Page 1

Harga Eceran Rp3.000,-

Jhonny Alen Dan Sutan Disebut Peminta Upeti

Demi Kebenaran Dan Keadilan


BPIH Calhaj 2013 Tertunda Dikembalikan AS$ 308

CIREBON(Antara): Calon haji 2013 yang tertunda JAKARTA (Waspada): Dua anggota DPR dari Partai keberangkatannya namun sudah melunasi Biaya PenyeDemokrat yang juga dari Dapil Sumut disebut sebagai lenggaraan Ibadah Haji (BPIH) akan mendapat pengempeminta upeti kepada PT.Pertamina. balian dana rata-rata sebesar 308 dolar AS per jamaah. Hal itu disebutkan penasihat hukum Direktur Utama Pengembalian dana tersebut, menurut Dirjen PenyePT Pertamina Galaila Karen Agustiawan, Rudy Alfonso Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) lenggaraan Haji dan Umroh Kemenag Anggito Abimanyu bahwa Jhonny Allen Marbun dan Sutan Bhatoegana ISSN: 0215-3017 di Cirebon, Selasa(4/3), merupakan konsekuensi dari pernah meminta upeti dari dua anak buah Karen. penurunan BPIH 2014. Penegasan itu disampaikan Rudy di Pengadilan Tipikor RABU, Pon, 5 Maret 2014/3 Jumadil Awal 1435 H No: 24510 Tahun Ke-68 Terbit 24 Halaman “Sebagaimana kita Jakarta, Selasa (4/3). Katahu, tahun lalu, keberen juga datang bersaksi rangkatan 20% jamaah untuk terdakwa mantan calon haji Indonesia terKepala SKK Migas, Rudi paksa ditunda. Padahal, Rubiandini sebagian besar dari meRudy membenarkan reka sudah dipanggil dan Karen pernah diperiksa MEDAN (Waspada) : Lembaga Bantuan melunasi BPIH. Nah, undan kesaksiannya diHukum (LBH) Medan menggelar aksi bakar tuk mereka yang sudah tuangkan dalam Berita ban dan orasi mendesak KPK memeriksa lunas (tetapi tertunda Acara Pemeriksaan (BAP) pejabat PLN dari daerah hingga pusat terkait kebe-rangkatan) uang tertanggal 8 November pemadaman di Sumatera Utara. LBH juga 308 dolar AS itu dikem2013 di KPK. mendesak Presiden Susilo Bambang Yudhobalikan,” katanya. Bahkan dia membeyono mencopot Menteri BUMN. Ia mengatakan, pronarkan anggota Komisi “Dalam sehari, pemadaman listrik di ses pengembalian uang VII Fraksi Partai DemoSumatera Utara bisa mencapai tiga sampai itu akan dilakukan di asrakrat Jhonny Allen meempat kali,bahkan dengan durasi waktu ma haji embarkasi menminta sejumlah uang pemadaman yang lama sehingga aktivitas jelang keberangkatan ke dari dua anak buah Kamasyarakat terganggu,’’ kata Direktur LBH Arab Saudi dan diberikan ren, Afdal Bahaudin dan Medan Surya Adinata, Selasa (4/3). secara tunai. Hanung Badya. LBH,kata Surya mengimbau seluruh ma“Hanya, untuk mata Keduanya bahkan syarakat untuk ikut berjuang dengan melauang yang digunakan, pernah dipanggil Jhonny kukan aksi massa terkait permasalahan listrik masih kami pertimbangdan Ketua Komisi VII di Sumatera Utara hari ini (5/3 -red) dengan kan. Apakah dolar, riyal, DPR Fraksi Demokrat titik kumpul di LBH Medan. atau malah rupiah. MaSutan Bhatoegana di ’’LBH telah membuka posko pengaduan sing-masing pilihan itu DPR. ”Iya ada. Yang dimasyarakat tentang listrik sejak seminggu ada plus minusnya. Selain minta itu benar (Hanung lalu,’’ kata Surya, dan menambahkan, banyak itu, besaran pengembadan Afdal). Iya (dua-duahal-hal buruk yang berpotensi muncul lian tersebut berbedanya) dipanggil (ke DPR),” diakibatkan ulah PLN yang tidak mendukung beda setiap embarkasi,” kata Rudy. kesejahteraan rakyat terkait pasokan listrik kata Anggito. Menurut Rudy, keyang tidak merata di daerah Sumatera Utara. Sebelumnya, pemesaksian itu Karen mende“Pemadaman listrik yang dilakukan secara rintah dan DPR sepakat ngar dari anak buahnya. massif banyak menyebabkan kerusakan BPIH untuk musim haji Kesaksian itu sifatnya de peralatan-peralatan elektronik, hubungan tahun ini (2014/1435 H) audito. Menurutnya, menarus pendek yang mengakibatkan kebakasebesar 3.219 dolar AS. jadi saksi itu tentu karena ran,meruginya pedagang dan terganggunya Angka tersebut lebih apa yang dia dengar atau aktivitas belajar mengajar di sekolah-sekolah rendah 308 dolar AS apa yang dia alami atau maupun kampus-kampus,” ujarnya. dibandingkan dengan apa yang dia ketahui. Lanjut ke hal A2 kol. 3 tahun lalu. Dengan “Permintaan itu ada. asumsi APBN 2014 (nilai Tapi saya tidak disampaiWaspada/Surya Efendi tukar rupiah Rp10.500), kan Bu Karen,” kata Rudy. GELAP GULITA: Ruko-ruko di kawasan Jl. Cirebon simpang Jl. Palangkaraya Medan, Selasa (4/3) malam, gelap gulita akibat listrik PLN padam. Tampak di foto hanya sebuah ruko menggunakan B PI H s e t a ra d e n g a n tenaga listrik genset. Lanjut ke hal A2 kol. 7 Rp33.779.500.

LBH Medan Desak KPK Periksa Pejabat PLN

Aceh Paling Rawan Pemilu Banyak Aksi Penembakan, BIN Minta Polisi Sweeping Senjata JAKARTA (Waspada): Kapolri Jenderal Pol. Sutarman mengungkapkan beberapa daerah yang rawan kerusuhan pada Pemilu 2014. Daerah yang rawan Pemilu yakni Aceh, Papua dan Poso.

Hal itu, kata Sutarman, berkaca dari pengalaman Pilkada beberapa waktu lalu. Di daerah-daerah ini kerap terjadi aksi kekerasan, mulai dari

intimidasi hingga penembakan. Dalam beberapa terakhir, ujarnya, penembakan sudah terjadi di Aceh. “Ada lima kali peristiwa, kor-

ban ada satu, termasuk beberapa kantor yang dilempar. Ini bagian yang terus kami amankan,” kata Sutarman di Kantor Presiden, Jakarta, Selasa (4/3).

Dari semua daerah, kata dia, paling rawan adalah di Aceh, disusul Papua dan Poso. Di daerah itu, kata dia, sudah ada ancaman kekerasan. Un-

tuk itu Sutarman menginstruksikan kepada KapoldaKapolda untuk memetakan titik kerawanan di daerah masing-masing.

Setelah Polda Polda sudah memetakan titik rawan, Sutarman meminta ada personel di titik-titik tersebut. Lanjut ke hal A2 kol. 4

Gubsu Minta Riau Atasi Kebakaran Lahan MEDAN (Waspada): Gubsu H Gatot Pujo Nugroho meminta kebakaran lahan di Riau bisa diatasi segera karena asapnya sudah mengganggu Sumatera Utara. “Perlu diatasi segera karena selain mengganggu masyarakat Riau juga warga Sumut,” kata Gatot Pujo Nugroho di Gubenuran Jl Sudirman, Medan, Selasa (4/3). Sebagai Gubsu, Gatot mengaku sudah mengingatkan Dinas Kehutanan dan Dinas Perkebunan untuk berjaga-jaga agar Lanjut ke hal A2 kol. 8

Bank Sumut Raih Penghargaan Islamic Finance Award Antara

SAMBUT KAPOLDA BARU: Kapolda Aceh yang baru Brigjen Pol. Husein Hamidi (tengah) disambut tarian pedang pada lepas sambut di Mapolda Aceh, Aceh, Selasa (4/3). Husein Hamidi menjadi Kapolda Aceh menggantikan Irjen Pol. Herman Effendi yang memasuki masa pensiun.

MEDAN (Waspada): Bank Sumut berhasil meraih dua penghargaan dari ajang Islamic Finance Award 2014 yang diselenggarakan Karim Business Consulting di Gedung UOB Plaza, Jakarta, kemarin malam. Lanjut ke hal A2 kol. 1


Ketua KPU DS 12 Pimpinan Parpol DS Sepakati Pemilu Damai Dan Seorang LUBUKPAKAM (Waspa- dang AKBP Dicky Patria Nega12 Pimpinan Partai Politik ra, Kapolres Pelabuhan BelaAnggota Dicopot da): (Parpol) peserta Pemilu 2014, wan AKBP Aswin Sipayung,

LHOKSEUMAWE ( Waspada) : Polres Lhokseumawe dalam serangkaian razia kendaraan bermotor di Jalan Lintas Medan–Banda Aceh, Selasa (4/3), menggagalkan pengiriman ganja 59 bal ke Sumatera Utara dan menyita satu mobil pribadi dan menahan dua orang diduga pemilik ganja. Puluhan kilogram ganja siap edar tersebut hendak dibawa ke luar Aceh melalui Kota Medan, kata Kapolres

MEDAN (Waspada): Dewan Kehormatan Penyelenggara Pemilu (DKPP) mencopot Ketua KPU Deliserdang, Muhammad Yusri dan anggotanya Fajar Pasaribu. Sementara, 3 komisioner lain, Agusnedi, Bajoka Nainggolan dan Zakaria Siregar mendapat peringatan. Demikian kata Komisioner KPU Sumut, Evi Novida Ginting menanggapi putusan DKPP tersebut, Selasa (4/3).

59 Bal Ganja Pembobol Toko Emas Di Padang Bulan Terlatih Ke Sumut MEDAN (Waspada): Polsek Medan Baru,Selasa (4/3) mendatangkan seorang pekerja tukang las ke Mapolsek tersebut untuk mengetahui cara kerja pembobol Toko Emas Karo Karo S di Pajak Sore, Padangbulan Medan. “Dilihat dari peralatan las yang disita polisi, berupa tabung oksigen dan kabelnya yang terlihat bersih tidak pernah dipergunakan dan elpiji 3 Kg,pelakunya orang yang biasa mengelas,” kata Kapolsek Medan Baru Kompol Nasrun Pasaribu, SH, SIK, MH meniru ucapan seorang tu-

kang las kepada Waspada, Selasa (4/3) sore. Hal itu dikatakan Nasrun terkait bobolnya Toko Emas Karo Karo S, yang diketahui Senin (3/3). Dari toko perhiasan tersebut kawanan penjahat menggondol perhiasan dan uang senilai Rp2 miliar. Nasrun didampingi Kanit Reskrim Iptu Alexander P, SH, mengatakan, pihaknya telah menurunkan semua kekuatan personel Polsek Medan Baru, dibantu Polresta Medan agar kasus itu bisa terungkap.Saksi yang diperiksa sudah tiga orang. (m36)

Lanjut ke hal A2 kol. 4


DIREKTUR Bisnis dan Syariah Bank Sumut Edie Rizliyanto (kanan) menerima piagam penghargaan dalam ajang Islamic Finance Award 2014 yang diselenggarakan Karim Business Consulting di Gedung UOB Plaza, Jakarta, kemarin.

Lanjut ke hal A2 kol. 6

melakukan ikrar sekaligus menandatangani kesepakatan “Pemilu Damai Tahun 2014”. Acara dipimpin Ketua Partai Amanat Nasional (PAN) Deliserdang Imran Obos, SE dalam satu rapat koordinasi (Rakor)Tim Terpadu Penanganan Gangguan Keamanan Dalam Negeri tingkat Kab. Deliserdang, dibuka Wakil Bupati Deliserdang H. Zainuddin Mars di Aula Cendana Kantor Bupati Deliserdang di Lubukpakam, Selasa (4/3). Hadir Kapolres Deliser-

543 Peserta Bersaing Di MTQ Ke-47 Kota Medan

Al Bayan

Manfaat Sapi Oleh Tgk. H. Ameer Hamzah Dan Dia (Allah) telah menciptakan binatang ternak untuk kamu; padanya ada (bulu) yang menghangatkan dan berbagai-bagai manfaat, dan sebagiannya kamu makan. (QS. An-Nahlu:5). SAPI memang binatang luar biasa. Semua yang ada pada sapi menjadi hal yang bermanfaat untuk kehidupan manusia. Tenaganya digunakan untuk membajak sawah, kebun, menarik gerobak dan sado, juga menarik kayukayu yang berat dengan memasang nok di lehernya. Sapi juga digunakan untuk olahraga seperti karapan sapi di Madura, dan balap sapi di Padang dan beberapa daerah lainnya. Lanjut ke hal A2 kol. 2 Waspada Daily


SEJUMLAH petugas Manggala Agni Kemenhut memadamkan kebakaran di Kab. Bengkalis, Riau, Selasa (4/3). Hingga kini kebakaran lahan dan hutan di Riau belum bisa ditanggulangi optimal akibat cuaca kering yang mengakibatkan kebakaran terus meluas lebih dari 8.000 hektare.


Waspada/Anum Saskia

PESERTA lomba cabang Kaligrafi yang harus menyelesaikan hasil karyanya sedikitnya 7 jam.

MEDAN (Waspada) : Sebanyak 534 peserta MTQ Tingkat Kota Medan, siap bersaing dalam berbagai perlombaan di arena MTQ ke 47 sejak 3 s/d 10 Maret di Jl. Gaperta Medan. Pantauan Waspada, pada hari pertama enam cabang diperlombakan, masing-masing untuk golongan putra dan putri dari golongan remaja dan anak-anak. Panitia penyelenggara Ketua, H Erwin bersama Wakil, Palid Muda dan Sekretaris Drs Zakaria, Selasa (4/3) mengatakan, pada hari pertama ada enam cabang diperlombakan, yakni lomba Fahmil Quran, Syahrilquran, Tafsir, Tahfiz, Tartil dan Kaligrafi. Sedangkan tadi malam perlombaan Qiraat Saba’ bagi golongan remaja putra dan putri serta Musyabaqah Makalah Alquran (M2Q). Sementara pelaksanaan lomba dipusatkan pada 7 lokasi yang berbeda untuk memberikan kemudahan pada peserta konsentrasi mengikuti kegiatan.

Lanjut ke hal A2 kol. 1

Sik, MH mewakili Kapolresta Medan, Kasdim 0204/DS Mayor Inf Muhammad Taufiq, Kajari Lubukpakam H. Khairil Aswan SH, unsur Muspida, Sekdakab Drs. H. Asrin Naim, Kaban Kesbang Drs. H. M. Ali Yusuf Siregar MAP, sejumlah pimpinan SKPD dan Camat sejajaran Pemkab Deliserdang. Nota kesepakatan “Pemilu Damai Tahun 2014” di Kab. Deliserdang terdiri 6 point, yakni menghormati dan

Lanjut ke hal A2 kol. 4

Ada-ada Saja Bercinta, Hakim Dipecat MAJELIS Kehormatan Hakim resmi memberhentikan Hakim Pengadilan Negeri Tebo, Elsadela dan Hakim Pengadilan Agama, Mustahi, karena terbukti melakukan perselingkuhan. Lanjut ke hal A2 kol. 6

Serampang Waspada/ Anum Saskia

PESERTA MTQ cabang Tartil Quran saat tampil di mimbar tilawah.

- Aceh Sepanjang Abad - He...he...he...

Harga Eceran Rp 3.000

Demi Kebenaran Dan Keadilan


Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

RABU, Pon, 5 Maret 2014/3 Jumadil Awal 1435 H

No: 24510 * Tahun Ke-68 Terbit 24 Halaman



PENGUNGSI KEBAKARAN LAHAN RIAU: Warga dengan alat seadanya berusaha memadamkan api di kebun kelapa sawit miliknya di Kota Dumai, Riau, Senin (3/3). Kebakaran lahan dan hutan yang terus terjadi di Riau, kini telah mencapai luas sekitar 7.972 hektare dan asapnya mulai mencapai Singapura.

WARGA mendatangi warung kopi yang terbakar di Desa Pineung Seuribee, Kecamatan Samalanga, Kabupaten Bireuen, Selasa (4/3). Akibat musibah itu, dua warga setempat meninggal dunia.


Warkop Terbakar, Dua Tewas

Gubsu Minta Riau Atasi Kebakaran Lahan MEDAN (Waspada): Gubsu H Gatot Pujo Nugroho meminta kebakaran lahan di Riau bisa diatasi segera karena asapnya sudah mengganggu Sumatera Utara. “Perlu diatasi segera karena selain mengganggu masyarakat Riau juga warga Sumut,” kata Gatot Pujo Nugroho di Gubenuran Jl Sudirman, Medan, Selasa (4/3). Sebagai Gubsu, Gatot mengaku sudah mengingatkan Dinas Kehutanan dan Dinas Perkebunan untuk berjaga-jaga agar tidak terjadi lagi kebakaran lahan. “Jangan lagi ada hotspot baik karena kebakaran lahan disengaja atau hanya karena dampak panas matahari,” katanya. Pemprov Sumut, ujar Gatot senang mengetahui sudah tidak ada lagi titik api di Sumut. “Kabut asap, bukan hanya mengganggu penerbangan, tapi menimbulkan penyakit ISPA pada warga,” katanya. Kepala Seksi Informasi dan Data -Badan Meteorologi,Klimatologi dan Geofisika atau BMKG Bandara Kualanamu, Mega Sirait menyebutkan, hasil pantauan Satelit TERRA dan AQUA tanggal 3 Maret 2014, pukul 05.00 dari titik api di Sumatera sebanyak 359, tidak terlihat hotspot di Sumut. “Kalau ada kabut asap, itu terjadi karena asap sudah lama mengendap di udara, Lanjut ke hal A2 kol 1


BIREUEN (Waspada): Dua orang tewas ketika terjadi kebakaran yang meludeskan satu warung kopi di Samalanga,Selasa(4/3) dinihari. Korban tewas, Martunis bin Bakhtiar, 19, dan Misbahuddin bin M Adam, 23, keduanya penduduk Desa Pineung Serribee, Kec. Samalanga, Kab. Bireuen. Kapolres Bireuen AKBP M Ali Kadhafi melalui Kapolsek Samalanga Iptu Saleh Amri di ruang kerjanya mengatakan, pada saat musibah itu, dua korban meninggal dan satu korban kritis yakni Husaini bin Mukhtar, 23, juga penduduk Pineung Seuribee sedang berada dalam warkop tersebut. Diduga kebakaran itu akibat kelalaian korban sendiri. “Karena di lokasi juga ditemukan kompor, mi instan yang sudah dimasak,” ucap Saleh Amri. Dia menyebutkan, selain menjual minuman, warung itu menjual bensin eceran. “Tempat bensin juga diletakkan tepat di bawah tempat tidur korban,” tutur Amri. Dia menjelaskan, saat dievakuasi, kedua jasad korban tergeletak di lantai, sementara tempat tidur mereka sudah gosong. ”Jadi tempat tidurnya dibuat agak tinggi dari lantai, tempatnya tergantung dan digunakan tangga, sedangkan tempat bensinnya diletakkan di dekat tempat tidur,” kata Kapolsek Samalanga, Iptu Saleh Amri.

MAHASISWA yang tergabung dalam Himpunan Mahasiswa Islam (HMI) membawa lilin ketika menggelar aksi di kawasan Jalan Balaikota Medan, Sumut, Senin (3/3) malam. Mereka memprotes PLN terkait pemadaman listrik yang menyengsarakan rakyat.

Lanjut ke hal A2 kol 1

Aceh Rawan Pemilu JAKARTA ( Waspada): Kapolri Jenderal Su t a r m a n m e n g u n g k a p k a n b e b e ra p a daerah yang rawan kerusuhan pada Pemilu 2014. Daerah yang rawan Pemilu yakni Aceh, Papua, dan Poso.

Hal itu, kata Sutarman, berkaca dari pengalaman Pilkada beberapa waktu lalu. Di daerah-daerah ini kerap terjadi aksi kekerasan, mulai dari intimidasi hingga penembakan. Dalam beberapa ter-

akhir, ujarnya, penembakan sudah terjadi di Aceh. “Ada lima kali peristiwa, korban ada satu, termasuk beberapa kantor yang dilempar. Ini bagian yang terus kami amankan,” kata Sutarman di

Kantor Presiden, Jakarta, Selasa (4/3). Dari semua daerah, kata dia, paling rawan adalah di Aceh, disusul Papua dan Poso. Di daerah itu, kata dia, sudah ada ancaman kekerasan.

Untuk itu Sutarman menginstruksikan kepada KapoldaKapolda untuk memetakan titik kerawanan di daerah masing-masing. Setelah Polda Polda sudah memetakan titik rawan, Sutar-

man meminta ada personel di titik-titik tersebut. Diberitakan sebelumnya, satu calon anggota legislatif tewas dibedil di Aceh Selatan, pada Minggu malam, 2 Maret 2014. Caleg Dewan Perwakilan

Rakyat Aceh Selatan dari Partai Nasional Aceh bernama Faisal ini diberondong 46 tembakan saat melintasi sebuah kawasan sepi di pegunungan. Lanjut ke hal A2 kol 2

Jhonny Alen Dan Sutan Disebut Peminta Upeti JAKARTA (Waspada): Dua anggota DPR dari Partai Demokrat yang juga dari Dapil Sumut disebut sebagai peminta upeti kepada PT.Pertamina. Hal itu disebutkan penasihat hukum Direktur Utama PT Pertamina Galaila Karen Agustiawan, Rudy Alfonso bahwa Jhonny Allen Marbun dan Sutan Bhatoegana pernah meminta upeti dari dua anak buah Karen. Penegasan itu disampaikan Rudy di Pengadilan Tipikor Jakarta, Selasa (4/3). Karen juga datang bersaksi untuk terdakwa mantan Kepala SKK Migas, Rudi Rubiandini Rudy membenarkan Karen pernah diperiksa dan kesaksiannya dituangkan dalam Berita Acara Pemeriksaan (BAP) tertanggal 8 November 2013 di KPK. Bahkan dia membenarkan anggota Komisi VII Fraksi Partai Demokrat Jhonny Allen meminta sejumlah uang dari dua anak buah Karen, Afdal Bahaudin dan Hanung Badya. Lanjut ke hal A2 kol 2 Antara

SAMBUT KAPOLDA BARU: Kapolda Aceh yang baru Brigjen Pol. Husein Hamidi (tengah) disambut tarian pedang pada lepas sambut di Mapolda Aceh, Aceh, Selasa (4/3). Husein Hamidi menjadi Kapolda Aceh menggantikan Irjen Pol. Herman Effendi yang memasuki masa pensiun.

Kasus Surat Suara 2 TPS Hilang

Ketua KPU D.Serdang Dan Seorang Anggota Dicopot MEDAN (Waspada): Dewan Kehormatan Penyelenggara Pemilu (DKPP) mencopot Ketua KPU Deliserdang, Muhammad Yusri dan anggotanya Fajar Pasaribu. Sementara, 3 komisioner lain, Agusnedi, Bajoka Nainggolan dan Zakaria Siregar hanya mendapat peringatan. Demikian kata Komisioner K P U Su m u t , Ev i Nov i d a

Ginting menanggapi putusan DKPP tersebut, Selasa (4/3). Pencopotan itu menyusul kasus hilangnya surat suara di TPS 18 dan 40, Desa Sei. Semayang, Kec. Sunggal, Kab. Deliserdang. Dampak dari hilangnya surat suara tersebut, juga munculnya putusan sela Mahkamah Konstitusi (MK) yang memerintahkan dilak-

sanakannya pemungutan suara ulang di dua TPS tersebut pada 19 Februari 2014. “Ini menjadi pembelajaran bagi penyelenggara Pemilu untuk melaksanakan tugas sesuai kewenangan,”ujar Evi. Sedangkan tindak lanjut keputusan itu, KPU Sumut menurut Evi, menunggu

Azwar Abubakar Diduga Terlibat Kasus Dermaga Sabang BANDA ACEH (Waspada): Menteri PAN dan Reformasi Birokrasi Azwar Abubakar dipanggil oleh KPK diduga terkait dugaan korupsi pembangunan dermaga Pelabuhan Sabang yang berpotensi merugikan negara sebesar Rp249 miliar. Keterlibatan Azwar terjadi karena mantan Gubernur Aceh itu merupakan konsultan pada pembangunan dermaga di ujung barat Sumatera. Azwar merupakan salah satu saksi yang diperiksa KPK, bersamaan dengan Azwar, KPK memeriksa dosen Teknik Sipil Institut Teknologi Bandung (ITB) Ananta Sofwan, kedua mereka ini terkait erat dengan keberadaan beberapa konsultan yang turut terlibat dalam pelaksanaan proyek Dermaga CT3 BPKS Sabang, bukan tak mungkin di kemudian hari keduanya bisa menjadi tersangka. Azwar Abubakar diperiksa selama kurang lebih 6,5 Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 4

Al Bayan

Oleh: H. Ameer Hamzah

LHOKNIBONG ( Waspada): Tiga remaja laki-laki tenggelam saat berusaha menyeberangi Krueng (sungai) Arakundo, di Desa Seuneubok Tuha, Kec. Pantee Bidari,

MEDAN (Waspada): Ketua DPD Persatuan Perusahaan Air Minum Daerah Indonesia (DPD PERPAMSI) Sumut Zaharuddin Sinaga, SE meminta Gubsu H. Gatot Pujo Nugroho, serius menyahuti percepatan penyehatan 60 % Perusahaan Daerah Air Minum (PDAM) di kabupaten/kota melalui Rencana Pembangunan Jangka Menengah Daerah (RPJMD) dan Rencana Strategis (Renstra) sebagai bagian dari program nasional Millennium Development Goals (MDGs). “Kita minta Gubsu H. Gatot Pujo Nugroho dan DPRD Sumut serius memperbaiki nasib PDAM

Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 7

Dan Dia (Allah) telah menciptakan binatang ternak untuk kamu; padanya ada (bulu) yang menghangatkan dan berbagai-bagai manfaat, dan sebagiannya kamu makan. (QS. An-Nahlu:5)

Lanjut ke hal A2 kol 2 Waspada Daily


Pengiriman 59 Bal Ganja Ke Sumut Digagalkan L H O K S E U M AW E (Waspada) : Polres Lhokseumawe dalam serangkaian razia kendaraan bermotor di Jalan Lintas Medan–Banda Aceh, Selasa (4/3), menggagalkan pengiriman ganja 59 bal ke Sumatera Utara dan menyita satu mobil pribadi dan menahan dua orang diduga pemilik ganja. Puluhan kilogram ganja siap edar tersebut hendak dibawa ke luar Aceh melalui

Kota Medan,kata Kapolres Lhokseumawe AKBP Joko Surachmanto melalui Kabag Ops AKP Ismuhardi. Ia membenarkan adanya menemukan 59 bal ganja seberat 100 kilogram dalam sebuah mobil yang ditumpangi dua pelaku. Menurut Kabag Ops, peristiwa itu tidak terduga, di mana polisi dibantu sejumlah personel Brimobda Polda Aceh menggelar razia rutin


SEJUMLAH relawan mengevakuasi mayat Syarkawi dari Sungai Arakundo, di Desa Seuneubok Tuha, Kec. Pantee Bidari, Aceh Timur, Selasa (4/3).

Tiga Remaja Tenggelam, Dua Tewas Dan Satu Selamat

secara terpisah terhadap kendaraan bermotor pada pukul 23:00, kemarin hingga Senin (3/3) dini hari. Tetapi pada razia yang berlangsung di depan Mapolres Lhokseumawe, petugas mencurigai gerak-gerik mobil jenis Toyota Avanza BK 1495 KN yang ditumpangi Mikail, warga Kota Banda Aceh, dan Dian Chandra, warga Kab. Aceh Besar. Lanjut ke hal A2 kol 6

Ada-ada Saja

Baru 30% Warga Sumut Cicipi Air PDAM

Manfaat Sapi

SAPI memang binatang luar biasa. Semua yang ada pada sapi menjadi hal yang bermanfaat untuk kehidupan manusia. Tenaganya digunakan untuk membajak sawah, kebun, menarik gerobak dan sado, juga menarik kayukayu yang berat dengan memasang nok di lehernya. Sapi juga digunakan untuk olahraga seperti karapan sapi di Madura, dan balap sapi di Padang dan beberapa daerah lainnya. Daging, susu, lemak, minyak, lidah, tanduk, kotoran

Waspada/Zainuddin Abdulah

LANTARAN terjebak dalam razia yang digelar di depan Mapolres Lhokseumawe Jalan MedanBanda Aceh, Selasa (4/3), Mikail dan Dian Chandra diamankan petugas bersama barang bukti 59 bal ganja yang hendak dikirim ke luar Aceh dengan satu unit mobil Avanza.

Bercinta Di PA 2 Hakim Dipecat MAJELIS Kehormatan Hakim resmi memberhentikan Hakim Pengadilan Negeri Tebo, Elsadela dan Hakim Pengadilan Agama, Mustahi, karena terbukti melakukan perselingkuhan. Kedua hakim itu Waspada/Anum Saskia

PESERTA lomba cabang kaligrafi yang harus menyelesaikan hasil karyanya sedikitnya 7 jam.

543 Peserta Bersaing Di MTQ Ke-47 Kota Medan MEDAN ( Waspada): Sebanyak 534 peserta MTQ Tingkat Kota Medan, siap bersaing dalam berbagai perlombaan di arena MTQ ke 47 sejak 3 s/d 10 Maret di Jl. Gaperta Medan. Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 5

Serampang - Aceh Sepanjang Abad - He.... he....he....

Berita Utama

A2 543 Peserta .... Pantauan Waspada, pada hari pertama enam cabang diperlombakan, masing-masing untuk golongan putra dan putri dari golongan remaja dan anak-anak. Panita penyelenggara Ketua, H Erwin bersama Wakil, Palid Muda dan Sekretaris Drs Zakaria, Selasa (4/3). Disebutkan, pada hari pertama ada enam cabang diperlombakan, yakni lomba fahmil quran, syahrilquran, tafsir,tahfiz,tartil dan kaligrafi. Sedangkan tadi malam perlombaan qiraat saba’ bagi golongan remaja putra dan putri serta Musyabaqah Makalah Alquran (M2Q). Sementara pelaksanaan lomba dipusatkan pada 7 lokasi yang berbeda untuk memberikan kemudahan pada peserta konsentrasi mengikuti kegiatan. “Tahun ini anomo masyarakat untuk mengikuti perlombaan meningkat dibandingkan tahun lalu.Hal itu dilihat dari peningkatan jumlah peserta sebanyak 543 orang dari berbagai cabang lomba yang dilaksanakan.,” kata Palid Muda kemarin. Saat pelaksanaan lomba tartil quran, dewan hakim yang memberikan penilaian kemarin, Chaidir Lubis, Dra Hj

Gubsu Minta .... sementara hujan turun tidak merata khususnya di Kualanamu, Deliserdang yang tidak ada hujan meski Minggu malam dan Senin siang, sebagian wilayah Medan dilanda hujan,”katanya. Tidak adanya titik api lagi pada Senin, 3 Maret dari 1 Maret yang masih tercatat 57 titik, membuat jarak pandang semakin bagus. (m28)

Tiga Remaja .... Aceh Timur, Senin (3/3) sekitar pukul 17:00. Satu orang diselamatkan, dua lagi ditemukan sudah tak bernyawa, Selasa (4/3) siang. Korban tewas Syarkawi Bin Mansur TA, 17, dan Muliadi Bin Alwi, 12, keduanya warga D e s a S e u n e u b o k Tu h a . Sedangkan korban selamat, Sulaiman, 18, asal Seunuddon Aceh Utara. Remaja yang baru sekitar dua bulan menumpang tinggal di rumah saudaranya di Desa Seuneubok Tuha ini, ditolong oleh seorang warga, beberapa saat setelah tenggelam, dalam kondisi pingsan. “Ketiganya dilaporkan tidak bisa berenang. Mereka nekat menyeberang karena mengira air sungai tidak dalam,” kata Camat Pantee Bidari, Iswandi didampingi Keuchik Seuneubok Tuha,

Warkop Terbakar .... Diperkirakan, api cepat membesar dan melalap seluruh isi warung yang berdampingan dengan tempat cuci sepeda motor itu dikarenakan ada bensin. Mungkin api cepat merambah bensin sehingga korban tak sempat menyelamatkan diri. (b17)

Jawaban Problem Catur, TTS Dan Sudoku

Jawaban Problem Catur: 1. Bxg3, Rh6. 2. Bb2, f5 atau Rh7. 3. Bxh2+mat. (Jika 1. ....., Rh4. 2. Rxh2, f5 atau Rh5. 3. Bh7+mat). Jawaban TTS: TTS

pemenang lomba. Sementara untuk kaligrafi, dewan juri Hasanul Kurnia, Satria, Azhari MT, Suhariono, Azhari dan Hariono yang memberikan penilaian pada peserta lomba dengan menilai, kaidah dan keindahan pada penulisan ayat Alquran QS Azzumar ayat 73 dan 75 serta QS Saba’ ayat 1 dan 2. Ada 53 Stand Semarak MTQ Kota Medan, kata Sekretaris Panitia, Drs Zakaria, menampilkan 53 stand dengan peserta dari 21 kecamatan dan dari SKPD lainnya yang memperlihatkan beragam hasil kerajinan dan kreativitas warga. Salah satu stand yang banyak dikunjungi para pelajar adalah Stand Kemenag Medan, didalamnya ditampilkan beragam kerajinan karya siswa MAN dan MTsN serta beberapa hiasan dan ada yang dijual. Demikian juga Stand Dinas Pendidikan Kota Medan yang juga diisi dengan hasil karya siswa dari berbagai sekolah. (m37)

Aceh Rawan .... BIN Minta Polisi Sweeping Senjata Di Aceh Kepala Badan Intelijen Nasional (BIN) Marciano Norman meminta agar aparat keamanan melakukan sweeping senjata di Aceh secara berkala menjelang Pemilu 2014. Hal ini dilakukan karena banyaknya aksi penembakan di Aceh. Terakhir, terjadi penembakan kepada caleg Partai Aceh Nasional pada Minggu dini hari. “Jangan sampai proses demokrasi ini ternoda oleh kekerasan yang terjadi,” kata Marciano di Istana Negara, Jakarta, Selasa (4/3) . Menurut dia ada saluran

yang bisa digunakan agar partai dipilih rakyat, tanpa menggunakan kekerasan. “Jangan melakukan teror, melakukan intimidasi apalagi dengan cara penembakan-penembakan seperti itu,” kata Marciano. Dia juga berharap agar aparat setempat segera mengusut kasus tersebut. Marciano berharap aparat kepolisian bisa menangkap pelaku penembakan sehingga masyarakat Aceh merasa terlindungi. “Oleh karena itu saya mengharapkan segera lakukan sweeping terhadap senjata api yang beredar karena teror seperti ini merusak pesta demokrasi itu sendiri,” ujarnya. (m11/vn)

s a l i n a n p u t u s a n D K P P. Namun, Evi memastikan tidak akan mempengaruhi pelaksanaan Pilkada yang belum usai di Deliserdang. “Kalau itu kan tinggal menunggu keputusan dari MK,” ujarnya. Sementara itu, Ketua KPU Sumut, Mulia Banurea, yang dihubungi secara terpisah, menjelaskan, soal pengganti antar waktu (PAW ) dua komisioner KPU Deliserdang, segera diplenokan. Namun, katanya, bukan mustahil jika nanti dua komisioner KPU Deliserdang yang dicopot tersebut (ketua dan seorang anggota) diisi oleh KPU Sumut. ‘’Kalau tidak diisi oleh KPU Sumut, tentu akan ditelusuri

Syafren, di lokasi kejadian. Menurut Camat, kedua korban tewas selama ini dikenal sebagai remaja yang baik dan jarang bermain ke kawasan tersebut. Sore naas itu, mereka berniat bermain bola di seberang sungai. Namun, sebelum hajat itu sampai, keduanya sudah dinyatakan hilang karena tenggelam di Krueng Arakundo. Pihak Muspika dibantu masyarakat sekitar dan tim

Badan Penanggulangan Bencana Daerah (BPBD) yang melakukan pencarian menggunakan perahu karet menemukan kedua jasad korban Tembakan Keuchik Seuneubok Tuha, Syafren, menambahkan, proses pencarian kedua jenazah remaja malang itu diwarnai tembakan ke udara yang dilepas aparat Polsek Pantee Bidari. Pihak desa sengaja minta aparat meletuskan sen-

jata api karena diyakini bisa mempercepat proses pencarian. “Ini sulit dijelaskan secara logis karena menyangkut halhal gaib. Yang jelas, sebagian masyarakat di sini meyakini, bunyi tembakan itu bisa mengusir makhluk halus dan membantu mempercepat proses penemuan mayat korban yang tenggelam,” ujar Muhammad Sufyan, tokoh KPA di kawasan itu. (b19)

Azwar Abubakar ....

dibagi menjadi dua tim sempat bertugas tiga hari di Banda Aceh dan Sabang. Di Banda Aceh, penggeledahan dilakukan penyidik di salah satu rumah di Geucue Jln. Jenderal Sudirman. Keberadaan tim penyidik KPK di Aceh dibenarkan Juru bicara KPK, Johan Budi SP. Menurutnya, penyidik KPK telah berada di Aceh sejak Selasa 3 September lalu. “Oh itu penggeledahan terkait kasus BPKS. Kalau di daerah pemer iksaannya meminjam ruang di Mapolres atau Mapolda. Kalau rumah saya cari tahu dulu,” kata Johan Budi dihubungi melalui saluran telepon. Informasi lain yang diterima dari sumber yang enggan namannya ditulis, rumah yang digeledah KPK di Geuceu merupakan kediaman T Zainuddin Hamid yang juga

Ketua KONI Aceh. Rumah dimaksud ditempati Muhammad Taufik yang statusnya dicekal KPK. KPK telah mencegah dengan mencekal empat terduga kasus korupsi BPKS Sabang yang merugikan negara sebesar Rp249 miliar. Pencegahan enam bulan sejak 25 Juli kemarin. Mereka yakni Heru Sulaksono, Kepala PT Nindya Karya, Ramadhan Ismy, Deputi Teknik Pengembangan dan Tata Ruang BPKS, Teuku Syaiful, mantan Kepala BPKS dan Muhammad Taufik (swasta). Dua di antaranya yakni RI, Pejabat Pembuat Komitmen (PPK), Satuan Pengembangan Kawasan Perdagangan Bebas dan Pelabuhan Bebas Sabang. Selanjutnya HS, Kepala PT Nindya Karya Cabang Sumatera Utara dan Provinsi Aceh, sekaligus kuasa PT Nindya Sejati Joint Operation. (b08/cb06)

merupakan pembeking PT Timas. Hal itu diungkapkan Karen ketika bersaksi di sidang perkara dugaan suap SKK Migas di Pengadilan Tipikor Jakarta, Selasa (4/3). Karen yang bersaksi untuk mantan Kepala SKK Migas Rudi Rubiandini itu awalnya ditanya Jaksa KPK, apakah per nah ber temu secara langsung dengan Sutan Bhatoegana? “Pernah ketemu Sutan?” tanya Jaksa kepada Karen. “Pernah di kantor,” jawab Karen. Jaksa melanjutkan pertanyaan menyinggung urusan Sutan menemui Karen di kantor Pertamina. “Terkait apa, THR?” tanya j a k s a l a g i .” Ti d a k ,” k a t a Karen.”Terkait apa?” tekan Jaksa. “Terkait keinginan ikut

tender di pengolahan,” jawab Karen. Jaksa kembali menanyakan Karen pengolahan apa yang dimaksud. Karen pun tanpa beban menyebut urusan Sutan.”Terkait dengan PT Timas,” tegas Karen. Sebelumnya, Sutan pernah membicarakan PT.Timas Suplindo ke Rudi Rubiandini yang masih menjabat Kepala SKK Migas. Sutan menanyakan kontrak PT Timas yang belum disetujui SKK Migas dalam proyek konstruksi anjungan pengeboran minyak. Sutan saat bersaksi menampik dirinya memiliki sah a m d i P T Ti m a s. Su t a n mengatakan dirinya membantu PT Timas mengomunikasikan ke Rudi karena dia berteman Herman Afifi, komisaris perusahaan tersebut. (j02)

binatang ternak itu ada yang dijadikan untuk pengangkutan dan ada yang untuk disembelih (QS. Al-An’am: 142). Zaman sekarang, kulit sapi bisa diolah menjadi makanan, misalnya menjadi kerupuk yang gurih. Ada juga yang membuat kue-kue. Ada juga industri yang mampu membuat kulit lembu sebagai tas yang berharga, tali pinggang, baju, jacket, dompet, sepatu, sarung jok mobil dan sebagainya. Mana lagi nikmat Tuhanmu yang engkau dustakan? Tanya Allah dalam surat ArRahman berulang kali. Allah SWT. telah menciptakan sapi untuk keperluan manusia, dan pada sapi itu ada pelajaran yang harus diteliti oleh ulama dan intelektual. “Dan sungguh pada binatang ternak itu (salah satunya sapi) benar-benar terdapat pelajaran bagi kamu”.(QS.An-Nahlu 66). Karena ada pelajaran,

maka sejak sekolah rendah sampai perguruan tinggi, ada mata pelajaran tentang kehidupan hewan, bukan? Bahkan ada Fakultas Kedokteran Hewan yang telah melahirkan sarjana-sarjana yang hanya memikirkan tentang kehidupan binatang ternak. Pelajaran yang harus kita ambil antara lain; dalam daging binatang ternak sapi itu sangat banyak mengandung vitamin yang dapat menyehatkan tubuh manusia. Tetapi bila pakan ternak yang kita berikan kepada sapi dari benda-benda yang najis, maka daging sapi itu akan rusak dan berpenyakit. Kalau dimakan manusia, mereka akan terjangkit penyakit yang berbahaya misalnya “gila”. Jadi bukan sapinya yang gila, tetapi manusia yang memakannya yang gila. Makanya, berilah makan ternak yang dari sumber-sumber tanaman yang tidak bernajis dan buruk.

jam oleh penyidik KPK karena kapasitasnya menjabat gubernur defenitif Aceh pada 2005. Kasus Dermaga CT 3 BPKS yang sedang ditanggai KPK saat ini berkaitan dengan anggaran APBN 2006-2010. Sebelumnya, Komisi Pemberantasan Korupsi (KPK) terus mengembangkan penyidikan kasus dugaan korupsi proyek pembangunan dermaga bongkar di Kawasan Perdagangan Bebas dan Pelabuhan Bebas Sabang, Provinsi Aceh. Setelah kantor PT Nindya Karya di Kawasan Jakarta Timur, KPK mencari bukti tambahan dengan menggeledah rumah dan kantor BPKS Jalan Cut Nyak Dhien, Desa Kuta Barat, Sukakar ya, Sabang pada November tahun lalu. Infor masi dihimpun Waspada, penyidik KPK yang

Jhonny Alen ....

