ma’had Al-Jami’ah), Muhammad Ramadhan, SAg, MA(Kepala Pusat Pengembangan Bisnis). Sementara itu, susunan pengurus Koperasi Pegawai Republik Indonesia (KPRI) IAIN SU Periode 2013-2016, Prof. Dr. H. Ahmad Qorib, MA(Ketua Badan Pengawas), Prof. Dr. H Fachruddin, MA (Anggota Badan Pengawas), Drs. Sahdin Hasibuan, MAg (Anggota Badan Pengawas), Rajin Sitepu, SH, M.Hum (Ketua I), Drs. Efi Brata Madya, MSi (Ketua II), Drs. Asy’ari, MM (Sekretaris I), Suheri Harahap, SAg, MSi (Sekretaris II), Dra. Hj. Rusmini, MA (Bendahara). (m49)

Medan Metropolitan


WASPADA Sabtu 25 Mei 2013

SDN Percobaan Kunjungi Waspada MEDAN (Waspada): 15 Siswa unggulan SD Negeri Percobaan Medan Jln. Sei Petani berkunjung ke gedung Bumi Warta Harian Waspada Medan, Jumat (24/5). Rombongan diterima Kahumas H. Erwan Effendi . Pimpinan rombongan Darwisyah Ipmawati Gultom atas nama Kepala Sekolah Dra. Hj. Elly Zarahmi Simatupang, MPd menjelaskan, yang berkunjung merupakan siswa kelasV Akselerasi di SD Negeri Percobaan Medan. Pada kunjungan itu Darwisyah Ipmawati Gultom memperkenalkan sistem pendidikan di sekolah jenis Akselerasi yang mempunyai program pendidikan berbeda dengan sekolah biasa. Di antaranya, lama pendidikan di sekolah ini hanya lima tahun saja. Sementara jenjang kelasnya tetap sampai kelas VI. Perberdaan lain adalah kalau sekolah biasa setiap satu tahun terdiri dua semester, namun di sekolah Akselerasi terdiri dari tiga semester. Dengan demikian, proses pendidikannya lebih cepat satu tahun dari pendidikan biasa. Sedangkan siswa yang diterima merupakan siswa unggulan. “Maksud kunjungan ke Harian Waspada agar siswa mengenal Waspada/ist

15 SISWA-siswi Unggulan SD Negeri Percobaan Medan diabadikan di ruangan Redaksi Harian Waspada.

lebih dekat suratkabar dan memotivasi minat membaca. Karena itu, dipandang perlu membawa siswa langsung ke sumbernya dalam hal ini kami pendidik di SDN Percobaan Medan memilih Harian Waspada,” jelas Darwisyah yang merupakan guru bahasa Indonesia. Kunjungan ke media juga bertujuan untuk memotivasi siswa agar membangkitkan minatnya menulis. Sebab, dalam program pendidikan telah diajarkan bagaimana cara menulis yang baik. “Dari hasil kunjungan ini, setiap siswa diwajibkan membuat laporan tentang apa yang didengar dan dilihatnya ke dalam bentuk tulisan,” tambah Darwisyah. Sementara itu, H. Erwan Effendi menjelaskan, tentang sejarah berdirinya Harian Waspada yang terbit pada 11 Januari 1947. Harian Waspada merupakan suratkabar tertua di Sumatera yang saat ini aktif memberikan informasi kepada masyarakat dan diminati semua golongan, agama dan suku dengan menjunjung tinggi kebenaran dan keadilan. Kepada siswa juga diperkenalkan tentang sistem kerja wartawan dalam mencari informasi guna menjadi bahan berita yang akan diterbitkan di suratkabar. Fungsi suratkabar sebagai sumber informasi, mencerdaskan, menghibur dan melakukan social control . Sebagai suratkabar terbesar di daerah ini, Harian Waspada juga memberikan informasi tentang dunia pendidikan. “Diharapkan para siswa unggulan dapat membaca Waspada untuk menambah pengetahuannya,” jelas Erwan Effendi.(m35)

DPD-RI Dan Pemprovsu Bahas Konflik Lahan Kelompok Tani, Perusahaan Harus Tahan Diri MEDAN (Waspada): Kelompok tani dan perusahaan pemegang hak pengelola hutan yang terlibat konflik pertanahan di beberapa desa di Kecamatan Aek Nabara Barumun, Kabupaten Padanglawas, diminta untuk mengendalikan diri dari perbuatan melawan hukum. Permintaan itu disampaikan Ketua Panitia Akuntabilitas Publik (PAP) Dewan Perwakilan

Daerah RI Prof DR Farouk Muhammad pada rapat kunjungan kerja di Kantor Gubsu, Jumat (24/05). Rapat yang dibuka Sekdaprovsu Nurdin Lubis itu khusus membahas kasus sengketa lahan antara Kelompok Tani Torang Jaya Mandiri (KTTJM) dengan PT Sumatera Silva Lestari (SSL) dan PT Sumatera Riang Lestari (SRL) antara Tim PAP DPD dan stakeholder terkait. Farouk yang hadir didampingi Wakil Ketua PAP Abdul

Lima Imigran Ilegal Asal Bangladesh Ditangkap MEDAN (Waspada) : Lima Imigran diduga illegal asal Bangladesh diamankan petugas keamanan Bandara Polonia Medan, di terminal keberangkatan dalam negeri, Kamis (23/5). Menurut saksi mata, ke lima warga Bangladesh itu ditangkap saat akan masuk ke area chek in tiket hendak berangkat ke Jakarta, dengan penerbangan Lion Air. Mereka antara lain Kirisna Pillai Vasuki Jaaffna, paspor nomor 31031973, Kannathasan Kururangan Jaaffna, paspor nomor 07071998, Kannathasan Ramanan Jaaffna, paspor nomor 2992000, Kannathasan Kopika Jaaffna, paspor nomor 26042003, dan Kannathasan Surithika Jaaffna, paspor nomor 12072006. Ke lima warga Bangladesh itu tiga di antaranya perempuan selanjutnya diboyong ke kantor Imigrasi Polonia Jln. Mangkubumi Medan, untuk proses pemeriksaan lebih lanjut. (m32)

Hari Ini Alumni MTsN Temu Kangen MEDAN (Waspada): Alumni Madrasah Tsanawiyah Negeri (MTsN) Jln. Pancing dan Jln. Peratun menggelar acara Temu Kangen pada Sabtu, 25 Mei. Acara dilaksanakan di Gedung MTsN 2 Jln. Peratun, kawasan Unimed mulai pukul 10:00 sampai selesai. Panitia pelaksana Duma Sari Sende Harahap mengatakan, acara Temu Kangen dilaksanakan dalam rangka menjalin silaturahim antarsesama alumni MTsN Pancing dan Peratun, karena setelah tamat banyak yang tidak pernah bertemu sama sekali. “Acara ini baru pertama kali diadakan, dan akan dihadiri alumnialumni dari dalam kota Medan dan luar kota yang sudah mengkonfirmasi kehadirannya, seperti dari Riau maupun Pulau Jawa,” kata Duma. Salah seorang guru MTsN Darwis Siregar menyebutkan, acara Temu Kangen seperti ini sangatlah baik diadakan. Selain dapat mempererat silaturrahim antaralumni, juga dapat menyatukan alumni yang kini banyak tersebar di seluruh penjuru nusantara maupun mancanegara. Bagi alumni yang ingin hadir di acara ini dapat menghubungi Duma Sari Sende Harahap 081264802188, Irom Mardiah 085362979171, Tengku Nina 081263246338, Hafizah Ladyana 08126440533, Yessy Rahmawaty 085297140461 dan Azmi 081361111166.(m27)

Gafar Usman dan anggota lainnya yaitu Drs Rudolf Pardede dan Sofia Maipauw menegaskan, konflik itu sebenarnya adalah sengketa antara negara dengan kelompok tani. KTTJM yang terdiri atas 315 KK mengklaim miliknya 15.000 ha lahan yang statusnya adalah hutan tanaman produksi oleh PT SRL (1.200 ha) dan PT SSL (300 ha). Berdasarkan masukan informasi dari berbagai pihak yang diundang yaitu pihak perusahaan dan kelompok tani, Pemkab Palas, DPRD Palas, Kanwil BPN dan kepolisian, Farouk menyimpulkan, kunci penyelesaian konflik berada pada Kementerian Kehutanan. ”Ini sebenarnya sengketa antara negara dan kelompok tani, karena status tanah yang dikuasai adalah hutan. Makanya

kunci penyelesaian ada pada Kementerian Kehutanan,” ujar Farouk. Dia meminta kelompok tani dan perusahaan dapat menahan diri dan kepolisian dapat memberikan pengawasan, sembari pihaknya mencari jalan keluar penyelesaian kasus ini. Dia juga meminta Pemprovsu dan Pemkab Padanglawas segera menyiapkan kajian terhadap masalah dan konsep penyelesaian secara tertulis kepada pihaknya. “Secepatnya kami akan bicarakan ini dengan Menteri Kehutanan,” tuturnya. Konflik berawal dari penguasaan lahan oleh masyarakat pada tahun 2004 dan mulai muncul konflik pada tahun 2011. Masyarakat mengaku memiliki alas hak beradasarkan

Waspada/Amir Syarifuddin

TIM PAP DPD-RI bersama Sekdaprovsu Nurdin Lubis dan sejumlah stafnya serta instansi terkait foto bersama usai membahas kasus sengketa lahan di Barumun Padanglawas, di Kantor Gubsu, Jumat (24/5). akte jualbeli yang disahkan Kepala Desa dan Camat setempat. Namun belakangan Kades dan Camat ditetapkan bersalah dan ditahan karena mengeluarkan surat palsu oleh pengadilan.

PrimeOne School Menangkan IMKC Regional Medan MEDAN (Waspada): PrimeOne School berbangga karena menjadi tempat penyelenggaraan International Mathematics Kangaroo Contest (IM-KC) 2013 pada 23 Maret 2013. Kompetisi digawangi Surya Institute ini, diikuti ratusan peserta dari berbagai sekolah di Medan. Itulah momen bagi siswa-siswi mengasah keterampilan mereka dalam menjawab soal-soal Matematika. Peme-

nang kontes ini diumumkan pada awal Mei 2013. Adapun para pemenang IMKC 2013 dari Prime One School dengan Kategori PreEcolier diraih Valerie Chowey (E2 Huron) Juara 1, Magnus Yunus (E2 Baikal) Juara 2. Sedangkan untuk Kategori Ecolier, Juara 2 diraih Vanneshia Swiegl Lee (E4 Kalahari) dan Juara 3 Jonathan Kevin B.P. Simorangkir (E4Kalahari).UntukKategoriBen-

Valerie Chowey

Jannis Jona-than

jamin juara 1 diraih Jannis Jonathan (E6 Galaxy), dan Kategori Junior,Angel(JH3NM)meraihjuara 2 dan (JH3 JFK) meraih juara 3. Pihak Surya Institute mengatakan, kompetisi ini bukan sekadar mencari siapa yang menang dan siapa yang kalah. Tetapi lebih mencari bakat dan kualitas dari pesertanya. Sementara, Amrin Susilo Halim selaku Ketua Yayasan POS mengatakan, dengan diadakannya ajang bergengsi ini maka seluruh peserta dapat mengukur serta mengasah kemampuannya. Tidak cukup jika seseorang hanya mampu membaca, menulis dan berhitung, tapi kita dituntut untuk mampu menggunakan teknologi dan mampu berkomunikasi dalam skala nasional dan internasional dengan media Bahasa Indonesia, Inggris, dan Mandarin. “Intinya tidak ada kata berhenti untuk belajar,” tegasnya.(m25)

Asian Agri Ingin Hidup Harmonis Dengan Masyarakat MEDAN (Waspada): Asian Agri ingin selalu hidup berdampingan secara harmonis dengan masyarakat sekitar kebun. Jika hidup secara harmonis, perusahaan dan masyarakat akan maju.

“Dengan hidup harmonis, kami percaya masyarakat maju dan perusahaan pun maju,” kata Group Manager Gunung Melayu Alfred Lawrence Purba saat menyerahkan bantuan 33 ribu bibit ikan lele dan pakan

sebanyak 3.120 kg untuk tiga kelompok tani ikan yakni Jumbo Masundung, Forum Masundung, dan Sumber Rezeki, di Dusun Masundung dan Dusun 1 Desa Batu Anam, Kec. Rahuning Oleh PT. Gunung Melayu/

Waspada/Mursal AI

GROUP Manager Gunung Melayu Alfred Lawrence Purba memberikan pakan ikan lele di kolam milik petani ikan Dusun Masundung, Desa Batu Anam, Kec. Rahuning.

PT. Saudara Sejati Luhur Asian Agri Grup, Kamis (23/5). Untuk itu, kata Alfred, sesuai komitmen Asian Agri, tahun ke tahun akan terus membuat program Corporate Social Responsibility (CSR) pada masyarakat. “Dalam program CSR kita akan melakukan survei dan menerima masukan warga sekitar. Ini dilakukan untuk mengetahui apa yang dibutuhkan masyarakat, sehingga kita bisa membantunýa,” ujarnya. Kata dia, program CSR Asian Agri bukan untuk kepentingan perorangan, namun kepentingan secara umum. Ada beberapa hal program CSR Asian Agri, di antaranya kemitraan, pemberdayaan ekonomi masyarakat, pendidikan, kesehatan, dan perbaikan masjid dan gereja. “Dalam program kemitraan, kita akan data petani-petani untuk membantu mereka dalam pemupukannya dan lainnya. Pendidikan, kita bangun ruang kelas dan kamar mandi sekolah serta merehab madrasah, program kesehatan kita memberikan peralatan posyandu, akses air bersih, dan lainnya,” sebutnya. Terkait pemberian bibit ikan lele dan pakan ini, menurut Alfred, masuk dalam program CSR pemberdayaan ekonomi masyarakat. “Kita harapkan bibit ikan lele ini dapat memberi kontribusi yang baik untuk masyarakat. Untuk itu, kelompok

tani ikan ini benar-benar serius memelihara bibit ikan lele ini,” tuturnya. Sementara itu, Koordinator Kelompok Petani Ikan Asmadi Lubis mengatakan, pihaknya akan menjaga dan memelihara bibit lele sebaik-baiknya, sehingga akan mendapatkan hasil dan keuntungan bagi keluarga. “Saya akan bertanggungjawab, bagi kami bantuan ini cukup besar. Kami berharap Asian Agri dan masyarakat terus menjalin kerjasama yang baik untuk selamanya,” katanya. Sedangkan Camat Rahuning Mahmudi meminta masyarakat untuk menjaga kebun sawit Asian Agri yang ada di tengah-tengah masyarakat. “Jika produktivitas kebun ini meningkat, keuntungan perusahaan pun meningkat, maka CSR yang diberikan kepada masyarakat juga meningkat, untuk itu mari bersama-sama menjaga perkebunan sawit Asian Agri,” ujarnya. Sedangkan Bagian CSR PT Gunung Melayu/PT. Saudara Sejati Luhur Asian Agri Grup Fajar berharap, bibit ikan lele ini dapat meningkatkan taraf ekonomi di desa tersebut. “Kita berharap, dalam 2 tahun, kelompok tani ini memanen ikan lele sebanyak enam kali. Mudah-mudahan keinginan masyarakat untuk dapat meningkatkan taraf ekonominya bisa terwujud,” sebut Fajar. (h02)

Pihak perusahaan beralasan, mendapatkan izin untuk pengelolaan lahan dari Kementerian Kehutanan pada tahun 1992 dan meminta penegasan kepada pemerintah terkait kon-

flik yang terjadi. Gesekan antara kelompok masyarakat dan karyawan perusahaan kerap terjadi dan telah menyebabkan seorang karyawan John Boyler tewas diduga

dibunuh. Di sisi lain kelompok tani juga mengeluhkan perusakan terhadap tanaman dan rumah milik mereka yang diduga dilakukan pihak perusahaan.(m28)

Rahudman Bantu Rp40 Juta Pembangunan Masjid Al Ikhwan MEDAN (Waspada): Wali Kota Medan nonaktif Drs H Rahudman Harahap menyerahkan bantuan Rp40 juta pembangunan Masjid Al Ikhwan Jln. Bunga Wijaya Kesuma, Pasar IV, Kec. Medan Selayang, Jumat (24/5) siang. Rahudman mengatakan, bantuan Rp40 juta yakni Rp20 juta dari Pemko Medan dan Rp20 juta lagi bantuan pribadi bersama keluarga, agar bisa dimanfaatkan untuk menambah biaya pembangunan Masjid Al Ikhwan. “Saya rutin mengunjungi rumah ibadah dan sekaligus memberikan bantuan,” ujarnya. Menurut dia, walaupun nonaktif tapi silaturahmi kepada masyarakat Kota Medan tetap dilakukan. “Saya harap panitia pembangunan Masjid Al Ikhwan bisa membangun rumah nazir dan imam masjid,” tuturnya. Sementara itu, ketua pembangunan Masjid Al Ikhwan Apriandi Gunawan SH mengatakan, pihaknya mengucapkan terimakasih kepada Rahudman Harahap yang telah memberi-

kan bantuan. Gunawan yang didampingi nazir Junadi dan ketua remaja masjid Arbi Pranata menyebutkan, pembangunan Masjid Al Ikhwan dilakukan sejak 2006

dengan dana swadaya masyarakat dan donator. “Setiap bulan pihak Masjid Al Ikhwan menjalankan kotak infak kepada warga sekitar lingkungan masjid, katanya. (m36)

Waspada/Ismanto Ismail

WALI KOTA nonaktif H Rahudman Harahap memberikan arahan pada para jamaah Masjid Al Ikhwan sebelum dilaksanakan shalat Jumat.

MAN 2 Model Medan Dan SMK Farmasi Apipsu Lulus 100 Persen MEDAN (Waspada): Pengumuman hasil Ujian Nasional (UN) tahun ajaran 2012-2013 di Madrasah Aliyah Negeri (MAN) 2 Model Medan dan SMK Farmasi Apipsu Medan, Jumat (24/5), disambut sukacita oleh para murid dan wali murid. Kegembiraan tiba-tiba menyeruak saat para murid mengetahui kelulusan 100 persen di sekolahnya. Kepala SMK Farmasi Apipsu Jln. Jambi Medan Desyanti S.Farm, Apt menjelaskan, pada UN tahun ajaran 2012-2013 seluruh siswa-siswinya lulus 100 persen atau sama seperti tahun sebelumnya. “Hasil UN tahun ini sangat memuaskan karena seluruh siswa-siswi lulus,” ujar Desyanti usai menyerahkan surat kelulusan kepada orangtua murid di aula SMK Farmasi Apipsu Medan, Jumat (24/5). Menurut Desyanti, jumlah murid yang mengikuti UN sebanyak 139 orang dan lulus semuanya. Ini membuktikan kerja keras para guru dalam mendidik ternyata tidak sia-sia. Apalagi didukung keseriusan murid yang telah mempersiapkan dirinya dalam menghadapi UN.

Selain itu, tambah Desyanti, pada tahun sebelumnya sejumlah murid SMK Farmasi Apipsu juga diterima di beberapa perguruan tinggi negeri (PTN) baik di Sumut, Aceh dan Pulau Jawa melalui jalur undangan. “Mudah-mudahan, alumni SMK Farmasi Apipsu yang diterima masuk ke PTN semakin bertambah,” harap Desyanti. Kelulusan 100 persen juga dialami siswa-siswi MAN 2 Model Jln. Pancing Medan. Selain lulus 100 persen, 12 alumninya

diterima melalui jalur undangan di Poltekkes Medan dan Polmed Medan. “Alhamdulillah, seluruh murid MAN 2 lulus UN tahun ajaran 2012-2013,” kata Kepala MAN 2 Model Medan Drs. H. Amarullah, MPd. Dijelaskan Amarullah, selain kelulusan 100 persen, 10 lulusannya diterima masuk di Poltekkes Medan dan dua di PolmedMedan.SedangkandariPTN lainnya masih menunggu pengumuman lebih lanjut.(h04)

Waspada/Andi Aria Tirtayasa

KEPALA SMK Farmasi Apipsu Desyanti S.Farm. Apt menyerahkan amplop berisi surat kelulusan murid saat pengumuman hasil UN tahun ajaran 2012-2013, Jumat (24/5) di Medan.

Medan Metropolitan

WASPADA Sabtu 25 Mei 2013

Polisi Kritis Dibantai Perampok MEDAN (Waspada): Anggota Polsek Medan Helvetia Aipda M Khairul Pane, kritis dibantai dua perampok di Jln. Pantai Harapan belakang PDAM Tirtanadi, Kel. Sunggal, Kec. Medan Sunggal, Jumat (24/ 5) dinihari. Informasi Waspada peroleh di lapangan, korban Khairul

Pane, penduduk Jln. Bajak II, Komplek Villa Mutiara, Kel. Harjosari II, Kec. Medan Amplas, usai mengikuti razia yang digelar Polsek Medan Helvetia, dengan mengendarai sepedamotor Honda Vario BK 5918 ACC pergi menuju ke kawasan Jln. Pantai Harapan, Medan Sunggal. Dalam perjalanan sepedamotor korban tiba-tiba dilempar kayu sehingga dia bersama

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6 12 Banda Aceh GA-278 13 Pekanbaru GA-276 14 Batam GA-272 15 Palembang GA-266 16 Batam GA-270 17 Padang GA-262

Tiba Dari


CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam

05.20 08.45 10.30 11.55 13.55 15.55 17.55 18.45 19.55 09.45 14.50 06.10 09.55 13.20 06.00 10.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Banda Aceh Pekanbaru Batam Palembang Batam Padang

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147 GA-279 GA-277 GA-273 GA-267 GA-271 GA-263

08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 13.10 17.55 08.45 12.40 19.45 09.55 14.05 20.50

QG-831 QG-833 QG-835 QG-880 QG-882

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung 12 Banda Aceh 13 Pekanbaru

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981 QZ-8022 QZ-8028

06.05 11.20 08.00 17.25 10.40 18.30 21.25 17.00 08.25 11.35 17.10 11.00 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Banda Aceh Pekanbaru

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8023 QZ-8029

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 3. Jakarta RI-096


Jadwal Perjalanan Kereta Api No KA

Nama KA





U.28 Sri Bilah Eks/Bisnis Medan RantauPrapat U30 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.32 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.34 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.27 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.29 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.31 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.33 Sri Bilah Eks/Bisnis Rantau Prapat Medan U35 Sri Lelawangsa Ekonomi Tebing Tinggi Medan U36 Sri Lelawangsa Ekonomi Medan Tebing Tinggi U37 Sireks Ekonomi Siantar Medan U38 Sireks Ekonomi Medan Siantar U.39 Putri Deli Ekonomi Tanjung Balai Medan U.40 Putri Deli Ekonomi Medan Tanjung Balai U.41 Putri Deli Ekonomi Tanjung Balai Medan U.42 Putri Deli Ekonomi Medan Tanjung Balai U.43 Putri Deli Ekonomi Tanjung Balai Medan U.44 Putri Deli Ekonomi Medan Tanjung Balai U45 Sri Lelawangsa Ekonomi Binjai Medan U46 Sri Lelawangsa Ekonomi Medan Binjai U47 Sri Lelawangsa Ekonomi Binjai Medan U48 Sri Lelawangsa Ekonomi Medan Binjai U49 Sri Lelawangsa Ekonomi Binjai Medan U50 Sri Lelawangsa Ekonomi Medan Binjai U51 Sri Lelawangsa Ekonomi Binjai Medan U52 Sri Lelawangsa Ekonomi Medan Binjai U53 Sri Lelawangsa Ekonomi Binjai Medan U54 Sri Lelawangsa Ekonomi Medan Binjai U55 Sri Lelawangsa Ekonomi Binjai Medan U56 Sri Lelawangsa Ekonom Binjai Medan U57 Sri Lelawangsa Ekonomi Medan Binjai U58 SriLelawangsa Ekonomi Binjai Medan U59 Sri Lelawangsa Ekonomi Medan Binjai Reservasi Tiket KA Medan (061-4248666)

08.17 10.47 15.46 22.50 08.45 15.20 17.10 23.55 05.36 18.17 06.25 14.27 07.55 06.57 13.20 13.12 19.00 16.57 05.45 05.00. 07.15 06.30 09.15 08.30 11.35 10.00 14.30 12.30 16.15 17.45 17.00 21.30 20.10


13.57 16.00 21.16 03.52 14.04 20.43 22.11 05.09 07.53 20.38 10.22 18.15 12.52 11.28 17.55 17.36 23.20 21.35 06.14 05.29 07.44 06.59 09.44 08.59 12.04 10.29 14.59 12.59 16.44 18.14 17.29 21.59 20.39

kendaraannya terjatuh. Kemudian datang dua pelaku lalu mengayunkan besi linggis ke arah wajah korban. Melihat korban tidak berdaya dan menduga korban tewas ditempat, pelaku meletakkan linggis di samping sisi korban dan berusaha mendirikan sepedamotor untuk dibawa kabur. Namun, korban Khairul yang berpura-pura tewas dan dalam keadaan berlumuran darah langsung mengambil linggis itu sambil berteriak minta tolong dan mengaku anggota kepolisian. Kedua pelaku yang belum sempat mengambil sepedamotor korban langsung melarikan diri. Selanjutnya, korban dalam kondisi berlumuran darah men-

dirikan sepedamotornya dan langsung pergi menuju ke RS Bina Kasih Jln. TB. Simatupang Medan. Kapolsek Sunggal Kompol M Luther Dachi S.Sos, SH, bersama Kanit Reskrim Iptu Bambang Gunadi Hutabarat, SH, MH yang mendapat informasi kasus itu turun ke Tempat Kejadian Perkara (TKP) melakukan penyelidikan dan melihat kondisi korban di rumah sakit. Dalam kasus itu, polisi menyita barang bukti sepedamotor Honda Vario, helm pecah, kayu, dan linggis. Sedangkan istri korban Rita Hafni, 42, membuat pengaduan di Polsek Sunggal. Sementara itu, istri korban Rita Hafni ketika dikonfirmasi


mengatakan, belum mengetahui motif kejadian yang menimpa suaminya. “Kondisi suamiku kritis,” ujarnya. Waspada yang membesuk korban M Khairul yang terbaring di ruang Mawar 13 lantai III RS Bina Kasih, Medan Sunggal, belum bisa diajak bicara banyak. Korban yang berbicara pelan mengatakan tindakan pelaku cukup sadis. “Saat dibantai, saya purapura mati dan ketika pelaku hendak mengambil sepedamotor, saya langsung terbangun sambil memegang linggis milik pelaku dan mengaku polisi, sedangkan pelaku langsung kabur. Aku saat itu hendak menemui teman untuk mengurus SIM,” tuturnya. (m36)

Mahasiswa Tolak Kenaikan Harga BBM MEDAN (Waspada): Dua elemen mahasiswa di Medan menggelar unjukrasa menentang rencana pemerintah menaikkan harga bahan bakar minyak (BBM), Kamis (23/5). Setelah Persatuan Mahasiswa UISU yang menggelar aksinya di depan kampus mereka Jln. Sisingamangaraja pada siang hari, maka sore harinya mahasiswa ITM menggelar aksi sama di depan Taman Makam Pahlawan dan salah satu SPBU di Jln. Sisingamangaraja. Dari amatan Waspada, Kamis sore, puluhan mahasiswa Institut Teknologi Medan (ITM) menggelar aksi sambil membakar ban bekas di badan jalan depan Taman Makam Pahlawan, sehingga arus lalulintas menjadi macat. Mereka juga berorasi di depan Stasiun Pengisian Bahan Bakar Umum (SPBU) No. 14.202.126 Jln. Sisingamangaraja, tidak jauh dari Taman Makam Pahlawan. Aksi itu mendapat pengawalan aparat kepolisian, tetapi tetap menimbulkan kemacatan panjang, karena mereka memaksa berbaris di tengah jalan. Sejumlah poster berisi kecaman terhadap pemerintah juga dipampangkan, seperti Tolak Kenaikan Harga dan Intervensi Asing dan lainnya. Bahkan salah satu mobil

plat merah jenis Ford Double Cabin BB 8087 D juga sempat disandera mahasiswa, dan menempelkan poster-poster kecaman di kaca mobil itu. Mereka mengatakan, rencana pemerintah menaikkan harga BBM awal Juni pada kisaran 15-20 persen akan berdampak buruk bagi perkembangan ekonomi. Harga kebutuhan pokok akan naik dan biaya produksi meningkat. “Ini akan menjadikan beban hidup semakin berat dan ekonomi nasional mengalami kesulitan. Apalagi pendistribusian BBM sering diselewengkan karena kurangnya pengawasan,” kata mahasiswa. Karena itu, mereka meminta pemerintah meninjau ulang UU No. 22/2011 dan PP No. 79/ 2000, kemudian menasionalisasikan aset-aset sumber daya alam yang dikelola pihak asing, stop pemborosan APBN untuk pejabat negara, memberdayakan potensi sumber daya manusia, membatasi kepemilikan kendaraan pribadi dan penjualannya serta merealisasikan penggunaan energi terbarukan. Sementara, puluhan mahasiswa Universitas Islam Sumatera Utara (UISU) Al Munawarah tergabung dalam Persatuan Mahasiswa (Pemas) UISU menggelar aksi di depan kampus mereka Jln. Sisingamanga-

raja. Mereka juga menolak kebijakan pemerintah yang akan menaikkan harga BBM. Menurut mereka, kenaikan harga BBM membuat masyarakat semakin menderita, bahkan akan meningkatkan tindakan kriminalitas, karena semakin kerasnya tekanan kehidupan yang harus dijalani masyarakat. Pemerintah, kata koordinasi aksi David, seharusnya mensejahterakan masyarakat dan meningkatkan jaminan bagi para buruh, tani, pedagang tradisional dan lainnya. Bukan malah menaikan harga BBM yang hanya menyusahkan dan membuat penderitaan masyarakat. Selain orasi, para mahasiswa juga membentangkan spanduk dan poster menolak kenaikan harga BBM, sambil menyanyikan lagu-lagu perjuangan. Aksi mereka dikawal belasan personel PolsekMedanKotaberpakaiandinas dan sipil. Sebagian di antaranya mengatur lalulintas dan berjagajaga di sekitar pengunjukrasa. Terpisah, Rektor UISU Prof Zulkarnain Lubis berharap mahasiswa yang melakukan unjukrasaagartetapmemberiruang bagi masyarakat pengguna jalan. Meski sempat memacatkan arus lalulintas, namun unjukrasa mahasiswa UISU berjalan tertib, hanyasekitar2,5jam,mulaipukul 10:00-11:30. (m27/m49)

Sekda Lantik Pengda PWRI Provsu MEDAN (Waspada): Sekretaris Daerah Provinsi Sumatera Utara H Nurdin Lubis SH, MM, mewakili Gubsu melantik Pengurus Daerah Persatuan Wredatama Republik Indonesia (PWRI) Provinsi Sumatera Utara Masa Bakti 2012-2017, di Gedung Binagraha Pemprovsu, Kamis (23/5). Gubsu melalui Sekdaprovsu Nurdin Lubis mengatakan, pelantikan Pengda PWRI Sumatera Utara, merupakan salah satu indikator PWRI Sumut telah mampu menjaga keberlangsungan serta eksistensi dan

peran organisasi. Diharapkan dengan dilantiknya kepengurusan merupakan daya penggerak bagi seluruh pengurus daerah PWRI Provsu dalam menyatukan visi dan aksi yang sama, agar PWRI Provsu semakin maju dan mampu memperkokoh eksistensi dalam pengembangan organisasinya. Ketua PWRI Provinsi Sumatera Utara Drs HM Ramli Purba MM mengatakan, pengurus PWRISumutsiapmendukungkebijakan-kebijajan dari Pemerintah Daerah Provsu untuk kemak-

muran dan kemajuan masyarakat, sesuai dengan potensi dari masing-masing pengurus PWRI. Dikatakannya, seluruh anggota PWRI masih dapat memberikan kontribusi, sehingga masih mampu memberikanide-idekreatifdaninovatif dalam upaya memacu kembali semangat untuk meningkatkan kinerja seluruh jajaran PWRI. Hadir dalam kesempatan tersebut Pimpinan FKPD beserta jajarannya, para Kepala SKPD, dan Pengurus Cabang PWRI Kabupaten/Kota se-Sumatera Utara.(m28)

AIMI Harus Tunjukkan Eksistensinya Dalam Pembangunan Nasional MEDAN (Waspada): Kepala Badan Kesbanglinmas Provsu Eddi Sofyan MAP, mengharapkan agar pengurus Dewan Pimpinan Pusat Asosiasi India Muslim Indonesia periode 20132016 yang telah dilantik segera menunjukkan eksistensinya dalam pembangunan nasional dan meningkatkan sumber daya manusia masyarakat India Muslim khususnya. “Hal ini pada gilirannya akan membantu pemerintah daerah dalam melaksanakan pembangunan yang berkesinambungan secara adil dan merata yang berorientasi pada kesejahteraan masyarakat secara keseluruhan,” tutur Eddi Sofyan pada acara pelantikan pengurus DPP Asosiasi India Muslim Indonesia sekaligus perayaan

HUT AIMI yang pertama di Medan, Kamis (23/5) malam. Menurut dia, dalam perspektif membangun persatuan dan kesatuan dalam kerangka NKRI, diharapkan kehadiran AIMI dapat menjadi perekat keutuhan bangsa, mengingat semangat kolektifitas etnisitas dewasa ini potensial menjadikan kita terkotak-kotak. Jika asumsi ini benar maka yang perlu menjadi perhatian kita adalah AIMI ikut serta dalam upaya meningkatkan wawasan kebangsaan kepada seluruh elemen masyarakat khususnya di Sumatera Utara. “Perlu dibangun sinergitas antara pemerintah dengan organisasi kemasyarakatan yang berbasis etnis untuk perkuatan empat pilar kebangsaan yaitu

Pancasila, UUD 1945, NKRI dan Bhineka Tunggal Ika,” katanya. Sementara itu, Ketua Umum DPP AIMI HM Danil Sultan SE menjelaskan, AIMI hadir tidak untuk memaksakan diri atau menonjolkan diri dari etnis-etnis lainnya, namun untuk menghadirkan misi dan visinya dalam menunjang pembangunan bangsa ini. “AIMI hadir ntuk mendukung program pembangunan pemerintah dalam sektor sosial, pendidikan dan ekonomi,” ujar Danil Sultan. Pengurus DPP AIMI periode 2013-2016 diketuai HM Danil Sultan, Sekretaris Umum Fauzan Amir Gos, Bendahara Umum Habiburrahman Khan yang dibantu dengan sejumlah pengurus lainnya. (h04)

Waspada/Andi Aria Tirtayasa

KETUA Umum DPP Asosiasi India Muslim Indonesia periode 2013-2016 HM Danil Sultan SE, menerima pataka dari Badan Pendiri HM Nasir Sahib.

Waspada/Amir Syarifuddin

GUBSU Gatot Pujo Nugroho meninjau stand Politeknik Negeri Medan pada Pekan Pameran Inovasi di Gedung Serbaguna Jln. Williem Iskandar Medan.

Gubsu Buka Pekan Pameran Inovasi Sumatera Utara 2013 MEDAN (Waspada): Gubernur Sumatera Utara H Gatot Pujo Nugroho ST, membuka Pekan Inovasi Sumatera Utara 2013 di Gedung Serbaguna Jln. Williem Iskandar Medan, Rabu ( 22/ 5). Pameran ini diikuti ratusan peserta dari berbagai daerah tingkat dua dan provinsi lain di Indonesia. Dalam sambutannya Gatot mengajak seluruh pihak mensukseskan Pekan Inovasi yang digelar 5 ingga 26 Mei mendatang. Pekan Inovasi yang digelar Badan Penanaman Modal dan Promosi Sumatera Utara bertujuan meningkatkan daya saing Sumut. “Meningkatkan daya saing itu dibutuhkan penyebaran informasi sehingga dapat menarik investor luar agar mau menanamkan modalnya di Sumatera Utara,” ujarnya. Pembukaan Pekan Inovasi berlangsung meriah, dihadiri konsulat asing di antaranya Konsulat RRC, Malaysia, Singapura, Bupati dan Wali Kota se Sumatera Utara, FKPD dan Jajaran SKPD Provsu dan Medan, Ketua Dekranasda Sumatera Utara Hj Sutias Handayani Gatot Pujo Nugroho serta ratusan peserta pameran. Gatot mengatakan, iklim usaha di Sumut terus tumbuh dan berkembang, untuk itu perlu promosi dan kerjasama yang lebih kuat dan luas agar dapat meningkatkan daya saing serta meningkatnya pembangunan. Dijelaskan, di Sumatera Utara banyak peluang usaha dan sumber daya alam yang perlu di kembangkan. Sehingga lewat Pekan Inovasi kali ini diharap bisa terjadi transaksi bisnis dan terjalin kerjasama bernilai ekonomis.

“Semoga dengan Pekan Inovasi kali ini dapat mengembangkan produk strategis, kreatif, inovatif dan menguntungkan semua pihak,” tutur Gatot yang membuka kegiatan itu dengan pemukulan Gordang Sembilan yang diikuti para Konsul dan bupati. Kepala Badan Penanaman Modal dan Promosi Sumatera Utara Hj Purnama Dewi dalam laporannya menjelaskan, Pekan Inovasi Sumut 2013 bertujuan membangun komunikasi tentang peluang investasi, menciptakan media informasi yang efektif, objektif tentang pembangunan, membuka pasar produk strategis, mitra usaha, media promosi seni budaya serta untuk meningkatkan kreatifitas masyarakat terutama untuk menciptakan daya saing ekonomi Sumut. Adapun rangkaian kegiatan berupa pameran pembangunan, produk inovatif, Sumut Investment Forum, Sumut Inovation Award dan pameran seni budaya, Indischool Band, festival kuliner dan hiburan rakyat. Pameran diikuti 81 peserta dan 93 stand dari SKPD, Pemkab, Perguruan Tinggi, BUMN , BUMD dan perusahaan nasional dan asing. Dalam ksempatan itu Gubsu dan rombongan meninjau stand pameran di antaranya stand Bank Sumut, Pemkab Sergai, Perkebunan Sumatera Utara, Badan Penanaman Modal dan Promosi Sumut, Railink Kereta Api, Dinas Perhubungan, Stand Dekranasda, Provinsi Kalimantan Barat, Angkasa Pura II, Kualanamu dan Silangit, Kantor Penanaman Modal dan Perijinan Terpadu Semarang, Prov Maluku Utara, dan stand lainnya.(m28)

Barnas Sumut Siap Menangkan Cabup-Cawabup Paluta Incumbent MEDAN (Waspada): Pengurus DPD Barisan Nasional (Barnas) Sumut akan bekerja keras untuk memenangkan pasangan Calon Bupati dan Wakil Bupati Incumbent Padang Lawas Utara (Paluta) Drs Bachrum Harahap dan Rikson Hasibuan. “Kita akan bekerja keras untuk memenangkan pasangan incumbent ini, dan diharapkan kedepan kinerjanya akan semakin bagus lagi,” kata Ketua DPD Barnas Sumut M Ilal Gunawan (foto) kepada Waspada di Medan, Jumat (24/5). Kata dia, dukungan kepada cabup dan cawabup incumbent ini sudah diserahkan ke KPU Paluta dengan melampirkan surat persetujuan DPP Barnas. “Sudah kita serahkan surat pemberitahuan, surat persetujuan dukungan Pilkada terhadap pasangan ini. Kita juga melampirkan SK DPP yang ditandatangani Ketua Umum DPP Barnas Ir HM Arfan MM, dan Sekjen Steven Rumangkang,” ujarnya. Menurutnya, sejak kepemimpinan pasangan

ini, pembangunan di Padang Lawas Utara sudah mulai terlihat. “Insfrastruktur sudah mulai baik. Sampai saat ini mereka tetap sejalan untuk kembali maju dalam Pilkada 2013–2018. Artinya, mereka tetap kompak memajukan Paluta ini,” sebutnya. Jika masyarakat kembali memberi kepercayaan kepada pasangan ini untuk memimpin Paluta, maka kemajuan Paluta akan lebih dirasakan masyarakat. “Untuk itu, mari kembali kita dukung pasangan ini,” tuturnya. Ilal Gunawan yakin, dukungan masyarakat untuk incumbent saat ini cukup besar. “Saya yakin masyarakat masih menginginkan incumbent untuk memimpin lagi, karena popularitasnya cukup besar,” katanya. Program yang dibuat pasangan cabup dan cawabup saat ini benar-benar merupakan kebutuhan masyarakat dan hasilnya benar-benar dirasakan serta dinikmati masyarakat. “Seluruh kader Barnas wajib mendukungnya,” tutur Ilal Gunawan. (h02)

Bawa Samurai, Siswa SMK Diamankan MEDAN (Waspada): Polsek Sunggal menangkap dua pria remaja diduga geng kereta membawa pedang samurai di Jln. Kenanga Raya dekat Toko Roti Mawar Medan, Kamis (24/5). Satu di antaranya pelajar SMK di Stabat, Kab. Langkat. Keduanya berinisial DSW, 16, penduduk Jln. Punak Gang Bengkok, dan YR, 16, pelajar SMK penduduk Jln. Bunga Asoka, Tanjungsari yang kos di Stabat, Langkat. Dari mereka, disita barang bukti sebilah pedang samurai dan sepedamotor Yamaha Mio. Informasi Waspada peroleh di lapangan, petugas yang sedang melakukan patroli ketika melintas di Jln. Kenanga Raya dekat toko Roti Mawar melihat kedua remaja itu mengendarai sepedamotor sambil membawa pedang samurai lengkap sarungnya diduga anggota geng kereta. Petugas langsung melakukan pengejaran dan menangkap keduanya lalu diboyong ke Polsek Sunggal. Kapolsek Sunggal Kompol M Luther Dachi SSos, SH melalui Kanit Reskrim Iptu Bambang Gunadi Hutabarat SH, MH mengatakan, pihaknya masih melakukan pemeriksaan terhadap dua tersangka membawa pedang samurai. “Kita belum mengetahui apakah mereka ini merupakan kelompok geng kereta, penyidik masih mendalami kasus tersebut,” kata Bambang. Selesai menjalani pemeriksaan,YR membantah dirinya kelompok geng kereta. “Pedang samurai itu milik DSW dan rencana untuk dijual untuk menambah uang kos di Stabat. Saya kos,

karena sekolah di Stabat,” tuturnya. Dianiaya Sehari sebelumnya, Selasa (21/5) malam, gara-gara senggolan sepedamotor, Taufik Hidayat, 19, dianiaya tiga pelaku diduga anggota geng kereta di depan pekuburan Kristen Jln. Letjen Jamin Ginting-Padangbulan Medan, Selasa (21/ 5) malam. Informasi Waspada peroleh di lapangan, korban Taufik, warga Komplek Purna Bakti TNI AU, Medan Polonia, mengendarai sepedamotor bersama teman wanitanya Tian Novelia melintas di Jln. Letjen Jamin Ginting-Padangbulan, untuk mengantar pacarnya itu pulang ke rumahnya di Jln. Balai Desa, Medan Polonia. Setiba di dekat pekuburan Kristen, korban mencoba mendahului sepedamotor pelaku, namun dihalang-halangi sehingga terjadi senggolan kendaraan mereka. Selanjutnya, tiga pelaku yang mengendarai dua sepedamotor itu memerintahkan korban berhenti. Merasa curiga, korban tidak mau berhenti dan menambah laju kendaraannya. Ketiga pelaku langsung mengejar dan memepet sepedamotor korban sehingga Taufik dan pacarnya nyaris terjatuh. Saat korban berhenti, ketiga pelaku memukulinya. Korban langsung lari ke rumah warga minta pertolongan. Melihat massa datang, ketiga pelaku langsung kabur. Sedangkan korban Taufik Hidayat membuat pengaduan ke Polsek Medan Baru.(m36)


Medan Metropolitan

WASPADA Sabtu 25 Mei 2013

Bengkel Pencincangan Mobil Curian Digerebek MEDAN (Waspada): Reskrim Unit Ranmor Polresta Medan menangkap delapan tersangka dalam penggerebekan bengkel sekaligus gudang pencincangan mobil curian di Jln. Kris 45, Medan Perjuangan, Kamis (23/5) sore. Tersangka yang diamankan

FH (kasir), MN, T, JP alias Ucok, BH, MN, A, dan HN. Sedangkan pemilik bengkel yang diduga sebagai bos RM berhasil melarikan diri. Informasi di Polresta Medan, sebelumnya polisi mendapat laporan dari warga yang menyebutkan ada bengkel yang

diduga gudang penyimpanan sejumlah sparepart mobil curian yang telah dicincang di lokasi kejadian. Polisi kemudian menuju ke lokasi dan menyaru sebagai pembeli yang ingin membeli spare part mobil Fuso Tronton. Saat dilakukan pengecekan

polisi melihat mesin mobil tronton milik Heru Susanto, 41, warga Jln. Gang Setia Dusun III, Desa Tanjung Sari Batangkuis, telah dicincang. Selain mesin mobil tronton yang nomornya sesuai dengan nomor mesin kendaraan korban yang hilang pada19 Mei

2013lalu,dilokasijugaditemukan ban,sparepartmobil,danlainnya. Dalam kasus ini, korban telah membuat laporan polisi di Polsek Batang Kuis dengan nomor LP/100/V/2013 atas hilangnya truk Fuso Tronton warna orange miliknya saat diparkir di halaman rumahnya. Akibat

pencurian itu, korban menderita kerugian Rp700 juta. Petugas mengamankan delapan orang yang berada di bengkel tersebut dan memboyongnya ke Polresta Medan. Dari hasil pemeriksaan, polisi kemudian menggeledah gudang BJ di Jln. Mandala By

Pass dan menemukan rangka mobil tronton. Kasat Reskrim KompolYoris Marzuki yang dikonfirmasi melalui Kanit Ranmor Iptu Alex, Kamis malam mengatakan, delapan orang yang diamankan diserahkan ke Polsek Batangkuis karena lokasi hilangnya mobil

di wilayah hokum Batang Kuis. “Pihaknya menduga di lokasi bengkel itu sudah ratusan mobil curianyangdicincang.Kitamasih melakukan penyelidikan karena masih ada dugaan beberapa gudang di kawasan Medan yang dijadikan lokasi pencincangan mobil curian,� jelasnya. (m39)


WASPADA Sabtu 25 Mei 2013

07:00 Barbie As The Princess 09.00 Dahsyat Weekend 11:00 Intens 12:00 Seputar Indonesia Siang 12:30 Where The Wild Things Are 15.15 Larva 15.45 Seputar Indonesia 16.15 Masterchief Indonesia 18.00 Jodohku 19.00 Berkah 20.00 Layar Drama Tukang Bubur Naik Haji 22.30 Box Office Movie 00.00 Seputar Indonesia


07.00 SCTV Musik Inbox 09.00 Liputan 6 Terkini 09.03 Hot Shot 10:00 SCTV FTV Pagi 11.00 Liputan 6 Terkini 12:00 Liputan 6 Siang 12.30 Film Layar Lebar 14.00 Liputan 6 Terkini 14.30 SL Eat Bulaga Indonesia 16.00 Liputan 6 Terkini 16.03 SL Eat Bulaga 16.30 Liputan 6 Petang 17.00 Heart Series 18.00 Pesantren Rock N Roll 19.00 Love In Paris 22.00 Ustad Fotocopy 22.00 SCTV Sinema

07:00 Ayo Main 07:30 Upin & Ipin Dkk 08:00 Smart Mom Happy Kid Season 2 08:30 Pose 09:00 Masak Apa Hari Ini 09:30 Pelesir 10:00 Jendela 10:30 Mata Pancing 11:00 Layar Kemilau 14:30 Senior Yunior 16:30 Tuntas 17:00 Inspirasi Sore 17:30 Animasi Spesial 18:00 Sepatu Super 19:00 Tendangan Si Madun Season 3 20:30 Raden Kian Santang 22:00 Hidayah 00:00 Layar Tengah Malam

07:30 Foody With Rudy 08:00 Clinic Secret Herbal 08:30 Fenomania 09:00 Property On Sale 09:30 Kaki 5 10:00 Jelajah Mimpi 10:30 Tamu Rempong 11:30 Topik Siang 12:00 KLIK! 13:00 Mantap 14:00 Total Football 14:30 Kampiun Sepakbola Nasional 15:00 Indonesia Super League 17:35 Pesbukers Like This 18:30 Indonesia Super League 21:00 Sinema Spesial 23:00 Mata Lensa

07:00 KISS Pagi 08:00 Jelita 08:30 Hypermart Show 09:00 Glumpers 09:30 Sinema Pagi Akhir Pekan 11:30 Patroli 12:00 Sinema Pintu Taubat Siang 14:00 Hot KISS 15:00 Fokus 15:30 Jangan Anggap Aku Kecil 16:00 The Voice Indonesia 18:00 Drama Seri Indonesia: Setulus Kasih Ibu 19:00 Sinema Indonesia: 20:00 Gebyar BCA 21:00 Pesta Semarak Indosiar 2013 23:00 Sinema Unggulan

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:05 Bedah Editorial Media Indonesia 08:05 Indonesia Now 08:30 Agung Sedayu Group 09:05 Untuk Buah Hati 09:30 Agung Sedayu Group 10:05 Menu & Venue 10:30 Metro Xin Wen Lifestyle 11:05 Inovator Indonesia 11:30 Spirit Football 12:05 Metro Siang 13:05 OprahWinfrey Show 14:05 Young On Top 14:30 Autozone 15:05 Just Alvin 16:05 360 17:05 Metro Hari Ini 18:30 Metro Highlights 19:05 Penantang Terakhir 20:05 Dua Tamu 21:05 Top 9 News 22:30 Segelas Cerita

A7 07:30 Mozaik Islam 08:00 Celebrity On Vacation 08:30 WIsata Kuliner 09:00 Ceriwis 09:30 Ala Chef 10:00 Sportvaganza 10:30 Woww 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 15:00 DR OZ 16:00 Insert Investigasi 16:45 Reportase Investigasi 17:15 Cari Cinta 18:00 Indonesia Mencari Bakat 3 21:00 Bioskop TransTV 23:00 Bioskop TransTV 01:00 Sinema Dini Hari

08:30 Tinju Legendaris 09:30 Sport Doc 10:00 Soccer One Indonesia 10:30 Prediksi 11:30 Live News Kabar Siang 12:00 Santap Siang 12:30 Property In Harmony 13:00 Damai Indonesiaku 15:00 Menuju Brazil 2014 15:30 Khazanah Islam 16:00 Bukan Jalan Jalan Biasa 17:00 Live News Kabar Petang 19:00 Sport Documentary 20:00 Live News Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam

07:30 Chicken Little 09:30 Cerita Dibalik Noda 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Awas Ada Sule 13:00 Before 30 13:30 Film TV 15:30 Fokus Selebriti 16:30 Kemayu 17:00 Komeng AcakAdul 18:00 Big Movies 20:00 Big Movies 22:30 Big Movies

07:00 Plester 07:30 Selebrita Pagi 08:30 She Can Tupperware 09:00 Party Kejutan 09:30 Spotlite 10:00 Wollipop 10:30 RAN 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Galeri Sepak Bola In. 13:30 One Stop Football 14:00 Highlights Otomotif. 14:30 Mancing Mania 15:00 Seleb Expose 16:00 Marry Me 16:30 Redaksi Sore 17:00 CCTV 17:30 5 Juta 5 Menit 18:00 Oesman 77 19:00 OVJ 21:00 Pas Mantab 22:30 Mister Tukul 23:30 Kualifikasi MotoGP 00:30 (Masih) Dunia Lain **m31/G

BandRockRusiaPakaiGitarBuatanIndonesia Ada kelompok musik Rusia beraliran rock menamakan diri Indonesia dan memakai gitar buatan Indonesia menyanyikan lagu-lagu hit mereka seperti Pretty Colours dan Against My Father. Mereka memakai nama Indonesia karena dengar cerita Indonesia dari orangtuanya yang berkunjung ke Bali. “Gitar mereka juga made in Indonesia”, kata Dubes RI di Moskow Djauhari Oratmangun dikonfirmasi lewat pesan elektronik dari Jakarta, Jumat. Band Indonesia yang mirip kelompok musik keras seperti Nirvana dan Led Zeppelin ini dibentuk di Saint Petersburg pada musim gugur 2007. Band ini diperkuat Coal (vocal), Santa (bass), Charlie (drum) dan De-

mian (gitar). “Saya sudah menemui mereka di studio saat latihan. Mereka pemusik rock kualitas tinggi. Lagu-lagu mereka bisa diunduh di youtube. Silahkan unduh dan nikmati,” kata Dubes Djauhari. Lagu-lagu yang bisa diunduh di youtube antara lain Againts My Father dan We Are The Same Mengenai mengapa mereka band beraliran cadas itu sampai memilih nama Indonesia untuk grup band mereka, Santa yang bermain Bass menjawab dalam MySpace bahwa itu terjadi karena kebetulan. Mereka sudah mencari banyak nama yang co-

cok tapi tidak ketemu-ketemu. Suatu ketika, si pemetik gitar Demian tidak sengaja menemukan sebaris kalimat di bawah gitarnya bertuliskan Made In Indonesia. “Yeah!” Demian tersintak. – “Ini dia nama yang dicari! INDONESIA!” lanjutnya. Maka sejak itu dan sampai sekarang kelompok band disukai muda-mudi Rusia dan menelorkan sejumlah album itu memakai nama Indonesia. “Saya bangga ada band Rusia pakai nama Indonesia dan pakai gitar Indonesia,” kataWiwit, mahasiswi yang mengaku suka mendengarkan lagu-lagu Indonesia via youtube. “Coba Indonesia diundang konser di Jakarta. Demian ganteng banged,” kata mahasiswi pencinta musik cadas itu.(ant)

Entong, Animasi Terbaru Kebanggaan Anak Bangsa

Festival Film Cannes bertabur bintang, namun banyak pula pencurian disana/

Festival Cannes Dicemari InsidenPencurianPerhiasan Festival Film Cannes digemparkan aksi pencurian perhiasan, Kamis, saat kalung berlian seharga dua juta euro (2,6 juta dolar as), raib dalam pesta bertabur bintang, menurut penjual perhiasan papan atas De Grisogono. Fawaz Gruosi, pendiri perusahaan perhiasan dari Swiss itu mengatakan, kalung tersebut merupakan koleksi peringatan 20 tahun perusahaan diperagakan 20 model dalam acara di hotel Du Cap-Eden-Roc di Antibes, pinggiran Cannes pada Selasa malam. Sharon Stone dan Paris Hilton ada di antara tamu yang hadir dalam peragaan tersebut. Gruosi mengatakan ada 80 orang pengawal serta polisi dan pe-

tugas keamanan hotel bertugas dalam acara tersebut demikian pula staf dari De Grisogono, tetapi saat pemeriksaan akhir dilakukan pada malam hari, kalung berlian itu telah lenyap. “Kami tidak tahu dengan pasti apa yang terjadi... kalung itu merupakan salah satu perhiasan tercantik yang kami miliki,” kata Gruosi kepada televisi Reuters. “Polisi sedang menyelidiki peristiwa tersebut.” Satu sumber di kepolisian Cannes mengatakan, pihak berwajib sedang menyelidiki apakah ini merupakan kasus pencurian, masalah pendataan atau kehilangan. Salah seorang produsen perhiasan Swiss lainnya, Chopard juga mengaku kehilangan permata bernilai 1,4 juta dolar pada pekan pertama festival berlangsung 12 hari di Riviera, daerah mewah Prancis, senantiasa menarik perhatian ribuan artis dan

insan film serta wartawan. Polisi mengatakan bahwa perhiasan Chopard berada di tempat aman di kamar suit hotel Novotel di pusat Cannes disewa pegawai perusahaan itu. Sistem keamanan sudah diterapkan di seluruh dinding hotel pada 16 Mei malam, tetapi seseorang berhasil masuk tanpa paksaan atau menggunakan kunci magnetik, kata polisi. Juru bicara Chopard perusahaan sponsor untuk Festival Film Cannes kemudian membuat laporan bahwa nilai kehilangan itu telah dilebih-lebihkan. Rumah mode dan perhiasan memanfaatkan festival film terbesar di dunia untuk ajang pameran dan promosi, mereka meminjamkan gaun-gaun dan perhiasan kepada para selebritas yang biasanya difoto di atas karpet merah dan selama pesta berlangsung di pelabuhan Croisette.(ant)

Komitmen MNCTV untuk gigih mengusahakan wadah berekpresi para animator Indonesia dengan menayangkan karya terbaru mereka terus berlanjut. Setelah tayangan animasi Songgo Rubuh mendapat sambutan luar biasa dari pemirsanya dan Didi Tikus menjadi karya animasi paling favorit Panasonic Awards 2012, MNCTV kembali meyangkan animasi bertajuk Entong setiap Rabu petang pukul 17.30. “Animasi Entong merupakan karya terbaru kebanggaan anak bangsa siap menghibur pemirsa MNCTV. Kami optimis tayangan dalam format animasi dengan cerita baru dan lebih menarik ini, mampu mengulang sukses besar Sinetron Si Entong yang pada 2006 silam pernah menjadi program unggulan kami dengan rating dan share tinggi,” papar Nana Putra, Managing Director MNCTV di Jakarta, baru-baru ini. Dibalut komedi khas Betawi yang kaya dengan adegan slapstick, tayangan animasi tetap bermuatan kisah realita dan fiksi ini, asyik untuk ditonton. Tayangan berdurasi 6 menit ini penuh dengan cerita yang menghibur juga berkualitas. “Daya tarik utama Animasi mengisahkan kehidupan bocah 10 tahun – anak janda bernama Fatimah yang tinggal di salah satu Kampung Jakarta adalah bumbu-bumbu petuah bagi anakanak dengan cara yang ringan dan tidak menggurui. Semua karakter pada cerita ini, memiliki keunggulan prilaku masingmasing yang mengundang tawa atau minimal membuat pemirsa tersenyum,” jamin Nana.

kan partner dan tim yang tepat untuk mendistribusikan dan memasarkan film pertama kami.” Angry Birds awalnya dikenal sebagai game mobile pada 2009 telah menjadi fenomena franchise hiburan yang besar di dunia. Pada Desember, Hed mengatakan pada AFP bahwa film

Angry Birds dapat memicu Rovio membuat studio film yang dapat berkompetisi dengan Studio Animasi Walt Disney. “Jika ini berjalan lancar, itulah yang akan terjadi. Kami membuat rencana agar kami dapat memproduksi banyak film setelah yang satu ini,” imbuhnya. (ant)

Berperan dalam 22 film dalam kurun waktu enam tahun bagi Reza Rahadian bukan berarti dia sudah merasa mapan sebagai aktor, ia mengaku masih membutuhkan acting coach. Reza mengungkapkan acting adalah proses belajar tiada henti karena selalu ada tantangan baru. Meskipun begitu, bukan berarti Reza selalu bergantung pada pelatih di setiap film. Hanya film tertentu memerlukan pendalaman karakter dengan tingkat kesulitan yang tinggi, seperti saat dia harus memerankan Habibie fasih berbahasa Jerman. Bagi aktor bermain di Finding Srimulat, acting coach adalah teman diskusi tentang interpretasi suatu peran. “Kalau dari unsur peran, butuh acting coach untuk debat, saya interpretasi tentang karakter ini, dia bagaimana interpretasinya, didebat,” kata dia usai jumpa media Indonesian Movie Awards 2013 di Jakarta, Selasa. “Bukan untuk melatih, tapi mengukur interpretasi,” jelasnya. Reza masuk dalam nominasi Pemeran Utama Pria Terbaik dan Pasangan Terbaik di Indonesian Movie Awards 2013 dari dua film berbeda, yaitu Test Pack dan Habibie & Ainun.(ant)

“Ratusan pelaku animasi dari Indonesia selama ini menghasilkan karya-karya animasi dunia, termasuk Ipin dan Upin produk Malaysia kini terlibat dalam pembuatan Entong dan berapa judul animasi lainnya,” tandas Liliana juga pencipta Theme Song Entong dinyanyikan Bagas dan Difa, kampiun Idola Cilik 2013. * (AgusT)

Bondan & Fade 2 Black Lepas

Art Of Party persembahan Galan Mild kembali singgah di kota Binjai. Sabtu (25/5) giliran Bondan Prakoso & Fade 2 Black akan menghibur masyarakat kota Binjai. Art Of Party dimulai pada 15 Mei lalu di Kisaran, akhirnya tiba di Binjai setelah menghampiri kota P.Siantar, L.Pakam, Tebingtinggi. Di kota-kota tersebut Judika dan Geisha bergantian tampil dengan penampilan terbaik mereka. Bondan Prakoso sudah tidak diragukan lagi kemampuan bermusiknya, sejak dari kecil ia sudah tampil di industri musik Indonesia sebagai penyanyi cilik. Saat ini berkolaborasi dengan grup rap Fade 2 Black mereka sudah banyak mengeluarkan hits yang akrab dan sangat digandrungi anak muda diantara adalah Bunga, Kroncong Protol, Ya Sudahlah, Tetap Semangat, Tak Terkalahkan, dan banyak lagi. Selain penampilan Bondan, Art Of Party Roadshow juga me-

Reza Rahadian Masih Perlu Acting Coach

Animasi Entong Sementara Liliana Tanoesoedibjo, Direktur Utama MNC Pictures, menambahkan ditayangkan animasi Entong di MNCTV merupakan bukti kesungguhan pihaknya mengembangkan animasi di Indonesia. Apalagi, lanjut istri bos MNC grup ini, dalam penggarapannya melibatkan para animator muda berbakat.

Sony Rilis Film Angry Birds 2016 Rindu Penggemarnya Di Binjai Sony telah memenangkan hak distribusi global atas film animasi Angry Birds akan dirilis pada 2016. Film itu diproduksi dan didanai perusahaan game mobile Rovio asal Finlandia yang menyebut bahwa film tersebut dapat menumbuhkan studio animasi dapat menyaingiWalt Disney. Sony Pictures Entertainment bersaing dengan studio besar lain untuk mendapatkan hak distribusi film 3D secara ekslusif ke seluruh dunia setelah mengumumkan kesepakatan dengan Mikael Hed, CEO Rovio Entertainment. Produser John Cohen- Despicable Me dan produser eksekutif David Maisel- Iron Man akan mengerjakan film yang rencananya rilis pada 1 Juli 2016, dalam siaran pers seperti dikutip dari AFP. “Sony membuat kami terkesan dengan sikap, tekad, dan profesionalisme yang baik,” kata Hed.“Mereka meyakinkan kami bahwa mereka telah menemu-

Dubes RI Djauhari Oratmangub bersama personel musik Rusia beraliran rock menamakan diri Indonesia di Rusia

nampilan band SPR dan Kredit, FDJ Wenny dan Rhythm Percussion. “Event Art Of Party Roadshow ini sebagai apresiasi dan bentuk terimakasih kami untuk masyarakat Sumatera Utara khususnya kota Binjai yang su-

Bondan & Fade 2 Black dah memberikan kontribusi positif kepada kami” ujar Budi Hermawan, Regional Marketing Manager Sumatera, PT Gelora Djaja, produsen Galan Mild. Galan Mild Art Of Party Roadshow di Binjai diadakan di Stadion Olahraga Binjai mulai pkl. 19.00.(m19)

Reza Rahadian

Kelly Rowland JuriThe X Factor Kelly Rowland dan Paulina Rubio akan bergabung sebagai juri dalam The X Factor USA bersama Simon Cowell dan Demi Lovato. Kedatangan mereka menggantikan posisi yang ditinggalkan Britney Spears dan LA Reid, demikian seperti dikutip laman Digital Spy. Dalam keterangan pers, Cowell mengatakan, “Memang butuh lebih dari satu dekade, tapi saya akhirnya senang untuk berada dalam satu panel bersama tiga wanita. Paulina dan Kelly sama-sama punya selera yang bagus dan pengalaman segudang di industri musik, bersama dengan Demi, ini akan jadi pa-

Kelly Rowland nel juri yang menyenangkan.” Rowland mengatakan dirinya senang bergabung lagi dengan keluarga The X Factor. Anggota Destiny’s Child itu sebelumnya pernah menjadi juri The X Factor Inggris pada 2011. Rubio pernah menjadi pelatih di The Voice Meksiko menambahkan, “Saya cinta The X Factor! Saya tidak sabar menemukan bintang selanjutnya di Amerika. Saya sangat senang bisa menjadi bagian dari acara ini sebagai juri.” Nama-nama lain sempat dihubunghubungkan akan menggantikan posisi juri adalah Hilary Duff, Katy Perry, Cheryl Cole dan Jennifer Love Hewitt.(ant)



WASPADA Sabtu 25 Mei 2013

Rizal Ramli: Jika NU Dan Muhammadiyah Bersatu Akan Mengalahkan Koalisi Parpol

DPR-DPD Desak Presiden Tutup PT. Freeport

Wahid tersebut mengatakan, sinergi NU dan Muhammadiyah akan menghasilkan gabungan suara sekitar 70 persen. Ini dahsyat sekali. Bila terjadi, tidak ada satu kekuatan pun yang mampu mengalahkan, walaupun Parpol-parpol bergabung membentuk koalisi. “Saya sering bermimpi, NU dan Muhammadiyah punya visi yang sama dan mewujudkannya dalam sinergi. Mudahmudahan apa yang dilakukan generasi muda NU dan Muhammadiyah Cilacap bisa mengilhami sekaligus mendorong hal serupa di daerah-daerah lain, sehingga bisa menjadi semacam sinergi nasional,” papar Capres alternatif versi The President Centre ini. (j07)

Salim: PKS Tidak Akan Keluar Koalisi

JAKARTA (Waspada): Menyadari kerusakan lingkungan, kemiskinan, dan berbagai kerugian negara secara sosial, ekonomi, dan budaya khususnya bagi masyarakat Timika Papua, ditambah dengan kecerobohan sehingga terowongan PT. Freeport ambruk dan menewaskan 28 orang, karena itu penanganan Freeport ini butuh ketegasan dari Presiden SBY dan berani untuk evaluasi dan bahkan menghentikan sementara Freeport. “Kalau presidennya tak tegas dan juga tak berani, maka sulit mengatasi Freeport. Padahal, selama ini tak memberi konstribusi pada rakyat Papua maupun Indonesia sendiri. Apalagi menolak kedatangan menteri, maka Freeport harus dilawan karena telah melecehkan negara,” ungkap Wakil Ketua DPRD Papua Jimmy Demianus Ijie di Gedung DPD RI Jakarta, Jumat (24/5). Pernyataan itu disampaikannya dalam diskusi di DPD RI Wakil Ketua Komisi IV DPR RI FPG Firman Subagyo, anggota DPD RI dari Papua Paulus Yohanes Sumino. Persoalannya sambung Paulus, kontrak karya Freeport itu antara pemerintah pusat dengan PT. Freeport secara langsung, sehingga sulit bagi DPR, DPD, DPR Papua dan lain-lain untuk menuntut penutupan Freeport. “Regulasi kontrak karyanya ditandatangani langsung oleh pemerintah pusat dan Freeport. Kalau mau merubahnya, maka UU Pertambangannya yang harus direvisi. DPR Papua, Pemda Papua, dan PT. Freeport sudah membuat nego baru, tapi tak bisa ditindaklanjuti, akibat kontrak karyanya langsung pusat dan freeport,” katanya mengingatkan. Selain itu menurut Paulus, pemerintah dan Freeport harus melakukan pendekatan kultural alamiah dan spiritual dengan rakyat Papua, karena rakyat mengetahui gejala alam. “Rakyat Papua bisa membaca tanda-tanda alam. Sedangkan teknologi canggih Freeport ternyata tak mampu membaca gejala alam itu,” tukasnya. Kesimpulan diskusi masalah Freeport itu, anggota DPR RI dan DPD RI mendesak Presiden Susilo Bambang Yudhoyono (SBY) menutup sementara PT. Freeport tersebut, sampai secara manejemen perusahaan multi nasional normal kembali dan sejalan dengan ketentuan UU yang berlaku. “Saya curiga dengan PT. Freeport, karena selama ini tidak terbuka ke publik. Selain menolak kedatangan Menteri ESDM dan Menakertrans, yang berkunjung ke sana, saya bersama rombongan wartawan pun pernah ditolak oleh Freeport. Karena itu pemerintah dan DPR harus mengevaluasi kinerja Freeport tersebut, apakah memang benar-benar untuk kepentingan Indonesia atau asing?” tanya Firman Subagio. Menyinggung adanya izin pertambangan baru seluas 2.000 hektar kata Firman, sejak awal DPR tak pernah memberikan izin pada pemerintah dan Freeport. “Kalau itu ada, berarti di luar tanggung jawab DPR RI. Penolakan DPR itu, karena tak memberi manfaat khususnya bagi 1.00.000 penduduk Timika, dan justru merusak lingkungan. Untuk ini, DPR akan rapat gabungan antara Komisi IV dan KomisiVII DPR RI guna mengavaluasi kinerja Freeport,” ujarnya. (j07)

M ATA R A M ( A n t a r a ) : Anggota Majelis Syuro Partai Keadilan Sejahtera (PKS) Salim Segaf Al Jufri menegaskan partai tersebut tidak akan keluar dari koalisi.

Farhat Jadi Tersangka Kicauannya

JAKARTA (Waspada): Ketua Aliansi Rakyat untuk Perubahan (ARUP) DR Rizal Ramli mengapresiasi sinergi positif yang dijalin kalangan muda Nahdatul Ulama (NU) dan Muhammadiyah di Cilacap, Jawa Tengah. Jika kondisi ini bisa dikembangkan secara lebih luas, maka akan menghasilkan kekuatan yang dahsyat. Ummat Islam bisa menyelesaikan persoalan kepemimpinan di semua tingkatan. “Jika NU dan Muhammadiyah bersatu dalam visi perjuangan demokrasi dan kebangsaan, ini sinergi yang luar biasa. Saya rasa Indonesia bisa segera keluar dari krisis kepemimpinan yang selama belasan tahun ini mendera. Kita akan punya

pemimpin yang berintegritas dan memiliki kompetensi tinggi dalam menyelesaikan berbagai persoalan bangsa,” ujar Rizal Ramli di alun-alun Kabupaten Cilacap, Kamis malam (23/5). Pernyataan ikon perubahan yang dinobatkan sebagai Capres Paling Ideal Versi Lembaga Pemilihan Indonesia (LPI) ini disampaikannya ketika menerima kunjungan sejumlah tokoh Pemuda Muhammadiyah Cilacap dan Pimpinan Gerakan Pemuda Anshor (GP Anshor) Cilacap di sela-sela Tabligh Kebangsaan dalam Rangka Harlah ke-79 GP Anshor, yang digelar Terkait soal kepemimpinan nasional, Menko Perekonomian era Presiden Abdurrahman

MPR Minta Elit Berhenti Mewariskan Konflik JaKARTA (Waspada): Wakil Ketua MPR RI M. Lukman Hakim Saifuddin berharap seluruh elit bangsa, lintas agama, dan etnis berhenti mewariskan konflik, dan tidak membuat konflik baru pada generasi bangsa mendatang. Apakah konflik itu dilatarbelakangi perbedaan ideologi politik, sejarah, agama, dan sebagainya demi Indonesia yang lebih baik ke depan. Karena itu, MPR RI akan terus berjuang menegakkan empat pilar bangsa, yang sudah disosialisasikan selama ini. “Sejak 1908 sampai saat ini pasti masih banyak perbedaan pandangan ideologi, dan sikap politik dam rasanya belum tuntas. Masih ada dendam dan konflik. Tapi, dengan kesadaran yang mendalam, maka perbedaan itu harus dihentikan demi keberagaman, kebhinnekaan,

NKRI, dan kemajuan bangsa ini,” tandas Lukman Hakim di Gedung DPR RI Jakarta, Jumat (24/5/2013), bersama tokoh nasional dalam rangka memperingati 10 Tahun Forum Silaturrahmi Anak Bangsa (FSAB), yang jatuh pada Sabtu (25/5) di Gedung Nusantara V DPR RI. Hadir antara lain Tato Pradja Manggala, Djoko Purwongemboro dan Suryo Susilo. Anggota FSAB terdiri putraputri dan generasi penerus dari tokoh-tokoh politik yang terlibat konflik dalam perjalanan sejarah republik ini, bukan sebatas peristiwa G30S saja, namun sejak 1945, lintas zaman dan lintas aliran, agama, dan ideologi. “FSAB ini menjadi teladan dan apapun konfliknya jangan sampai mengoyak NKRI dan kebhinnekaan,” ujar Lukman.

Karena itu lanjut Lukman, MPR RI ingin membangun rekonsiliasi di tengah berbagai perbedaan, dan itu membutuhkan kesadaran untuk Indonesia yang lebih baik. “Saat ini momentum terbaik di tengah masih banyak konflik di tengah masyarakat. Baik berlatarbela-kang agama, etnis, sosial politik, dan sebagainya. Jadi, FSAB ini menjadi teladan. Di mana tak semua konflik harus diselesaikan secara hukum. Seperti konflik Ahmadiyah, Syiah, HKBP, dan lainlain,” tambah Wakil Ketua Umum DPP PPP itu. Dengan demikian Lukman berharap, forum-forum seperti FSAB ini akan lebih banyak lagi lahir dan menjadi kesadaran bersama bagi elit bangsa ini, agar keberagaman terpelihara di bumi Indonesia. (j07)

Stabilitas Sistem Keuangan Tak Bisa Diganggu JAKARTA (Waspada): Penguatan stabilisasi sistem keuangan tidak bisa diganggu, sebab kondisi ini perlu diwaspadai, khususnya dalam stabilitas sistem keuangan. Karena hal ini terkait dalam memperkuat kebijakan moneter, khususnya terkait kebijakan inflasi, stabilitas nilai tukar rupiah, hingga cadangan devisa. Demikian kata Agus Martowardojo usai dilantik menjadi Gubernur Bank Indonesia (BI) di ruang pers Mahkamah Agung di Jakarta, Jumat (24/5). “Untuk kami akan bekerja sama de-

ngan lembaga terkait, khususnya Otoritas Jasa Keuangan (OJK), Badan Kebijakan Fiskal (BKF), hingga Lembaga Penjamin Simpanan (LPS) untuk memperkuat stabilitas sistem keuangan tersebut.” Untuk memperkuat stabilitas sistem keuangan ini, Agus akan memprioritaskan revisi Undang-Undang Jaring Pengaman Sistem Keuangan (JPSK) dan Undang-Undang BI yang terkait hal ini. “Sehingga saat UndangUndang JPSK dan Undang-Undang BI direvisi serta penga-

wasan perbankan dialihkan ke OJK, stabilitas sistem keuangan itu tidak akan terganggu. Saya pastikan pengalihan pengawasan perbankan ke OJK akan berjalan dengan baik tanpa hambatan sama sekali,” tambah Agus. Dia akan mendorong pengembangan sistem pembayaran nasional yang efisien. Sebab, selama ini, transaksi wholesale hingga ritel masih terpisah-pisah sehingga saat ada integrasi sistem pembayaran itu, semua perbankan bisa melakukannya dengan baik. (j03)


PERTEMUAN PKS: Presiden Partai Keadilan Sejahtera (PKS) Anis Matta (tengah) bergegas mengikuti pertemuan Election Update PKS di Jakarta, Jumat (24/5). Anis Matta menyatakan pertemuan yang diikuti DPP dan DPW PKS se-Indonesia itu tidak dalam rangka membahas soal rencana PKS keluar dari koalisi pemerintahan.

“Tergantung keputusan Majelis Syuro, keputusan beberapa hari lalu tetap dalam koalisi .Kita tidak akan keluar,” kata Salim di Mataram Nusa Tenggara Barat, Jumat (24/5). Salim yang menjabat Menteri Sosial di Kabinet Indonesia Bersatu II itu menambahkan, jika ada omongan PKS akan keluar dari koalisi, maka itu hanyalan keinginan pribadi atau orang tersebut bukan anggota Majelis Syuro. Majelis Syuro adalah majelis tertinggi penentu kepemimpinan dan ideologi PKS. Terdapat 99 anggota Majelis Syuro PKS yang dua di antaranya anggota seumur hidup yaitu Ketua Majelis Syuro Hilmi Aminuddin dan Salim Segaf Al Jufri selaku Ketua Majelis Syuro sebelumnya. Sebelumnya Wakil Sekretaris Jenderal PKS Fahri Ham-

zah menyatakan keinginan agar PKS keluar dari koalisi partai gabungan pendukung pemerintah. Alasan Fahri menginginkan PKS keluar dari koalisi karena ia mengaku tidak mendukung gaya kepemimpinan Presiden Susilo Bambang Yudhoyono. Wacana PKS keluar dari Sekretariat Gabungan (Segab) koalisi bukan kali ini saja dihembuskan, sebelumnya beberapa kali adanya isu partai yang tengah digoncang isu korupsi kuota impor daging sapi dengan tersangka mantan Presiden PKS Luthfi Hasan Ishaak itu akan keluar dari koalisi. Bisa Terpengaruh Anggota Majelis Syuro Partai Keadilan Sejahtera, Tifatul Sembiring, tidak membantah jika masalah yang melanda belakangan ini dapat mempengaruhi peraihan suara partai politik tersebut. “Ini perasaan saya saja, suara pasti ada pengaruh,” katanya, usai membuka Pertemuan Bakohumas Regional I Indonesia Barat, di Medan, Jumat (24/5).

PKS yang pernah dia pimpin dan mengantarkan dia ke kursi Kabinet Indonesia Bersatu II sedang bermasalah hukum, ditimpa dugaan korupsi impor daging yang juga melibatkan kader lain PKS, Menteri Pertanian Suswono, selain presidennya, Luthfie Hasan. Lebih jauh lagi, ada nuansa lain pada kasus itu yang melibatkan orang dekat petinggi PKS, Ahmad Fathanah, yang juga bernuansa perselingkuhan dengan banyak perempuan. Sejauh ini, kata Sembiring, soliditas di tingkat kader PKS masih terkendali terkait masalah yang menimpa mantan Presiden PKS Luthfi Hasan Ishaak dan rekannya Ahmad Fathanah dalam dugaan kasus suap kuota impor daging sapi. Namun sebagai orang yang memahami dinamika politik, dia memiliki pendapat pribadi yakni kemungkinan adanya pengaruh masalah yang terjadi terhadap peraihan suara PKS. “Saya yakin ada pengaruh, tetapi perlu ada penjelasan dan komunikasi lagi kepada publik,” katanya.

JAKARTA (Waspada) : Farhat Abbas ditetapkan sebagai tersangka kasus penghinaan yang menyebut Wakil Gubernur DKI Jakarta Basuki T Purnama atau Ahok dengan kata-kata China dalam kicauannya di media sosial Twitter. “Farhat Abbas sudah ditetapkan sebagai tersangka,” kata Kepala Bidang Humas Polda Metro Jaya Kombes Pol Rikwanto kepada wartawan di Mapolda Metro Jaya, Jumat (24/5). Tweet Farhat soal Ahok itu diunggah dalam akun twitter @farhatabbaslaw, yang isinya ‘Ahok protes, Dasar Ahok plat Aja diributin! Apapun plat nya tetap Cina!’, sebut Farhat dalam Twitternya. Hal itu memancing reaksi Anton Medan melaporkan Farhat, karena ucapan suami Nia Daniati itu tidak dapat diterima, bahkan Ramdan Alamsyah yang mewakili Komunitas Interlektual Masyarakat Betawi (KIMB) ikut melaporkan Farhat ke Polda Metro Jaya. Anton Medan yang mewakili PITI dalam laporannya bernomor LP/82/I/2013/PMJ/Ditreskrimsus tertanggal 10 Januari 2013, menuding Farhat atas tuduhan Pasal 28 ayat (2) UU ITE jo Pasal 4 jo 16 UU No 40 tahun 2008. Selain itu, Anton Medan juga melaporkan Farhat dalam laporan resmi bernopol LP/86/I/2013/PMJ/Ditreskrimsus dengan tuduhan Pasal 28 ayat (2) UU RI No 11 Tahun 2008 tentang ITE. Meski Farhat telah menyatakan permohonan maafnya, namun hal itu tidak digubris Anton Medan yang telah emnjadi mualaf bahkan telah menjadi penceramah dengan memabngun pesantren.(j02)

Pendapatan AirAsia Naik 11% YOY Waspada/Aidi Yursal

KETUA Umum DPP PKB Pujakesuma H. Suratman SP bersama Sekum Ir. Abdul Halim, Bendum Suratno Gurdi, Ketua Dewan Pakar DPP Pujakesuma Prof Hj. Sri Sulistyawati SH, M.Si, PhD foto bersama usai menggelar usai menggelar rapat Selasa.

Pujakesuma Bentuk Forum Punakawan Center MEDAN (Waspada): Dalam upaya menyatukan dan menyalurkan aspirasi politik warga dari etnis Jawa yang berada di berbagai daerah provinsi di pulau Sumatera, terutama untuk wilayah Sumatera Utara, DPP Paguyuban Keluarga Besar (PKB) Putra Jawa Kelahiran Sumatera (Pujakesuma) telah membentuk wadah baru bernama Forum Punakawan Center (FPC), yang dalam waktu dekat akan diresmikan dalam suatu acara yang akan dihadiri semua utusan dari berbagai provinsi dan Kabupaten/ Kota di Sumatera. Berbeda sewaktu pemilihan pasangan calon Gubsu dan Wakil Gubsu tempo hari yang DPP Pujakesemua membentuk GPN Center, namun pada pemilihan anggota legislatif yang dijadwal berlangsung Maret 2014 akan digelar secara serentak di Indonesia, DPP Pujakesuma yang bermarkas di Medan sudah menyepakati wadah baru itu. Nantinya wadah baru itu, kata Presiden DPP Pujakesema H.Suratman, SP dalam keterangannya usai memimpin rapat pengurus Rabu (22/5) di kantor DPP Jl. Gagak Hitam/Ringroad Medan, akan mengakar ke berbagai provinsi di Sumatera sampai pada tingkat kabupaten dan kota sehingga memudahkan warga etnis Jawa berkomunikasi dalam menyalurkan aspirasi politik, atau dalam meminta dukungan melalui wadah FPC apabila ada figur dari etnis Jawa ataupun di etnis lain yang hendak maju menjadi calon bupati atau calon wali kota. H. Suratman SP yang didampingi Sekjen Ir. Abdul Halim, Bendahara Umum Suratno Gurdi, Ketua Dewan Pakar DPP Pujakesuma Prof Hj. Sri Sulistyawati SH, M.Si, PhD, Koordinator Bid Ekonomi Doddy Asmaranjaya ST, Kordinator Bid Infokom H. Robby Anangga SE, lebih lanjut menyebutkan mengenai pembentukan wadah baru yang punya benang merah (underbow) dengan wadah induk Pujakesuma itu dibentuk sesuai kepentingan warga Jawa. Alasan lain dibentuknya FPC itu, kata Suratman, adalah dengan pertimbangan selama

ini banyak calon legislatif ataupun calon wali kota dan bupati mengalami kesulitan dalam mendapatkan dukungan dari wadah etnis yang sama akibat muncul klaim mengklaim tentang dukungan sehingga warga kebingungan mana sebenarnya calon yang didukung Pujakesuma. “Jadi, selain menyerap aspirasi warga Jawa, kita berharap calon yang akan tampil, baik dalam Pilkada, Pileg maupun Pilpres mendatang, kita sudah dapat mengusung calon yang benarbenar terbaik,” ujar Suratman. Hal senada juga juga disampaikan Prof Sri Sulistyawati. Menurutnya Pujakesuma, sesuai aturan AD/ ART, memang tidak boleh berpolitik, tetapi untuk menyahuti aspirasi warga Jawa, makanya perlu dibentuk wadah baru ini. Memang, kata Suratno Gurdi, selama ini, warga Jawa sepertinya kecolongan, dari 35 persen orang Jawa di Sumut, mestinya minimal 10 % warganya duduk di legislatif, birokrasi dan posisi stretegis lainnya di pemerintahan. Tapi, kita sadar, sumber daya warga Jawa belum maksimal memenuhi posisi-posisi penting itu. Jadi, dalam kaitan ini, kata Suratno, Pujakesuma akan membentuk tim 7 yang nantinya akan menggodok forum, yang akan mendukung kesuksesan warga Jawa ini. Jadi, nantinya, warga Jawa yang ingin maju dalam bursa pencalonan politik, tentu dapat menggunakan wadah yang juga akan dikembangkan di daerah. Nantinya, siapapun calon kepala daerah, calon legislatif maupun Pilpres, dapat berkordinasi ke daerah masing-masing, untuk kemudian dikonsultasikan ke DPP, siapa yang bakal mendapat dukungan itu. Prof Hj Sri menambahkan, baru-baru ini DPP Pujakesuma membuat program dalam rangkaian mencerdaskan warga Jawa dengan melakukan MoU dengan Akademi Manajemen Informatika Komputer (AMIK) Polibisnis Medan, dimana Pujakesuma akan memberikan kesempatan bagi 100 warga Jawa mendapatkan beasiswa mengikuti pendidikan di akademi itu.(m22)

JAKARTA (Waspada): Perusahaan AirAsia Berhard mengumumkan keuangan untuk periode Januari – Maret 2013 atau kuartal pertama yang berakhir 31 Maret 2013 (1Q2013) membukukan pendapatan yang signifikan mencapai RM 1.30 miliar atau meningkat 11% dibandingkan kuartal yang sama tahun lalu sebesar RM1.17 miliar. Peningkatan pendapatan ini dipicu oleh tumbuhnya jumlah penumpang sebesar 7% menjadi 517 juta, lalu kenaikan pendapatan tambahan/ancillary income perpenumpang (dari makanan, minuman, bagasi) dan rata-rata tarif tiket, serta bertambahnya kapasitas kursi penumpang seiring dengan dioperasikannya 66 unit pesawat di Malaysia. Tingkat keterisian penumpang (load factor) tetap tinggi yakni 79% di tengah meningkatnya kapasitas kursi penumpang sebesar 9% pada kuartal pertama 2013. Pada kuartal pertama tahun ini, AirAsia mencatat peningkatan laba operasional sebesar 6% year-on-year (y-o-y) menjadi RM 254.93 juta, didukung oleh meningkatnya pendapatan dan stabilnya biaya produksi. CEO AirAsia Berhad Aireen Omar mengatakan, perusahaan mengawali tahun 2013 dengan sangat baik, didorong oleh kinerja keuangan yang luar biasa di tahun sebelumnya. “Pada kuartal pertama 2013, kami mencetak kenaikan pendapatan sebesar 11%, yang dikontribusikan oleh peningkatan jumlah penumpang. Di samping itu, kinerja bisnis ancillary juga sangat bagus dengan pendapatan sebesar RM42 per penumpang atau meningkat sebesar 7% dibandingkan dengan periode yang sama tahun lalu,” kata Aireen Omar dalam keterangan pers yang diterima Waspada di Jakarta, Kamis (23/5). Aireen Omar menyampaikan rasa senangnya melihat upaya penurunan biaya produksi mulai terwujud dengan tingginya produktivitas sumber daya manusia yang mengarah ke pengurangan biaya untuk SDM. “Diukur dari cost per available seat per kilometer (CASK), konsumsi bahan bakar turun cukup banyak yakni 5% menjadi 6.83 sen dibandingkan dengan 7.18 sen pada periode yang sama tahun lalu. Namun, karena harga bahan bakar yang meningkat, rata-rata CASK tetap di 13.62 sen, atau sama secara y-o-y,” ucap Aireen Omar. Pendapatan perusahaan, secara revenue per available seat per kilometer (RASK), sebesar 16.89 sen atau berada di level yang sama dari tahun lalu. Hasil ini diperoleh dari kenaikan rata-rata tarif tiket sebesar 2% pada 1Q13 menjadi RM180 dari RM177 pada tahun lalu yang mengimbangi penurunan load factor sebesar 1%. Peningkatan ini menggambarkan kesuksesan operasional rute kami, kualitas pelayanan, dan nama besar AirAsia sehingga menghasilkan permintaan yang berkelanjutan dari penumpang setiap tahunnya. Pendapatan ancillary per penumpang pada kuartal pertama tumbuh RM42 dari RM40 secara y-o-y didukung oleh pendapatan yang cukup besar dari bagasi dan kargo. Menurut Aireen Omar, posisi kas AirAsia sampai saat ini cukup kuat dengan deposit, bank dan cash balance senilai RM 2.17 miliar, dan terus mengelola level net gearing yang saat ini berada di 1.38 kali per 31 Maret 2013. “Kami juga menerima umpan balik positif dari investor terkait formalisasi kebijakan dividen yakni, membayarkan 20% dari laba bersih operasional tahunan. Hal ini membuktikan bahwa AirAsia memiliki posisi balance sheet yang kuat sehingga mampu memberikan imbal hasil investasi yang optimal kepada para pemegang saham,” tuturnya. Dalam kedisiplinan dalam hal biaya produksi adalah salah satu faktor yang membuat AirAsia berbeda dari kompetitor. “Kemampuan menjaga fokus pada model bisnis low-cost dimana kami menawarkan kursi hemat, mengoptimalisasi penggunaan pesawat, menerapkan kebijakan single fleet, dan mencapai on-time performance, menjadi kunci keberhasilan kami,” terang Aireen Omar. Sedangkan Thai AirAsia (TAA) membukukan pendapatan sebesar THB6.03

miliar pada 1Q13, meningkat 24% dibandingkan dengan periode yang sama tahun sebelumnya. Laba operasional meningkat 48% y-o-y menjadi THB931.85 juta sehingga laba setelah pajak meningkat 19% menjadi THB738.96 juta pada kuartal pertama tahun ini. CEO Thai AirAsia, Tassapon Bijleveld mengatakan, kuartal pertama tahun ini sangat bagus bagi Thai AirAsia. Dimana pendapatan TAA tumbuh 24% sehingga laba setelah pajak meningkat 55% dan RASK meningkat 4%. “Salah satu pemicu tumbuhnya pendapatan adalah jumlah penumpang yang meningkat sebesar 20%, didukung oleh pertumbuhan rute-rute kami dari dan ke China. Selain menambah 4 unit pesawat menjadi 28 dibandingkan dengan 24 di periode yang sama tahun sebelumnya, tingkat keterisian kami juga sangat luar biasa yakni di 87%,” kata Tassapon. Pendapatan ancillary TAA juga mengalami peningkatan dari THB354 menjadi THB357 per penumpang, dengan bagasi sebagai kontributor terbesar terhadap total pendapatan. Indonesia AirAsia Di kuartal pertama tahun 2013, Indonesia AirAsia (IAA) mencatat peningkatan pendapatan sebesar 34% menjadi Rp 1.22 triliun dari Rp 911.35 miliar di tahun sebelumnya. Laba operasional meningkat signifikan sebesar 172% menjadi Rp 41.97 miliar dari Rp 15.45 miliar di periode yang sama tahun lalu. Laba setelah pajak juga meningkat sebesar 104% y-o-y menjadi Rp 1.36 miliar. CEO AirAsia Indonesia Dharmadi mengatakan, strategi kami untuk mengembangkan saluran distribusi dan memperkenalkan brand AirAsia di seluruh Indonesia membuahkan hasil, sebagaimana tercermin pada kinerja perusahaan. “Bisnis ancillary juga terus tumbuh sejalan dengan meningkatnya pendapatan ancillary per penumpang sebesar 5% y-o-y atau dari Rp 138.448 menjadi Rp 145.773, dengan bagasi dan fasilitas pemilihan kursi sebagai kontributor terbesar terhadap total pendapatan ancillary. Saat ini AirAsia Indonesia mengoperasikan 22 unit pesawat,” kata Dharmadi. Sementara itu, Phillipines AirAsia (PAA) beberapa waktu lalu membuka lembaran baru ketika megumumkan aliansi strategis dengan maskapai terbesar ketiga di Filipina, Zest Air. CEO AirAsia Filipina, Maan Hontiveros mengatakan, dengan dimulainya kerjasama ini, AirAsia Filipina kini beroperasi dari Clark dan juga Bandara utama yang terletak di Manila. Dengan demikian, PAA dapat menarik feeder traffic melalui Clark dan memanfaatkan slot maskapai Zest Air dari Manila. “Kini penerbangan Zest Air juga tersedia melalui website AirAsia dan menjadi bagian dari jaringan Grup AirAsia, sehingga mampu meningkatkan akses menuju Asia Utara. Pada akhir Maret, AirAsia Filipina mengoperasikan 2 pesawat dan mencatat tingkat keterisian sebesar 76% di kuartal pertama 2013,” kata Maan Hontiveros. Sedangkan biaya operasional di Jepang mengalami kemahalan membuat AirAsia Japan (AAJ) mengalami tantangan yang lebih besar dibandingkan dengan asosiasi AirAsia lainnya. Saat ini AirAsia tengah berdiskusi serta menyusun strategi dengan rekan bisnis di Jepang agar perusahaan dapat meraih laba atas investasi di masa mendatang. CEO baru AAJ, Yoshinori Odagiri mengatakan, biaya operasional merupakan tantangan tersulit bagi kami di AAJ. “Saya percaya biaya operasional dapat berkurang seiring dengan membesarnya skala bisnis. Guna meningkatkan pendapatan, beberapa waktu lalu AAJ menjadikan Nagoya sebagai hub kedua serta meluncurkan rute baru di kuartal ini, yakni Nagoya – Fukuoka,” kata Yoshinori Odagiri. AAJ mengoperasikan 4 pesawat di akhir Maret dan mencatat tingkat keterisian sebesar 70% pada kuartal pertama 2013. (j02)

Luar Negeri

WASPADA Sabtu 25 Mei 2013


Jembatan Di Washington Ambruk, Banyak Mobil Dan Orang Tercebur LOS ANGELES, AS (Antara/AFP): Jembatan di atas sungai untuk jalan bebas hambatan di belahan baratlaut Washington sebagian ambruk, sehingga banyak mobil dan orang tercebur, kata polisi. Foto menunjukkan potongan luas jembatan penghubung lima jalan raya di atas sungai Skagit di utara Seattle itu runtuh ke air pada saatlalulintaspadatdankerumunanmanusiaterlihatdidaratanterdekat. “Banyakorangdanmobilyangberadadidalamair,”kataMarkFrancis, juru bicara paroli jalan raya Washington dalam kicauan di Twitter. Polisi belum mengangkat telepon untuk diminta keterangan atas kejadian tersebut termasuk potensi korbannya. Sedikitnya ada dua mobil yang terendam di air dan tiga orang berhasil diselamatkan dari kendaraannya,kataMarcusDeyerin,jurubicaraTimPengeloaKecelakaan di Washington Barat Laut kepada media Seattle Times. Para penyelamat mengatakan mereka telah menarik semua orang yang terlihat di air, tetapi tidak bisa memastikan dan menambahkan penyebab jembatan runtuh pada pukul tujuh malam waktu setempat itu juga belum diketahui.