Dari Halaman Sport.

Politik & Hukum

Keduanya bahkan pernah dipanggil Jhonny dan Ketua Komisi VII DPR Fraksi Demokrat Sutan Bhatoegana di DPR.”Iya ada. Yang diminta itu benar (Hanung dan Afdal). Iya (dua-duanya) dipanggil (ke DPR),” kata Rudy. Menurut Rudy, kesaksian itu Karen mendengar dari anak buahnya. Kesaksian itu sifatnya de audito. Menurutnya, menjadi saksi itu tentu karena apa yang dia dengar atau apa yang dia alami atau apa yang dia ketahui. “Permintaan itu ada. Tapi saya tidak disampaikan Bu Karen,” kata Rudy. Sutan Pembeking PT Timas Sementara itu, Direktur Utama PT Pertamina, Karen Agustiawan menyebut, Ketua Komisi VII Sutan Bhatoegana

Al Bayan ....

Jawaban Sudoku: 9 2 6 4 8 1 3 5 7

1 7 8 5 3 9 4 6 2

5 3 4 7 6 2 1 8 9

3 4 7 2 5 6 8 9 1

6 8 1 9 7 4 2 3 5

2 9 5 3 1 8 7 4 6

4 5 9 8 2 7 6 1 3

7 1 3 6 4 5 9 2 8

8 6 2 1 9 3 5 7 4

BMKG: Tingkat Kepekatan Asap Berfluktuasi

Habibah, H Amir Soleh, Kholil Husaini, H Gamal Abdul Nasir, Sa’dun MAP,Ramli BR, Mustafa Kamal, Sufia Rahmi, Rinaldi, Khairul Bahri dan Hakimsyah. Peseta lomba tilawatil quran golongan anak-anak putera bernama Ahmad Ronfiakim Harahap,10 utusan Kecama-tan Medan Selayang yang membacakan QS Al an’am dan Ahmad Tarmizi utusan Medan Tembung membacakan QS Al Imran ayat 64 mengaku perlombaan dengan waktu 6 menit, dapat mereka lalui dengan sempura. Meski menunggu sampai Sabtu mendatang untuk mengetahui peserta yang lolos ke babak final, namun kedua-nya akan tetap hadir untuk menyaksikan penampilan temantemannya di arena lomba. Sedangkan peserta cabang lomba tartil quran puteri, atas nama Siti Nur Fara Adilla utusan Kecamatan Medanbelawan yang membacakan QS Al Imran ayat 130, mengaku senang bisa berlomba di tingkat Kota Medan dan berharap jadi

dan kulit dan bulu yang ada pada sapi semua dibutuhkan manusia. Daging untuk dimakan, susu untuk diminum, lemak dan minyak untuk makanan, Kulit dan bulu sapi dijadikan untuk menutup lubang beduk. Atas kulit itulah dipukul dengan kayu sehingga mengeluarkan suara yang sangat nyaring. Sejak zaman dulu beduk yang berkulit lembu sudah digunakan manusia sebagai alat komunikasi. Di India dan Nepal, Sapi malah dinggap satu di antara dewa-dewa yang dipuja. Sesungguhnya sapi bukanlah dewa, tetapi binatang ternak yang diciptakan Allah untuk manusia. Allah berfirman: Dan apakah mereka tidak melihat bahwa sesungguhnya Kami telah menciptakan binatang ternak untuk mereka (QS.Yasin:71). Dalam ayat lain Allah menyebutkan; Di antara

M E D A N ( Wa s p a d a ) : BMKG Wilayah I mencatat, tingkat kepekatan asap akibat kebakaran hutan berfluktuasi (berubah-ubah). Sempat membaik namun tiga hari terakhir, kabut asap kembali pekat menyelimuti KNIA (Kualanamu International Airport). Pada 1 Maret jarak pandang hanya mencapai 700 meter hingga 2000 meter. Pada 2 Maret dari 500 meter hingga- 5000 meter, sementara Senin 3 Maret 2014, jarak pandang sekitar 1100 meter hingga 3000 meter. Mega Sirait, SP, kepala Seksi Data dan Informasi pada BMKG Wialyah I stasiun Bandara Kualanamu saat dikonfirmasi, Selasa (4/3), membenarkan.Sebaran kabut di kawasan Sumatera Utara hampir

menyeluruh hingga ke Tapsel, Madina, Sibolga, Tanjung Balai, Asahan, Batubara, Langkat, Tanah Karo, Deliserdang, Tebingtinggi dan Sergei. Pantauan beberapa hari terakhir di KNIA, asap semakin pekat menyelimuti bandara tersebut.Pada 24 Februari 2014, jarak pandang berkisar 200 meter hingga 5000 meter. Berdasarkan data citra satelit Terra dan Aqua selama empat hari terakhir, titik panas (hotspot) terpantau paling banyak di daerah Riau untuk Sumatera, namun demikian hotspot di daerah Sumut juga terlihat muncul dibeberapa daerah. Kata Mega, analisa Badan Meteorologi Klimatologi dan Geofiska (BMKG) Wilayah I, asap yang sampai di bandara

Ketua KPU ....

personil yang terdahulu dalam seleksi menempati ranking 6 dan 7 menjadi PAW,’’kata Mulia. Menjawab pertanyaan, jika setelah PAW atau pengisian oleh KPU Sumut berkaitan kelanjutan tugas KPU Deliserdang tersebut, menurut Mulia menunggu putusan MK apakah nanti terjadi pemungutan suara ulang Pilkada Deliserdang, atau tidak. ‘’Yang pasti Pilkada Deliserdang belum selesai karena menunggu putusan MK,’’ ujarnya. Sedangkan Muhammad Yusri yang coba dihubungi wartawan untuk dikonfirmasi mengenai putusan DKPP tersebut,tidak berhasil. Sms yang dikirim kepadanya, juga tidak mendapat balasan. (m34)

Ada-ada Saja .... diberhentikan karena dinilai telah melanggar kode etik hakim, setelah terbukti berselingkuh. Putusan itu dibacakan Ketua Majelis MKH Andi Syamsu Alam di Gedung Mahkamah Agung, Jakarta, Selasa (4/3). “Memutuskan, menyatakan hakim terlapor terbukti melanggar Kode Etik Pedoman dan Perilaku Hakim (KEPPH), dan menjatuhkan hukum disiplin terlapor, berat, pemberhentian tetap, dengan hak pensiun,” kata Andi Syamsu.

WASPADA Rabu 5 Maret 2014

Baru 30% ....

Sa a t d i h e n t i k a n d a n dilakukan penggeledahan terhadap mobil itu, petugas nyaris dikelabui oleh tumpukan barang ditutup plastik warna hitam dan dibalut karung goni pada bagian bagasi. Karena penasaran, katanya, petugas menyibak plastik hitam itu dan membuka karung goni tersebut.Ternyata isi bungkusan yang tidak biasa. Begitu membuka lagi, polisi melihat bungkusan itu berisi ganja. Saat ini Mikail dan Dian Chandra ditahan di Mapolres. (b16)

kabupaten/kota yang kurang sehat dan sakit dengan mengalokasikan anggaran melalui RPJMD dan Renstra,” kata Zaharuddin Sinaga, SE, didampingi Wakil Ketua Ir. H. Jusman Syah, MT. MBA dan Jufrizal, SE serta sekretaris Drs. H. Indar Muda Dongoran di Medan, Selasa (4/3). Menurut Zaharuddin Sinaga, sangat tidak mungkin mengharapkan kabupaten/ kota untuk perbaiki keadaan 60 % PDMA yang kurang sehat dan sakit tanpa bantuan Pemprovsu.Hal itu dapat dilakukan melalui RPJMD untuk waktu lima tahun dan Renstra untuk waktu satu tahun sebagai menyahuti MDGs. Zaharuddin Sinaga berharap Gubsu dan DPRD Sumut memberi dukungan penuh dengan memasukan program penyehatan 60% PDAM kabupaten/kota dengan mengalokasikan anggaran dalam RPJMD dan Renstra. “DPD PERPAMSI Sumut yakin Gubsu dan dewan menyahutinya karena hingga kini kurang dari 30 % masyarakat Sumut yang mendapat akses air minum dari PDAM,” tutur Jufrizal, SE. MDGs (tujuan pembangunan millennium), lanjut Jusman Syah, merupakan deklerasi millennium, hasil kesepakatan kepala negara dan perwakilan 189 negara di PBB pada KTT di Newyork. Delapan butir kesepakatan itu, di antaranya sektor air bersih di mana target MDGs tahun 2015 mengurangi separuh jumlah orang yang tidak memiliki akses air bersih. Di Indonesia, hingga tahun 2015

sebanyak 68, 8 % lebih penduduk harus mendapatkan akses air bersih dari PDAM. Me n y a h u t i p r o g r a m nasional dari kesepakatan 189 negara itu, lajut Jusman, Pemprovsu bisa menyahutinya dengan mengalokasikan anggaran dalam RPJMD dan Renstra. Selama ini belum ada pos khusus membantu percepatan perbaikan PDAM kabupaten/kota yang kurang sehat dan sakit kecuali melalui pos SKPD. PERPAMSI Sumut juga meminta Gubsu dan DPRD Sumut serius mendorong PLN memperkecil tingkat pemadaman, karena sangat mengganggu terhadap operasional PDAM. Jika lampu mati, kata Jusman, semua pompa yang digunakan mati.Jika menggunakan genset akan menambah beban biaya. ‘’Dengan begitu, PDAM bukan lagi sakit tapi langsung mati,’’ kata Jusman dan men a m b a h k a n , P E R PA M S I Sumut sudah berulangkali menyurati dan meminta PLN mengurangi pemadaman dari tiga menjadi satu kali sehari. Un t u k m e n a m b a h pengetahuan dan wawasan P E R PA M S I S u m u t , k a t a Sekretaris Drs. H. Indar Muda Dongoran, akan melakukan lawatan ke Asia Water di Kuala Lumpur, Malaysia pada 18 Maret 2015 setelah bertemu Gubsu. Juga mengunjungi Chief Regional Sumatera IUWASH Ir. Subahri Ritonga, MM dan pelatihan peningkatan sumber daya manusia (SDM), penyusunan bisnis plan dan lain-lain. (m26)

Keputusan MKH untuk melakukan pemberhentian diambil setelah memperhatikan sejumlah pertimbangan. Baik yang memberatkan maupun yang meringankan. Hal yang memberatkan keduanya, tuduhan perselingkuhan mencedarai pengadilan, bertentangan dengan KEPPH, perbuatan tercela dan tidak menjunjung harga diri, martabat dan keluhuran hakim. Hal yang memberatkan lainnya adalah, hakim itu telah melakukan perselingkuhan tersebut berulang kali, dan

bahkan bercinta di ruang kerja Pengadilan Negeri Agama. “Terlapor sudah berulang kali melakukan hal itu,” kata Andi. Sementara, yang meringankan, kedua hakim itu menyesali perbuatannya dan tidak akan mengulanginya lagi. “Hal yang meringankan terlapor, menyesali perbuatannya. Berjanji tidak akan mengulangi lagi,” kata hakim anggota Desnayati. Majelis pun merekomendasikan agar kedua hakim itu langsung dibebastugaskan, sambil menunggu keputusan

Presiden. “Mengusulkan untuk diberhentikan sementara, sampai turun surat keputusan (SK) dari presiden,” ujarnya. Perselingkuhan itu terbongkar saat Elsadela dilaporkan suaminya, Herman ke Pengadilan Tinggi Jambi karena diduga melakukan perselingkuhan dengan Hakim Pengadilan Agama, Mustahi. Mustahi diketahui telah melakukan hubungan badan dengan Elsadela lebih dari satu kali. Hubungan terlarang itu dilakukan di kantornya. (vn/m09)

Kualanamu umumnya berasal dari kebakaran lahan/hutan dari daerah sekitar seperti Langkat, Karo, dan Deli Serdang. Sedangkan angin yang bertiup di wilayah Kualanamu umumnya dari barat laut hingga timur laut. Kondisi asap ini diperkirakan masih bertahan hingga beberapa hari kedepan mengingat hujan juga sangat jarang terjadi, jika hujan turun intensitasnya juga hanya ringan hingga sedang dan sifatnya lokal atau tidak merata. Kebetulan Selasa (4/3) s i a n g , h u j a n a g a k d e ra s dengan durasi lebih kurang 1 jam menyebabkan Sungai Deli dan Sungai Babura meningkat air dari biasanya, mudahmudahan ke depan kabut agak berkurang, kata Mega. Disamping itu, aktivitas pembakaran lahan/hutan juga sepertinya masih tetap berlanjut jika dilihat dari grafik hotspot berfluktuasi naik dan turun. (m32)

Pengiriman 59 Bal ....


Berita Utama

DPD PERPAMSI Sumut Minta Gubsu Sehatkan 60 % PDAM Sakit Menurut Zaharuddin Sinaga, sangat tidak mungkin mengharapkan kabupaten/ kota untuk perbaiki keadaan 60 % PDAM yang kurang sehat dan sakit tanpa bantuan Pemprovsu.Hal itu dapat dilakukan melalui RPJMD untuk waktu lima tahun dan Renstra untuk waktu satu tahun sebagai menyahuti MDGs. Zaharuddin Sinaga berharap Gubsu dan DPRD Sumut memberi dukungan penuh dengan memasukkan program penyehatan 60 % PDAM kabupaten/kota dengan mengalokasikan anggaran dalam RPJMD dan Renstra. “DPD PERPAMSI Sumut yakin Gubsu dan dewan menyahutinya karena hingga kini kurang dari 30 % masyarakat Sumut yang mendapat akses air minum dari PDAM,” tutur Jufrizal, SE. PERPAMSI Sumut juga meminta Gubsu dan DPRD Sumut serius mendorong PLN memperkecil tingkat pemada-

man, karena sangat mengganggu terhadap operasional PDAM. Jika lampu mati, kata Jusman, semua pompa yang digunakan mati.Jika menggunakan genset akan menambah beban biaya. ‘’Dengan begitu, PDAM bukan lagi sakit tapi langsung mati,’’ kata Jusman dan menambahkan, PERPAMSI Sumut sudah berulangkali menyurati dan meminta PLN mengurangi pemadaman dari tiga menjadi satu kali sehari. Untuk menambah pengetahuan dan wawasan PERPAMSI Sumut, kata Sekretaris Drs. H. Indar Muda Dongoran, akan melakukan lawatan ke Asia Water di Kuala Lumpur, Malaysia pada 18 Maret 2015 setelah bertemu Gubsu. Juga mengunjungi Chief Regional Sumatera IUWASH Ir. Subahri Ritonga, MM dan pelatihan peningkatan sumber daya manusia (SDM), penyusunan bisnis plan dan lain-lain.(m26)

Bank Sumut Raih ...

Muliaman D. Hadad yang juga Ketua Dewan Komisioner OJK (Otoritas Jasa Keuangan) dalam sambutannya berharap agar perbankan syariah di Indonesia dapat menjadi pusat pengembangan perbankan syariah di dunia. Karena itu, bank-bank syariah di Indonesia diminta untuk terus-menerus melakukan perbaikan dan percepatan peningkatan kualitas layanan dan produknya seraya memperluas akses pasarnya ke kalangan masyarakat mikro, kecil dan menengah. Secara terpisah, Direktur Bisnis dan Syariah Bank Sumut Edie Rizliyanto, Selasa (4/3) mengatakan, prestasi yang diraih Unit Usaha Syariah Bank Sumut tersebut tidak terlepas dari kepercayaan masyarakat menggunakan fasilitas produk yang ada di Bank Sumut Syariah, sehingga Bank Sumut Syariah mengalami peningkatan pertumbuhan DPK, pembiayaan dan profitabilitas yang siginifikan. Pertumbuhan positif kinerja finansial Bank Sumut Syariah terus mengalami peningkatan. Pada saat ini salah satunya terlihat dari pertumbuhan DPK posisi per Februari 2014 yakni mencapai Rp1,06 triliun. Begitu pula dengan pertumbuhan pembia-

yaan yang mencapai Rp1,7 triliun. Sedangkan profitablitas tahun berjalan pada posisi Februari 2014 telah mencapai Rp11,3 miliar. Bank Sumut Syariah kini memiliki 5 kantor cabang syariah, yakni Kantor Cabang Syariah Medan di Jalan Letjend S Parman, Kantor Cabang Syariah PadangSidempuan di Jalan Merdeka, Kantor Cabang Syariah Tebingtinggi di Jl Dr Sutomo, Kantor Cabang Syariah Sibolga di Jl Sisingamangaraja dan Kantor Cabang Syariah Pematangsiantar di Jl Jend Sudirman serta didukung dengan keberadaan 17 unit Kantor Pembantu Cabang Syariah masingmasing Capem Syariah Stabat, Capem Syariah Multatuli Medan, Capem Syariah Karya, Capem Syariah HM Joni, Capem Syariah Jamin Ginting, Capem Syariah Binjai, Capem Syariah Kota Baru Medan, Capem Syariah HMYamin, Capem Syariah Marelan Raya, Capem Syariah Hamparanperak, Capem Syariah Sp Kayu Besar Tanjungmorawa, Capem Syariah Panyabungan, Capem Syariah Lubukpakam, Capem Syariah Kisaran, Capem Syariah Kampung Pon, Capem Syariah Perdagangan dan Capem Syariah Rantauprapat. Selain itu pelayanan syariah dapat juga dilakukan melalui 121 unit cabang/Cabang Pembantu Bank Sumut Konvensional. (m28)

Kedua penghargaan itu adalah terbaik kedua The Most Profitable untuk kategori Unit Usaha Syariah (UUS) bank seluruh Indonesia dengan aset di atas Rp1 triliun dan terbaik kedua Top Growth Financing untuk kategori BPD seluruh Indonesia. Penghargaan diterima oleh Direktur Bisnis dan Syariah Bank Sumut Edie Rizliyanto dan Pemimpin Divisi Unit Usaha Syariah Bank Sumut Didi Duharsa. Peringkat tersebut merupakan hasil penilaian Karim Colsulting berdasarkan laporan keuangan audited periode 31 Desember 2011 dan 31 Desember 2012 beserta data keuangan lainnya dengan menilai empat faktor yaitu pertumbuhan market share Dana Pihak Ketiga (DPK), pertumbuhan market share pembiayaan, tingkat efisiensi (BOPO) dan tingkat profitabilitas. Karim Business Consulting adalah konsultan bisnis syariah terbesar yang didirikan pada Agustus 2001 dan memposisikan diri sebagai perusahaan terkemuka di dunia, bergerak dalam bidang konsultasi Kepatuhan Hukum Syariah. Ketua Umum BPH Masyarakat Ekonomi Syariah (MES)

543 Peserta Bersaing ... “Tahun ini animo masyarakat untuk mengikuti perlombaan meningkat dibandingkan tahun lalu.Hal itu dilihat dari peningkatan jumlah peserta sebanyak 543 orang dari berbagai cabang lomba yang dilaksanakan.,” kata Palid Muda. Saat pelaksanaan lomba tartil Quran, dewan hakim yang memberikan penilaian kemarin, Chaidir Lubis, Dra Hj Habibah, H Amir Soleh, Kholil Husaini, H Gamal Abdul Nasir, Sa’dun MAP,Ramli BR, Mustafa Kamal, Sufia Rahmi, Rinaldi, Khairul Bahri dan Hakimsyah. Peserta lomba tilawatil Quran golongan anak-anak putra bernama Ahmad Ronfiakim Harahap,10 utusan Kecamatan Medan Selayang yang membacakan QS Ali An’am dan Ahmad Tarmizi utusan Medan Tembung membacakan QS Ali Imran ayat 64 mengaku perlombaan dengan waktu 6 menit, dapat mereka lalui dengan sempura. Meski menunggu sampai Sabtu mendatang untuk mengetahui peserta yang lolos ke babak final, namun keduanya akan tetap hadir untuk menyaksikan penampilan teman-temannya di arena lomba. Sedangkan peserta cabang lomba tartil Quran putri, atas nama Siti Nur Fara Adilla utusan Kecamatan Medan Belawan yang membacakan QS Ali Imran ayat 130, mengaku senang bisa berlomba di tingkat Kota Medan dan berharap jadi pemenang lomba. Sementara untuk kaligrafi, dewan juri Hasanul Kurnia, Satria, Azhari MT, Suhariono, Azhari dan Hariono yang memJawaban Problem Catur, berikan penilaian pada peserta lomba dengan menilai, kaiTTS Dan Sudoku dah dan keindahan pada penulisan ayat Alquran QS AzDari Halaman Sport. zumar ayat 73 dan 75 serta QS Saba’ ayat 1 dan 2. Ada 53 Stand Jawaban Problem Catur: Semarak MTQ Kota Medan, kata Sekretaris Panitia, 1. MxM, Rg8 atau Drs Zakaria, menampilkan 53 stand dengan peserta dari 21 Rg6 atau h5. kecamatan dan dari SKPD lainnya yang memperlihatkan 2. Mg7+mat. beragam hasil kerajinan dan kreativitas warga. Salah satu stand yang banyak dikunjungi Jawaban TTS: para pelajar adalah Stand Kemenag Medan, didalamnya TTS Kesehatan ditampilkan beragam kerajinan karya siswa MAN dan MTsN serta beberapa hiasan dan ada yang dijual. Demikian juga Stand Dinas Pendidikan Kota Medan yang juga diisi dengan hasil karya siswa dari berbagai sekolah. (m37)

LBH Medan Desak ... Bahkan, kata Surya, pemadaman yang sering terjadi di Sumatera Utara telah memicu angka kriminalitas, yang pada akhirnya menambah catatan buruk polisi Sumatera Utara karena dianggap tidak mampu menekan angka kejahatan di daerah ini. “Patut diketahui, permasalahan krisis listrik di daerah ini karena tingginya pertumbuhan konsumsi listrik tapi tidak diimbangi dengan pasokan listrik yang cukup.Hal ini mengindikasikan, PLN di-anggap tidak siap dalam mengatasi keterbatasan energi listrik di tengah pertumbuhan penduduk yang semakin pesat di Sumatera Utara,’’ kata Surya. Sedangkan Wakil Direktur LBH Medan mengatakan, aksi mereka dibarengi dari massa Badan Komando (Badko) Himpunan Mahasiswa Islam (HMI) Sumut yang memprotes pemadaman yang dilakukan oleh PT PLN. “Seharusnya ada sinergisitas antara Pemda dan Pusat terkait permasalahan listrik. Namun, yang kita rasakan adanya pembiaran dari Pemerintah Pusat, terutama Kementrian BUMN dan Kementrian ESDM,” ujarnya. LBH Medan mengecam Menteri terkait yang telah melakukan pembohongan publik dan menebar janji-janji palsu terkait pemadaman listrik yang dikatakan sele-sai November 2013, namun hingga saat ini belum terealisasi. (m38)

Al Bayan ...

Jawaban Sudoku:

6 3 2 5 9 7 8 4 1

1 8 9 4 3 2 7 5 6

7 5 4 8 1 6 9 3 2

2 9 1 6 5 8 4 7 3

3 4 5 2 7 1 6 9 8

8 6 7 3 4 9 1 2 5

4 7 8 1 2 3 5 6 9

5 2 6 9 8 4 3 1 7

9 1 3 7 6 5 2 8 4

Daging, susu, lemak, minyak, lidah, tanduk, kotoran dan kulit dan bulu yang ada pada sapi semua dibutuhkan manusia. Daging untuk dimakan, susu untuk diminum, lemak dan minyak untuk makanan, Kulit dan bulu sapi dijadikan untuk menutup lubang beduk. Atas kulit itulah dipukul dengan kayu sehingga mengeluarkan suara yang sangat nyaring. Sejak zaman dulu beduk yang berkulit lembu sudah digunakan manusia sebagai alat komunikasi. Di India dan Nepal, Sapi malah dinggap satu di antara dewa-dewa yang dipuja. Sesungguhnya sapi bukanlah dewa, tetapi binatang ternak yang diciptakan Allah untuk manusia. Allah berfirman: Dan apakah mereka tidak melihat bahwa sesungguhnya Kami telah menciptakan binatang ternak untuk mereka (QS.Yasin:71). Dalam ayat lain Allah menyebutkan; Di antara binatang ternak itu ada yang dijadikan untuk pengangkutan dan ada yang untuk disembelih (QS. Al-An’am: 142). Zaman sekarang, kulit sapi bisa diolah menjadi makanan, misalnya menjadi kerupuk yang gurih. Ada juga yang membuat kue-kue. Ada juga industri yang mampu membuat kulit lembu sebagai tas yang berharga, tali pinggang, baju, jacket, dompet, sepatu, sarung jok

Rabu 5 Maret 2014

Jika Listrik Padam, Peserta UKG Tak Perlu Khawatir

Baru 30 % Warga Sumut Cicipi Air Bersih PDAM MEDAN (Waspada): Ketua DPD Persatuan Perusahaan Air Minum Daerah Indonesia (DPD PERPAMSI) Sumut Zaharuddin Sinaga, SE meminta Gubsu H. Gatot Pujo Nugroho, serius menyahuti percepatan penyehatan 60 % Perusahaan Daerah Air Minum (PDAM) di kabupaten/kota melalui Rencana Pembangunan Jangka Menengah Daerah (RPJMD) dan Rencana Strategis (Renstra) sebagai bagian dari program nasional Millennium Development Goals (MDGs). “Kita minta Gubsu DPRD Sumut serius memperbaiki nasib PDAM kabupaten/kota yang kurang sehat dan sakit dengan mengalokasikan anggaran melalui RPJMD dan Renstra,” kata Zaharuddin Sinaga, SE, didampingi Wakil Ketua Ir. H. Jusman Syah, MT. MBA dan Jufrizal, SE serta sekretaris Drs. H. Indar Muda Dongoran di Medan, Selasa (4/3).


Waspada/HM Husni Siregar

WABUP Deliserdang H. Zainuddin Mars bersama Unsur Muspida menyaksikan para pimpinan Parpol menandatangani kesepakatan bersama pada Rakor Tim terpadu penanganan gangguan keamanan dalam negeri tingkat Kab.Deliserdang, di Aula Cendana kantor bupati Deliserdang, Selasa (4/3).

12 Pimpinan Parpol ... mentaati segala keputusan dan penilaian dari penyelenggara Pemilu terhadap partai. Mendukung segala upaya dan kerja penyelenggara Pemilu untuk menyukseskan penyelenggaraan Pemilu tahun 2014. Segala penilaian dan keputusan yang merugikan akan diproses menurut mekanisme hukum yang berlaku. Selama masa kampenye, Parpol tunduk dan patuh terhadap segala ketentuan yang berlaku dan siap menerima pemberian sanksi sesuai hukum bila Parpol terbukti melakukan pelanggaran aturan kampanye serta menghormati dan menghargai hasil Pemilu 2014 yang ditetapkan oleh KPU. Dalam kesempatan itu, Wabup H. Zainuddin Mars mengajak seluruh pimpinan Parpol dan seluruh elemen masyarakat untuk menyatukan tekad dan semangat menciptakan Pemilu Legislatif (Pileg) yang kondusif, aman dan lancer. Dengan adanya nota kesepakatan “Pemilu Damai” oleh 12 pimpinan Parpol Zainuddin Mars yakin, Pemilu

Aceh Paling Rawan ... Diberitakan sebelumnya, satu calon anggota legislatif tewas dibedil di Aceh Selatan, pada Minggu malam, 2 Maret 2014. Caleg Dewan Perwakilan Rakyat Aceh Selatan dari Partai Nasional Aceh bernama Faisal ini diberondong 46 tembakan saat melintasi sebuah kawasan sepi di pegunungan. Penembak Berbeda Pada kesempatan itu Kapolri Jenderal Pol Sutarman memastikanpelakupenembakanterhadap calonanggotalegislatif(caleg)Partai Nasional Aceh, Faisal ,35, berbeda dengan pelaku penyerangan posko caleg Partai NasDem di Aceh. “Pelaku orang yang berbeda,” kata Sutarman usai memimpin upacara serah terima jabatanWakapolri di Mabes Polri, Jakarta, Selasa (4/3). Menurut Sutarman, sedikitnya ada lima aksi teror di Aceh jelang pemilu tahun ini. Beberapa di antaranya sudah terungkap, yakni pelaku penembakan caleg Partai NasDem yang telah diketahui identitasnya. “Tinggal melakukan penangkapan pada dua pelaku yang sudah dikenali identitasnya,” sambung Sutarman. Ia mengingatkan kepada seluruh masyarakat untuk tidak terpengaruh dengan adanya aksiaksi teror tersebut. “Tidak terpengaruh pada ancaman ketakutan maupun dipengaruhi masalahmasalah (politik) uang dan sebagainya,” paparnya. Sweeping Senjata Api Kepala Badan Intelijen Nasional (BIN) Marciano Norman meminta agar aparat kemanan melakukan sweeping senjata di Aceh secara berkala menjelang Pemilu 2014. Hal ini dilakukan karena banyaknya aksi penembakan di Aceh. Terakhir, terjadi penembakan kepada caleg Partai Aceh Nasional pada Minggu dini hari. “Jangan sampai

59 Bal Ganja ... Kapolres Lhokseumawe AKBP Joko Surachmanto melalui Kabag Ops AKP Ismuhardi. Ia membenarkan adanya menemukan 59 bal ganja seberat 100 kilogram dalam sebuah mobil yang ditumpangi dua pelaku. Menurut Kabag Ops, saat razia di depan Mapolres Lhokseumawe, petugas men-curigai gerak-gerik mobil jenis Toyota Avanza BK 1495 KN yang ditumpangi Mikail, warga Kota Banda Aceh, dan Dian Chandra, warga Kab. Aceh Besar. Saat dihentikan petugas membuka karung goni ternyata berisi ganja. (b16)

mobil dan sebagainya. Mana lagi nikmat Tuhanmu yang engkau dustakan? Tanya Allah dalam surat Ar-Rahman berulang kali. Allah SWT. telah menciptakan sapi untuk keperluan manusia, dan pada sapi itu ada pelajaran yang harus diteliti oleh ulama dan intelektual. “Dan sungguh pada binatang ternak itu (salah satunya sapi) benar-benar terdapat pelajaran bagi kamu”.(QS.An-Nahlu 66). Karena ada pelajaran, maka sejak sekolah rendah sampai perguruan tinggi, ada mata pelajaran tentang kehidupan hewan, bukan? Bahkan ada Fakultas Kedokteran Hewan yang telah melahirkan sarjana-sarjana yang hanya memikirkan tentang kehidupan binatang ternak. Pelajaran yang harus kita ambil antara lain; dalam daging binatang ternak sapi itu sangat banyak mengandung vitamin yang dapat menyehatkan tubuh manusia. Tetapi bila pakan ternak yang kita berikan kepada sapi dari benda-benda yang najis, maka daging sapi itu akan rusak dan berpenyakit. Kalau dimakan manusia, mereka akan terjangkit penyakit yang berbahaya misalnya “gila”. Jadi bukan sapinya yang gila, tetapi manusia yang memakannya yang gila. Makanya, berilah makan ternak yang dari sumber-sumber tanaman yang tidak bernajis dan buruk.

berjalan damai. Kepada seluruh pimpinan Parpol demikian juga kepada para Calegnya,Zainuddin minta untuk menyatukan tekad membangun Kabupaten Deliserdang. Meski APBD Deliserdang 2014 sudah menembus angka Rp2,8 triliun,namun dirasakan masih terlalu sedikit untuk menyahuti tuntutan kebutuhan masyarakat yang kian berkembang. Sebelumnya, Kaban Kesbang Drs. H. M. Ali Yusuf Siregar MAP menjelaskan penyelenggaraan rapat koordiasi bertujuan untuk meningkatkan suasana kondusif, nyaman dan harmonis di wilayah Kab. Deliserdang dalam bingkai kesatuan dan persatuan untuk menghadapi Pemilu 2014. Narasumber Kapolres Deliserdang, Dandim 0204/ DS dan Kakan Kemenag Deliserdang dengan peserta tim ,terdiri dari Polres Deliserdang, Polresta Medan, Polres Pelabuhan Belawan, Kodim 0204/ DS, Kodim 0201/BS, pimpinan SKPD, instansi vertikal, GM PT Angkasa Pura II dan Camat se-Kab.Deliserdang.(a06) prosesdemokrasiiniternodaoleh kekerasan yang terjadi,” kata Marciano di Istana Negara, Jakarta, Selasa (4/3) . Menurut dia ada saluran yang bisa digunakan agar partai dipilih rakyat, tanpa menggunakan kekerasan. “Jangan melakukan teror, melakukan intimidasi apalagi dengan cara penembakanpenembakan seperti itu,” kata Marciano. Dia juga berharap agar aparat setempat segera mengusut kasus tersebut. Marciano berharap aparatkepolisianbisamenangkap pelaku penembakan sehingga masyarakat Aceh merasa terlindungi. (vvn/okz/m11)

JAKARTA (Waspada): Para guru peserta Ujian Kompetensi Guru (UKG) yang mengalami kendala mati lampu tidak perlu khawatir. Karena Kementerian Pendidikan dan Kebudayaan melalui Badan Pengembangan Sumber Daya Manusia Pendidikan dan Kebudayaan dan Penjaminan Mutu Pendidikan (BPSDMPK PMP) menegaskan sistem bisa dibuka 24 jam atau esok harinya, sesuai permintaan pani-

tia lokal di sekolah. “Nilai, waktu yang tersisa dan soal-soalnya bisa dikerjakan ketika listrik menyala kembali. Tapi semuanya tetap harus seizin Dinas Pendidikan dan dan LPMP setempat,” kata Sekretaris BPSDMPK PMP, Abi Sujak yang dihubungi melalui telepon selularnya, Selasa (4/3). Seperti diketahui, pelaksanaan UKG di Kota Medan terkendala mati lampu pada

Selasa (4/3) sejak pukul 08.00 WIB hingga pukul 15.00 WIB. Kondisi itu membuat guru-guru khawatir dan bertanya-tanya, seperti yang terjadi di lokasi ujian di SMKN 5 Medan. Peserta UKG Medan mencapai 4.140 yang tersebar di 14 lokasi. Pengumuman hasil pelaksanaan UKG 2014 akan disampaikan langsung oleh BPSDMPK PMP melalui website pada tanggal 11 Maret 2014. (dianw)

Ketua KPU DS ...

sioner KPU Deliserdang, segera diplenokan. Namun, katanya, bukan mustahil jika nanti dua komisioner KPU Deliserdang yang dicopot tersebut (ketua dan seorang anggota) diisi oleh KPU Sumut. ‘’Kalau tidak diisi oleh KPU Sumut, tentu akan ditelusuri

personil yang terdahulu dalam seleksi menempati ranking 6 dan 7 menjadi PAW,’’kata Mulia. Sedangkan Muhammad Yusri yang coba dihubungi wartawan untuk dikonfirmasi mengenai putusan DKPP tersebut,tidak berhasil. Sms yang dikirim kepadanya, juga tidak mendapat balasan. (m34)

Jhonny Alen Dan Sutan ...

setujui SKK Migas dalam proyek konstruksi anjungan pengeboran minyak. Sutan saat bersaksi menampik dirinya memiliki saham di PT Timas. Sutan mengatakan dirinya membantu PT Timas mengomunikasikan ke Rudi karena dia berteman Herman Afifi, komisaris perusahaan tersebut.(j02)

Pencopotan itu menyusul kasus hilangnya surat suara di TPS 18 dan 40, Desa Sei. Semayang, Kec. Sunggal, Kab. Deliserdang. Dampak dari hilangnya surat suara tersebut, juga munculnya putusan sela Mahkamah Konstitusi (MK) yang memerintahkan dilaksanakannyapemungutansuaraulang di dua TPS tersebut pada 19 Februari 2014. “Ini menjadi pembelajaran bagi penyelenggara Pemilu untuk melaksanakan tugas sesuai kewenangan,” ujar Evi. Sedangkan tindak lanjut keputusan itu, KPU Sumut menurut Evi, menunggu salinan putusan DKPP. Namun, Evi memastikan tidak akan mempengaruhi pelaksanaan Pilkada yang belum usai di Deliserdang. “Kalau itu kan tinggal menunggu keputusan dari MK,” ujarnya. Sementara itu, Ketua KPU Sumut, Mulia Banurea, yang dihubungi secara terpisah, menjelaskan, soal pengganti antar waktu (PAW) dua komi-

Ada-ada Saja ... Majelis Kehormatan Hakim resmi memberhentikan Hakim Pengadilan NegeriTebo, Elsadela dan Hakim Pengadilan Agama, Mustahi, karena terbukti melakukan perselingkuhan. Kedua hakim itu diberhentikan karena dinilai telah melanggar kode etik hakim, setelah terbukti berselingkuh. Putusan itu dibacakan Ketua Majelis MKH Andi Syamsu Alam di Gedung Mahkamah Agung, Jakarta, Selasa (4/3). Perselingkuhan itu terbongkar saat Elsadela dilaporkan suaminya, Herman ke Pengadilan Tinggi Jambi karena diduga melakukan perselingkuhan dengan Hakim Pengadilan Agama,Mustahi. Hubunganterlarang itudilakukandikantornya.(vn/m09)

Sutan Pembeking PT Timas Sementara itu, Direktur Utama PT Pertamina, Karen Agustiawan menyebut, Ketua Komisi VII Sutan Bhatoegana merupakan pembeking PT Timas. Hal itu diungkapkan Karen ketika bersaksi di sidang perkara dugaan suap SKK Migas di Pengadilan Tipikor Jakarta, Selasa (4/3). Karen yang bersaksi untuk mantan Kepala SKK Migas Rudi Rubiandini itu awalnya ditanya Jaksa KPK, apakah pernah bertemu secara langsung dengan Sutan Bhatoegana? “Pernah ketemu Sutan?” tanya Jaksa kepada Karen. “Pernah di kantor,” jawab Karen. Jaksa melanjutkan pertanyaan menyinggung urusan Sutan menemui Karen di kantor Pertamina. “Terkait apa, THR?” tanya jaksa lagi.”Tidak,” kata Karen.”Terkait apa?” tekan Jaksa. “Terkait keinginan ikut tender di pengolahan,” jawab Karen. Jaksa kembali menanyakan Karen pengolahan apa yang dimaksud. Karen pun tanpa beban menyebut urusan Sutan.”Terkait dengan PT Timas,” tegas Karen. Sebelumnya, Sutan pernah membicarakan PT.Timas Suplindo ke Rudi Rubiandini yang masih menjabat Kepala SKK Migas. Sutan menanyakan kontrak PT Timas yang belum di-

Gubsu Minta Riau ... tidak terjadi lagi kebakaran lahan.“Janganlagiadahotspotbaik karena kebakaran lahan disengaja atau hanya karena dampak panas matahari,” katanya. “Kabut asap, bukan hanya mengganggu penerbangan, tapi menimbulkan penyakit ISPA pada warga,” katanya. Berfluktuasi BMKG Wilayah I mencatat, tingkat kepekatan asap akibat kebakaran hutan berfluktuasi (berubah-ubah). Sempat membaik namun tiga hari terakhir, kabut asap kembali pekat menyelimuti KNIA (Kualanamu International Airport). Mega Sirait, SP, kepala Seksi Data dan Informasi pada BMKG Wialyah I stasiun Bandara Kualanamu saat dikonfirmasi, Selasa (4/3), membenarkan.Sebaran kabut di kawasan Sumatera Utara hampir menyeluruh hingga ke Tapsel, Madina, Sibolga, Tanjung Balai, Asahan, Batubara, Langkat, Tanah Karo, Deliserdang, Tebingtinggi dan Sergei. (m28/m32)

Medan Metropolitan

WASPADA Rabu 5 Maret 2014


Tiga Anggota Geng Kereta Ditangkap Rampas Sepedamotor PNS Poldasu MEDAN (Wasapada): Polda Sumut melalui Unit II Bunuh/Culik (Buncil) Subdit III Direktorat Reserse Kriminal Umum menangkap tiga tersangka anggota geng kereta yang melakukan perampasan sepedamotor dari dua lokasi berbeda di Medan. Salah satunya diduga terlibat perampokan sepedamotor seorang pegawai negeri sipil (PNS) Polda Sumut. Kabid Humas Poldasu Kombes Pol. Heru Prakoso kepada wartawan, Selasa (4/3) mengatakan, pengungkapan dan

pemberantasan pelaku tindak kriminal di masyarakat, seperti geng kereta merupakan fokus pihak kepolisian. “Aksi-aksi geng kereta sudah sangat meresahkan, mereka melakukan perampokan dengan cara-cara melukai korban. Bahkan, beberapa korban tewas karena terhempas di jalan akibat ditendang kawanan itu,” kata Heru. Sebab itu, Heru menekankan seluruh jajaran, terutama Polresta Medan untuk meningkatkan giat rutin berupa patroli di kawasan rawan terjadinya tindak kriminal, terutama geng kereta. Mengenai tiga tersangka

yang diamankan, menurut dia, masih dalam proses pemeriksaan di Reskrimum. Dua tersangka ditangkap di salah satu tempat hiburan malam di kawasan Jln. Kolonel Sugiono/ Jln. Wajir, Senin (3/3) dinihari sekira pukul 02:30. “Keduanya berinisial LHP, 18, warga Jln. Kutilang VII Perumnas Mandala, dan MIL alias Iis, 29, warga Jln. Tangguk Bongkar I Perumnas Mandala, sudah masuk dalam daftar pencarian orang (DPO) Poldasu setelah melakukan aksinya Januari lalu,” sebut Heru mengatakan, dari dua tersangka diamankan empat pisau, satu sepedamotor Honda Beat BK 5680 ADR.