Konferensi Kebijakan Keamanan ARF Ke-10 Di Brunei BANDAR SERI BEGAWAN, Brunei (Antara/Xinhua-OANA): Brunei Darussalam Kamis (23/5) menjadi tuan rumah Konferensi Kebijakan Keamanan (ASPC) Forum Regional ASEAN (ARF). Tujuan utama ASPC adalah untuk lebih memperkuat kerja sama langkah-langkah dalam membangun kepercayaan di bidang militer dalam kerangka ARF dan partisipasi pejabat pertahanan ARF, untuk membuka saluran baru dialog dan pertukaran antara para pejabat pertahanan, diplomat serta akademisi militer. Ini untuk lebih meningkatkan rasa saling percaya dan pengertian di antara para pejabat pertahanan, dan untuk lebih meningkatkan dan memperkuat proses ARF serta terus mendorong ke depan. Konferensi tersebut dipimpin oleh Kol. (Purn) Pengiran Dato Paduka Haji Azmansham bin Pengiran Haji Mohamad, Sekretaris Tetap (Pertahanan Kebijakan dan Pengembangan), Departemen Pertahanan, Brunei Darussalam.

Pemerintah Syria Ikut Dalam Konferensi Damai MOSKOW, Rusia (AP): Pemerintah Syria telah menyetujui untuk ikut ambil bagian dalam satu konferensi mengenai nasib masa depan negeri itu yang diusulkan Rusia dan Amerika Serikat, demikian menurut Kementerian Luar Negeri Rusia Jumat (24/5). Jurubicara Kemlu Alexander Lukashevich mengatakan dalam satu pernyataan melalui televisi bahwa pemerintah Syria pada ‘prinsip-nya telah menyetujui’ untuk ikut ambil bagian dalam konferensiyangakandiselenggarakandiJenewa,Swiss,yangmenurut rencana dilangsungkan dalam tempo dua minggu. Namun Lukashevich mengatakan bahwa tidak mungkin untuk menetapkan tanggalnyasekarangkarena‘belumadaklarifikasitentangsiapayangberbicara atas nama oposisi dan kekuasaan apa yang mereka miliki.’ Kelompok-kelompokoposisitelahmengatakanmenentangperwakilan Presiden Bashar Assad ambil bagian dalam konferensi tersebut. “Kami menyatakan puas bahwa kami menerima persetujuan dari Damaskus untuk menghadiri konferensi internasional itu, untuk kepentingan rakyat Suriah mencari jalan politik untuk menyelesaikan konflik tersebut, yang menghancurkan negara dan kawasan itu,” kata jurubicara Kemlu Lukashevich kepada wartawan. Beberapa media Eropa melaporkan pertemuan itu menurut rencana akan diselenggarakan 10 Juni. Pertemuan Jenewa pertama Juni tahun lalu berakhir dalam satu prsetujuan luas yang bertujuan pada pembentukan satu pemerintah transisidiSyriadanmemberlakukangencatansenjatayangberlangsung lama.Tetapikesepakatanitutidakpernahdilaksanakankarenaadanya keidaksepakatan menyangkut peran Bashar dalam pemerintah baru itu dan keputusan meletakkan senjata mereka. (m10)

Serangan Bom Bunuhdiri Di Niger, 20 Orang Tewas NIAMEY, Nigeria (Antara/AFP): Militan melancarkan dua serangan bom mobil bunuhdiri terhadap pangkalan militer dan tambang uranium yang dikelola Prancis di Niger, yang menewaskan sedikitnya 20 orang dan menyandera sejumlah perwira peserta pelatihan di negara Afrika barat yang miskin itu. Sebuah kelompok garis keras mengklaim serangan-serangan itu sebagai pembalasan atas keterlibatan Niger dalam ofensif Prancis terhadap militan di Mali. Gerakan Keesaan dan Jihad di Afrika Barat (MUJAO), salah satu kelompok muslim garis keras yang menguasai Mali utara tahun lalu sebelum diusir oleh pasukan pimpinan Prancis, menyatakan bertanggung jawab atas serangan bom yang hampir serentak terhadap pangkalan militer Agadez dan tambang uranium dengan saham mayoritas Prancis di Arlit. Menurut jurubicara MUJAO Abu Walid Sahraoui, kelompok itu menyerang Niger karena kerja samanya dengan Prancis dalam perang melawan militan. Sementara itu, Presiden Prancis Francois Hollande berjanji membantu Niger “menghancurkan” militan dan mengatakan, Prancis akan mendukung “segala upaya Niger untuk menghentikan penyanderaan” di pangkalan militer itu. “Kami tidak akan campur tangan di Niger seperti di Mali, namun kami memiliki kemauan yang sama untuk bekerja sama menumpas terorisme,” katanya. Bom mobil pertama meledak pada saat fajar dipangkalanmiliterdiAgadez,kotaterbesardiNigerutarayangsebagian besar gurun.

Tokyo Bantah PM Enggan Pindah Ke Rumah Dinas Karena Hantu TOKYO, Jepang (Antara/AFP): Pemerintah Jepang Jumat (24/ 5) menepis kabar, yang beredar dalam beberapa bulan belakangan, bahwa PM Jepang Shinzo Abe enggan pindah ke rumah dinasnya karena takut rumah itu berhantu. Pemimpin konservatif itu menduduki jabatan perdana menteri sejakDesembernamunbelumpindahkerumahbatadengan11kamar diwilayahutaraTokyoitu,waktubertahanpalinglamajikadibandingka dengan para pendahulunya, kata laporan media setempat. Beberapa PM sebelumnya dilaporkan mengalami penampakan tak biasa di rumah mewah yang menjadi saksi dua upaya kudeta berdarah yang gagal pada tahun 1930-an. Mantan PM Junichiro Koizumi pernah mengatakan kepada wartawan, “Saya tidak pernah bertemu hantu, meskipun saya ingin melihatnya.” Beberapa ibu negara juga menolak tinggal di rumah tersebut karena takut ada arwah gentayangan. “Ada rumor bahwa rumah dinas itu berhantu. Benarkah? Apakah PM Abe menolak pindah ke rumah dinas karena rumor itu?” anggota parlemen dari partai oposisi menanyakan hal tersebut ke kabinet Abe.

The Associated Press

DALAM foto yang disiarkan oleh Francisco Rodriguez menunjukkan regu pertolongan membentuk rantai manusia ketika mereka mulai mengangkat seorang wanita yang mengulurkan tangannya dari satu truk pickup yang ringsek setelah jatuh ke Sungai Skagit setelah ambruknya jembatan di Interstate 5 Kamis (23/5) di Mount Vernon, Washington.

Inggris Hadapi Bentrokan Dan Serangan Teror LONDON, Inggris (AP): Inggris menghadapi serangkaian bentrok dengan ekstremis sayap kanan dan kemungkinan serangan teror berikutnya setelah pembunuhan brutal atas seorang prajurit mudanya. Kepolisian MetropolitanLondonmengatakanJumat(24/5)lebih dari1.000petugasakandikirimkan ketempat-tempatberpotensirusuh dengankesatuan-kesatuantanggap bersenjata. Hanya sebagian kecil dari petugas polisi Inggris yang dipersenjatai. Serangan berdarah Rabu ditangkap video yang direkam oleh orang yang lewat dan dibuatnya untukmemperlihatkankengerian — di mana seorang terlihat dengan tangannya bernoda merah dan memegang dua pisau tukang dagingsaatdiamarahdanmengeluhkan pemerintah Inggris dan pasukanditanahasing.Sementara tubuh tak bernyawa terlihat terkapar di jalan di belakang-nya. Pengamat teror mengatakan para penyerang menginginkan publisitas untuk menginspirasi serangan peniru dan bahwa me-

reka telah melihat peningkatan obrolan di situs ekstremis menyerukan serangan tersebut. Sementara ituWalikota London Boris Johnson tidak mau menyalahkan Islam atas peristiwa pembunuhan tentara di Woolwich. Pembunuhan itu memang meningkatkan sentimen antiIslam di Inggris. “Menyalahkan Islam atas pembunuhantersebutadalahhal yang sangat salah,” ujar Johnson, seperti dikutip Metro, Kamis. “Yang salah adalah pola pikir dari sang pelaku. Demi keluarga korban, kita harus membawa para pelaku ke hadapan pengadilan,” lanjutnya. Seorang tentara tewas setelah dibunuh secara keji oleh dua orang pria di Woolwich. Pelaku mengaku membunuh tentara itu untuk membalas invasi di Irak

dan Afghanistan. Serang masjid Beberapa masjid di Inggris diserang sesaat setelah kabar pembunuhan di Woolwich menyebar. Pihak masjid menduga, serangan tersebut adalah bentuk balas dendam terhadap peristiwa di Woolwich. Pembunuhan itu juga memicu kemarahan kelompok sayap kanan di Inggris. Mereka bentrok dengan petugas setelah berbuat onar di jalanan Woolwich. Sementaraitu,politisiMuslim Inggris Barones Sayeeda Warsi menghimbau televisi agar tidak memberikanjamtayangyangcukup lama untuk ulama garis keras Anjem Choudary.Warsi pun menyebut Choudary bodoh karena komentarnyayangpenuhkebencian. Tepat setelah peristiwa berdarah itu terjadi, BBC menyiarkan program wawancara khusus denganChoudary,selakupriayang mengenal pelaku pembunuhan, MichaelAdebolajo.Disiarkanpula rekaman demonstrasi yang diha-

diri Adebolajo dan Choudary pada 2007. Namun keputusan itu ditentang oleh Warsi. “Kita semua bertanggung jawab(atasperistiwaitu)termasuk juga media. Sebaiknya, jangan memberikanjamtayangyangcukup lama terhadap para ekstrimis bodoh dan gila itu. Mereka hanya berbicara untuk kepentingannya sendiri,” ujarWarsi, seperti dikutip Daily Mail, Jumat. “Yang paling menggembirakan di tengah masalah ini adalah, komunitas Muslim Inggris semakinbersatu,danmengecamperistiwa pembunuhan itu. Mereka juga mendukung penuh angkatan bersenjata kita,” imbuhnya. Warsi pun berpendapat, dukungan warga Muslim Inggris menunjukan bahwa ada kedewasaan di kalangan warga dalam menyikapi peristiwa itu. Meski demikian, Warsi tetap marah besar dengan media karena mereka memberikan jam tayang lebih pada ulama garis keras pemimpinorganisasiAlMuhajiroun itu. (bbc/vn/m10)

5 Tentara Thai Tewas Digasak Bom Jalanan Di Thailand Selatan HATYAI,Thailand (AP): Lima tentara Thai tewas dan seorang cedera ketika satu bom jalanan meledak di kawasan bergolak Thailand Selatan. Kol. Polisi Jeera Setdao-ngerntrakul mengatakan Jumat (24/ 5) bahwa pemberontak Muslim dicurigai meledakkan bom di kabupaten Saiburi di provinsi Pattani pada saat truk yang membawa keenam tentara itu melintas. Diamengatakanparaprtajurit tersebutberadadalamperjalanan untukmembantupasukankeamanan memberikan pengamanan bagi warga Buddha yang melakukanperjalanankeviharaviharalokal pada hari libur keagamaan. Serangan pada pertengahan pagiitumengingatkanbahwapemberontak di pedalaman selatan

Raja Muda Perlis Syed Faizuddin Putra Jamalullail:

belumbisamengekangkekerasan terhadappasukankeamananThailand,atauwarga,meskipunperundingan perdamaian sedang berlangsung di negara tetangga, Malaysia. Polisi mengatakan personel paramiliter itu sedang bepergian dengantrukpick-upuntukmenemui tokoh masyarakat Muslim di Kabupaten Saiburi Pattani, salah satu dari provinsi Thailand paling selatanyangdilandapemberontakan panjang hampir satu dekade yang telah mengklaim lebih dari 5.500nyawa. “Empatpenjagatewas danduaterluka,diantaranyaadalah komandanyangterlukaparah,”kata Sersan Montri Prommee dari kepolisianSaiburidanmenambahkan bahwaperangkatpeledakituditimbun di jalan. “Mereka(parapemberontak)

ingin membuat kerusuhan pada haripentingini,”tambahnya,mengacu pada waktu serangan itu terjadidisalahsatutempatliburan yang paling penting bagi umat BuddhadalamkalenderThailand. Para pengamat mengatakan pemberontakmenggunakanbom buatan yang makin canggih dan teknik peledakan menyebabkan lebih banyak korban. Kamis paramiliterlaintewasbersamaseorang tersangkamilitandalambakutembaklarutmalamdiNarathiwat,yang berbatasan dengan Malaysia, sementara Buddis pedagang kelontong ditembakmatidisiangbolong hari sebelumnya. Pertumpahan darah pekan inimengikutipembicaraandamai resmipertamaantarapemerintah Thailand dan perwakilan kelompok pemberontak Barisan Revo-

lusi Nasional (BRN) di Malaysia pada Maret dan putaran lain pada April. Sejak itu, serangan mematikan hampir terjadi setiap hari sehingga memperbaruipertanyaan mengenai apakah Thailand sedang berbicara dengan para pemimpinpemberontakyangdapat mengendalikan kekerasan. Pemeluk Buddha dan Muslim menjadi korban gerilyawan bayangan yang menargetkan pasukan keamanan, warga sipil dan perwakilan yang dirasakan sebagaikekuasaannegarasepertiguru. Pada Aprilpemberontakyang terlibat dalam pembicaraan mengatakanmerekaingin‘pembebasan’dariThailand,suatuyangditolak PanglimaMiliterThaiJend.Prayut Rabuselamaperjalanankeprovinsi selatan Yala. (m10)

dan media massa dalam pembangunan dan memodernkan satu negara,”katanya ketika menutup Seminar Kewartawanan Keamanan IMT-GT di kampus Universiti Teknologi Mara (UiTM) Arau Jumat itu. Putra Mahkota Perlis itu mengatakan laporan berita yang pantasmerupakantantanganbagi pengusaha media untuk mengukuhkanetikakewartawanan,terutama dalam keadaan kondisi politik terkini dan asas hubungan antarabangsa yang boleh dieksploitasi ke arah tidak sihat dan membimbangkan. Raja Muda menyebutkan penulisanmampumengubahpemikiran masyarakat malah kekuatanpadaketajamanpenulisan bolehmenjatuhkan,membangunkanataumemporak-porandakan satu negara. “Akhir-akhir ini, kuasa pena sudah bertukar menjadi gabungan kuasa jari jemari dan jalur lebar yang luar biasa pantasnya dan nilai berita turut diukur daripada kepantasannya,”sabda baginda. Dia bertitah, kalau dahulu berita dianggap masih baru jika dia dilaporkan dalam tempo 24 jam, namun pada masa ini, jika berita dilaporan dalam tempoh dua atau tiga jam selepas peristiwa, dia sudah agak ketinggalan. “Walaupun kepantasan

menjaditolokukurpentingnamun anjuransaya,diaperlulahdidasari oleh nilai kebenaran dan realisasi menyeluruh atau ketepatannya,” kata Tuanku Syed Faizuddin. Dia mencadangkan inisiatif

Bom Meledak Di Luar Pusat Perbelanjaan Filipina Selatan DAVAO, Filipina (Antara/Xinhua-OANA): Bom rakitan Kamis (23/5) sore meledak di luar pusat perbelanjaan di kota Pagadian, Filipina Selatan. Tidak ada korban jiwa, tapi kejadian itu merusak sejumlah kendaraan, kata radio setempat. Peledak itu ditanam di kendaraan di lapangan parkir mal Gaisano, kata polisi setempat. Penegak hukum sedang menyelidiki motif dan bahan peledak dalam pemboman itu.

Kunjungan PM Jepang Ke Myanmar Tingkatkan Hubungan Bilateral YANGON, Myanmar (Antara/Xinhua-OANA):PM Jepang ShinzoAbetibadiYangonJumat(24/5)untukkunjungankenegaraan tiga hari di Myanmar. Dia akan menjadi PM Jepang pertama yang mengunjungi Myanmar dalam 36 tahun sejak tahun 1977 ketika mantan PM Takeo Fukuda datang ke negara itu. Abe, disertai oleh para pemimpin bisnis lebih dari 30 perusahaan Jepang, yang dijadwalkan mengadakan pembicaraan dengan Presiden U Thein Sein mengenai peningkatan iklim investasi di Myanmar untuk perluasan investasi Jepang. Hubungan baru antara Myanmar dan Jepang telah dibuka setelah Presiden U Thein Sein melakukan kunjungan bersejarah ke Jepang April 2012, yang pertama dalam 28 tahun. Selama kunjungan itu, U Thein Sein menghadiri KTT Jepang-Mekong Keempat di Tokyo. Kunjungan Sein mendapat sorotan dengan penghapusan hutang sebesar 300 miliar yen (sekitar AS$3,68 miliar) dan biaya tunggakan Myanmar dari dua dekade terakhir untuk membantu langkah negara itu menuju demokrasi.

Para Pekerja Mogok Tuntut Kenaikan Upah Di Yangon YANGON, Myanmar (Antara/Xinhua-OANA): Para pekerja dari 41 pabrik di Zona-3 Industri Hlaing Tharyar Yangon telah menggelar pemogokan buruh, mereka menuntut kenaikan upah, kata satu harian melaporkan Kamis (23/5). Para pekerja yang mogok menuntut peningkatan upah pokok bulanan menjadi 20.000 kyat (21,28 dolar AS), kata harian Yangon Times. Namun, lima dari 41 pabrik telah menghentikan aksi mogok setelah tuntutan merekadipenuhiolehpengusaha.Pemogokanpekerja,yangdimulai dengan lebih dari 1.000 pekerja dari 10 pabrik Senin, terus meningkat pada Rabu. Saat ini, ada total 10 zona di Hlaing Tharyar Industrial Zone, enam zona di antaranya memiliki sekitar 700 pabrik. Menurut angka resmi, ada 40 organisasi buruh secara hukum dibentuk, yang terdiri satu federasi buruh, 10 organisasi pengusaha utama dan 29 organisasi buruh utama.

Tornado Oklahoma Rusak Lebih Dari 12.000 Rumah HOUSTON, Texas (Antara News): Tornado maut yang memporak-porandakan pinggiran selatan Kota Oklahoma, ibukota Negara Bagian Oklahoma di AS, telah merusak lebih 12.000 rumah, kata beberapa pejabat. Perkiraan jumlah rumah yang rusak atau hancur akibat terjangan tornadoSenintersebut,sebagian,didasarkanatasanalisisgambarudara sebelum-dan-setelah tornado menerpa, kata beberapa pejabat di Kota Oklahoma sebagaimana diberitakan ABC News Kamis (24/5). Kepolisian kota itu dan kantor wali kota telah memperkirakan jumlah rumah yang jadi korban di Oklahoma dan pinggiran selatannya, Moore, ialah 12.000, demikian laporan tersebut. Kepala Staf Wali Kota Steve Hill mengatakan pada Kamis para pejabat memperkirakan 12.600 rumah berada di atau cukup dekat dengan jalur angin puting beliung itu untuk terpengaruh, kata Xinhua. Sementara itu, para pejabat mengatakan sebanyak 33.000 orang diperkirakan telah jadi korban.Michelann Ooten, Wakil Direktur Departemen Penanganan Keadaan Darurat di Oklahoma, Kamis, mengatakan kantornya sedang berusaha mengumpulkan perkiraan tentang jumlah rumah yang rusak atau hancur. Tornado mengakibatkan kerugian sebanyak dua miliar dolar AS, kata beberapa pejabat.Sebanyak 24 orang tewas dan lebih dari 200 orang lagi cedera ketika tornado sangat besar menerjang Moore di bagian selatan daerah Metropolitan Kota Oklahoma pada Senin sore, sehingga memporak-porandakan banyak rumah dan gedung.

Jurnalistik Tuntut Sifat Amanah

Waspada/Muhammad Joni RAJA MUDA Perlis Syed Faizuddin Putra Jamalullail (tengah) menyalami Tikwan Siregar (kanan) di pengujung seminar sehari Kewartawanan Keamanan IMT-GT 2013 Perlis Jumat (17/5) lalu. Di ujung kiri adalah Agus Salim, yang mendampingi Siregar dalam seminar tersebut yang diseleng-garakan sehubungan dengan Hari Keputraan Ke-70 Raja Perlis Syed Sirajuddin ibni almarhum Tuanku Syed Putra Jamalullail. SEMINAR Kewartawanan Keamanan IMT-GT (Segitiga Pertumbuhan - Indonesia, Malaysia dan Thailand) yang diselenggarakan di Kangar,Perlis,Jumat (17/ 5) lalu berlangsung sengit ketika para hadirin mempertanyakan berbagai sepak-terjang para kuli tinta Indonesia dalam melaksanakan tugasnya. Pertanyaan itu terutama mengenai berbagai berita ‘masalah yang memanaskan suhu Indonesia dan Malaysia.’ Tetapi kepiawaian Ketua Panel Rektor Universiti Teknologi Mara Prof.Datuk

Dr Ahmad Redzuan Abdul Rahman semua pertanyaan dapat disederhanakan, ditambah dengan kelihaianwakildarimediaMedan, Tikwan Siregar, sehingga semua jawaban yang dikemukakan membuatseminartersebutmakin menambahpemahamantentang pentingnya pemupukan hubungan ketiga negara bagi para mahasiswa, wartawan atau siapa saja yang hadir saat itu. Ketua Panel mempertanyakan,apakahIMT-GTmasihdiperlukan mengingat saat ini kerjasamaituhampirtidakterdengarlagi

gaungnya, padahal pembentukannyabeberapatahunlalupenuh dengan semangat untuk dapat mengatasi berbagai tantangan yangmenghadangIndonesia,Malaysia dan Thailand. Dia mengingatkan betapa pentingnya untuk menggiatkan kembali IMT-GT karena,katanya, padamulanya,segitigapertumbuhan Indonesia, Malaysia dan Thailandmerupakansatujaringan kerjasama yang melibatkan beberapa kawasan yang berada dekat dengankawasanSumut,Perlisdan daerahselatanThailand.Jaringan itulamakelamaanmeluasdengan bergabungnya sejumlah provinsi di Sumatera, kawasan Malaysia danThailand.Karenaluasnyajaringanitu,jaringankerjanyamakin melemah dan Ketua Kelab Media Perlis (KEMPs) Adenan mengatakan sudah tiba saatnya untuk mengembalikan fungsi jaringan itugunalebihmengeratkanhubungan ketiga negara. Shahidi Shahidan, timbalan (wakil) Ketua KEMPs, mengingatkankembalimengenaipembentukan IMT-GT tahun 1993 yang merupakaninisiatifparapemerintah Indonesia,Malaysia,danThailand gunamengekselerasitransformasi ekonomidibeberapaprovinsiyang kurangberkembang.Sektorswasta telah memainkan dan akan melanjutkan peran penting dalam meningkatkan kerjasaama

ekonomi di IMT-GT. Sejak pembentukan itu,IMTGT telah berkembang dalam lingkup geografis dan kegiatan untukmencakuplebihdari70juta orang. Akhirnya IMT-GT terdiri dari 14 provinsi di Thailand Selatan,8negarabagianSemenanjung Malaysia dan 10 provinsi Sumatera di Indonesia. Paneldiseminarituterdiridari wakil dari Malaysia, Adenan, ShahidiShahidan,dari Indonesia, Tikwan Siregar dan Agus Salim dan dari Thailand A. Rahim Abd. Rahman. Ditutup Raja Muda Perlis RajaMudaPerlisSyedFaizuddin Putra Jamalullail ketika menutup seminar itu, menyatakan rasa sukacitanya atas inisiatif bersama ketiga kelompok jurnalis Indonesia,MalaysiadanThailand yang menyelenggarakan seminar tersebut sehubungandenganHari Keputraan ke-70 Raja Perlis Syed Sirajuddin ibni almarhum Tuanku Syed Putra Jamalullail. Raja Muda bertitah, masyarakat perlu menguasai teknologi terkini yang memudahkan lagi penerimaan informasi dan berita yang melintasi faktor geografi, ruang waktu, bahasa, budaya maupun agama. “Kewartawanan menuntut sifat amanah, berdisiplin dan beradab.Sayapastitiadasiapaboleh menafikan peranan wartawan

latihan dan pertemuan sama ada di peringkat domestik dan antarabangsa perlu dilaksanakan lebihkerapsamaadabagitempoh jangka pendek dan jangka panjang untuk memperkasakan du-

nia kewartawanan. Ikut hadir pada seminar itu Direktur Tourism Malaysia di Medan Nor Asikin Haron. (Muhammad Joni)

Waspada/Muhammad Joni

RAJA PERLIS Syed Sirajuddin Putra Jamalullail (depan,kiri) dan Raja Perempuan Perlis Tuanku Tengku Fauziah Tengku Abdul Rashid (depan, kanan) diiringi Raja Muda Perlis Syed Faizuddin Putra Jamalullail (belakang, kiri) dan Raja Perempuan Muda Perlis Tuanku Lailatul Shahreen Akashah Khalil (belakang, kanan) berjalan menuju Balairung Istana Arau untuk memberikan penghargaan kepada sejumlah pejabat dan kaki tangan pemerintah dan kerajaan Perlis Jumat (17/5) pagi lalu.



WASPADA Sabtu 25 Mei 2013

Optimis Minus Gotze LONDON (Waspada): Borussia Dortmund tetap optimis mampu mengatasi Bayern Munich pada final Liga Champions 2012-2013 di Stadion Wembley, meski minus partisipasi playmaker Mario Gotze (inzet). “Sangat menyedihkan bahwa Mario tidak dapat tampil. Saya turut sedih untuknya, terutama dia juga melewatkan final DFB Pokal musim lalu,” jelas winger Kevin Grosskreutz melalui Bild, Jumat (24/5). “Tetapi kita seharusnya jangan lupa bahwa kami juga menang pada pertandingan itu meski tanpa dia,” kenang Grosskreutz, yang akan menggantikan peran Gotze dalam duel yang turut ditayangkan langsung SCTV dinihari nanti mulai pkl 01:45 WIB. Tanpa Gotze yang akhir musim nanti mandah ke Munich, Si Kuning Hitam memang mengalahkan Die Roten 5-2 pada final Piala Jerman 2012. Gotze masih bergulat dengan cedera otot yang dideritanya saat melawan Real Madrid pada leg kedua semifinal lalu, sehingga absen lagi lawan Bayern di London. Kenyataan ini membuat posisi Die Borussens makin underdog bagi Die Bavarians. “Kita sekali lagi menjadi underdog, tetapi secara jujur saya tidak berpikir seperti itu. Saya tahu dengan baik kemampuan kami. Kami sangat layak memenangkan trofi itu,” klaim Grosskreutz. “Saya ada di sana saat Dortmund juara pada 1997 dan itu merupakan pengalaman tak terlupakan,” tambah pemain berusia 24 tahun, yang sudah tiga kali memperkuat Timnas Jerman tersebut. Absennya Gotze malah

Juara 20 Tahun Terakhir 2011-12 Chelsea (Inggris) 2010-11 Barcelona (Spanyol) 2009-10 Inter Milan (Italia) 2008-09 Barcelona (Spanyol) 2007-08 Man United (Inggris) 2006-07 AC Milan (Italia) 2005-06 Barcelona (Spanyol) 2004-05 Liverpool (Inggris) 2003-04 Porto (Portugal) 2002-03 AC Milan (Italia) 2001-02 Real Madrid (Spanyol) 2000-01 Bayern Munich (Jerman) 1999-00 Real Madrid (Spanyol) 1998-99 Man United (Inggris) 1997-98 Real Madrid (Spanyol) 1996-97 B Dortmund (Jerman) 1995-96 Juventus (Italia) 1994-95 Ajax (Belanda) 1993-94 AC Milan (Italia) 1992-93 Marseille (Prancis)

Weidenfeller Klaim Beda KEVIN Grosskreutz menjadi bintang kemenangan Dortmund atas Bayern Munich pada final Piala Jerman 2012. menjadi berkah tersendiri buat Grosskreutz, yang direkrut Dortmund dari Rot Weiss Ahlen pada awal musim 2008/2009. Sebab dia bakal tampil sebagai starter, setelah musim ini lebih banyak tampil dari bangku cadangan. Namun kekuatan Dortmund diyakini playmaker Bayern Bastian Schweinsteiger, sudah tentu berkurang minus Gotze, gelandang kreatif Jerman yang baru berusia 20 tahun. “Ketika pemain seperti Gotze absen, tim yang dia bela pasti berkurang kekuatannya. Padahal, ini akan jadi laga terbesar sepanjang karirnya, jadi saya turut bersimpati,” tutur Schweinsteiger. “Hanya saja, Dortmund

pasti akan mengerahkan 11 pemainnya untuk tampil 100 persen. Kami menghormati Dortmund, tapi saya yakin baik menang atau kalah semuanya berpulang pada kami,” katanya lagi. Gelandang berumur 27 tahun itu bahkan mengklaim, FC Hollywood saat ini merupakan klub terbaik di Benua Biru. “Jika mencapai potensi terbaik yang kami miliki, hanya sedikit tim Eropa yang bisa mengalahkan kami,” beber Schweinsteiger. Cara Spesial Hanya saja pelatih Dortmund Jurgen Klopp justru mengaku, pasukannya tidak perlu melakukan persiapan khusus apalagi beradaptasi untuk meladeni permainan Bayern asuhan

Jupp Heynckes. “Kami tidak pernah beradaptasi terhadap lawan-lawan kami, begitu juga dengan Bayern. Caranya adalah membuat laga ini seperti partai biasa, namun dilakukan dengan cara spesial dan kami akan melakukannya,” kata Klopp. Dia pun menuturkan kembali kisah perjalanan skuadnya menembus final, yang sejak babak penyisihan dibenturkan dengan klub-klub elit Eropa. Gabung di Grup D, Die Borussens harus bersaing dengan raksasa Real Madrid (Spanyol), Manchester City (Inggris) dan Ajax Amsterdam (Belanda). Ketiga rival dimaksud merupakan jawara di masing-masing liga negaranya, namun Dort-

Harga Tiket Naik 38 Kali Lipat LONDON (Waspada): Harga tiket final Liga Champions dinihari WIB nanti di Stadion Wembley, London, naik sampai 38 kali lipat. Para pendukung Bayern Munich maupun Borussia Dortmund berarti mesti merogoh kocek lebih dalam, karena kuota tiket untuk pendukung kedua finalis itu hanya 50 ribu lembar dan semuanya sudah habis terjual sejak pekan lalu. Stadion Wembley sebenarnya memiliki kapasitas 86 ribu kursi. Tapi sejak Jumat (24/5), lokasi-lokasi penjualan tiket resmi yang ditunjuk panitia untuk 36 ribu lembar lagi, sudah tidak melayani pembelian. Menurut, sebagian tiket tersebut telah diperdagangkan di pasar gelap. Di tangan para calo, harga tiket melambung hingga 38 kali lipat. Untuk kategori paling murah saja, saat ini ditawarkan dengan harga £4.510 atau Rp66 juta sepasang. Padahal harga resmi yang ditetapkan oleh pantia hanya £60 atau Rp885 ribu per tiket. Harga tiket untuk kategori


LISA Rossenbach selalu mendukung aksi Roman Weidenfeller sebagai kiper utama Dortmund.


GELANDANG Bayern Bastian Schweinsteiger memberikan respon kepada pendukung timnya saat berjalan di Bandara Munich untuk menuju London, Jumat (24/5). lainnya juga ikut melambung. Bahkan ada yang sampai menyentuh angka £14 ribu atau Rp206,5 juta per lembar. Diperkirakan ada sekitar 150 ribu fans Jerman yang akan menyerbu London, mereka kebanyakan belum memiliki tiket dan akan menjadi sasaran para calo. Juru bicara UEFA mengatakan, pihaknya sedang berusaha un-

tuk memerangi praktek percaloan tersebut. “UEFA dan asosiasi sepakbola (FA) sedang bekerjasama untuk memerangi praktik percaloan tiket. Kami akan menempuh jalur hukum bagi para calo yang melanggar hukum Inggris, syarat tiket dan kondisi tiket,” tegas sang jubir. Final Liga Champions 2013

ini merupakan penampilan keempat FC Hollywood dalam 12 tahun terakhir. Tapi setelah menang pada 2001, Bayern kalah 0-2 dari Inter Milan pada final 2009/2010 dan menyerah melalui adu penalti lawan Chelsea pada 2011/2012 di Allianz Arena. Tapi kali ini FC Hollywood sangat yakin bisa merajai Eropa, sehingga mereka sudah memesan ballroom Hotel Grosvenor di London, yang mampu menampung 1800 orang. Manajemen Die Bayern juga sudah menyewa bar hotel untuk buka hingga pukul 5 pagi. Daily Mail melansir, ballroom Hotel Grosvenor yang dinamakan “The Great Room” merupakan salah satu ruangan dansa terbesar di Eropa, yang sering digunakan oleh Kerajaan Inggris. Musim lalu Bayern pernah melakukan hal serupa, mereka menyewa aula Postpalast di Munich untuk merayakan kesuksesan Liga Champions. Namun Arjen Robben cs malah dipecundangi tamunya The London Blues. (m15/vvn/metro/dm)

KAPTEN Nadine Kessler (tengah) dan para pemain Wolfsburg pamer trofi juara Liga Champions putrid di Stamford Bridge Stadium, London, Jumat (24/5) dinihari WIB. -AP-

Putri Wolfsburg Lengkapi Kejayaan Jerman LONDON (Antara/Reuters): Vfl Wolfsburg membuat kejutan pada final Liga Champions putri, Jumat (24/5) dinihariWIB, ketika mengalahkan juara bertahan dua kali Olympique Lyon 1-0. Sukses Nadine Kessler cs ini melengkapi kejayaan Jerman di Eropa, karena Bayern Munich dan Borussia Dortmund juga akan bertemu pada final Liga Champions putra dinihari WIB nanti di Stadion Wembley. Gol penentu kemenangan Wolfsburg di Stadion Stamford Bridge, London, dihasilkan lewat tendangan penalti pada babak kedua oleh Martina Mueller.

Wolfsburg merupakan tim pertama yang mengalahkan juara Prancis itu dalam waktu normal. Favorit Lyon, yang tampil di babak final untuk keempat kalinya, mendominasi duel sejak awal. Namun mereka tidak mampu menembus pertahanan lawan di markas Chelsea tersebut. Mentas di kompetisi itu untuk pertama kalinya, Wolfsburg mengakhiri kebuntuan permainan ketika mendapat hadiah tendangan 12 pas, setelah Laura Georges dikasari di kotak terlarang Lyon.


mund mampu menjadi juara Grup D dan lolos babak 16 besar bersama Real Madrid sebagai runner-up. “Perasaan yang menyenangkan ketika kami lolos babak 16 besar, karena caranya sangat luar biasa. Permainan kami di babak grup cukup mengejutkan dan laga melawan ManCity membuat kami sadar jika kami bisa bersaing dengan tim-tim besar di Eropa,” kenang Klopp. Robert Lewandowski cs kemudian mencapai final dengan menyingkirkan Shakhtar Donetsk di babak 16 besar, lantas Malaga (perempatfinal) dan Madrid (semifinal). “Saya sudah tak sabar menjalani festival sepakbola yang hebat pekan ini,” tegas winger Marco Reus. “Musim pertama saya di Dortmund sungguh hebat. Seluruh pengalamanku di Liga Champions benar-benar luar biasa. Tampil diWembley benarbenar puncak karir saya,” pungkas Reus. (m15/vvn/bild/espn/uefa)

LONDON (Waspada): Kiper Roman Weidenfeller mengklaim, timnya Borussia Dortmund bakal tampil beda saat menghadapi Bayern Munich pada final Liga Champions dinihari WIB nanti di Stadion Wembley. Die Borussens, menurutnya, tidak akan sama dengan tim yang disingkirkan Bayern di Piala Jerman dan yang bermain imbang pada laga kandang dan tandang musim ini di Bundesliga. Dortmund memang kalah bersaing dengan Bayern, yang merampas mahkota liga mereka dengan keunggulan 25 poin di klasemen akhir. “Bagaimanapun kami selalu tampil berbeda di Liga Champions,” klaim Weidenfeller. “Kami selalu berjuang secara maksimal di setiap pertandingan Liga Champions,” tambah suami Lisa Rossenbach tersebut, seperti dilansir Soccerway, Jumat (24/5). Kiper berumur 32 tahun itu tak lupa menjadikan kisah sukses Dortmund pada final 1997 sebagai sumber inspirasi. Mentas sebagai underdog, saat itu Dortmuns secara mengejutkan mampu mengandaskan raksasa Italia sekaligus juara bertahan Juventus 3-1. “Setiap orang masih mengagumi tim Dortmund ’97. Besok kami akan mengangkat trofi di London dan mendapatkan status yang sama,” tutur kata Weidenfeller. “Dortmund kembali menyandang status underdog, sama seperti tim ’97. Saya hanya bisa katakan, semua hal dapat terjadi dalam sebuah pertandingan,” katanya menambahkan. Bayern Pantas Namun menurut mantan pemain Bayern, Roy Makaay, Mario Gomez cs pantas lebih diunggulkan. Dia yakin, era Dortmund sudah surut setelah mendominasi sepakbola Jerman pada musim 2010/11 dan 2011/12. “Saya pikir Bayern memiliki kesempatan bagus. Jika mereka mampu menampilkan permai-

Distribusi Juara Piala/Liga Champions 9754-

Real Madrid (Spanyol) AC Milan (Italia) Liverpool (Inggris) Bayern Munich (Jerman), Barcelona (Spanyol), Ajax Amsterdam (Belanda) 3 - Inter Milan (Italia), Manchester United (Inggris) 2 - Benfica (Portugal), Juventus (Italia), Nottingham Forest (Inggris), Porto (Portugal) 1 - Celtic (Skotlandia), Hamburg (Jerman), Steaua Bucharest (Romania), Mareille (Prancis), Chelsea (Inggris), Feyenoord (Belanda), Aston Villa (Inggris), PSV Eindhoven (Belanda), Red Star Belgrade (Serbia), Borussia Dortmund (Jerman). nan seperti yang mereka tunjukkan di semifinal (melawan Barcelona), saya yakin mereka akan menang,” ucap Makaay melalui situs resmi Bundesliga. FC Hollywood asuhan Jupp Heynckes memang sangat superior di semifinal. Setelah menggunduli El Barca 4-0 pada leg pertama di Allianz Arena, Munich kemudian mempermalukan Lionel Messi cs 3-0 pada leg kedua di Camp Nou. “Duel ini hanya berlangsung sekali dan Anda tak bisa bilang apa yang akan terjadi. Namun saya yakin Bayern akan melakukannya kali ini. Dortmund sama sekali tak buruk, tapi Bayern sedikit lebih baik dari mereka,” tutur mantan bomber Munich dan Deportivo La Coruna itu. Mantan penyerang Belanda itu juga membahas kisah kegagalan Die Roten pada final Liga Champions musim 2009/10 (dipukul Inter Milan 0-2) dan 2011/12 (dipecundang Chelsea melalui adu penalti). “Tekanan ada pada mereka, namun Bayern adalah klub yang sudah terbiasa dengan tekanan,” pungkas Makaay. (m15/okz/sw/dpa/espn)


WASPADA Sabtu 25 Mei 2013


Sociedad Hanya Fokus Madrid MADRID ( Wa s p a d a ) : Real Sociedad perlu pulih dengan cepat dari berita-berita yang menyebutkan bahwa pelatihnya Philippe Montainer akan pergi untuk bergabung dengan Stade Rennes pada akhir musim nanti. Sangat menyesakkan, sebab mereka akan menghadapi Real Madrid pada partai penting untuk memperjuangkan peringkat keempat dengan bonus ke kualifikasi Liga Champions musim depan. Montainer telah memutuskan untuk mengakhiri kiprahnya di San Sebastian setelah timnya mendapat garansi berkompetisi di Eropa. Namun striker Imanol Agirretxe (foto) yakin, Sociedad mampu mengesampingkan keputusan orang PranAP

GELANDANG Chelsea Yossi Benayoun (kanan) bertarung seru dengan bek Manchester City Pablo Zabaleta di Busch Stadium, St. Louis, Jumat (24/5) siang WIB.

City Puas Bangkit Pukul Chelsea ST LOUIS, AS (Waspada): Manchester City puas setelah bangkit dari ketertinggalan untuk memukul Chelsea 4-3 pada laga eksibisi tur Amerika Serikat di Stadion St. Louis Cardinals’ Busch, Jumat (24/5) siang WIB. “Saya pikir kami sudah tak beruntung lagi saat tertinggal 0-2, namun para pemain tampil luar biasa. Mereka telah melakukan pekerjaan besar,” puji Brian Kidd, caretaker pelatih The City kepada Sports Mole. Chelsea sempat tampil mengesankan di depan 48.623 penonton yang memadati St. Louis Cardinals. The Blues unggul tiga gol lebih dulu melalui Demba Ba menit 14, penalti Cesar Azpilicueta (45') dan gol Oscar (53'). Dua gol awal Chelsea tercipta berkat assist Juan Mata. Citizens memperkecil ketinggalan menjadi 2-3 setelah mencetak dua gol hanya dalam dua menit melalui gelandang Javi Garcia (63’) dan penyerang Edin Dzeko (64’). City lantas menyamakan kedudukan melalui gol kedua Dzeko menit 84 dan berbalik unggul lewat sundulan bek Micah Richards pada in-

Chelsea Vs Manchester City 3-4 Chelsea (1-4-1-4-1): Petr Cech (Blackman 61'); Cesar Azpilicueta (Paulo Ferreira 46'), Branislav Ivanovic (David Luiz 46'), Gary Cahill (Ramires 46'), Christensen; Jon Obi Mikel; Juan Mata (Oscar 46'), Yossi Benayoun, LoftusCheek (Ake 80'), Ashley Cole; Demba Ba (Fernando Torres 46'). City (1-4-2-3-1): Joe Hart (Wright 46'); Pablo Zabaleta (Douglas Maicon 62'), Vincent Kompany (Micah Richards 46'), Rekik (Boyata 8'), Gael Clichy; Javi Garcia, Yaya Toure (Huws 46'); Rusnak (James Milner 62'), Carlos Tevez, David Silva (Samir Nasri 46'); Sergio Aguero (Edin Dzeko 46'). jury time, meneruskan umpan Garcia. “Para pemain memiliki beberapa pekan sulit menyusul kepergian sang pelatih (Roberto Mancini) dan kegagalan mereka pada final FA Cup. Sungguh pekan yang emosional, tim ini penuh talenta dan tidak diragukan lagi,” klaim Kidd. (m15/goal/sm/fifa)

Sinar Husni Cup 17 Juni MEDAN (Waspada): SSB Sinar Husni, baru saja terbentuk, akan menggelar turnamen bertajuk Sinar Husni Cup I di Lapangan Yayasan Pendidikan Sinar Husni, Jl Banten Helvetia, mulai 17 Juni mendatang. “Turnamen ini akan mempertandingan pemain kelompok umur di bawah 13 tahun atau kelahiran tahun 2000. Event ini untuk lebih memperkenalkan keberadaan SSB Sinar Husni yang baru saja muncul,” ujar Koordinator Turnamen, Suyono, Jumat (24/5). Dikatakan, Sinar Husni Cup I ini diharapkan menjadi suntikan motivasi bagi pemain binaan,

serta semakin menarik minat masayarakat sekitar Helvetia untuk mempercayakan anak-anaknya dibina dan dididik di SSB Sinar Husni. Meski turnamen tahun pertama, panitia tidak membatasi jumlah peserta. Tim calon peserta sudah bisa mendaftar mulai Selasa (28/5) nanti dengan menghubungi 081375321058 atau 082370599758. “Kami berharap seluruh tim peserta tetap mampu menjunjung semangat sportivitas dan tidak melakukan hal-hal yang dapat mencederai pembinaan pemain usia dini, seperti melakukan tindak pencurian umur pemain,” ujar Suyono. (m42)

Problem Catur Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2. 8







1 A








(1800) (1800) (1800) (1800) (1800) (1800) (1800) (1800) (1800) (1800)

cis itu dan hanya fokus menjamu Madrid besok malam pada jornada 37 La Liga Primera. “Kamar ganti tetap tenang, kami memiliki laga sangat penting. Pelatih menyadari betapa pentingnya ini dan dia meminta kami tetap tenang,” ungkap Agirretxe, seperti dikutip dari AFP, Jumat (24/5). “Saat ini kami berkonsen-

94 81 72 62 62 54 52 49 47 47 44 44 43 42 39 36 35 34 32 31

trasi melawan Real Madrid dengan hasrat dan kegembiraan

besar. Kami bermain demi banyak hal , saya pikir kegembiraan di atas semua situasi pribadi kami sebagai manajer atau pemain,” tambahnya. Tim tamu Los Blancos juga menghadapi berita suksesi entrenador, setelah secara resmi mengonfirmasi Jose Mourinho akan meninggalkan ibukota Spanyol pada akhir musim nanti. Madrid juga tidak memiliki apapun untuk diperjuangkan, namun Agirretxe tetap tidak mau meremehkan sang juara bertahan.

“Namun pada akhirnya mereka tahu bagaimana caranya bermain baik. Real Madrid adalah Real Madrid, saya tidak pernah melihat mereka bersantai atau melepaskan laga dengan mudah,” ujar Agirretxe. Apalagi superstar Cristiano Ronaldo bisar main, meski mendapat skorsing dua partai untuk kartu merah yang diterimanya saat melawan Atletico Madrid pada final Copa Del Rey pekan lalu di Santiago Bernabeu. (m15/ant/afp/uefa)

Hotlan Pimpin Perkemi Sumut MEDAN (Waspada): Ketua Umum KONI Sumut, Gus Irawan Pasaribu (foto), mengatakan dampak tidak tertampungnya anggaran KONI Sumut di APBD 2013 membuat Pengurus Provinsi (Pengprov) Olahraga di Sumut harus mandiri dalam menanggulangi biaya pembinaan atlet. “Untuk tahun ini, KONI Sumut belum bisa berbuat apaapa, mengingat anggaran kita tahun ini tidak tertampung di APBD,” ujar Gus Irawan, saat membuka Musyawarah Persaudaraan Provinsi (Musperprov) Perkemi Sumut di Hotel Madani Medan, Jumat (24/5). Gus mengaku heran kenapa anggaran pembinaan olahraga KONI Sumut bisa tidak tertampung dalam APBD 2013. Hal ini menurutnya sama dengan Pemprovsu tidak mematuhi isi UU No 3 Tahun 2005 Tentang Sistem Keolahragaan Nasional yang salah satu pasalnya menegaskan bahwa Pemerintah Pusat maupun Daerah wajib membiayai pembinaan olahraga. “Apalagi secara subtansi kegiatan olahraga sesuai UU No 3 Tahun 2005 adalah bagian dari pembangunan nasional. Hal ini yang mungkin terlupakan, sehingga anggaran olahraga untuk KONI Sumut juga terlupakan,” ucap Gus.

Hari Ini Di Merdeka Walk

Honda Bikers Leo Wijaya, Marketing Manager CV Indako Trading Co, mengklaim bahwa Honda selalu berupaya menciptakan teknologi

Ath Bilbao v Levante Atl Madrid v Mallorca Getafe v Vallecano Malaga v Deportivo Osasuna v Sevilla Espanyol v Barcelona Real Betis v Zaragoza Sociedad v Real Madrid Valladolid v Celta Vigo Valencia v Granada

Klasemen La Liga Barcelona 36 30 4 2 109-39 Real Madrid36 25 6 5 96-37 Atl Madrid 36 22 6 8 62-30 Sociedad 36 17 11 8 66-46 Valencia 36 18 8 10 63-50 Malaga 36 15 9 12 49-45 Real Betis 36 15 7 14 52-55 Vallecano 36 15 4 17 46-63 Sevilla 36 13 8 15 53-49 Getafe 36 13 8 15 42-53 Espanyol 36 11 11 14 43-49 Bilbao 36 12 8 16 42-62 Valladolid 36 11 10 15 47-52 Levante 36 11 9 16 38-56 Granada 36 10 9 17 35-53 Osasuna 36 9 9 18 29-45 Deportivo 36 8 11 17 46-66 Zaragoza 36 9 7 20 36-55 Mallorca 36 8 8 20 39-70 Celta Vigo 36 8 7 21 34-52

Gus Minta Pengprov Mandiri

Momen Bersejarah Honda Injection Day MEDAN (Waspada): Setelah deklarasi PGM FI pada 1 Desember 2011, Honda kembali akan menciptakan moment bersejarah bagi masyarakat Sumatera Utara lewat gelaran spektakuler ‘Honda Injection Day’ yang akan berlangsung pada Sabtu (25/5) ini. Kegiatan di Merdeka Walk Medan ini bakal mencuri perhatian masyarakat, terutama mereka yang mengagumi kecanggihan teknologi Honda. Salah satunya teknologi PGM FI atau injeksi yang dihadirkan sebagai produk berkualitas dari sisi teknologi kecepatan, keamanan dan kenyamanan. Demikian Gunarko Hartoyo, Corporate and Marketing Communication Manager CV Indako Trading Co selaku main dealer Honda di Wilayah Sumatera Utara, Jumat (24/5). Melalui gelaran Honda Injection Day, pihaknya ingin lebih memperkenalkan teknologi Honda PGM FI kepada masyarakat pengguna sepeda motor. “Ada pepatah yang mengatakan ‘Tak Kenal Maka Tak Sayang, Tak Sayang Maka Tak Cinta’, maka kami ingin masyarakat semakin mengenal teknologi PGM FI agar semakin sayang dan cinta dengan teknologi ini untuk mewujudkan impian menciptakan langit biru di Sumatera Utara dan Indonesia, “ ujar Gunarko. Honda Injection Day juga akan menjadi moment peluncuran teknologi terbaru Idling Stop System (ISS) yang diterapkan pada Honda Vario Techno 125 CBS. Idling Stop System merupakan teknologi yang dirancang untuk mengurangi emisi dan konsumsi bahan bakar saat kondisi diam. “Dalam kondisi aktif ISS akan mematikan mesin secara otomatis jika berada tiga detik di lampu merah dan menyalakan mesin kembali hanya dengan memutar gas yang membuat konsumsi bahan bakar menjadi lebih efisien,” beber Gunarko.

Jornada 37 La Liga Minggu, 26 Mei (GMT)

Padahal, lanjut Gus, anggaran senilai Rp15 miliar KONI Sumut untuk tahun 2013 sudah ketuk palu di DPRD. Artinya, DPRD sudah setuju, tetapi walau sudah dikawal oleh sejumlah pengurus KONI yang juga duduk sebagai anggota dewan, anggaran tersebut akhirnya tidak tertampung juga di APBD Sumut 2013.

Begitupun, Gus mengaku mendapat angin segar setelah Pemerintah Provinsi Sumut berjanji akan menampung anggaran dana olahraga prestasi KONI Sumut tahun 2013 dalam P-APBD. Hanya saja, Gus menilai dana tersebut tentunya sudah kurang efektif, karena kalaupun terealisasi, baru akan turun di bulan Oktober. “Jadi untuk saat ini, Pengprov Cabang Olahraga harus lebih mandiri dalam meningkatkan pembinaan dan prestasi atlet,” ucap Gus, mengisyaratkan jika KONI Sumut untuk saat ini belum bisa membantu biaya penyelenggaraan pembinaan Pengprov Olahraga.

Musperpov Perkemi Dalam Musperprov Perkemi Sumut, Ir Hotlan Sibarani terpilih sebagai ketua umum periode 2013-2017. Hotlan menang mutlak dengan meraup enam suara mengalahkan Ir Ucwatul Achyar (incumbent). Ketua Panitia Musperprov Perkemi, Azwir Agus SH MHum, mengatakan tujuan kegiatan tersebut juga sekaligus mempererat tali persaudaraan antara seluruh kenshi di Sumut dalam menentukan masa depan Perkemi Sumut. “Secara khusus, Musperprov meminta pertanggungjawaban Pengprov periode 2009-2013, baik laporan kerja


maupun keuangan. Memilih ketua umum dan formatur untuk menyusun struktur kepengurusan baru dan merumuskan program kerja kepengurusan Perkemi Sumut empat tahun mendatang,” ucapnya. (m42)

Menang 7-0, Mundari Belum Puas JAKARTA (Waspada): Sukses mencukur tim U-14 SSB Rajawali 7-0 dalam laga ujicoba di Lapangan Sawangan, Depok, Jawa Barat, Jumat (24/5), tidak membuat Pelatih Timnas U-14, Mundari Karya (foto) puas. Mantan Pelatih PSPS Pekan Baru ini menegaskan skuad timnas besutannya yang tengah dipersiapkan tampil di babak kualifikasi AFC U-14 di Myanmar pekan depan, masih memiliki sejumlah kekurangan. Salah satunya menyangkut pemahaman dalam bermain di dalam lapangan. Karena itulah, kemenangan besar yang diraih dalam laga ujicoba terakhir sebelum terbang ke Myanmar, dinilainya masih kurang memuaskan.


“Secara kualitas, kemampuan mereka sebaga anak-anak yang berusia 14 tahun memiliki kualitas yang baik. Hanya saja, selain teknik, para pemain juga perlu pengetahuan dan pema-

haman dalam bermain sepakbola,” kata Mundari ditemui seusai laga ujicoba. Ditambahkan, dirinya sangat berharap ke depan Timnas U-14 bisa melanjutkan program yang sudah dijalani. Ia juga menyatakan bahwa ajang internasional seperti AFC U-14 sangat bermanfaat buat para pemain muda yang tengah berupaya mengembangkan kemampuan. “Kesempatan tampil di ajang internasional seperi event AFC sangat penting untuk memberi pengalaman bertanding bagi anak-anak. Kalau mau membangun pemain muda, kesempatan tampil di ajang internasional harus diperbanyak,” beber Mundari dengan nada kritis.

Sebelumnya, Badan Tim Nasional (BTN) PSSI sempat membatalkan keikutsertaan Timnas U-14 di ajang AFC U14 kali ini, dengan alasan kesiapan timnas junior yang minim. Akan tetapi akhirnya diputuskan tetap diberangkatkan, setalah Ketua Umum PSSI, Djohar Arifin Husin, turun tangan. Sesuai hasil undian yang dilakukan di markas AFC beberapa waktu lalu, Indonesia berada di Grup F dalam babak kualifikasi AFC U-14. Nantinya, Indonesia akan bersaing dengan Bangladesh, Kamboja, Laos, Singapura, dan Thailand. Babak kualifikasi berlangsung pada 28 Mei hingga 3 Juni di Myanmar. (yuslan)

Sumut Jajal Siak, Aceh Vs Maluku Kejurnas Antar PPLP/PPLPD

irit dan ramah lingkungan dan teknologi ISS merupakan satu dari sekian banyak teknologi terbaik yang dipersembahkan Honda untuk pecintanya. Beragam kegiatan menarik juga dipastikan akan menjadi daya tarik tersendiri bagi masyarakat untuk terus merayakan Honda Injection Day bersama Honda. Salah satunya Honda Technical Skill Contest Regional Sumut 2013 yang akan diikuti oleh para mekanik dan Service Advisor AHASS. Komunitas Honda tergabung dalam Sumut Honda Bikers juga ikut memeriahkan. Tidak hanya kaya pengetahuan tentang cara berkendara yang baik dan sesuai aturan safety riding, namun klub Honda juga memiliki pengetahuan tentang teknologi Honda, karenanya tidak kurang dari 17 klub Honda yang ada di Kota Medan akan mengikuti kompetisi seputar pengetahuan mereka tentang teknologi Injeksi, Honda PGM FI. “Kegiatan ini merupakan pesta Honda Injeksi No 1 untuk seluruh masyarakat Sumut, tidak hanya menjadi No 1 hadir di Indonesia, tetapi juga No 1 Mudahnya, No 1 Hematnya, dan No 1 Hebatnya,” klaim Gunarko. (adv)

BANDA ACEH (Waspada): Tim PPLP Sumut akan menghadapi PPLPD Siak pada laga perdana Kejurnas Sepakbola Antar PPLP/PPLPD se Indonesia di Lapangan Sintetis Stadion Harapan Bangsa (SHB) Lhong Raya, Banda Aceh, Sabtu (25/5) ini. Dalam Kejurnas yang dibukaWagub Aceh, Muzakir Manaf, di Hall Serbaguna SHB Lhong Raya, Banda Aceh, Jumat (24/5) malam, tim PPLP Sumut berada di Grup B bersama PPLP Jawa Tengah, PPLP Papua, dan PPLPD Siak. Sementara di pertandingan lainnya yang dipentaskan di tempat sama malam harinya, tuan rumah PPLPD Aceh menantang tim favorit PPLP Maluku. Tim Aceh berada di Grup

C bersama PPLP Sulsel, PPLPD Riau, dan PPLP Maluku. Grup A ditempati Sekolah Khusus Olahraga (SKO) Ragunan, PPLPD Maluku Utara, PPLP Sumbar, dan PPLPD DKI Jakarta. Demikian hasil technical meeting yang berlangsung di aula Grand Aceh Hotel, Banda Aceh, Jumat (24/5), dipimpin Wakil Ketua Pengprov PSSI Aceh, M Nasir Guru Mud, dan disaksikan langsung Deputi Pemberdayaan Olahraga Kemenpora, Drs Tunas Dwidharta. Pada pertemuan teknik tersebut, sempat muncul usulan dari kontingen PPLP Sumut dan SKO Ragunan agar pergantian pemain setiap tim bisa dilakukan lima kali. Namun, panitia memutuskan tetap tiga kali



pertunjukan filem, dsb). 27. Bioskop. 28. Gambar/filem dengan penampilan yang lucu.



1. _____Stewart, aktris Hollywood berusia 23 tahun, berpenghasilan tertinggi (Rp324M) dengan filemnya Breaking Dawn dan Snow White and The Huntsman. 4. Rod_____, penyanyi Inggris sejak 1962, nama orangtuanya (surname) juga sama dengan aktris diatas. 7. _____Diaz, aktris Hollywood berpenghasilan Rp319M dengan filemnya Bad Teacher. 8. _____Bullock, aktris Hollywood berpenghasilan Rp235M dengan tiga filemnya termasuk The Blind Side. 10. Kayu cemara (Inggris); Nama studio filem Inggris, memproduksi filem-filem James Bond. 12. Yoko_____, artis Jepang isteri gitaris John Lennon. 13. Seperangkat tanda nada. 15. Alat musik pukul; Genderang. 18. Alat musik tradisional yang dibuat dari tabung bambu. 19. _____Shara, penyanyi dan kakaknya Krisdayanti. 20. Beruang (Inggris): Yogi——, salah satu keluarga beruang dalam filem kartun. 21. Mister _____, aktor dan pelawak Inggris. 22. Nama sungai di Jawa, judul lagu sejak tempo dulu. 26. Pertama; Perdana (tentang

MENURUN 1. Alat musik petik tradisional bersenar 3,5,6 dsb. 2. Perekaman produksi suara yang lebih realistis dengan menggunakan dua saluran pengeras suara. 3. Menonton (ucapan singkat dalam percakapan). 5. Sekolah musik di Medan (dua kata tanpa spasi). 6. Alat peraga yang bersifat dapat didengar. 9. Suku di Australia, memiliki alat musik didgeridoo. 11. Nada pertama tangga nada diatonik. 14. Jenis suara tertinggi untuk pria. 15. Pertunjukan (filem, dsb); Persembahan. 16. Tidak stereo. 17. Gendang pipih bundar; Alat musik kasidah. 21. Nada yang besar dan rendah. 22. Pulau di Indonesia, tempat syuting filem Hollywood. 23. Nyanyian tunggal, diiringi alat musik seperti opera dan oratoria. 24. Tinggi rendahnya bunyi dalam lagu dan musik. 25. Nyanyian; Ragam nyanyi.

Jadwal Sabtu (25/5) Stadion Harapan Bangsa (SHB) Lhong Raya 14.45 SKO Ragunan vs PPLPD Malut (Grup A) 16.30 PPLP Jateng vs PPLP Papua (Grup B) 20.00 PPLP Sulses vs PPLPD Riau (Grup C) Lapangan Sintetis SHB Lhong Raya 14.45 PPLP Sumbar vs PPLPD DKI Jakarta (Grup A) 16.30 PPLP Sumut vs PPLPD Siak (Grup B) 20.00 PPLP Maluku vs PPLPD Aceh. (Grup C) sesuai peraturan PSSI. “Kita berlakukan seperti ini, karena kita ingin Kejurnas kali ini menjadi tolok ukur bagi pelaksanaan kejuaraan berikutnya,” ujar Koordinator Pertandingan, Drs Nasruddin MSi yang kemudian diterima semua kontingen.

Hingga Jumat (24/5) sore, seluruh peserta sudah tiba di Banda Aceh, kecuali tim PPLP Sumbar yang akan tiba di Banda Aceh malam harinya serta PPLP Jateng dijadwalkan tiba Sabtu (25/5) siang karena tidak ada koneksi penerbangan dari Jakarta ke Banda Aceh. (b04)

Sudoku 10x10 Isi kotak dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu kurang dari 15 menit. Jawaban di halaman A2 kolom 1.


8 0 7 2 5 8 4 7 3 9 3

7 1 9 5 9 1 4 0 2 0 2 6 1 5 8 9 4 8 0 5

6 7

9 8 4 9 0 1 9 5 8 6




WASPADA Sabtu 25 Mei 2013

Nadal Favorit PARIS (Waspada): Melihat sepak terjang Rafael Nadal (foto) selama beberapa pekan terakhir, tampaknya petenis Spanyol ini bakal kembali memenangi Prancis Terbuka untuk kedelapan kalinya. Pada Senin (27/5), salah satu turnamen grand slam ini bakal digelar di Roland Garros. Nadal, terkenal jagonya lapangan tanah liat, pun datang ke sebagai unggulan ketiga. Padahal, petenis kidal itu baru kembali ke lapangan pada Februari lalu setelah absen tujuh bulan akibat cedera lutut. Sekembalinya ke lapangan, Nadal mulai menunjukkan permainan tenis level atas dengan menjuarai dua turnamen di lapangan tanah liat, Mutua Madrid dan Roma Masters. Di final Monte Carlo, Nadal kalah dari Novak Djokovic (Serbia). “Jika Anda mengatakan kepada saya empat atau lima bulan lalu bahwa setelah dela-

pan turnamen, saya akan memenangi enam di antaranya dan delapan kali masuk final, saya akan mengatakan Anda sudah gila,” ungkap Nadal tentang torehan mengejutkannya, Jumat (24/5). Bila mampu memenangi Prancis Terbuka, Nadal bakal memecahkan rekor sebagai petenis pertama yang mampu juara sebanyak delapan kali di salah satu ajang seri grand slam. Melihat penampilan Nadal, bukan tak mungkin mantan raja tenis dunia itu bisa mewujudkan rekor tersebut. Petenis sebelumnya paling banyak hanya menjuarai tujuh gelar grand slam yang sama. Roy Emerson mengoleksi enam

trofi Australia Terbuka, sementara William Renshaw, Pete Sampras, dan Roger Federer masing-masing tujuh kali berjaya di Wimbledon. Bill Larned, Bill Tilden, dan Richard Sears juga menang tujuh kali di AS Terbuka. Di kategori putri, Victoria Azarenka dikenal sebagai sosok yang cukup temperamental. Namun, saat ini petenis Belarus itu mengaku ingin lebih meredam emosinya agar tak mengganggu konsentrasinya pada pertandingan. Menjelang perhelatan Prancis Terbuka 2013, Azarenka sangat fokus memperbaiki diri dan berharap bisa memenangi gelar di Roland Garros sebagaimana targetnya sejak awal tahun ini. Kebetulan, titel Prancis Terbuka memang belum pernah dirasakan Azarenka. “Tujuan utama saya adalah Prancis Terbuka,” ujar Azarenka yang kalah di final tahun lalu dari Maria Sharapova. (m33/ap)


LeBron, Kobe Pimpin Tim All NBA NEW YORK, AS (Waspada): LeBron James menjadi pilihan utama didampingi Kobe Bryant untuk memimpin tim All NBA, berdasarkan voting para jurnalis olahraga di Amerika Serikat (AS) dan Kanada, Jumat (24/5). Bersama Kobe, LeBron sudah merasakan tempat utama di tim All NBA sebanyak 11 kali. Total, bintang Miami Heat itu mendapatkan 119 suara untuk mengungguli Kobe yang absen tampil di playoff bersama LA Lakers akibat cedera. Tiga pemain melengkapi skuad inti All NBA adalah Kevin Durant (Oklahoma City Thunder), Tim Duncan (San Antonio Spurs), dan Chris Paul (LA Clippers). Sementara itu, tim kedua All NBA dihuni Carmelo Anthony (New York Knicks), Russell Westbrook (Oklahoma City Thunder), Tony Parker (San Antonio Spurs), Marc Gasol (Memphis Grizzlies), dan Blake Griffin (LA Clippers). Untuk tim ketiga, para jurnalis memilik James Harden (Houston Rockets), DwyaneWade (Miami Heat), Dwight Howard (LA Lakers), Paul George (Indiana Pacers), dan David Lee (Golden State Warriors). Di lain pihak, Mike Krzyzewski kembali diberi kepercayaan menukangi tim nasional AS. Pelatih Universitas Duke itu dikontrak hingga tahun 2016, setelah berhasil mempersembahkan dua medali emas Olimpiade secara beruntun di Beijing 2008 dan London 2012. ‘’Saya memang sudah memperkirakan akan kembali dipanggil, kini sudah menjadi kenyataaan. Karena itu, saya pastikan akan memberi 100 persen komitmen kepada tim bermodalkan tujuh tahun pengalaman,” ungkap Krzyzewski yang sudah berusia 66 tahun itu. Bila tetap dalam kondisi fit, Krzyzewski sepertinya akan tetap mengandalkan LeBron James, DwayneWade, Kevin Durant, Carmelo Anthony, Chris Paul, dan lainnya. Untuk tugas pertama, Krzyzewski akan melakukan persiapan jelang Kejuaraan Dunia 2014 di Spanyol sebelum membidik medali emas ketiga di Olimpiade 2016 mendatang. (m33/nba)


DUA bintang NBA, LeBron James (kanan) dan Kobe Bryant (kiri), terpilih sebagai anggota tim ALL NBA.

AS Bingung Pilih PG AP

Lotus Bisa Saingi Mercedes MONACO (Waspada): Pebalap Lotus, Kimi Raikkonen, yakin timnya memiliki kecepatan untuk bisa bersaing dengan dua pebalap Mercedes dalam lanjutan Formula One (F1) di GP Monaco, Minggu (26/5) nanti. Nico Rosberg memang mampu menjadi yang tercepat dalam dua sesi free practice awal GP Monaco. Kendati begitu, Kimi tidak melihat alasan Lotus tidak bisa menyaingi kecepatan Mercedes di sesi kualifikasi, kendati pebalap asal Finlandia ini menolak membuat prediksi. “Saya pikir ya (menyaingi Mercedes), jika kami mendapatkan semua hal yang benar,” kata The Ice Man, Jumat (24/5). “Kami bisa melihat hal itu. Mengapa tidak? Kami juga akan melihat apa yang terjadi pada hari Sabtu,” jelas mantan pebalap Ferrari yang menempati posisi keenam pada pelatihan kedua. Selain itu, Kimi juga yakin segala hal masih bisa terjadi, meski Mercedes tampil cepat selama dua sesi awal. Dia juga percaya Lotus sejauh ini telah berkembang dan mampu finish di tempat yang bagus saat balapan. “Anda akan berpikir mereka akan sangat cepat. Hari ini mereka sangat cepat, tetapi hal-hal bisa berubah. Kita harus menunggu dan melihat. Saya

tidak tertarik untuk mulai menebak apa yang bisa terjadi pada hari Sabtu (kualifikasi),” tegasnya. Disinggung masalah kontraknya, Kimi akhirnya angkat bicara terkait spekulasi yang mengabarkan dirinya akan hengkang dari Lotus musim depan. Kimi menegaskan dirinya masih fokus pada balapan musim ini dan belum memikirkan kontrak baru. Sebelumnya, Kimi dikabarkan masuk radar Red Bull sebagai tandem Sebastian Vettel musim depan. Hal ini menyusul performanya yang apik di awal musim, hingga sukses berada di posisi kedua klasemen sementara dengan 85 poin atau selisih empat angka dari Vettel. Kabarnya, Red Bull tertarik menduetkannya denganVettel, pasalnya MarkWebber dikabarkan akan memilih hengkang akhir musim nanti. Hal ini karena perselisihan yang terjadi antaraWebber dan Vettel. “Saya tidak terburu-buru. Kalau saya sangat menginginkan kontrak, saya sudah mencoba untuk menandatanganinya tahun lalu. Saya lebih suka mengerjakan tugas dengan baik, karena kalau bekerja dengan baik maka saya yakin akan mendapatkan kontrak sesuai keinginan,” tutupnya. (m33/auto)


BAGIAN depan mobil Lotus E21 milik Romain Grosjean hancur lebur akibat menabrak pembatas jalan di free practice GP Monaco, Kamis (23/5) malam.

Grosjean: Bukan Masalah Besar MONACO (Waspada): Romain Grosjean merasa tak ada masalah meski dirinya mengalami kecelakaan dalam sesi free practice GP Monaco, Kamis

(23/5) malam. Pebalap Lotus itu menegaskan kecelakaan itu sama sekali tidak membuat kepercayaan dirinya berkurang. Mobil E21 miliki Grosjean

Pirelli Ancam Mundur Dari F1


MONACO (Waspada): Pemasok ban mobil Formula One (F1) Pirelli, memberi peringatan akan mundur dari perlombaan pada akhir musim bila kontrak baru mulai 2014 tidak segera disetujui. Direktur Motorsport Pirelli, Paul Hembery, tidak menyembunyikan ketidaksabarannya ketika memberi keterangan kepada wartawan di Monaco, Jumat (24/5), dengan menyebutkan waktu terus bergulir bagi perusahaan Italia itu untuk mendesain dan uji ban yang cocok dengan peraturan yang amat radikal pada perlombaan 2014. “Setelah 1 September mendatang, kami akan menyatakan kepada mereka (tim) perlu mengetahui tentang ban untuk musim mendatang. Sekarang sudah di penghujung Mei, jadi Anda dapat membayangkan begitu perlunya kami mendapatkan kepastian tentang kontrak baru,” katanya. Ditanya tentang besarnya kemungkinan mundur dan seriusnya Pirelli, Hembery mengatakan pada waktu yang tepat seseorang akan menjatuhkan keputusan. Dalam peraturan baru musim mendatang, dilakukan peralihan ke mesin berkekuatan 1,6 liter V6 turbocharged dengan sistem penambahan daya, sehingga ban juga harus diubah dengan karakteristik unit baru. “Segala sesuatnya kini amat penting, sepanjang yang kami ketahui, karena secara ekstrem pergantian yang amat substansial akan dilakukan tahun depan jadi harus ada keputusan yang yang harus dilakukan,” tutup pria asal Inggris itu. (m33/ant/rtr)

menghantam pembatas jalan, sehingga bagian depan kiri mobilnya rusak. Meski dirinya kehilangan banyak lap saat latihan, driver asal Prancis ini merasa peluangnya masih terbuka di Monaco. “Itu bukan masalah besar. Sedikit disayangkan, karena kami kehilangan beberapa waktu, tapi keyakinan kami tetap ada,” kata Grosjean, Jumat (24/5). “Saya terjebak ketika saya berada di tikungan, sayangnya tidak ada yang benar-benar bisa dilakukan kala itu,” terangnya lagi. Dalam sesi free practice kedua, Grosjean mampu menyelesaikannya dengan menjadi pebalap tercepat ketujuh atau satu posisi di belakang rekan satu timnya, Kimi Raikkonen. Grosjean dan Kimi tertinggal satu detik dari pencetak waktu tercepat di hari pertama, Nico Rosberg (Mercedes GP). “Saya pikir itu akan menjadi kualifikasi dan balapan yang ketat. Fernando (Alonso) tampil cepat, begitu juga Mercedes, dan saya pikir kami pun demikian, sehingga nanti akan menjadi pertarungan yang bagus,” tandasnya. (m33/auto)

NEW YORK, AS (Waspada): Setelah dipercaya kembali melatih tim nasional bola basket Amerika Serikat (AS), Mike Krzyzewski langsung dihadapkan problema menentukan point guard (PG) dalam timnya. Tujuh pemain berposisi PG atau playmaker diharapkan hadir melengkapi 24 pemain yang dipanggil untuk melakoni latihan pasca-musim pada Juli mendatang. Di antara tujuh pemain itu terdapat Damian Lillard (Portland Trailblazers) dan Kyrie Irving (Cleveland Cavaliers) yang baru memenangi gelar Rookie Terbaik NBA musim ini. Panggilan hadir pada pelatihan di Las Vegas pada 22-25 Juli itu juga diterima Ty Lawson (Denver Nuggets), John Wall (Washington Wizards), dan Kemba Walker (Charlotte Bobcats). Guard Memphis Grizzlies, Mike Conley, dan bintang Indiana Pacers, George Hill, juga diprediksi bakal dipanggil Krzyzewski. Ofisial Basket AS juga berharap Krzyzewski mempertimbangkan pemain veteran yang sarat pengalaman dalam timnya sebagai persiapan tampil di Kejuaraan Dunia 2014 di Spanyol dan Olimpiade 2016 di Rio de Janeiro. Adapun para pebasket veteran dimaksud itu antara lain Chris Paul (LA Clippers), Derrick Rose (Chicago Bulls), RussellWestbrook (Oklahoma City Thunder), dan Deron Williams (Brooklyn Nets). Kendati tampil gemilang sekalipun cedera, Stephen Curry (foto) secara mengejutkan tidak dipanggil Juli mendatang. Mengingat performanya yang kian matang, ofisial basket AS meminta Krzyzewski memanggil guard andalan Golden State Warriors itu. Bila pulih cedera, Krzyzewski juga diminta memasukkan nama Rajon Rondo (Boston Celtics). Nantinya para guard itu akan bersaing mendapat tempat dalam tim yang sudah pasti diperkuat LeBron James, Dwayne Wade (Miami Heat), Kevin Durant (Oklahoma City Thunder), Carmelo Anthony, Tyson Chandler (New York Knicks), dan Blake Griffin (LA Clippers). (m33/nba)


Sumatera Utara

WASPADA Sabtu 25 Mei 2013


Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:24 12:37 12:25 12:32 12:31 12:28 12:24 12:20 12:27 12:26

15:49 16:02 15:49 15:56 15:56 15:53 15:49 15:45 15:52 15:51

Magrib 18:34 18:50 18:34 18:44 18:43 18:34 18:33 18:29 18:37 18:38



Shubuh Syuruq


19:47 20:04 19:48 19:58 19:56 19:47 19:47 19:42 19:50 19:51

04:42 04:51 04:42 04:47 04:47 04:50 04:43 04:39 04:45 04:43

04:52 05:01 04:52 04:57 05:57 05:00 04:53 04:49 04:55 04:53

L.Seumawe L. Pakam Sei Rampah Meulaboh P.Sidimpuan P. Siantar Balige R. Prapat Sabang Pandan

06:12 06:22 06:13 06:17 06:18 06:20 06:13 06:09 06:15 06:13

Zhuhur ‘Ashar 12:30 12:23 12:22 12:34 12:21 12:22 12:22 12:19 12:37 12:23

15:55 15:48 15:47 15:59 15:46 15:47 15:47 15:44 16:02 15:48



Imsak Shubuh Syuruq


18:42 18:33 18:32 18:45 18:28 18:31 18:30 18:26 18:50 18:30

19:56 19:46 19:46 19:58 19:41 19:44 19:43 19:40 20:04 19:43

04:45 04:41 04:40 04:51 04:43 04:41 04:42 04:40 04:51 04:44

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

04:55 04:51 04:50 05:01 04:53 04:51 04:52 04:50 05:01 04:54

06:16 06:11 06:10 06:21 06:13 06:11 06:12 06:10 06:22 06:14

Zhuhur ‘Ashar 12:23 12:25 12:35 12:27 12:24 12:31 12:19 12:30 12:23 12:22

15:48 15:50 15:59 15:52 15:49 15:56 15:44 15:54 15:47 15:47





Shubuh Syuruq


18:30 18:33 18:47 18:35 18:34 18:42 18:28 18:39 18:30 18:31

19:43 19:47 20:01 19:48 19:48 19:56 19:42 19:52 19:43 19:45

04:44 04:44 04:49 04:48 04:42 04:47 04:39 04:48 04:43 04:40

04:54 04:54 04:59 04:58 04:52 04:57 04:49 04:58 04:53 04:50

Panyabungan Teluk Dalam Salak Limapuluh Parapat Gunung Tua Sibuhuan Lhoksukon D.Sanggul Kotapinang Aek Kanopan

06:14 06:14 06:20 06:18 06:12 06:18 06:09 06:18 06:13 06:10

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur 12:20 12:27 12:25 12:21 12:23 12:20 12:20 12:29 12:23 12:18 12:20

‘Ashar Magrib 15:45 15:52 15:50 15:46 15:47 15:45 15:44 15:54 15:48 15:43 15:45

18:26 18:32 18:33 18:30 18:31 18:26 18:25 18:41 18:31 18:25 18:28



Shubuh Syuruq

19:39 19:45 19:46 19:43 19:44 19:40 19:38 19:55 19:44 19:38 19:41

04:43 04:50 04:45 04:39 04:42 04:41 04:42 04:45 04:44 04:39 04:40

04:53 05:00 04:55 04:49 04:52 04:51 04:52 04:55 04:54 04:49 04:50

06:13 06:20 06:15 06:09 06:12 06:11 06:12 06:15 06:14 06:09 06:10

Polres Binjai Sita Mobil Wabup Langkat BINJAI (Waspada): Terkait kasus pengrusakan baleho Bupati Langkat H. Ngogesa Sitepu, SH, Minggu (12/5) dinihari, Polres Binjai akhirnya menyita mobil Ford Everest hitam milik Wabup Langkat, B, SE. Waspada/Nazelian Tanjuing

MOBIL dinasWabup Langkat setelah disita diparkir di Mapolres Binjai.

Mayat Mr X Ditemukan Tanpa Pakaian TEBINGTINGGI (Waspada): Mayat Mr X ditemukan dalam keadaan tanpa pakaian di areal Afdeling III, Desa Pabatu Km 10 Jalinsum Tebingtinggi - Pematangsiantar, Kab. Serdang Bedagai, Jumat (24/5) pagi. Saat ditemukan kondisi korban mulai membusuk. Mayat berjenis kelamin pria tersebut pertama kali ditemukan Abdul Khalik dan Poniman, karyawan Kebun PTPN IV Pabatu. Kedua karyawan hendak memanen sawit dan memberitahu warga dilanjutkan ke Polsek Dolok Merawan. Menurut Kapolsek Dolok Merawan, Zulfadli, SH di lokasi, korban diduga berkelainan jiwa karena menurut warga, korban kalau lapar sering minta makan kepada mereka. Mayatnya dievakuasi ke ruang mayat RSU Dr Kumpulan Pane. Ciri-ciri korban berusia berkisar 45 tahun, berbadan kurus, kulit sawo matang, tinggi sekitar 163 cm dan rambut gondrong.(a11)

Pencuri Sepedamotor Dihajar Massa STABAT (Waspada): Pencuri sepedamotor yang beraksi di depan Kantor Catpil Langkat di Stabat, Kamis (23/5) pagi, tertangkap dan dihajar massa. Usai dimassa warga menyerahkannya kepada polisi. Kapolsek Stabat AKP Zulkarnaen mengatakan dari tersangka AZ, 25, warga Kualaimpang, Aceh, disita kunci T. Tersangka naik bus dari Aceh dan turun di depan Kantor Catpil Langkat untuk mencari sasaran. Sebelumnya ada beberapa sepedamotor warga yang hilang di halaman kantor tersebut. Polisi masih mengembangkan kasusnya.(a03)

GMN DS Bantu Sembako Dan Santuni Anak Yatim PERCUT SEITUAN (Waspada): Garda Muda Nasional (GMN), salah satu sayapnya Partai Amanat Nasional (PAN) berusaha memberdayakan masyarakat dengan mendirikan berbagai usaha sehingga dapat hidup lebih makmur. Hal itu dikatakan Ketua Garda Muda Nasional Kab. Deliserdang, Ir. Irawan, Selasa (21/5) malam, saat menyerahkan bantuan sembako kepada keluarga kurang mampu sekaligus menyantuni 80 anak yatim di Sei Rotan Kec. Percut Seituan. Dijelaskan, Garda Muda Nasional wadah aktivitas/kegiatan para pemuda, yang punya visi dan misi menjadikan pemuda dan masyarakat mandiri, berkreasi demi kemajuan bangsa dan negara di bawah panji Partai Amanat Nasional PAN). “Apa yang saya lakukan sesungguhnya tidaklah seberapa nilainya dari rezeki yang saya peroleh selama ini, namun hendaknya dapat disyukuri oleh masyarakat. Di samping itu hal ini juga sudah menjadi salah satu kewajiban bagi kita untuk menyisihkan sebagian rezeki yang kita miliki selama ini, sesuai ajaran agama yang kita anut yakni islam” kata Ir. Irawan.(crul)

Waspada/Khairul K Siregar

KETUA GMN Deliserdang, Ir. Irawan menyerahkan bantuan sembako dan santunan kepada anak yatim di Dusun IX Desa Sei Rotan Kec. Percut Seituan.