Sedangkan seorang tersangka lagi berinisial IABS, 26, warga Jln. Bunga Raya I Pasar IV Sunggal, ditangkap di Jln.Tasbih, Sunggal, saat merampas sepedamotor milik Ratna Nefo Sembiring, PNS Polda Sumut. Menurut Heru, tersangka IABS ditangkap saat petugas melakukan pengembangan terhadap dua tersangka yang telah ditangkap sebelumnya. Saat tim Unit Buncil melintas di kawasan Jln. Tasbih, Sunggal, melihat aksi tersangka. Petugas langsung dikejar dan ditangkap. Dari tersangka, polisi mengamankan 1 kunci letter T dan sepedamotor Supra X BK 6770 QP.(m27)

Listrik Sering Padam

UKG Dan Maghrib Mengaji Terganggu MEDAN (Waspada): Akibat pemadaman listrik, pelaksanaan Uji Kompetensi Guru (UKG), maghrib mengaji, majelis taqlim jadi terhambat. Selain itu, keamanan masyarakat juga terancam. PantauanWaspada di SMKN 5 Medan, Selasa (4/3), padamnya listrik sejak pagi membuat suasana UKG terhambat. Peserta pada gelombang pertama yang seharusnya mulai ujian sejak pukul 08:00 hingga pukul 10:00, harus menahan kecewa karena harus menunggu listrik menyala. Tapi nyatanya, mereka tidak juga bisa ujian hingga pukul 15:00. “Kecewa sekali, padahal kami sudah datang tepat waktu, ternyata sampai di sini listrik padam. Jadwal izin dari sekolah hari ini, kalau besok datang lagi, bagaimana dengan tugas mengajar,” kata seorang peserta guru SD yang akhirnya bertahan menantikan listrik menyala pukul 15:00. Kepala Dinas Pendidikan Kota Medan H Marasutan Siregar MPd, mengaku sangat kecewa dengan pemadaman listrik ini, padahal Disdik Medan telah memberikan surat permohonan agar saat pelaksanaan UKG sejak 4 s/d 8 Maret tidak ada pemadaman pada 14 lokasi pelaksanaan ujian. “Sudah disurati, tapi tetap dipadamkan juga,” kata Marasutan yang menyebutkan peserta ujian mencapai 4.140 guru. Dia berharap, peserta UKG yang sudah akrab dengan dunia maya karena harus melaksanakan ujian secara online, bukan hanya membuka internet pada saat ujian, tetapi untuk keperluan refrensi pembelajaran atau yang mendukung untuk proses mengajar sangat perlu menjelajahi dunia maya. Hal ini juga bisa dimanfaatkan untuk menyebar informasi keberhasilan siswa atau kegiatan sekolah yang lainnya kepada sesama guru atau sekolah yang sudah mempunyai website,sehingga pemanfaatan teknologi lebih melancarkan dunia kerja dan membangun jaringan untuk kemajuan pendidikan. Kepala SMKN 5 Medan Maraguna Nasution MAP, menyebutkan, untuk memberikan kemudahan pada peserta yang harus pulang karena tidak dapat mengikuti ujian akibat padamnya listrik, pihaknya meminta penyelenggara agar server tidak ditutup pada pukul 17:00. “Untuk pelaksanaan ujian selanjutnya, saya usulkan pada pelaksana yakni LPMP agar tidak menutup server mereka pukul 17:00. Kami bersedia menunggu peserta untuk bisa ujian walaupun sampai malam hari. Karena UKG ini harus dilaksanakan sesuai jadwal,” tuturnya. Maraguna memberikan saran agar peserta yang jumlahnya 300 orang di SMKN 5, setiap gelombang yang jumlahnya 25 orang bisa ditambah menjadi 32 orang setiap gelombangnya. Maghrib Mengaji Sementara itu, Ustadz Drs H Amhar Nasution MA juga menyatakan kekecewaannya terhadap pemadaman listrik yang dilakukan PT. PLN. Kata dia, krisis listrik di Sumatera Utara, selain merugikan masyarakat juga menghambat perekonomian nasional. “Masyarakat terancam keamanannya karena banyaknya aksi pencurian, perampokan, pendidikan juga terancam karena anakanak tidak dapat belajar di malam hari dan program kegiatan

maghrib mengaji jadi terganggu. Lebih parahnya lagi perkuliahan malam hari serta majelis taqlim terhenti,” ujar Amhar Nasution kepada Waspada, Selasa (4/3). Menurut ustadz yang juga dosen di sejumlah perguruan tinggi negeri dan swasta itu, kegiatan maghrib mengaji dalam beberapa bulan belakangan ini terkenda akibat PLN mematikan listrik 34 kali sehari semalam. Amhar Nasution mengatakan, masyarakat sepatutrnya marah kepada PLN dan bersama-sama menekan perusahaan negara itu agar memperbaiki kinerjanya yang buruk. Selama ini, masyarakat terlalu baik dan pemaaf pada PLN sehingga krisis listrik di Sumut tidak pernah teratasi. Seharusnya masyarakat giat melakukan aksi dan tekanan agar manajemen PLN benarbenar profesional, mampu menyusun strategi jangka panjang dan pendek agar krisis listrik di provinsi ini tuntas. Oleh karena itu, kata Amhar, presiden mendatang pada Pemilu 2014 harus memprioritaskan kesinambungan dan ketersediaan energi khususnya di Sumut. Bentuk BUMD Listrik Terkait ide pembentukan Badan Usaha Milik Daerah (BUMD) Listrik, Ustadz Amhar sependapat dengan Wagubsu dan menyambut positif. Apalagi kebijakan itu sudah ada di daerah lain, dan mendapat dukungan pansus Listrik di DPRD Sumut. Dia meminta Menteri BUMN Dahlan Iskan menepati janjinya mengatasi krisis listrik, tidak sekadar basa-basi lagi agar namanya tetap dikenang dan dihormati masyarakat Sumut. “Rakyat cuma berharap listrik aman, infrastruktur terpenuhi dan umat Islam mudah beribadah,” sebutnya.(m37/m03)


KADISDIK Medan Marasutan Siregar MPd, didampingi Kepala SMKN 5 Maraguna Nasution MAP, melihat pelaksanaan UKG yang diwarnai padamnya listrik, Selasa (4/3) sejak pukul 08:00 s/d 14:00.

Medan Metropolitan


WASPADA Rabu 5 Maret 2014

Pembukaan MTQ Ke-47 Kota Medan

Konvoi Sepeda Semarakkan Pawai Ta’aruf

Waspada/Rizky Rayanda

PLT WALI Kota Medan Dzulmi Eldin (kiri) didampingi istri Hj. Rita Maharani (kanan) melambaikan tangan kepada peserta pawai taaruf MTQ ke-47 tingkat Kota Medan di Jln. Gaperta Medan, Senin (3/3).

MEDAN (Waspada): Pawai Ta’aruf sebagai tanda mengawali pembukaan Musabaqoh Tilawatil Quran (MTQ) ke-47 tingkat Kota Medan, terlihat berbeda dari tahun sebelumnya. Sebab, tahun ini pawai ta’aruf disemarakkan dengan konvoi sepeda yang dilakukan jajaran Kecamatan Medan Petisah. Selain itu, terlihat penampilan busana daur ulang dari sampah dan memamerkan hewan reptil. PantauanWaspada, Senin (3/3), ribuan kafilah dari 21 kecamatan yang ada di Kota Medan terlihat antusias mengikuti pawai ta’aruf di Jln. Gaperta Medan Helvetia. Peserta pawai ta’aruf disambut oleh Plt Wali Kota Medan Dzulmi Eldin, Ketua DPRD Medan Amiruddin, tokoh masyarakat, ulama, serta unsur Forum Komunikasi Pimpinan Daerah (FKPD) Kota Medan dan para pimpinan SKPD jajaran Pemko Medan. Pawai diawali laporan dari Komandan Pawai Kapolsek Medan Helvetia Kompol Anggoro Wicaksono kepada Plt Wali Kota Medan Dzulmi Eldin, dilanjut dengan barisan Marching Band Bina Musika MAN-2 Model Medan. Sedangkan konvoi peserta pawai ta’aruf diawali peserta dari Medan Johor dengan membawa tropi bergilir yang dimenangkan pada MTQ tahun lalu. Pawai ini disemarakkan dengan konvoi sepeda yang ditampilkan dari Kec. Medan Petisah, terlihat camat, lurah dan kepling Medan Petisah mengenakan sepeda bersama-sama. Selain itu kecamatan ini juga memamerkan busana daur ulang dari sampah. Kecamatan Medan Selayang menampilkan hewan reptile berupa buaya juga busana daerah delapan etnis. Para peserta pawai ini terlihat selain menampilkan marching band juga menampilkan ciri khas budaya 8 etnis, selain itu juga terlihat penampilan reog, kuda lumping, dan barongsai. Camat Medan Petisah M Yunus mengatakan, mereka memang melakukan konvoi sepeda, karena selama ini Kec. Medan Petisah juga sudah membudayakan bersepeda ke tempat kerja. Untuk itulah, pihaknya ingin mengajak masyarakat Kota Medan untuk bersama-sama bersepeda selain dapat meminimalisir polusi udara juga menyehatkan badan. “Selama ini kami sudah

membudayakan bersepeda ke kantor di hari Jumat, makanya ini kita juga berkonvoi bersepeda bersama untuk menyemarakkan MTQ,” katanya. Plt Wali Kota Medan Dzulmi Eldin mengatakan, pawai ta’aruf ini merupakan gambaran kesiapan semua kecamatan yang ada di Kota Medan dalam mengikuti MTQ ke-47. Selain itu juga pawai ta’aruf ini mengajak masyarakat untuk ikut serta dan berpartisipasi didalam rangka memeriahkan acara MTQ, bersama-sama melakukan pawai sehingga menunjukkan kebersamaan dengan pemerintah, masyarakat, serta para qori dan qoriahnya. Menurut Eldin, MTQ akan dibuka pada malam harinya oleh Gubernur Sumatera Utara Gatot Pujo Nugroho. Untuk itulah, Eldin mengharapkan agar masyarakat Kota Medan mau berbondongbodong bersama-sama hadir dalam rangka memeriahkan pembukaan MTQ dan menjadikan MTQ ke-47 ini sebagai momentum untuk gemar membaca Alquran dan sekaligus mengimplimentasinya di tengah-tengah kehidupan bermasyarakat, serta keluarga. “Kepada para qori dan qoriah agar bertandinglah dengan lillahi ta’alla, karena yang dibaca adalah ayat-ayat suci Alquran. Disamping kita juga ingin mendapatkan yang terbaik, yakinlah diri kita terhadap penilian para dewan juri, dan apa yang diputuskan oleh dewan juri adalah merupakan hasil yang terbaik, jujur, dan tidak direkayasa sama sekali,”ujar Eldin. Usai menerima pawai ta’aruf dilanjut dengan pengguntingan pita oleh Wakil Ketua PKK Kota Medan Rita Maharani menandai dibukanya bazar untuk memeriahkan MTQ ke-47 ini, juga peninjauan stand bazar oleh PltWali Kota Medan berserta FKPD, tokoh masyarakat, ulama dan SKPD. Adapun jumlah stand ini sebanyak 102 stand yang diikuti 21 kecamatan, SKPD, BPJS serta Perguruan Tinggi. Pantauan Waspada, pelaksanaan pawai ta’aruf ini kurang tertib, karena peserta pawai yang masuk ke lokasi MTQ dan peserta yang keluar terlihat satu jalur sehingga semrawut. Selain itu, sampah banyak berserakan di lokasi sehingga Sekda Kota Medan Syaiful Bahri terlihat sibuk mengutip sampah sebelum pelaksanaan MTQ dibuka. (m50)

Pemko Medan Somasi Dinas Tarukim Sumut PT. Waskita Karya Terancam Blacklist MEDAN (Waspada): Pemerintah Kota (Pemko) Medan berang melihat kinerja Dinas Tarukim Sumut. Pasalnya, proyek pembangunan pipanisasi limbah yang sudah berjalan sejak beberapa bulan lalu menyebabkan sejumlah ruas jalan di Medan rusak, namun tidak juga diperbaiki. Menyikapi hal ini, Pemko melakukan somasi terhadap Dinas Tarukim Sumut sebagai Satuan Kerja (satker) proyek dari Kementerian PU tersebut. “Sudah berulangkali kita melayangkan surat supaya mereka memperbaiki jalan-jalan yang rusak akibat galian tersebut, namun tidak diindahkan. Makanya, kita somasi Dinas Tarukim Sumut minggu lalu. Jangan sampai mereka yang merusaknya, Pemko yang memperbaikinya. Inikan sudah tidak benar lagi,” kata Kadis PU Bina Marga Kota Medan Khairul Syahnan kepada Waspada, Selasa (4/3).

Syahnan menjelaskan, Pemko Medan sudah berulangkali menyurati Satker proyek pipanisasi limbah tersebut, namun sampai saat ini tidak mendapat respon. “Kesulitan kita karena tidak ada rekomendasi apapun dari Plt Wali Kota Medan, meski proyek dikerjakan di Kota Medan. Akibatnya, Pemko Medan jadi tidak punya gigi. Seharusnya ada rekomendasi pada saat pengerjaan. Kenyataannya, Pemko Medan sama sekali tidak ada dilibatkan mulai dari pengerjaan proyek hingga pembayaran, makanya jadi susah. Kita surati berulangkali, tapi tidak pernah mendapatkan respon,” ujarnya. Blacklist Sementara itu, Plt. Wali Kota Medan Dzulmi Eldin mengatakan, Pemko Medan sudah berulangkali menyurati Satker Dinas Tarukim, namun tidak juga mendapat respon. Jika tidak ada solusi dari Satker atau dari kontraktor untuk memperbaiki jalan yang sudah rusak tersebut, maka Pemko Medan juga akan memblacklist PTWaskita Karya.

Mushalla Al Wahdah Diperluas Butuh Bantuan Masyarakat MEDAN (Waspada): Untuk menambah jumlah jamaah yang beribadah di Mushalla Al Wahdah, warga sekitar melalui badan kenaziran mushalla melakukan perluasan bangunan yang sudah dimulai sejak satu bulan lalu. Nazir Mushalla Al Wahdah Dachyar Syah mengatakan, selama ini jumlah jamaah yang beribadah di mushalla tersebut hanya sekitar 60 orang. Sementara pada kegiatan tertentu seperti shalat Tarawih, masyarakat yang ingin beribadah melebihi kapasitas yang tersedia. “Alhamdulillah, respon masyarakat untuk pembangunan mushalla ini baik, tapi tentu dana yang terkumpul selama ini masih kurang. Sebab, total dana yang dibutuhkan sebesar Rp376.125.000. Karena itu, panitia mengharapkan bantuan dari masyarakat demi kelangsungan pembangunan mushalla yang sudah berdiri sejak 1960 ini,” katanya Senin (3/3). Dikatakannya, bangunan yang ditambah seluas 8,5 x 12 meter. Sampai saat ini, bangunan tersebut rampung sekitar 30 persen. “Kami berharap bangunan dapat diselesaikan sebelum Ramadhan sehingga bisa digunakan masyarakat untuk shalat Tarawih dan tadarusan,” ujar Dachyar. Bagi masyarakat yang ingin membantu pembangunan Mushalla Al Wahdah dapat langsung datang ke Sekretariat Panitia Jln. Puri Gg. Kesatuan Kel Kota Matsum, Kec Medan Area atau dapat menghubungi Ketua Panitia Pembangunan H Erwin Yusran (082367667887).(m45)

“Kalau tidak juga diperbaiki, maka yang resah tetap warga Kota Medan, makanya kita akan memblacklist PT Waskita Karya. Jangan sampai orang yang punya kerja, kita yang memperbaikinya,” tegas Eldin. Pelaksana Dinas Tarukim Sumut Heryanto ketika hendak dikonfirmasi melalui telepon, ternyata ponselnya tidak aktif.

Begitu juga dengan Satker Air Limbah Dinas Tarukim Sumut Syarifah. Saat dihubungi berulangkali, Syarifah tidak menjawab telepon genggamnya. Sedangkan Kepala Proyek MSMHP IV PT. Waskita Karya Pantas Tambunan ketika dikonfirmasi mengakui sudah beberapa kali mendapat surat dari Pemko Medan, namun tidak sa-

tupun yang mereka balas. Sebab, menurut Pantas, seharusnya pihak Satker Dinas Tarukim sumut yang berwenang untuk menjawab surat tersebut. “Memang sudah ada surat dari Pemko Medan, tapi kami tidak ada kewenangan untuk membalasnya. Yang membalas surat itu seharusnya pihak Satker sebagai pejabat pemegang

kuasa anggaran,” ujar Pantas. Namun, lanjut Pantas, surat yang dilayangkan Pemko Medan itu menjadi motivasi pihaknya untuk bekerja. “Ada beberapa jalan yang memang belum kita aspal, karena masih menunggu proses pemadatan dulu setelah itu baru kita perbaiki dan kita aspal. Jln. Sutomo, Jln. Gaharu dan Jln. Krakatau itu

sudah kita aspal dan tinggal di Jln. Gaharu itu sedikit yang belum diaspal,” ujarnya. Sementara untuk jalan lainnya seperti Jln. Pelita II saat ini sedang dilakukan pengerjaan, di Jln. bukit Barisan I dan II. Untuk Jln. Bukit Barisan II sudah diaspal. Untuk proyek pipanisasi limbah sekunder dari rumah-

rumah warga nantinya akan dilakukan dengan kontrak selanjutnya. “Kalau Medan menjadi Kota Metropolitan memang harus dibangun pipanisasi limbah ini, kalau yang sekarang dilakukan masih pipanisasi primernya. Kalau kami dari Waskita hanya menangani proyek IV dan II di Jln. Cemara,” katanya. (m50)

Bayi Alami Ketulian Bisa Hidup Normal MEDAN (Waspada): Bayi yang mengalami gangguan pendengaran dan ketulian bisa hidup normal dan tidak perlu sekolah luar biasa (SLB), jika sebelum usia enam bulan dihabilitasi dan rehabilitasi dengan alat bantu dengar. Oleh sebab itu, para bidan se Sumut diharapkan dapat melakukan skrinning kepada bayi yang baru lahir, sehingga gangguan pendengaran bisa diketahui lebih dini. “Para bidan harus melakukan skrinning pada bayi baru lahir untuk mengetahui bayi tersebut mengalami gangguan

pendengaran atau tidak. Caranya gampang, dengan membunyikan alat-alat sederhana dekat si bayi. Jika tidak ada respons atau curiga ada bakat bayi mengalami tuli, rujuk ke dokter spesialis telinga hidung dan tenggorokan,” kata Ketua Komda PGPKt Sumut Prof. DR. dr. Delfitri Munir Sp.THT-KL (K), disela-sela acara bhakti sosial pemeriksaan THT dan Pemberian Alat Bantu Dengar kepada tiga Sekolah Luar Biasa (SLB) di Taman Pendidikan Islam (TPI), Selasa (4/3). Selain bidan, menurut Prof Delfitri, orangtua juga bisa men-

deteksi secara dini untuk mengetahui apakah bayi mengalami gangguan pendengaran atau tidak. “Jika bayi dapat tidur nyenyak dan tidak terkejut, meski suara berisik di sekitarnya itu patut dicurigai ada bakat tuli. Ini harus segera dirujuk kedokter,” ujarnya. Menurut dia, ketulian ini bisa disebabkan faktor genetik atau saat hamil ibu terinfeksi virus torch dan rumella. “Bisa juga saat lahir berat badan bayi kurang, sehingga saraf pendengarannya terganggu. Bisa juga terjadi setelah lahir ketika bayi terkena meningitis. Maka-

nya, paling baik bayi sudah terdeteksi alami gangguan pendengaran harus dihabilitasi dan rehabilitasi dengan alat bantu dengar sebelum usia 6 bulan, sehingga usia 3 tahun dan seterusnya bisa hidup normal, dan tidak perlu sekolah di SLB,” sebutnya. Saat ini, kata Delfitri, Komda PGPKt Sumut sudah melatih 900 bidan di Rantauprapat, Tebingtinggi, dan Pematangsiantar. “Target kita seluruh bidan se Sumut kita latih untuk mendeteksi dini gangguan pen-

dengaran. Tanpa diminta orangtua, bidan harus melakukan skrinning,” tuturnya sembari mengatakan, seluruh kab/ kota juga harus peduli dengan gangguan pendengaran ini. Ditambahkannya, pada Hari Pendengaran Sedunia 3 Maret kemarin, Komda PGPKt membagikan 5 ribu brosur di persimpangan jalan di Medan, dan membagikan 17 alat bantu dengar kepada sekolah SLB-B Karya Murni, SLB-ABC Taman Pendidikan Islam, dan Yayasan Rumah Siput Indonesia. “Kegia-

tan ini bekerjasama dengan Lions Clubs Indonesia Distrik 307 A2,” katanya lagi, sembari menyarankan anak yang sudah memakai alat bantu dengar, agar diterapi bisa berbicara dan mendengar maksimal. Sementara itu, Sekretaris Komda PGPKt Dr. Adlin Adnan, SpTHT-KL menambahkan, alat bantu dengar yang diharapkan itu yang bisa menyaring suara dengan alat bantu dengar digital. “Namun terkadang anak tidak merasa nyaman dengan itu,” sebutnya. (h02)

Gelapkan Dana Kurban, Divonis 16 Bulan MEDAN (Waspada): Terdakwa Indra Zulkarnain Nasution, 45, yang melakukan tindak penipuan dan penggelapan dana lembu kurban milik masyarakat Delitua, divonis 1 tahun empat bulan(16bulan)penjaraolehmajelishakimPengadilanNegeri(PN) Lubukpakam yang bersidang di Pancurbatu, Selasa (4/3). Dalam persidangan yang dipimpin Ketua Majelis Hakim Sukry SH, dinyatakan terdakwa Indra Zulkifli Nasution, warga Dusun III, Desa Suka Makmur, Kec. Delitua, terbukti bersalah melanggar pasal 374 jo 65 ayat 1 KUHP dalam kasus penipuan dan penggelapan. Menurut hakim, terdakwa secara sengaja melakukan peni-

puan dan penggelapan dana milik masyarakat untuk membeli 10 ekor lembu kurban senilai Rp91 juta pada Idul Adha lalu. Sebelumnya, Jaksa Penuntut Umum (JPU) Fachri Rahmadani SH, menuntut terdakwa agar dihukum 18 bulan penjara dipotong masa penahanan. Diketahui, terdakwa Indra Zulkarnain Nasution dihakimi warga saat berada di Masjid Baiturrohim, Selasa (15/10) siang. Menurut perwakilan Badan Kenaziran Masjid (BKM) Baiturrohim Ponidi, penggelapan dana kurban tersebut diketahui setelah warga curiga melihat gelagat terdakwa saat ditanyai perihal hewan kurban. Setelah shalat Idul Adha,

hewan kurban yang sudah dipesan ternyata belum datang. Sementara itu dana Rp91 juta milik warga sudah diserahkan kepada terdakwa Indra. Kata Ponidi, terdakwa Indra berdalih uang pembeli lembu kurban itu sudah diserahkan kepada pedagang lembu di kawasan Secanggang, Langkat. Ternyata, setelah dicek ke Langkat, uang itu tidak ada diserahkan terdakwa ke pedagang lembu di sana. Akhirnya, terdakwa mengaku uang tersebut sudah digunakannya untuk kepentingan pribadi.Warga yang emosi langsung menghajar terdakwa hingga babak belur dan menyerahkannya ke Polsek Delitua. (m40)

Waspada/Mursal AI

KOMDA PGPKt Sumut Prof. DR. dr. Delfitri Munir Sp. THT-KL (K) (kiri) bersama Sekretaris Komda PGPKt Dr. Adlin Adnan SpTHT-KL (tengah) saat memeriksa telinga salah satu murid SLB di TPI Jln. SM. Raja Medan, Selasa (4/3).

Tiga Tersangka Korupsi Alkes Ditahan Pejabat RSPM Terima Gratifikasi Tiket Perjalanan Ke LN


SEJUMLAH pekerja melaksanakan pembangunan Mushalla Al Wahdah di Jln. Puri Gg. Kesatuan, Kel. Kota Matsum, Kec Medan Area, Senin (3/3).

MEDAN (Waspada): Setelah menjalani pemeriksaan secara intensif dan mendengarkan keterangan saksi ahli, akhirnya penyidik Reskrim Unit Tipikor Polresta Medan menahan tiga tersangka kasus korupsi alat kesehatan (alkes) RSU Pirngadi Medan (RSPM). Ketiga tersangka yakni KA, 45, warga Jln. Setia Budi Medan selaku pemenang tender alkes yang menggunakan nama perusahaan PT IGM (Indofarma Global Medica); Suk, 50, PNS RSU Pirngadi Medan, warga Jln. Polonia Medan, sebagai pejabat pembuat komitmen (PPK) dan AA, 45, warga Tangerang sebagai pelaksana kontrak. Data yang diperoleh Waspada di Polresta Medan, Selasa (4/3), tersangka KA selaku pemenang tender mendapat

keuntungan dari proyek ini sebesar Rp900 juta. Kemudian pejabat RSU Pirngadi berinisial Suk menerima gratifikasi dari KA berupa tiket perjalanan ke luar negeri. Sedangkan tersangka AA menerima keuntungan atau fee sebesar Rp 200 juta karena perusahaan miliknya PT IGM digunakan oleh KA untuk mengikuti tender tersebut. Ketiga tersangka dikenakan pasal 2 ayat 1, pasal 3, 5, 12b UU Korupsi No. 20 tahun 2001 tentang perubahan UU No. 31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi dengan ancaman hukuman 15 tahun. Modus yang dijalankan ketiga tersangka yakni mengarahkan merek alkes dari distributor tertentu untuk dijadikan bahan dalam pelelangan. Kemudian, harga alkes di mark up hingga pembayaran

100 persen kepada rekanan. Alkes yang di mark up antara lain anestesi, kamera PCNL, LMA dan Vigon. Kerugian negara akibat perbuatan tersangka mencapai Rp3 miliar. “Tiga orang yang ditetapkan sebagai tersangka sudah ditahan. Tetapi KPA (kuasa pengguna anggaran) berinital AL belum diperiksa. Diharapkan AL segera datang memenuhi panggilan penyidik,” kata seorang petugas di sana. Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak yang dikonfirmasi Waspada membenarkan adanya tiga tersangka korupsi alkes RSU Pirngadi Medan yang ditahan. “Tiga tersangka sudah kita tahan dan saat ini masih dalam pemeriksaan,” katanya.(m39)

Medan Metropolitan

WASPADA Rabu 5 Maret 2014

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-278 11 Banda Aceh GA-142 12 Banda Aceh GA-280 14 Palembang GA-266 15. Palembang GA-268 16. Batam GA-270 17. Batam GA-272 18. Padang GA-260 19. Penang GA-804 20. Pekanbaru GA-276 21. Tanjungkarang GA-270

05.15 08.55 11.00 12.10 13.20 13.55 16.45 18.30 20.30 07.15 09.40 17.10 06.00 17.40 09.30 14.20 10.35 10.55 06.00 12.35

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Banda Aceh Palembang Palembang Batam Batam Padang Penang Pekanbaru Tanjungkarang

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-279 GA-143 GA-281 GA-267 GA-269 GA-271 GA-273 GA-261 GA-805 GA-277 GA-271

08.10 08.55 10.15 11.25 13.10 16.00 17.30 19.30 22.10 09.50 12.35 19.45 09.55 21.35 12.50 20.45 16.25 13.20 08.45 20.10

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Bangkok 9 Bandung 10 Surabaya 11 Bandung 12 Penang 13 Pekanbaru 14 Singapura 15 Kuala Lumpur

QZ-8050 06.20 QZ- 8054 17.40 AK- 1351 08.00 AK-1355 17.55 QZ-8072 14.25 AK-1581 18.45 AK-1357 21.20 QZ-8084 14.15 QZ-7987 08.45 QZ-7611 13.15 QZ-7981 17.10 QZ-8078 06.25 QZ-8028 11.30 QZ-664 07.45 QZ-8052 13.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Penang Pekanbaru Singapura Kuala Lumpur

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-1580 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8079 QZ-8029 QZ-665 QZ-8053

08.30 10.55 07.35 17.00 16.35 18.30 21.05 16.40 11.30 09.55 19.55 08.35 12.50 10.35 15.55

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT-207 JT- 301 JT-395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.40 08.05 13.35 2010 18.00 20.40 19.30 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.05 17.20 17.50 19.45 10.25 15.55 09.20 18.25. 21.05 22.20 23.50 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur

MH-861 MH-865 NH-841

09.40 15.45 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur

MH-860 MH-864 MH-840

08.50 15.00 06.15

SILK AIR 1 Singapura 2 Singapura 3 Singapura

MI-233 MI-237 MI-235

08.40 20.35 13.15

Singapura Singapura Singapura

MI-234 MI-238 MI-236

07.35 19.50 12.20

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang 9 Jakarta

SJ-021 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021 SJ-017

13.15 15.55 16.50 10.20 17.20 12.50 07.20 16.00 08.05

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang Jakarta

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020 SJ-016

18.10 16.20 14.55 11.50 15.45 14.20 09.50 14.10 17.20

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55





MANDALA AIRLINE 1 Singapura RI-861

Tiba Dari



Wagubsu: Jaga Harmonisasi MEDAN (Waspada): Wakil Gubernur Sumut (Wagubsu) Ir H T Erry Nuradi MSi mengemukakan, meski proses pembauran kebangsaan di Sumut, cukup harmonis dan kondusif namun janganlengahpadakemapananini. “Kita jangan lengah, melainkan harus setiap saat berupaya memperkukuh dan menjaga harmonisasi itu tetap utuh dan solid,” ujarWagubsu saat menerima rombongan Forum Pembauran Kebangsaan (FPK) Kalimantan Tengah (Kalteng), Senin (3/4) malam. Pada pertemuan sekaligus jamuan makan malam itu, Wagubsu didampingi Asisten I Ketataprajaan Setdaprovsu Hasiholan Silaen, Kepala Badan Kesbangpol Sumut H Eddy Syofian, dan Ketua FPK Sumut Ba-

hari Damanik memaparkan, semua komponen harus komit menjaga kemapanan ini termasuk FPK. Kepada rombongan yang dipimpin Asisten I Pemprov Kalteng Drs H Mukhtar MSi, dan Ketua FPK kabupaten itu, Wagubsu menyampaikan, FPK berperan strategis guna membantu daerah melakukan pembinaan dan pemeliharaan ketertiban dan ketentraman masyarakat terhadap kemungkinan timbulnya ancaman keutuhan dan kerukunan bangsa. Asisten I Pemprov Kalteng Drs H Mukhtar MSi, mengakui pihaknya kagum atas suasana pembauran kebangsaan yang cukup baik di Sumut, meskipun provinsi ini masyarakatnya cukup heterogen dan dinamis.

“Itulah sebabnya kami datang untuk mempelajari sekaligus tukar pengalaman untuk lebih memberhasilkan proses pembauran kebangsaan secara hakiki,” sebutnya sembari memperkenalkanrombonganberjumlah 37 orang termasuk beberapa wakil bupati dari Kalteng. Lebih lanjut Wagubsu mengemukakan, bangsa Indonesia sebagai bangsa yang besar, kemajemukan yang terdiri dari beragam agama, bahasa, suku, ras, dan kelompok etnik, menjadikan perhatian bersama yang mengingatkan untuk selalu meningkatkan kewaspadaan agar ancaman konflik yang dapat meresahkan masyarakat dapat dihindari. Di tengah kondisi masyarakat Indonesia yang sangat multi-

Nama KA

U28 A U30 A U32 A U34 A U27 A U29 A U31 A U33 A U37 A U38 A U39 A U40 A U41 A U42 A U43 A U44 A U35 A U36 A U45 A U46 A U47 A U48 A U49 A U50 A U51 A U52 A U53 A U54 A U55 A U56 A U57 A U58 A U59 A U60 A








RANTAU P 07.47 RANTAU P 10.17 RANTAU P 15.44 RANTAU P 23.03 MEDAN 07.52 MEDAN 14.58 MEDAN 17.18 MEDAN 23.13 MEDAN 08.08 SIANTAR 14.30 MEDAN 07.50 TANJUNG 06.49 MEDAN 13.06 TANJUNG B 13.11 MEDAN 19.36 TANJUNG B 17.33 MEDAN 05.42 TEBING TINGGI 18.44 MEDAN 05.46 BINJAI 05.02 MEDAN 07.14 BINJAI 06.30 MEDAN 09.15 BINJAI 08.30 MEDAN 12.18 BINJAI 10.00 MEDAN 13.53 BINJAI 13.09 MEDAN 16.49 BINJAI 14.37 MEDAN 19.00 BINJAI 18.16 MEDAN 21.40 BINJAI 20.56

13.56 15.46 22.02 04.38 14.04 10.17 22.55 04.47 11.54 18.24 12.54 11.11 18.01 17.45 00.29 22.24 07.42 20.57 06.15 05.31 07.43 06.59 09.44 08.59 12.47 10.29 14.22 13.38 17.18 15.06 19.29 18.45 22.09 21.25

Jadwal Keberangkatan KA Bandara Kuala Namu- Medan

No. KA

No. KA



kultur, maka pembauran kebangsaan merupakan bagian penting dari kerukunan nasional dalam upaya meningkatkan persatuan dan kesatuan bangsa. Untuk itu, dalam rangka menjaga dan memelihara keutuhan serta tetap tegaknya ke-

daulatan Negara Kesatuan Republik Indonesia, diperlukan adanya komitmen seluruh bangsa dan upaya-upaya guna meningkatkan persatuan dan kesatuan bangsa, salah satunya melalui pemberdayaan Forum Pembauran Kebangsaan (FPK).

Forum ini merupakan wadah informasi, komunikasi, konsultasi dan kerjasama antara masyarakat yang diarahkan untuk menumbuhkan, memantapkan, memelihara, dan mengembangkan pembauran kebangsaan. (m28)

DPRD: Eldin Harus Tegas MEDAN (Waspada): Wakil Ketua DPRD Kota Medan Ikrimah Hamidy mendesak Plt Wali Kota Medan Dzulmi Eldin agar bersikap tegas dalam mengevaluasi kinerja jajarannya. Dia juga meminta Eldin menjalankan ultimatum yang telah disampaikannya terhadap Kadis Pertamanan Kota Medan Zulkifli Sitepu terkait banyaknya pohon pelindung jalan yang mati dan taman kota tidak terawat. “Sebagai pemimpin, Plt.Wali Kota harus melaksanakan apa yang telah diucapkannya. Kalau memang ucapan itu tidak bisa dijalankan, maka jangan disampaikan kepada publik. Jika Plt Wali Kota Medan memberikan ultimatum satu minggu kepada Kadis Pertamanan, maka harus dijalankan,” kata Ikrimah kepada Waspada, Selasa (4/3). Ikrimah juga mengaku heran dengan pernyataan Plt

Wali Kota Medan Dzulmi Eldin yang memberikan ultimatum kepada Zulkifli Sitepu saat meninjau kondisi pohon pelindung jalan yang layu dan mati. “Saya juga terkejut saat membaca di media massa bahwa Plt. Wali Kota Medan mengultimatum Kadis Pertamanan dan memberikannya waktu satu minggu untuk menyelesaikan masalah taman kota dan pohon yang mati. Namun sampai saat ini, ultimatum tesrebut tidakdilaksanakan.Padahalsudah dua minggu berjalan,” ujarnya. Karena itu, Ikrimah meminta Plt Wali Kota Medan jangan menyampaikan pernyataan kepada publik jika hanya bersifat gertak sambal. Sebab, apa yang telah diucapkan Eldin akan menjadi konsumsi publik dan realisasinya ditunggu oleh masyarakat. “Sebenarnya, saya juga tidak percaya kalau Kadis Pertamanan mampu menyelesaikan taman-taman yang sudah rusak

dalam waktu satu minggu. Ternyata kekhawatiran saya benar, dan pernyataan pak Eldin hanya sebatas ancaman,” ujarnya. Ikrimah juga sangat menyesalkan kinerja Kadis Pertamanan Zulkifli Sitepu yang sampai saat ini belum menunjukkan peningkatan. Karenanya, dia meminta Plt Wali Kota Medan segera mengevaluasi kinerja Kadis Pertamanan. Menurut Ikrimah, kinerja di Dinas Pertamanan itu hanya tiga yang paling pokok. Yakni mengurus taman, lampu jalan dan reklame. Tapi semua ini tidak dikerjakan dengan baik. “Kita bisa lihat bagimana kondisi taman-taman kota saat ini, begitu juga dengan kondisi lampu jalan banyak yang padam. Bahkan banyak papan reklame yang merusak keindahan kota. Seperti di zona larangan juga masih banyak papan reklame yang belum ditertibkan,” kata Ikrimah. Sebelumnya, Plt. Wali Kota Medan Dzulmi Eldin menga-

takan, kinerja Kadis Pertamanan Zulkifli Sitepu sudah mulai ada perubahan. “Kita kan tidak mau tendensius menilai orang. Kita mendorong agar kinerjanya bisa diperbaiki, jadi tidak tendensius,” ujarnya. Sedangkan Kadis Pertamanan Kota Medan Zulkifli Sitepu

mengatakan, pihaknya sudah banyak melakukan perbaikan kinerja terutama untuk menangani pohon-pohon yang kering. Menurutnya, sesuai dengan arahan dari pakar lingkungan, maka pada median jalan dibuat parit sehingga daya serap air bisa lebih banyak.

Terkait dengan papan reklame, Zulkifli juga mengatakan, telah melakukan penertiban secara berkala. “Setiap saat kita melakukan pembenahan taman-taman dan pemangkasan pohon-pohon. Namun, mengerjakan semua ini tidak bisa sekaligus,” katanya. (m50)

Pejabat Poldasu Dilaporkan Ke Propam Mabes Polri MEDAN (Waspada): Pejabat di Polda Sumut dilaporkan Ketua Majelis Muslimin Indonesia Kota Pematangsiantar ke Divisi Propam Mabes Polri. Laporan itu terkait terbitnya surat pemberitahun perkembangan hasil penyelidikan (SP2HP) dugaan ijazah palsu Wali Kota Pematangsiantar Hulman Sitorus. Kepada wartawan di Medan, Selasa (4/3), Ketua MMI Kota Pematangsiantar Ir Bonatua Naipopos mengatakan, pihaknya melaporkan Direktur Dit Reskrimum Poldasu Kombes Dedi Irianto, karena banyak menemukan kejanggalan dalam penerbitan SP2HP. “Banyak kejanggalan, sehingga kita mengadukannya ke Propam Mabes Polri,” katanya. Kejanggalan dalam SP2HP yang diterimanya sebagai pihak pelapor, di antaranya tidak dicantumkan tembusan surat ke Mabes Polri, padahal kasus itu dilaporkan ke Mabes Polri. “Dalam surat Kabag Reskrim Mabes Polri yang kami terima, disebutkan Poldasu sebagai perpanjangan tangan Mabes Polri harus mengkoordinasikan setiap perkembangan proses hukum kasus itu ke Bareskrim. Tetapi SP2HP tidak ditembuskan

ke Bareskrim. Apalagi disebut pula proses hukum dihentikan. Identiknya ini SP3, bukan SP2HP,” sebutnya. Kejanggalan lain terkait keterangan Dinas Pendidikan Pematang yang dijadikan dasar oleh penyidik untuk menghentikan proses penyelidikan. “Saya heran Dinas Pendidikan Pematang mana yang dimaksud penyidik, yang saya tahu Dinas Pendidikan Kota Pematangsiantar. Kalau Dinas Pendidikan Pematang, saya tidak tahu di mana keberadaannya di Indonesia ini,” ujar dia. Apalagi, kata dia, hanya satu ijazah pembanding yang dijadikan penyidik sebagai dasar menghentikan proses penyelidikan. “Sementara kami menyerahkan tiga ijazah untuk pembanding. Kok bisa tiga bukti ijazah pembanding yang kita serahkan sebagai bukti dikalahkan oleh satu ijazah pembanding yang sampai sekarang tidak pernah diperlihatkan penyidik kepada kami. Ini diskriminasi terhadap bukti-bukti hukum,” tuturnya. Paling mengherankan, kata Bonatua, Direktur Reskrimum Kombes Dedi Irianto mengaku tidak tahu SP2HP telah diterbit-

kan penyidik pada 10 Februari 2014. “Kami melaporkan kasus itu 2011, tetapi SP2HP baru keluar 2014. Itu pun setelah kita menggelar demo ke Poldasu dua kali,” kata dia. Atas dasar itu, maka MMI Kota Pematangsiantar melaporkan Direktur Dit Reskrimum ke Propam Mabes Polri. Dia berharap kasus dugaan ijazah palsu Wali Kota Pematangsiantar diselesaikan sebelum pemilu legislatif agar tidak ditunggangi oleh kepentingan politik, apalagi Hulman Sitorus adalah ketua Demokrat Kota Pematangsiantar. Sudah SP3 Direktur Dit Reskrimum Poldasu Kombes Pol. Dedi Irianto dikonfirmasi melalui Kasubdit II Harda Tahbang AKBP Yusup Saprudin, Selasa (4/2) mengatakan, sudah melakukan cros cek kasus itu. Kasus tersebut, menurut dia, sudah di SP3 dua tahun lalu. “Ini kasus lama, bukan saya yang tangani. Saya sudah tanyakan ke Kanit V Kompol Ramlan Purba, dia menyebutkan kasus tersebut sudah di SP3 dua tahun lalu. Saat itu Direktur Dit Reskrimum juga belum dijabat Kombes Dedi Irianto,” kata Yusup.(m27)

1050 Pelajar Ikuti Try Out Univa


Medan –Kuala Namu

Waspada/Amir Syarifuddin

WAGUBSU Ir H T Erry Nuradi MSi, menerima kunjungan rombongan Forum Pembauran Kebangsaan (FPK) Kalimantan Tengah (Kalteng).