Asisten PTPN III Sarang Giting Dipukul Calon Karyawan DOLOKMASIHUL (Waspada): Asisten Afdeling IV PTPN III Sarang Giting, A. Ginting, 32, warga Desa Sarang Giting, Kec. Dolok Masihul dipukul calon karyawan (cakar), RR, 27, warga Desa Kuala Bali, Kec. Serba Jadi di areal karet Afdeling IV, baru-baru ini. Informasi diperoleh, siang itu beberapa cakar yang lulus seleksi menjalani training di areal tanaman karet 1999 Desa Sarang Giting, termasuk RR. Saat temannya sibuk bekerja, RR malah dudukduduk santai. Mandor kerja, Hasyim, 36, menegur RR namun tak diindahkan. Kemudian Hasyim melapor ke Asisten, A. Ginting yang selanjutnya menegur RR untuk meneruskan pekerjaan. Tapi RR malah memukul wajah dan menunjang korban hingga terjatuh, setelah itu kabur. Korban melaporkan peristiwa tersebut ke Mapolsek Dolok Masihul. Kapolsek Dolok Masihul, AKP Darwin Ketaren melalui Kanit Reskrim, Ipda Khairul Saleh, SH membenarkan Asisten Afdeling IV PTPN III Sarang Giting telah melapor dan perkaranya dalam penanganan.(c03)

Menurut informasi, Jumat (24/5), di Polres Binjai, diamankannya mobil tersebut sebagai barang bukti untuk pengusutan

karena mobil tersebut yang digunakan tersangka melakukan pengrusakan baleho yang sedang dipasang oleh lima pemu-

da daerah tersebut, di antaranya Juminir, 27, dan Junaidi, 38, warga Kec. Binjai, Kab. langkat. Kapolres Binjai AKBP Musa Tampubolon, SH, ketika dikonfirmasi melalui telepon s e l u l a r, m e m b e n a r k a n pihaknya telah menyita mobil dinas tersebut sebagai barang bukti untuk pengusutan selanjutnya.(a05)

Bocah Penderita Tumor Mata Hanya Mampu Menangis SEIBAMBAN (Waspada): Abdul Azid, bocah berusia 7 tahun putra bungsu lima bersaudara dari pasangan Wagiman, 45, dan Suniyah, 40, warga Dusun I, Suka Tani Desa Suka Damai, Kec. Sei Bamban, Kab. Serdang Bedagai, menderita penyakit tumor mata. Saat ini Azid hanya merintih menahan sakit dengan kondisi bagian mata kiri yang tanpa bola mata terus membengkak. Begitu juga bagian kepala serta leher hingga ke mulut turut membesar. Mirisnya, pengobatan Azid sejak beberapa bulan terakhir total terhenti akibat ketiadaan biaya, berhubung keseharian Wagiman hanya sebagai buruh di pembuatan batubata. Saat disambangi di kediamannya, kemarin, ibu dan ayahnya menuturkan tumor mata yang diderita berawal saat putra bungsunya berusia 5 tahun. Dia mengeluh sakit pada bagian mata kiri. Berhubung keterbatasan biaya sambung Suniyah, dia hanya mengandalkan berobat jalan, namun semakin hari kondisi mata Azid makin parah hingga akhirnya memutuskan untuk menempuh operasi ke RS Sumatera Eye di Medan. Hasil operasi 12 Juni 2012 itu, kondisi Azid terlihat mem-

baik meski bola matanya terpaksa dikeluarkan dan diganti bola mata palsu. Tapi setelah , tiga bulan, putranya kembali kesakitan dan kondisi matanya pun mulai membengkak. Kedua orangtua Azid pun sempat membawa putranya ke Dr. Safi’i di Tebingtinggi untuk dicuci, tetapi Azid masih merasakan sakit dan terus merintih, hingga akhirnya

kembali dibawa ke RS Sumatera Eye di JL. Iskandar Muda, Medan. Namun dokter mengatakan mata Azid harus dikemo. Sementara A zid yang berada dalam dekapan ibunya terdengar terus merintih, bahkan untuk berbicara pun seperti tidak mampu. Saat ini pihak keluarga Azid hanya berharap uluran tangan para dermawan.(c03)

Waspada/Edi Saputra

PENDERITA tumor mata, Azid lemah di gendongan ibunya, Suniyah.

Mobil Dinas Plat Hitam ‘Menjamur’ Di DS DELISERDANG (Waspada): Mobil dinas menggunakan plat hitam di areal Pemerintah Kabupaten Deliserdang (Pemkab DS) kian menjamur, khususnya di jajaran Camat se Deliserdang. Mobil dinas yang kerap menggunakan plat hitam di antaranya mobil dinas Camat Delitua yang sering terlihat parkir di halaman kantor kecamatan, mobil dinas Camat Patumbak, Camat STM Hilir dan Camat Biru-biru yang kerap melintas di Jl Pertahanan, Patumbak. Menurut Ketua DPP Lembaga Pengawasan Tindak Korupsi dan Peduli Lingkungan (LKPi) Wagino, SH didampingi Kabid Humas Edy M. Padang, Pemkab Deliserdang terkesan membiarkan mobil dinas di lingkungan Pemkab terus menjamur, sehingga mengindikasi mobil dinas tersebut digunakan bukan untuk kepentingan dinas melainkan pribadi. Dikatakan, sebagai perbandingan, para Kepala Dinas bahkan Asisten I Pemkab Deliser-

dang tetap menggunakan plat merah di mobil dinasnya. “Kenapa para Camat ini terus memakai plat hitam pada mobil dinasnya. Berarti ada indikasi pemakaian mobil dinas untuk kepentingan pribadi,” katanya. Ditegaskan, Pemkab harus memberi sanksi kepada para pejabat atau pegawai di lingkungan Pemkab Deliserdang yang

selalu memakai plat hitam pada mobil dinasnya, khususnya para Camat yang kurang mendapat pengawasan dari Pemkab. Kadis Infokom Neken Ketaren yang dikonfirmasi Jumat (24/5), menyebut pihaknya akan melakukan pengecekan terlebih dulu, dan jika benar maka akan dilakukan penertiban.(c02/a06)

Waspada/Andi Nasution

SALAH satu mobil dinas di jajaran Pemkab Deliserdang yang menggunakan plat hitam.

Wabup DS Apresiasi Kebijakan Wabup Labuhanbatu LUBUKPAKAM ( Waspada): Wabup Deliserdang H. Zainuddin Mars mengapresiasi kebijakan Wabup Labuhanbatu Suhari Pane, S.IP memilih Kab. Deliserdang menjadi objek kunjungan belajar program USAID Prioritas. Karena di samping sebagai wadah untuk saling bersilaturahmi, kunjungan juga dapat dijadikan sebagai forum saling tukar informasi dan pengalaman dalam upaya membangun dan mengembangkan pendidikan di dua daerah. Wabup Deliserdang H. Zainuddin Mars mengemukakan hal itu saat menerima rombongan kunjungan belajar program USAID Prioritas Kab. Labuhanbatu di Balairung Pemkab Deliserdang di Lubukpakam, Kamis (23/5). Juga dihadiri Provintial Koordinator USAID Prioritas Drs Agus Marwan, Kadis Pendidikan Pemuda dan Olahraga Hj. Sa’adah Lubis, S.Pd, MAP, Sekretaris Disdikpora Deliserdang Drs H. Jaswar, M.Pd beserta jajarannya, Ka. Kemenag Deliserdang Drs H. Dur Brutu, MA dan sejumlah pejabat Pemkab Deliserdang ditandai dengan saling tukar cendramata. Wabup H. Zainuddin Mars menjelaskan

Kab. Deliserdang menempatkan sektor pendidikan, kesehatan dan infrastruktur sebagai prioritas pembangunan daerah dan menjadi bahagian penting tanpa mengabaikan sektor lainnya. Karenanya Pemkab Deliserdang terus berupaya melakukan percepatan pembangunan, khusus di sektor pendidikan yang dilakukan melalui pola konsep “Cerdas” (Percepatan Rehabilitasi dan Apresiasi terhadap Sekolah) dengan mengandalkan tiga pilar kekuatan yaitu kemam-puan pemerintah yang terbatas didukung pihak swasta dan partisipasi masyarakat melakukan perbaikan gedung SD yang mengalami kerusakan. Wabup Labuhanbatu Suhari Pane SIP menyatakan rasa kagum dengan perkembangan pendidikan di daerah ini setelah meninjau langsung ke beberapa sekolah tingkat SD, SMP/ MTS. Termasuk tampilan karakter anak-anak didik yang sangat membanggakan. Demikian juga pola percepatan pembangunan daerah khususnya disektor pendidikan dapat menjadi bahan referensi bagi mereka guna peningkatan mutu pendidikan di Kabupaten Labuhanbatu, kata Sahari Pane, SIP.(a06)

Wabup Sergai: Suarakan Empat Pilar Kebangsaan SEIRAMPAH (Waspada): Wakil Bupati (Wabup) Serdang Bedagai (Sergai) Ir H Soekirman berharap, dengan pemahaman yang benar dalam mengembangkan empat pilar kebangsaan, dapat mewujudkan visi dan citacita bersama mewujudkan Kab. Sergai sebagai kabupaten terbaik dengan masyarakat Pancasilais, religius, modern, kompetetif dan berwawasan lingkungan. ‘’Karena itu, peran seluruh elemen masyarakat sangat penting untuk selalu menyuarakan empat pilar kehidupan berbangsa dan bernegara tersebut kepada seluruh lapisan masyarakat luas, di tengah kondisi masyarakat yang majemuk dan memiliki banyak perbedaan,’’ jelas Wakil Bupati Serdang Bedagai Ir H Soekirman. Pernyataan itu disampaikan Wabup Sergai saat tampil sebagai narasumber pada acara Sosialisasi Nilai-nilai Empat Pilar Kebangsaan diselenggarakan Pemerintah Kabupaten Serdang Bedagai (Pemkab Sergai) dengan Kantor Kesbangpol Linmas Provsu di aula Sultan Serdang kompleks Kantor Bupati Sergai di Sei Rampah, baru-baru ini. Perwujudan empat pilar kehidupan berbangsa dan bernegara yaitu Pancasila, UUD Negara Republik Indonesia, Bhinneka Tunggal Ika dan Negara Kesatuan Republik Indone-

sia (NKRI) menjadi dasar kekuatan bangsa Indonesia harus segera diimplementasikan ke dalam kehidupan nyata. Turut hadir Dandim 0204/DS Letkol Arh Syaeful Mukti Ginanjar SIP, Sekdakab Drs. H. Haris Fadillah M.Si, Kabid Ideologi danWawasan Kebangsaan Kantor KesbangPol Linmas Provsu Darto Muhammad, Kakan Kesbangpol Linmas Sergai Drs. Ramses Tambunan, unsur Pemerintah Kecamatan se-Sergai, tokoh adat dan tokoh masyarakat. Dandim 0204/DS Letkol Arh Syaeful Mukti Ginanjar SIP mengatakan NKRI adalah kedaulatan bangsa Indonesia harus dijaga dan dipertahankan dengan prinsip bela negara bagi setiap warga negara Indonesia, hal ini sesuai dalam amandemen UUD tahun 1945 Pasal 30, yang memuat sebagai warga negara yang baik sudah sepantasnya kita turut serta dalam bela negara dengan mewaspadai dan mengatasi berbagai macam ancaman, tantangan, hambatan dan gangguan (ATHG ) demi kedaulatan NKRI. Maka, dalam mengatasi berbagai konflik sosial yang terjadi dalam masyarakat dan mengancam keutuhan negara Indonesia, perlu adanya kerjasama, kesadaran dan tanggung jawab dari semua pihak untuk menciptakan situasi keamanan dan ketertiban yang damai. (a08)

Salahnama Bermanfaat Multi Fungsi Bagi Nelayan DULU jarang ditemukan masyarakat yang datang ke Pulau Salahnama, namun setelah dijamah Pemkab Batubara dengan manatanya, sejalan pengembangan

obyek wisata di Sumut khususnya di Batubara, pulau yang berjarak sekitar 13 mil dari Pelabuhan Tanjungtiram ini kerap dikunjungi masyarakat. Penataan pulau tidak saja

untuk pengembangan obyek wisata, namun manfaatnya dirasakan masyarakat khususnya nelayan dengan dibangunnya berbagai fasilitas umum sebagai pendukung di areal pulau,

Warga-PT. Aqua Parm Gotongroyong PERBAUNGAN (Waspada): Pihak PT. Aqua Parm di Desa Naga Kisar, Kec. Pantai Cermin, Kab. Serdang Bedagai bekerjasama dengan masyarakat Desa Sei Naga Lawan, Kec. Perbaungan gotongroyong masal membersihkan dan memperbaiki jalan sepanjang 7 km dari Simpang Desa Sei Buluh ke Desa Sei Naga Lawan, baru-baru ini. Selain memperbaiki jalan Sei Buluh ke Naga Lawan, masyarakat membersihkan jalan dari Dusun VI ke Dusun VII Desa Naga Kisar, Kec. Pantai Cermin. Gotongroyong melibatkan 150 orang terdiri dari masyarakat Desa Sei Buluh, Sei Naga Lawan, Lubuk Bayas, Naga Kisar bersama aparatur pemerintahan desa seperti Kades Sei Naga Lawan Jafar Sidik Nasution, anggota DPRD Serdang Bedagai H.Syahlan Siregar, ST dari partai PAN, Nur Alamsyah, SH dari partai PPP, Camat Perbaungan diwakili Sekcam (Parmin), Dinas PU Binamarga.(a08)

Waspada/HM Husni Siregar

WABUP Deliserdang H. Zainuddin Mars (dua kanan) didampinggi Kadis Dikpora Hj. Sa’adah Lubis memberikan Cenderamata kepadaWabup Labuhanbatu Suhari Pane, S.Ip pada kunjungan belajar Program USAID Prioritas Kab. Labuhanbatu di Deliserdang.

Waspada/Iwan Has

SAMPAN tempel nelayan muatan penumpang mendarat ke Pulau Salahnama sekitar 13 mil dari Pelabuhan Tanjungtiram.

berupa pos pembantu sampai sarana kesehatan seperti Pusat Kesehatan Pembantu (Pustu). Selain menyediakan satu kapal motor (KM) cepat guna memudahkan pelayanan terhadap nelayan jika sewaktuwaktu sakit di laut. Penataan yang dilakukan dua tahun terakhir itu sampai sekarang masih terus berjalan. Pertama dilakukan mencari titik air bersih dengan mengebor bebatuan pulau. Ini dilakukan guna memudahkan mendapat air bersih dalam keperluan pembangunan seperti mengaduk semen. Selain airnya juga dialirkan ke sejumlah bangunan untuk keperluan sehari-hari para pekerja maupun petugas di sana. Bahkan pekerjaan mengebor tersebut tidak mudah seperti dilakukan banyak orang memboring air di daratan, karena kondisi pulau berbatuan terjal. “Ini kami rasakan sendiri jika kehabisan stok air bersih di laut, cukup mendarat ke pulau

karena kondisinya baik dan lanyak dikonsumsi,” tukas Uyup dan Ridwan, nelayan jaring yang ber tangkahan di Sungai Batubara Desa Masjid Lama dan Indrayaman Kec. Talawi. Apalagi di sisi pulau telah dibangun dermaga dalam upaya memudahkan masyarakat yang berkunjung maupun nelayan yang mendarat, baik mengambil keperluan air bersih maupun istirahat melepas lelaH selama beraktivitas, mau pun berlindung jika sewaktu-waktu terjadi ribut di laut seperti angin kencang dan gelombang besar. Dulu mereka beristirahat dan berlindung di atas bebatuan kini bisa menumpang pada bangunan pos dan sarana pendukung yang ada setelah dilakukannya penataan terhadap pulau tersebut.” Ini contoh kecil saja dirasakan masyarakat atas pembenahan Pulau Salahnama,” ujarnya. Belum lagi di sisi kesehatan nelayan mudah mendapatkan jika sewaktu-waktu jatuh sakit dengan dibangunnya Pustu.

Selain menyediakan satu kapal motor (KM) cepat memudahkan langkah penanggulangan maupun evakuasi. Bahkan KM cepat yang dilengkapi personel dari Dinas Kesehatan dan satu dokter itu juga melayani masyarakat di pinggir tangkahan sungai Kuala Batubara. “KM cepat sebagai sarana terapung kesehatan ini kerap bertambat maupun melayani kesehatan masyarakat di sini,” kata R Sinaga, pengurus salah satu kelompok nelayan di Batubara yang bermukim di tangkahan Sungai Batubara. ini mengingatkan kita kembali apaYANG dikatakan Bupati Batubara, H. OK Arya Zulkarnain, SH, MM bahwa penataan Pulau Salahnama tidak saja disisi pengembangan parawisata, namun paling utama bermanfaat multi fungsi bagi nelayan. * Iwan Has

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Sosialisasi Bahaya Narkoba INDRAPURA (Waspada): Ratusan pelajar setingkat SMK seKabupaten Batubara secara antusias mengikuti sosialisasi dan penyuluhan bahaya narkoba di Aula Sudjono Giatmo komplek Yayasan Perguruan Budi Dharma, Desa Tanah Merah, Kec. Air Putih, Kab. Batubara, Rabu (23/5) sore. Acara yang diberi judul Seminar Sosialisasi dan Penyuluhan Bahaya Narkoba bagi para pelajar ini, sengaja digelar oleh Pengurus Cabang (PAC) Satuan Pemuda Dan Mahasiswa Pemuda Pancasila (SAPMA PP) Kab. Batubara yang diketuai oleh Istihar Ahmad ST. Menurut Istihar, tingginya angka kasus keterlibatan pelajar terkait penyalahgunaan narkoba di berbagai wilayah termasuk di Sumatera Utara serta kurangnya pemahaman pelajar tentang bahaya narkoba, menjadi tujuan serta motivasi bagi SAPMA PP Batubara untuk menggelar seminar ini. Istihar sendiri berharap setidaknya khusus untuk Kab. Batubara, hal tersebut bisa sedini mungkin di antisipasi. (c05)

Sabtu 25 Mei 2013

Informasi UN SMA Di Asahan Bertahap 1 Siswa Belum Dipastikan KISARAN (Waspada): Hasil Ujian Nasional (UN) di Kab. Asahan, diperkirakan lulus mendekati 100 persen, karena ada satu siswa kelulusannya masih ‘mengambang’, dan belum bisa dipastikan karena masih menunggu. Sedangkan informasi data diterima dengan bertahap. Kadis Pendidikan Ismail, melalui Kasi Pendidikan Menengah Mahmuddin Syah, dikonfirmasi Waspada, Jumat (24/5) sore, saat pengumuman kelulusan, menuturkan, sebelumnya data yang diterima seluruh siswa SMA/Sederajat yang ikut UN 2013 ini lulus semua. Hanya saja, ada 15 siswa di MA Hidayutul Islam, Kec BP.Mandoge (10 siswa), MA Silobonto (1 siswa) SMA Swadaya, Kec. Pulaurakyat (4 siswa) yang masih belum diketahui kepastian, karena data mereka masih menunggu. Data terakhir, 14 siswa itu lulus, jadi

hanya satu siswa yang masih belum jelas. “Satu siswa ini belum tentu tidak lulus, karena data mereka masih menunggu dari Medan. Namunkitaupayakandataitukita dapat, sehingga bisa pastikan kelulusannya,”jelasMahmuddin. Disinggung dengan kekacauan UN SMA beberapa waktu lalu, sehingga berakibat dengan dengan bertahapnya informasi kelulusan, Mahmuddin menepis hal itu, karena tiga sekolah itu tidak semua menggunakan soal yang di fotocopy, dan UN berjalan dengan lancar.

“Saya kira itu tidak ada kaitannya dengan kekacauan kemarin, mungkin ini masalah data, dan hal itu bisa kita maklumi, karena ada puluhan ribu data siswa yang ikut UN,” jelas Mahmuddin. Atas kelulusan yang mendekati 100 persen, Mahmuddin juga mengucapkan terima kasih kepada orang tua, instansi terkait karena UN bisa berjalan dengan baik dan lancar dan Asahan lulus 100 persen. “Hari ini kita akan usahakan satu siswa itu (mengambang-red) didapatkan informasinya,” jelas Mahmuddin. Berdasarkandatayangdihimpun,UNSMA2013,siswadariKab Asahan terdaftar sebanyak 8.990 siswa,namunyangtidakikutujian sebanyak 62 siswa. Sedangkan untuk 2012 lalu Kab. Asahan lulus 99,85 persen, dan hanya 13 siswa gagal. (a15/a31)

T. Balai, Batubara Lulus 100 Persen TANJUNGBALAI (Waspada): Seluruh siswa SMA/SMK di Kota Tanjungbalai yang ikut Ujian Nasional (UN) dinyatakan lulus, atau kelulusannya 100 persen. “Tidak ada satupun siswa SMA/SMK yang tidak lulus. Alhamdulillah, kerja keras kita selama ini membuahkan hasil positif,” kata Kadis Pendidikan Kota Tanjungbalai Drs.H. Hamlet Sinambela,MPd kepada Waspada saat memantau pengumuman UN Jumat (24/5). Dikatakan Hamlet, pengumuman kelulusan diserahkan kepada masing-masing sekolah, dan bisa diumumkan langsung kepada siswa melalui orangtua yang diundang ke sekolah, ataupun diantar ke rumah siswa. “Tingkat kelulusan 100 persen ini membuktikan pendidikan di KotaTanjungbalai semakin berkualitas, dan kita berharap hal ini dapat terus dipertahankan,” kata Hamlet.

Dia menjelaskan, ujian nasional tingkat SMA sederajat tahun ini, diikuti 2.929 siswa yang terdiri dari 2.153 siswa SMA dengan rincian jurusan IPA 379 siswa laki-laki dan 842 siswa perempuan. Sementara jurusan IPS berjumlah 411 siswa lakilaki dan 521 siswa wanita. Selanjutnya siswa SMK yang tersebar di 6 sekolah, berjumlah 776 siswa, terdiri dari 435 lakilaki dan 341 wanita. Di Batubara Sementara, kelulusan siswa/i SMA/SMK di Kab. BatubaradalamUNTA2012/2013juga mencapai angka 100 persen. Pengumuman hasil UN berlangsung, Jumat (24/5) sore di masing masing sekolah. Pantauan Waspada pengumuman melalui amplop tertutup lewat orangtua dan wali murid itu berlangsung aman dan lancar. Di SMK Negeri 1 Airputih jalan SMK Desa Sukaraja pengumuman hasil UN dipimpin

langsung Kepala Sekolah Drs Muswardi. Telah empat kali pelaksanaan UN di SMK ini sejak didirikan tahun 2006, semuanya lulus 100 persen. Sementara itu pelaksanaan pengumuman hasil UN MA Alwashliyah Indrapura ditunda hingga Sabtu (25/5). Kepala MA Alwashliyah Indrapura Suyono SPd menjawab Waspada mengatakan, sampai sekarang pihaknya belum menerima hasil UN untuk madrasahnya dari sub rayon maupun rayon. “Sehingga pengumuman kita tunda menjadi esok,” ujarnya. Kadisdik Batubara ketika dihubungi melalui Kabid Dikmen Ishak Liza SPd MSi membenarkan kelulusan UN SMA/SMK TA 2012/2013 di Batubara mencapai 100 persen. Ishak juga mengatakan, ada nilai UN dari beberapa MA yang belum masuk sehingga hasil UN nya belum diketahui dan belum dapat diumumkan. (a14/c04)

FPI T.Balai Minta Jamaah Ahmadiyah Bubar TANJUNGBALAI (Waspada): Ketua Front Pembela Islam (FPI) Kota Tanjungbalai, Surya Abdi Lubis meminta kepada kelompok Jamaah Ahmadiyah yang ada di Kel. Bungatanjung, segera membubarkan diri. Surya yang akrab disapa Osama menyatakan, ajaran yang dianut pengikut Mirza Ghulam Ahmad adalah sesat dan menyesatkan. Dia mendesak agar jamaah yang saat ini berjumlah belasan kepala keluarga segera kembali ke jalan yang benar. “Kembalilah wahai pengikut ajaran sesat, bersyahadatlah. Pintu taubat masih terbuka lebar,” kata Osama. Osama menuturkan, beberapa bulan terakhir ini mereka

sangat gencar menyebarkan ajaran yang menyimpang dari Islam itu. Sasaran dakwah ajaran asal India ini ialah penduduk yang tinggal di daerah pedalaman seperti Desa Perbangunan, Kec. Seikepayang, dan beberapa desa lainnya di Kec. Airbatu, Kab. Asahan. “Di Tanjungbalai ruang gerik mereka Jamaah Ahmadiyah sedikit terkunci. Sehingga mereka cenderung menyebarkan ajaran sesat ini ke luar daerah seperti Kab. Asahan karena luput dari pantauan. Kepada Pemko Tanjungbalai dan unsur aparat keamanan Osama mendesak agar segera bertindak dan membubarkannya. Jika tidak, keberadaan

jamaah sesat itu akan menimbulkan konflik horizontal dan berbau SARA. Kepala Lingk. IV, Kel. Bungatanjung, Kec. Datukbandar Timur, Kota Tanjungbalai, Raymond Navarro dikonfirmasi Waspada membenarkan ada sekelompok Jamaah Ahmadiyah di sana. Raymond menuturkan, jamaah itu telah ada sejak puluhan tahun lalu dan secara turun temurun diajarkan kepada sanak famili dan keluarganya. “Dulu mereka ini punya tempat ibadah di inti Kota Tanjungbalai tepatnya di Jl. Ahmad Yani. Namun beberapa tahun lalu mereka pindah ke daerah saya,” ungkap Raymond. (a32)

Suku Nias Biasa Hidup Rukun Di Manapun KISARAN (Waspada): Kadisporabudpar Kab Nias Seletan Yamonaha Waruwu, menuturkan bangga dengan suku Nias yang bisa hidup rukun di manapun berada, dan hal itu merupakan kebanggaan. Ha itu diungkapnya, saat kunjungan ke Replika Rumah Adat Nias saat Pergelaran Seni Budaya Daerah (PSBD) Kab Asahan, Rabu (22/5) malam. Dia menuturkan partisipasi masyarakat Nias di Asahan dalam kegiatan ini merupakan kebanggan, karena hal itu mencerminkan mereka bisa hidup bersama dan diterima oleh suku lain yang ada di Asahan. “Suku Nias bisa menjadi bagian etnis di Asahan, hal ini

membuktikan bahwa Suku Nias bisa menyatu dengan suku lain,” jelas Waruwu. Oleh sebab itu, dirinya atas nama Pemkab Nias Selatan sengaja menyempatkan diri untuk esame berkunjung di Asahan untuk melihat secara langsung PSBD dan melihat kehidupan dekat suku Nias di perantauan. “Saya berharap suku Nias yang ada di Asahan bisa menjaga persatuan dan hidup rukun, dan membantu Pemkab Asahan dalam membangun, dan hal itu merupakan kebanggaan bagi Suku Nias,” jelas Waruwu. Sementara Ketua Panitia PSBD Etnis Nias Asahan Asa’aro Zai, S.Kom, didampingi Wakil

Ketua Hazanolo Dawolo, Budiman Hura dan Bendahara Ingatan Gulo, menuturkan sangat berterima kasih kepada atas perhatian Kadisporabudpar Kab Nias Selatan, yang telah meluangkan waktunya untuk melihat kegiatan Etnis Nias di Asahan.“Kami sangat berterima kasih sekali, walaupun kami tanah orang (merantau-red) masih tetap diperhatikan,” jelas Zai. Zai juga mengundang kepada suku Nias yang ada masih di esame halaman, untuk bisa esame ke Asahan untuk melihat pameran ini. “Dengan demikian, ikatan kekeluargaan esame suku Nias bisa terjalin dengan baik, walaupun sudah berbeda tempat,” jelas Zai. (a15)


ISNAINI, salah satu guru madrasah berunjukrasa di Gedung DPRD Asahan, membawa bayinya yang masih berumur empat bulan.

Ibu Guru Bawa Bayi Unjukrasa KISARAN (Waspada): Lima bulan tidak gajian, sedikitnya 500 guru Madrasah di Asahan unjukrasa di gedung DPRD. Sementara salah satu ibu guru rela membawa bayinya berumur empat bulan ikut dalam aksi itu, Kamis (23/5). Gaji guru itu macet dikarenakan dana Bantuan Operasi Sekolah (BOS) tidak dicairkan. “Selama lima bulan kami tidak gajian, akibatnya tidak mampu membeli susu, apalagi membantu suami dalam memenuhi kebutuhan rumah tangga,” tutur salah seorang guru yang berunjukrasa yang membawa bayinya, Isnaini, saat ditemui Waspada. Isnaini bersama suaminya, sama profesi sebagai guru Madrasah, dan guru lainnya tidak mendapatkan gaji. Sehingga, mereka terpaksa mencari usaha sampingan untuk memenuhi

kehidupan keluarga. Menurut Isnaini, biasanya gaji mereka tersendat paling lama tiga bulan, namun saat ini malah macet selama lima bulan, dan hal ini sangat menyedihkan, sehingga para guru madrasah yang tergabung dalam Forum Komunikasi Guru Madrasah Swasta (Fokgmas) Kab. Asahan, mengadakan aksi unjukrasa itu. “Jujur gaji saya hanya Rp300 ribu per bulan, namun sayangnya selama lima bulan kami tidak menerimanya. Kami hanya meminta perhatian pemerintah untuk nasib kami,” harap Isnaini. Komisi D DPRD Asahan menerima perwakilan guru dan berjanji akan menyampaikan aspirasi ke instansi terkait, dan akan berusaha agar tuntutan mereka dapat direalisasikan. Setelah mendengar hal itu, para guru meninggalkan kantor DPRD Asahan dengan tertib. (a15)

Calhaj Labusel Sudah Dapat Lakukan Pelunasan BPIH KOTAPINANG (Waspada): Bagi warga Kab. Labusel yang akan menunaikan ibadah Haji tahun ini, sudah dapat melakukan pembayaran biaya keberangkatan. Pasalnya, masa pelunasan Biaya Penyelenggaraan Ibadah Haji (BPIH) 2013 sudah dimulai pada 22 Mei dan berakhir pada 12 Juni 2013. Hal itu diungkap Kepala Kementerian Agama Kab. Labuhanbatu Azaman Harahap kepada Waspada, Kamis (23/5). Menurutnya, kuota haji Provinsi Sumatera Utara pada musim haji 2013 sebanyak 86.033 orang. Dari jumlah itu kata dia, kuota untuk Kab. Labuhanbatu dan daerah pemekarannya yakni Kab. Labusel dan Kab. Labura sebanyak 922 orang. “Kepada yang akan menunaikan ibadah haji dapat segara melakukan pembaya-

ran dan mendaftarkan diri,” katanya. Dijelaskan, besaran BPIH reguler untuk Embarkasi Bandara Polonia Medan sebesar AS$ 3.263. Pembayaran pelunasan BPIH itu, kata Azaman, dilakukan di Bank Penerima Setoran (BPS) dengan waktu penyetoran untuk Wilayah Barat mulai dari pukul 10.00 hingga 16.00. Bagi calon jamaah yang sudah melunasi BPIH, lanjut dia, dalam waktu selambat-lambatnya tiga hari setelah penyetoran, wajib segera mendaftar ulang ke Kantor Kemenag Kab. Labuhanbatu dengan membawa bukti setor lunas BPIH. “Bagi yang tidak melunasi sampai pada 12 Juni 2013, maka yang bersangkutan masuk ke dalam `waiting list` atau daftar tunggu tahun berikutnya dan kesempatan kuotanya menjadi kuota haji nasional,” katanya. (c18)

Remaja Putri Gantung Diri SEIDADAP, Asahan (Waspada): Diduga putus cinta, seorang remaja putri gantung diri di pintu kamar di rumahnya, Jl. Protokol, Dusun IV, Desa Seialim Hasak, Kec Saidadap, Kab. Asahan, Kamis (23/5). Informasi dihimpun Waspada, korban Andini, 18, ditemukan tewas gantung diri dengan tali nilon di tiang pintu kamarnya. Ditemukan oleh pihak keluarga, sekitar pukul 08.30 dan langsung memanggil orangtua korban selanjutnya melapor ke pihak yang berwajib.

Sementara jasad korban dibawa ke RSUD Kisaran untuk keperluan visum. Kapolres Asahan AKBP Yustan Alpiani, dikonfirmasi Waspada melalui Kapolsek Airbatu AKP W Sidabutar menuturkan, berdasarkan penyidikan awal korban bunuh diri, karena dari tubuhnya tidak ditemukan tanda-tanda kekerasan. “Motif bunuh diri, diduga karena putus cinta. karena dari telepon genggam milik korban berisikan tentang perkelahian dengan pacarnya,” jelas Sidabutar. (a15)

Tigor Siregar Gelar Khitanan Massal RANTAUPRAPAT (Waspada): Dr H Tigor Panusunan Siregar SpPD sekeluarga melaksanakan khitanan massal terhadap 84 anak dari keluarga kurang mampu dari sebelas desa dan dua kelurahan yang ada di Kecamatan Bilah Hilir, Kabupaten Labuhanbatu, Rabu (22/5). Sama seperti tahun sebelumnya, sunat massal tahun ini juga dilaksanakan secara bergilir di seluruh kecamatan yang ada di L.Batu. Dalam sambutannya Tigor mengatakan, berkhitan merupakan kewajiban yang harus dilaksanakan oleh kaum muslim, terutama yang telah mencapai usia akil balig. Namun untuk menjalankan kewajiban tersebut tidak semua

orangtua mampu menyediakan dana bagi anakanaknya berkhitan, dengan kegiatan ini kiranya dapat membantu dan mengurangi beban para orang tua yang ingin menyunatkan anaknya. Selain itu, Tigor yang juga Bupati L.Batu itu mengharapkan kepada anak-anak yang sudah dikhitan ini kelak menjadi anak yang sholeh, rajin belajar, berbakti kepada orang tua serta berguna bagi agama, bangsa dan negara serta rajin mengaji. Hadir pada kesempatan itu Camat Bilah Hilir, para tokoh masyrakat setempat, pemuka agama, para kepala kelurahan se-Kec. Bilah Hilir, para kepala lingkungan dan para orang tua anak yang dikhitan. (a18)

Kemenag Asahan Lakukan Pembinaan KISARAN (Waspada): Kantor Kementerian Agama Kabupaten Asahan menggelar kegiatan pembinaan kerjasama antar instansi pemerintah dan swasta dalam rangka sosialisasi tata cara pelelangan barang milik negara. Kegiatan berlangsung, Selasa (21/5) di Aula Kantor MUI, Kabupaten Asahan. Kakan Kemenag Kab. Asahan Drs.H.Syafi’i, M A k e p a d a Wa s p a d a , K a m i s ( 2 3 / 5 ) menyatakan. tujuan dari kegiatan untuk mewujudkan hasil pelaksanaan urusan di lingkungan Satker Madrasah Negeri, KUA kecamatan dan kantor Kementerian Agama Kab. Asahan secara efektif dan efisien dalam tertib administrasi/pengelolaan inventarisasi

barang milik negara yang akuntabel dan profesionalisme. Ketua panitia Syahrizal, SE, MM menjelaskan dasar pelaksanaan kegiatan ini adalah Peraturan Menteri Keuangan nomor 93 PMK 06/2010 tentang petunjuk pelaksanaan lelang dan PMK nomor 96 tahun 2007. Syahrizal menambahkan saat ini Kemenag telah mendapat opini WTP (Wajar Tanpa Pengecualian) Unqualified Opinion. “Narasumber dalam kegiatan tersebut Kepala Seksi Lelang Farida Ariani, Plt Lelang Kantor KPKNL Kisaran Angger Agung Pramugalih, dan dari Dinas Perhubungan Budi Muhammad Yusuf,” tambah Syahrizal. (a31)

Warga Dukung Pencalonan Azwar Hamid

Pontren Bina Ulama Wisuda 60 Santri KISARAN (Waspada): Pondok Pesantren (Pontren) Bina Ulama Kisaran mewisuda/Haflatut Takhrij 60 santri yakni 31 siswa Madrasah Aliyah dan 29 siswa Madrasah Tsanawiyah. Haflatut Takhrij (wisuda) Angkatan VIII, Kamis (23/5) di Aula Pontren Bina Ulama, Kisaran Asahan. Panitia pelaksana H.Aswiluddin Rambe, S.Pd I menyatakan, acara diisi orasi ilmiah oleh Sekretaris Kopertais Sumatera Utara Prof. Dr. H. Amroini Drajat, MA dengan tema Khairul Ummat (Umat yang terbaik). Ketua Yayasan Bina Ulama Rabi’Atul Adawiyah Siregar, S.Pd I dalam sambutan mengharapkan santri-santri yang telah diwisuda nantinya dapat menjadi orang yang berguna dan berbakti pada orangtua, bangsa dan negara. (a31)



KADISPORABUDPAR Nias Selatan Yamonaha Waruwu (empat dari kiri) didampingi Ketua Panitia PSBD Etnis Nias Asahan Asa’aro Zai, S.Kom, Wakil Ketua Hazanolo Dawolo, Budiman Hura dan Bendahara Ingatan Gulo, foto bersama di depan Replika Rumah Adat Nias saat Pergelaran Seni Budaya Daerah (PSBD) Kab Asahan.

KEDAISIANAM-Batubara (Waspada): Suksesi balon Bupati Batubara terus bergaung, setelah calon independen mendaftar di KPU. Di antara balon, seperti Ir. Azwar Hamid di kediamannya di Kedai Sianam, Kamis (23/ 5) menyatakan, siap menjadi balon Bupati Batubara periode 2013 -2018 melalui jalur partai. Kata dia, dalam perebutan sampan partai mendukung balon terjadi saling sikut harus pandai-pandai, karena yang mendaftar enam sampai tujuh orang per partai. Di kediaman Azwar, mantan Kadis Kelautan dan Perikanan Batubara hari itu terlihat ratusan

warga sebagian besar tokoh nelayan asal Pagurawan, Kuala Tanjung, Perupuk, Guntung, Talawi, Tanjungtiram mendukung pencalonannya sebagai balon Bupati Batubara. “Kami harapkan pak Azwar dapat menjadi balon Bupati Batubara. Nelayan se Batubara siap mendukung memperperjuangkannya karena dinilai mampu merubah nasib nelayan,” ujar Jakfar, nelayan Desa Lalang Medangderas. Azwar menyatakan sedang menjajaki beberapa partai masih dalam proses, jadi atau tidak dapat pasti setelah mendaftar nanti ke KPU Batubara 27 Juni 2013. (a12)

Sumatera Utara

WASPADA Sabtu 25 Mei 2013


Terkait SKPI Bupati Karo Puluhan Kepsek Datangi DPRD DPRD Tak Mau Diintervensi Soal Pansus SKPI Bupati KABANJAHE (Waspada): Puluhan kepala sekolah (Kepsek) tingkat SMP, SMA, dan SMK seKab. Karo tersebar di 17 kecamatan tergabung dalam Musyawarah Kerja Kepala Sekolah (MKKS) mendatangi kantor DPRD Karo, Kamis (23/5). Kepsek melakukan aksi terkait kewenangan Kepsek dalam menerbitkan Surat Keterangan Pengganti Ijazah (SKPI) Bupati Karo, berdasarkan Permindiknas Nomor 59 Tahun 2008 yang dikaitkan dengan tahapan Pemilukada Karo periode 20142019. Amatan Waspada di ruang rapat DPRD Karo, yang dihadiri sebagian para anggota dewan, dan dipimpin langsung ketua DPRD. Di hadapan wakil rakyat di

gedung dewan, salahseorang Kepsek Drs Kenan Ginting, M.Pd menumpahkan kekhawatiran mereka atas penerbitan. Dikatakan, penerbitan SKPI Bupati Karo DR (HC) Kena Ukur Karo Jambi Surbakti telah memenuhi ketentuan, sebagaimana diamanatkan Permendiknas no. 58 tahun 2008 tentang penerbitan SKPI. “Salahsatu isi peraturan Permendiknas Nomor 59 Tahun 2008, apabila ada kehilangan ijazah dan tidak ditemukan bisa

Perempuan Paruh Baya Tersangka Bandar Narkoba SOSA (Waspada): Perempuan paruh baya, DS, 40, warga Desa Hutaraja Lama, Kec. Sosa, Kab Padanglawas (Palas), tertangkap aparat Polsek Sosa bersama barang bukti berupa daun ganja kering 3 Kg dan 14 amp ganja kering siap edar, Rabu (22/5) malam. Kapolsek Sosa AKP Abdi Abdulah SH melalui Kanit Reskrim IPTU Mulyadi mengatakan, DS ditangkap di rumah tersangka di jalan menuju lokasi PT Karya Agung Sawita (KAS) Sosa. Saat itu tersangka akan keluar rumah diduga untuk melakukan transaksi barang haram tersebut. Penangkapan dilakukan setelah pihak Polsek Sosa melakukan pengintaian dan berhasil melakukan penangkapan bersama barang bukti pada pukul 21:30. Tersangka merupakan target kepolisian sejak enam bulan lalu, namun dalam melakukan aksinya, ibu rumah tangga tersebut sangat‘licin’ sehingga sulit untuk diamankan. “Tersangka sudah diamankan di Polsek Sosa dan untuk selanjutnya kita akan melakukan pengembangan, “ ujar Mulyadi. Tersangka akan dijerat dengan UU RI Nomor 35 tahun 2009 Pasal 114 KUHP tentang narkotika dengan ancaman hukuman 15 tahun penjara. (a34)

7 Warga P. Sidimpuan Ditangkap Bermain Judi P. SIDIMPUAN ( Waspada): Praktik perjudian di Kota Padangsidimpuan berhasil diungkap petugas Polres setempat. Tujuh pelaku ditangkap, satu di antaranya memiliki narkoba. Kapolres Kota Padangsidimpuan AKBP Budi Hariyanto Sik Msi diwakili Kaurbin Ops IPTU CJ Panjaitan SH, mengatakan, ketujuh pelaku perjudian itu ditangkap di berbagai tempat, yang diduga telah menjadi tempat judi sejak lama. “Para pelaku ini termasuk licin dan sudah kami incar. Begitu dapat laporan dari masyarakat, kami segera melakukan penggerebekan,” katanya, Jumat (24/5). Ketika dilakukan penggerebekan, petugas memergoki tujuh tersangka sedang bermain judi kim dan togel, yakni ES, 32, IH, 39, SH, 42, JS, 52, AMM, 52, JH, 36, dan DAZ, 40. Semuanya warga Kota Padangsidimpuan. Panjaitan menambahkan, pihaknya juga menyita barang bukti berupa uang tunai, alat komunikasi (HP), sedangkan dari tangan DS ditemukan narkoba jenis ganja 3,38 gram. (c13)

MAN Sidikalang Lulus UN 100 Pesen

menghadirkan tiga teman sekolah. Polemik SKPI Bapak Kena Ukur Surbakti harus segera dihentikan. Hentikan rencana pembentukan pansus itu,” ungkap Kenan Ginting. . Para Kepsek diterima Ketua DPRD Karo Effendy Sinukaban, di dampingi sejumlah anggota dewan Sentosa Sinulingga, Siti Aminah br Perangin-angin, Masdin DT Ginting, Marthin Luther Sinulingga, Frans Dante Ginting, Pengamat Sembiring. Anggota DPRD Karo Sentosa Sinulingga dan Frans Dante Ginting mengatakan, para kepala sekolah tidak perlu khawatir dalam menerbitkan SKPI apabila sesuai prosedur perundang-undangan. “Kepala sekolah yang dating, apakah kalian datang dengan murni atau ditunggangi oleh pihak lain,” ungkap Sinulingga kepada para kepala sekolah. Menurut Sinulingga dari Partai Gerinda, bicara soal Permendiknas Nomor 59 Tahun 2008 dalam penerbitan SKPI jangan sepotong-potong. Apabila ijazah hilang, si pemohon

membuat laporan ke polisi, mempunyai data nilai, nomor induk, nomor ujian. Kalau tidak ada atau tidak lengkap kesemunya itu, lanjut dia, pihak kepala sekolah tidak bisa menerbitkan SKPI. “Menyinggung soal keabsahan SKPI, Polres Karo telah menetapkan dua tersangka, yang menerbitkan SKPI atas nama Kena Ukur Surbakti, yaitu Teringat Aku Ginting (mantan Kepsek SD No 040487 Tiganderket) dan Amiruddin SP (mantan Kepsek SMK Negeri 2 Medan) sejak Februari 2013. Polisi bukan asal-asalan menetapkan kedua tersangka, tapi berdasarkan pemeriksaan saksi seperti ahli pendidikan, dan data-data lain yang akurat,” terangnya. Meski demikian, lanjut dia, DPRD Karo bukan mengurusi soal penyidikan kepolisian. “Kami tetap bekerja sesuai tugas dan wewenang kami. Jadi, kami jangan diintervensi untuk menghentikan pembentukan Pansus SKPI Bupati. Berita Acara Kepolisian (BAP) oknum mantan Kepala Sekolah SMK Negeri

Warga Laporkan Pemalsuan Dukungan Balon Perseorangan Ke Panwaslu Palas SIBUHUAN (Waspada): Sejumlah warga mendatangi kantor sekretariat Panwaslu Kab. Padanglawas terkait pemalsuan dukungan bakal calon (balon) pasangan perseorangan yang akan ikut bertarung dalam Pemilukada Kab. Padanglawas (Palas), September 2013. Seperti warga Desa Tanjung Rokan, Kec. Aeknabara Barumun, Jumat (24/5). Mereka menyampaikan, berkas dukungan balon pasangan perseorangan tertentu ada mencantumkan nama mereka yang ikut memberi pernyataan dukungan, padahal itu samasekali tidak sepengetahuan mereka. Di antaranya termasuk Ahmad Raja Simamora, Mukhlis Tanjung, Ramli Tanjung, dan

Kaharuddin Tanjung yang dinyatakan ikut memberi pernyataan dukungan terhadap balon pasangan perseorangan tertentu, tetapi menurut mereka tanpa sepengetahuan mereka. Hal itu bisa dibuktikan dengan kekeliruan pada berkas pernyataan dukungan, di antaranya nomor seri yang terdapat pada fotokopi KTP yang ada dalam lampiran pernyataan dukungan tidak sama dengan KTP asli yang dipegang pemilik. Begitu juga dengan tanda tangandantanggalpenerbitanserta masa berlaku, juga berbeda. Melihat pemalsuan data berkas dukungan balon perseorangan itu perlu penelusuran, karena disinyalir ada keterli-

batan oknum tertentu selaku pemegang data kependudukan. Abdul Rahman Daulay, SE anggota Panwaslu Kab. Palas ketika dihubungi membenarkan adanya laporan warga Desa Tanjug Rokan terkait pemalsuan pernyataan dukungan balon pasangan perseorangan.Warga dinyatakan memberi pernyataan dukungan, padahal mereka samasekali tidak pernah memberi pernyataan dukungan. “Hampir di semua kecamatan di Kabupaten Padanglawas ditemukan hal serupa, dan mereka telah membuat pernyataan tidak benar memberi dukungan terhadap balon pasangan perseorangan tertentu,” katanya. (a33)

Ditangkap Saat Pesta Sabu GUNUNGTUA (Waspada): Lima orang diciduk dari rumah kontrakan di Jalan KH Dewantara, Desa Saba Bangunan, Kec. Padangbolak, Jumat (24/ 5) sekira pukul 09.00 pagi. Diduga, rumah itu dijadikan tempat pesta narkotika jenis sabu. Dari penggerebekan itu,

polisi berhasil mengamankan lima tersangka beserta barang bukti sabu. “Berawal dari laporan masyarakat adanya rumah kontrakan yang sedang digunakan untuk pesta narkoba. Saya bersama anggota langsung melakukan eksekusi,” ujar Kapolsek

SIDIKALANG (Waspada): Pengumuman hasil ujian nasional (UN) tahun 2013 di Madrasah Aliyah Negeri (MAN) Sidikalang dari 127 siswa yang mengikuti ujian nasional (UN), seluruhnya dinyatakan lulus, Jumat, (24/5). Kepala MAN Sidikalang Abdul Karim Siregar mengatakan, pihak sekolah sudah berupaya semaksimal mungkin melakukan serangkaian persiapan, sehingga kelulusan di MAN Sidikalang sesuai ditargetkan sekolah. Namun Kepsek menyebutkan, pihak sekolah tetap mengharapkan agar silaturahmi dan kerjasamanya untuk memajukan MAN Sidikalang. Selain itu, disebutkan, pihak MAN tetap siap menerima kritikan dan saran masyarakat demi kemajuan MAN yang merupakan satu-satunya sekolah Agama Islam Negeri di Sidikalang. (ckm)

Perwira Tes Kesamaptaan PEMATANGSIANTAR (Waspada): 95 Perwira pertama (Pama) jajaran Korem 022/PT melaksanakan tes kesamaptaan jasmani periodik I TA 2013 di lapangan sepakbola dan kolam renang taman rekreasi serta olahraga, Makorem 022/PT, Jalan Asahan, Pematangsiantar, Selasa (21/5). Kasiopsrem 022/PT Letkol Inf EH. Limbong selaku pimpinan asistensi pelaksanaan tes kesemaptaan menjelaskan, tes kesamaptaan bertujuan memantau sejauhmana kemampuan fisik prajurit dalam melaksanakan tugas sehari-hari dan hal itu penting, sebab setiap prajurit dituntut senantiasa dalam keadaan siap operasi di manapun dan kapanpun. Tes kesamaptaan jasmani meliputi Samapta A berupa lari dengan jarak 3.200 meter, dilanjutkan Samapta B terdiri dari pull up, sit up, push up dan shuttle run serta renang dasar militer gaya dada 50 meter. Kapenrem 022/PT Mayor Caj Drs. Prinaldi menambahkan, sebelum pelaksanaan tes samapta, lebih dulu dilaksanakan pengecekan terhadap tensi tekanan darah dari tim medis Rumkit Tingkat IV dan dilanjutkan pemanasan dipimpin anggota Jasrem 022/PT. (a30)

2 Medan Amiruddin SP yang telah ditetapkan sebagai tersangka, telah tiga kali menerbitkan surat atas nama Kena Ukur Surbakti terhitung 21 Juli 2010 hingga 30 Agustus 2010,” ujarnya. Hal senada disampaikan anggota DPRD Karo Siti Aminah br Perangin-angin SE. Sesuai BAP dari saksi ahli pendidikan mantan Kadis Diknas Drs Kasman Sembiring, dan Plt Kadis Diksnas Sastra Tarigan menyatakan, penerbitan SKPI tidak memenuhi prosedur sesuai ketentuan berlaku. “Saya juga sebagai pengusung pansus SKPI tetap konsen memperjuangkannya, agar terang benderang SKPI Bupati Karo apakah telah sesuai prosedur atau tidak, bukan ada maksud lain,”terangnya. Ketua DPRD Karo Effendi Sinukaban SE menyampaikan terimakasih atas keprihatinan para kepala sekolah. “Kami akan mempelajari masukan dan aspirasi para Kepsek, untuk dibicarakan sesuai aturan tata tertib dewan,” katanya. (c19/c10)

Waspada/Sori Parlah Harahap

PETUGAS memperlihatkan barang bukti jenis sabu 2 gram, alat isap (bong), satu batang rokok berisi ganja, 4 mancis dan uang Rp850 ribu hasil penggerebekan saat pesta sabu.

Padangbolak AKP JW Sijabat didampingi Kanit Iptu Sugiri kepada Waspada di Mapolsek Padangbolak. Dikatakan, dari tangan kelima tersangka, pihaknya mengamankan narkoba jenis sabu 2 gram, alat isap (bong), satu batang rokok berisi ganja, 4 mancis dan uang senilai Rp850 ribu. Kelima orang yang diamankan itu satu orang diduga bandar berinisial SMR, 45, warga Gunungtua Tonga, IHS, 23, warga Gunungtua Tonga bagian penjualan, HSS, 27, warga Limo Manis, TGT, 37, warga Simpang Portibi dan AN, 45, warga Batang Baruhar, Kec. Padangbolak. Atas perbuatannya, para tersangka dijerat UU No 35 tahun 2009 Pasal 112 Ayat 1 juncto 27 Ayat 1 dengan ancaman hukuman lima tahun penjara. Untuk pendalaman tentang penjual sabu tersebut masih dalam proses penyidikan Polsek Padangbolak. Kapolsek mengungkapkan, bandar narkoba jenis sabu ini sudah lama menjadi target operasi. (a35)

Parkir Tak Tertib, Jalan Sutomo Macat P E M ATA N G S I A N TA R (Waspada): Salahsatu penyebab kemacatan pada alur lalulintas di kawasan Pasar Horas Jalan Sutomo Pematangsiantar adalah akibat pengaturan parkir kendaraan baik sepedamotor maupun mobil, tidak tertib. “Terjadinya kemacetan karena parkir kendaraan di Jalan Sutomo ini tidak benar,” kata

Abdi Pohan,45, pengusaha toko kelontong di Jalan Sutomo Pematangsiantar kepada Waspada ketika ditanya komentarnya soal kemacatan yang terjadi di kawasan itu, Jumat (24/5). Petugas parkir hanya berpikir bagaimana agar bisa sebanyak-banyaknya mendapatkan uang parkir.Akibatnya, dimana saja ada tempat yang bisa

dijadikan lokasi parkir, maka kendaraan diarahkan ke sana. Pantauan Waspada di lapangan, selain soal parkir, ketidakseragaman konsep kerja petugas yang ada di daerah langganan macat tersebut juga ikut melengkapi. Mereka (petugas) tidak perduli walau areal parkir sampai memakan setengah badan jalan. (crap)

FKIP UMTS Sosialisasi Kurikulum 2013 P. SIDIMPUAN (Waspada): Fakultas Keguruan Ilmu Pendidikan (FKIP) Universitas Muhammadiyah Tapanuli Selatan (UMTS) sosialisasikan kurikulum 2013 di aula UMTS, baru-baru ini. Diharapkan, kurikulum baru dapat mendongkrak mutu pendidikan. Sosialisasi dihadiri lebih 1.000 guru SD di Tapanuli Selatan (Tapsel) dengan antusias, SMP sederajat dan SMA sederajat juga dari Kota Padangsidimpuan dan Tapsel, serta Kemenag Kota P.Sidimpuan. Narasumber guru besar Universitas Muhammadiyah Profesor Hamka (UHAMKA) Jakarta Prof Dr Suyatno MPd, dihadiri Kemenag Kota P.Sidimpuan diwakili Iswadi MPd, mewakili Disdik Tapsel Monalisa Cahaya, Dikdasmen PD Muhammadiyah H Muhammad Aris Lubis, MPd. Prof Suyatno menyampaikan, saat ini persepsi di tengah masyarakat tentang pendidikan di Indonesia carut-marut. Dimana kurikulum terlalu menitikberatkan pada aspek kognitif, beban siswa terlalu berat, serta kurikulum kurang bermuatan karakter. Dekan Fakultas Keguruan dan Ilmu Pendidikan Universitas Muhammadiyah Tapanuli Selatan (FKIP-UMTS), Drs H Putoro Dongoran MH didampingi Ketua Program Studi Bimbingan Konseling (BK), Khairul Amri SPd menyambut baik sosialisasi itu. Para guru yang hadir diharap bisa mengaplikasikan kurikulum 2013 kepada para siswa. (c13)

Waspada/Ahmad Cerem Meha

WALI kota Padangsidimpuan Andar Amin Harahap, SSTP,MSi beserta rombongan saat meninjau SMAN 2 Jalan Sudirman Padangsidimpuan.

99,85 Persen Lulus UN Di P. Sidimpuan 63 Siswa Tak Lulus Di Paluta P. SIDIMPUAN (Waspada): Apresiasi dan reward pantas disampaikan kepada kepala sekolah dan guru yang telah bekerja ekstra-keras sehingga peserta ujian nasional (UN) SMA, SMK dan MA di Padangsidimpuan luluh hampir 100 persen. “Kita bersyukur melihat hasil yang diperoleh anak didik kita. Tingkat kelulusan mereka tahun 2013 hampir mencapai 100 persen atau tepatnya 99,85 persen,” ujar Ketua DPRD Padangsidimpuan H.Aswar Syamsi Lubis, SE, MM, Jumat (24/5). Prestasi yang membanggakan diperoleh ini, lanjut politisi Demokrat ini, tidak terlepas pula dari upaya DPRD dan Pemerintah Kota Padangsidimpuan yang mengalokasikan anggaran pendidikan 20 persen dari APBD sesuai arahan pemerintah pusat. “Dengan demikian visi dan misi wali kota menjadikan daerah ini sebagai kota yang sehat, maju dan sejahtera (SMS) menjadi kenyataan, dimana salahsatunya kemajuan pendidikkan yang dibuktikan dengan tingginya angka kelulusan siswa SMA, SMK dan MA,” kata Syamsi. 63 Tak Lulus Sedangkan persentase kelulusan ujian nasional (UN) SMA/MA dan SMK 2013 di Kab. Padanglawas Utara (Paluta) mencapai 97,63 persen. Demikian Kepala Dinas Pendidikan, Drs Hazairin Hasibuan mengungkapkan kepada Waspada di Gunungtua, Jumat (24/5).

Dia merinci, 2.661 siswa SMA, SMK dan MA yang melaksanakan UN tahun ini, 63 di antaranya dinyatakan tidak lulus. Siswa SMA yang melaksanakan UN 950 siswa, tidak lulus 55 siswa. SMK 681 siswa lulus 100 persen dan MA 1.030 siswa, yang tidak lulus delapan siswa. Angka ketidaklulusan siswa SMA, SMK dan MA di Paluta 2,37 persen. Pengumuman UN di Kab. Paluta dilakukan dengan cara orangtua siswa mengambil surat pemberitahuan kelulusan, yang antara lain dimaksudkan untuk mempererat silaturahim dengan orangtua siswa, setelah anaknya dididik tiga tahun di sekolah tersebut. “Alangkah baiknya, bila orangtua siswa berjumpa dengan kepala sekolah, guru dan dewan guru,” kata Ali Usman Siregar, Spd, Kepala SMAN 1 Padangbolak sembari mengungkapkan, pengumuman kelulusan di sekolahnya berjalan dengan tertib dan tidak ada kendala. H.Ishak Harahap, Sekretaris Komisi III DPRD Paluta, yang membidangi pendidikan mengungkapkan, untuk siswa/i yang sudah lulus dan akan melanjutkan pendidikannya ke jenjang lebih tinggi, diharapkan agar bersiap-siap untuk mengikuti seleksi penerimaan mahasiswa baru. Kepala Polisi Sektor Padangbolak AKP JW. Sijabat, mengatakan, pelaksanaan pengumuman UN di wilayah hukumnya, berjalan aman dan tertib. (c13/a35)

98,87 Persen Lulus UN SMA/MA, SMK P. Siantar PEMATANGSIANTAR (Waspada): Siswa SMA/MA dan SMK yang mengikuti Ujian Nasional (UN) di Kota Pematangsiantar barubaru ini dinyatakan 98,87 persen lulus dan 1,13 persen dinyatakan tidak lulus atau tidak memenuhi ketentuan ditetapkan. “Siswa SMA/MA dan SMK negeri dan swasta yang mengikuti UN di Pematangsiantar dinyatakan lulus 98,87 persen atau hanya 1,13 persen yang tidak lulus atau tidak memenuhi ketentuan yang sudah ditetapkan,” sebut Kadis Pendidikan Drs. Resman Panjaitan di ruang kerjanya, Jumat (24/5). Saat pelaksanaan UN di Pematangsiantar 15-17 April, sebanyak 9.395 siswa dari 78 SMA/ MA dan SMK negeri dan swasta yang terdaftar sebagai peserta UN TA 2012/2013 terdiri 5.562 siswa SMA/MA negeri dan swasta dari 44 sekolah dan 3.633 SMK negeri dan swasta dari 34 sekolah.

Menurut Panjaitan, tingkat kelulusan itu sudah memenuhi target kelulusan yang diharapkan, karena target kelulusan yang diharapkan dalam TA 2012/2013 di atas pencapaian target TA 2011/2012 yakni 98 persen tingkat kelulusan. Panjaitan menambahkan dari Dinas Pendidikan sudah diutus ke Pemprovsu di Medan menjemput hasil UN dan dibawa ke Pematangsiantar untuk diumumkan di masingmasing sekolah. Menurut Panjaitan, hasil UN agak terlambat sampai ke Pematangsiantar, karena ada kesalahan teknis, dimana nilai siswa peserta dari satu sekolah ada yang tidak masuk akibat adanya kesalahan teknis itu. “Tapi, masalah itu sesuai informasi kami dapat, sudah diatasi.” Panjaitan menyebutkan peserta yang tidak lulus hanya 15 orang berasal dari lima sekolah. (a30)

172 Pejabat P. Siantar Dimutasi Dan Dilantik PEMATANGSIANTAR (Waspada): 172 Pejabat terdiri 18 eselon II seperti staf ahli, asisten, inspektur, kepala badan dan kepala dinas, 34 eselon III terdiri kepala kantor, bagian, camat, sekretaris dan kepala bidang serta 120 eselon IV terdiri lurah, kepala UPTD, seksi, sub bagian dan sub bidang dimutasi dan dilantik di Kota Pematangsiantar. “Jabatan yang dipercayakan kepada seorang PNS, merupakan amanah yang harus diemban dan harus disadari, amanah itu sewaktu-waktu dapat ditarik dan digantikan,” tegas Wali Kota Hulman Sitorus, SE melalui Sekda Drs. Donver Panggabean, M.Si sekaligus mengambil sumpah dan janji jabatan serta melantik 172 pejabat itu di ruang data Balai Kota Pemko, baru-baru ini. “Karena itu, seorang pejabat harus mampu melaksanakan tugas dengan baik, jujur dan bertanggungjawab sesuai tugas pokok dan fungsi masing-masing,” ujarnya. Pejabat eselon II yang dimutasi dan dilantik di antaranya Drs. Esron Sinaga, M.Si sebelumnya Kadis Dukcapil menjadi Kepala BPPT, Drs. Kalbiner Lumbantungkup, M.Si sebelumnya Kabag Administrasi Keuangan dan Asset menjadi Pj. Kadis KUMKM, Sertamalem Ulinasari Girsang, SH sebelumnya Kadis Pasar menjadi Kadis Dukcapil, Robert D Simatupang,

SE sebelumnya Kadis KUMKM menjadi Inspektur, Drs. Pardamean Silaen, M.Si sebelumnya Inspektur menjadi Kepala BKPP, Posma Sitorus, SH sebelumnya Camat Siantar Timur menjadi Pj. Kepala BPPS, Drs. Muhammad Akhir Harahap sebelumnya Kepala BPPS menjadi Asisten Administrasi Perekonomian dan Pembangunan. Leonardo H Simanjuntak, SH, M.Hum sebelumnya Asisten Administrasi Umum menjadi Asisten Administrasi Pemerintahan dan Kesejahteraan Rakyat, Ir. Adiaksa Dian Sasman Purba, MM sebelumnya Staf Ahli Bidang Pemerintahan menjadi Asisten Administrasi Umum, Drs. Eddy Nuah Saragih sebelumnya Kepala BPM menjadi Staf Ahli Bidang Pembangunan, Baren Alijoyo Purba, SH sebelumnya Wakil Direktur III RSUD menjadi Kadis Sosnaker, Drs. Resman Panjaitan sebelumnya Kadis Sosnaker menjadi Kadis Pendidikan, Drs. Setia Siagian sebelumnya Kadis Pendidikan menjadi Kadis Pasar, Agus Salam, SE sebelumnya Kadis Perindag menjadi Kepala BPMPD, Zainal Siahaan, SE sebelumnya Kepala BPMPD menjadi Kadis Perindag, Jhon Pieter Sitorus, S.Sos, M.Si sebelumnya Kepala BKPP menjadi Pj. Kepala BPM dan Drs. Robert Samosir sebelumnya Kakan Pemadaman Kebakaran menjadi Kadis Kebersihan. (a30)

Golkar Usung Bachrum-Riskon

Waspada/ Rap.Negara Siregar

POLISI terlihat sibuk mengatur alur lalulintas di Jalan Sutomo Pematangsiantar, akibat pengaturan parkir kenderaan mobil dan sepedamotor yang tidak beraturan, menjadi penyebab kemacatan setiap hari di kawasan ini.

GUNUNGTUA (Waspada): DPD Partai Gokar Kabupaten Paluta resmi menyatakan dukungan untuk pasangan incumbent Drs H Bachrum Harahap-H Riskon Hasibuan sebagai calon bupati dan wakil bupati di Pilkada Paluta 14 Agustus 2013. Dukungan disampaikan melalui surat rekomendasi DPP Partai Golkar diterima Drs H Bachrum Harahap yang diserahkan Plt Ketua DPD Golkar Paluta Ir Doli Sinomba Siregar disaksikan Sekretaris Dewan Pimpinan Daerah (DPD) Partai Golkar Sumut HM Hanafiah Harahap SE, Wakil Ketua Partai Golkar Sumut H Syahrul M Pasaribu dan pengurus lainnya di sela acara silaturahmi dan konsolidasi sekaligus penyerahan rekomendasi dukungan

calon Bupati Partai Golkar Paluta di Aula Hotel Mitra Gunungtua, Senin (20/5) kemarin. Ketua DPD Golkar Sumut diwakili Sekretaris DPD Partai Golkar Sumut HM Hanafiah Harahap SE menyatakan, dukungan yang diberikan pada pasangan incumbent tersebut bukannya tanpa alasan. Dukungan tersebut diberikan berdasarkan hasil survei menunjukkan pasangan tersebut merupakan calon bupati dan wakil bupati yang dipilih oleh rakyat. Calon Bupati Paluta Drs H Bachrum Harahap menyampaikan terimakasih atas dukungan yang diberikan Partai Golkar. Dia mengajak semua pihak mengikuti Pilkada sebagaimana mestinya tanpa harus menjelekkan satu sama lain. (a35)



WASPADA Sabtu 25 Mei 2013

Konflik Siswa Berakhir BIREUEN (Waspada) : Tawuran antara siswa SMKN-1 dengan SMAN-2 Bireuen yang terjadi beberapa hari lalu sudah diselesaikan secara damai dalam pertemuan silaturahmi siswa kedua sekolah di aulda Setdakab Bireuen, Kamis (23/5). Sekretaris P dan K Bireuen M Nasir menekankan, tawuran yang sudah terjadi antara siswa SMKN-1 dengan SMAN-2 Bireuen sebenarnya tidak perlu terjadi dan jangan sampai terulang lagi. Semenara Kasat Bimas Polres Bireuen mengatakan, kasus tawuran yang telah terjadi tidak diselesaikan polisi, akan tetapi diselesaikan secara damai agar kedua kelompok siswa yang berseteru diselesaikan secara adat Aceh agar semua dendam kesumat yang telah terjadi menjadi sirna. Kakan Kemenag Bireuen Zulhelmi A Rahman menekankan tentang pentingnya pembinaan akhkak bagi siswa harus selalu berakhlakul karimah menjadi contoh yang baik bagi masyarakat. (b12)

Di Bireuen, SMA Lulus 99 Persen, SMK 100 Persen BIREUEN (Waspada) : Hasil Ujian Nasional SMA, MA di Kabupaten Bireuen tahun 2013 lulus 99 persen dan SMK lulus 100 persen. Demikian dikatakan Kadis P dan K Bireuen Nasrul Yuliansyah menjelaskan hal itu, Jumat (24/5). Dikatakan, sebelum pengumuman hasil UN pihaknya dengan bekerjasama para Kasek sudah berupaya mencegah aksi coret-coret pakaian seragam sekolah, meminta seluruh siswa yang sudah menamatkan sekolahnya di SMA, MA dan SMK menyerahkan pakaian seragam kepada sekolahnya masing-masing untuk disumbangkan kepada para siswa keluarga miskin yang masih bersekolah. (b12)

MENANGIS: Seorang siswa SMA Negeri-1 Lhoksukon, Aceh Utara berusaha menenangkan rekannya yang menangis karena tidak lulus Ujian Nasional (UN), Jumat (24/5). Dari 276 peserta UN di sekolah favorit ibu kota Aceh Utara tersebut, sebanyak 21 siswa tidak lulus.

14 Siswa SMP Dan Dua Siswa SD Wakili Bireuen Ikuti FLS2N BIREUEN (Waspada) : Sebanyak 14 siswa SMP dan dua siswa SD asal Kabupaten Bireuen yang unggul meraih juara pertama dalam Festival Lomba Seni Siswa Nasional (FLS2N) Bireuen mewakili Kabupaten Bireuen untuk mengikuti FLS2N tibgkat Provinsi Aceh. Menurut Kabid Dikdas Dinas P dan K Bireuen Abdullah yang juga Ketua Panitia FLS2N Bireuen, Jumat (24/5), 14 siswa SMP dan dua siswa SD yang akan mengikuti FLS2N tingkat Provinsi di Banda Aceh 27-29 Mei 2013, cabang lombaVokal Grup diwakili SMPN-1 Bireuen diikuti 5 pserta, cabang Seni Tari diwakili SMPN2 Bireuen diikuti 5 peseerta. Cabang MTQ putera diwakili Arif Maulana siswa SMP Ummul Aiman Samalanga, MTQ putri diwakili Nuryasrina siswi SMPN1 Jeumpa, Cabang Cipta Cerpen diwakili Chairatin Ulfa dan Cabang Story Telling (bercerita dalam bahasa Inggris) diwakili Alya Sakinah, keduanya siswi SMP Sukma Bangsa Cot Keutapang. Sementara dua siswi SD masing-masing Sarah Nurfadhilla, siswi SDN-4 Peusangan wakili cabang lomba “Menyenyi Solo” dan Maulia, siswi SDN-9 Juli wakili cabang pidato dalam bahasa Indonesia. (b12)


71 Siswa Di Aceh Timur Tak Lulus UN IDI (Waspada): Sebanyak 71 siswa SMA/MA di lingkungan Dinas Pendidikan Aceh Timur tidak lulus Ujian Nasional (UN) tahun 2013 yang diumumkan, Jumat (24/5) sore. Sementara untuk Sekolah Menengah Kejuruan ( SMK) lulus 100 persen.

Waspada/H AR Djuli

KETUA PKK Bireuen Faridah M Adam menyerahkan piala, piagam kepada Sarah Nurfadhilla yang meraih juara I lomba menyanyi Solo Festival Lomba Seni Siswa Nasional Kabupaten Bireuen.

Kuala Baru Usul Tuan Rumah MTQ Ke-33 SINGKIL (Waspada) : Kecamatan Kuala Baru (Kuba) mengusulkan menjadi tuan rumah musabaqah tilawati quran (MTQ) ke-33 tingkat Kabupaten Aceh Singkil pada 2017 mendatang. Demikian disampaikan ketua Kafilah Kuala Baru Abdul Haris yang juga Sekretaris Kecamatan, Kamis (23/5) di Singkil di acara Musda pemilihan Ketua LPTQ Kabupaten Aceh Singkil periode 2013-2015. Menurutnya, dengan ditunjuknya Kuala Baru sebagai tuan rumah akan mempercepat pembangunan jalan Kayu Menang – Trumon Aceh Selatan dan sebagai syiar Islam di Kecamatan terpencil itu ke dunia luar. “Untuk pengusulan tersebut kita sudah mengajukan proposal sebagai tuan rumah kepada Lembaga Pengembangan Tilawatil Quran (LPTQ) Aceh Singkil dan sudah mendapat rekomendasi Bupati Aceh Singkil,” ujarnya. Sebelumnya LPTQ sudah menunjuk Kecamatan Kota Baharu sebagai tuan rumah penyelenggaran MTQ ke-32 tingkat Kabupaten Aceh Singkil pada 2015 mendatang. (cdin)

Demikian disampaikan Kadis Pendidikan Aceh Timur Abdul Munir, kepada wartawan Jumat siang. “Angka kelulusan Ujian Nasional untuk Sekolah Menengah Atas dan Madrasah Aliyah dalam wilayah ini mencapai 98 persen,” katanya. Adapun jumlah peserta ujian nasional SMA/MA sederajat tahun ini dalam wilayah Aceh Timur yaitu sebanyak, 4.088 peserta yang terdiri dari SMA 3.078 peserta, MA 369 peserta, SMK 641 peserta.

Kelulusan ujian nasional SMA dan MA dalam wilayah Aceh Timur tahun ajaran 2013 ini masih seimbang dengan kelulusan tahun ajaran sebelumnya. “Tidak mengalami peningkatan dan tidak menurun masih sama,” papar Abdul Munir. 4 Siswa SMA Langsa Tak Lulus UN Sebanyak 4 siswa SMA/MA di Kota Langsa dinyatakan tidak lulus dalam ujian nasional TA 2012/2013, dengan persentase 99.82 persen dari 2.272 peserta UN. Sementara untuk tingkat SMK lulus 100 persen dari 772 peserta UN. Demikian dikemukakan Kadis Pendidikan Kota Langsa Jauhari Amin didampingi Kakan Kemenang Yunus Ibrahim saat melakukan pertemuan dengan para kepala sekolah di aula Dinas Pendidikan Kota Langsa, Jumat (24/5). “Keempat siswa yang tidak lulus itu, dua siswa dari SMA Cut Nyak Dhien, 1 dari SMAN 2

Langsa dan 1 siswa dari SMAN 5 Langsa. Untuk pengumuman secara serentak sesuai petunjuk dari Provinsi Aceh, bahwa pengumuman secara serentak dilakukan pada pukul 17:00,” katanya. Kabid Dikmen Bambang menambahkan, peserta SMA/ MA yang ikut dalam ujian nasional sebanyak 2.272 siswa, sementara untuk SMK sebanyak 772 siswa. “Untuk nilai tertinggi SMK bidang studi Bahasa Indonesia 9.00, B. Inggris 8.60, Matematika 9.40 dan kompetensi 9.30, sementara nilai rata-rata 34.60. Sedangkan untuk SMA/ MA belum bisa direkap, hingga saat ini belum bisa kita persentasekan karena masih terjadi kesalahan,” kata Bambang. Jauhari juga menekankan bahwa dalam penerimaan siswa baru TA 2013/2014, Dinas Pendidikan Kota Langsa menerapkan sistem pelayanan standar minimal. Artinya, dalam penerimaan siswa baru kita akan menerapkan pemerataan siswa di setiap sekolah.(cri/m43)

Ratusan Pejabat Pemko Langsa Safari Magrib LANGSA (Waspada): Ratusan pejabat Pemko Langsa yang terdiri dari pejabat eselon II, Kepala Dinas, Asisten, pejabat eselon III, eselon IV dan PNS di lingkungan Pemko Langsa dan pejabat, pegawai Kementerian Agama Kota Langsa melaksanakan safari shalat Magrib di Masjid NurulYaqin Cinta Raja Kecamatan Langsa Timur, Rabu (22/3). Wali Kota Langsa, Tgk Usman Abdullah, SE yang hadir dalam acara itu mengatakan, Pemko Langsa sengaja megadakan safari shalat Magrib di Gampong Cinta Raja untuk berkomunikasi dan menyerap berbagai informasi dari masyarakat di sini dan kemudian kita tindak lanjuti dan sengaja kita mengikut sertakan semua Kepala SKPK untuk menyahuti usulan masyarakat. “Kita sangat memperhatikan Gampong Cinta Raja ini, karena gampong ini berada di pesisir dan sarana prasarana masih kurang. Kita akan memperioriataskan pembangunan di gampong ini. Kita mengharapkan di gampong ini dapat memakmurkan masjid dan menghidupkan pengajian baik di masjid, meunasah dan di rumah-rumah tangga,” katanya. Kepala Dinas Syariat Islam Kota Langsa, Drs H Ibrahim Latif, MM mengatakan, pihaknya melalui Dinas Syariat Islam membantu sumbangan dana sebesar Rp30 juta untuk kelanjutan pembangunan Masjid Nurul Yaqin Cinta Raja. Dana bersumber dari dana APBA. (m43)

DKP Aceh Timur Kembangkan PUGAR IDI (Waspada): Dalam upaya menanggulangi kemiskinan bagi masyarakat pesisir dan untuk mencapai swasembada garam nasional, Dinas Kelautan dan Perikanan (DKP) Aceh Timur terus mengupayakan Pemberdayaan Usaha Garam Rakyat (PUGAR) di dua kecamatan di wilayah ini. Kadis Kelautan dan Perikanan Aceh Timur Ahmad, Kamis (23/5) mengatakan, target untuk pengembangan PUGAR dilakukan bagi petambak dan pengolah garam yang berdomisili di dua kecamatan di Aceh Timur yakni pesisir Kecamatan Julok dan Kecamatan Darul Aman. Pada 2013 ini pihaknya akan fokusuntuk terus membentuk Kelompok Usaha Garam Rakyat (KUGAR) dalam menciptakan lapangan kerja bagi petambak garam rakyat, sehingga usaha garam rakyat Aceh Timur akan menjadi model pengembangan PUGAR di Provinsi Aceh.(cri)

Waspada/Gito rolies

KAJATI Aceh TM Syahrizal menyerahkan kunci mobil operasional kejari seluruh Aceh secara simbolis Jumat (24/5) di kantor Kejati Aceh.

Kejati Aceh Terima 24 Unit Mobil Dari Kejagung

Kasus Unsyiah, Silahkan Laporkan Ke KKRI BANDA ACEH (Waspada): Kejaksaan Tinggi Aceh menerima 24 unit mobil Toyota New Avanza dari Kejaksaan Agung RI. Mobil tersebut diperuntukkan bagi operasional 22 Kantor Kejaksaan Negeri di seluruh Aceh. Kajati Aceh TM Syahrizal usai membagikan 22 unit mobil kepada kajari se-Aceh, Jumat (24/5) mengatakan, selama ini di setiap Kejari di Aceh terdapat dua unit angkutan yaitu mobil tahanan dan mobil kepala kajari, sedangkan mobil untuk operasional tidak ada. Oleh karena itu, Kejaksaan Agung menyalurkan sebanyak 24 unit mobil operasional untuk dibagikan kepada setiap kantor kejari dan kejati di seluruh Indonesia. “Aceh mendapat 24 unit mobil, 22 unit dibagikan kepada kejari dan dua unit untuk operasional kejati Aceh,” terang Syahrizal. Kajati menekankan kepada

kepala kejari di Aceh agar menjaga dan merawat mobil yang telah dibelikan dari uang rakyat. “Saya tekankan jangan digunakan untuk kepentingan pribadi, ada sanksi bila saya mendengar kabar itu,” tegas Kajati Aceh kepada kajari di Kantor Kejati Aceh. Kasus Unsyiah Belakangan ini tertanggal 7 Mei 2013, kuasa hukum Darni M Daud, yaitu Mukhlis Mukhtar melaporkan Kepala Kejaksaan Tinggi Aceh ke Komisi Kejaksaan RI di Jakarta, karena menilai Kajati Aceh telah melakukan diskriminasi terhadap penetapan tersangka Darni M Daud dalam kasus dana bantuan umum Unsyiah. Menanggapi hal itu, Kajati Aceh TM Syahrizal mempersilahkan kuasa hukum Darni melaporkan dirinya kepada Komisi Kejaksaan RI.“Silahkan mereka melaporkan saya ke Komisi

Kejaksaan RI (KKRI), itu hak mereka,” papar kajati dengan tersenyum kepada wartawan. Ia menambahkan, dirinya tidak ingin beragumen tentang kasus Unsyiah, bahkan kajati mempersilahkan adu argumen nantinya di pengadilan. “Polemik ini bisa kita lihat di persidangan nanti, di situ akan terungkap semuanya ada bukti ada saksi dan disaksikan oleh umum, ini bukan kalah menang, akan tetapi membuktikan kebenaran,” kata Syahrizal. Kajati menegaskan, penanganan kasus ini tidak berhenti di sini, bila bukti sangat mendukung, maka siapa pun bisa jadi tersangka dalam kasus ini. “Kami berharap kasus ini bisa tuntas secepatnya, dan rencananya Senin (27/5) akan diadakan rapat dengan tim penyidik untuk membahas kasus ini telah sampai tahap mana,” kata Kajati Aceh. (cb01)

Panleg DPRK Langsa Rapat Prolek LANGSA (Waspada): Panitia Legislasi (Panleg) DPRK Langsa melakukan rapat evaluasi Program Legislasi Kota (Prolek) tahun 2013 dengan sejumlah tokoh masyarakat di lima kecamatan di Langsa, LSM, mahasiswa dan media massa di ruang Komisi C DPRK Langsa, Jumat (24/5). Hadir pada kesempatan itu Ketua Panleg Muhammad Nur dan beberapa anggota yakni Muharman, Syaiful Anwar, Fitriani T, Farida Hanum dan Kabag Hukum Pemerintah Kota Langsa, Alfian. Ketua Panleg, Muhammad Nur mengatakan, sejak 2009 hingga 2012, DPRK Langsa telah mensahkan sebanyak 42 qanun. Sementara di 2013 ada beberapa qanun yang akan dibahas, tapi sebelum itu dilaksanakan Prolek ini untuk menerima masukan-masukan dari tokoh masyarakat terkait rancangan qanun yang akan di bahas nantinya. Tahapan pembentukan Prolek ini telah dilakukan awal Januari 2013, serta telah melakukan rapat dengan Pemko Langsa sehingga telah terkumpul 15 rancangan qanun prioritas yang akan dibahas nantinya, yang terdiri dari tiga

bidang anggaran, sepuluh usulan pemerintah dan dua inisiatif dari DPRK Langsa. Adapun ke-15 Rancangan Qanun (Ranqanun) tersebut yakni: Ranqanun pertanggungjawaban pelaksanaan anggaran pendapatan dan belanja Kota Langsa tahun 2012, Ranqanun perubahan anggaran pendapatan dan belanja Kota Langsa tahun 2013, Ranqanun anggaran pendapatan dan belanja Kota Langsa tahun 2014, Ranqanun ketertiban dan ketentraman masyarakat, Ranqanun pemeliharaan dan penertiban hewan ternak, Ranqanun pengelolaan sampah. Kemudian, Ranqanun pemberian izin tertentu dalam wilayah Kota Langsa, Ranqanun pelayanan kesehatan, Ranqanun nama-nama jalan dalam Kota Langsa, Ranqanun bangunan gedung, Ranqanun penyertaan modal pemerintah kota Langsa kepada PT Pelabuhan Kota Langsa, Ranqanun penyertaan modal Pemerintah Kota Langsa kepada PDAM, Ranqanun biaya pemberangkatan dan pemulangan jemaah haji Kota Langsa, Ranqanun penanggulangan kemiskinan serta Ranqanun transparansi pelayanan publik. (m43)

Larangan Menari

Sosiolog: Jangan Benturkan Budaya Vs Syariat LHOKSEUMAWE (Waspada): Soal larangan tarian dimainkan wanita dewasa, menurut sosiolog, M Husen, kepala daerah jangan membenturkan budaya dengan Syariat Islam. Seni tari dimainkan wanita dewasa di Aceh telah lahir beberapa abad lalu. Tarian di Aceh, kata akademisi dari Fakultas Ilmu Sosial dan Ilmu Politik (FISIP) Unimal tersebut, seperti tari liko pulo, ranup lampuan, saman, rateb meuseukat, ratoh, seudati, laweut, tarek pukat, seurune kale dan lainnya. Semua tarian ini sangat dekat dengan nila-nilai keagamaan yang dilakukan nenek moyang Aceh dulu. Umumnya jenis tarian dilakukan oleh Dendayang (wanita cantik) dipersembahkan kepada raja-raja, baik masa Sultan Iskandar Muda dan sesudahnya. Jadi, tidak mungkin masyarakat Aceh dengan Syariat Islam melahirkan budaya atau seni tari termasuk penarinya yang menciderai nilai-nilai religius. Ketua Peneliti Pengkajian Pembangunan SDM dan Sosial Ekonomi Masyarakat (LP3EM) itu mengatakan, seni tari ini menyampaikan peutuah (pesan) sosial budaya, nasihat agama, larangan. Bila kaum laki-laki serius menikmati tarian, tidak akan membangkitkan nafsu biologisnya. Maka dia menilai, Bupati Aceh Utara

terlalu tendensius terhadap larangan ini. “Saya melihat, kepala daerah di Aceh saat ini terlalu sensasional terhadap kebijakan. Mengeluarkan statemen yang tak substansi. Kalau mereka serius tentang Syariat Islam, coba berantas dulu sabu-sabu, ganja, judi togel, kehidupan wanita nakal dengan pejabat, jualan sedang azan magrib, tingkatkan shalat jamaah di masjid, pengajian malam,” tegasnya. Bahkan mengenai peraturan Syariat Islam telah diatur dalam qanun, seperti qanun tentang Pelaksanaan Syariat Islam, tentang minuman keras, dan tentang judi, dan tentang mesum. Pemerintah tinggal melaksanakan saja, jangan mengeluarkan statemen yang tak penting lainnya, dan justru menimbulkan kontroversi, termasuk larangan ngangkang. Kepala Bidang Kebudayaan dan Pariwisata di Dishubudpar, Nurliana mengatakan setuju dengan kebijakan bupati, karena dia menilai keinginan itu tepat dalam mengimplementasi Syariat Islam. Bupati memberi porsi terhadap seni tari tersebut, dan tidak semua tari dilarang dimainkan wanita dewasa, seperti ratoh duek, selawat badar, asmaul husna itu masih bisa. Namun tarian lain, dia menilai semuanya memiliki gerakan heroik dan sangat tidak pantas dimainkan oleh wanita dewasa. (cmk)

Warga Desak Copot Keuchik Teupin Breuh SIMPANG ULIM (Waspada): Puluhan warga Desa Teupin Breuh, Kec. Simpang Ulim, Aceh Timur, Jumat (24/5) berunjukrasa di halaman kantor Camat Simpang Ulim, di Simpang Ulim. Mereka mendesak camat memproses pencopotan Abdussalami sebagai Keuchik Teupin Breuh, karena disinyalir terlibat kasus narkoba dan asusila. “Banyak info miring dialamatkan untuk Keuchik Abdussalami. Antara lain, dugaan melakukan asusila terhadap bides, mahasiswa


WARGA Desa Teupin Breuh, berunjukrasa di halaman Kantor Camat Simpang Ulim, Jumat (24/5) KKN dan terhadap seorang nenek. Terakhir, dengan dua mobil pick-up dan tiba di kantor mobil yang ia rental dikabarkan ditangkap polisi Camat Simpang Ulim. Sayangnya, Camat Simdi Medan, karena kedapatan membawa sabu- pang Ulim, Lukman tidak ada di tempat dan sabu dan dia terpaksa menjual mobil dan ke- pengunjukrasa akhirnya membubarkandiri, bunnya demi menebus mobil rental tersebut,” sekitar pukul 12:30. Keuchik Teupin Breuh, Abdussalami memkata Zainuddin Abdullah, koordinator aksi, bantah keras semua dugaan itu. kemarin. Camat Simpang Ulim Lukman SP, yang Itu sebabnya, kata Zainuddin, masyarakat Teupin Breuh, tidak mau lagi menerima Abdus- dihubungi via telepon menegaskan, pihaknya siap mencopot Abdussalami sebagai keuchik salami sebagai keuchik. Sejumlah ibu-ibu dan anak-anak ikut diba- asalkan tuduhan perbuatan asusila dan dugaan wa dalam aksi unjukrasa itu. Mereka datang terlibat narkoba, terbukti secara hukum.(b19)


WASPADA Sabtu 25 Mei 2013

UN Di Aceh Besar, 99,80 Persen Lulus

Parlementaria DPR Kota Banda Aceh Pemko Serahkan Raqan LPJK Pelaksanaan APBK 2012 PEMERINTAH Kota Banda Aceh menyerahkan Rancangan Qanun (Raqan) Pertanggungjawaban Pelaksanaan APBK Banda Aceh tahun Anggaran 2012 kepada dewan untuk dibahas lebih lanjut oleh badan anggaran DPRK Banda Aceh. Penyerahan Raqan Pertanggungjawaban Pelaksanaan APBK TA 2012, yang dibungkus dalam satu bundel itu diserahkanWakil Wali Kota Banda Aceh Illiza Sa’aduddin Djamal, yang diterima Ketua DPRK Banda Aceh Yudi Kurnia, dalam sidang paripurna di gedung DPRK Banda Aceh, Kamis (23/5). Ketua DPRK Banda Aceh Yudi Kurnia dalam pidatonya mengatakan, dewan melalui badan anggarannya akan berkonsentrasi penuh untuk membahas pertanggungjawaban atas pelaksanaan APBK Banda Aceh tahun anggaran 2012 ini. “Dokumen LPJK, ini akan menjadi bahan kajian badan anggaran dewan untuk ditelisik dan dibahas secara serius, yang pada akhirnya nanti akan menjadi inti materi yang termaktub di dalam qanun pertanggungjawaban APBK Banda Aceh TA 2012,” jelas politisi Partai Demokrat ini. Dalam siklus anggaran, pembahasan terhadap Laporan Pertanggungjawaban (LPJ) Pelaksanaan APBK, hendaknya disikapi sebagai tugas dan tanggungjawab dewan dan sekaligus juga sebagai langkah untuk mengawasi berbagai kebijakan efektivitas dari setiap anggaran yang sudah disetujui. “Karenanya,DewanmelaluiBadanAnggaranyangditu-gaskan membahas pertanggungjawaban pelaksanaan APBK tersebut merupakan bentuk pengawasan dewan terhadap pelaksanaan anggaran secara keseluruhan baik dari aspek kebijakan, program dan kegiatannya serta aspek pelaksanaan,” terang Yudi. Dan kita harapkan pada gilirannya nanti, dewan dapat mengetahui sejauh mana kemanfaatan anggaran tersebut bagi perwujudan kesejahteraan masyarakat di Kota Banda Aceh yang kita cintai ini, tuturnya. Wakil Wali Kota Banda Aceh Illiza Sa’adduddin Djamal menyebutkan, laporan keuangan yang disampaikan ke dewan merupakan laporan keuangan yang telah dilakukan audit oleh BPK-RI selama dua bulan lamanya. “Alhamdulillah berkat dukungan dan ketaatan kita semua dalam pengelolaan keuangan tahun 2012, maka prestasi opini “WTP” (Wajar Tanpa Pengecualian) dapat kita pertahankan untuk yang ke-5 kalinya secara berturut-turut, yang merupakan predikat tertinggi dalam bidang pengelolaan keuangan daerah yang diberikan oleh BPK-RI dan tentunya predikat ini adalah kebanggaan bagi kita semua,” papar Illiza.