Soal Buruknya Kinerja Kadis Pertamanan

Jadwal Perjalanan Kereta Api No KA


Berangkat KNIA Tiba Medan

U62 04:00 04:37 U61 05:05 06:50 U2A 04:50 05:27 U65 07:33 08:15 U4A 06:15 06:52 U1A 08:00 08:46 U6A 07:16 07:53 U3A 09:05 09:49 U8A 08:20 08:57 U5A 09:25 10:10 U10A 09:10 09:47 U7A 10:20 11:07 U12A 10:40 11:17 U9A 11:50 12:37 U14A 11:10 11:47 U11A 12:25 13:09 U16A 12:10 12:47 U13A 13:25 14:12 U18A 13:45 14:22 U15A 14:55 15:42 U20A 14:15 14:52 U17A 15:30 16:14 U22A 15:15 15:52 U19A 16:25 17:12 U24A 16:45 17:22 U21A 17:55 18:42 U26A 17:15 17:52 U23A 18:30 19:14 U66 18:15 18:52 U25A 19:56 20:40 U68 19:17 19:54 U67 20:40 21:17 U70 20:01 20:38 U69 21:15 21:59 U72 21:10 21:57 U71 23:30 00:07 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)

Waspada/Rudi Arman

POLISI yang melakukan pengamanan menyaksikan satu alat berat eskavator merubuhkan bangunan saat pelaksanaan eksekusi tanah dan bangunan di Jln. Yos Sudarso Medan, Selasa (4/3).

Eksekusi Tanah Dan Bangunan Dinilai Cacat Hukum MEDAN (Waspada): Eksekusi tanah dan bangunan di Jln. Yos Sudarso yang dilaksanakan PN Medan dinilai cacat hukum. Sebab, penetapan eksekusi pada tanggal 13 Januari 2014, masih dalam proses kasasi. Demikian juga perkara terkait lainnya yaitu perkara No. 673/Pdt.Plw/2012/ PN Medan masih dalam proses banding. “Eksekusi yang dilaksanakan itu cacat hukum,” kata pemilik tanah Drs. Budi Fianto Buna melalui kuasa hukumnya Drs. Muchtar Luthfie, SH, MH kepada wartawan, Selasa (4/3). Selain itu, pada berita acara sita eksekusi 16 Januari 2014, dua bangunan di atas tanah yang dieksekusi, tidak turut diletakkan sita eksekusi. Luthfie mensinyalir Grant Sultan 106/31 Oktober 1898 terindikasi palsu, karena tidak terdaftar di Kantor BPN pada register Sultan yang tersimpan di Kantor BPN Medan dan telah dilaporkan ke Polda Sumut sesuai No. Pol: STTP/522/V/ 2012/SPKT ‘I’ tanggal 14 Mei 2012. “Kasus di Poldasu sampai saat ini masih belum jelas kepastian hukumnya,” kata Luthfie. Pemilik tanah Budi Fianto Buna juga menjelaskan, kronologis pembelian tanah pada tahun 1995 di depan PPAT dan telah terdaftar di Direktorat Agraria (BPN Kota Medan). “Setelah melakukan pem-

belian sebidang tanah dengan seluas 10.516 m2 di Tanjung Mulia, langsung dilakukan bea balik nama atas nama saya. Kemudian di atasnya dibangun tiga bangunan permanen dan semuanya memiliki Izin Mendirikan Bangunan (IMB),” jelas Budi Fianto. Permasalahan ini muncul tahun 2009, ketika pemohon eksekusi mengaku ahli waris H. Usman Bin H Abdul Rahman yang mengklaim bahwa tanah dengan sertifikat HM 294/ Tanjung Mulia adalah miliknya yang berasal dari Grant Sultan 106 tanggal 31 Oktober 1898. Grant Sultan 106 dalam tulisan Arab Melayu (panjang, lebar dan luas tanah persis sama dengan luas tanah dalam SHM 294/Tanjung Mulia). M Rivai selaku ahli waris menggugat pemilik tanah Drs. Budi Fianto Buna dan PT Nipsea Paint and Chemicals di PN Medan regristrasi perkara No .165/PDT.G/2009/PN.Medan, yang diputus tanggal 27 Januari 2010 dengan amar putusan antara lain, menyatakan sah dan berharga Grant Sultan tanggal 31 Oktober 1898. Kemudian, menyatakan Sertifikat Hak Milik No 294 tanggal 25 Pebruari 1977 tidak berharga dan tergugat dinyatakan melakukan perbuatan melawan hukum. Menurut Luthfie, pemilik

tanah dinyatakan melakukan perbuatan melawan hukum, sedangkan BPN selaku instansi yang menertibkan sertifikat tidak digugat. Kemudian, bangunan di atas tanah yang berdiri secara sah dengan IMB lengkap disewa PT. Nipsea Paint and Chemicas sampai 31 Desember 2014, juga dinyatakan melakukan perbuatan melawan hukum. Dijelaskannya, tanah tersebut sudah dikuasai pihak lain termasuk pemilik tanah sekarang selama 59 tahun dan tidak pernah ada gangguan maupun klaim ke Kantor BPN Kota Medan. Sesuai ketentuan perundang-undangan di bidang pertanahan yaitu siapa yang menguasai tanah lebih dari 20 tahun berturut-turut dengan itikad baik tanpa ada yang mengklaim, maka sesungguhnya dialah pemilik. Pantauan wartawan eksekusi yang didahului dengan pembacaan penetapan Ketua Pengadilan Negeri (PN) Medan, pihak PN Medan melaksanakan eksekusi tanah dan bangunan di Jln. Yos Sudarso KM 8,4 Medan Deli, Selasa (4/3). Dengan mendapat pengawalan ketat puluhan aparat kepolisian dan aparat kelurahan setempat, dua unit alat berat eskavator merubuhkan pagar dan bangunan yang ada di atas tanah tersebut. (m39)

MEDAN (Waspada): Para pelajar saat ini adalah pemimpin masa depan, untuk itu persiapkan diri dengan memadukan tiga kualitas yakni kualitas intelektual, emosional, dan spiritual. “Sebab tidak ada para pemimpin besar di dunia ini menjadi besar dan terkenal hanya dengan thulul amal (panjang angan-angan) berharap pertolongan dari orang lain tanpa mau berusaha, bekerja keras. Bahkan, Islam mengajarkan kepada kita tentang metode terbaik dalam menumbuhkan etos kerja,” ujar Ketua PW Al Washliyah Sumatera Utara Drs H Hasbullah Hadi SH, MKn, dihadapan 1050 peserta Try Out 2014 Universitas AlWashliyah (Univa) Medan, Sabtu (1/3). Hadir Wakil Rektor I Dr Ir HM Idris MP, Wakil Rektor II Drs H Hairul Arifin Ritonga MM,Wakil Rektor III Drs H Alimuddin Siregar SH, SPdI, MHum, Wakil Dekan I Fakultas Ekonomi H Akman Daulay SE, MM, Ketua Panitia Samio MPd, dan Kepala Unit Ganesha Operation Irma Yohana SPd. Kata Hasbullah, apalagi di era modern yang penuh dengan dunia persaingan, terutama dalam dunia pendidikan, kita tidak boleh kalah dengan ne-

gara-negara maju seperti Jepang, Cina, Amerika, dan lain sebagainya. Kita mampu mengalahkan mereka, terbukti dengan diraihnya beberapa penghargaan Olimpiade oleh para para pelajar Indonesia. Menurut dia, bukti yang lebih konkrit penghargaan yang diraih mahasiswa USU pada kompetisi Final Shell Eco-Marathon (SEM) 2014 dengan mobil horasnya. Tergantung kemauan kita, kalau kita mau kita bisa memimpin dunia ini. “Kepada seluruh peserta saya mendoakan semuanya lulus pada ujian yang akan datang, khususnya bagi peserta terbaik 1, 2, dan 3 saya berikan beasiswa satu tahun bila kuliah di Univa Medan,” kata Hasbullah. Sementara itu, Plt Sekretaris Jenderal PB Al Washliyah yang juga Sekretaris Majelis Pendidikan Pengurus Besar (MPPB) Al Washliyah Drs Haris menyatakan, bangga atas kemajuan Univa Medan dengan berbagai ide-ide terbaiknya, di antaranya digelarnya try out bagi pelajar Aliyah, SMA, SMK dan sederajat yang diikuti 1050 pelajar dari Kab. Deliserdang dan Kota Medan. Sebelumnya, Rektor Univa Medan Ir H Aliman Saragih MSi mengatakan, Universitas Al Washliyah dengan visinya seba-

gai universitas unggulan di kawasan Asia Tenggara, pada tahun 2025 akan siap menghasilkan alumni yang berdaya guna di tengah masyarakat. “Bagi para peserta setelah lulus dari sekolah/madrasah silahkan melanjutkan ke Univa Medan yang memiliki 6 fakultas dan 16 program studi yang telah terakreditasi BAN-PT,” katanya. Penutupan Try Out 2014 Univa Medan dilakukan Rektor diwakili Wakil Rektor IV H Sultoni Trikusuma MA. Kata dia, try out ini sebagai sarana silaturahmi kelurga besar Univa Medan dengan bimbingan belajar Ganesha Operation dan siswa/i sekolah/madrasah dari Kab. Deliserdang dan Kota Medan. Para pemenang Try Out 2014 dari Aliyah/SMA pada bidang IPA yakni juara I Yohana M Sitorus (SMA Negeri XIV), juara II Albert Nova Silaen (SMA Negeri XIV), juara III Khairul Azmi (SMA UISU). Bidang IPS juara I Hilda M Sihotang (SMA Negeri XIV), juara II Riza (SMA AW Gedung Johor), juara III Jery Mandela (SMA Angkasa). Sedangkan dari SMK juara I Novi Ningsih (SMK Istiqlal), juara II Ayu Zunita (SMK Istiqlal), dan juara III Tritami Noviani (SMK Nurazizi). (cwan)


WAKIL Rektor IV Univa Medan H Sultoni Trikusuma MA, didampingi Wakil Rektor III, Ketua Panitia, dan pihak Ganesha Operation foto bersama juara Try Out 2014 Univa Medan.

Medan Metropolitan


WASPADA Rabu 5 Maret 2014

Pemilik 61 SHM Banding Mohon Pembatalan Putusan Hakim PTUN MEDAN (Waspada): Proses penerbitan 61 Sertifikat Hak Milik(SHM) oleh BPN Labuhanbatu, atas nama masyarakat (Herawani dkk) dalam kurun waktu tanggal 23-29 Desember 2003, yang menjadi objek sengketa di PTUN (Pengadilan Tata Usaha Negara) Medan, atas gugatan PT Belunkut (Terbanding), sebenarnya sudah memenuhi prosedur pendaftaran yang benar dengan data fisik dan data yuridis yang benar. Dengan terpenuhinya azas publisitas dalam penerbitan SHM itu, tidak perlu lagi dibuktikan dengan alat bukti lainnya. Dan tolak ukur pengajuan gugatan bagi PT Belunkut, seyogianya terhitung sejak tanggal terbitnya SK BPN 26 Desember 2003 tentang pemberian hak milik tersebut. Sehingga, gugatan PT Belunkut sesungguhnya telah lewat tenggang waktu yang diatur UU yaitu 90 hari, karena ke 61 SHM yang digugat terbit 2003. Advokat Sudarsono SH, MH, selaku kuasa hukum Herawani dkk (pemilik 61 SHM), menyatakan hal itu dalam memori banding tertulis yang diajukan ke PT-TUN Medan, memohon pembatalan putusan tingkat pertama hakim PTUN (Pengadilan Tata Usaha Negara) No

Waspada/Ismanto Ismail

PETUGAS Reskrim Polsek Sunggal menggiring tersangka pencurian helm yang babak belur dihajar massa.

Maling Burung Tewas Diamuk Massa Pencuri Helm Nyaris Dibakar MEDAN (Waspada): Gara-gara burung Gelatik yang hendak dicuri berkicau, satu dari tiga maling tewas diamuk massa di Jln. Sukaria/Taud, Kel. Siderejo Hilir, Kec. Medan Tembung, Selasa (4/ 3) sekira pukul 04:30.

Jasad tersangka berinisial MA, 24, warga Perumnas Mandala, Kec. Percut Seituan, segera dievakuasi oleh petugas Polsek Percut Seituan ke instalasi jenazah RSU Dr Pirngadi Medan, guna divisum. Informasi yang diperoleh di kepolisian, menjelang pagi, ter-

Terdakwa Penipuan Rp25 Juta Dituntut 2 Tahun Penjara MEDAN (Waspada): Terdakwa Billu, 44, warga Jln. SMA II, Karang Sari, Medan Polonia, yang melakukan penipuan dan penggelapan dituntut dua tahun penjara oleh Jaksa Penuntut Umum (JPU) Rivai dalam persidangan yang digelar di Pengadilan Negeri (PN) Medan, Selasa (4/3). “Terdakwa terbukti bersalah melakukan penipuan dan dituntut sesuai dengan pasal 378 KUHP tentang tindak pidana penipuan,” ujar JPU Rivai dalam persidangan yang dipimpin oleh Ketua Majelis Hakim M Ishak. Kata JPU, Billu didakwa bersalah telah melakukan penipuan dan penggelapan terhadap saksi korban W Sijabat, warga Eka Bakti Ujung Medan, dengan kerugian mencapai Rp25 juta. “Halhal yang memberatkan tuntutan tersebut di antaranya perbuatan terdakwa meresahkan masyarakat dan merugikan orang lain, serta memberikan keterangan yang berbelit-beli sehingga mempersulit jalannya persidangan. Sedangkan yang meringankan adalah terdakwa belum pernah dihukum,” ujarnya. Usai sidang JPU menyatakan bahwa tuntutan yang diutarakan sebanding mengingat jika diambil maksimalnya mencapai empat tahun penjara. Menurut Rivai, terdakwa melakukan tindakan penipuan dan penggelapan terhadap korban dengan meminjam uang dalam kurun waktu yang cukup lama yakni lebih dari satu tahun. “Perbuatan terdakwa menyebabkan kerugian materi dimana berawal dari tanggal 13 Juni 2012, terdakwa melakukan pertemuan denganW Sijabat dan meminjam uang sejumlah Rp25 juta dengan cara bertahap selama lima kali tahapan,” sebutnya. Setiap tahapan, kata Rivai, terdakwa diberi oleh korban sebesar Rp5 juta. “Namun tidak diketahui kapan dilakukan pengembalian yang berakhir pada Jumat tanggal 23 Agustus 2013 sekira pukul 14:00 Wib, bertempat di rumah terdakwa yang terletak di Jln. SMA Negeri II, Kel. Sari Rejo, Medan Polonia,” tuturnya. Terdakwa Billu ditangkap petugas Polresta Medan dengan tuduhan melakukan tindak pidana penipuan dan penggelapan sebagaimana dilaporkan korban. (m38)

sangka MA bersama dua temannya datang ke Jln. Sukaria/ Taud dengan mengendarai mobil CRV warna hitam. Mobil tersebut berhenti persis di depan rumah korban Roni Tobing, 23, yang saat itu sedang tertidur. Selanjutnya, MA turun dari mobil dan langsung melompati pagar rumah korban, sedangkan dua lagi teman pelaku memantau situasi dari dalam mobil. Kemudian MA naik ke atas teras dan mengambil sangkar burung berikut Gelatik di dalam sangkarnya. Namun, saat sangkar burung hendak diturunkan, burung Gelatik tersebut berkicau berkali-kali. Mendengar suara kicauan burung Gelatik berkalikali, korban Roni Tobing terbangun dari tidurnya. Merasa curiga, Roni perlahan-lahan mengintip dari balik jendela dan melihat tersangka MA sedang menurunkan sangkar burung yang tergantung di plafon depan rumahnya. Spontan korban membuka pintu rumahnya sembari berteriak maling. Sejumlah warga yang mendengar teriakan korban keluar dari rumah masing-masing. Dua teman pelaku yang berada di dalam mobil langsung tancap gas meninggalkan MA yang masih berada di depan rumah korban. Saat hendak melompati pagar, MA berhasil disergap warga bersama barang bukti sangkar burung yang berada di genggamannya. Massa yang berdatangan langsung memukuli MA

hingga babak belur dan wajahnya berlumuran darah. Melihat kondisi MA yang melemah karena tubuhnya berlumuran darah, aksi amuk massa berhenti seketika. Ternyata, MA telah tewas dan jasadnya dibiarkan tergeletak menjelang pukul 08:00. Petugas Polsek Percut Seituan yang mendapat informasi langsung datang ke lokasi. Selanjutnya mayat MA dibawa ke Instalasi Jenazah RSU dr Pirngadi Medan, untuk keperluan visum. Kapolsek Percut Seituan Kompol Ronald Sipayung menjelaskan, korban tewas akibat amuk massa itu sudah dievakuasi ke instalasi jenazah RSU Dr Pirngadi Medan, sedangkan korban Roni Tobing sudah membuat laporan pengaduan berikut saksi-saksinya. “Dari saku celana MA ditemukan obeng, sedangkan barang bukti yang disita yakni sangkar burung berikut burung Gelatiknya. Pihak keluarga pelaku sudah menjemput mayat MA di instalasi jenazah untuk dibawa pulang ke rumah duka,” tutur Ronald. Pencuri Helm Sebelumnya, seorang pencuri helm yang kedua lengan tangannya bertato babak belur dan nyaris dibakar massa di Jln. Setiabudi, Pasar VI Medan, Senin (3/3). Informasi di Tempat Kejadian Perkara (TKP) menyebutkan, pencurian itu berawal tersangka U mendekati sepedamotor yang diparkirkan pemiliknya dengan

helm tergantung di kaca spion. Namun, warga yang melihat gerak-gerik tersangka mencurigakan menghampirinya. Tersangka U berusaha kabur tetapi masa berhasil menangkap dan menghajarnya hingga babak belur. Massa yang sudah emosi, apalagi di kawasan Jln. Setia Budi sering terjadi pencurian helm dan kaca spion, langsung mengikat kedua tangan tersangkaketiangtelepondengan tali dan memukuli tersangka. Seorang petugas satpam mengamankan tersangka dari amuk massa dengan membuka ikatan tali yang melilit kedua tangannya. Satpam itu kemudian memborgol tangan tersangka U dan membawanya ke pos satpam salah satu komplek perumahan di sekitar lokasi kejadian. Kemarahan massa bukannya surut, mereka langsung mengejar tersangka U sambil melakukan pemukulan pakai kayu, batu dan benda keras lainnya, hingga tersangka terkapar di lantai pos tersebut. Bahkan, ada di antara massa berteriak agar tersangka dibakar hidup-hidup. Polisi yang turun ke lokasi langsung mengamankan tersangka U dari amuk massa yang nyaris membakarnya hiduphidup dengan memboyongnya ke Mapolsek Sunggal. Kanit Reskrim Polsek Sunggal Iptu Adhi Putranto Utomo SH mengatakan, tersangka U dibawa ke rumah sakit karena kondisinya babak belur setelah dihajar massa. (h04/m36)

Pemerintah Harus Permudah UKM Urus HKI MEDAN (Waspada): Pemerintah harus memberi kemudahan bagi pelaku usaha kecil dan menengah (UKM) dalam pengurusan Hak Kekayaan Intelektual (HKI). Pada Asean Economic Community 2015 nanti, HKI sangat dibutuhkan UKM dalam menghadapi kompetisi perdagangan serta perlindungan atas produk dan jasa yang dihasilkan. “Kemudahan tersebut, mencakup penyederhanaan prosedur, waktu pengurusan

dan juga keringanan biaya,” kata Anggota DPD RI utusan Sumut Parlindungan Purba disela-sela diskusi tentang pengurusan HKI, di Kantor Dinas Perindustrian dan Perdagangan (Disperindag) Sumut, Senin (3/3). Parlindungan Purba mengatakan, produk HAKI sangat diperlukan oleh pelaku UKM karena nantinya mereka akan bersaing dengan pelaku UKM dari negara-negara Asean lainnya. “Karena itu, kita mendorong agar pelaku UKM ini men-

dapat kemudahan dalam pengurusan HKI oleh pemerintah. Baik dari segi prosedur, waktu pengurusan, dan biaya yang dikeluarkan,” ujarnya. Dekan Fakultas Hukum USM Indonesia Irwan Jasa Tarigan juga mengakui rumitnya pengurusan HKI, serta mahalnya pembiayaan dan lamanya proses kepengurusan. “Sehingga banyak para pelaku usaha mengambil jalan pintas guna mendapatkan keuntungan yang sebesar-besarnya dari pe-


DPD RI utusan Sumut Parlindungan Purba menjadi moderator dalam diskusi pengurusan HKI, di Kantor Disperindag Sumut, Senin (3/3).

langgaran tersebut,” sebutnya. Menurut dia, para pelanggar menganggap bahwa sanksi hukum yang dijatuhkan oleh pengadilan selama ini terlalu ringan. “Bahkan tidak ada tindakan preventif dan represif yang dilakukan oleh para penegak hukum. Namun ada juga para pencipta merasa bangga dengan hasil karyanya ditiru orang lain. Tetapi hal ini sudah berangsur hilang berkat adanya peningkatan kesadaran hukum terhadap HKI, dan ada juga masyarakat yang tidak peduli apakah barang yang dibelinya itu asli atau palsu,” tuturnya. Menanggapi hal ini, Direktur Teknologi Informasi Kemenkum HAM Karyono meyakinkan para pelaku usaha mulai tanggal 26 April 2014, waktu pengurusan hak cipta akan dipersingkat dari semula 9 bulan hanya menjadi maksimal 7 hari, bahkan bisa tujuh menit jika pelaku usaha itu aktif. Karyono mengatakan, pemerintah telah menyediakan alokasi dana khusus untuk membantu kalangan UKM yang ingin mengurus hak cipta, hak merek, dan lainnya. “Hal ini merupakan salah satu wujud dukungan dari pemerintah dalam pengembangan sektor

UKM,” ujarnya. Dijelaskannya, Sumut memiliki potensi yang sangat besar dalam menghasilkan berbagai produk. Seperti produk makanan dan minuman yang dapat dibuat dari buah durian, rambutan, terong belanda, maupun bika ambon. Sedangkan Perwakilan BBPOM di Medan Sacramento menambahkan, pelaku UKM juga perlu memperhatikan berbagai aspek dalam pembuatan produk, khususnya yang berkaitan dengan makanan dan minuman. “Aspek tersebut menyangkut keamanan, mutu, manfaat dan yang juga penting adalah daya saing. Dengan memperhatikan keempat hal itu, maka produk UKM dari Sumut akan diminati masyarakat, khususnya dari luar Sumut,” sebutnya. Acara yang bekerjasama dengan DPD RI, USM Indonesia, dan Disperindag Sumut ini dibuka oleh Kadisperindag Sumut Alamsyah. Hadir juga dalam diskusi tersebut Rektor Universitas Sari Mutiara (USM) Indonesia DR. Dra. Ivan Elisabeth Purba MKes, perwakilan MUI Sumut H Ramli Abdul Wahid, dan puluhan kalangan pelaku usaha. (h02)

37/G/ 2013/PTUN-Mdn tertanggal 6 Nopember 2013. Sudarsono kepada wartawan di Medan, Selasa (3/3) mengatakan, sebagaimana diuraikan dalam memori bandingnya, majelis Hakim PTUN Medan dalam pertimbangan putusannya tanggal 6 Nopember 2014 lalu itu, dinilai telah mengabaikan seluruh alat bukti yang diajukan Pembanding/ Tergugat (BPN Labuhan Batu), maupun yang diajukan kliennya sebagai Pembanding/Tergugat II Intervensi 1, 2 dan 3, (Lie Kian Sing, Herawani, dan Sherly). Sebab, kata Sudarsono, hakim PTUN dalam putusannya hanya mempertimbangkan bukti dari Terbanding/Penggugat (PT Belunkut) secara sepihak. Sehingga memutus perkara menjadi tidak objektif dan menciderai rasa keadilan, dengan dikabulkannya gugatan PT Belunkut dan membatalkan 61 SHM yang diterbitkan BPN di Desa Negeri Lama Seberang, maupun Desa Belungkut yang menjadi objek sengketa. Pertimbangan Hakim PTUN yang menyatakan terjadinya tumpang tindih di lokasi karena duluan SHGU (sertifikat hak guna usaha) sebelum terbit SHM Herawani dkk (pembanding intervensi), menurut Su-

darsono, adalah juga didasarkan berita acara peninjauan lapangan 18 Maret 2013 yang diperbuat dan dilaksanakan secara tidak fair dan tidak objektif, karena tanpa melibatkan pembanding intervensi di lapangan sebagai pihak yang namanya tercatat pemegang hak dalam SHM itu. Kata dia, dalam memori bandingnya, sebagai alasan bagi hakim banding PT-TUN untuk menolak gugatan PT Belunkut (Terbanding/Penggugat) dan membatalkan putusan tingkat pertama PTUN Medan, tanah yang didiami kliennya Herawani dkk (Pembanding/Tergugat II Intervensi) sesuai 61 SHM yang didasarkan akta jual beli yang sah, sebelumnya telah dikuasai masyarakat terus menerus dengan tanaman palawija sejak 1988 yang dikuatkan keterangan saksi-saksi.. Sehingga penggugat terlalu dini menggugat SHM secara tata usaha negara, tanpa lebih dulu menempuh penyelesaian secara keperdataan terkait hak keperdataan masyarakat. Sebelumnya PT Belunkut menggugat BPN Labuhan Batu mempersoalkan keabasahan ke 61 SHM milik masyarakat (Herawani dkk klien Sudarsono), karena sudah ada HGU-nya atas tanah di lokasi tersebut. (m38)

Ratusan Petani Tuntut Penyelesaian Kasus Tanah MEDAN (Waspada): Ratusan massa yang mengatasnamakan Komite Tani Menggugat (KTM) Sumatera Utara, berunjukrasa di depan Kantor Gubsu Jln. Diponegoro Medan, Senin (3/3). Mereka menuntut kepastianatassengketatanahyangtidak pernah diselesaikan di Sumut. Massa yang didominasi wanita itu, dalam tuntutannya menyampaikan kekecewannya kepada Gubsu H Gatot Pujo Nugroho ST, MSi, yang telah gagal dan tidak mampu menyelesaikan konflik agraria yang terjadi di Sumut. “Kembalikan dan distribusikan tanah rakyat yang dirampas oleh perkebunan negara, swasta, dan perkebunan asing. Tangkap dan adili preman serta mafia tanah serta kroni-kroninya,” kata Tao Maindoana br Simamora dalam orasinya di hadapan para polisi, Satpol PP, dan PNS yang menyaksikan mereka berorasi. Massa meminta kepada pemerintah dan aparat penegak hukum agar menghentikan kriminalisasi dan segera bebaskan tanpa syarat petani yang ditahan dalam memperjuangkan hak atas tanah seperti yang terjadi di Deliserdang, Padang La-

was, Binjai, dan sebagainya. “Bila ditelusuri bahwa konflik/sengketa agraria bukan makin berkurang saat ini, malah semakin bertambah. Menurut data yang pernah dilakukan oleh Tim B-Plus pada tahun 2000 telah terjadi sengketa tanah sekitar 700 kasus. Bahkan tahun 2012 kasus sengketa tanah semakin bertambah sekitar 2800 kasus di Sumut,” sebut Tao. Dia menjelaskan, hal ini bisa dilihat ternyata dalam konflik agrarian, pemerintah tidak serius dalam menyelesaikan persoalan yang ada. Kondisi ini diperparah dengan meningkatnya konflik/sengketa agraria yang terjadi di antara kaum tani dengan perkebunan swasta, perkebunan asing maupun perkebunan negara, serta kaum tani dengan mafia tanah yang terjadi di Sumut. “Apalagi Gatot Pujo Nugroho selaku Gubsu diduga gagal dalam menyelesaikan persoalan tanah yang terjadi di Sumut. Jika Gatot tidak mampu menyelesaikan masalah ini, lebih baik mundur saja dari jabatannya,” ujarnya. Padahal, menurut dia, bila pemerintah mengacu pada UU Pokok Agraria No. 5 tahun 1965 bahwa tanah merupakan fungsi

sosial. Artinya, sudah jelas hal ini mengacu pada pasal 33 Ayat 3 UUD 1945, yang berbunyi ; bumi dan air kekayaan alam yang terkandung didalamnya dikuasai oleh negara dan dipergunakan sebesar-besarnya untuk kemakmuran dan kesejahteraan rakyat,” tutur Tao. Pantauan Waspada, hingga sore hari para petani tetap bertahan di Kantor Gubsu karena pengunjukrasa tidak mau menerima perwakilan Gubsu untuk menampung aspirasi mereka. Para petani ingin langsung diterima oleh Gubsu, sekaligus menampung dan menjawab aspirasi mereka. Karena tidak mendapat jawaban, ratusan petani mendatangi Rumah Dinas Gubsu yang berada di Jln. Sudirman. Massa berorasi dan menuntut agar Gubsu memberikan kepastian atas kasus sengketa tanah. “Sebagai Gubsu, Gatot harus peduli kepada rakyat Sumut, jangan biarkan masyarakatnya hidup dibawah garis kemiskinan,” tutur mereka. Para pengunjukrasadi sampai Mahgrib masih bertahan dan belum beranjak dari Jln. Sudirman depan rumah dinas Gubernur.(m28)

Waspada/Rizky Rayanda

MASSA dari Petisi Komite Tani Menggugat melakukan aksi unjukrasa di depan Kantor Gubernur Sumatera Utara Jln. Diponegoro Medan, Senin (3/3). Mereka menuntut agar Gubsu menyelesaikan konflik agraria antara petani dengan perkebunan negara, perkebunan swasta, perkebunan asing dan mafia tanah.

Jenazah Korban Trafficking Diotopsi Di RSPM MEDAN (Waspada): Setelah dua hari berada di Ruang Instalasi Jenazah RSU dr. Pirngadi Medan (RSPM), jenazah Rista Bota, 22, salah satu korban trafficking diotopsi oleh pihak RSPM, Senin (3/3) siang. Otopsi berlangsung sekitar 2 jam dan hasilnya akan segera dikirim ke pihak kepolisian untuk keperluan penyelidikan. “Kemarin belum diotopsi karena belum ada surat dari kepolisian. Hari ini sesuai permintaan kepolisian, mayat warga NusaTenggaraTimur itu diotopsi. Nanti hasilnya kita serahkan kepada polisi,” ujar Humas RSPM Edison Perangin-angin SH, MKes. Kata Edison, 15 wanita NTT itu juga sudah diperbolehkan pulang oleh pihak RSPM, karena kondisi mereka sudah berangsur pulih. “Sekarang mereka ditampung di kantor Komisi Perlindungan Anak Indonesia (KPAID) Sumut,” sebutnya. Sebelum dibawa ke kantor KPAID Sumut, Kapolresta Medan Kombes Pol Nico Afinta menjenguk korban trafficking itu di RSPM. Kepada wartawan Nico mengatakan, otopsi yang

dilakukan terhadap jenazah untuk mengetahui penyebab tewasnya, apakah dianiaya, dipukul, dan sebagainya. Menurut Nico, pelaku usaha burung walet dikenakan UU Perlindungan Anak Nomor 4 Tahun 2003 dengan ancaman hukuman 15 tahun. Pelaku lainnya berinisial R yang diduga memperdagangkan anak juga sudah diamankan di Kupang NTT. “Masih banyak informasi yang masih harus kita kutip. Korbannya sekarang sudah memberikan banyak informasi,” katanya. Pengungkapan kasus itu, kata dia, setelah pihaknya menerima informasi penyekapan ataupun anak kerja di bawah umur yang dilakukan seseorang. Dari situ, petugas kepolisian berhasil mengevakuasi 18 orang pekerja. “Kemudian dari pengecekan, ditemukan ada lima orang yang diduga dibawah umur. Selanjutnya dilakukan pemeriksaan kepada seluruh saksi dan dan kami sudah menemukan dua orang tersangka, yakni tersangka dengan inisial M yang sudah kami tangani dan R dimana berperan mensuplai te-

naga kerja yang bekerja di rumah M,” sebutnya. Nico mengatakan, saat ini pihaknya melakukan proses terhadap para korban supaya bisa kembali ke NTT dan diterima keluarganya. “Untuk pelaksanaan ini bekerjasama dengan KPAI, Dinas Sosial supaya hakhak dari korban ini bisa diberikan, baik oleh pemilik rumah selaku pemberi kerja. Dan hakhak mereka selaku warga negara yakni perlindungan kepada korban,” tuturnya sembari mengatakan, proses pemulangan sekitar 2 hingga 3 hari lagi. Sementara itu, Ketua KPAID Sumut Zahrin Piliang mengatakan, 15 korban sudah dibawa ke tempat penampungan sementara yakni di kantor KPAID Sumut. “Langkah selanjutnya akan dikoordinasikan dengan pemprovsu untuk tindak lanjut, termasuk tempat penampungannya. Proses hukum, kita minta segera dilakukan kepolisian,” katanya menambahkan, seorang korban berinisialY yang dirawat di RS Deli, hingga kini kondisinya masih belum memungkinkan untuk dipindahkan. (h02)


WASPADA Rabu 5 Maret 2014


2,3 Juta Rakyat Tinggal Di Rumah Tak Layak


MENSOS Salim Segaf Al Jufri meletakkan batu pertama pembangunan rumah tidak layak huni dalam kegiatan bedah kampung di Desa Teupok Tunong, Kec. Jeumpa, Bireuen, Selasa (4/3).

BIREUEN (Waspada): Kemiskinan membuat sedikitnya 2,3 juta orang Indonesia tinggal di rumah tidak layak huni. Hal itu membuat para penghuninya jauh dari rasa nyaman, aman dan sehat. “Karena itu pemerintah terus menerus mengupayakan program bedah rumah dan bedah kampung sebagai salah satu upaya pengentasan kemiskinan,” kata Menteri Sosial Salim Segaf Al Jufri saat peletakan batu pertama program bedah rumah di Desa Teupok Tunong, Kecamatan Jeumpa, Kabupaten Bireuen, Aceh, Selasa (4/3). Sebanyak 200 rumah dibedah di Bireuen dengan jumlah bantuan pembelian material bangunan sebesar Rp 10 juta untuk tiap rumah. Program bedah rumah atau bedah kampung sudah dilakukan pemerintah melalui Kemsos sejak 2012. Daerah-daerah yang telah direhabilitasi rumah tidak layak huninya adalah Jawa Barat, Jawa Timur, Sumatera Barat, Maluku Utara, Gorontalo, Sulawesi Utara, Sulawesi Tenggara, Sulawesi Tengah dan kini Aceh. Hingga kini sudah lebih dari 6 ribu rumah dibedah dari target sebanyak 15 ribu rumah yang dibedah atau direhabilitasi setiap tahunnya. Dikatakan Salim, pembangunan rumah tidak layak huni ini sesuai dengan Undang-Undang Dasar (UUD) 1945 pasal 34 dan UU No. 11/2009 tentang kesejahteraaan. Disebutkan, penanganan kemiskinan harus didukung sepenuhnya oleh berbagai elemen, mulai dari pemerintah pusat, pemerintah daerah dan masyarakat. “Gotong royong menjadi landasan utamanya. Sebab dana Rp10 juta bagi setiap rumah tidak ada artinya tanpa gotong royong dan peran serta lingkungan serta masyarakat luas,” kata Salim. Dalam acara tersebut hadir juga anggota KomisiVIII DPR RI Daerah Pemilihan Aceh, Raihan Iskandar; perwakilan Gubernur Aceh, Bupati dan Wakil Bupati Bireuen serta Kepala Dinas Sosial Aceh. Bedah rumah atau bedah kampung ini juga menjadi alat pemersatu. Sepanjang perjalanan program bedah kampung, Salim Segaf merasa bersemangat karena

rasa setia kawan di antara masyarakat masih ada. “Ketika satu keluarga tidak mampu membangun rumahnya, tetangganya ikut membantu. Nilai rehabilitasi rumah bahkan ada yang menjadi 40 juta rupiah karena semua membantu,” kata Salim. Wakil Bupati Bireuen, Mukhtar didampingi Sekretaris Daerah Bireuen, Zulkifli mengatakan, angka kemiskinan di wilayahnya masih tinggi. Dari 400 ribuan penduduk Bireuen, sebanyak 18 persen diantaranya adalah warga miskin. “Sebagian besar tinggal di pelosok-pelosok desa, ditandai dengan kondisi rumahnya yang tidak layak ditinggali sebenarnya, “ ujar Wabup. Meski demikian, Bireuen tengah terus berbenah dengan manargetkan penurunan angka kemiskinan pada 2017 menjadi 15 persen. Salah satu upaya yang terus digalakkan adalah meningkatkan usaha perekonomian masyarakat dan meningkatkan investor asing masuk ke Bireuen. Kegiatan bedah kampung atau bedah rumah di wilayah Kecamatan Jeumpa ini rencananya memakan waktu 5 hari. Satu rumah dikerjakan oleh 50 sampai 100 orang dengan melibatkan para ahli bangunan dan masyarakat sekitarnya. Kegiatan ini menurut Bupati Bireuen sangat bermanfaat karena menggugah rasa persaudaraan sesama warga. Selain melakukan bedah rumah, kegiatan bedah kampung di Teupok Tunong juga berupa pemberian Usaha Ekonomi Produktif (UEP) kepada 40 Kelompok Usaha Bersama (Kube). Masing-masing Kube mendapat Rp20 juta dengan total mencapai Rp 800 juta; bantuan senilai masing-masing Rp1 juta kepada 100 orang Wanita Rawan Sosial Ekonomi; bantuan perlengkapan tidur anak panti asuhan senilai Rp366.225.000bantaun makanan santri di Pesantren Dayah Al Madinatuddiniyah dan Pesantren Mudi Masjid Raya Samalangan senilai Rp 192 juta. Total bantuan yang diberikan mencapai lebih dari 4 miliar. (dianw)

KPU: Patuhi Aturan Kampanye JAKARTA (Antara): Komisi Pemilihan Umum (KPU) menetapkan masa kampanye akbar atau rapat umum, dan kampanye melalui media massa pada 16 Maret - 5 April. Untuk itu, KPU mengingatkan Parpol peserta Pemilu 2014, dan para calon anggota legislatif (Caleg) memahami dan mematuhi aturan kampanye baik yang tertuang dalam undang undang maupun peraturan KPU. KPU juga telah menetapkan zona kampanye akbar atau rapat umum Parpol yang akan berlangsung 21 hari tersebut. Kampanye akan melibatkan langsung 4 Parpol di setiap Dapil (Daerah Pemilihan) pada hari yang sama. Komisioner KPU RI Ferry Kurnia Rizkiyansyah dalam keterangan persnya di Jakarta, Selasa (4/3) mengatakan, setiap Parpol (partai politik) memiliki hak yang sama untuk melaksanakan kampanye rapat umum.

“KPU akan memfasilitasi pelaksanaan kampanye rapat umum dari segi lokasi dan jadwal,” kata Ferry dan menambahkan, povinsi yang punya satu sampai dua Dapil, kampanye dilakukan 2 kali selama 21 hari. Untuk provinsi dengan 3 Dapil, kampanye dilakukan sebanyak 3 kali oleh masing-masing Parpol. Sementara provinsi yang daerah pemilihannya lebih dari tiga, kampanye dilakukan sebanyak 5 kali oleh tiap Parpol. Terdapat 26 provinsi dengan 1-2 Dapil, 4 provinsi dengan 3 Dapil dan 3 provinsi dengan lebih dari 3 Dapil. “Dengan demikian setiap Parpol akan berkampanye 79 kali di 77 Dapil untuk DPR RI,” ujar Ferry. Untuk lokasi kampanye, Ferry mengatakan ditetapkan oleh KPU Kabupaten/Kota. Penentuan lokasi kampanye dilakukan berkoordinasi dengan pemerintah Kabupaten/Kota. Pelaksanaan kampanye anggota DPRD Provinsi dilaksa-

nakan oleh pengurus partai tingkat provinsi dan/atau calon anggota DPRD Provinsi. Selanjutnya, pelaksanaan kampanye anggota DPRD Kabupaten/ Kota diselenggarakan oleh pengurus Parpol tingkat kabupaten/kota dan/atau calon anggota DPRD Kabupaten/Kota. “Sementara kampanye untuk calon anggota DPD diselenggarakan oleh calon yang bersangkutan. Calon anggota DPD dapat mengangkat juru kampanye, orang-seorang atau organisasi penyelenggara kegiatan,” kata Fery.. Ketua KPU Husni Kamil Malik sebelumnya mengatakan, KPU menetapkan masa kampanye Pemilu 2014 mulai 11 Januari 2014 hingga 5 April 2014. “Pelaksanaan kampanye melalui pertemuan terbatas, pertemuan tatap muka, penyebaran bahan kampanye kepada umum dan pemasangan alat peraga,” kata Husni. Pendaftaran identitas juru kampanye (Jurkam) disampai-

kan kepada Komisi Pemilihan Umum (KPU) sesuai tingkatan, paling lambat 3 hari sebelum pelaksanaan kampanye terbuka oleh peserta Pemilu. Sesuai pasal 36 ayat 4 PKPU Nomor 1 Tahun 2013, media massa cetak, online, elektronik dan lembaga penyiaran dalam memberitakan, menyiarkan dan mengiklankan kampanye harus mematuhi tata cara penyusunan dan penyampaian materi kampanye dan larangan berkampanye. Terkait penyusunan dan penyampaian kampanye, KPU sudah memberikan ketentuan di antaranya sopan, tertib, mendidik, bijak dan beradab, menjaga dan meningkatkan moralitas dan nilai-nilai agama serta jati diri bangsa, menjaga persatuan dan kesatuan bangsa, meningkatkan kesadaran hukum, memberikan informasi yang benar, seimbang dan bertanggung jawab sebagai bagian dari pendidikan politik dan menjalin komunikasi sehat

JADWAL TAHAPAN PEMILU 2014: 1. Audit Dana Kampanye 6 - 8 April 2014 2. Pemungutan dan Penghitungan Suara Pemilih Luar Negeri 30 - 6 April 2014 3. Pemungutan dan Penghitungan Suara 9 April 2014 4. Penetapan Hasil Pemilu: A. Penetapan Partai Politik memenuhi ambang batas 7-9 Mei 2014 B. Penetapan Kursi Calon Terpilih 11-18 Mei 2014 5. Pengucapan Sumpah /Janji Juli-Oktober 2014 6. Pengajuan Perselisihan /Gugatan hasil Pemilu ke MK 12-14 Mei 2014 7. Penyusunan laporan penyelenggaraan Pemilu 1 Oktober-1 November 2014 antara peserta Pemilu dan calon anggota DPR, DPD dan DPRD. Dicoret Dari DCT KPU mengingatkan Parpol peserta Pemilu 2014 dan para Caleg untuk memahami dan mematuhi aturan kampanye baik ketentuan yang tertuang dalam undang undang maupun peraturan KPU. Caleg yang melanggar aturan kampanye dapat dicoret dari daftar calon tetap (DCT). Ferry menerangkan larangan kampanye tertuang dalam

peraturan KPU (PKPU) Nomor 1 Tahun 2013 tentang Pedoman Pelaksanaan Kampanye Pemilihan Umum Anggota DPR, DPD dan DPRD. Sesuai pasal 32 ayat 1 PKPU Nomor 1 Tahun 2013, pelaksana, peserta dan petugas kampanye dilarang mempersoalkan dasar Negara Pancasila, Pembukaan UUD 1945 dan bentuk Negara Kesatuan Republik Indonesia (NKRI). Kemudian melakukan kegiatan yang membahayakan keutuhan

NKRI, menghina seseorang, agama, suku, ras, golongan, calon dan/atau peserta Pemilu yang lain. Selanjutnya menghasut dan mengadu domba, mengganggu ketertiban umum, mengancam dan melakukan kekerasan, merusak alat peraga kampanye peserta Pemilu yang lain, menggunakan fasilitas pemerintah, tempat ibadah dan pendidikan, menjanjikan dan memberikan uang atau materi lain kepada peserta Pemilu.