Komplotan Pencuri Kambing Ditangkap SIGLI (Waspada): Komplotan bandit pencuri kambing asal Desa Keude Paru, Kecamatan Bandar Baru, Pidie Jaya, Jumat (24/5) ditangkap di Desa Lueng, Kecamatan Padang Tiji, oleh anggota Polsek bersama warga setempat. Bersama tersangka polisi menyita barang bukti mobil Xenia warna silver nopol BK 1894 KN, seekor kambing warna hitam, sejumlah handphone dan beberapa alat kontrasepsi. Kapolres Pidie AKBP Dumadi melalui Kapolsek Padang Tiji Ipda Muhammad Hidin, Jumat (24/5) mengungkapkan, kelima tersangka kawanan pencuri kambing, IH, 27, MG, 25, S, 25, Z, 23, dan AR,17, mereka semua tercatat sebagai warga Desa Keude Paru, Kecamatan Bandar Baru, Kabupaten Pidie Jaya. Menurut dia, kawanan maling ini diketahui warga pada saat memakirkan mobilnya di kawasan Pesantren Darul Aitam. Warga yang saat itu terbangun karena mendengar suara teriakan kambing, mendatangi mobil tersebut. Mereka juga sempat dihajar masa, sebelum diserahkan warga kepada polisi. Pada hari yang sama, Jumat (24/5), anggota Polres Pidie mengamankan salah seorang tersangka pencuri toko bangunan Hidup Subur Kota Sigli, MR, 46, warga Desa Baroh, Kecamatan Montasik Aceh Besar. Bersama tersangka polisi menyita barang bukti gergaji besi merek Bahco sebanyak 160 unit seharga Rp1.600.000. Kapolres Pidie AKBP Dumadi melalui Kasat Intelkam AKP Apriadi mengungkapkan tersangka tertangkap tangan oleh pemilik toko saat melakukan aksinya. (b10)

Gunung Meriah Juara Umum MTQ Ke-31 SINGKIL (Waspada) : Kafilah Kecamatan Gunung Meriah tampil sebagai juara umum pada MTQ ke-31 tingkat Kabupaten Aceh Singkil setelah mengantongi sebanyak 69 poin dari tujuh cabang musabaqah yang diperlombakan . Penetapan kafilah Kecamatan Gunung Meriah sebagai juara umum dituangkan dalam SK dewan hakim MTQ ke -31 Nomor :01/DH-MTQ/V/2013 tanggal , 23 Mei 2013 yang dibacakan sekretaris koordinator dewan hakim Umma Abidin pada penutupan yang berlangsung Kamis (23/5) malam di lapangan alun alun Pulau Sarok Singkil. Sedangkan tuan rumah kafilah Kecamatan Singkil berada di posisi dua dengan nilai 52 poin, disusul kafilah utusan dari PT Nafasindo di urutan tiga dengan mengantongi 48 poin disusul kafilah Kecamatan Simpang Kanan di urutan empat dengan 22 poni dan kafilah Kecamatan Pulau Banyak di posisi lima dengan 12 poin. Acara penutupan MTQ ke-31 tingkat Kabupaten Aceh Singkil ditandai dengan penyerahan piala bergilir oleh Wakil Bupati Aceh Singkil Dulmusrid kepada kafilah Gunung Meriah yang diterima Camat Gunung Meriah M Ihcan dan dirangkaian dengan penurunan bendera LPTQ Kabupaten Aceh Singkil serta bendera LPTQ 12 kafilah. (cdin)

Waspada/Abdul Mukthi Hasan

SISWA SMAN 2 Bireuen, Jumat (24/5) yang lulus UN menyambut suka cita atas kelulusannya di Kanit Turjawali Satlantas Polres Bireuen.

Ketua MUI Sabang

Hukum Cambuk Berlaku Untuk Semua Pelanggaran SI SABANG (Waspada) : Hukum cambuk berlaku untuk semua pelanggaran Syariat Islam di Aceh. Demikian dikatakan Ketua MUI Sabang M Yakob Saleh, Jumat (24/5) menanggapi gagalnya eksekusi cambuk terhadap pelaku maisir (judi) yang telah divonis cambuk sebanyak 6 kali oleh Majelis Hakim Mahkamah Syar’iyah Kota Sabang, Kamis (23/6). Ketua MUI Sabang menyesalkan tindakan oknum jaksa Sabang selaku eksekutor yang dengan sengaja membatalkan eksekusi cambuk terhadap tiga orang yang telah mendapatkan keputusan tetap dari Mahka-

mah Syar’iyah Kota Sabang. Hanya gara-gara salah seorang di antaranya adalah anggota Polres Sabang yang telah divonis cambuk dijemput oleh oknum Polres Sabang. Hukuman cambuk berlaku juga bagi anggota Polri yang melanggar Syariat Islam di Aceh, sebab dalam qanun Provinsi Aceh No.13 tahun 2003 tentang Maisir/Judi tidak ada pengecualian. Lagi pula, gara-gara satu orang yang gagal dicambuk terikut juga yang dua orang lagi. MYakob Saleh mengatakan, sepertinya pihak aparat penegak hukum sendiri kurang serius menegakkan hukum Syaraiat Islam di Sabang ini. Jangan sampai ada kesan dalam masyarakat hukum hanya diberlakukan bagi masyarakat sipil saja, sedangkan oknum aparat tidak diberlakukan. Harapannya kepada unsur Muspida supaya se-

rius dan mendukung penegakan hukum Syariat Islam di Aceh ini. Ketua Majelis Adat Aceh Sabang Ramli Yusuf mengatakan, kalau masih ada anggota Polri tidak mau dihukum karena melanggar Syariat Islam, berarti tidak mendukung penegakan hukum Syariat Islam di Aceh, sebaiknya pindah saja dari Aceh. Karena dalam qanun No.3 tahun 2003 tidak ada pengecualian, siapa saja yang melanggar qanun tersebut harus dihukum sesuai dengan putusan Mahkamah Syar’iyah. Dia berharap, dalam waktu dekat ini pihak jaksa selaku eksekutor harus melakukan koordinasi kembali dengan pihak Polres untuk mempersiapkan secara matang jadwal eksekusi cambuk terhadap ketiga tervonis cambuk tidak terkecuali termasuk anggota Polri. (b31)

Mantan Wabup Belum Kembalikan Mobil Dinas TAPAKTUAN (Waspada) : Meski telah sebulan masa jabatannya berakhir sebagai Wakil Bupati Aceh Selatan periode 2008-2013, mantanWabup Daska Aziz, hingga kini belum mengembalikan mobil jenis Xtrail Bl 5 T yang selama ini digunakan sebagai mobil dinas. Selain mobil tersebut, Daska Aziz juga belum mengembalikan satu unit mobil double cabin bernomor polisi B 8080 AA, sebagai mobil operasional yang merupakan hibah Badan Rehabilitasi dan Rekonstruksi (BRR) tahun 2010. Akibat penyanderaan mobil dinas tersebut, Pemkab Aceh Selatan terpaksa membeli mobil baru jenis fortuna sebagai mobil dinasWabup Kamarsyah. “Meski telah dibeli lain buat wabup yang baru, mobil dinas lama harus dikembalikan karena merupakan aset Pemkab yang belum dihapus (dum),” ucap sumber

Waspada, Jumat (24/5). Sekdakab Aceh Selatan Harmaini mengakui belum dikembalikannya kedua mobil aset daerah itu ke Pemkab dan statusnya hingga saat ini belum dihapus (dum). “Persoalan pengembaliannya sudah kita serahkan kepada pengelola aset daerah, Dinas Pendapatan Pengelola Kekayaan dan Keuangan Daerah (DPPKKD) dan sejauh mana prosesnya belum kita ketahui,” ucapnya. Menurut dia, Bupati HT Sama Indra telah mengeluarkan larangan penghapusan (dum) kendaraan roda dua dan empat dalam tahun 2013. Larangan tersebut sesuai surat bupati bernomor 030/413/2013, tertanggal 8 Mei 2013, ditujukan kepada seluruh SKPK di jajaran Pemkab Aceh Selatan. Larangan ini, menurut Harmaini, dikeluarkan mengingat

Pemkab Aceh Selatan sampai saat ini belum melakukan inventarisasi aset sesuai Permendagri No.17/2007 tentang Pedoman Tehnis Pengelolaan Barang Milik Daerah. Sehingga dalam laporan keuangan yang diaudit BPK-RI Perwakilan Aceh, masih menjadi temuan karena belum menyajikan angka aset yang wajar. “Karena itu diinstruksikan kepada SKPD, agar tidak mengajukan usulan penghapusan (dum) kendaraan roda dua dan empat dalam tahun 2013 ini, sampai inventarisasi aset tuntas dilaksanakan,” katanya. Seorang pejabat DPPKKD Aceh Selatan yang enggan ditulis identitasnya mengakui kedua mobil tersebut belum dikembalikan mantan wabup dan pihaknya telah berusaha menghubungi yang bersangkutan, namun hingga saat ini belum mendapat respon. (b30)

Bayi Yang Dibuang Dikembalikan Kepada Keluarga


WAKIL Bupati Aceh Singkil Dulmusrid menyerahkan piala bergilir kepada Camat Gunung Meriah M Ikhsan sebagai juara umum MTQ ke-31 tingkat Kabupaten Aceh Singkil, Kamis (23/5)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu)

Garuda Indonesia

GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.


Berangkat (flight, tujuan, waktu)

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45


FY 3400 Penang*


SIGLI (Waspada): Pusat Pelayanan Terpadu (PPT) Kabupaten Pidie mengembalikan seorang bayi laki-laki kepada keluarganya di Desa Kampong Blang Meunasah Raya, Kecamatan Simpang Tiga, Pidie, Jumat (24/5). Bayi tersebut sempat dibuang oleh kedua orang tuanya di Desa Peureulak Busu, Kecamatan Mutiara, Pidie, Minggu (5/5). Saat dibuang umur bayi laki-laki itu, baru berusia 10 hari. “Bayi ini sekarang kita serahkan kembali pada keluarganya. Meski begitu ia masih dalam pengawasan kami,” kata Kabit Pelayanan Rehabilitasi dan Bansos, Pidie, Megawati. Bayi tersebut saat diserahkan pada keluarga disaksikan kepala desa. Namun saat itu kakek dari bayi tersebut tidak ada di rumah dengan alasan sedang sedang berobat di rumah sakit. Bayi ini diterima oleh nenek dan ibunya Kapolres Pidie AKBP Dumadi melalui Kasat Intelkam AKP Apriadi menjelaskan, pengungpakan orang tua bayi itu berawal dari informasi masyarakat yang menyebutkan, ada seorang ibu di Kecamatan Simpang Tiga yang melahirkan tanpa anak. Selanjutnya petugas Intelkan Polres Pidie melakukan

Waspada/Muhammad Riza

NUHAYATI, warga Desa Kampong Blang Meunasah Raya, Kecamatan Simpang Tiga sedang mendekap bayinya disaksikan petugas PPT Dinsos Pidie, Jumat (24/5) pengembangan dan menemukan ibu kandung bayi tersebut. Setelah dilakukan penyidikan, ibu bayi itu bernama Nurhayati, 33, dan ia mengaku anak itu lahir dari hasil hubungannya dengan Jamaluddin, warga Kecamatan Keumala. Menurut pengakuan Nurhayati, ia tidak membuang bayinya itu. Tetapi pada malam itu ia bersama Jamaluddin (ayah

si bayi) dalam satu becak. “Saat itu ia tertidur, lalu bayi itu diletakkan di samping sebuah warung kopi,” katanya. Sementara dari pengakuan Jamaluddin kepada penyidik, kata AKP Apriadi, bayi itu sengaja dibuang karena malu. “Jadi keduanya tetap kita lakukan proses hukum dengan ancaman lima tahun penjara,” katanya. (b10)

KOTA JANTHO (Waspada): 99,80 Persen dari 3.902 siswa SMA, Madrasah Aliyah (MA) dan SMK yang mengikuti Ujian Nasional (UN) dinyatakan lulus pada Tahun Ajaran 2013. Semantara 35 lainnya tidak lulus. Jumlah tersebut menempatkan Kabupaten Aceh Besar pada urutan sepuluh jumlah siswa yang lulus UN se-Provinsi Aceh. “Alhamdulillah, ada perubahan yang signifikan kita peroleh tahun ini. Pada tahun lalu (2012red), Aceh Besar berada pada urutan 19, namun tahun ini naik menjadi urutan sepuluh. Kita berharap, pada tahun depan bisa mencapai lima besar. Perubahan ini mampu kita capai, karenakerjasamasemuapihakyangterlibatdalam proses belajar-mengajar di daerah ini. Terutama para siswa dan orang tua yang telah membangkit semangat anaknya untuk belajar,” kata Kadis Pendidikan Aceh Besar Razali, Jumat (24/5). Kasubdin SMA Dinas Pendidikan Kabupaten Aceh Besar Saifullah mengatakan, jumlah siswa SMA dan MA di Aceh Besar yang lulus Ujian Nasional pada Tahun Ajaran 2013, Jurusan IPA 99,6 persen, Jurusan IPS 97,8 persen, Juirusan Bahasa 94,4 persen dan Jurusan Agama 100 persen. Sedangkan untuk SMK, jumlah siswa yang lulus 100 persen. Pengumuman hasil Ujian Nasional tingkat SMA, MA dan SMK Tahun Ajaran 2012-2013 diumumkan secara serentak di sekolah masing-

masing, Kamis petang. Para SMA, MA dan SMK di daerah itu mulai mendatangi sekolahnya sejak pagi. Namun, karena pengumuman belum ditempel, menjelang shalat Jumat para siswa tersebut kembali ke rumah. Tiga Siswa SMA 2 Seulimum Tak Lulus Tiga siswa jurusan IPS SMA Negeri 2 Seulimum di Lamteuba, Aceh Besar, gagal lulus Ujian Nasional Tahun Ajaran 2012-2013. Sementara, 44 siswa, 26 di antaranya siswa jurusan IPA, dinyatakan lulus. “Kita bersyukur, anak-anak kita 90 persen lebih lulus tahun ini, hanya tiga orang yang gagal. Ini murni hasil perjuangan mereka sendiri, tanpa ada campur tangan dewan guru,” kata Hamdani, kepala SMA Negeri 2 Seulimum, Jumat (24/5). Menurutnya, jumlah kelulusan para siswa Kelas III tahun ini mengalami peningkatan dibanding tahun sebelumnya. Salah satu SMA di kawasan terpencil lainnya, yakni SMA Negeri 1 Lhoong, jumlah siswa yang mengikuti Ujian Nasional sebanyak 65 siswa. Dari jumlah tersebut, 26 di antaranya jurusan IPA dan 39 jurusan. “Alhamdulillah, tahun ini lulus 100 persen. Keberhasilan para siswa ini, tidak terlepas dari dukungan dan kerja sama dari orang tua mereka,” kata Yusniar, Kepala SMA Negeri 1 Lhoong. (b05)

Protes Penghapusan TPK Guru BIREUEN (Waspada) : Ketua PGRI Bireuen Zainuddin dan Ketua Kobar-GB Muhammad Jafar memprotes keras terhadap rencana Pemkab Bireuen yang akan menghapus tunjangan Prestasi Kerja (TPK) guru sertifikasi. Pihak Pemkab Bireuen yang dimotori Sekda Zulkifli didampingi para asisten, Kadis Keuangan dan Kadis Pendidikan, Rabu (22/5) baru lalu mengundang organisasi profesi guru PGRI dan Kobar-GB berikut 20 anggota mewakili guru Kabupaten Bireuen untuk mensosialisasikan rencana penghapusan TPK Guru sertifikasi. Ketua PGRI Bireuen Zainuddin dan Ketua Kobar-GB Muhammad Jafar mengatakan, Jumat (24/5), guru yang sudah menerima tunjangan sertifikasi tidak boleh lagi menerima tunjangan TPK yang diplot daerah karena penerimaan tunjangan yang sudah tumpang tindih

sesuai peraturan Menteri Keuangan No 42/ PMK.07/2013 tidak dibenarkan. Pihak PGRI dan Kobar-GB memprotes keras terhadap rencana penghapusan TPK guru sertifikasi, karena peraturan tersebut merupakan pedoman umum alokasi dana pembayaran tunjangan guru non sertifikasi. Ketua PGRI Zainuddin meminta Pemkab Bireuen jangan ikut-ikutan mengadopsi ide Pemko Lhokseumawe yang menghapus TPK guru tanpa landasan hukum. Menurut Zainuddin, pihaknya sudah melakukan investigasi ke lembaga terkait, Biro Hukum Kantor Gubernur Aceh, Inspektorat Provinsi yang mengatakan, tidak ada larangan bagi guru yang sudah menerima tunjangan sertifikasi untuk menerima TPK. (b12)

Komisi V Himpun Informasi Penyusunan RUU PP BANDA ACEH (Waspada): Komisi V DPRRI berkunjung ke Banda Aceh untuk menghimpun informasi terkait rancangan undang-undang tentang pencarian dan pertolongan (RUU PP), yang saat ini sedang digodok di parlemen. Selain mengadakan pertemuan dengan jajaran pemerintah Aceh yang terkait, KomisiV DPRRI juga mengunjungi komplek rumah susun sewa (Rusunawa) di Gampong Keudah, Kecamatan Kutaraja serta Politeknik di Kota Banda Aceh. Pertemuan Komisi V DPR-RI yang diketuai Laurens Bahang Dama serta sejumlah anggota komisi lainnya dengan jajaran pemerintah Aceh, dipimpin Asisten Umum dan Administrasi Setda Aceh, Muzakkar A Gani, Jumat (24/5) di kantor gubernur.

Gubernur Aceh dalam sambutan yang dibacakan Asisten Umum dan Administrasi Setda Aceh tersebut, mengatakan, di tingkat provinsi, Aceh sudah mempunyai Badan Penanggulangan Bencana Aceh (BPBA). “Pelatihan-pelatihan tentang pencarian dan pertolongan terus dilakukan di tingkat provinsi maupun kabupaten/kota, karena Aceh termasuk salah satu wilayah dengan potensi bencana yang sangat tinggi di Indonesia,” ungkap gubernur. Hanya saja, tambah gubernur, dasar legalitas bagi masyarakat terlibat melaksanakan misi pencarian, pertolongan dan penyelamatan korban bencana belum ada. “Ini alasan mengapa kita membutuhkan UU tentang pencarian dan pertolongan ini,” katanya. (b06)

Bener Meriah Pilot Projek Unit Pengaduan Pelayanan Publik REDELONG (Waspada): Untuk saat ini, di Aceh, hanya Kabupaten Bener Meriah menjadi pilot projek penerapan Unit Pengaduan Pelayanan Publik (UP3) serta keberadaan UP3 di kabupaten penghasil kopi itu merupakan yang pertama diresmikan di Indonesia dari tiga lokasi yang ditetapkan. Proses peresmian yang berlangsung di aula setdakab setempat, Kamis (23/ 5) dihadiri Ketua Ombudsman RI, Danang Girindrawardana, Deputi Pelayanan Publik Kementerian Pendayagunaan Aparatur Negara Wiharto, Bupati Bener Meriah Ruslan Abdul Gani, serta perwakilan Gubernur Aceh serta Ketua Ombudsman Aceh. Deputi Pelayanan Publik Kementerian Pendayagunaan Aparatur Negara (PAN),Wiharto mengatakan, di Indonesia, hanya ada tiga UP3, namun untuk pertama kali diresmikan itu di Kabupaten Bener Meriah. Selain Bener Meriah, unit pengaduan pelayanan publik ini, ada di Kota Palangkaraya, dan Palu, Sulawesi Tengah,” sebutnya. Menurut Wiharto, Pemkab Bener Meriah patut diapresiasi karena telah berani untuk me-

nghadirkan UP3 di daerah itu. Tujuan kehadiran UP3 untuk meningkatkan pelayanan publik yang lebih prima. “Nanti dalam pelaksanannya, diharapkan jangan hanya menunggu di kantor, tetapi harus jemput bola. Jadi dengan melakukan jemput bola, pengaduan masyarakat bisa terhimpun,” katanya. Ketua Ombudsman RI, Danang Girindrawardana mengatakan, Kabupaten Bener Meriah diharapkan dapat menjadi contoh bagi daerah-daerah lain dalam hal pengelolaan UP3 dan menjadi pusat pembelajaran (learning centre) bagi pengelolaan pengaduan pelayanan publik di Indonesia. “Kabupaten Bener Meriah, sudah sangat berani untuk menghadirkan UP3. Padahal di Indonesia, belum 7 persen daerah yang memilik UP3,” tuturnya. Acara peresmian tersebut selain dihadiri sejumlah tokoh penting dari Jakarta, juga diikuti Kepala Perwakilan Ombudsman Aceh Taqwaddin dan Project Manager SAJI-UNDP Anis Hamim, serta 300 peserta dari pejabat SKPK, kepala kampung, tokoh masyarakat dan mahasiswa. (b33)

Tokoh Golkar Barat-Selatan Tuding Bupati Abdya ‘Asbun’ BLANGPIDIE (Waspada) : Tokoh Partai Golongan Karya wilayah Pantai Barat-Selatan SufrizalYusuf, SH menuding Bupati Aceh Barat Daya Ir Jufri Hasanuddin, MM telah melakukan pembohongan publik skala besar. Tudingan keras tersebut disampaikan Sufrizal Yusuf kepada sejumlah wartawan di Balai PWI Abdya Kamis (23/5) terkait pernyataan Jufri Hasanuddin beberapa hari lalu yang dilansir sejumlah yang menentang pembentukan Provinsi ABAS dan lepas dari Pemerintah Aceh. Saat itu Jufri mengatakan tidak ada alasan untuk melakukan pemekaran provinsi, karena menurutnya Pemerintah Aceh telah bersikap sangat adil, dimana pada tahun 2012 silam sekitar 80 persen dana pembangunan dialokasikan ke wilayah barat dan tengah, demikian juga dalam pembangunan jalan wilayah barat sangat diistimewakan. “Itu jelas sebuah pembohongan publik, dana mana yang 80 persen dialokasikan ke wilayah barat dan tengah, demikian juga jalan mana yang dibangun oleh Pemerintah Aceh untuk wilayah barat, jalan di wilayah barat yang sekarang kita rasakan agak mulus ini yang bangun bukan Pemerintah Aceh, tapi dibangun oleh bantuan luar negeri yakni USAID,”cecar Sufrizal. Dikatakan Sufrizal, selaku mantan Ketua Komisi-D DPRA, harusnya Jufri bisa membuka mata lebar-lebar dalam melihat arah pembangunan yang sangat tidak adil di wilayah pantai barat-selatan ini, bukannya membela pemerintah Aceh yang tidak adil hanya untuk mencari muka semata. Dimana katanya sangat banyak pembangunan yang seperti sengaja ditelantarkan oleh Pemerintah Aceh untuk wilayah pantai barat-selatan ini, dicontohkannya pembangunan 2 jembatan abu nawas (yang dibangun kepala jembatan saja, sementara badan jemba-

tan tidak ada) di Kecamatan Manggeng, Abdya sudah hampir 7 tahun terbengkalai, pembangunan irigasi sayap kanan di Kecamatan Blangpidie juga tidak tersentuh, akibatnya belasan ribu hektare lahan pertanian penduduk jadi kering dan tidak bisa diolah. “Demikian juga dengan pembangunan jembatan di Krueng Batee, Abdya sampai saat ini belum juga tuntas,”ungkapnya. Persoalan lain tambahnya, pembangunan jalan Buluh Sema, Kabupaten Aceh Selatan sampai saat ini belum ada kejelasan, dan masih banyak persoalan tidak adil lainnya yang dirasakan masyarakat wilayah pantai barat-selatan. “Ini menjadi sebuah PR yang harus direnungkan Pemerintah Aceh dan juga Bupati Jufri, jangan asal ngomong kalau pembangunan sudah sangat adil, dasar mana Jufri mengatakan hal itu adil, apa Jufri tidak pakai kacamata dan asal lihat-lihat saja,”tegas Sufrizal. Disamping itu, Sufrizal juga menyorot pernyataan Bupati Jufri yang mengatakan ada beberapa pejabat Eselon-II dan III yang dipakai Pemerintah Aceh berasal dari Pantai Barat-Selatan, menurutnya itu juga merupakan pembohongan publik. “Coba tunjukkan kepada kami mana pejabat yang dimaksud Jufri itu, jika pun ada kapasitasnya hanya sebagai pejabat yang bertugas untuk menyeduh kopi di kantor saja,”ujarnya. Sayangnya hingga berita ini diturunkan, Bupati Abdya Jufri Hasanuddin belum bisa dimintai tanggapannya karena sedang berada di luar kantor, menurut keterangan Kabag Humas dan Protokol Abdya Usmadi, SPd, Bupati sedang berada meninjau salah satu SMA di kawasan Padang Merantee Susoh, ponsel yang biasa digunakan bupati dihubungi Waspada berkali-kali juga tidak diangkat.(b08)



Jiwa ‘’Korsa’’ Bertindak Qanun NAD Dalam Bahaya


eorang anggota Polres Sabang, Kamis (23/5), menggagalkan pelaksanaan hukum cambuk di Masjid Agung kota itu. Tiba-tiba saja dia membawa salah seorang terhukum yang akan menjalani enam kali hukuman cambuk sehingga gagal dieksekusi di depan umum. Penjelasan Kapolres Sabang AKBP Chomariasih,SH membenarkan salah satu terhukum yang terlibat kasus judi (maisir) adalah anggotanya Brigadir Irwanuddin. Mengapa terhukum dibawa lari oleh temannya? Terjadi beda pendapat. Hemat kita, Qanun No.13/2003 tidak membedakan masyarakat sipil dengan polisi, harus menjalani hukuman cambuk. Tapi, ada semacam ketidakikhlasan dari pihak polisi yang menganggap hukuman cambuk itu memalukan dan tidak sesuai diterapkan kepada anggota polisi dan militer, sehingga sebelum eksekusi dijalankan seorang teman terhukum Brigadir Irwanuddin melakukan upaya penyelamatan sehingga pelaksanaan hukuman cambuk menjadi gagal. Mungkin saja benar alasan pihak polisi di sana keberatan dilaksanakan hukuman cambuk di depan umum terhadap anggotanya yang terbukti main judi karena malu atau faktor lainnya, atau merasa derajat anggota polisi setingkat lebih tinggi dari warga sipil lainnya. Kalau alasannya tidak ada komunikasi karena sebelum dieksekusi harus dilakukan koordinasi lebih dahulu dengan pihak kepolisian sebagai institusinya hal itu perlu dibuktikan. Kalau memang ada dasarnya tindakan menggagalkan hukuman cambuk merupakan bagian dari jiwa korsa yang positif. Sebab, masih ada aturan dan prosedur yang harus dilakukan, tidak boleh langsung dieksekusi tanpa sepengetahuan atasan sebagaimana dikemukakan Kapolres. Sebaliknya, kalau penggagalan eksekusi cambuk itu hanya untuk membantu teman dan atas nama menjaga korps polisi tidak tercemar, maka tindakan menggagalkan hukuman cambuk itu jelas menyimpang dari Intisari ketentuan perundangan, khususnya qanun No 13 tahun 2003 yang tidak membedakan Qanun NAD dalam ba- terdakwa dari sipil maupun dari polisi, yang polisi juga bagian dari sipil karena haya besar akibat pene- sebenarnya sudah dipisah dari ABRI/TNI. Memang ada semacam keegoan dari pihak rapan jiwa‘’korsa’’salah yang menyelamatkan terhukum Brigadir kaprah oleh oknum polisi Irwanuddin, seakan membela korps kepolisian, tapi pembelaan tanpa dasar hukum yang kuat, apalagi tindakan menggagalkan hukuman cambuk itu dilakukan di depan umum jelas menunjukkan jiwa korsa yang salah kaprah dari oknum Polres Sabang. Awalnya, tiga pelaku maisir (judi) divonis Majelis Hakim di Mahkamah Syar’iyah, Kota Sabang, bersiap hendak menghadapi eksekutor hukuman cambuk masing-masing enam kali. Sidang ketiga kasus judi dilakukan terpisah untuk Muliadi, 36 dipimpin Majelis Hakim diketuai Zaini Usman, SH didampingi dua hakim anggota yaitu Drs Abdul Basyir Ihksanuddin dan Drs Zukri, SH. Kasus judi yang didakwakan terhadap Brigadir Irwanuddin alias One, 28 dalam persidangan dipimpin Hakim Drs Ramli dan dua hakim anggotanya Abdul Basyir Ikhsanuddin dan Drs Zukri, SH. Sedangkan kasus judi yang menimpa Sulastri alias Suli, 39 dalam sidang yang dipimpin Hakim Drs Indra Suhadi, SAg dan hakim anggota Drs Ramli dan Drs Zukri. Masing-masing Majelis Hakim berkesimpulan, ketiga terdakwa terbukti melanggar pasal 6 ayat 1 jo. Pasal 23 ayat 2 qanun Provinsi NAD Nomor 13 Tahun 2003, dan diancam hukuman aqubat cambuk. Majelis hakim ketiga perkara sama-sama menjatuhkan hukuman cambuk sebanyak 6 kali terhadap para pelaku judi tersebut. Karena majelis hakim menjatuhkan vonis cambuk enam kali, jaksa penuntut umum dan terdakwa menerima isi putusan dan tidak melakukan banding. Jaksa penuntut pmum selaku eksekutor merencanakan selepas shalat zuhur dilakukan eksekusi cambuk di depan Masjid Agung Babussalam. Tapi eksekusi itu gagal dilakukan setelah seorang di antaranya diambil paksa anggota polisi yang belakangan diketahui merupakan atasan terhukum. Suasana pun menjadi heboh karena baru pertama kali ini pelaksanaan hukuman cambuk terhadap oknum polisi gagal karena munculnya teman terhukum melakukan penyelamatan. Mungkin jiwa korsanya terpanggil membela korps. Dalam kasus Cebongan muncul jiwa korsa dari kesatuan TNI. Kepala Staf TNI Angkatan Darat Jenderal (TNI) Pramono Edhie menilai tidak ada yang salah dengan jiwa korsa yang dipegang oleh para prajurit TNI. Jiwa korsa harus dimiliki untuk menghadapi perang. Kalau dia tidak punya jiwa korsa, suatu saat kawannya terluka di dalam pertempuran, mau ditinggal atau dibawa? Ditinggal nanti dibunuh padahal dia masih terluka tapi tidak bisa berjalan. Kalau tidak punya jiwa korsa, dia tinggal temannya di situ, demikian kata Pramono. Hemat kita dalam kasus Cebongan jiwa korsa yang ditunjukkan 12 terdakwa sedikit dapat diterima karena sasarannya preman kelas kakap, ketimbang kasus Sabang. Kasus Brigadir Irwanuddin kita nilai memalukan. Hukuman harus dijalankan tanpa pilih kasih. Jangan sampai qanun NAD dalam bahaya besar gara-gara penerapan jiwa ‘’korsa’’ yang salah kaprah dan akhirnya bisa melebar ke mana-mana. Oleh karena itu perlu kita garis bawahi jiwa korsa wajib dievaluasi kembali dalam proses pendidikan para anggota TNI dan Polri dalam hal penerapannya demi perbaikan citra aparat keamanan dan kepolisian kita di masa mendatang.+


Faks 061 4510025

+6285260088842 Wooi... Fackri H (PKS) bacotmu terlalu kotor. Kini kena batunya... eehh cop kena DAGINGnya. +6285372509208 Apresiasi saya terhadap WASPADA terhadap pemberitaan LHI dan PKS selama dua hari ini,mulai berimbang,tdk tendensius dan tdk ad muatan politik atau tdk autk PKS) dan masih mengutip pendapat ICW bentukan asing (ingin melemahkan Islam seperti Mesir) yg kemungkinan besar, rekeningnya makin gendut aja tu dr luar negeri sana.Bravo buat WASPADA dn prihatin buat media lain yg sdh kehilangan nurani,dn berubahlah karena perubahan adalah ciri zaman.(WUR) +6281360716903 ABU ROBAN TELAH PERGI , menyusul para Mujahid yang lebih dahulu masuk ke ëAlam Barzakh ï Abu Roban menggelegak darahnya melihat Insan-Insan yang se-iman dengannya , melihat Masjid-Masjid dibakari oleh begundal-begundal pembenci Islam di Myanmar ï Abu Roblak Izroëiel ber-ucap ; ìInna liLLAHI wa inna ila IHI rojiëun !î an melintas didepan Gedong Ke dutaan Myanmar di Bandar Jakarte , lalu timbul fikirannya ; ìIni sajalah sasaran pembalasan îï Tetapi sayang saudara-saudari ! Pelor-pelor tajam logam dari laras panjang Detasement 88 , menghantar Beliau ke ëAlam Barzakh Ö AlMaall martir follower Moukhammad ; geutanyo ureung krueng sikameng # +628153195774 Orang lain yang menulis, tapi nama orang lain yang disebutkan. Jadi capek dee kita membacanya. +6282165158707 Kami dari keluarga alm.MUHAYAR .bsc. Ingin mempertanyakan tentang kebenaran asuransi yang tertera di belakang kartu keanggotaan partai GOLKAR.karena sampai saat ini asuransi untuk alm ab kami belum kami terima.(HALOMOAN SITORUS/ahli waris.kec tinggi raja) +6281260492974 Pak Gubernur dan Kadis PU, tolong dong perhatikan aliran sungai kami yang berada di jalan danau Singkarak G.madrasah Kec. Medan Barat dan sekitarnya, keadaan sampai masuk ke rumah warga, jangan hanya mau pada saat akan PILKADA bapak memperhatikan warganya, mohonperhatian dan tindakan nyata y pak, trimakasih. +6288262009493 Masih percaya minyak akan habis. penemuan migas berlimpah ruah di Meksiko. ya dinegra barat sendiri, minyak tidak berasal dari posil binatang purba, telah ada dari dulu. dan tidak habis. +6288262009493 Saya telah komentar, negara barat migas juga ada. tapi pengeboran lebih dalam, kerena suhu di negara barat tidak panas. +6285359784745 Untuk mengatasi tindak kejahatan/perampokan, menurut saya pak monang polisi harus dimasyarakatkan dan masyrakat di polisikan, tempelkan no panggil darurat pol dimana gimana pak cocok? +6287713908300 Dunia ini sudah tua dan sudah kopong. Lihat aja umatnya.

Masyarakat Di Altar Paranormal Oleh Dirja Hasibuan Masalah ini semestinya tidak sebatas diposisikan sebagai problema akidah. Ia juga bagian dari masalah sosial yang pada akhirnya memicu perubahan ke arah ketegangan sosial.


erseteruan Adi Bing Slamet dengan Eyang Subur, telah menjadipusatpembicaraanluas. Terlebihlagiterkuakberitabahwa kasus Adi terjadi pula pada sejumlah artis, elie politik, pengusaha, anggota masyarakat,bahkanjugapetingginegara.Mereka berduyun-duyun bersimpuh di altar paranormal(orangpintar,dukun,ahli nujum, pawang atau ahli supranatural, spiritualis). Pada umumnya bantuan yang ditawarkan paranormal tersentralisasi pada kepentingan duniawi bersifat hedonisme. Sebagai misal, “pagar” diri, “penglaris”, jabatan, meningkatkan popularitas, kharisma, hingga “membumi-hanguskan” seseorang yang dianggap sebagai rival. Sampai seberapa jauh akurasi “mantra” sang dukun memang masih perlu dipertanyakan. Namun, tekanan atas ambisi duniawi telah memadamkan api agama yang menjadi pedoman. Multi Paradigma Secara akademis, berbagai variabel dominan dapat dikedepankan sebagai hipotesis kertas kerja atas membludaknya masyarakat yang “sujud” di altar paranormal. Hipotesis yang pertama adalah faktor ketertarikan manusia mendayagunakan mitologi makhluk supernatural (setan, iblis, jin) yang dimistifikasi punya peran dan tugas di alam semesta (makrocosmos). Bermetafisika dengan dimensi makrocosmos, maka secara otomatis terlepas dari ikatan atau otoritas Ilahi. Karena itu, orang yang jatuh sakit misalnya, pendekatan medis (diagnosis) tidak berlaku. Bibit penyakit (virus/bakteri) dipercaya bersumber dari gangguan makhluk supernatural, sehingga metode penyembuhan dilakukan dengan cara pengusiran setan (exorcise). Fenomena ketertarikan masyarakat memohon bantuan kepada ahli-ahli spiritual, paranormal atau dukun khususnya, adalah bertolak dari sifat putusasa, serakah dan keinginan secepat mungkin meraih sesuatu tanpa harus bersusah-payah. Ambisi duniawi telah menekan logika berfikir ke titik nadir yaitu alam bawah sadar. Dalam kondisi demikian, individu mengalami proses intoksikasi diri, sehingga terperangkap ke dalam tipu-muslihat paranormal. Maka tak heran bila harta, anak, istri dan keimananpun ditumbalkan. Praktik paranormal yang mendayagunakan makhluk-makhluk supernatural untuk mencapai tujuan, memang bukan merupakan kerja akal (logika).

Ia bertengger di alam keghaiban. Ironisnya adalah individu (pemuja) bisa mengilustrasikan sosok kekuatan ghaib, sesuai jangkauan imajinasi individu pula. Keanehan juga nampak dari pola interaksi yang mengambil bentuk “majikan-budak” dengan subyek yang dapat berubah-ubah (saling bertukar) sesuai kondisi tertentu. Di satu sisi, pemuja dapat mendayagunakan makhluk supernatural sebagai budak untuk melaksanakan perintah. Namun di lain segi, sosok makhluk ghaib juga memperbudak pemuja untuk memenuhi berbagai persyaratan ritual. Terlepas sejauhmana reaksi dan akurasi magis mempengaruhi dimensi makrocosmos, namun sistem kepercayaan tentang roh sangat bertentangan dengan sains. Adalah EB.Tylor, seorang professor legendaris di bidang antropologi, dalam buku monumentalnya “Primitive Culture”—dengan gayanya yang sistematis dan berangkaian,ditambahratusancontoh, Tylor bergerak menelusuri seluruh tingkat kehidupan, pemikiran dan kebiasaan primitif. Dalam setiap tempat, Tylor menunjukkan bagaimana doktrin tentang roh memahami ide-ide dan tingkah laku yang di sisi lain akan mengejutkan kita sebagai sesuatu yang tak lebih dari sekedar kebohongan yang irasional dan tak dapat dimengerti. Seperti yang diketahui setiap peneliti modern yang berpengetahuan, dunia tidaklah dihidupkan oleh roh-roh yang tak tampak. Pakar geologi juga telah membuktikan bahwa batu tidak memiliki hantudidalamnya.(EB.TylordalamDaniel L. Pals: Seven Theories of Religion; 2001). Sedangkan jika meminjam pendekatan sosiologi, maka praktik perdukunan yang kian mewabah di tanah air telah mengindikasikan terjadi degradasi di bidang keagamaan yang cukup mengkhawatirkan. Masyarakat tidak mau tahu dengan agama (agnostik). Padahal pesanpesanagamaselamainitelahmengajarkan tentang kebajikan hidup bermasyarakat dan bernegara. Sedangkan paham agnostisme lewat praktik perdukunan cenderungbersikapsebaliknyayaitumenebar keserakahan dan kebencian.

Pandangan Islam Dalam perspektif Islam, terutama bidang tauhid, paham agnostis dan magis (praktikperdukunan)tergolongperbuatan syrik. Cara ini bertentangan dengan Rukun Iman yaitu Beriman Kepada Allah. Rukun Iman adalah wujud hakiki dari tauhid (wahhada-yuwahhidu) yaitu meng-Esakan. Artinya adalah meyakini bahwa Allah itu Esa atau tunggal, dengan sendirinya mengarahkan seluruh ibadah secara tunggal kepada Allah, bukan kepada makhluk atau benda-benda lainnya. Beriman kepada Allah harus bersendikan pada dua masalah pokok yaitu iman terhadap rububiyah Allah dan iman terhadap uluhiyah Allah. Iman kepada rububiyah Allah maksudnya berikrar bahwa Allah adalah pencipta segalagalanya, yang memilikinya, mengadakannya, dan memberi rezekinya. Dialah yang menghidupkan dan mematikan, mendatangkan manfaat dan marabahaya, yang menguasai segala urusan, di tangan-Nya segala kebaikan, dan Dia Mahakuasa atas segala sesuatu, dan tidak ada penanding (sekutu) dalam semua urusan. UmatIslamwajibpercayabahwaAllah adalah sentral dan pemegang otoritas tunggal terhadap segala paristiwa yang ada di makrocosmos. Allah Subhanahu wa Ta’ala berfirman: “Kepunyaan Allahlah kerajaan langit dan bumi dan apa yang ada di dalamnya”: (Q.S Al-Maidah: 120).Termasuk juga dalam memberikan rezeki kepada sem u a makhluk hidup, sebagaimana isi dari firman Allah Azza wa Jalla: “Dan tidak ada suatu binatang melatapun di bumi melainkan Allah-lah yang memberi rezekinya”. (Q.S Hud: 6). Sedangkan makna iman kepada uluhiyah AllahTa’ala yaitu membenarkan secara pasti bahwa AllahTa’ala sematalah yang mempunyai hak atas semua bentuk ibadah, lahir maupun bathin. Misalnya berdoa, takut, tawakkal, meminta pertolongan, shalat, zakat dan puasa. Seseorang yang hanya mengakui tauhid rububiyah, dengan tidak menindaklanjutinya dengan tauhid uluhiyah, tidak menjadikan ia Muslim. Sebab, iblis pun mengakui tauhid rububiyah, namun mengingkari tauhid uluhiyah. (Dr. Abdul Aziz bib Muhammad Ali Abdul Lathif: Kitab Tauhid: 2010). Karena itu, bagi umat Islam wajib hukumnya men-Esa-kan Allah. Sebagaimana isi firman Allah: “Dan Tuhanmu adalah TuhanYang Maha Esa; tidak ada Tuhan melainkan Dia yang MahapemurahlagiMahapenyayang”.(Q.SAl-Baqarah: 163). Tidak diperkenankan untuk menyembah makhluk supernatural, bangsa jin misalnya, apa lagi meminta bantuan-

nya. Allah berfirman: “Hanya Engkaulah yang Kami sembah, dan hanya kepada Engkaulah kami meminta pertolongan”. (Q.S Al-Fatihah; 5). Dan bangsa jin pun diciptakan untukmenyembahAllah.“Dan aku tidak menciptakan jin dan manusia melainkan supaya mereka mengabdi kepada-Ku (Allah)”. (Q.S Adz-Dzariyat: 56). Pada intinya, pendekatan tauhid menegaskan bahwa umat Islam harusmenjauhi segala perbuatan yang mengarah ke thaghut. Thaghut ialah setan dan apa saja yang disembah selain dari Allah. Imam Ibnul Qoiyyim rahimahullah menegaskan bahwa thaghut itu adalah segala sesuatuyangdiperlakukansecaraberlebihlebihan oleh seorang manusia, baik itu berupasesuatuyangdisembah,diikutiatau ditaati. Allah Ta’ala berfirman: “Dan sungguh, kami telah mengutus seorang rasul pada tiap-tiap umat (untuk menyerukan): Sembahlah Allah dan jauhilah thaghut”. (Q.S An-Nahl: 36). Uraian di atas menunjukkan bahwa tidak ada tempat dalam Islam bagi pelaku praktik paranormal, dukun, ahli nujum, tukang sihir atau apapun namanya. Di kemudian hari Allah akan menjatuhkan hukumanyangsangatmengerikan,karena tergolong perbuatan syirik. Sedangkan di dunia, sebagaimana hadis diriwayatkan olehJundupra.secaramarfu:“Hukumbagi tukang sihir adalah dibunuh dengan pedang”. (HR.Tirmidzi, Baihaqi dan Daruquthni, dengan sanad shahih). Sedangkan hukuman bagi orang yang berdukun atau mendatangi paranormal, Rasulullah bersabda:“Barang siapa yang mendatangi tukang ramal, kemudian menanyakan sesuatu(danmembenarkanapayangdiramalkannya), maka shalatnya tertolak selama 40 hari” (HR. Muslim). Walau Islam telah menutup rapat bagi pelaku praktik perdukunan, namun celakanya perkembangan paranormal justru bertambah dasyat, bahkan sudah menjurus ke dimensi ekonomi (bisnis). Kondisi demikian jelas tidak terlepas dari rendahnya kadar keimanan masyarakyat yang dikondisikan oleh kemajuan peradaban modren. Di lain segi, hal ini mengidentifikasikan pula bahwa ulama telah gagal menjalankan perannya sebagai“corong” kenabian,karenadisibukkandengantugas ganda yaitu sebagai politikus. Meskipundemikianakar masalahnya, namun seyogyanya pemerintah diharapkan juga peran aktifnya menyiasati perkembangan perdukunan di tanah air. Dengankatalain,masalahinisemestinyatidak sebatas diposisikan sebagai problema akidah di kalangan umat beragama. Ia juga bagian dari masalah-masalah sosial yang padaakhirnyamemicuperubahankearah ketegangan sosial. Sebab, praktik perdukunan selalu menaburkan bibit-bibit permusuhan dan kebringasan di kalangan masyarakat kita. Pembantaian terhadap seseorang/keluarga dipicu oleh isu “begu ganjang” yang sering terjadi si Sumatera Utara, adalahsebuahcontohyangperludirenungkan. Penulis adalah Alumni IAIN-SU, Staf Pengajar SMK Negeri I Lubukpakam.