Corby Bisa Masuk Penjara lagi JAKARTA(Antara): Menteri Hukum dan HAM Amir Syamsuddin, akan meninjau pembebasan bersyarat perempuan Australia narapidana kasus narkoba, Schapelle Leigh Corby, dan tidak tertutup kemungkinan Corby masuk penjara lagi. Peninjauan itu ditempuh Syamsuddin segera setelah mendapat laporan Badan Pemasyarakatan Bali. Corby dibebaskan bersyarat dan ditempatkan di satu vila di kawasan Seminyak, Bali. Namun diam-diam dia bersedia diwawancara khusus saluran TV Australia, Channel 7. Hasil wawancara khusus ini dipancarluaskan dan menggegerkan. Tetapi dibandingkan Indonesia, sikap penegak hukum Australia lebih jelas dan tegas tentang wawancara Corby ini. Mereka langsung mengerahkan Kepolisian Federal Australia menggerebek kantor redaksi Channel 7, di Sydney, atas informasi mereka bersedia membayar AS$ 3 juta kepada Corby untuk wawancara khusus itu.

Elektabilitas Demokrat Naik Karena Kerja Keras Kader

Waspada/Surya Efendi

KUNJUNGAN FPK KALTENG DI SUMUT: Wagubsu HT Erry Nuradi didampingi Asisten I Pemprovsu Hasiolan Silaen dan Kaban Kesbanglinmaspol Eddy Sofyan diabadikan bersama rombongan Forum Pembauran Kebangsaan (FPK) Kalimantan Tengah di restoran Jimbaran Medan, Senin (3/3) malam. Kunjungan balasan dari Kalteng ini guna melihat dari dekat potensi Sumatera Utara. Tim FPK Kalteng selama di Sumut juga mengunjungi Danau Toba, Istana Maioon, Masjid Raya, Vihara di Cemara Asri dan lokasi-lokasi lainnya serta melakukan dialog dengan FPK Provinsi Sumut.

Catatan Perjalanan Umrah (3-habis)

Makassar, Sulawesi Selatan, untuk mengikuti Debat Bernegara ke-8 Konvensi Partai Demokrat yang akan berlangsung 5 Februari 2014. Ruhut Sitompul, yang hadir sebagai pendukung Edhie menambahkan bahwa survei LSI yang terakhir diterimanya menyatakan bahwa elektabilitas partainya hampir mencapai angka 11%. Terkait hubunganya dengan nama besar dua Jenderal yang melatarbelakangi keluarganya, yakni ayahnya Sarwo Edhie Wibowo dan iparnya Susilo Bambang Yudhoyono (SBY), Edhie secara tegas mengakui hal tersebut tidak bisa dilepas dari dirinya. “Saya adalah anak Sarwo

Edhie Wibowo, tentunya darah beliau mengalir dalam diri saya, demikian juga pengaruh ajaran beliau jelas ada pada diri saya,” tukasnya. Kemudian, lanjut Edhie, dirinya memiliki hubungan sebagai kakak adik dengan SBY sejak kakaknya, Ani menikah dengan SBY.“Tentunya saya juga banyak belajar dari kakak saya,” tambah Edhie. Di akhir sesi silaturahmi dengan insan pers, Edhie menyatakan akan memberikan perhatian khusus kepada daerah luar Pulau Jawa. “Saya rasa Pulau Jawa sudah cukup tertata baik infra strukturnya, kini saatnya membangun wilayah luar Pulau Jawa,” kata Edhie. (aya)

Jamaah Umrah Nyaris Samai Musim Haji

Sepanjang hari sampai berganti malam, Masjidil Haram dan Ka’bah—walau bukan pada musim haji— tetap penuh sesak dengan jamaah yang rata-rata sedang melaksanakan ibadah Umrah. Entah dari mana asal negara masing-masing , namun para tamu Allah itu menyatu dan saling berebutan secara rukun dan damai dalam melaksanakan amalan-amalan utama sebagai bentuk ibadah untuk meraih keampunan dan rahmat , berkah serta karuniaNya. SELAMA Desember sampai Januari 2014, Kota Makkah serta kota-kota lain di Arab Saudi termasuk Madinah berada pada puncak musim dingin, suhunya rata-rata 2 derajad Celsius. Namun pada awal minggu pertama Februari, udara kota kelahiran Rasulullah itu mulai bergerak panas. Buktinya awal pertama menginjakkan kaki di Bandara King Abdul Aziz, Jeddah, dan kemudian dua hari di kota Madinah, jaket tebal yang menutup tubuh bagaikan tak mampu menyingkirkan rasa dingin. Baru setelah berada di Makkah, suhu yang katanya sempat menembus angka 8 derajat Celsius, berangsur naik ke angka 15 C di pagi hari dan 25 C di siang hari. Sedangkan pada puncak musim panas Makkah bisa menempus 55 derajad Celsius. Cuaca yang terbilang masih sejuk itu termasuk salah satu faktor membuat tingginya angka kedatangan jamaah umrah ke tanah suci. Faktor lain yang tak kalah pentingnya adalah terkait dengan masalah pembatasan kuota haji dari pemerintah Kerajaan Arab Saudi. Menunggu antrean haji sampai 10 tahun merupakan waktu panjang yang dapat diisi dengan perbuatan baik lainnya dengan

JAKARTA (Waspada): Pertumbuhan positif elektabilitas Partai Demokrat diakui Pramono Edhie Wibowo, peserta Konvensi Calon Presiden Partai Demokrat, sangat mengembirakan. Apalagi pencapaian peningkatan elektabilitas Partai Demokrat yang dinyatakan Ketua Umum merupakan hasil kerja keras para kader di berbagai daerah. “Mari kita bersama buktikan bahwa Partai Demokrat masih besar dan dicintai rakyat. Mari kita buktikan Partai Demokrat lebih besar dari yang dinyatakan lembaga-lembaga survei selama ini,” ujar Pramono Edhie Wibowo, Selasa (4/3) saat bersilaturahmi dengan wartawan diWarung Kopi Daeng Sija,

melaksanakan ibadah umrah. Pimpinan bimbingan Umrah Multazam dari Medan Ust Drs.H.Indra Harahap, MA mengaku sulit menerima alasan membludaknya jumlah jamaah umrah ke tanah suci karena faktor udara yang masih terbilang sejuk pada JanuariFebruari-Maret. Sebab, pada bulan Ramadhan, saat suhu udara antara 32-42 derajad Celsius, akan jauh lebih besar lagi jumlah umat Islam yang melaksanakan ibadah umrah. “Kita bisa bayangkan, dalam suhu udara panas seperti itu dan selagi jamaah sedang melaksanakan puasa Ramadhan , tidak mengurangi keinginan umat Islam untuk memenuhi panggilan Allah ke Baitullah itu. Jadi bukan faktor cuaca atau alasan lain kecuali karena niat beribadah kepada Allah SWT,” katanya. Dia menambahkan, sekali melaksanakan shalat di Masjidil Haram pahalanya setara dengan 100.000 shalat di masjid lain (kecuali masjid Nabawi 1000 kali) dikalikan 27 lagi apabila shalat berjamaah, berarti 2,7 juta. Apalagi pada bulan Ramadhan, akan ada lagi keistimewaan-keistimewaan yang diraih dalam beribadah. Adalah akan jauh lebih besar


JALAN berbatu menuju puncak Jabal Rahmah, tempat pertemuan Nabi Adam As dengan Siti Hawa setelah 400 tahun berpisah sejak dilemparkan ke dunia dari Surga, menjadi kenangan menarik bagi wartawan Harian Waspada Aidi Yursal saat melaksanakan ibada Umrah Februari lalu. lagi jumlah jamaah kalau pada musim haji sehingga semakin terlihat kecil daya tampung dan semakin terlihat sempitlah ruang Masjidil Haram. Sebaliknya animo umat Muslim dunia semakin meningkat tajam untuk memenuhi panggilan Allah sejalan dengan perkembangan dan pertambahan penduduk dunia dari waktu ke waktu. Kondisi Masjidil Haram dengan daya tampung yang tidak seimbang dengan arus kedatangan jamaah Muslim dari seantero dunia, cukup beralasan kalau pemerintah Kerajaan Arab Saudi menyikapi dengan berbagai kebijakan. Perluasan hingga dapat menampung jamaah dalam jumlah

besar, itulah program yang tengah dilaksanakan saat ini. Namun akibat keterbatasan lahan, pemerintah Arab Saudi mau tak mau harus melibatkan dengan membebaskan tanah milik swasta atau negara yang berada sekeliling, dan sudah sejak lama berdiri berbagai hotel mewah yang juga sebagai tempat pemondokan para jamaah. Dari berbagai sumber layak dipercaya yang berhasil dihimpun Waspada di tanah suci, dalam perluasan areal Masjidil Haram pemerintah setempat menerapkan cara pembebasan lahan yang tidak meresahkan dan juga tidak merugikan pemilik tanah dan bangunan. “Ganti Untung”, itulah sistem yang

diterapkan pemerintah Kerajaan Arab Saudi dan kini menjadi istilah popular. Artinya, bangunan pemilik diambil, pemiliknya menikmati untung, dan bukan istilah “Ganti Rugi” seperti di negara lain, sudah diganti, pemilik merugi. “Jadi pemilik hotel-hotel mewah yang berada di sekitar Masjidil Haram, seperti Hotel Dar Al Tawhid Intercontinental, Hotel Grand Zam Zam, Hotel Hilton dan hotel-hotel mewah lainnya sudah dan akan mendapat ganti untung sebagai kompensasi dari perluasan Masjidil Haram,” kata Hari Supardi, 45, warga Indonesia yang mengaku sudah hampir 40 tahun berdomisili kota Makkah, Arab Saudi. Mengenai perobohan hotelhotel mewah untuk perluasan, Hari Supardi yang sudah fasih berbahasa Arab, mengaku dilakukan secara bertahap. Sesuai dengan informasi resmi dari Kerajaan, kata Hari, tahun 2013-2018 akan menjadi giliran Hotel Mukaini, Hotel Al Olayan, hotel Al Tawhid, Hotel Zam Zam dan Hotel Hilton serta lainnya untuk dirobohkan. Istana Raja yang kini berdiri rapat dengan Masjidil Haram, tanpa kecuali, juga ikut terkena perluasan, akan digeser arah ke belakang yang pelaksanaanya sekitar tahun 2023. Memang perluasan Masjidil Haram itu menurut Hari, sudah berlangsung sejak beberapa tahun lalu yang dibuktikan berdirinya bangunan-bangunan baru yang masih tahap penyelesaian, termasuk beberapa menara dan Jam Besar

Waspada/Aidi Yursal

JAMAAH umrah Multazam di bawah bimbingan Ustaz Drs.H.Indra Harahap MA foto bersama saat berada di gerbang masuk Jabal Sur. (Gadang), yang bisa dilihat dari kejauhan dari semua arah. Malah ada bagian bangunan dekat Ka’bah yang kini ditutup seng karena dalam tahap pekerjaan. Hotel-hotel pencakar langit, termasuk Hotel Jabar Umar yang berada di sebuah puncak bukit, kini terlihat dalam tahap perobohan. Dalam tahap perluasan, yang tak kalah menarik adalah cerita tentang rumah tempat kelahiran Nabi Muhammad SAW yang waktu itu bernama (bergelar) Al Amin, serta rumah kediaman alm.Siti Khadijah yang keduanya turut tergusur. Hasan yang juga warga Indonesia sudah 30 tahun bekerja di sana, mengatakan sempat berkembang cerita aneh mengenai pembongkaran rumah kelahiran Rasulullah di daerah Gaza, Bukit Mubia, oleh pengem-

bang. Alat-alat berat sulit merobohkan bangunan itu, demikian pula barang-barang peninggalan yang ada di dalamnya, sulit diangkat. Bagaimana kelanjutannya, kini kawasan rumah kelahiran Nabi itu sudah menjadi bagian dari Masjidil Haram, demikian pula rumah alm.Siti Khadijah, janda kaya yang menjadi istri pertama Rasul, yang berlokasi dekat Bukit Marwah, tempat Sa’i, sudah menyatu semua dengan Al Haram. Perluasan Masjidil Haram yang sudah dilakukan pemerintah setempat, kata Hari, yakni pembangunan terowongan Bukit Ka’bah dan Bukit Hindi yang menghubungkan ke stasiun Kereta Api monorel di Rosaifa, nama perkampungan yang tadinya dihuni etnis kulit hitam (Nigeria) dari warga Arab

Saudi. Stasiun Rosaifah juga merupakan stasiun KA transit ke MinadanMuzdalifahyangsegera berfungsi pada musim haji. “Yang sedang dibangun sekarang ini adalah lintasan kereta api monorel JeddahMekkah yang kini dalam tahap pemasangan konstruksi baja, direncanakan tahun depan sudah dioperasikan bagi angkutan jamaah haji,” kata Hari. Tujuan pembangunan KA Monorel itu selain mengantisipasi kemacatan, terutama pada musim haji, tetapi juga untuk meningkatkan pelayanan kepada jamaah haji dan jamaah umrah yang datang dari berbagai penjuru dunia. Itu, menurut Hari, bukan berarti alat transportasi jenis bus akan ditiadakan, tetapi jamaah tinggal pilih saja, mau naik monorel atau bus.

A8 1 CM


Rp. 22.000

2 CM

BURSA AUTOMOTIVE Informasi Pembaca

Bursa Automotive AC BR CL ND DB

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

CHEVROLET BLAZER MONTERA Thn 2005. Ac, Cd + Tv, Vr, Ps, Pw, Cl, Jok Kulit, Hitam, BK Mdn, Rp. 67Jt. Hub 0853 7089 9893

DAIHATSU GRAND MAX Pick Up 1,5 cc Over Kredit Th 2012, Ex Angkat Telur, Sgt Orisinil, Sudah dibayar 19x sisa 29x 2.668.000, Balik Dp 35Jt Nego, AC, PS. Hub: 0812 6281 6585 DAIHATSU ROCKY/F78 Thn 1997, Biru Hitam Metalic, Independen. BK Mdn, Sangat Mulus, Harga Nego Rp. 120Jt. HP : 0 8 1 3 7 0 6 3 4 7 7 0 - D. ESPASS 1.3 P.Up’03, Htm, Dp 10Jt Angs 1,4Jt x 35 - M. T120 SS 1.3 P.Up’03, Htm, Dp 10Jt Angs 1,3Jt x 35 - S. Carry 1,5 P.Up’07, Htm, Dp 15Jt Angs 1,9Jt x 35 Hub Yos Sudarso 42F Glugur, 6 6 1 4 9 7 6 /7 7 7 0 4 0 2 4 - D. ESPASS 1.3 P.Up’03, Htm, Dp 10Jt Angs 1,4Jt x 35 - M. T120 SS 1.3 P.Up’03, Htm, Dp 10Jt Angs 1,3Jt x 35 - S. Carry 1,5 P.Up’07, Htm, Dp 15Jt Angs 1,9Jt x 35. Hub Yos Sudarso 42F Glugur, 6 6 1 4 9 7 6 /7 7 7 0 4 0 2 4

Rp. 33.000

3 CM

Rp. 44.000

T OYOTA KIJANG SUPER G Long 95. Warna Abu - Abu Metalik, Kondisi Sehat, siap pakai, Vr, Br, Tape, Pw, Cl, Hrg 58Jt/Nego. No SMS. Hub 0 8 1 3 7 6 0 9 5 1 1 1

H ON DA CRV V-Tec Manual Th’05. Wrn Silver, Mobil Istimewa, BK 100 V, 1 Tangan dr Baru, Rp. 115Jt. Jl. Sm Raja No. 200. 0815 3373 3688 / 7851402

I SU Z U PANTHER LM Thn 2005. Ac, Tape, Vr, Ps, Cl, Biru Muda, BK Mdn, Rp. 105Jt. Hub 0 8 5 2 7 5 3 8 3 2 1 8 OPEL BLAZER LT INJECTION Th 96 Biru. Ban Cangkul, Mesin Sehat, Ac Dingin, Hrg 40Jt, Mesin Sehat, Ac Dingin, Hrg 40Jt Nego. Hub 0852 6134 0538

SU Z U K I APV X’2004, PW/ PS/TS/AC DB/CL, Abu - Abu Met Nego. 0815 3377 9191 SUZUKI CARRY MINIBUS Thn 89 Dijual B.U. Harga Nego. Hub Jln Alfalah I No. 14 Glugur Darat Dekat Kampus UMSU Mdn. 0813 7086 5875

TOYOTA SE SALOON Pemakaian Th 86. Sgt Orisinil Sekali, Sehat dan siap pakai, Hrg 33Jt Nego. Hub 0812 6063 7823

TERCECER TELAH HILANG / TERCECER Asli Surat Pernyataan Sebidang Tanah yang dibuat Oleh MAAS HARAHAP yang diketahui oleh Kepala Kelurahan Besar Kecamatan Medan Labuhan Tertanda NGADIMAN. S Tertanggal 14 Maret 1983 TERCECER


Rp. 1.350.000,Jok (model press) + Alas

Rp. 121.000



6 CM


TOYOTA NEW AVANZA 1.3 G Th’12 Bln 11, Wrn Hitam Metalik, Velg Racing, Pakai Sensor, Mobil Cantik, Rp. 155Jt. Hub 0 8 1 3 2 0 2 0 3 1 0 7

BUTUH DANA BANTU TUTUP KARTU KREDIT / KTA Hanya Bayar 30% Hutang Lunas 100% dan Legal. Hub Tinah 0812 8153 9552

Telah tercecer & hilang 2 buah Surat Tanah a/n Alm Rumbang Surbakti : Tanah di Dusun II Sidodadi, Desa Sei Semayang + 2354 M2, Yang berbatas dibagian Utara Tanah Katimin, Sblh Selatan dgn Jalan. Sblh Timur dgn Tanah Derek Sitepu, Sblh Barat dgn Ationg. Tanah Ationg. Tanah di Dusun II Sidodadi, Sei Semayang , Seluas 24x24, Batas dibagian Utara dgn jalan , sebelah Selatan dgn Tanah Ramlan Sembiring, Sebelah Timur dgn Tanah Banta Br Sitepu, Sebelah Barat berbata dgn tanah Banta Br Sitepu. Tercecer disekitar Sunggal, bagi yg menemukan Hub Ahli Waris Musa Surbakti di lokasi tanah.

T ERCECER Sebuah BPKB BK 9006 SE, An. Wira Andrea Ginting. Jl. Karya Sehati No. 28 Sei Agul-Medan T ERCECER


DO RE M I J OK M OBI L JL. S. PARMAN BLOK DD No. 3-4 (DEPAN ST. THOMAS 2 MEDAN) Telp. 061-4522123, 0812 6550 123, 061-6639123 JL. MAKMUR No. 10 A, MEDAN (MASUK DARI JL. ADAM MALIK / JL. KARYA) TELP. 061-6639123, 6636123, 0812 6550123




PROMO I Rp. 700.000 Rp. 800.000 PROMO II Rp. 1.000.000 Rp. 1.100.000 PROMO III Rp. 1.400.000 Rp. 1.600.000 Hub.

ELITE MOTOR Jl. Nibung II No. 114 Medan (Samping Medan Plaza)

Telp. 061- 76224409, 0811608140 dekat Carrefour


Rp. 55.000

DI J U AL TOYOTA SUPER KIJANG Tahun 95 Long 1.8 cc, Mobil Sangat Terawat, Jarang pakai, Warna Abu Metalik, BK Medan, Mulus, Lengkap, Ac, Tape, Velg Racing, Harga 57Juta. Hub 0 8 5 3 7 2 4 0 7 7 9 0

H ON DA MAESTRO 90. Warna Abu - Abu Lengkap, Harga Rp. 34Jt. HP 081 2633 4114, 0821 6603 9297 H Y U N DAI TRAJET Thn 2004. Ac, Db, Tape, Ps, Pw, Bangku 3 Baris, Silver, BK Mdn, Rp. 52Jt Net. Hub 0852 7538 3218

4 CM


Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:


WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347

STUK. BK 8144 CR. No uji : Ab.01.021351. A/N : PT. Bismaniaga Lestari. Alamat : Jl. Sm Raja Km 6,5 Medan. Jenis : Truck Tronton

H I LAN G / T ERCECER Surat Ganti Rugi Tanah Tahun 1985 antara Tn. Nawa Ketaren Selaku Pihak I dan Tn. Selamat Perangin - angin Selaku Pihak II, tanah yg terletak di Desa Salam Tani Kec.Pancur Batu. Kab. Deli Serdang. Hilang disekitar Jalan Jamin - P. Bulan Medan. HP 0 8 1 3 6 2 1 0 5 9 5 7

TELAH HILANG / TERCECER Surat Penyerahan Hak Atas Tanah Dengan Cara Ganti Rugi Nomor 4701/070/TS-1/ 2014. A/N. Abdul Rahman. Disekitar Sukaramai Dan Jl. Bakti. Bagi siapa yang menemukan tidak akan dituntut T ERCECER STUK. BK 9132 ba. No uji : mdn 12008 c. A/N : H. Mhd Hasan Ismail. Alamat : Jl. Gurilla No. 2 Mdn. Merek : Mitsubishi

CV TOPPAN Jaya, Pemilik Muhammad Andreas Pekken Ginting, Alamat Pemilik Dusun I Desa Tanah Abg Kecamatan Galang. Alamat Cv. Jln Medan No. 17 Lubuk Pakam, Tercecer di Jln Besar Petumbukan Jaharun B BURSA ALAT MUSIK

8 CM Rp. 137.500

Rabu, 5 Maret 2014


6x6,6 kolom Rp. 165.000


I nfo Pe m e sa na n I k la n H ub. PI N BB 2 6 2 4 7 F5 E H P. 0 8 7 7 1 7 8 4 4 0 3 5 - 0 8 1 1 6 0 4 6 9 0


DCR IIs SLTA/sdrj U/diddk & lsg dislrkn mjd Guru PG/TK Hub : Jl. KH. Wahid Hasyim 92 Medan. Tlp. 4533875,4569269 DICARI Guru Private English dan Semua Mata Pelajaran. Hub 0 8 5 2 7 6 2 7 9 6 7 3


Informasi Pembaca Bursa Property G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu


RU M AH DI J UAL Komplek Setia Budi Makmur / Jl. Stella Raya. 2 TKT, 3 KMT, 2 KMD, SHM, Siap Huni. Harga 450Jt/Nego. Hub 0813 6152 4894 RU M AH DI J UAL



Komp. Millenium Indah No. 4 B, Jl. Setia Luhur Psr I . Kel. Dwikora, Luas 72 M2, 3 Tingkat, SHM, Siap Huni, Harga 600 Jt. Hub 0812 6484 8080 RUMAH DIJUAL Jl. Marelan VII Psr 1 Tengah No 11. Uk 10x24 M, Ada tingkat, Toko, Ada Rumah Sewa, KT 3, Grasi, Toko, Listrik, 1300 Watt, Pam, Rp. 550Jt. Hub 0 8 5 2 6 2 2 4 2 6 1 8 , 0 8 2 3 6 2 5 8 2 1 0 8

DI J U AL RU M AH M U RAH 2 Unit di Jl. Pancasila Gg. Keluarga Ukuran 6 x11 dan 7 x 11, Harga 375 Jt. Bisa KPR, SHM, Masuk mobil, Rumah nyaman dan minimalis. HP 0 8 1 3 9 7 8 1 3 0 3 0 DI J U AL


Dikomplek Taman Anggrek Blok A 36 No. 6 Jl. Binjai Km 14 Serasi - Jl. Setia Gg. Anggrek Desa Muliorejo, posisi rmh hadap timur mentari terbit pagi hari. HP 0 8 1 2 6 4 7 6 5 0 4 5

DIJUAL RUMAH Jl. Tempirai 2 No 71 Blok VII Griya Martubung Medan. SHM, UK 7x14, PAM, PLN, PGN, 2 KT, 2 KM, 1 Ruang Serbaguna. Harga 195Jt Nego. Hub 0821 6082 8210 Maaf TP RU M AH DI J U AL Jl. Puyuh 7 No. 138 Perumnas Medan II. Uk. 14x15m2 = 210 m2, RT 1, KT 3, RM 1, KM 1, RS. Grasi, Telp, PLN, Air. Hub 0812 6394 9109

DISEWAKAN 1 Pintu Ruko Bertingkat 3, Terletak di B. Katamso, Cocok Untuk Usaha Atau Kantor, Lengkap, Listrik, AIr, Tel, Ac, 1 Tahun 30 Juta. Minimum 2 Tahun. Hub 0 8 5 2 6 1 1 4 0 2 3 0



H P. 0812.6495.8456, 0813.6137.2321 0852.0648.6301, 0823 6252 6008 TELP. 061- 4576116 FAX 061-4512319

LOWON GAN K ERJ A PERUSAHAAN BARU BUKA * P E R S YA R AT A N * * Tamatan Smu Sederajat * Umur +/- Max 36 Tahun * Pengalaman Di Bidang Marketing * Memiliki Kenderaan Pribadi (Sepeda Motor) * Memiliki Sim C * Pas Photo Terbaru Ukuran 3x4 = 2 Lembar * Surat Lamaran Kerja * Daftar Riwayat Hidup * Fa silit a s Y g Dit e rim a * - Gaji Pokok - Uang Transport - Komisi Penjualan - Incentive - Jenjang karier - Tour Luar dan Dalam Negeri Lamaran Dapat Dikirim Langsung pada jam Kerja 08.00 - 17.00 Wib, Senin - Jumat Ke S u g i h A r t h a Jln Sunggal Depan Asrama Perkampungan Kodam No. 140B Medan Sunggal. 0 8 1 3 6 1 5 9 7 2 2 3



MAK EROT YANG TERUJI DAN T ERBU K T I Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna K H U SU S WAN I T A: K H U SU S PRI A: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DI J AM I N 100% K ON SU LT ASI U M U M : H AN YA T EM PAT - Buka aura K AM I K LI N I K - Cari jodoh M AK EROT - Pelaris - Mencari orang hilang J L. LAK SAN A N O. 6 2 A M ASU K DARI J L. AM ALI U N Y U K I SI M PAN G RAYA M EDAN (PRAK T EK T ETAP) H P: 0 8 1 2 4 0 3 8 3 3 3 - w w w.t e ra pia lat vit a lm a ke rot .c om


Metode pengobatan dengan cara ditotok dibagian syaraf dan kelemahannya dan diberikan Ramuan/ Jamu, 100% alami tidak ada efek samping bebas usia, bebas untuk semua agama, REAKSI DITEMPAT K H U SU S PRI A: - Panjang: 13, 15, 16, 18, 20 - Besar: 3, 4, 5, 6 - Impotensi - Kurang Keras/Ejakulasi dini - Tidak punya keturuan - Hernia K H U SU S WAN I TA: - Memperbesar payudara - Mempersepit vagina K O N S U LTA S I U M U M : - Buka Aura - Pengasihan/penglarisan usaha - Masalah rumah tangga - Ingin dapat jodoh/pelet Alamat: J l. SM . Ra ja de pa n H ot e l GARU DA PLAZ A sa m ping K linik BU N DA Gg. Ke lua r ga N o. 1 3 C H P. 0 8 1 2 6 0 5 7 6 4 4 4

BURSA PERABOT T EM PAH AN M U RAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 75107000


SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun


Hub Telp. (061) 661.8116 - (061) 661.6802 - 75107000


Anda Butuh Perabot Jepara Asli?

Keterangan lebih lengkap silahkan hubungi: TELPON : 061 - 4576602 FAX : 061 - 4561347

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

* Format: JPG - TIFF (Photoshop)




Hub 0812 6506 3407 0812 62415090 BURSA


BURSA KOMPUTER CUCI GUDANG LAPTOP TERMURAH Merk terkenal *Toshiba 14’ = 1,99 Jt -- Kwalitas terjamin - Digaransi * Dell 14’ = 1,7 Jt Hubungi : -0813 7508 3972 * IBM 14’ = 1,8 Jt -0853 5880 0373 - (061) 844 3449 * Fujitsu 12’ = 1,7 Jt Pondok Kelapa No. 9 B * Infokus Proyektor = 1,7 Jt Medan Ringroad Tersedia Cicilan * Fujitsu 14” Lyr Putar = 1,9Jt 12 Bulan


MENYEWAKAN PERALATAN PESTA - Pelaminan, cukup hanya 2,5Jt - Teratak, Pentas, Meja Complete,

Ice Cream 350rb/tong. Hanya 2,5Jt Dijamin Murah & Puas. Segera Hubungi

0821 6600 0606 - 0822 6778 8889 (simpan iklan ini, sewaktu - waktu anda butuhkan)

I N V ESTASI Perhari 5 Jt Selama 90 Hari (PASTI). Hub PT. BOSSVENTURE. T+ 6 2 2 1 4 1 1 9 6 3 0 1 . HP : 0 8 2 3 1 2 7 8 1 3 6 6 atau SMS “ Berminat”. HP 0 8 7 8 8 1 5 7 0 8 6 7 (www. bossventureautoprofit. com)




8 4 5 .8 9 9 6 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim



HERBAL & TERAPI OZON Kanker, Diabetes, Kista, Prostat, Lemah Syahwat, Osteoporosis, Radang Sendi, Rematik, Asam Urat, Saraf Terjepit, Kesuburan, Gangguan Tidur, Sakit Pinggang, Pengapuran, Stroke, dll. Dr. Suba H P : 0 8 5 2 7 0 4 4 4 7 1 8 J l. Pa sunda n N o. 3 2 -B Te lp : 4 5 5 0 3 6 2 M e da n BERTAHUN....BELUM SEMBUH....?

Tuntas Tak kambuh lagi, dgn Herbal Mujarab Asam urat/Reumatik, Maag/Asam lambung(Akut),syaraf terjepit, Sakit gula(DM) (Busuk), Typhus, DBD, Ambeien (berdarah?), TBC, Stroke (Lumpuh), Kista (blm ada Keturunan?) dll. Hub Pak Ngadi HP 0 8 1 3 7 5 0 0 7 1 7 7

Luar Negeri

WASPADA Rabu 5 Maret 2014

A9 Rahasia Panjang Umur Misao Okawa: Makan Sushi dan Tidur TOKYO, Jepang (Telegraph): Misao Okawa akan memperingati ulangtahunnya yang ke 116 pada hari ini Rabu (5/3). Kepada suratkabar Inggeris Telegraph, Misao mengungkap rahasia panjang umurnya, yakni tidur cukup, makan makanan sehat dan tidur siang. “Makan dan tidur lah dan Anda akan panjang umur. Anda harus belajar menikmati hidup santai. Setidaknya makan sushi sekali dalam sebulan,” tambah Tomohito Okada, Kepala Rumah Jompo di mana Misao tinggal selama 18 tahun terakhir. Misao lahir tahun 1898 dan memiliki cicit enam orang. Ketika ditanya tentang masa-masa paling bahagia dan menyedihkan dalam hidupnya, Misao mengatakan pernikahannya dengan suaminya di tahun 1919 dan kelahiran ketiga anak-anaknya menjadi masa-masa paling membahagiakan. Suaminya meninggal dunia tahun 1931. Anak-anaknya yang masih hidup sekarang berusia 94 dan 92 tahun, menurut keterangan Telegraph. Misao menjadi manusia tertua yang hidup di muka bumi ini tahun lalu ketika penyandang gelar sebelumnya, Jiroemon Kimura, meninggal dunia pada usia 116 tahun.(m23)

Thailand Mungkin Perpanjang Status Gawat Darurat

Getty Images

Misao Okawa, wanita tertua di dunia menurut Guinness World Records menerima kue ulangtahun pada ultahnya yang ke 115 di Rumah Jompo Kurenai tahun lalu. Hari ini dia genap berusia 116 tahun.

Putin Perintahkan Penghentian Latihan Militer Rusia MOSKOW, Rusia (Antara/AFP/Reuters): Presiden Rusian Vladimir Putin, Selasa (4/3) memerintahkan pasukan kembali ke pangkalan-pangkalan permanen mereka untuk memeriksa kesiapan tempur mereka pekan lalu, tindakan yang dipandang sebagai usaha untuk meredakan ketegangan antara Timur-Barat terkait pengerahan pasukan Rusia ke Ukraina. PresidenVladimir Putin yang juga panglima tertinggi militer memberikan perintah kepada pasukan dan satuan-satuan yang ikut serta dalam pelatihan militer untukpulangkepangkalan-pangkalan permanen mereka, kata juru bicara Putin, Dmitry Peskov kepada kantor-kantor berita Rusia. Putin pada 26 Februari memerintahkan pelatihan kesiapan tempur yang melibatkan ribuan tentara, dalam apa yang disebut satu pelatihan rutin. Pelatihan itu melibatkan

pasukan angkatan-angkatan darat, laut dan udara yang berpangkalan di distrik-distrik militer tengah dan barat, satu wilayah luas termasuk wilayah-wilayah yang berbatasandenganUkrainatetapi juga meluas ke Arktik. Pelatihanitutidakmelibatkan daerah-daerah di luar perbatasan RusiasepertiKrimea,wilayahLaut Hitam Ukraina yang menjadi titik api dalam konflik antara Moskow dan para penguasa baru Ukraina setelah penyingkiran presiden Viktor Yanuovych. Menteri Pertahanan Sergei

Serangan Pesawat Tanpa Awak Yaman, 10 Tewas ADEN, Yaman (Reuters): Sedikitnya empat tersangka militan Al-Qaida tewas dalam serangan udara diYaman menyusul tewasnya beberapa tentara di selatan negara itu, kata pejabat setempat dan kantor berita Saba Senin (3/3). Negara sekutu AS itu yang berbagi perbatasan dengan Arab Saudi dilanda kerusuhan sejak 2011, ketika aksi unjukrasa massal memaksa Presiden Ali Abdullah Saleh mundur. Kantor berita Saba mengatakan sejumlah pria bersenjata menyerang para tentara dalam dua serangan, menewaskan enam orang, setelah tentara berhasil menggagalkan serangan mortir, dan granat berpeluncur roket atas satu pipa gas di Provinsi Shabwa. Dikatakan 14 tentara lainnya cidera dalam serangan antara distrik Mayfa’a dan Radoum di Shabwa. Kantor berita itu tidak menyebutkan identitas para penyerang namun pemerintah sering menuding kelompok Islam yang terkait Al-Qaida mencoba menyabotase infrastruktur di negara itu. Penduduk setempat mengatakan, satu pesawat tanpa awak milik AS menyerang satu kenderaan yang tengah dalam perjalanan di daerah itu dan menewaskan dua dari penumpangnya. AS meningkatkan serangan dengan pesawat tanpa awak sebagai bagian dari perang terhadap AQAP, yang dipandangWashington sebagai sayap paling aktif dari jaringan itu.(m23)

AS Hentikan Kerja Sama Militer Dengan Rusia WASHINGTON (Reuters): Pemerintah Amerika Serikat menghentikan kerja sama militer dengan Rusia, menyusul invasi tentara Kremlin ke wilayah Crimea. Penghentian kerja sama ini sesuai dengan ancaman AS agar Rusia menarik pasukannya dari wilayah otonomi Ukraina tersebut. Diberitakan Reuters, pengumuman ini disampaikan Pentagon pada Senin (3/3). Dalam pernyataannya, Pentagon mengatakan bahwa termasuk yang dihentikan adalah kerja sama latihan militer maupun pertemuan para pejabatnya. “Kami menyerukan Rusia untuk menurunkan tensi krisis di Ukraina dan bagi tentara Rusia di Crimea untuk kembali ke pangkalan mereka,” kata juru bicara Pentagon, Laksamana Muda John Kirby. Selain itu Pentagon mengatakan bahwa AS juga tengah mempertimbangkan menjatuhkan sanksi ekonomi dan diplomatik kepada Rusia.Selainhubunganmiliter,ASjugatelahmembatalkanpertemuan investasi dan dagang dengan negara yang dipimpinVladimir Putin itu. Langkah ini diambil AS setelah Rusia menurunkan pasukannya di Crimea, diperkirakan jumlahnya mencapai 16.000 tentara. Presiden AS Barack Obama mengecam campur tangan Rusia dalamurusandalamnegeriUkrainadenganmengatakannya“berada di sisi sejarah yang salah”. Kecaman juga berdatangan dari negaranegara Eropa. Kendati kecaman dari banyak pihak, namun Putin tetap bergeming. Rusia menambah kekuatannya di Crimea. Putin bahkan memerintahkan para tentara untuk kembali ke pangkalan mereka jika sudah selesai latihan.(vvn)

Shoigu mengatakan pelatihan itu akantermasukpelatihan-pelatian militer“di perbatasan-perbatasan Rusia dengan negara-negara lain termasuk Ukraina”. Tangguhkan Latihan Militer ASlangsungmemperlihatkan responnya terhadap Rusia, denganmengumumkanpenangguhan hubungan militer dengan Rusia, termasuk latihan militer, kunjunganpelabuhandanmem-

batalkan pembicaraan dagang dan investasi dengan Moskow. Presiden Barack Obama mengadakan pembicaraan selama dua jam dengan penasehat keamanan nasionalnya untuk membahas langkah-langkah yang bisa dilakukan AS dan sekutunya guna ‘semakin mengucilkan’ Rusia, kata pejabat Gedung Putih. “Masalah ini akan dibayar mahal oleh Rusia. Dan sudah

waktunya bagi mereka untuk mempertimbangkan apakah mereka bisa menyelamatkan kepentingan mereka dengan memilih cara diplomasi,” kata Obama kepada wartawan. Deplu AS mengatakan, AS tengah mempersiapkan sanksi atasRusiaatasintervensitersebut, meski belum ada keputusan yang diambil. Sementara Uni Eropa mengancam akan melakukan ‘lang-

kah yang ditargetkan’ jika Rusia tidak menarik pasukannya dan membuka pembicaraan dengan pemerintah baru Ukraina. Para pemimpin barat mengirimkanberbagaiperingatankepada Putin menentang tindakan Rusia mengerahkan pasukan ke Ukraina, dengan mengancam akan menghadapi konsekwensi perekonomian dan diplomatic, namun tidak mempertimbangkan respon militer.(m23)

PBB Perlukan 10 Ribu Prajurit, 1.820 Polisi Untuk Afrika Tengah PBB, NewYork (Antara/AFP): Sekretaris Jenderal PBB Ban Ki -moon merekomendasikan pengiriman11.820personilpasukan penjaga perdamaian di negara yang dikoyak perang Republik Afrika Tengah, termasuk 10 ribu tentara dan 1.820 polisi, untuk membangun kembali tata pemerintahan. Dalam sebuah laporan yang dikirimkepada15anggotaDewan KeamananSenin(3/3),Banmenjelaskanbahwamisipenjagaperdamaian harus fokus, di tahap awal, pada“perlindungan warga sipil .“ Namun, mandat untuk operasi yang diusulkan akan semakin diperluas untuk mencakup “dukunganbagitransisiprosespolitik”, khususnya mengembalikan otoritas pemerintah di seluruh negeri danmenyelenggarakanpemilihan

umum, menjaga pengiriman bantuan kemanusiaan , menghormati hak asasi manusia dan pengembalian orang-orang yang mengungsi akibat konflik. “Diperkirakan bahwa kekuatanpasukanpenjagaperdamaian itu akan terdiri dari hingga 10 ribu tentara dan 1.820 personil polisi,” serta termasuk logistik dan transportasi pendukung, seperti helikopter, jelas laporan itu. Pengiriman akan dilakukan secara bertahap . “Untukmengatasikebutuhan keamanan langsung, akan ada lonjakan awal personil militer,” kata laporan itu . “Polisi juga akan (dikirim) secara bertahap dan, saat lingkungankeamananmembaik,akhirnya(mereka)harusmenggantikan sebagian besar lonjakan jumlah

militer,” pertama di ibukota , Bangui, dan kemudian di provinsiprovinsi lain. Sedikit demi sedikit, komponensipilbesarakanditambahkan, meskipun laporan tersebut tidak menentukan angka pastinya . Komponensipilini-administrator, insinyur, pengamat hak asasi manusia dan pengacara akandimintamembantumenyelenggarakan pemilihan umum, mempromosikan rekonsiliasi nasional dan untuk membangun kembali pemerintahan nasional yang belum efektif selama berbulan-bulan dan yang tidak lagi menyediakan layanan penting bagi masyarakat. Tetapi bahkan dalam kasus terbaik, pasukan penjaga perdamaian PBB tidak dapat dikirim hingga enam bulan mendatang

- tidak sebelum September atau Oktober - karena waktu yang dibutuhkan untuk mematangkan operasi tersebut . Bekas koloni Prancis itu masuk ke dalam kekacauan setelah pemberontak dari kelompok Seleka yang mayoritas Muslim merebut kekuasaan dalam kudeta Maret 2013 . Kekerasan Muslim - Kristen yang telah meletus pasca kudeta itu mengakibatkan tewasnya ribuan orang dan sekitar seperempat dari total populasi 4,6 juta mengungsi. Hal itu juga mendorong PBB untuk mencemaskan terjadinya genosida dan pembersihan etnis. Pasukan MISCA pimpinan Uni Afrika dengan kekuatan 6.000 prajurit telah ada di lapangan bersama sekitar 2.000 tentara Prancis dari operasi Sangaris.

Badai Dahsyat Landa Bagian Timur AS, 2.900 Penerbangan Dibatalkan WASHINGTON, AS (Reuters): Badai mematikan menghantam kawasan East Coast, Amerika Serikat, dengan membawa hujan es, salju dan cuaca dingin, sehingga 2.900 penerbangandibatalkan,sejumlahsekolah dan kantor pemerintahan diWashington ditutup. Badaitersebutmenyebabkan saljusetebal4incidiibukotaASitu padasorehariketikabadaitersebut menyapu dari MississippiValley menujupantaiAtlantik,kataBadan Cuaca Nasional Senin (3/3). Suhu udara di bawah normal (- derajat Celsius) ketika udara dingin berhembus dari kawasan Great Plains menuuju pantai Atlantik, kata Brian Hurley, seorang pakarmeteorologydibadancuaca itu. Pada Selasa (4/3), kantor federal di Washington, D.C, buka dua jam lebih lama dari waktu biasa dan para karyawan diperbolehkan bekerja dari rumah. Jalanan yang ber-es diVirginia menyebabkan satu orang tewas Senin pagi, ketika seorang pria berusia 30 tahun yang mengemudikan mobil pick-up, terbalik dan menabrak pohon, kata polisi. Sedikitnya empat orang

tewasakibatkecelakaanlalulintas di Texas, Oklahoma dan Tennessee akhir pekan lalu. Meski salju melintasi kotakota di utara termasuk NewYork danBoston,Seninpagi,suhuNew Yorksudahnaikmenjadi-5derajat Celsius, kata Hurley. Peringatan akan suhu yang membekukan masih dipasang

di kawasan mulai perbatasan Kanada sampai Texas. Operator listrik utama untuk Texas mengeluarkan anjuran untuk berhemat listrik terkait meningkatnya kebutuhan, dan hujan bercampur salju yang menyebabkan 30.000 rumah dan usaha di Memphis, Tennessee, terputus dari aliran listrik, lapor badan Air, Gas dan

Cahaya Memphis. Sekitar 2.900 penerbangan dibatalkan dan hampir 5.000 ditunda jam keberangkatannya Seninkarenabadaitersebut,me-nurut situs Bandara yang paling buruk dilanda badai tersebut adalah Reagan National, di mana lebih 80 persen penerbangan dibatalkan. (m23)

BANGKOK, Thailand (Reuters): Status negara dalam keadaan darurat di Bangkok kemungkinan akan diperpanjang sampai aksi unjukrasa anti-pemerintah benar-benar berakhir, kata Menteri LuarNegeriThailandSelasa(4/3),sambilmenambahkandiakhawatir akan terjadinya kerusuhan meski aksi unjukrasa sudah mereda. Aksi unjukrasa yang ditujukan untuk menggulingkan PM Yingluck Shinawatra telah memasuki bulan kelima namun akhir pekanlalupengunjukrasatelahmenutupbeberapatempatunjukrasa dan bergerak ke taman pusat Bangkok. “Jika Suthep masih melanjutkan aksi unjukrasa ini dan insiden kekerasan masih terjadi, termasuk pelemparan granat, penembakan dan tindak kekerasan oleh provokator, hukum darurat masih akan tetap diberlakukan sampai situasi membaik,” kata Menlu Surapong Tovichakchaikul kepada wartawan. “Kami menunggu pasukan keamanan, tentara dan kabinet untuk memutuskan sebelum status gawat darurat berakhir 22 Maret mendatang,” kata Surapong. Pemerintah menerapkan kondisi gawat darurat selama 60 hari di Bangkok pada 21 Januari untuk mencegah meningkatnya aksi unjukrasa menjelang pemilu pada 2 Februari lalu, yang tetap mengalami gangguan. Menteri Perburuhan ChalermYoobumrung, yang bertanggung-jawab memberlakukan kondisi gawat darurat, mengatakan aksi unjukrasa sepertinya belum akan berakhir dalam waktu dekat.(m23)

Dokter Tanpa Batas Dilarang Di Myanmar RAKHINE, Myanmar (CNN): Lembaga bantuan Dokter Tanpa Batas dilarang beraktivitas di Rakhine, Myanmar, menyusul adanya tuduhan resmi bahwa lembaga tersebut bersikap cenderung membela minoritas Rohingya di daerah itu. Badan medis internasional ini minggu lalu dilarang beroperasi di negara AsiaTenggara itu, di mana mereka memberikan perawatan kesehatan bagi puluhan ribu pasien dan telah beroperasi selama 22 tahun. Sabtu, lembaga tersebut mengumumkan pemerintah telah mengijinkanpihaknyamelanjutkanoperasidibeberapadaerah,namun tidak di Rakhine, di mana minoritas Muslim Rohingya menetap. Sejak2012,Rakhine,rumahbagisekitar800.000MuslimRohingya, menjadi tempat kerusuhan yang telah menewaskan ratusan dan menyebabkan 140.000 Muslim Rohingya terusir. Dalam satu pernyataan, Dokter Tanpa Batas mengatakan “pihaknya sangat terkejut dengan keputusan sepihak itu.” Sebagai pemberi pelayanan kesehatan di Rakhine, lembaga itu mengelola klinik di sembilan kota“merawat setiap orang yang tidak mendapatkanperawatankesehatanyangmerekabutuhkan”termasuk puluhanribuorang-orangyanglemahyangterpaksatinggaldikampkamp akibat kerusuhan itu. NamunYe Htut, jubir Presiden Myanmar TheinSein,mengata-kanlembagaitudilarangdiRakhinekarenaselama ini lebih cenderung membela Muslim Rohingya.(m23)

Pengadilan Larang Hamas Di Mesir KAIRO, Mesir (Reuters): Satu pengadilan Mesir Selasa (4/3) melarang semua kegiatan Hamas di Mesir. Hamasdinyatakansebagaikelompokterorisolehpihakpenguasa Mesir dan mendapat tekanan sistematis sejak angkatan bersenjata menggulingkan Mohamed Moursi dari jabatan kepresidenan Juli lalu. Ketika Moursi berkuasa dia memberikan perlakuan istimewa kepada Hamas, sehingga membuat gerah kelompok sekuler dan liberal di Mesir. Penguasa dari kalangan militer sekarang menyebut Hamas berbahaya bagi keamanan, dengan menuduh kelompok itu mendukungpemberontakanIslamyangmenyebardengancepatsejakMoursi terguling, tuduhan yang dibantah keras oleh Hamas. Pengadilan juga memerintahkan ditutupnya kantor-kantor Hamas di Mesir. Hamas mengecam keputusan itu. “Keputusan tersebut merusak citra Mesir dan perannya terhadap perjuangan Palestina. Keputusan tersebut sama dengan menentang perlawanan Palestina terhadap Israel,” kata Sami Abu Zuhri, jubir Hamas. SemasakekuasaanMoursi,Hamasmengadakanpemilihaninternal di Mesir di tahun 2012. Pejabat tinggi Hamas, Musa Abu Marzouk, yang tinggal di Kairo sekarang kemungkinan menghadapi resiko penangkapan sehubungan dengan keputusan pengadilan itu.(m23)

Serangan Udara Israel Tewaskan Dua Warga Palestina Di Gaza GAZA CITY, Palestina (Antara/AFP): Serangan udara Israel di Jalur Gaza utara menewaskan dua warga Palestina dan melukai dua lainnya, kata layanan darurat di daerah kantong yang dikelola Hamas. Kepala layanan darurat Ashraf al-Qudra Senin (3/3) mengatakan kepada AFP bahwa Musaad Alzaneen, seorang pemuda 20-tahunan, tewas dalam serangan di ladang pertanian dekat kota Beit Hanoun. Ia kemudian menambahkan bahwa Sharif Nasser, 31 tahun, meninggal karena luka yang diderita dalam serangan tersebut. Juru bicara kantor militer Israel mengatakan target serangan adalah “regu peluncur roket” Palestina. “Pesawat angkatan udara Israel menargetkan teroris yang mempersiapkan untuk meluncurkan roket di Jalur Gaza utara,” katanya dalam satu pernyataan. “Misi ini dilakukan untuk menghilangkan serangan dalam waktu dekat yang menargetkan penduduk sipil di Israel selatan.” Media Israel sebelumnya melaporkan bahwa serangan roket gagal, dengan proyektil tampaknya jatuh lebih pendek dan mendarat di Jalur Gaza. Pada Jumat, serangan udara Israel menghancurkan sebuah lokasi peluncuran roket di Gaza yang juga digambarkan sebagai “sebuah ancaman,” kata tentara pada saat itu.

Kabut Asap Selimuti Malaysia Akibat Kebakaran Lahan Terbuka


Badai dahsyat disertai salju dan angin dingin melanda bagian timur AS, akibatnya 2.900 penerbangan dibatalkan.

KUALA LUMPUR, Malaysia (Antara): Kabut asap menyelimuti beberapa wilayah di Malaysia akibat kebakaran lahan terbuka dan hutan di negara ini, sehingga tujuh kawasan mencatatkan Indeks Pencemaran Udara (IPU) tidak sehat. Menurut laman resmi Kantor Lingkungan Hidup (JAS) Malaysia, Selasa (4/3), kawasan yang dinyatakan tidak sehat adalah Pelabuhan Klang dengan IPU mencapai 143, Seri Manjung, Perak (110), Shah Alam (110), Banting (108), Petaling Jaya (108), Muar (105) dan Kuala Selangor (104). Di 20 kawasan lain termasuk Kuala Lumpur, IPU mencapai level sederhana antara 68-100. Dari pantauan Antara, Selasa, kabut asap tampak semakin tebal di kawasan Kuala Lumpur dan sekitarnya dan tercium bau asap yang mengganggu kenyamanan. Sedangkan sekolah-sekolah di Selangor, khususnya di sekitar Pelabuhan Klang diimbau untuk mengurangi aktivitas luar ruangan. KepalaKantorPemadamKebakarandanPenyelamatanMalaysia, DatukWan Mohd Nor Ibrahim mengatakan lebih dari 500 laporan kebakaran lahan diterima pihaknya sejak Sabtu (1/3).



WASPADA Rabu 5 Maret 2014

Adam Terdakwa Nginjak Giroud


DARI KIRI: Marco Verratti, Mattia Perin, Andrea Pirlo, Giorgio Chiellini, Davide Astori, allenatore Cesare Prandelli dan kiper Gianluigi Buffon, Senin (Selasa WIB) di Milan, memamerkan kostum Timnas Italia untuk Piala Dunia 2014 di Brazil.

Pelajaran Dari Prandelli MILAN, Italia (Waspada): Allenatore Cesare Prandelli mempertahankan keputusannya, mencoret Daniele De Rossi dari Timnas Italia untuk laga eksibisi dinihari WIB nanti menghadapi Spanyol. Prandelli berharap, gelandang AS Roma belajar mengendalikan emosi setelah tertangkap kamera meninju striker Inter Milan dalam laga Liga Seri A akhir pekan lalu

di Stadion Olimpico. “Ada aturan dan saya hakimnya. Saya tidak perlu menunggu bukti rekaman televisi. Jika saya merasa pemain bersikap buruk, maka dia tidak

Skuad Italia Vs Span yol Spany Kiper: Gianluigi Buffon (Juventus), Mattia Perin (Genoa), Salvatore Sirigu (Paris Saint Germain/Prancis) Belakang: Ignazio Abate (AC Milan), Davide Astori (Cagliari), Andrea Barzagli (Juventus), Leonardo Bonucci (Juventus), Giorgio Chiellini (Juventus), Domenico Criscito (Zenit Saint Petersburg/Rusia), Mattia De Sciglio (AC Milan), Christian Maggio (Napoli), Gabriel Paletta (Parma) Tengah: Antonio Candreva (Lazio), Emanuele Giaccherini (Sunderland/Inggris), Claudio Marchisio (Juventus), Riccardo Montolivo (AC Milan), Thiago Motta (Paris Saint Germain/Prancis), Marco Parolo (Parma), Andrea Pirlo (Juventus), Marco Verratti (Paris Saint Germain/ Prancis) Depan: Alessio Cerci (Torino), Mattia Destro (AS Roma), Alberto Gilardino (Genoa), Ciro Immobile (Torino), Lorenzo Insigne (Napoli), Pablo Daniel Osvaldo (Juventus).

akan mendapat panggilan,” papar Prandelli melalui Football Italia, Selasa (4/3). “Saya melakukannya untuk mereka. Di Piala Dunia, saya menginginkan pemain yang siap menghadapi segalanya. Saya tidak ingin tim ini bermain sepuluh orang. Saya tidak mau melihat aksi ceroboh di lapangan,” katanya lagi. De Rossi sendiri dihukum tiga pertandingan oleh Komisi Disiplin FIGC, karena terbukti bersalah meninju Icardi. Gelandang 30 tahun itu memang memiliki sejarah buruk dalam masalah disiplin dan sudah kali kedua dikeluarkan Prandelli dari skuad Azzurri. Antonio Cassano pernah punya masalah serupa di masa lalu, belakangan bomber bengal itu memperlihatkan performa positif bersama Parma. Namun Cassano tiidak diterbangkan Prandelli ke Vicente Calderon, Madrid. “Di saat seperti sekarang, saya tidak menutup kemungkinan bagi siapapun untuk

memperkuat Italia. Musim masih menyisakan dua bulan, kita lihat saja nanti,” dalih mantan pelatih Parma dan Fiorentina tersebut. Prandelli malah memanggil debutan, striker Ciro Immobile dan bek Gabriel Paletta. Kiper Genoa Matia Perrin dan striker Roma Mattia Destro kembali masuk tim untuk pertama kalinya sejak laga persahabatan 2012 melawan Inggris dan Prancis. Perrin masuk sebagai pemain nomor dua setelah kiper veteran Gianluigi Buffon, karena penampilan memprihatinkan penjaga gawang Lazio Federico Marchetti. Sedangkan Destro menggantikan peran penyerang Milan yang sedang cedera, Mario Balotelli. Masuknya kembali bek Milan Mattia De Sciglio merupakan catatan lain, setelah dia terakhir kali membela Azzurri di Piala Konfederasi 2013 di Brazil. Marco Verratti, gelandang Paris Saint Germain, masuk

skuad untuk pertama kalinya sejak dia mengikuti laga pesahabatan melawan Argentina pada Agutus 2013. (m15/ant/rtr/fi/tf)

LONDON (Antara/AFP): Gelandang Stoke Charlie Adam didakwa melakukan tindak kekerasan oleh Asosiasi Sepakbola (FA) Inggris, setelah kedapatan menginjak penyerang Arsenal Olivier Giroud. “Insiden kekerasan itu tidak terlihat oleh para ofisial pertandingan namun tertangkap video di Stadion Britannia pada Sabtu 1 Maret 2014,” bunyi pernyataan FA, seperti dikutip Selasa (4/3). Adam (foto kanan) terlihat menginjak tulang kering kiri Giroud (foto kiri), ketika bintang Prancis itu terduduk di lapangan setelah mengoperkan bola dalam duel yang akhirnya dimenangkan Stoke 1-0. Giroud kesakitan selama beberapa waktu dan terlihat mengajukan protes kepada wasit Mike Jones. Jones dan ofisial lainnya tidak melihat insiden itu, namun FA sekarang


PELATIH Joachim Loew (tengah) memberikan arahan kepada para pemain Jerman dalam sesi latihan di Stuttgart, Senin (Selasa WIB).

Der Panzer Kini Berbeda BERLIN (Waspada): Pelatih Joachim Loew mengaku khawatir penurunan performa dan kondisi fisik para pemain Jerman, sehingga rawan mengganggu penampilan mereka pada Piala Dunia 2014 di Brazil. “Di atas kertas kami merupakan tim top berisikan pemain-pemain dengan kemampuan di atas rata-rata. Namun kenyataannya kini berbeda,” ratap Loew, seperti dikutip dari Goal, Selasa (4/3). Bastian Schweinsteiger (Bayern Munich), Sami Khe-

dira (Real Madrid), Mario Gomez (Fiorentina), Ilkay Gundogan dan Mats Hummels (Borussia Dortmund). sering dihajar cedera sepanjang musim ini. Striker senior Miroslav Klose (SS Lazio), diragukan turun menghadapi Chile dalam laga eksibisi dinihari WIB nanti di Stuttgart. Sedangkan gelandang Mesut Ozil terlalu fokus di klub barunya, Arsenal. “Sebuah fakta kondisi kami tidak terlalu baik, karena banyaknya pemain yang terlalu lama berkutat dengan cedera hingga kehilangan ritme. Bisa juga dikarenakan penurunan performa atau cedera

kecil,” ucap Loew. Padahal, Der Panzer hanya kehilangan dua poin di babak kualifikasi zona Eropa hingga berstatus favorit juara di Brazil. “Dua setengah bulan ke depan sangat penting untuk meningkatkan kekuatan dan mencapai puncaknya musim panas nanti,” harap Loew. “Waktu terus berjalan, saya tidak akan lelah mengingatkan semua orang untuk mempersiapkan diri sebaik mungkin, baik itu mental maupun kebugaran. Kami butuh modal kuat, sayangnya beberapa pemain masih memperlihatkan kekurangan,” sesalnya lagi. (m15/goal/fifa)

Sinabung Cup Dimulai Hari Ini MEDAN (Waspada): Turnamen sepakbola bertajuk PSSI ‘Mediate’ Sinabung Cup 2014, mulai digelar Rabu (5/ 3) ini di Lapangan Raja GOK Purba, Kabupaten Tanah Karo. Event khusus diikuti tim warga pengungsi bencana erupsi Gunung Sinabung itu, rencananya dibuka Sekjen PSSI, Joko Driyono dan Ketua Pelaksana Hinca Panjaitan. Turnamen mempertandingkan kategori U-12 dan U-15 ini, diikuti 78 tim dan berlangsung satu bulan. Panitia Pelaksana Turnamen, Budi, Selasa (4/3), mengatakan pihaknya akan memberikan jersey klub kontestan Indonesian Super Leguae (ISL) untuk setiap tim peserta, sehingga turnamen ini layaknya miniatur ISL. “Turnamen diadakan PSSI ini, sesuai program kemanusiaan FIFA bertajuk Football For Hope. Dengan dibagikannya jersey klub ISL, diharapkan masyarakat setempat, khususnya korban erupsi Sinabung, bisa turut merasakan atmosfer ISL sebagai kompetisi kasta tertinggi sepakbola tanah air,” beber Budi. PSSI menggandeng PS Kwarta Deliserdang, guna menyukseskan kegiatan ini. CEO PS Kwarta, Arif Fadillah, mengatakan selain meng-

hibur korban Sinabung, PSSI juga dapat melihat sejumlah pemain muda potensial asal Tanah Karo. “Ada banyak kegiatan dalam rangkaian turnamen kali ini. Minggu kemarin, sudah kita gelar coaching clinic bagi anak-anak pengungsi. Nantinya, setelah acara pembukaan juga digelar laga eksibisi antara tim gabungan pengurus PSSI

dan legenda sepakbola Sumut versus tim pengungi erupsi Gunung Sinabung,” jelasnya. Ditambahkan, dokumentasi jalannya pertandingan, nantinya diserahkan kepada FIFA melalui PSSI. “Para pengungsi pun bisa melihat mereka bertanding lewat rekaman video yang akan diputar dan ditonton beramai-ramai,” tutur Arif. (cat)

17:40 21:00 21:00 00:00 00:00 00:00 00:30 00:30 00:30 01:00 01:00 01:30 01:45 01:45 02:00 batal 02:30 02:30 02:45 02:45 02:45 03:00 03:00 03:00 03:45 04:00

telah mengambil tindakan terhadap gelandang Skotlandia berusia 28 tahun tersebut. “Di bawah proyek percontohan baru di Liga Utama Inggris musim ini, jika insiden tidak terlihat oleh para ofisial pertandingan, panel tiga orang berisi mantan wasit elit akan diminta oleh FA untuk meninjau dan memberi masukan ter-

hadap,” jelas FA Adam memiliki waktu untuk merespon dakwaan itu. “Klub telah mempelajari bahwa FA memilih untuk mendakwa Charlie Adam. Charlie dan klub terkejut serta kecewa, sehingga akan mengajukan banding terhadap keputusan tersebut,” bunyi pernyataan Stoke.

Costa Percaya Del Bosque

Eksibisi Malam Ini (WIB) Jepang v Selandia Baru Rusia v Armenia Iran v Guinea Aljazair v Slovenia Montenegro v Ghana Afrika Selatan v Brazil Yunani v Korea Selatan Rep Ceko v Norwegia Bosnia v Mesir Kolombia v Tunisia Siprus v Irlandia Utara Turki v Swedia Rep Irlandia v Serbia Wales v Eslandia Romania v Argentina Ukraina v AS Austria v Uruguay Swiss v Kroasia Belgia v Pantai Gading Jerman v Chile Polandia v Skotlandia Inggris v Denmark Australia v Ekuador Prancis v Belanda Portugal v Kamerun Spanyol v Italia

Getty Images


ENTRENADOR Vicente del Bosque memantau Diego Costa (tengah) dan Andres Iniesta, Senin (Selasa WIB), saat sesi latihan Timnas Spanyol di Madrid.

MADRID (Waspada): Diego Costa memilih Timnas Spanyol, karena sangat percaya dengan kejujuran dan kinerja entrenador Vicente Del Bosque. “Vicente Del Bosque menunjukkan kepercayaan terhadap saya. Saya senang bicara langsung dengan orang lain, saya merasakan kejujuran dalam diri Del Bosque,” ungkap Costa dalam AS, Selasa (4/3). “Dia tidak menjanjikan saya apapun. Saya tidak suka saat orang-orang menjanjikan saya sesuatu. Saya lebih suka menghasilkannya, itu baru berharga,” tambah bomber Atletico Madrid berdarah Brazil tersebut. Costa masuk skuad El Matador untuk menghadapi Italia dinihari WIB nanti di Vicente Calderon, Madrid. Mantan penyerang Real Valladolid ini diyakini akan menjadi starter La Furia Roja, kendati pernah memperkuat Brazil di dua laga eksibisi melawan Italia dan Rusia pada Maret 2013. “Saat saya sadar Spanyol tertarik dengan saya, saya pikir ‘kenapa tidak?’. Sebuah kehormatan tim juara dunia ingin Anda bermain untuk mereka, terutama melihat kualitas pemain yang dimiliki Spanyol saat ini. Saya merasa penting, saya sangat dihargai,” tegas Costa. Dia pun sudah latihan bersama Andres Iniesta cs untuk pertama kalinya sebagai pesiapan melawan Gil Azzurri. Bomber berumur 25 tahun itu mendapat sambutan meriah dari penonton yang menyaksikan latihan skuad Del Bosque pada malam dingin di Rozas, dekat Madrid. Costa telah mencetak 21 gol untuk Atletico di La Liga musim ini, urutan kedua setelah superstar Real Madrid Cristiano Ronaldo dengan 23 gol. “Saya kira dia merupakan pilihan hebat untuk masuk dalam tim,” puji Sergio Ramos, bek Spanyol dan Madrid. Ramos sekaligus menampik anggapan bahwa hubungannya tidak cocok dengan Costa, yang beberapa kali dia ‘kerjai’ dalam derbi Madrid yang berakhir 2-2 akhir pecan lalu di Vicente Calderon. “Tidak ada masalah, itu merupakan bagian dari permainan olahraga. Sepakbola permainan tim dan kami merupakan teman di tim nasional,” pungkas Ramos. (m15/ant/rtr/as)

Optimis Inggris Redam Dinamit LONDON ( Waspada): Kapten Steven Gerrard optimis, Inggris mampu meredam dan menjinakkan Denmark dalam laga eksibisi dinihari WIB nanti di Stadion Wembley, London.

Cech Belum Tergelincir PRAHA (Antara/ AFP): Kiper Chelsea Petr Cech, Senin (Selasa WIB), kembali dinobatkan sebagai Pesepakbola Terbaik Republik Ceko untuk ketujuh kalinya. Suami Martini Cechova (foto), yang telah 106 kali memperkuat Timnas Ceko sejak debutnya pada 2002 itu, mengalahkan Tomas Rosicky yang bermain di Arsenal dan Vladimir Darida (SC AP Freiburg). Cech belum mau tergelincir, sehingga terus berusaha maksimal ketika membela Chelsea dan Ceko. “Setiap tahun saya melakukan semua yang saya bisa untuk menjadi yang terbaik,” ungkapnya kepada AFP, Selasa (4/3). “Ini penghargaan yang membuat standar siapa pun yang menerimanya tak boleh tergelincir,” pungkas Cech, bintang The Blues ketika menjuarai Liga Europa 2013 dan Liga Champions 2012.

“Penting bagi kami untuk berusaha kembali ke jalur kemenangan. Saya yakin manajer akan menggunakan duel ini untuk bereksperimen, tapi kami juga membawa tim ke dalam pola pikir yang bagus jelang Piala Dunia,” beber Gerrard. Pada dua laga eksibisi terakhir, November silam, The Three Lions memang kalah dari Jerman. “Sudah begitu lama sejak kami bermain di Wembley,” ujar Gerrard melalui Sports Mole, Selasa (4/3). Setelah menjamu Tim Dinamit, St George Cross asuhan manajer Roy Hodgson akan melakoni tiga pertandingan eksibisi lagi sebelum terbang ke Brazil 2014. “Bagus bisa kembali bertanding dan main bersamasama lagi. Harapannya, kami bisa meraih hasil positif agar fans merasa senang,” tambah gelandang Liverpool, yang telah 108 kali membela Inggris tersebut. Dalam duel nanti, Gerrard terpaksa saling sikut dengan rekan setimnya di Liverpool, Daniel Agger, yang menjadi bek sentral Denmark. “Saya rasa sebagai pesepakbola Anda harus fokus pada pertandingan berikutnya,


KAPTEN Steven Gerrard (kiri) diskusi dengan manajer Roy Hodgson pada sesi latihan Timnas Inggris di lapangan Tottenham Hotspur, Enfield, Selasa (4/3) dinihari WIB. yakni melawan Inggris. Setelah laga selesai, saya akan kembali ke Liverpool,” tutur Agger. Dia juga mendukung juniornya di Anfield, winger Raheem Sterling, masuk skuad Tiga Singa untuk Piala Dunia 2014. “Dia bisa menghadapi tekanan. Ini kesempatan bagus buat dia,” ucapnya lewat PA. “Kalau dia terus melakukan seperti sekarang, saya tidak melihat alasan kenapa dia tidak masuk (Piala Dunia). Dia pemain bagus, punya talenta hebat, dan memiliki sejumlah

kualitas yang bisa dimanfaatkan Inggris,” kampanye Agger. Sterling baru sekali masuk Timnas Senior, namun telah mencetak tujuh gol dari 27 kali membela Si Merah di Liga Premier. “Saya pikir satu tahun lebih setelah caps pertamanya, Inggris akan melihat pemain dengan tingkat kedewasaan tinggi. Juga pemain muda yang terbiasa tampil di partai besar,” timpal Brendan Rodgers, manajer Liverpool. (m15/goal/sm/pa)


WASPADA Rabu 5 Maret 2014


Lahirkan Petinju Andal Impian Joniful RAMAH dan suka bercanda. Itulah sosok Joniful Bahri (foto), pelatih tinju Kabupaten Bireuen. Selama terjun di olahraga adu jotos, Joniful telah menorehkan sejumlah prestasi membanggakan bagi Bireuen, baik saat masih menjadi atlet maupun ketika melatih. “Alhamdulillah, banyak juga medali yang sudah saya persembahkan bagi daerah dalam mengikuti sejumlah kejuaraan, baik saat menjadi petinju maupun setelah melatih,” ujar Joniful Bahri kepada Waspada, Selasa (4/3). Begitu pun, banyak orang tidak tahu kalau pria kelahiran Bireuen, 6 Juni 1974 ini, merupakan mantan atlet tinju dan pelatih. Kesehariannya sebagai Sekretaris Desa Blang Cot Baroh dan mahasiwa STIE Kebangsaan Bireuen, Juniful justru dikenal sebagai seorang jurnalis sejumlah media yang masih aktif hingga kini. Putra pasangan Abd Rahman Sabi dan Rohani, warga Blang Cot Baroh, Jeumpa, Bireuen ini, mengaku pertama kali mengikuti turnamen tinju Piala Gubernur tahun 1990. Sedangkan karier kepelatihannya dimulai sejak menjelang Porda VIII/2002 di Pidie. Semasa menjadi atlet, pengurus KONI Bireuen ini pernah mengikuti Piala Gubernur 1990 (junior), Piala Danrem Cup II di Lhokseumawe (1991), Porda di Banda Aceh (1992), Piala Gubernur Aceh (1992), Kejurnas di Jawa Barat (1993), Kejurda

se-Sumatera di Medan (1994), Kejurda Piala Sub Denpom di Pidie (1995), Porda di Aceh Barat (1996), dan Pra PON (1999). Sedangkan karier pelatih, menangani atlet Bireuen pada Porda VIII/2002 di Pidie, melatih atlet Bireuen di Piala Gubernur 2003 dan 2004, serta menjadi asisten pelatih atlet tinju Aceh dalam mengikuti Sarung Tinju Emas (STE) XX1V di Medan (2004). “Saya juga pernah ikut Waspada/Abdul Mukthi Hasan pelatihan pelatih tinju nasional di Medan (2004), melatih petinju Kadet Junior Bireuen ke Kejurnas di Jakarta (2004) dan pernah mempersiapkan petinju Bireuen mengikuti Porda X di Takengon (2006),” bebernya. Terakhir, Joniful mengaku akan terus menggeluti dunia tinju dan mengabdikan diri bagi kejayaan olahraga tinju Bireuen. “Tekad dan mimpi saya adalah bersama rekan-rekan sesama pelatih, melahirkan petinju-petinju andal di Bireuen,” pungkasnya. *Abdul Mukthi Hasan

TIM putra dan putri SMA Methodist Binjai siap bersaing dalam ajang Honda DBL 2014 North Sumatera Series di GOR Samudera Medan, 8-15 Maret. -Waspada/Dedi Riono-

Persiraja Genjot Persiapan BANDA ACEH (Waspada): Persiraja Banda Aceh terus menggenjot persiapan tim, khususnya dalam menghadapi pertandingan segi empat sebagai turnamen pra musim di Aceh Timur pada akhir pekan ini. CEO Persiraja, Said Mursal, Selasa (4/3), menyebutkan timnya akan menjadikan turnamen segi empat itu sebagai ajang ujicoba pemain, sekaligus pemanasan jelang menghadapi kompetisi Divisi Utama Liga Indonesia musim ini. Karena itu, Said Mursal tidak berharap muluk-muluk mengenai hasil yang akan di-

capai dalam turnamen tersebut. “Pemain kami rata-rata masih muda hasil seleksi. Persiapan tim juga hanya beberapa hari, sehingga sangat tidak realistis berharap juara,” ujarnya. Ditemui terpisah, pelatih Persiraja Wahyu AW dan Akhyar Ilyas, mengatakan dalam seleksi yang berlangsung pe-

kan lalu, pihaknya sudah menjaring 12 pemain dari total 37 peserta mengikuti seleksi tim Laskar Rencong tersebut. “Tim pelatih dan manajemen sudah memilih 12 pemain yang punya kelebihan dari pemain lain. Kami berharap mereka mampu menjawab kepercayaan yang telah kami berikan dalam seleksi berikutnya,” ujar Wahyu AW. Kata dia, ke-12 pemain dimaksud akan bergabung dengan pemain musim lalu, guna mengikuti seleksi lanjutan. “Pemain musim lalu belum ada jaminan kembali terpilih.

Semua akan diseleksi lagi dan harus bersaing satu sama lain,” ungkapnya. Karena itu, turnamen segi empat yang bakal berlangsung mulai Sabtu (8/3) di Stadion Moen 9, Idi Rayek, Aceh Timur,

menjadi ajang seleksi bagi calon pilar Laskar Rencong. Empat tim yang akan bersaing dalam turnamen itu adalah Persidi Idi, Persiraja Banda Aceh, PSAP Sigli, dan PSMS Medan. (b07)

AHS 5 Community Mantapkan Persiapan Futsal Piala Ahmad Husin Siregar MEDAN (Waspada): AHS 5 Community terus memantapkan persiapan turnamen futsal Piala Ir H Ahmad Husin Siregar MM yang merupakan Caleg DPR RI dari Partai Golkar di Lapangan Galaxy, Jl Air Bersih Ujung Medan, mulai Sabtu (8/3). Ketua AHS 5 Community, Mhd Teguh Syuhada Lubis, Selasa (4/3), mengatakan selain memperebutkan piala tetap, turnamen ini juga menyediakan dana pembinaan total Rp10 juta. Teguh menambahkan, komunitas AHS 5 (Gerakan Pemuda Pendukung Ahmad Husin Siregar) ini didirikan karena melihat Ahmad Husin sebagai sosok pemuda yang penuh spirit dan semangat, baik dalam bentuk pergerakan serta perhatian terhadap perkembangan pemuda. “Karena pemuda sangat identik dengan kegiatan bersifat olahraga dan seni, AHS 5 Communty menilai cabang olahraga futsal merupakan wadah paling tepat untuk merangkul kalangan pemuda dalam menyalurkan hobi bersifat positif,” tambah Teguh. Dikatakan, kegiatan ini disambut baik Ir H Ahmad Husin Siregar MM yang sekaligus sebagai Dewan Pembina AHS 5 Community. “Dengan harapan kegiatan ini dapat menjadi agenda rutin AHS 5 Community,” katanya. Ahmad Husin Siregar sendiri berharap turnamen ini dapat lebih menggairahkan olahraga futsal. Sebagai putra daerah yang lahir di Medan pada 9 April 1970, Husin mengakui bahwa perkembangan olahraga futsal sekarang ini sangat pesat di Sumatera Utara. (m18)

Penuh Warna Di Methodist Binjai MEDAN (Waspada): Tim Roadshow Honda DBL 2014 North Sumatera Series, akhirnya sampai di Kota Binjai, Senin (3/3). Bertempat di GOR Panca Bhakti, perkenalan kompetisi bola basket pelajar terbesar di Indonesia itu, berlangsung meriah. Suasana semakin meriah dengan persiapan maksimal pihak sekolah dalam menyambut kedatangan tim Roadshow Honda DBL, terutama hadirnya ratusan pelajar yang menyambut kegiatan ini dengan mengenakan kostum warna-warni. Penuh warna kostum merupakan kombinasi dari berbagai organisasi pelajar SMA Methodist Binjai. Semuanya sengaja dihadirkan untuk menyemarakkan acara, sehingga kegiatan roadshow di sekolah ini menjadi lebih istimewa dari sekolah-sekolah sebelumnya. “Terima kasih kepada tim Roadshow Honda DBL 2014 yang hadir di sekolah kami. Suatu kebanggaan bagi kami,

JAKARTA (Antara): Pengurus Pusat Persatuan Soft Tennis Indonesia (PP Pesti) berupaya membangkitkan cabang olahraga soft tennis untuk turut mengharumkan nama Indonesia di kancah internasional. “Pesti pernah mengalami kevakuman sejak 1998 hingga bernaung di bawah Persatuan Tenis Indonesia (Pelti). Dalam kondisi vakum organisasi, kiprah atlet soft tennis tetap mampu membanggakan Merah putih,” ujar Ketua Umum PP Pesti Martuama Saragi di Jakarta, Selasa (4/3). Martuama mengatakan salah satu prestasi cabang

KONI Aceh Tamiang Dikukuhkan

Waspada/Dedi Riono

KADISDIK Medan, Drs Marasutan Siregar MPd didampingi Ir Fadiya Harry Satwiko, melepas balon ke udara sebagai tanda dimulainya turnamen futsal Multi Karya Cup III/2014, Selasa (4/3).

Disdik Apresiasi Multi Karya Cup MEDAN (Waspada): Dinas Pendidikan (Disdik) Kota Medan mengapresiasi Yayasan Multi Karya Medan, karena rutin menggelar turnamen futsal khusus untuk pelajar Sekolah Lanjutan Tingkat Pertama (SLTP) di Medan setiap tahunnya. “Turnamen ini sangat positif dalam mendukung bakat olahraga siswa, khususnya futsal. Olahraga sangat sejalan dengan tujuan dunia pendidikan, yakni menciptakan siswa yang sehat, cerdas, dan berprestasi,” ujar Kadis Pendidikan Medan, Drs Marasutan Siregar MPd, saat membuka resmi turnamen Multi Karta Cup III/2014, di Lapanga The Kop Medan, Selasa (4/3). Dikatakan, pendidikan di-

dukung dengan olahraga, dapat melahirkan generasi cerdas dan sehat. Marasutan pun berharap dari turnamen ini muncul bibit-bibit pemain andal yang ke depan mampu mempersembahkan prestasi bagi daerah. “Saya minta panitia mencatat nama-nama pemain potensial dari turnamen ini dan diserahkan ke Disdik Medan. Mereka nantinya bisa dibina lebih lanjut dan dipersiapkan menghadapi event-event tingkat provinsi maupun nasional,” pungkas Marasutan. Ketua Yayasan Multi Karya Medan, Ir Fadiya Harry Satwiko, mengatakan turnamen yang sudah memasuki tahun ketiga ini, diharapkan menjadi ajang meningkatkan pembi-

Problem Catur

naan dan prestasi tim-tim futsal pelajar di Medan. “Perkembangan olahraga futsal di Medan begitu pesat, ditandai dengan menjamurnya lapangan. Hal ini harus didukung dengan adanya turnamen yang rutin, sebagai wadah mengukir dan meningkatkan prestasi,” ucap Satwiko didampingi Pembina Yayasan H Marsimin. Ketua Panitia, Drs Irwan Herianto Siregar, melaporkan 74 tim yang bersaing berasal dari 42 sekolah. Turnamen ini digelar SMK Multi Karya dan SMK Plus Muti Karya di Lapangan The Kop, Jl Krakatau dan Lapangan De Futsal, Jl STM Medan hingga 8 Maret. (m42)


Putih melangkah, dalam posisi sekak, mematikan lawannya dua langkah.

Jawaban di halaman A2.







“Sedangkan untuk menghadapi Pora 2014 di Aceh Timur, dari 26 cabang olahraga, Aceh Tamiang akan mengikuti 18 cabor dan diharapkan semua cabang mempersiapkan atlet-atlet terbaik,” pinta Hamdan. Ketua KONI Aceh, Zainuddin Hamid, mengaku KONI perlu dukungan semua pihak, terutama pemerintah. Tanpa adanya dukungan pemerintah dan masyarakat, akan sulit melahirkan atlet-atlet andal dan berprestasi. “Pengurus KONI Aceh Tamiang yang baru saja dilantik,










harus segera melakukan konsolidasi dengan pengurus cabang olahraga. Hal ini penting, mengingat KONI berperan sebagai koordinator bagi pengurus cabang-cabang olahraga,” katanya. Susunan pengurus KONI Aceh Tamiang periode 20132-14: Ketua Umum H Hamdan Sati ST, Ketua Harian Drs H Armand Muis SH MM, Wakil Ketua Elpian Raden, Muhammad Hanafiah, dan Idris Pardan, Sekretaris Umum/Wakil Sekretaris Juliansyah SPdI MPd dan Awalussyahri SP, Bendahara Charanjit Singh. (b23)

olahraga soft tennis Indonesia yaitu menyapu bersih tujuh medali emas dalam pesta olahraga Asia Tenggara (SEA Games) 2011 di Palembang. Pesti, kata Martuama, akan menyempurnakan organisasinya hingga 2017 dengan melakukan sosialisasi ke daerahdaerah di Indonesia tentang olahraga yang mirip dengan tenis lapangan ini. “Soft tennis ini olahraga yang menjanjikan prestasi. Kami memang perlu sosialisasi. Karena banyak daerah yang belum mengenal soft tennis. Bahkan bolanya sendiri belum dijual di sana. Kami akan melakukan demo ke daerah-daerah,” ujar Martuama. Menurut Martuama, Pesti saat ini memiliki 10 pengurus provinsi dan akan menambahnya menjadi 14 untuk memenuhi persyaratan agar dapat aktif kembali sebagai anggota Komite Olahraga Nasional Indonesia (KONI).

Adapun 10 Pengprov Pesti yang sudah ada terdapat di Sulawesi Selatan, Sumatera Barat, Sumatera Selatan, Jawa Tengah, Jawa Barat, Jawa Timur, Riau, DKI Jakarta, Bali dan Yogyakarta. Empat pengprov yang akan ditambah, yaitu di Sumatera Utara, Kalimantan Barat, Sulawesi Utara dan Gorontalo. Martuama mengatakan soft tennis lahir dan berkembang di Jepang dan resmi dipertandingkan dalam Asian Games 1994 di Hiroshima, setelah menjadi cabang eksibisi Asian Games di Beijing, China. Ditambahkan, Indonesia pernah ikut serta pada Asian Games 1994 dan Asian Games 1998 di Bangkok, Thailand. “Kebangkitan kembali PP Pesti sebagai induk organisasi mandiri, semoga menjadi tambahan semangat baru tim soft tennis Indonesia hingga mampu mengukir prestasi lagi,” kata Martuama.