Momentum Besar Dari Badai PKS Oleh Hari Murti, SSos

Facebook Smswaspada

+6285277850101 Fachri H dari PKS (Biawak) kebakaran JENGGOT/panik/galau terhadap KPK (cicak). He..he..he.

WASPADA Sabtu 25 Mei 2013

... entah karena memang tak-tis atau karena tak bisa dihindari, PKS sedang melepaskan duri-duri itu dalam waktu cepat.


dakah partai yang benar-benar bersih seratus persen? Rasanya saya tak perlu menulis jawabannya di sini. Karena badai partai selalu berkaitandengankorupsi,makajikaadapartai yang aman-aman saja dari badai, tidak terlalu salah jika dikatakan, pertama, badai belummendatangimereka.Kedua,karena mereka begitu rapi menyimpan pengundang badai itu. Tetapi, terlalu penat untuk membicarakan soal benar atau tidaknya partai yang sedangdiguncangbadaiitu—oknumatau institusinya—melakukankorupsi.Dengan kata lain, berangkat dari asumsi bahwa tak ada gading yang tak retak, tulisan ini tidak akan membahas benar tidaknya dugaan korupsi itu, baik oleh oknum atau institusinya.Biarkanpengadilannantiyang memutuskannya.Sayalebihbersemangat membahas adakah partai yang mau bergerak menjadi partai yang bersih dengan memanfaatkan momentum badai tersebut, yang menurutsaya,datangtepatwaktunya dalam kaitannya dengan Pemilu. Jawabannya bukan ada atau tidak, tetapi harus bergerak. PKS adalah salah satu partai itu. Badai telah berlalu dari Partai Demokrat,setidaknyasudahsepidimediamassa. Kini, badai itu menerpa PKS. Durasi badai yang menerpa PKS tampaknya akan lebih singkat dibanding yang menerpa Partai Demokrat. Lihat, tidak seperti Partai Demokrat yang sempat lama diterpa badai, PKS langsung sampai pada langkah jauhnya, misalnya LHI yang langsung berhenti dari jabatannya di partai. Lihat juga soal penyitaan mobil di kantor PKS yang awalnya berjalan alot, tetapi langsung clear beberapa hari kemudian. Ini menunjukkan bahwa badai itu tidak akan lebih lama dibanding misalnya badai Partai Demokrat karena tahapan badai begitu cepat dilalui. Dan, menurut saya pribadi, terlepas dari persoalan benar tidaknya ada kadernya yang bermain, alangkah bagusnya waktu kemunculan badai terkait Pemilu yang akan dilangsungkan lebih dari satu tahun lagi. Jika badai itu datang sekitar lima–enam bulan menjelang Pemilu, PKS sepertinya akan terpuruk lebih dalam.

Pemilu 2014, dalam konteks dinamika politik, masih cukup jauh. Dalam hal waktu dan aktivitas, masih banyak ruang gerak bagi PKS untuk memperbaiki keadaan, yaitu bergerak menuju keadaan yang memang diinginkan rakyat dari sebuah partai politik. Inilah yang saya sebut sebagai badai PKS tepat waktunya. PKS harus mampu bergerak secepat mungkin memperbaiki keadaan agar badai tersebut tidak berpanjangpanjang durasinya. Perhitungannya jelas adalah soal ketersediaan waktu menuju Pemilu dan soal memori negatif yang sebenarnya, diakui atau tidak, cepat hapus dari memori publik kita. Bukanlah saya mengajari PKS tentang manajemen waktu dan pola politik menuju Pemilu 2014 nanti, apalagi mengajari mereka memanfaatkan keterbatasan memori publik yang, ya, bisa dibilang singkat saja. Justru sebaliknya, saya ingin mendorong partai ini keluar dari badai menuju seperti yang diharapkan rakyat dari sebuah partai politik. Bahasa mudahnya seperti ini: Kalau PKS pandai membaca isyarat alam politik, sekaranglah, di waktu ramai badai seperti inilah, waktunya PKS mencabuti dan melemparkan duri-duri di dalam tubuhnya ke hadapan publik sehingga tidak punya beban besar lagi paling lambat setengah tahun menjelang Pemilu. Mereka yang bersalah harus diserahkan ke depan hukum dan yang benar harus dipertahankan. Tampaknya, entah karena memang tak-tis atau karena tak bisa dihindari, PKS sedang melepaskan duriduri itu dalam waktu cepat. Mengapa saya bersikap “melawan” arus publik terkait badai PKS? Karena tak ada kesalahan yang tidak bisa diperbaiki. Bagaimanapun, partai adalah aset besar bangsa di tengah kemungkinan besar munculnya aset baru yang tak bisa dijamin bersih dari awal sampai akhirnya. Dengan kata lain, ini adalah proses yang bukan hanya terjadi pada PKS, tetapi mungkin pada semua partai menuju partai bersih luar dalam. Sebagai sebuah institusi sosial, partai tidak dapat bersih tanpa bantuan publik dari luar. Kalau sebuah partai demikian bersihnya, publik menikmati bagian

terbesar dari kebersihan partai itu. Tetapi lihatlah jika partai dihantam badai karena ulah orang di dalamnya, publik marah-marah karena terkena getahnya. Salah-kah publik bersikap seperti itu? Tentu saja tidak. Tetapi, ini soal saling memberi dan menerima yang terbaik antara publik dengan aset sosial politiknya, partai. Sesuai Harapan Rakyat Tentu saja partai harus memenangi kue Pemilu. Salah satu caranya, setidaknya bagi PKS, adalah memanfaatkan badai ini sebagai momentum untuk bersih-bersih. Tetapi satu yang perlu dicatat, bahwa memanfaatkan momentum badai untuk bersih-bersih ini bukan melulu soal kue Pemilu. Lebih dari itu, tujuan sentralnya, adalah menjadikan badai ini sebagai langkah besar menuju partai yang sesuai dengan harapan rakyat. Kalau hanya kue Pemilu, biarkan saja badai ini karena pasti akan berlalu sendiri. Setelah berlalu, terjadi situasi sebaliknya di sisi partai, yaitu setidaknya tidak terlalu buruk raihan suaranya nanti. Namun, ini adalah soal idealisme untuk memberi yang terbaik bagi rakyat. Maka, manfaatkanlah momentum badai ini untuk menunjukkan diri pada rakyat bahwa kami bisa bergerak ke arah yang ideal dan semakin matang. Menjadi partai yang sesuai harapan rakyat, pasti diinginkan oleh setiap partai. Persoalannya, untuk bisa menjadi partai seperti itu, tidak mudah, sama sekali tidak mudah. Ada banyak oportunis, bahkan mungkin terbanyak yang memanfaatkan partai. Inilah yang menyakiti rakyat dan memukul partai itu sendiri. Karena itu, kuncinya adalah pada komitmen partai itu sendiri akan jadi sesuai harapan rakyat atau sekadar menjadi instrumen oportunis untuk menyakiti rakyat dan memukul partainya sendiri. Nah, karena kita sudah melihat para oportunis ini bergelimpangan hukum, maka arah yang dipilih sudah jelas, yaitu menjadi sesuai harapan rakyat. Untuk apa mereka ini dibiarkan di dalam partai karena yang berjaya dia sendiri, tetapi partainya morat-marit. Membiarkan para oportunis berada di partai sama seperti kapal dengan lebih dari satu nahkoda yang arahnya berlawanan. Kalau kapal sampai pecah, siapa saja yang tenggelam? Maka, ayolah PKS. Jadikanlah situasi ini bukan hanya badai, tetapi juga momentum bersih-bersih yang lebih dari sekadar kue Pemilu. Juga, untuk menjadi

aset bangsa Indonesia yang benar-benar bisa diandalkan. Jika tujuan yang kedua itu yang diprioritaskan, kue Pemilu akan datang lebih dari yang diduga. Kalau bukan kue Pemilu 2014, 2019 hanya butuh waktu lima tahun lagi. Lihat, PKS dan partai Islam lainnya sudah lebih bisa mandiri dibanding partai lain yang masih belum bergerak dari sosok populer di dalamnya. Soal institusionalisasi yang sejati, partai Islam jauh lebih maju dibanding partai-partai besar yang masih mengandalkan sosok-sosok populer di dalamnya. Jadi, pekerjaan mereka sudah bisa masuk tahap selanjutnya, yaitu mencabuti sosok-sosok yang mendestruksinya. Penulis adalah, Alumnus Sekolah Tinggi Ilmu Komunikasi”Pembangunan” Medan.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Poldasu peringkat pertama pelayanan terburuk - Alamak, ape nak jadi ni, he...he...he * Purwa Tjaraka: Indonesia krisis lagu anak - Maklum lagu anak kurang menarik * KNIA momentum peningkatan pariwisata - Makanya pesawat MAS mendarat duluan


D Wak

B7 Ekonomi & Bisnis B2SA Bisa Perbaiki Daging Sapi Masih Mahal Ekonomi Masyarakat

WASPADA Sabtu, 25 Mei 2013

BIREUEN (Waspada):Wakil Bupati Bireuen H MukhtarAbda, mengatakan, lomba cipta menu beragam, bergizi seimbang dan aman (B2SA) dapat menciptakan sumber daya manusia yang berkualitas dengan memperbaiki kualitas ekonomi masyarakat. Kombinasi berkualitas dapat diwujudkan apabila makanan yang dikonsumsi sehari-hari mengandung zat lengkap sesuai kebutuhan tubuh dengan jumlah berimbang. “Memang lomba memasak seperti terkesan acara serimonial saja. Namun dibaliknya, bila kita kaji mendalam, acara ini seperti ini dapat mendorong dan meningkatkan kreatifitas masyarakat, khususnya para ibu rumah tangga. Terutama dalam memilih, menentukan, menyusun, ciptakan menu berbasis sumber daya lokal dengan pangan sumber karbohidrat selain beras dan terigu,” katanya dalam acara B2SA berbasis makanan khas daerah dan menu serba ikan, di halaman Meuligoe Bupati, Kamis (23/5).

PEMATANGSIANTAR (Waspada): Harga daging sapi di pasar-pasar daging di kota Pematangsiantar, sampai Jumat (24/5), masih bertahan mahal. Yakni dikisaran Rp85.000 per kg. Dengan harga demikian, minat masyarakat untuk membeli daging jauh menurun. Ini membuat pedagang tidak berani menyediakan stok dalam jumlah banyak. Di rumah potong hewan (RPH) Jalan Malanton Siregar, menurut pantauan Waspada, aktivitas petugas pemotong hewan juga tidak banyak. Mereka terlihat sangat santai. Karena jumlah hewan yang masuk untuk dipotongkan ketempat itu sangat sedikit sekali. Hanya dua sampai tiga ekor sapi saja setiap harinya. Menurut salah seorang pedagang daging di pasar tradisional, Parluasan Pematangsiantar, Doglo Siregar, permintan pedagang rumah-rumah makan untuk membeli daging juga sangat menurun. Bahkan mereka (pedagang rumah makan) belakangan lebih memilih memperbanyak jualannya dari menu ikan laut dan ayam potong. Novi,salah seorang pengusaha rumah makan Ikola di Jalan Dr.Wahidin, mengatakan, dengan tingginya harga daging, masyarakat yang makan di kedainya juga belakangan ini lebih memilih menu ikan-ikan laut dan ayam. Sedikit sekali pembeli yang meminta menu daging.(c16

Waspada/ Mulia Siregar

Sejumlah petugas di rumah potong hewan Pematangsiantar, sedang menyelesaikan pekerjaannya memotong bagian-bagian sapi yang disembelih sebelum dijual ke pasar.

Rp6 T Untuk Bangun Desa JAKARTA (Waspada): Menteri Pekerjaan Umum, Djoko Kirmanto, mengatakan pihaknya memperoleh dana dari Anggaran Pendapatan dan Belanja Negara Perubahan (APBNP) 2013 Rp6 triliun. Dana tersebut akan dianggarkan untuk tiga program. Diantaranya untuk pembangunan desa baru. Berbicara di kantornya, Jakarta, Jumat (24/5), Djoko Kirmanto, mengatakan program pertama yang akan dijalankan dari dana itu adalah Program Percepatan Perluasan Pembangunan Infrastruktur Pedesaan (P4IP). Dananya mendekati Rp2 triliun. Dari dana sebesar Rp1,88 triliun, dia menjelaskan, akan digunakan untuk pembangunan di desa baru dan penyesuaian pada desa yang sebelumnya memang dianggarkan. “Total ada 8.490 desa yang akan men-

dapatkan bantuan Rp350 juta untuk pembangunannya,” ujar Djoko. Dari total 8.490 desa tersebut, kata Djoko, ada 2.450 desa baru yang menerima anggaran pada APBN-P. Sementara itu, ada 6.040 desa yang mendapatkan tambahan Rp150 juta, setelah pada anggaran tahun ini menerima Rp200 juta. Sedang-kan sisa dana Rp118,5 miliar untuk dana pendampingan bagi 1.225 fasilitator, penyiapan masyarakat dan pembinaan manajemen. Program kedua, katanya, dana sebanyak Rp2 triliun lagi akan digunakan untuk program penyediaan air minum. Djoko, mengatakan ada 318 desa nelayan, termasuk lokasi pelabuhan perikanan dan pangkalan pendaratan ikan mendapatkan Rp1 miliar pada setiap desanya.

Selain itu, menurut Djoko, dana tersebut akan digunakan untuk penyediaan air minum bagi 260 desa dan 35 ibu kota kecamatan rawan air sebesar Rp742 miliar. Sedangkan sisa dari Rp2 triliun yang kedua itu, akan digunakan untuk penyediaan air minum untuk masyarakat berpenghasilan rendah perkotaan di 341 kawasan sebesar Rp940 miliar. Kemudian, sisa Rp2 triliun lagi dari anggaran seluruhnya Rp6 triliun tersebut untuk program pengembangan infrastruktur air minum di daerah rawan air di 93 kabupaten kota sebesar Rp899,5 miliar. Lalu, sebanyak Rp299,5 miliar akan digunakan untuk perlindungan kawasan pantai dan pemukiman nelayan miskin. Selain itu, perbaikan irigasi kecil di 4.000 desa mendapatkan Rp810,1 miliar. (vvn)

Stok Beras Bulog 4.650 Ton MEULABOH (Waspada) : Stok Beras di Bulog Meulaboh, Aceh Barat mencapai 4.650 ton untuk tahun 2013. Sedangkan tahun 2012 hanya 2.030,000ton. Kepala Bulog sub Drive Aceh Barat M.Junaidi, Kamis (23/5), di ruang kerjanya mengatakan selain stok 4.650 ton itu masih ada lagi penambahan beras dalam kemasan lebih kurang 2.000 Ton.

Dengan adanya peningkatan itu maka Bulog bisa mandiri. Tidak lagi mengharapkan dari luar atupun provinsi. Menurut Junaidi, stok beras Bulog tahun 2013 ini bisa meningkat karena pihaknya langsung turun ke kilang-kilang padi kecil maupun besar. Sedangkan pada 2012, Bulog hanya pasif menunggu laporan saja.

‘’Dari temuan di lapangan, kami temukan ternyata banyak pemilik kilang tadak tahu sama sekali apa itu Bulog,’’ katanya. Berkaitan dengan ketersediaan beras, Junaidi, mengharapkan para petani, khususnya barat selatan supaya melakukan penanaman serentak, sehingga nantinya harga bisa stabil dan hama perusak padi juga bisa berkurang.(cb07)


Direktur Hubungan Pemerintahan & Manajemen Resiko Giant Supermarket Yudhi Komarudin (dua dari kiri) dan Direktur Marketing Giant Supermarket Wirry Tjandra (paling kanan) bersama Dandim Percut Seituan, Camat Percut Seituan, dan Kepling setempat disaksikan Direktur Operasional Giant Supermarket Arief Nasruddin bersama memotong pita menandai diresmikannya Giant Supermarket Jl.Williem Iskandar Medan (Pancing), Jumat (24/5).

Usai Diresmikan, Giant Pancing Diserbu Pembeli MEDAN (Waspada): Tidak lama usai dibuka secara resmi, Giant Supermarket Jalan Williem Iskandar (Pancing) langsung diserbu pembeli, Jumat (24/5). Masyarakat berbondong-bondong mendatangi supermarket yang berkomitmen menjadikan produk lokal menjadi nasional ini. Dalam acara peresmian, Direktur Operasional Giant Supermarket Arief Nasruddin mengatakan bahwa Giant yang diresmikan hari itu adalah yang kedua di Medan. Sebelumnya telah diresmikan Giant Supermarket di Jalan HM.Joni Medan. “Secara nasional ini adalah Giant Supermarket yang ke 106,” sebut Arief. Hadir dalam acara peresmian tersebut Camat Percut Seituan, Danramil Percut Seituan, Kapolsek Percut Seituan, Lurah Medan Estate, juga kepala lingkungan setempat. Acara yang berlangsung sederhana itu digelar di depan pintu masuk Giant Supermarket Pancing tersebut. Sementara itu, Luas Pandang Purba selaku Store Mana-

ger Giant Supermarket Pancing, lebih jauh menjelaskan, bahwa ramainya pengunjung karena memang masyarakat menunggu hadirnya Giant di daerah tersebut. “Pembukaan Giant ini memang sudah ditunggu-tunggu masyarakat. Karena sejak beberapa hari yang lalu orangorang datang dan menanyakan kapan dibuka,” papar Luas Pandang Purba. Dia juga menjelaskan bahwa dalam setiap peresmian supermarket Giant, bersamaan dengan itu diluncurkan program beasiswa One Store One School (OSOS). Program ini adalah program pemberian beasiswa bagi pelajar berprestasi di sekolahnya yang berasal dari keluarga kurang mampu. “Tujuan program ini adalah memberikan dukungan anak didik berprestasi supaya mereka bisa lebih mengembangkan prestasi pendidikannya di masa yang akan datang,” ujar Luas Pandang Purba. Dia menambahkan, program OSOS ini diberikan kepada tiga anak didik setiap kali

dibuka satu Giant Supermarket. “Beasiswa yang diberikan dalam bentuk uang tunai sebesar Rp2 juta per tahun per anak. Untuk kali ini diberikan kepada anak didik di Sekolah Dasar SD 101778 Percut Seituan,” jelasnya. Selain menjual bahanbahan kebutuhan pokok seperti beras, gula, minyak, sayuran, buah-buhan dan lainnya, Giant Supermarket juga menyediakan tempat makan bagi pengunjung. “Di supermarket Giant kita ada Giant Fried Chicken (GFC) yang menyediakan berbagai paket makanan yang menarik dengan harga terjangkau mulai dari Rp9.900,” ujarnya. Giant Supermarket dalam operasionalnya lebih banyak menjual produk lokal daripada produk nasional. Di supermarket ini ada 60 persen barang lokal, dan 40 persen yang dipasok dari District Center (DC) Cibitung, Jakarta. “Kalau produk yang didatangkan dari DC sudah bisa dipasok secara lokal, maka kita akan menggunakan produk lokal,” katanya.(m07)

BI Siap Antisipasi BBM Naik JAKARTA (Antara): Gubernur Bank Indonesia (BI) Agus Martowardojo, mengatakan pihaknya sudah menyiapkan berbagai instrumen untuk mengantisipasi tingginya inflasi sebagai akibat rencana kenaikan harga bahan bakar minyak (BBM) bersubsidi. Berbicara di Jakarta, Jumat (24/5), Agus Martowardojo, mengatakan BI akan terus mengikuti dan menyimak perkembangan pembahasan RAPBNP mengenai kenaikan BBM ini. ‘’Tentu pasar sudah menduga akan ada tekanan inflasi dan kita siap meresponnya,” kata Agus. Menurutnya, BI menyiapkan berbagai kebijakan untuk menahan laju inflasi yang diperkirakan akan membengkak akibat kenaikan harga BBM ini. “Kalau itu terjadi BI akan keluar dengan bauran kebijakan untuk merespon kondisi itu,” katanya. Dijelaskannya, BI memiliki banyak instrumen untuk merespon lonjakan inflasi seperti dengan menaikkan BI rate, kebijakan nilai tukar dan lain-lain serta bisa bekerja sama dengan lembagalembaga lain. Agus menegaskan bahwa respon yang akan dilakukan BI tidak semata-mata hanya dengan suku bunga, karena banyak instrume yang bisa diambil untuk mengendalikan inflasi yang muncul karena kebijakan Pemerintah atau administered price ini. Sebelumnya, Deputi Gubernur Bank Indonesia Perry Warjiyo memperkirakan dampak langsung inflasi dari kenaikan harga BBM Rp1.000 per liter sebesar 0,62 persen, sehingga jika Pemerintah menaikkan Rp2.000 akan berdampak inflasi langsung sebesar 1,24 persen. Angka itu belum menghitung dampak inflasi tidak langsung seperti kenaikan harga barang-barang dan transportasi. Pemerintah sebelumnya mengubah asumsi inflasi di APBN 2013 sebesar 4,3 persen menjadi 7,2 persen di RAPBNP 2013.

Vietnam Pesaing Indonesia Ke Ukraina KIEV (Antara): Indonesia mewaspadaiVietnam sebagai pesaing untuk merebut ekspor lebih besar ke Ukraina yang merupakan pasar kedua terbesar setelah Rusia di kawasan Eropa Timur. Saat ini Indonesia telah menempati (ekspor) urutan nomor satu di antara negara anggota Asean di Ukraina. Duta Besar Indonesia untuk Ukraina Niniek Kun Naryati, mengatakan itu di Kiev, Kamis (23/5). Dia menyebutkan itu pada pertemuan dengan Dirjen Pengembangan Ekspor Nasional (PEN) dan sejumlah pejabat dari kementerian terkait, serta pengusaha yang ikut dalam pameran bertajuk Window to Indonesia. Namun, menurut Niniek, Vietnam perlu diwaspadai, karena mulai ekspansif dan nilai ekspornya di Ukraina mendekati Indonesia. Selain Vietnam, Indonesia juga waspada terhadap Thailand, yang mulai gencar masuk ke pasar Ukraina, karena Thailand memiliki produk yang lebih bervariasi. Oleh karena itu, dia berharap pameran Window to Indonesia yang berlangsung mulai 24-26 Mei 2013 mampu mendongkrak ekspor Indonesia ke Ukraina yang GDP-nya telah mencapai sekitar 7.500 dolar AS per kapita. Pada tahun lalu, total nilai ekspor Indonesia ke Ukraina baru mencapai sekitar 548 juta dolar AS. Turun 3,65 persen dibandingkan tahun 2011 sebesar 569 juta dolar AS. Produk Indonesia yang diekspor ke negara tersebut sebagian besar adalah minyak sawit mentah (CPO), tekstil, sepatu, dan produk kehutanan, termasuk furnitur. Sedangkan impor Indonesia dari Ukraina mencapai sekitar 774 juta dolar AS pada 2012. Naik sekitar 10,33 persen dibandingkan tahun sebelumnya, dengan produk antara lain scrap, baja, dan gandum.

Berupaya Dongkrak Ekonomi Melalui Kain Klos KAMPAS kopling (kain klos) kendaraan, baik mesin diesel dan non diesel, juga sepeda motor memiliki fungsi untuk menggerakkan dan memindahkan persinelling. Problem kain klos aus kadang sering dialami oleh pengemudi mobil. Bagaimana cara menanganinya manakala keuangan anda sedang tipis?. Adamal Tampubolon, 36, seorang mahasiswa jurusan ekonomi di PTS Kota Padangsidimpuan menggeluti usaha kain klos manual. Kain klos buatan tangannya dijual dengan harga murah dibandingkan di harga buatan pabrik. Usahanya ini telah pula mengantarkannya hingga ke bangku perkuliahan. Bukan hanya itu, berkat usaha kecilnya ini, Adamal juga telah mampu menafkahi tiga orang anaknya dari istrinya yang berprofesi sebagai guru SD di kota itu. Dia sendiri saat ini sedang menyususn skripsi. Namun Adamal, berupaya mendongkrak ekonominya demi masa depan yang lebih baik di bengkel sewaannya. Merakit kain klos yang sederhana di Jalan Sudirman, Kelurahan Sadabuan, kota Padangsidimpuan. ‘’Harga kain klos rakitan kita masih terjangkau harganya dibandingkan buatan pabrik. Bila mesin tak kuat lagi ditanjakan, berarti kain klosnya sudah aus,’’ujarnya kepada Waspada, Rabu (22/5). Ahmad Cerem Meha

Waspada/Ahmad Cerem Meha

ADAMAL Tampubolon, 36, seorang mahasiswa jurusan ekonomi di PTS Kota Padangsidimpuan sedang mengerjakan kain klos manual, di bengkelnya.

Untuk menunjang hal tersebut, kataWabup, diperlukan membangun budaya keluarga dan masyarakat untuk mengkomsumsi aneka menu makanan khas daerah sesuai prinsip B2SA melalui hasil pemamfaatan pekarangan. Sekretaris BP2KP Bireuen Mursyid SP menambahkan, lomba B2SA yang diikuti sejumlah tim dari kecamatan tersebut bertujuan untuk membudidayakan pemakaian bahan mudah didapat, bukan dari beras dan terigu. Sekaligus upaya untuk mengembangkan produk lokal dan makanan khas daerah. Keluar sebagai pemenang lomba, juara I diraih tim Kecamatan Jeunieb dan I Kecamatan Kota Juang meraih juara I. Sedangkan juara II Kecamatan Peusangan, juara III Kecamatan Pandrah. Harapan I Kecamatan Kuala, II Kecamatan Kutablang, III Kecamatan Samalanga. Untuk juara harapan lomba menu serba ikan. Juara harapan I diraih Kecamatan Simpang Mamplam, II Kecamatan Peudada, III Kecamatan Jangka. (cb02)

Masih Banyak PR Untuk Hadapi MEA JAKARTA (Antara): Ketua Kamar Dagang dan Industri (Kadin) Indonesia Suryo Bambang Sulisto, mengatakan Indonesia masih memiliki banyak pekerjaan rumah (PR) yang harus diselesaikan untuk menghadapi Masyarakat Ekonomi Asean (MEA) 2015. PR yang harus dikerjakan tersebut, menurut Suryo Bambang Sulisto, di Jakarta, Jumat (24/ 5), yaitu infrastruktur, reformasi birokrasi, lahan dan penguatan usaha mikro, kecil dan menengah. Suryo, mengatakan MEA tidak perlu disikapi sebagai ancaman. MEA justru harus disikapi sebagai tantangan dan peluang bagi Indonesia untuk mengembangkan dan menumbuhkan perekonomian. Menurut Suryo, sepanjang perjalanan MEA, Indonesia perlu mengeluarkan kebijakan yang integratif antarkomponen. Yaitu pemerintah dan pelaku ekonomi. “MEA juga memerlukan peran sentral daerah. Karena itu, perlu ada

harmonisasi kewenangan antara pemerintah pusat dan daerah,” ujarnya. Menurut Suryo, Indonesia saat ini belum secara sistemik dan konsisten menyiapkan masyarakat dan usaha mikro kecil dan menengah (UMKM). Akibatnya, UMKM belum siap dan mampui bersaing dalam MEA. “UMKM harus ikut berperan dalam MEA. Indonesia memang masih harus bekerja keras untuk menghadapi MEA dengan mengintegrasikan komponen-komponen dalam negeri,” tuturnya. Suryo Bambang Sulisto menjadi salah satu pembicara dalam seminar “Kesiapan Ekonomi Negara-Negara di Kawasan Asia Tenggara dalam Menghadapi MEA 2015”. Selain Suryo, pembicara lain adalah ekonom CSIS Djisman Simanjuntak, ekonom BNI Ryan Kiryanto, Kepala Divisi Riset Bursa Efek Indonesia Poltak Hotradero dan Ketua Asean Competitiveness Institute Soy Pardede.

Patra Niaga Pasok BBM Ke PLTGU Belawan JAKARTA (Antara): PT PLN (Persero) menetapkan PT Patra Niaga sebagai pemasok bahan bakar solar ke PLTGU Belawan, di Medan. Kepala Divisi BBM dan Gas PLN Suryadi Mardjoeki, di Jakarta, Jumat (24/5) mengatakan, Patra Niaga akan memasok total 750.000 kiloliter solar dengan nilai sekitar Rp6 triliun. “Setiap tahun Patra Niaga akan memasok 250.000 kiloliter selama tiga tahun antara 2013 hingga 2016,” katanya. Menurut dia, penandatanganan perjanjian jual beli bahan bakar minyak (PJBBBM) direncanakan Mei ini. Selain Patra, PLN juga menetapkan PT Kutilang Paksi Mas (KPM) sebagai pemasok BBM ke pembangkit di Bangka Belitung. Volume BBM yang dipasok KPM mencapai 40.000 kiloliter per tahun selama tiga tahun (2013-2016) atau total senilai sekitar Rp990 miliar. Menurut dia, Patra dan Kutilang akan mulai memasok BBM pada Juli 2013. Pasokan Patra

Niaga ke Belawan tersebut menggantikan PT Shell Indonesia yang sudah habis kontraknya pada Maret 2013. Total kebutuhan PLTGU Belawan kini sekitar satu juta kiloliter per tahun. Selain Patra Niaga, perusahaan yang memasok BBM ke PLTGU Belawan adalah Pertamina sebanyak 50 persen atau sekitar 500.000 kiloliter dan KPM 250.000 kiloliter per tahun. Kebutuhan BBM PLTGU Belawan bakal bertambah dikarenakan terhentinya pasokan gas dari Lapangan Glagah Kambuna. Dalam RAPBN Perubahan 2013, pemakaian BBM pembangkit ditargetkan 6,27 juta kiloliter yang terdiri atas solar 4,85 juta kiloliter dan minyak bakar 1,42 juta kiloliter. Pemakaian BBM tersebut terdiri atas PLN dan pengembang swasta. Dengan asumsi harga yang dipakai Rp9.169 per liter solar dan Rp6.325 per liter minyak bakar, maka perkiraan pembelian BBM pembangkit 2013 adalah Rp53,45 triliun.


Rahmat didampingi Operation Manager Auto 2000 Wilayah Sumatera Hendra Purnawan, Kepala Cabang (Kacab) Auto 2000 Medan SM Raja Herry Liu, Kacab Auto 2000 Medan Amplas Martogi Siahaan, Kacab Auto 2000 Medan Gatsu Herry Deswanto, Kacab Medan Krakatau Dodi Herwindo dan Kacab Auto 2000 Medan Pancing Rudy Chandra foto bersama pada peluncuran New Toyota Avanza.

Toyota Incar Penjualan Avanza Hingga 19.000 Unit MEDAN (Waspada) : PT Toyota Astra Motor (TAM) mengincar penjualan kendaraan Toyota Avanza sebanyak 19.000 unit per bulan. Saat ini, penjualan kendaraan yang masuk kategori MPV low tersebut sebanyak 16.000-17.000 unit per bulan. Hal itu dikatakan Marketing Director PT TAM Rahmat Samulo, kepada wartawan di Medan, Rabu (23/5). Dalam kesempatan itu, Rahmat didampingi Operation Manager Auto 2000 Wilayah Sumatera Hendra Purnawan, Kepala Cabang (Kacab) Auto 2000 Medan SM Raja Herry Liu, Kacab Auto 2000 Medan Amplas Martogi Siahaan, Kacab Auto 2000 Medan Gatsu Herry Deswanto, Kacab Medan Krakatau Dodi Herwindo dan Kacab Auto 2000 Medan Pancing Rudy Chandra. Rahmat mengatakan, pihaknya memperkirakan penjualan Avanza akan mencapai 19.000 unit per bulan dalam waktu dekat. Hal ini seiring dengan diluncurkannya New Toyota Avanza dan New Toyota Avanza Veloz. “Kami bersyukur, sejak diluncurkan 9 tahun lalu, Avanza dapat diterima secara antusias oleh masyarakat Indonesia sehingga mobil ini dapat meraih pencapaian penjualan legendaris, yaitu mencapai 1,1 juta unit, tidak hanya di pasar domestik, namun juga di 27 negara. Antusiasme ini sekaligus memacu kami melakukan improvement guna memberikan yang terbaik bagi masyarakat Indonesia, melalui New Toyota Avanza dan New Toyota Avanza Veloz,” jelasnya. Disebutkannya, dalam varian terbaru ini,

pihaknya menambahkan beberapa fitur berkaitan dengan keamanan, kenyamanan dan keindahan. Seperti adanya dual airbags, front seatbelt pretensioner/ force limiter, driver seatbelt warning, sliding brake pedal, dan knee bolster bagi pengendara. Untuk meningkatkan kenyamanan, terdapat fitur seat and trim dengan new back cushion yang lebih tebal di semua grade. Semua grade juga dilengkapi head rest di baris kedua dengan saddle type Selain itu, untuk menambah kenyamanan, kendaraan ini juga dilengkapi dengan hadirnya improvement pada noise, vibration dan harshness. Ditambahkannya, kendaraan ini dikembangkan sesuai kebutuhan Indonesia serta kondisi geografis negara ini. Salah satu ciri terlihat adalah ground clearence mencapai 200 mm, penggunaan penggerak belakang serta kabin yang lega. “Kendaraan yang diproduksi di Indonesia ini telah memiliki kandungan lokal atau local content sesuai dengan standar Toyota,” tambahnya. Operation Manager Auto 2000 Wilayah Sumatera Hendra Purnawan menambahkan, saat ini penjualan Avanza di Sumatera Utara tercatat sebanyak 800 unit per bulan. “Market share kendaraan ini sebesar 50 persen dari total penjualan seluruh merek di kelas MPV low yang sebanyak 1.600 unit per bulan. Bahkan akhir-akhir ini, market share tersebut meningkat menjadi 60 persen,” ujarnya.(m38)



WASPADA Sabtu 25 Mei 2013

“Bunda Pasti Bangga” Dies Natalis STIK-P XXVI Meskipun dirayakan sederhana, Dies Natalis Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan ke-26 tetap meriah. Terlihat jelas raut wajah bahagia dari civitas akademik kampus orange saat merayakan ulang tahun di aula kampus tersebut, Jl SM Raja No 84 Medan, Sabtu (18/5) malam. Ketua STIK-P, Hj Ida Tumengkol BComm MHum, mengawali sambutannya dengan bercerita tentang sejarah berdirinya sekolah tinggi tersebut. Di hadapan hadirin, Ida mengaku teringat pesan Bunda Hj Ani Idrus (almh) setiap kali menggelar perayaan Dies Natalis. “Ada wasiat yang saya terima agar STIK-P tetap berdiri dan berkembang meneruskan cita-cita Bunda. Alhamdulillah ini periode kedua saya menjadi ketua dan STIK-P tetap berdiri sekaligus mampu bersaing dengan lulusan kampus lain dalam era globalisasi ini,” kata Mem Ida, sapaan akrabnya. “Betapa bangganya jika Bunda bisa melihat kampus yang telah susah payah dibangun dengan penuh perjuangan ini, masih tampak gagah berdiri melahirkan banyak lulusan sarjana ilmu komunikasi andal dan mampu bersaing di dunia kerja. Saya pun ikut bangga karena masih mampu meneruskan harapannya yang meminta STIK-

P harus terus eksis menghadapi segala tantangan di depannya,” lanjut Mem. Meski tak semegah kampus lain, STIK-P tak kalah bersaing dalam mencetak lulusan siap pakai. Terbukti, STIK-P telah banyak melahirkan jurnalis andal yang tersebar di berbagai media massa di Medan maupun kota besar lainnya. Tak mau ketinggalan, lulusan Public Relations (PR) juga sudah banyak menuai sukses dan memiliki peranan strategis. “Secara kualitas, STIK-P sudah mengikuti standar kurikulum nasional dilengkapi sarana prasarana yang memadai menunjang kegiatan perkuliahan serta telah mendapatkan Akreditasi BAN PT,” ungkap Ida lagi disambut aplaus keluarga besar STIKP yang hadir. Acara dilanjutkan dengan pemotongan kue oleh petinggi kampus. Kemeriahan makin bertambah saat pembagian hadiah peserta lomba Dies Natalis, lucky draw, dan pemutaran video kegiatan kampus selama satu tahun terakhir yang mengun-

Waspada/Arianda Tanjung

KETUA STIK-P Hj Ida Tumengkol BComm MHum (2 kanan) didampingi sejumlah dosen memotong kue Dies Natalis STIK-P ke-26 di aula kampus tersebut, Sabtu (18/5) malam. dang tawa dan haru. “Semoga STIK-P selalu jaya, terus berkarya, dan menghasilkan sarjana-

sarjana berkualitas dan tangguh, agar tidak kalah bersaing dengan kampus lain serta mampu menghadapi peru-

bahan globalisasi saat ini,” demikian seruan sejumlah mahasiswa kepada Kreasi.

Hidup STIK… Hidup STIK… Hidup STIK Pembangunan ! Jayalah terus kampus orange menggapai cita-

citamu. Congrats! *Afli Yarman & Dio Utama

JUARA The Voice diabadikan bersama Ketua STIK-P Hj Ida Tumengkol BComm MHum (tengah). -Waspada/Arianda Tanjung-

PUKET II Suprapti Indah Putri SP MIKom (tengah) bersama para juara Live Report dan News Presenting. -Waspada/Arianda Tanjung-

JUARA lomba fotografi ‘Gebyar Honda CB150R’ kategori mahasiswa dan profesi bersama dosen fotografi Ferdy Siregar (3 kanan). -Waspada/Afli Yarman-

KETUA STIK-P Hj Ida Tumengkol BComm MHum foto bersama tiga peserta terbaik lomba menulis feature ‘Prabudi Said Award’. -Waspada/Arianda Tanjung-

Hasil Lengkap Pemenang Lomba

Mahasiswa STIK-P Kritis & Kompeten Program Indonesia Memilih Metro TV PULUHAN mahasiswa Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan berkumpul di pelataran parkir kampus, Jl SM Raja No 84 Medan, Senin (20/5). Yang pasti bukan mau tawuran atau habis pulang nonton PSMS Medan tanding, melainkan nonton bareng peluncuran program ”Indonesia Memilih” dengan tema

Satu Nusa Satu Suara dari Metro TV. Sebagai bentuk kepedulian pada rakyat Indonesia yang akan menggunakan hak pilihnya dalam pemilihan presiden dan calon anggota legislatif 2014, tayangan perdana program tersebut disiarkan langsung dari Senayan, Jakarta, serta beberapa kota lainnya di antaranya Medan, Surabaya, dan Makassar. Di Jakarta, hadir 12

perwakilan partai politik nasional, dua parpol lokal Aceh, pengamat politi, dan narasumber lainnya yang dapat berinteraksi langsung dengan pemirsa. Selain para politikus, Nidji pun meramaikan malam peluncuran. Kota Medan tak mau kalah, kru Metro TV live di Kampus STIK-P. Diawali penandatanganan spanduk massal oleh mahasiswa menyoal kriteria presiden

pilihan mereka, kegiatan dilanjutkan dengan wawancara langsung dua mahasiswa. Kedua mahasiswa ilmu komunikasi nan beruntung itu adalah Ayu Alfinia Qori dan Syarah Aprilia. “Seperti terlihat di spanduk, mahasiswa STIK-P menuliskan aspirasi serta beberapa pendapat kritis di antaranya “pemerintah jangan hanya memperkaya keluarga sendiri” dan “lebih baik golput”. Ini menandakan mahasiswa memang kritis dengan pemerintah, terutama saat pemilihan pemimpin di negeri ini,” ujar Syarah

kepada Kreasi. Kekecewaan terhadap pemerintah sebagaimana diutarakan Syarah memang banyak dirasakan masyarakat, tapi sebagai warga negara yang baik kita tidak boleh golput. “Pastinya masingmasing dari kita memiliki harapan terhdap pemerintah, sehingga sayang aja kalo kesempatan memilih tidak dipergunakan. Tentu kita semua berharap pemerintah yang bertanggung jawab, bukan hanya janji manis aja,” sambung Ayu Qori. Penanggung Jawab

Program Indonesia Memilih Wilayah Sumbagut, Romi Siahaan, mengatakan alasan dipilihnya STIK-P di Kota Medan karena kampus tersebut memiliki jurusan ilmu jurnalisme. “Di awal, kami memang sengaja memperkenalkan program ini di kampus. Alasannya karena kampus wadah lahirnya kaum intelektual yang diharapkan kritis dengan pemilu mendatang. Dalam hal ini, mahasiswa STIK-P pun saya rasa cukup kritis serta kompeten,” tutup Romi. *Arianda Tanjung

� Ranking I

: Ahmad Fauzi

� Fotografi Mahasiswa Profesi

: M Rajab, Adil Syahputra, Indah Permata Sari : M Hamdani, Arianda Tanjung, Hang Tuah J Said

� Menulis Feature : Kartika Ayu, Christopel Naibaho, Dio Utama Nst � The Broadcasters Live Report : Wiwin Vamela, Kartika Ayu, Oktri Safridiani News Presenting : Ayu Alfinia Qori, Antonius Naibaho, Bella Destaria � The Voice Pria Wanita � Tenis Meja Tunggal Putra Tunggal Putri Ganda Putra

: Rully Hasta, Rio Azhari, Arif Rahman : Anggina Iasha, Wiwin Vamela, Isni Armardani : Dian Kristanto, Abdul Khoir, Christopel : Oktri Safridiani, Nining Sitorus, Fauziah Dongoran : Christopel/Adil S, Andi Arispati/Hamdani, Austin T/Dian K

� Basket 3 On 3 Putra Putri

: Taka-Tiki, Seleb STIK-P, Peluru Gaya : Putri All-Star, Caur Angels, Starball

� Futsal Putra Pemain Terbaik Top Skor Putri Pemain Terbaik Top Skor Tim Fair Play

: Tim Sisa Dunia, Gunners FC, Potret FC : Austin Tumengkol (TSD) : Phillip Joseph (Taka-Tiki/14 gol) : Diamond FC, Caur Angels, B’Girlz Plus : Wierna Fawliza (Caur Angels) : Rika Urrahmah (Diamond) & Nining (BGirlz/4 gol) : Federasi FC

Info Kreasi Waspada/Afli Yarman

DUA mahasiswi STIK-P, Ayu Alfinia Qori (tengah) dan Syarah Aprilia (kiri), diwawancara oleh reporter Metro TV dalam acara peluncuran program ”Indonesia Memilih”, yang ditayangkan langsung dari kampus tersebut, Jl SM Raja No 84, Medan, Senin (20/5).

Waspada/ Afli Yarman

ASPIRASI mahasiswa STIK-P dituangkan di atas spanduk dalam rangkaian acara peluncuran perdana program Indonesia Memilih oleh Metro TV.

Jika sekolah atau kampus (Medan sekitarnya) kalian bikin kegiatan dan ingin diliput tim Kreasi, silakan hubungi: Afli (085658109651), Arianda (085658008201), Dio (085262748330)

Waspada, Sabtu 25 Mei 2013  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you