Aceh Tengah Jaring Pebasket Popda TAKENGEN (Waspada): Jelang digelarnya Pekan Olahraga Pelajar Daerah (Popda) XII/2014 di Lhokseumwe pada Juni mendatang, puluhan atlet bola basket dari tiga sekolah di Aceh Tengah, mengikuti seleksi yang digelar Dispora dan Pengcab Perbasi setempat. “Seleksi kali ini berlangsung tiga hari, 3-5 Maret di Lapangan Musara Alun, Kota Ta-


kengen. Para peserta berasal dari tiga sekolah, yakni SMAN 1, SMAN 8, dan SMAN 4 Takengen,” ujar Ketua Harian Perbasi Aceh Tengah, Illiyandi, Selasa (4/3). Dijelaskan, seleksi tahap pertama dijaring 15 atlet, tahap kedua diciutkan menjadi 12 pemain, dan tahap ketiga ditetapkan 10 pemain sebagai tim inti. Selanjutnya, 10 pemain ter-

baik itu akan disiapkan tampil dalam Popda lewat pemusatan latihan selama dua bulan. “Sebagian atlet yang mengikuti seleksi ini penah tampil di sejumlah event tingkat Provinsi Aceh. Meski demikian, untuk mengikuti Popda seluruhnya harus melewati persaingan ketat, sehingga atlet terpilih benar-benar terbaik,” pungkasnya. (cb09)


jantung. 3. Mati rasa pada tubuh karena suntikan obat bius. 4. Keluarga Berencana. 5. Dragon; Buah kaya vitamin C. 6. Haid. 7. Penyakit dengan gejala berak-berak. 8. Cairan antiseptik untuk mengobati luka. 11. Nasi direbus hingga lunak. 14. Ketombe; Penyakit pada kulit kepala menyebabkan bersisik halus dan gatal. 15. Sarjana Kesehatan Masyarakat. 16. Sakit perut seperti diremasremas. 17. Menahan napas dengan tenaga; Batuk—, artinya batuk keras. 18. Dokter. 21. Keadaan tertutupnya lubang karena pembawaan sejak lahir. 23. Bentuk terikat melawan, memusuhi: ——————biotik. 24. Menderita sakit saraf dengan suka meniru-niru ucapan orang lain, hanya terdapat di Asia Tenggara. 27. Sistem Kesehatan Nasional. 28. Disebut buah surga, dapat menyembuhkan berbagai penyakit. 29. Klinik Patologi Anatomi. 30. Singkatan Laser Skin Tightening (mengencangkan kulit dengan laser). 31. Spesialis.

2. Penyakit kulit (pada anak-anak) karena peluh. 4. Alat kontrasepsi. 8. Singkatan Bau Badan. 9. Obat kumur antiseptik untuk membunuh kuman penyebab bau mulut. 10. Penyakit yang dicegah dengan vaksinasi ATS. 12. Perekat untuk menutup luka. 13. Penyakit yang berjangkit di suatu daerah; Hawar. 14. Konsil Kedokteran Indonesia. 15. Spesialis Urologi. 16. Rasa nyeri kepala pada satu sisi saja. 18. Panggilan akrab dokter. 19. Berasa lemah. 20. Kuping (Inggris). 22. Myslodysplastic Syndromes. 24. Merek obat batuk sirup. 25. Spesialis Anestesi. 26. Rumah Sakit Islam. 28. Buah zakar. 31. Spesialis Anak. 32. Bermalam; Bukan rawat jalan tapi rawat——. 33. Merek obat luka pakai plester.



harus tanpil enjoy, sehingga tidak merasa terbebani di lapangan,” kata Handy. Jacklyn dan Yovie yang akan menyandang status kapten tim putra dan putrid SMA Methodist Binjai, optimis timnya mampu bersaing di Honda DBL 2014. Keduanya pun berharap bisa tampil maksimal dan mempersembahkan prestasi terbaik bagi sekolah. Seperti diketahui, tim bola basket putra SMA Methodist Binjai sukses menjuarai ajang Honda DBL pertama kali digelar di Medan tahun 2010. Ketika itu, tim ini dimotori Youngky Leonardo yang berhasil lolos ke Amerika Serikat bersama Honda DBL. (m42)

Pesti Berupaya Bangkitkan Soft Tennis

Majukan Olahraga Tanggungjawab Bersama KUALASIMPANG (Waspada): Pengurus KONI Kabupaten Aceh Tamiang masa bakti 2013-2017, telah resmi dikukuhkan oleh Ketua Umum KONI Aceh, H Zainuddin Hamid, di Aula Setdakab Aceh Tamiang, Jumat (28/2) lalu. Ketua KONI Aceh Tamiang, H Hamdan Sati, mengatakan memajukan olahraga merupakan tanggungjawab bersama, yakni antara pemerintah dan seluruh elemen masyarakat. Untuk itu, pihaknya berharap dukungan semua pihak memajukan olahraga di Aceh Tamiang.

kembali berpartisipasi dalam Honda DBL 2014. Kami berharap tim sekolah ini mengukir prestasi,” ujar Wakil Kepala SMA Methodist Binjai, Romauli Siringo. Hal senada dikatakan pelatih tim basket putra dan putri Methodit Binjai, Handy. Dia berharap Methodist Binjai sebagai salah satu tim yang selalu diperhitungkan lawan, tampil maksimal memberikan permainan terbaik untuk mengharumkan nama sekolah. “Persiapan tim sudah cukup maksimal dan target kami minimal menembus partai semifinal. Begitu pun, saya nantinya tidak ingin memaksakan permain anak-anak, mereka

1. Tumor pada selaput lendir hidung. 2. Frambos; Jenis buah seri berwarna merah, bermanfaat untuk membakar lemak dan mengurangi risiko serangan

Sudoku Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari 10 menit. Jawabannya di halaman A2 kolom 1.

6 1

5 9

9 4 6 5 8 6 9 4 3 7 5 6 3 8 7 8 9 5 7 9 6 5 3 7 9 2 1 6 7 4 ***434


WASPADA Rabu 5 Maret 2014


Ukraina Jadi Ladeni AS KIEV (Waspada): Ukraina memastikan tim nasionalnya akan berangkat untuk memainkan laga eksibisi melawan Amerika Serikat dinihari WIB nanti di Siprus. “Tim Ukraina akan be-rangkat untuk pertandingan itu. Tidak ada pertanyaan lagi,” tegas Menteri Politik Pemuda dan Olahraga (Menpora) Ukraina Dmitri Bulatov melalui halaman Facebook, Selasa (4/3). Lawatan itu sempat dibatalkan, menyusul intervensi militer Rusia ke Crimea, daerah otonom Ukraina. “Saya mendoakan tim kami bermain baik, meraih kemenangan, dan para pemain berada dalam semangat bagus,” tambah Bulatov. Petugas pers Olexandr Hlyvynskiy melalui telepon mengatakan kepada Reuters, timnas sedang dalam perjala-

nan menuju Bandara Boryspil di Kiev. Ukraina jadi meladeni Paman Sam, yang sedang dalam persiapan menuju putaran final Piala Dunia 2014. Padahal sebelumnya, Presiden Federasi Sepakbola Ukraina, Anatoliy Konkov, menegaskan timnas tidak akan berangkat ke Siprus untuk melakoni laga, yang awalnya dijadwalkan mentas di Kharkiv. Duel itu harus dipindahkan karena situasi politik yang tidak stabil di negara pecahan Uni Soviet tersebut. “Kami tidak dapat mengadakan kejuaraan nasional, maka tim sepakbola seperti apa yang dapat kami bicarakan. Ji-

ka kami tidak mendapat kesempatan main di kandang sendiri, mengapa kami akan ke Siprus pada masa-masa sulit ini untuk negara Anda,” kata Khonkov. “Kami bermain untuk orang-orang dan negara kami. Tim kami tidak terbang ke Siprus dan bertahan di sini,” ujarnya lagi kepada ICTV. Liga Tertunda Liga Utama Ukraina juga mengalami penundaan saat akan dimulai kembali setelah jeda tengah musim akibat krisis politik dan keamanan di dalam negeri. Namun Senin (Selasa WIB), Timnas AS mengklaim, pertandingan itu tetap akan dimainkan. “Federasi Sepakbola Ukraina mengonfirmasi bahwa tim mereka akan pergi ke Siprus dan laga akan di-


PARA pemenang invitasi tenis meja antarmedia Piala Marzuki Alie di Jakarta, diabadikan bersama usai penyerahan hadiah, Selasa (4/3).

Waspada Tiga Terbaik Tenis Meja Marzuki Alie Cup JAKARTA (Waspada): Harapan wartawan Waspada biro Jakarta, Yuslan Kisra, meraih gelar juara dalam invitasi tenis meja antarmedia memperebutkan piala Ketua Umum PB PTMSI, Marzuki Alie, belum terwujud. Yuslan hanya finish di posisi ketiga bersama Hermanus Priatna (Antara). Ambisi wartawan desk olahraga Waspada ini terhenti, setelah ditaklukkan Djony (Bisnis Indonesia) 24 dalam pertandingan di Gedung Tenis Meja Gelora Bung

Karno Jakarta, Selasa (4/3). Gelar juara diraih Dedy (Bisnis Indonesia). Di partai puncak, Dedy menaklukkan rekan se-kantornya Djony dalam lima games 11-9, 11-6, 711, 11-6, 11-9. Dedy pun berhak atas hadiah uang tunai Rp5 juta dan Djony Rp3 juta. Dody pun mendapatkan hadiah tambahan Rp2 juta rupiah, lantaran mampu mengalahkan Sekjen KONI Pusat, EF Hamidy dalam partai eksibisi. Hamidy mengatakan ajang ini sangat bagus karena

mampu menyatukan semuanya. “Ini baru pemenang beneran, buktinya dia (Dedy) mampu mengalahkan saya,” ucap Hamidy kala menutup invitasi ini. “Melalui ajang ini, semuanya sudah bersatu, wartawan bersatu, pengurus bersatu, sehingga tidak ada lagi dualisme dalam kepengurusan yang nantinya bisa berdampak buruk pada prestasi tenis meja Indonesia,” pungkas Hamidy. (yuslan)

mainkan seperti telah dijadwalkan,” klaim pihak Paman Sam melalui Twitter. Para ofisial Stadion Antonis Papadopoulos di Larnaca, Siprus, arena yang akan dipakai untuk melangsungkan pertandingan, pun menegaskan bahwa pertandingan itu tetap akan dimainkan sesuai jadwal. AS sendiri bersiap untuk menjatuhkan sanksi kepada Rusia untuk intervensi militernya di Crimea, meski sejauh ini belum ada keputusan yang diambil. Sedangkan Presiden Rusia Vladimir Putin memenangi izin dari parlemennya untuk menggunakan kekuatan militer di Ukraina. (m15/ant/rtr/ictv)

bagi daerah. “Saya minta panitia mencatat nama-nama pemain potensial dari turnamen ini dan diserahkan ke Disdik Medan. Mereka nantinya bisa dibina lebih lanjut dan dipersiapkan menghadapi event-event tingkat provinsi maupun nasional,” ujar Marasutan. Ketua Yayasan Multi Karya Medan, Ir Fadiya Harry Satwiko, mengatakan turnamen yang sudah memasuki tahun ketiga ini, diharapkan menjadi ajang meningkatkan pembinaan dan prestasi tim-tim futsal pelajar di Medan. “Perkembangan olahraga futsal di Medan begitu pesat, ditandai dengan menjamurnya lapangan. Hal ini harus didukung dengan adanya turnamen yang rutin, sebagai wadah mengukir dan meningkatkan prestasi,” ucap Satwiko, didampingi Pembina Yayasan H Marsimin. Ketua Panitia, Drs Irwan Herianto Siregar, melaporkan

-Waspada/Dedi Riono-

Percasi Medan Panggil 18 Pecatur MEDAN (Waspada): Sesuai surat Pengprov Percasi Sumut nomor 128/Percasi-SU/ II/2014 tentang persiapan Porwilsu cabang olahraga catur, Pengkot Percasi Medan mempersiapkan tim catur mengikuti Porwilsu 2014. Ketua Percasi Medan, Sonny Firdaus SH didampingi Sekretaris Ir H Syaharuddin Noor MN WNP PNP, Selasa (4/3), mengatakan pihaknya memanggil 18 pecatur untuk mengikuti seleksi atlet Pekan Olahraga Wilayah Sumatera Utara tersebut. “Seleksi digelar 10-12 Maret di Sekretariat Percasi Medan, Jl Perbaungan No 2 Medan. Atlet yang dipanggil mengikuti seleksi diharapkan menghubungi Sekretaris Percasi Medan di 0813 6162 6569, paling lambat Sabtu (8/3). Jika sampai batas waktu tersebut tidak ada konfirmasi, maka akan diganti atlet lain sesuai ranking di Porkot 2013,” jelasnya. Tim catur Medan masuk Wilayah I bersama Karo (tuan rumah), Pakpak Barat, Dairi, Langkat, Asahan, dan Tebingtinggi. Ke-18 pecatur putra yang dipanggil adalah Daniel HL

Disdik Medan Apresiasi Multi Karya Cup MEDAN (Waspada): Dinas Pendidikan (Disdik) Kota Medan mengapresiasi Yayasan Multi Karya Medan, karena rutin menggelar turnamen futsal khusus untuk pelajar Sekolah Lanjutan Tingkat Pertama (SLTP) di Medan setiap tahunnya. “Turnamen ini sangat positif dalam mendukung bakat olahraga siswa, khususnya futsal. Olahraga sangat sejalan dengan tujuan dunia pendidikan, yakni menciptakan siswa yang sehat, cerdas, dan berprestasi,” kata Kadis Pendidikan Medan, Drs Marasutan Siregar MPd, saat membuka Multi Karta Cup III/2014 di Lapangan The Kop Medan, Selasa (4/3). Dikatakan, pendidikan didukung dengan olahraga, dapat melahirkan generasi cerdas dan sehat. Marasutan pun berharap dari turnamen ini muncul bibit-bibit pemain andal yang ke depan mampu mempersembahkan prestasi

TIM putra dan putri SMA Methodist Binjai siap bersaing dalam ajang Honda DBL 2014 North Sumatera Series di GOR Samudera Medan, 8-15 Maret.

Tobing (Medan Petisah), Akun Nasution (Amplas), Ukur Sitepu (Johor), Mula Sahat Manurung (Deli), W Guntur MS Matondang (Maimun), Dahlian Nasution (Denai), Dermawan Tarigan (Tuntungan), Julifian (Helvetia), Adrian Pinem (Johor), Heriyanto (Barat), Yusnan Manan (Maimun). Selanjutnya, Irwan (Area), Sugianto Kliwon (Denai), Roy Charles Marpaung (Denai), Sukardi ( Tembung), Budi Setiawan (Marelan), Zul Irfan (Maimun), dan Erjan Akbar Nasution. Atlet putri otomatis ikut Porwilsu, yakni Ade R Nastion, Giovanni Chrestella, Catrina Dwi Haloho, Nur Nazli Anliani, dan Maria Herlina Siahaan. (m18)

Penuh Warna Di Methodist Binjai MEDAN (Waspada): Tim Roadshow Honda DBL 2014 North Sumatera Series, akhirnya sampai di Kota Binjai, Senin (3/3). Bertempat di GOR Panca Bhakti, perkenalan kompetisi bola basket pelajar terbesar di Indonesia itu, berlangsung meriah. Suasana semakin meriah dengan persiapan maksimal pihak sekolah dalam menyambut kedatangan tim Roadshow Honda DBL, terutama hadirnya ratusan pelajar yang menyambut kegiatan ini dengan mengenakan kostum warna-warni. Penuh warna kostum merupakan kombinasi dari berbagai organisasi pelajar SMA Methodist Binjai. Semuanya sengaja dihadirkan untuk menyemarakkan acara, sehingga kegiatan roadshow di sekolah ini menjadi lebih istimewa dari sekolah-sekolah sebelumnya. “Terima kasih kepada tim Roadshow Honda DBL 2014 yang hadir di sekolah kami. Suatu kebanggaan bagi kami,

Waspada/Dedi Riono

74 tim yang bersaing berasal dari 42 sekolah. Turnamen ini digelar SMK Multi Karya dan SMK Plus Muti Karya di Lapa-

ngan The Kop, Jl Krakatau dan Lapangan De Futsal, Jl STM Medan hingga 8 Maret. (m42)

harus tanpil enjoy, sehingga tidak merasa terbebani di lapangan,” kata Handy. Jacklyn dan Yovie yang akan menyandang status kapten tim putra dan putrid SMA Methodist Binjai, optimis timnya mampu bersaing di Honda DBL 2014. Keduanya pun berharap bisa tampil maksimal dan mempersembahkan prestasi terbaik bagi sekolah. Seperti diketahui, tim bola basket putra SMA Methodist Binjai sukses menjuarai ajang Honda DBL pertama kali digelar di Medan tahun 2010. Ketika itu, tim ini dimotori Youngky Leonardo yang berhasil lolos ke Amerika Serikat bersama Honda DBL. (m42)

AHS 5 Community Mantapkan Persiapan Futsal Piala Ahmad Husin Siregar MEDAN (Waspada): AHS 5 Community terus memantapkan persiapan turnamen futsal Piala Ir H Ahmad Husin Siregar MM, berlangsung di Lapangan Galaxy Jl Air Bersih Ujung Medan, mulai Sabtu (8/ 3) nanti. Ketua AHS 5 Community, M Teguh Syuhada Lubis, Selasa (4/3), mengatakan selain memperebutkan piala tetap, turnamen juga menyediakan dana pembinaan total Rp10 juta. Hingga kemarin, sudah 33 tim mendaftar dan siap bersaing.

Teguh menambahkan, komunitas AHS 5 (Gerakan Pemuda Pendukung Ahmad Husin Siregar) ini didirikan karena melihat Ahmad Husin sebagai sosok pemuda penuh spirit dan semangat, baik dalam bentuk pergerakan serta perhatian terhadap perkembangan pemuda. “Karena pemuda sangat identik dengan kegiatan bersifat olahraga dan seni, AHS 5 Communty menilai olahraga futsal merupakan wadah paling tepat merangkul kalangan

PGSI Karo Bangga Boru Sembiring

KADISDIK Medan, Drs Marasutan Siregar MPd didampingi Ir Fadiya Harry Satwiko, melepas balon ke udara sebagai tanda dimulainya turnamen futsal Multi Karya Cup III/2014, Selasa (4/3).

kembali berpartisipasi dalam Honda DBL 2014. Kami berharap tim sekolah ini mengukir prestasi,” ujar Wakil Kepala SMA Methodist Binjai, Romauli Siringo. Hal senada dikatakan pelatih tim basket putra dan putri Methodit Binjai, Handy. Dia berharap Methodist Binjai sebagai salah satu tim yang selalu diperhitungkan lawan, tampil maksimal memberikan permainan terbaik untuk mengharumkan nama sekolah. “Persiapan tim sudah cukup maksimal dan target kami minimal menembus partai semifinal. Begitu pun, saya nantinya tidak ingin memaksakan permain anak-anak, mereka

KABANJAHE (Waspada): Ketua PGSI Kabupaten Karo, Ir Taufan Agung Ginting, memberikan tali asih kepada Heka Mayasari Br Sembiring. Heka merupakan atlet asal Karo yang mempersembahkan medali perak bagi Indonesia pada SEA Games 2013 di Myanmar. “Jangan dinilai dari nominalnya, tetapi lihatlah pemberian tali asih ini sebagai bentuk kepedulian kami terhadap atlet yang telah berprestasi,” ujar Ketua Persatuan Gulat Seluruh Indonesia (PGSI) Karo itu akhir pekan lalu di Aula Halilintar Kabanjahe. Taufan Ginting yang merupakan politisi PDIP ini, mengaku bangga dengan prestasi yang diraih Heka Mayasari. “Semoga ke depan kembali lahir pegulat-pegulat andal sepert Heka di Karo,” ucapnya. Heka Mayasari merupakan alumni SMA Negeri Barusjahe dan kini kuliah di Unimed. “Terima kasih atas perhatian pengurus PGSI Karo dan apa yang telah diberikan kepada saya, telah menambah motivasi untuk terus berprestasi,” ujarnya. Begitu pun, Heka, mengaku menyayangkan sikap Pemkab Karo yang dinilainya kurang peduli dengan dunia olahraga, termasuk tidak adanya apresiasi terhadap atlet-atlet yang telah berprestasi nasional dan internasional. ( c09)

Waspada/Setia Budi Siregar

AHMAD Husin Siregar (tengah berdiri) bersama unsur panitia di Posko Jl Suluh, Kelurahan Sidorejo Medan, Selasa (4/3). pemuda dalam menyalurkan hobi bersifat positif,” tambah Teguh. Ahmad Husin berharap turnamen ini mampu menggairahkan olahraga futsal. Sebagai putra daerah yang lahir di Medan pada 9 April 1970, Ahmad Husin mengakui jika perkembangan olahraga futsal sekarang ini sangat pesat di Sumatera Utara. Selain futsal, Ahmad Husin akan menggelar jalan santai

yang mengambil start di Jl Suluh Kelurahan Sidorejo, akhir Maret mendatang. Ketua Panpel, Khairul Hadi, menjelaskan turnamen ini menggunakan sistem setengah kompetisi, laga digelar setiap Sabtu dan Minggu. Babak final dijadwalkan 2 April. Panitia masih membuka pendaftaran hingga Kamis (5/3) malam di Sekretariat AHS 5 Community, Jl Bromo No.42 Medan. (m18)

Kiki Sabet Best Of The Best Binaraga P. BRANDAN (Waspada): Binaragawan F2 Fitnes Medan, Kiki, menyabet gelar best of the best turnamen binaraga dan body contest bertajuk ‘Danyon8 Marinir Cup Tahun 2014’ akhir pekan lalu di Pelataran Parkir Gedung UDW Pertamina Pangkalanberandan. Turnamen dalam rangka menyambut HUT Yonif-8 Ma-

rinir ke-10 itu, diikuti atlet asal Sumut, Sumbar, dan Aceh. Di kelas 60 kg, Fery (Natural Gym Medan) menjadi yang terbaik, setelah mengungguli lima atlet lainnya pada partai final. Hasil lainnya, Waw dari Tama Gym juara kelas 65 kg, Hendra Hulk (Medan/70 kg), Arifin (PABBSI Medan/75 kg), dan Kiki (F2 Fitnes Medan/+75 kg).

Untuk body contest, Andi (Medan) juara kategori junior dan nomor senior dimenangkan Akram (Family Gym Medan). Selanjutnya, Kiki (F2 Fitnes Medan) meraih predikat best of the best, setelah mengungguli atlet-atlet terbaik di setiap kelasnya. Turnamen yang digelar atas kerjasama Yonif-8 Marinir Tangkahan Lagan dan


Problem Catur Putih melangkah, dalam posisi sekak, mematikan lawannya dua langkah.

Jawaban di halaman A2.







One Barble Club itu, sebelumnya dibuka resmi perwakilan Kadispora Langkat dan ditutup Sekjen PABBSI Sumut, Syarifuddin Lubis. Ketua Panitia, Kapt (Mar) Yopie Tanjung didampingi Ketua One Burble Club Irwan Tobing, mengucapkan terima kasih kepada pihak-pihak yang telah membantu kegiatan. (c01)


Waspada/Basita Bukit

KETUA PGSI Karo, Taufan Ginting dan pengurus lainnya memberi tali asih kepada atlet gulat putri Heka Mayasari Br Sembiring. MENDATAR 2. Penyakit kulit (pada anak-anak) karena peluh. 4. Alat kontrasepsi. 8. Singkatan Bau Badan. 9. Obat kumur antiseptik untuk membunuh kuman penyebab bau mulut. 10. Penyakit yang dicegah dengan vaksinasi ATS. 12. Perekat untuk menutup luka. 13. Penyakit yang berjangkit di suatu daerah; Hawar. 14. Konsil Kedokteran Indonesia. 15. Spesialis Urologi. 16. Rasa nyeri kepala pada satu sisi saja. 18. Panggilan akrab dokter. 19. Berasa lemah. 20. Kuping (Inggris). 22. Myslodysplastic Syndromes. 24. Merek obat batuk sirup. 25. Spesialis Anestesi. 26. Rumah Sakit Islam. 28. Buah zakar. 31. Spesialis Anak. 32. Bermalam; Bukan rawat jalan tapi rawat——. 33. Merek obat luka pakai plester.











1. Tumor pada selaput lendir hidung. 2. Frambos; Jenis buah seri berwarna merah, bermanfaat untuk membakar lemak dan mengurangi risiko serangan

jantung. 3. Mati rasa pada tubuh karena suntikan obat bius. 4. Keluarga Berencana. 5. Dragon; Buah kaya vitamin C. 6. Haid. 7. Penyakit dengan gejala berak-berak. 8. Cairan antiseptik untuk mengobati luka. 11. Nasi direbus hingga lunak. 14. Ketombe; Penyakit pada kulit kepala menyebabkan bersisik halus dan gatal. 15. Sarjana Kesehatan Masyarakat. 16. Sakit perut seperti diremasremas. 17. Menahan napas dengan tenaga; Batuk—, artinya batuk keras. 18. Dokter. 21. Keadaan tertutupnya lubang karena pembawaan sejak lahir. 23. Bentuk terikat melawan, memusuhi: ——————biotik. 24. Menderita sakit saraf dengan suka meniru-niru ucapan orang lain, hanya terdapat di Asia Tenggara. 27. Sistem Kesehatan Nasional. 28. Disebut buah surga, dapat menyembuhkan berbagai penyakit. 29. Klinik Patologi Anatomi. 30. Singkatan Laser Skin Tightening (mengencangkan kulit dengan laser). 31. Spesialis.

Sudoku Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari 10 menit. Jawabannya di halaman A2 kolom 1.

6 1

5 9

9 4 6 5 8 6 9 4 3 7 5 6 3 8 7 8 9 5 7 9 6 5 3 7 9 2 1 6 7 4 ***434



WASPADA Rabu 5 Maret 2014

James Ukir Rekor MIAMI, AS (Waspada): Bintang basket NBA LeBron James sukses membuat rekor baru bagi klubnya Miami Heat. King James mencetak 61 poin yang merupakan tertinggi sepanjang kariernya di NBA, di Miami, AS, Selasa (4/3) saat timnya mengalahkan Charlotte Bobcats. Penampilan James tidak terhentikan ketika menjamu Charlotte Bobcats. Heat pun berhasil mencatatkan kemenangan dengan skor 124-107. Itu merupakan kemenangan ke delapan secara beruntun sang juara bertahan NBA tersebut.

“Pria yang ada di atas memberikan kemampuan luar biasa kepada saya di olahraga basket ini. Saya hanya mencoba untuk mengambil keuntungan di setiap malam. Saya mendapatkan kepercayaan dari rekan setim dan staf pelatih untuk bermain

sebaik mungkin,” kata James, dilansir ESPN. King James, sapaannya, memecahkan rekor lama yang pernah dibuatnya saat membela Cleveland Cavaliers melawan Toronto Raptors, pada 20 Maret 2005. Ketika itu, King James membukukan 56 poin untuk Cavaliers. Bukan hanya itu, dia juga memecahkan rekor lama yang pernah dibuat oleh mantan bintang Heat, Glen Rice yang pernah menyumbangkan 56 poin saat Heat melawan Orlando Magic, pada 15 April 1995. Permainan gemilang James mendapatkan pujian dari punggawa Heat. “Kami sudah tahu dia dapat melakukannya. Bagian yang luar

Hasil lengkap Memphis New York Charlotte Chicago Utah Minnesota LA Lakers New Orleans

110 – 104 85 – 96 107 – 124 80 – 96 88 – 114 132 – 128 107 – 106 89 – 96

biasa adalah dia bermain sangat efesien.Ya tuhan, 61 poin dalam 33 kali percobaan,dia seperti legenda Wilt Chamberlain. Itu penampilanyangluarbiasa,”kata forward Heat, Shane Battier. Hasil pertandingan lainnya, Los Angeles Lakers berhasil

Washington Detroit Miami Brooklyn Milwaukee Denver Portland Sacramento mengakhiri kekalahan beruntun dengan mempermalukan Portland Trail Blazers dengan skor sengit107-106.PauGasolmenjadi top skor Lakers dengan mencetak 22 poin dan sembilan rebound di pertandingan ini. (esp/m47)

Lorenzo Masih Tercepat PHILLIP ISLAND, Australia (Waspada): Tes hari kedua pramusim MotoGP 2014 yang dihe-

lat di Sirkuit Phillip Island, Austria, rampung digelar. Setelah menjadi yang tercepat pada hari per-


AKSI Jorge Lorenzo di hari kedua sesi uji coba pramusim di sirkuit Phillip Island, Australia, Selasa (4/3).

tama, pebalapYamaha, Jorge Lorenzo, kembali melakukannya pada hari kedua. Pada tes yang digelar Selasa (4/3) tersebut, Lorenzo menjadi yang tercepat usai mencatatkan waktuterbaik1menit29,133detik. Posisi kedua ditempati pembalap andalan Honda, Dani Pedrosa dengan torehan waktu 1 menit 29,381 detik. Pembalap dari kelas terbuka, Andrea Dovizioso, yang mengendarai Ducati ada di posisi 3 dengan catatan waktu 1 menit 29,387 detik. Disusul Valentino Rossi dari Yamaha di peringkat 4, dengan torehan waktu 1 menit 29,516 detik. Rekan setim Dovizioso di

Ducati, Cal Crutchlow, yang pada hari pertama menempati peringkat 2, Cal Cruthlow, harus puas menempati urutan 5, dengancatatanwaktu1menit29,660 detik. Adapun posisi enam hingga sembilan ditempati oleh para pembalap Moto2.

Tes di Phillip Island digelar untuk mengantisipasi buruknya kualitas ban seperti yang terjadi pada MotoGP Australia musim 2013.Tesyangberlangsunghingga 5 Maret ini juga ajang persiapan terakhir bagi para pembalap tim pabrikan. (crs/m47)

Hasil lengkap tes hari II 1. Jorge Lorenzo (Yamaha) 2. Dani Pedrosa (Honda) 3. Andrea Dovizioso (Ducati) 4. Valentino Rossi (Yamaha) 5. Cal Crutchlow (Ducati) 6. Esteve Rabat (Marc VDS) 7. Mika Kallio (Marc VDS) 8. Nico Terol (Mapfre Aspar) 9. Jordi Torres (Mapfre Aspar)

1’29.133 1’29.381 1’29.387 1’29.516 1’29.660 1’32.168 1’32.698 1’33.014 1’33.160

Tak Ada Tim F1 Siap Di Balapan Pembuka SAKHIR, Bahrain (Waspada): Driver balap mobil Formula Satu (F1) Lewis Hamilton, berhasil keluar sebagai tercepat dalam tes pramusim terakhir musim dingin di Bahrain. Namun, pebalap Mercedes ini menilai masih banyak yang harus diperbaiki jelang balapan pertama di Australia pada 16 Maret mendatang. “Ini pasti menjadi musim dingin paling menantang yang saya alami. Mobil masih dalam proses perkembangan. Namun, kami telah banyak belajar selama beberapa pekan terakhir. Secara

Wladimir Tidak Fokus Berlatih LONDON (Waspada): Juara dunia tinju kelas beratWBA, IBF, WBOdanIBO,WladimirKlitschko (foto), mengaku tidak bisa fokus dengan persiapannya jelang pertarungan melawan Alex Leapai,26April2014.KondisiUkraina yang sedang diambang perang dengan Rusia, membuat petinju 37 tahun itu tidak bisa fokus melakukan persiapan. Sekitar 77 orang tewas dalam bentrokan berdarah antara ribuandemonstrankelompokoposisi dengan pasukan pemerintah Ukraina di Kiev, pertengahan Februari 2014. Para demonstran tersebut menuntut mundurnya Presiden Viktor Yanukovych. Yanukovych berhasil dilengserkan,dankiniUkrainadipimpin oleh Oleksandr Turchynov yang ditunjuksebagaipresidensementara. Namun, rakyat Ukraina justru dihadapkan dengan masalah yang jauh lebih serius setelah berhasilmenggulingkanYanukovych. Ukraina kini di ambang perang dengan Rusia. “Bagaimana saya bisa memikirkan masalah tinju ketika kompatriot saya dibunuh di jalanan Kiev? Saya sangat sedih. Saya ingin memberi penghormatan untuk mereka yang disiksa dan dipukuli, mereka yang ditahan dandibunuh.Merekatewassebagai pahlawan,” ujarWladimir seperti dilansir Daily Mail. Ukraina akan menggelar pemilihan umum pada 25 Mei 2014 untuk memilih Presiden baru. Dan kakak kandung Wladimir, Vitali,menjadisalahsatukandidat untuk menjadi Presiden Ukraina dalampemilihanumumtersebut. Wladimir yakinVitali bisa menjadi Presiden Ukraina yang baru. “Kakak saya berada di Kiev selama ini, bekerja siang dan malam dalam tiga bulan terakhir. Dia jarang tidur. Saya sudah berbicara dengan beberapa orang di negara Barat, dan mendapat sejumlah dukungan. Kami mendapatdukungandarimantanPresiden Amerika Serikat, Bill Clinton,” papar Wladimir. “George Clooney dan Arnold Schwarzenegger juga memberi dukungan.Sayainginmengucapkan terima kasih atas dukungan mereka. Tanpa dukungan Barat, negara kami mungkin sudah hancur,” sambungnya. Wladimir akan menghadapi

Leapai di Arena Koenig Pilsener, Jerman. Ini adalah usaha ke-16 Wladimir mempertahankan gelar sejak mengalahkan Chris Byrd pada 2006. (dam/m47)

keseluruhan, ini uji coba musim dingin yang bagus untuk kami,” kata Hamilton seperti dikutip Motor Sports Talk. “Ada banyak hal yang perlu dikerjakan oleh tim baik di pabrik maupun di trek,” lanjutnya. Hamilton menilai masih banyak yang harus dikerjakan oleh Mercedes. Namun, dia juga menilai tak ada yang sepenunya siap jelang balapan pertama nanti. Dengan peraturan rakit baru yang diterapkan, menjadi tugas berat bagi para desainer dan mekanik di

masa tes pramusim. “Ada banyak hal yang perlu dipelajari dengan mobil-mobil baru. Ini yang terpikirkan dan saya pikir tak ada yang sepenuhnya siap untuk tantangan musim ini,” kata Hamilton. “Namun, saya siap karena saya sudah tak sabar untuk melihat posisi kami di Melbourne,” tegasnya. Mercedes tampil dominan selama tes pada musim dingin. Namun, mereka mendapat persaingan ketat dari Williams, Force India, dan juga Ferrari. (mst/m47)


BINTANG Miami Heat LeBron James menyapa penggemarnya usai partai melawan Charlotte Bobcats di laga lanjutan NBA di Miami, AS, Selasa (4/3). James membukukan rekor 61 poin saat Heat menang 124-107.

Pasang Iklan

Telp. 4528431 HP. 081370328259 Email:


A12 MIAMI, AS (Wasp ad a): Bin tan g b asket NBA LeBron Jam es m em b u at rekor b aru b agi klu b n ya Miam i Heat. LeBron m en cetak 61 p oin seb agai rekor tertin ggi sep an jan g kariern ya d i NBA, Selasa (4/ 3), saat tim n ya m en galah kan Ch arlotte Bob cats. Pen am p ilan Jam es tid ak terh en tikan ketika m en jam u Bo b ca t s d a n He a t m e n a n g m eyakin kan 124-107. Itu m eru p akan kem en an gan ked elapan beruntun bagi sang juara b ertah an . “Saya hanya m encoba untu k m en gam b il keu n tu n gan

d i setiap m alam . Saya m en d a p a tka n kep erca ya a n d a ri rekan setim d an staf p elatih un tuk berm ain sebaik m un gkin ,” je la s Le Bro n m e la lu i ESPN . Kin g Ja m es, sa p a a n n ya , m em ecahkan rekor lam a yang dibuatn ya saat m em bela Cle-

veland Cavaliers m elawan Toron to Raptors, 20 Maret 2005. Ketika itu dia m em bukukan 56 p oin u n tu k Cavs. LeBron juga m em ecahkan rekor lam a yan g dibuat m an tan b in tan g Heat, Glen Rice, ya n g m e n yu m b a n gka n 56 p oin saat m elawan Orlan d o Magic pada 15 April 1995. Perm ain an gem ilan g Jam es p u n m e n d a p a t ka n p u jia n d a r i p u n ggawa Heat. “Kam i su dah tah u dia dap a t m e la ku ka n n ya . Ba gia n yang luar biasa adalah dia ber-


m ain sangat efesien. Ya Tuhan, 61 p oin d alam 33 kali p ercobaan ,dia sep erti legen da Wilt Cham berlain. Itu penam pilan luar biasa,” kata forward Shane Battier. Di Washin gton , un tuk Wizards m encatatkan laju kem en a n ga n te rp a n ja n g se la m a sem bilan tahun , gagal terwujud setelah m ereka kalah 104110 d ari tam u n ya Mem p h is Grizzlies. Tayshaun Prince m encetak 21 angka dan Mike Conley m en am bahi 20 an gka un tuk m em im pin Grizzlies. Sedan gkan Zach Randolph m em bukukan 16 an gka dan 10 reboun d un tu k m en gh en tikan laju en am kem en a n ga n b eru n tu n Wizard s. Dom in asi Mem p h is terb an tu karen a Wash in gton tidak diperkuat Nen e, pebasket Brazil yang m engalam i cedera lutut kiri pekan lalu. Juga sm all

WASPADA Rabu 5 Maret 2014

Hasil Selasa (4/3) Memphis v Washington NY Knicks v Detroit Charlotte v Miami Chicago v Brooklyn Utah v Milwaukee Minnesota v Denver LA Lakers v Portland New Orleans v Sacramento

110-104 85-96 107-124 80-96 88-114 132-128 107-106 89-96

forward Martell Webster, yang m en derita cedera pun ggun g. “Jika kam i m em iliki satu pem ain lagi, kam i akan m en jadi lebih baik. Kam i tidak akan m e n ya jika n d ra m a ka re n a kam i kalah, ini bukan m asalah b esar,” klaim Marcin Gortat, cen ter Wizards asal Polan dia. Grizzlies dengan dem ikian m em iliki rekor 34-25, m asih tertin ggal satu p ertan din gan d ari Dallas u n tu k p osisi kedelapan sekaligus tem pat tera kh ir zo n a p layoff Wila ya h Barat. (m 15/m 47/esp n/rtr)

Wladimir Terusik Krisis Ukraina LONDON (Waspada): Juara dunia tinju kelas berat WBA, IBF, WBO d an IBO, Wlad im ir Klitsch ko (foto), m en gaku tidak bisa fokus den gan persiap a n n ya jela n g p erta ru n ga n m elawan Alex Leapai, 26 April 2014. Kon d isi Ukrain a yan g sed a n g d ia m b a n g p era n g d en gan Ru sia, yan g m en gu sik kon sen trasi p etin ju 37 tah u n itu saat bersiap m em pertahankan sabukn ya buat ke-16 kalin ya d i Jerm an . “Bagaim an a saya b isa m em ikirkan m asalah tin ju ketika kom p atriot saya dibun uh di jalan an Kiev? Saya san gat sedih,” tu tu r Wlad im ir sep erti d ilan sir Daily Mail, Selasa (4/ 3). “Saya in gin m em b eri p en gh orm atan u n tu k m ereka yan g disiksa dan dipukuli, m ereka yang ditahan dan dibunuh. Mereka tewas seb agai p ah lawan ,” u jarn ya lagi. Sekitar 77 oran g tewas dalam ben trokan berdarah an tara ribuan dem on stran kelom pok oposisi den gan pasukan pem erin tah Ukrain a d i Kiev, p erten gah an Feb ru ari lalu . Para d em on stran m en un tut m un durn ya Presiden Viktor Yan ukovych, yan g kem u d ian b erh asil d ilen gserkan . Kini Ukraina dipim pin Oleksandr Turchynov yang ditunjuk seb agai p resid en sem en tara. Nam u n rakyat Ukrain a ju stru dihadap kan den gan m asalah lebih serius, karen a m en guatn a in terven si Ru sia. Ukrain a akan m en ggelar p em ilih an u m u m p ad a 25 Mei 2014 un tuk m em ilih presiden baru. Kakak kan dun g Wladim ir, Vitali, m en jad i salah satu kan d id at Presid en Ukrain a d alam p em ilih an u m u m terseb u t. “Kakak saya b erad a d i Kiev selam a in i, b ekerja sian g d an m alam dalam tiga bulan terakhir. Dia jaran g tidur. Saya sudah berbicara den gan beberap a oran g di n egara Barat, dan m en d ap at seju m lah d u ku n gan ,” u n gkap n ya. “Kam i m en dap at du ku n gan dari m an tan Presiden AS Bill Clin ton . George Cloon ey d an Arn old Sch warzen egger ju ga m em b eri d u ku n gan . Saya in gin m en gu cap kan terim a kasih atas du ku n gan m ereka. Tan p a du ku n gan Barat, n egara kam i m u n gkin su d ah h an cu r,” b eb er Wlad im ir, yan g akan m en gh ad ap i Leap ai d i Aren a Koen ig Pilsen er, Jerm an . (d m /m 47) AP

Lorenzo Tepis Keraguan PHILLIP ISLAND, Australia (Waspada): Tes hari kedua pram usim MotoGP 2014 di Sirkuit Ph illip Islan d, Au stria, Selasa (4/ 3), t e t a p m e n a m p ilka n Jorge Loren zo (foto) seb agai yan g tercep at. In i m e r u p a ka n s u ks e s lan jutan pebalap Yam aha itu, yang sepertinya berusaha m enepis segala keraguan m engen ai kesehatan n ya, setelah dia ju ga m e n d o m in a si te s h a ri p ertam a. Saat liburan balapan, juara du a kali MotoGP itu m elaku kan operasi berkaitan den gan ced era tu lan g selan gkan gan yan g dialam in ya saat terjatuh p a d a b a la p a n d i Assen d a n Sach sen rin g m u sim 2013.. “Saya m elakukan tiga kali operasi, saya tidak dalam kondisi terbaik. Saya tidak m em iliki waktu yan g ban yak un tuk sem buh dari tiga kali pem biusa n u m u m ,” b eb er b in ta n g Sp an yol itu kep ad a Gazzetta dello Sp ort. “Saya sedikit terlam bat dalam latihan gym dan saya jauh d ari kon d isi tah u n lalu . Saya m en galam i kesu litan u n tu k m en gen d arai m otor d an si-

Hasil Tes Hari Kedua 1. Jorge Lorenzo (Yamaha) 2. Dani Pedrosa (Honda) 3. Andrea Dovizioso (Ducati) 4. Valentino Rossi (Yamaha) 5. Cal Crutchlow (Ducati) 6. Esteve Rabat (Marc VDS) 7. Mika Kallio (Marc VDS) 8. Nico Terol (Mapfre Aspar) 9. Jordi Torres (Mapfre Aspar) m ulasi m enghancurkan saya,” u jarn ya lagi. Te t a p i d ia m e m b a n t a h sp eku lasi bakal berh en ti dari MotoGP. “Ketika Anda m engalam i stress, Anda akan berpikir untuk pension,” dalih Lorenzo. “Sebaliknya jika Anda m en ikm ati b alap an , An d a in gin teru s m elaku kan n ya. Itu tergan tun g ban yak hal, tapi saya in gin terus m em balap hin gga em pat atau lim a tahun terdep an ,” tegasn ya. Lorenzo m em buktikan tekad itu den gan m en jadi yan g tercepat hari kedua. Dia m en catat waktu terb aik 1 m en it 29,133 detik. Posisi kedu a ditem pati pebalap Honda, Dani Ped rosa , ya n g m en oreh ka n waktu 1 m en it 29,381 d etik.

Pasang Iklan HP. 081370328259

Email: w


Tak Ada Tim F1 Siap Sambut Seri Pertama SAKHIR, Bahrain (Waspad a): Driver b alap m ob il Form ula Satu (F1) Lewis Ham ilton (foto), m en jadi yan g tercep at tes pram usim terakhir m usim d in gin d i Ba h ra in . Na m u n pebalap Mercedes in i m en ilai m asih ban yak yan g h aru s diperbaiki jelang balapan pertam a di Australia, 16 Maret m end atan g. “In i p asti m en jadi m usim dingin paling m enantang yang saya alam i. Mobil m asih dalam p roses p erkem b an gan . Tap i kam i telah banyak belajar selam a beberapa pekan terakhir,” jela s Ha m ilto n lewa t Motor Sports Talk, yang dikutip Selasa (4/ 3). “Secara keselu ru h an , in i u jicob a m u sim d in gin yan g bagus untuk kam i. Ada banyak hal yang perlu dikerjakan oleh tim , baik di pabrik m aupun di trek,” lan ju tn ya. Pebalap Inggris ini m enilai, m asih ban yak yan g h aru s dikerjakan , b ah kan b elu m ad a satu tim pun yang sepenuhnya siap m enyam but balapan pertam a. Dengan peraturan baru yan g diterapkan , m en jadi tugas b erat b agi p ara d esain er dan m ekan ik di m asa tes pram u sim . “Ada banyak hal yang perlu dipelajari dengan m obil-m obil baru. In i yan g terpikirkan dan saya p ikir tak ad a yan g sep en uhn ya siap un tuk tan tan gan m u sim in i. Nam u n , saya siap karen a saya su d ah tak sab ar u n tu k m elih at p osisi kam i d i Melbourn e,” klaim Ham ilton . Mercedes tam pil dom inan selam a tes pada m usim dingin. Tetapi m ereka m en dapat persain gan ketat d ari William s, Force In d ia, d an Ferrari. (m st/m 47)

1’29.133 1’29.381 1’29.387 1’29.516 1’29.660 1’32.168 1’32.698 1’33.014 1’33.160 Pebalap kelas terbuka, Andrea Dovizioso, yang m engendarai Du cati berada di p osisi 3 dengan waktu 1 m enit 29,387 detik. Disusul Valen tin o Rossi dari Yam ah a den gan waktu 1 m en it 29,516 d etik. Rekan setim Dovizioso di Du cati, Cal Cru tch low, yan g pada hari pertam a m enem pati p erin gkat 2, tu ru n ke u ru tan 5 dengan catatan waktu 1 m en it 29,660 d etik. Posisi en am h in gga sem b ila n d item p a ti p ara p eb alap Moto2. Tes di Phillip Island digelar un tuk m en gan tisipasi burukn ya kualitas ban , seperti yan g terjadi pada MotoGP Australia m usim 2013. Tes berlan gsun g h in gga 5 Maret in i ju ga ajan g p ersiap an terakh ir b agi p ara p eb alap tim p ab rikan . (m 15/m 47/okz/ld gs)


BINTANG Heat LeBron Jam es m en yapa pen ggem arn ya u sai m elaw an Ch arlotte Bobcats pada laga lan ju tan N BA di Miam i, AS, Selasa (4/3).

Sumatera Utara

WASPADA Rabu 5 Maret 2014

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:39 12:52 12:40 12:47 12:46 12:43 12:40 12:35 12:42 12:42

‘Ashar 15:54 16:09 15:55 16:03 16:02 15:56 15:54 15:50 15:57 15:58

Magrib 18:41 18:54 18:42 18:48 18:48 18:46 18:42 18:38 18:44 18:43



Shubuh Syuruq


19:50 20:02 19:51 19:57 19:57 19:55 19:51 19:46 19:53 19:52

05:10 05:24 05:11 05:18 05:18 05:13 05:10 05:06 05:13 05:13

05:20 05:34 05:21 05:28 05:28 05:23 05:20 05:16 05:23 05:23

L.Seumawe 12:45 L. Pakam 12:38 Sei Rampah12:37 Meulaboh 12:49 P.Sidimpuan12:37 P. Siantar 12:37 Balige 12:37 R. Prapat 12:34 Sabang 12:52 Pandan 12:38

06:34 06:49 06:35 06:43 06:42 06:37 06:35 06:30 06:37 06:37

Zhuhur ‘Ashar 16:02 15:53 15:53 16:05 15:50 15:52 15:51 15:48 16:09 15:52





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq







Shubuh Syuruq

18:47 18:40 18:40 18:51 18:40 18:40 18:40 18:37 18:53 18:42

19:55 19:49 19:48 20:00 19:48 19:49 19:49 19:46 20:02 19:50

05:16 05:09 05:08 05:20 05:06 05:08 05:08 05:04 05:24 05:09

05:26 05:19 05:18 05:30 05:16 05:18 05:18 05:14 05:34 05:19

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:38 12:40 12:50 12:42 12:39 12:46 12:35 12:45 12:38 12:37

18:42 18:43 18:51 18:45 18:42 18:48 18:37 18:47 18:41 18:39

19:50 19:51 20:00 19:54 19:50 19:57 19:46 19:56 19:49 19:48

05:09 05:10 05:21 05:13 05:10 05:17 05:05 05:16 05:08 05:08

05:19 05:20 05:31 05:23 05:20 05:27 05:15 05:26 05:18 05:18

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:35 12:42 12:40 12:36 12:38 12:35 12:35 12:44 12:39 12:33 12:35

15:48 15:54 15:54 15:51 15:52 15:48 15:47 16:01 15:53 15:47 15:49

18:39 18:46 18:43 18:38 18:41 18:38 18:38 18:46 18:42 18:36 18:38

19:47 19:55 19:52 19:47 19:49 19:47 19:47 19:55 19:50 19:45 19:46

05:05 05:12 05:11 05:07 05:08 05:05 05:04 05:16 05:09 05:03 05:05

05:15 05:22 05:21 05:17 05:18 05:15 05:14 05:26 05:19 05:13 05:15

06:41 06:34 06:33 06:45 06:31 06:33 06:32 06:29 06:49 06:33

15:52 15:54 16:06 15:56 15:55 16:02 15:49 16:00 15:52 16:52

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:33 06:35 06:46 06:37 06:35 06:42 06:30 06:40 06:33 06:32

06:29 06:36 06:35 06:31 06:33 06:29 06:29 06:40 06:33 06:28 06:30

Di Tengah Krisis Listrik

Ketua Komisi VII DPR RI Beri Kelonggaran PLTU PANGKALANSUSU ( Waspada): Di tengah terjadinya krisis energi listrik yang sudah akut dan melanda Sumatera Utara, Ketua Komisi VII DPR RI Sutan Bhatoegana Siregar memberi kelonggaran kepada proyek PLTU 2 x 200 MW Tanjungpasir, Kec. Pangkalansusu, Kab. Langkat. “Kita datang mensupport sekaligus memberi kelonggaran kepadaPLNuntukmenyelesaikan proyek ini. Kalau pembangunan PLTU selesai, maka kebutuhan energi listrik sebesar 400 MW untuk Sumut dapat diatasi,” ujarnyakepadawartawanpadakunjungan kerja ke PLTU, Selasa (4/3). Ia beralasan, yang menjadi kendala saat ini ada satu tiang to-

wer jaringan transmisi yang belum dibangun karena masih ada persoalan sosial dengan masyarakat.“Masalahinidiharapkandapatsegerateratasisehingga pembangunan sambungan transmisi dapat segera diselesaikan,” ujarnya. Ketika ditanya Waspada terkait jadwal penyelesaian megaproyek berbiaya triliunan

Banyak Permasalahan Masyarakat Belum Mendapat Perhatian DELISERDANG (Waspada): Banyak permasalahan yang terdapat di tengah-tengah masyarakat memerlukan perhatian. Ini terungkap saat reses anggota DPRD Provinsi Sumut dari fraksi Partai Golkar, Hj. Syafrida Fitrie, SP, MSP, ketika berdialog dengan warga Desa Denai Kuala, Pantai Labu, Deliserdang, pekan lalu. Berbagai aspirasi warga, seperti perbaikan jalan di Dusun 2 Desa Denai Kuala, terlebih untuk akses menuju objek wisata Pantai Putra Deli telah dikemukakan. Selain itu, di lokasi objek wisata belum ada sarana air bersih dan musholla. Menanggapi aspirasi warga ini, Syafrida Fitrie, mengajak seluruh warga untuk lebih kritis terhadap lingkungan, terlebih memperhatikan faktor-faktor pendukung perekonomian masyarakat. Seperti halnya objek wisata, kata Fitrie, merupakan sumber daya alam potensial yang dapat memberikan lapangan pekerjaan terhadap masyarakat setempat, diperoleh dari jumlah pengunjung. Kehadiran pengunjung akan memotivasi masyarakat untuk berkarya, seperti menjajakan hasil asli masyarakat Pantai Labu, dan menjadi daya tarik tersendiri bagi pengunjung dari luar Pantai Labu. “Ini menjadi perhatian kami,” kata Fitrie, meminta kepada masyarakat agar terus berkoordinasi dengan fraksi Golkar DPRD Provinsi Sumatera Utara, dengan harapan, sama-sama dalam membangun objek wisata Pantai Putra Deli, Pantai Labu, Deliserdang. Selain permasalahan diatas, Fitrie juga menerima keluhan masyarakat nelayan tentang belum adanya irigasi yang mengaliri sawah-sawah penduduk, terutama di enam desa yaitu Desa Durian, Kuba Sentang, Pematang Biara, Kelambir, Rantau Panjang dan Desa Gemuk, karena selama ini sarana air menggunakan sumur bor. Menanggapi ini, Fitrie akan memperjuangkan aspirasi warga, termasuk dalam menjembati dan menyampaikan kepada pihak pemerintah atau eksekutif, agar segera merespon permasalahan ini. “Ini permasalahan rakyat, juga menjadi permasalahan penting bagi kami sebagai wakil masyarakat di partai Golkar,” kata Fitrie, mengimbau kepada warga menjaga kebersamaan sehingga apaapa yang menjadi permasalahan di Pantai Labu bisa teratasi sesuai keinginan masyarakat. Tentang adanya laporan nelayan mengenai pukat trawl/pukat harimau sehingga pencarian nelayan menjadi berkurang, Fitrie, meminta kepada pemerintah agar menindak tegas pelakunya. “Nelayan tradisional secara teoritis sangat menjaga lingkungan bahari dan tidak terjadi pengrusakan lingkungan laut, dan ini harus dihargai,” kata Fitrie, sedangkan pukat harimau sangat merusak lingkungan laut, karena tanpa pilih menjaring semua jenis hasil laut, yang lamakelamaan hasil laut tak bisa dinikmati oleh masyarakat. Masalah krisis listrik di Sumut pun menjadi permasalahan besar bagi masyarakat, karena merasa dirugikan, dan pemerintah akan segera membuat kebijakan terhadap krisis listrik. “Kita akan terus mendampingi pemerintah dalam permasalahan listrik, berbagai upaya akan dilakukan untuk bersama-sama dengan pemerintah meminta pertanggungjawaban pihak PLN,” kata Fitrie. Diakhiri reses anggota DPRD Provinsi Sumut dari fraksi Partai Golkar, Hj. Syafrida Fitrie, SP, MSP, menerima keluhan masyarakat tentang penereimaan pegawai di Bandara Kuala Namu banyak orangorang titipan pejabat. “Kita akan lakukan pengawasan agar proses perekrutannya dapat berjalan sesuai prosedur, termasuk dilakukan test kemampuan,” kata Fitrie, mengingat masih banyak warga di sekitar Kuala Namu yang masih menganggur.(a07)

rupiah yang terus molor, Ketua KomisiVII itu terkesan membela PTPLNKitsuIdenganmelimpahkan kendala molornya proyek kepada salah satu kontraktor. “Pembangunan molor karena kontraktor kita ada yang wanprestasi terkait masalah pondasi. Kalautidakadapondasibagaimanamaudibangun.Ibaratmembangun jembatan, kalau tiangnya satu saja tidak ada gimana,” jelasnyasembarimenambahkan, untukmenggantikontraktortentu memakan waktu. Menyinggung laporan warga Langkat menyangkut pemotongan dana sebesar 40 persen dari hasil kompensasi pemasangan jaringan saluran udara tegangan ekstra tinggi (sutet) oleh LBHN, ia menyatakan tak tahu masalah itu, karena belum ada laporan warga masuk ke Komisi VII.

Sikap Ketua Komisi VII DPR RI terkesan sangat melunak mengundang pertanyaan sejumlah wartawan. Tidak seperti sebelumnya, Sutan Bhatoegana selalubersikapkritis,bahkankerab bersuaravokalketikamencermati adaketidakberesandiperusahaan BUMN. Secara terpisah, Suhami Akbar, salah seorang warga yang sedang berada di Jakarta untuk mencari keadilan hukum ketika dikonfirmasi Waspada melalui selularnya, menyatakan laporannya kepada Ketua Komisi III dan Komisi VII DPR RI sudah masuk pada 20 Februari 2014. “Kalau dia mengatakan laporan masyarakat belum masuk, maka hari ini saya akan kembalimendatangigedungDPR RI untuk memasukkan laporan ulang,” kata Suhami Akbar seraya

mendesak KomisiVII secepatnya merespon laporan masyarakat yang merasa dirugikan atas pemotongan 40 persen dana kompensasi. Buruh Mogok Momen kedatangan wakil rakyat itu ditunggu para buruh PTAMSyangsudahsembilanhari mogok kerja. Tapi mereka kecewa,sebabmobilyangditumpangi Sutan Bhatoegana tidak berhenti, padahal para buruh sudah menunggu di bawah terik matahari untuk menyampaikan aspirasi. “Kami rencananya hendak mengadukan nasib kami kepada wakil rakyat yang notabene sebagai pembuat UU. Tapi tampaknya tidak ditanggapi. Kalau begini, kepada siapa lagi kami harus mengadu,” kata Rudi Damanik, salah seorang dari buruh kecewa.(a02)

Waspada/Ibnu Kasir

WAKIL Bupati Langkat Drs H. Sulistianto menyerahkan penghargaan kepada petugas yang berprestasi dalam pencapaian target PBB Tahun 2013 dalam acara yang berlangsung di halaman Kantor Dispenda Langkat di Stabat.

Bupati Langkat

Petugas Pemungut Pajak Harus Santun Dan Hormat STABAT (Waspada) : Pemkab Langkat mulai tahun 2014 mengelolapungutanPajabBumidan Bangunan (PBB) Pedesaan/ Perkotaan menjadi Pendapatan Asli Daerah (PAD). Karenanya aparatharusmelaksanakantugastugasnyadenganserius,melakukan penagihan dengan santun dan terhormat,melakukanpendataan yangterbarudanmembentuktim operasionalpenagihan yangsetiap minggunya dievaluasi. Laksanakanlah tugas dengan baik dan jadilan PNS sebagai teladan dan pelopor dalam membayar kewajiban, kataWakil Bupati Langkat H. Sulistianto ketika membacakan pidato tertulis Bupati H. Ngogesa dalam

acara penyerahan penghargaan terhadap SKPD, Camat, KaUPTD, Kades dan Lurah yang berprestasi dalam pencapaian target PBB di halaman kantor dispenda Langkat di Stabat, Selasa (4/3). Dikatakan, terhadap aparat yangbelummampumeraihprestasi diminta untuk melakukan evaluasi, mau belajar dan segera mencari titik lemah terhadap permasalahan yang dihadapi sehinggapadatahun2014prestasi pencapaian target meningkat. Dalam kesempatan itu H. Sulistianto menyerahkan penghargaan kepada Kaban LingkunganHidup,HermintaSembiring , Kadisdukcapil Ruswin, Kadisnak M Tambeng, Camat Sei Bingei

M Akhyar, CamatWampu Parsadanta Sembiring, Camat Babalan Faizal Rizal Matondang, Kades Sp Kuta Buluh Abdul Karim , Kades Mekar Jaya Edi Sunarto, Lurah Pelawi Utara Rosmiati dan Lurah Kw. Bingai M Nawawi yang kesemuanyaberhasilmeraihpencapaian target penerimaan PBB. Sebelumnya Plt. Kadispenda Langkat Dra Muliani, S melaporkan, target PBB pedesaan dan perkotaanTA2013Rp7.632.662.000, dan terealisasi Rp9.533.769.867, atau 129, 91 persen. Sedangkan penerimaan dari sektor PBB pedesaan dan perkotaan pada TA 2014 ini direncanakan Rp9.500.000.000,ataumengalami kenaikan 19,66 persen.(a01/a03)

Pemasangan Pipa Gas Pertamina Resahkan Warga Alur Dua

Waspada/Nazelian Tanjung

SUMIATI menggendong bayi yang ditemukan di pinggir jalan.

Warga Temukan Bayi Di Pinggir Jalan BINJAI (Waspada):Warga Dusun II Desa Sambirejo, Kec. Binjai, Kab. Langkat, Senin (3/3) pagi heboh dengan ditemukannya bayi laki-laki dalam kondisi tanpa pakaian di pingir jalan persawahan daerah itu. Sumiati, 37, begitu melihat bayi jenis kelamin laki-laki menangis, langsung membawanya pulang. Menurut Sumiati, awalnya bayi yang diperkirakan berusia sekitar 5 - 7 hari itu ditemukan warga yang kebetulan melintas. Lalu pria tersebut memberitahu Sumiati yang juga melintas. Sumiati menyebut tidak tau mau dikemanakannya bayi itu. Tapi kalau tidak ada yang mengambil, Sumiati juga berniat merawatnya.(a05)

MEDAN (Waspada): Masyarakat Kel. Alur Dua, Kec. Sei Lepan, Langkat resah dengan alat berat jenis excavator yang digunakan PT. CPM dalam pemasangan pipa gas milik PT.ARUN. Alat berat itu dioperasikan melintasi jalur permukaan tanah yang di bawahnya tertanam pipa gastuamilikPertaminayangmasih aktifdanbertekanantinggi,sehingga dikuatirkan bisa meledak. Keresahan itu disampaikan utusan warga Alur Dua, Selasa (4/3), di kantor Redaksi Harian Waspada Jl.Letjen Suprapto Medan, dengan harapan pihak pelaksana pemasangan pipa, yakni PT. CPM tidak menggunakan alat berat tetapi dilakukan secara manual dengan tenaga kerjamanusiaataualat-alatringan. Dede Achmat mewakili masyarakatsetempatdidampingi Koordinator Lembaga Cegah Kejahatan Indonesia (LCKI) Langkat, Ali Imran Purba mengaku telah mengirim surat keberatankepadaLurahAurDuadengan tembusan Camat Sei Lepan, Ma-

nager PT. Pertamina Pkl. Brandan dan Pimpinan PT.Wika serta PT. Panji Manunggal (CPM), minta Lurah mengambil kebijakan denganmemintapihakpelaksana menghindari bahaya besar akibat kebocoran gas yang tergilas alat berat. “Jangan tunggu sampai

terjadi bahaya baru kita bertindak, tapi sebaliknya lebih baik bertindak sebelum terjadi,” kata AliImranPurbayangsangatkecewa dengan pihak PT. CPM yang hanya memikirkan keuntungan semata tanpa mempertimbangkan bahaya besar yang mengancam kehidupan warga.(m22)


SEJUMLAH pipa yang akan dipasang PT.CPM untuk penyaluran gas bawah tanah milik PT. ARUN di kawasan Kelurahan Alur Dua, Kec. Sei Lepan menuai protes warga.

Waspada/Khairul K Siregar

BUPATI Deliserdang Drs H. Amri Tambunan menandatangani prasasti kantor desa yang selesai dibangun dan rehab loods pasar Mingguan di Kec. Gunung Meriah.

Masyarakat Gunung Meriah Berterimakasih Kepada Bupati DS GUNUNGMERIAH (Waspada) : Kepemimpinan Bupati Deliserdang Drs H. AmriTambunan dua periode (2004/2009 dan 2009/2014) telah dirasakan dan dinikmati hasilnya oleh masyarakat termasuk warga Kec. Gunung Meriah merupakan wilayah terujung Deliserdang yang berbatasan dengan Kab. Simalungun. “Berbagai program pembangunan telah kami nikmatiapakahberupasaranadanperasaranaseperti jalan dan jembatan, gedung sekolah bahkan kini telahberdiriSMA.”katatokohmasyarakatR.Saragih kepada Bupati Drs H. Amri Tambunan saat mengadakankunjungankerjasekaligusmeresmikan 12 kantor desa, loods dan Pasar Mingguan di Desa Gunung Meriah Pekan, Jumat (28/2) sore. Menurut Saragih, selama dua periode memimpin Deliserdang, Bupati Drs H. Amri Tambunanbanyakmelakukansentuhan-sentuhan pembangunan untuk peningkatan kesejahteraan masyarakat. Seperti bangunan gedung sekolah saatinitidakkalahcantikdanindahdengangedung sekolah di ibukota kabupaten. Bahkan sekolah SD dilengkapi perpustakaan namun masih perlu upaya peningkatan kualitas. Dengan hadirnya SMA Negeri di Gunung

Meriah, juga sangat membantu warga. Kalau sebelumnya anak-anak Gunung Meriah harus bersekolah ke daerah lain setelah menamatkan SMP kini tidak lagi, kata Saragih seraya menyebutkan, telah banyak jalan-jalan setapak dirabat beton di wilayah mereka. Sebelum menyampaikan terimakasihnya kepada Bupati yang hadir bersama Ketua TP PKK Ir Hj. Anita Amri Tambunan, tokoh masyarakat itu menyanpaikan kondisi jalan di Desa Ujung Meriah dan Gunung Sinembah yang perlu mendapat penanganan. Mendengar keluhan warga Bupati Drs H Amri Tambunan ketika menyampaikan bimbingan dan arahan langsung bertanya kepada Ir Chairum dari Dinas PU Bina Marga tentang keluhan warga spontan dijawab minggu depan dikerjakan. Pada kesempatan itu, Bupati Drs H. Amri Tambunanmengingatkanwargaagartetapmemupuk kebersamaan dan kekeluargaan. Karena hanya dengankebersamaanmelaluitigapilarpembangunan (kemampuan pemerintah, partisipasi masyarakat dandukungansektorswasta)yangtelahkitabuktikan selamainipercepatanpembangunandaerahdapat dilakukan.(crul/a06)

Tak Terdata Di DPT, Pemilih Masuk Ke DPK BINJAI(Waspada):Pemilihyangbelummasuk pada Daftar Pemilih Tetap (DPT) akan masuk Daftar Pemilih Khusus (DPK). Ketua KPU Binjai HeryDani,SHmenjelaskan,Senin(3/3),padarapat kordinasiyangdipimpinWaliKotaBinjaiHMIdaham daftar pemilih Kota Binjai 178.689 orang. Jumlah pemilih kemungkinan bertambah, apabila ada warga Binjai belum terdata di DPT, akan masuk ke dalam DPK. Heri juga memprogramkan agenda deklarasi kampanye damai. Wali Kota Binjai HM Idaham SH, M.Si mengharapkan KPUD Binjai membuat brosur tentang

bagaimana tata cara masyarakat mendapatkan hak suaranya di TPS. Wali Kota mempertanyakan tentang logistik pemilu 2014. Yang oleh ketua KPU disebutkan, untuk kotak suara semua sudah siap, termasuk tinta, namun surat suara belum ada informasi kapan akan dikirim. Idaham menegaskan pemerintah kota Binjai siap mensukseskan Pemilu 2014 dan mengimbau PNS agar tetap menjaga netralitas. Mengenai penertiban alat peraga parpol yangmenyalahiaturan,ditegaskankesiapanSatpol PP membantu Panwaslu menertibkannya.(a04)

Waspada/Andi Nasution

POLISI memukul mundur massa yang bertindak anarkis saat simulasi Sispamkota Polres Deliserdang.

Polres DS Pukul Mundur Pengunjukrasa Anarkis LUBUKPAKAM (Waspada): Kepolisian mengurai dan memukul mundur ratusan massa yang berupaya bertindak anarkis saat melakukan unjukrasa menuju kantor Komisi Pemilihan Umum Daerah (KPUD) Deliserdang di Lubukpakam. Massa mendatangi kantor KPUD minta agar penghitungan suara diulang kembali karena sarat kecurangan. Bentrok antara polisi dengan massa tak terelakkan, disebabkan para pengunjukrasa tidak menghiraukan imbauan kepolisian agar tidak melakukan tindakan anarkis bahkan massa semakin banyak dan suasana semakin memanas. Kapolres Deliserdang AKBP Dicky Patrianegara, SH, S.Ik memerintahkan pasukannya untuk segera melakukan tindakan refresif sesuai prosedur dengan mengerahkan pasukan pengendali massa (Dalmas). Polisi berhasil memukul mundur ratusan massa yang akhirnya bubar setelah mobil Water Canon difungsikan serta mengamankansejumlahprovokatoryangmemicu kericuhan itu. Demikian Simulasi Sistem Pengamanan Kota (Sispamkota) yang dilakukan Polres Deliserdang,

kemarin, di alun-alun Pemkab Deliserdang dalam rangka kesiapan aparat keamanan menghadapi Pemilihan Umum (Pemilu) 9 April 2014. KapolresAKBPDickyPatrianegaradidampingi WakapolresKompolBambangYudhoMdanKabag Ops Kompol Josua Tampubolon usai simulasi mengatakan,simulasiberorientasiuntukpersiapan menghadapi Pemilu pada April 2014, serta mengantisipasi apabila terjadi kejadian yang tidak diinginkan terkait unjukrasa anarkis. “Pelaksanaan simulasi telah dipersiapkan berkali-kali untuk menghadapikejadiansesungguhnya,meskipuntidak kitainginkanadanyakejadiananarkissehinggaharus dilakukan tindakan represif,” ujar Kapolres. Dalam memecahkan masalah unjukrasa, pihak kepolisian lebih mengedepankan tindakan persuasif dan preventif. Sedangkan tindakan represif dan hukum adalah upaya atau tindakan terakhir apabila upaya persuasif dan preventif tidak berjalan. “Simulasi Sispamkota digelar dalam rangka menghadapi kontijensi Operasi Mantap Brata 2014 yangmelibatkan 750 personil kepolisian ditambahpuluhanTNIsertaSatpolPPdanPemkab Deliserdang,” jelas Dicky.(c02)

Sumatera Utara


LIMAPULUH (Waspada): Pukat gerandong curi-curi beroperasi menangkap ikan di perairan Batubara, karena pengawasan di sektor kelautan dan perikanan tetap berjalan. Selain mengeluarkan himbauan kepada pengusaha untuk tidak mengoperasikan alat tangkap ikan tersebut, karena keberadaannya dilarang sebagaimana Kepmen No: 02 Tahun 2011 secara tegas melarang pengoperasian pukat ikan gandeng dua di perairan NKRI. ‘’Jika pukat gerandong masih ditemukan beroperasi menangkap ikan di Batubara, itu dilakukan curi-curi. karena kita tetap melakukan pengawasan di laut. Selain mengeluarkan himbauankepadakalanganpengusahaperikanan untuk tidak mengoperasikan,’’ tukas Kepala Dinas Kelautan dan Perikanan (DKP) Kab. Batubara Ir. Rinaldi MSi dalam laporannya kepada Bupati, H OK Arya Zulkarnain, SH, MM, Senin (3/3). Menurutnya, pengusaha nelayan yang bertangkahan di Kuala Batubara secara berangsur merubah alat tangkap, di mana sebagian mereka

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta).

Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Efendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Efendi, Rizky Rayanda. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar. Singkil: Tarmizi Ripan, Mansurdin.

Semua wartawan WASPADA dilengkapi kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.  Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.


KANIT Resum Ipda Rinato (depan) menggiring dua tersangka perampok alat berat TR, alias Men,35, dan rekannya NS,35, Warga Desa Alangbonbon, Kec. Aekloba, Kab Asahan, dari RSUD Kisaran.

Polisi Bekuk Kawanan Perampok Alat Berat KISARAN (Waspada): Tiga kawan perampok alat berak berhasil dibekuk Sat Rekrim Polres Asahan, karena melawan dan melarikan diri saat akan ditangkap, dua tersangka dilumpuhkan dengan timah panas, Senin (3/3) malam. Informasi dihimpun Waspada, penangkapan itu dipimpin Kanit Resum, Sat reskrim Ipda Rianto,danmembekuktersangka TR, alias Men, 35, Desa Alangbonbon, dan rekannya EST, 32, warga Guting Saga, Kec. Aekloba, Kab Asahan, di kediamannya. Karena berusaha kabur, mereka dilumpuhkan dengan ditembak, namun sebelumnya diberi peringatan namun tidak dihiraukan. Sedangkan satu tersangka lainnya berhasil kabur. Sedangkansatulagi,NS,35,Warga Desa Alangbonbon, Kec. Aekloba, menyerah. Kedua perampok ini ditahan karena terlibat pencurian alat

berat, pada awal Februari lalu, di kawasan Tanjungpasir, Kec Pulauraja, dan Pemangke, Labuhanbatu.Tigatersangkainibeserta dua rekan lainnya saat beraksi menggunakan senjata api, dan tidak segan-segan melakukan kekerasan kepada korbannya bila melakukan perlawanan. Tidak hanya itu, korbannya (penjaga alat berat/excavator) diikat dan matanya ditutup, dan kawanan perampok dengan leluasa membongkar mesin dan melarikan bagian terpenting. “Merekainiadalahperampok alat berat, dan mereka sering beraksiantarkabupaten(AsahanLabuhanbatu). Dan kini, kita

masih memburu tersangka lainnya,” jelas Kapolres Asahan AKBP Budi Suherman, melalui Kanit Resum Ipda Rianto, di RSUD Kisaran, saat membawa tersangka untuk mendapatkan perawatan medis. “Dalampenangkapanini,kita juga membawa dua sepedamotor sebagai lat bukti, yang digunakan tersangka melansir barang curian itu. Sedangkan untuk senpi, belum ditemukan karena dibawa olah rekan tersangka lainnya. Tiga tersangka ini masih dalam pemeriksaan intensif, dan kita akan memburu tersangka lainnya, dan mencari dimana hasil curian itu dijual,” jelas Rianto. Sementara dua tersangka menutup mulut dan tidak memberi keterangan apapun saat ditanyai Waspada, dengan alasan masih menjalani perawatan medis dari luka tembak. (a15)

RANTAUPRAPAT (Waspada):SayainginPujakesumabukan jadi wadah untuk berpolitik, akan tetapi orang Pujakesuma harus mengerti politik. Karena seorang muslim yang tak mengerti politik sama dengan mactria peli, dengankatalainakanterbelakang, untuk itu jadikanlah Pujakesuma tempat berkumpulnya orangorang yang bergabung dalam wadah Pujakesuma. Demikian antara lain dikatakan Gubernur Sumatera Utara H. Gatot Pujo Nugroho, ST, Sabtu (1/3) malam, pada acara Syukuran dan Peresmian Padepokan DPD Pujakesuma Kab. Labuhanbatu yang berlokasi di Jl. Khairil Anwar, Kec. Rantau Selatan. “Saat ini kompetisi semakin tinggi, untuk itu mari kita pelajari nilai-nilai budaya yang diajarkan oleh orangtua kita. Konsolidasi budaya, pendidikan, iptek dan ekonomi merupakan hal yang

sangat penting, mengajar dan belajarekonomi.Bagimasyarakat yang tergabung dalam Pujakesuma merupakan usaha kita agar prestasi Pujakesuma diperhitungkanbaikditingkatkabupaten maupun internasional,” jelas Gatot. Bupati Labuhanbatu dr. H. Tigor Panusunan Siregar, SpPD dalam sambutannya, merasa terkesan sewaktu masuk ke lokasi acara. Karena melihat ada marga Simanjuntak, Harahap dan lainlain hadir semua pakai blankon. InilahciriLabuhanbatu,38persen penduduk Labuhanbatu adalah suku jawa. Di daerah ini budaya bisa berbeda tapi bisa membaur dan begitu akrabnya antara sesama warga masyarakat. Mudah-mudahan PadepokanDPDPujakesumatetapdisini untuk melestarikan budaya bangsa karena telah banyak diberikanbantuanperalatankesenian,

seperti Reog Ponorogo, Ludruk dan lain-lain. “Untukitusayamintasesama atau sedulur harus akur-akur jangan berkelahi, kalian jangan urus-urusan politik di organisasi Pujakesuma dan Padepokan ini. Tetapi urus dan kembangkanlah budaya jawa ini untuk mengikat kita supaya tetap bersatu di Kab. Labuhanbatu, semoga padepokan ini menjadi tempat berkumpulnya warga masyarakat untuk memajukan kemaslahatan ummat,” kata Tigor mengingatkan. Ketua DPW Pujakesuma Sumatera Utara Muhammad Roem dalam kesempatan itu sangat mengapresiasiadanyapadepokan tersebut. “Sangat luar biasa berkah peresmian padepokan ini, dan ini adalah merupakan motivasi untuk membangun Pujakesumasehinggadapatberkontribusi membangun Sumatera Utara,” sebutnya. (c07/a18)

 Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412.

Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Bupati Hadiri Malam Hiburan Rakyat

KISARAN (Waspada): Sat Narkoba Polres Asahan gerebek salah satu kantin Universitas Asahan (UNA), empat orang dibekuk, karena diduga konsumsi sabu-sabu, Senin (3/3) sore. Informasi dihimpun Waspada, berawal diamankannya JM, 42, (Satgaskam UNA), saat di pelataran parkir kampus, selanjutnya penangkapan itu berlanjut ke salah satu kamar kantin belakang universitas tersebut, dan menahan AT, FR, dan SY, dan kini masih dalam pemeriksaan intensif. “Penangkapan dilakukan setelah mengembangkan informasi yang disampaikan masyarakat,” jelas Kapolres Asahan Budi Suherman, saat memimpin penggerebekan, didampingi Kasat Narkoba AKP Anderson Siringoringo. Kapolres mengatakan bahwa pihaknya belum menentukan status, karena masih dalam pemeriksaan intensif. “Kita masih mendalami kasus ini, dan empat orang ini masih dalam pemeriksaan, bila mereka terbukti bersalah, maka akan diproses sesuai dengan hukum yang berlaku,” jelas Kapolres. (a15)

Parlindungan: Membangun Daerah Tidak Perlu Banyak Bicara KISARAN (Waspada): Anggota DPD RI Parlindungan Purba, SH, MM mengatakan dalam membangun daerah tidak perlu banyak bicara, namun yang dibutuhkan adalah tindakan nyata untuk masyarakat. Hal itu diungkapkannya, saat Kunker di Kab Asahan, Selasa (4/3) di Aula Melati Kantor Bupati Asahan dan diterima oleh Asisten II, dan Bappeda, dan 25 Camat. Parlindungan membawa rombongan baik itu dari PU Provinsi, PSDA, PLN dan pengusaha, dalam dengar pendapat, dan mensosialisasikan rencana pembangunan PemerintahPusatdanProvinsiuntukKab.Asahan. “Saya senang mendengar keluh kesah Camat, dansemuapembangunanyangberkaitandengan sarana jalan, aliran listrik, jalan, akan kita tulis, dan itu tidak perlu saya jawab, namun akan dibuktikandengantindakan,sehinggaKabAsahan bisa lebih maju,” jelas Parlindungan dalam diskusinya. Parlindunganjugamengapresiasipembangun di Asahan, terutama program seribu rumah pemasangan listrik setiap tahun, dan hal itu

merupakan program yang nyata dan bermanfaat oleh masyarakat banyak. Sehingga, dirinya membawa PU, PSDA Provinsi, dan PLN, sehingga merekatahusejauhmanapembangunandiAsahan. Parlindungan mengatakan, dalam tahun ini direncanakan pembangunan tanggul Sungai Asahan sepanjang sekitar 22 KM, sehingga Asahan bisa bebas banjir karena luapan sungai Asahan. “Sama juga dengan sarana jalan dan jembatan,. Kita akan upayakan semua jalan di Asahan bisa membaik, sehingga perputaran ekonomi bisa berjalan dengan baik. Dan saya akan upayakan itu sehingga bisa terwujud,” jelas Parlindungan. Sementara Camat dari setiap Kabupaten mengungkapkan semua keluh kesahnya, dan baik itu sarana pertanian infrastruktur lainnya, diharapkan walaupun tidak semua terpenuhi paling tidak bisa mengurangi semua beban masyarakat dalam meningkatkan kualitas hidupnya. “Masih banyak yang harus diperbaiki, namun semua itu tidak terlepas dukungan dari DPDuntukmeluluskanpembangunandiAsahan,” kata Asisten II Bupati Asahan Mahendra. (a15)


ANGGOTA DPD RI Parlindungan Purba, SH, MM bersama rombongan (PU, PSDA Provinsi, dan PLN) sedang mendengarkan keluh kesah pembangunan di Kab. Asahan.

KPU Batubara Butuh 7.350 KPPS Berpengalaman SEISUKA (Waspada): Perubahan peraturan dan tata cara pemungutan suara pada pemilu tahun 2014 ini membutuhkan petugas yang berpengalaman dan punya kemampuan. Demikian disampaikanKetuaKPUBatubaraMukhsinKhalid, SE dalam bimtek PPK se-Kab. Batubara. “Dalam pemilihan ini ada empat tipe pemilih yang ditulis dalam form terpisah. Ini membutuhkan tenaga - tenaga yang memiliki ketelitian dan keakuratan dalam tata cara pemungutan dan penghitungan suara,” kata Mukhsin. Lebih lanjut dikatakannya, empat tipe pemilih itu masing - masing berdasarkan DPT, DPT tambahan, DP Khusus dan DP Khusus tambahan.

Waspada/Budi Surya Hasibuan

GUBSU dan Bupati Labuhanbatu diabadikan bersama warga Pujakesuma dalam acara syukuran dan peresmian padepokan.

Pembangunan Pagar Masjid Nurul Ikhsan RANTAUPRAPAT (Waspada): Bupati Labuhanbatu dr. H. Tigor Panusunan Siregar, SpPD didampingi Plt. Sekdakab H Ali Usman Harahap, Minggu (2/3) menerima surat hibah tanah untuk pembangunan sarana pendidikan dari tokoh masyarakat, dan meletakkan batu pertama pembangunan pagar Masjid Nurul Ikhsan, Dusun Bandar Selamat, Desa Kampung Dalam, Kec. Bilah Hulu. Bupati Labuhanbatu dalam arahannyamengatakan,penyerahan surat hibah tanah dari Bapak H. Sugino kepada Bupati Labuhanbatu adalah untuk pembangunan sarana pendidikan di Desa Bandar Selamat.“Tanah ini akan saya manfaatkan untuk pembangunansaranapendidikan danakankamipelajarikebutuhan pendidikan tingkat apa yang akan kita bangun di daerah ini,” ungkapnya.

“Atas pemberian hibah tanah untuk sarana pendidikan yang diserahkan H. Sugino, saya ucapkan terimakasih. Demikian juga kepada warga masyarakat di Dusun Bandar Selamat, Desa Kampung Dalam, atas dukungan dan partisipasinyanya dalam mewujudkan pembangunan di Kab. Labuhanbatu, khususnya di desa ini,” sebut Bupati. “Khusus dalam melanjutkan pembangunan pagar Masjid Nurul Ikhsan, saya pribadi memberikansumbanganatauinfaqsebesar Rp5jutadansebagaiBupatiLabuhanbatu saya akan membantu pembangunannya,asalkanpihak panitia pembangunan mau mengikuti prosedur yang ada. Harapan kita semua, kiranya pembangunan pagar Masjid ini dapat selesai tepat waktu,” kata Tigor. Sementara, H. Sugino yang berbicara selakuTokoh Masyarakat Desa Bandar Selamat meng-

harapkan, agar Bupati Labuhanbatumaumenambahruangkelas baru untuk sekolah SD Negeri 117830 P3RSU Tanjungsiram berikut MCK. Karena SD Negeri yang dibangun sejak 1984 ini, siswanya sekarang mencapai 400 orang,sehinggadibutuhkanruang kelas baru. Selain itu, kata Sugino, masyarakatdisinisangatmembutuhkan pengaspalan jalan dan drainase serta pemekaran Kec. Bilah Hulu untuk dimekarkan menjadi dua kecamatan. “Dengan alasan agar mempermudahkan dalam pengurusan administrasi pemerintahan seperti KTP dan lainlain,” harapnya. Dalamduakegiatanitu,dilaksanakan kotak amal dari seluruh rombongan atau undangan dan terkumpul infaq sebesar Rp6.170.000, untuk pembangunan pagar Masjid Nurul Ikhlas. (c07/a18)

Ia mengimbau agar PPS dalam merekrut petugas KPPS benar - benar selektif, sehingga dalam proses pemilihan tidak banyak masalah. Hadir dalam Bimtek Tata Cara Pemungutan Dan Penghitungan Suara Di TPS ini Ketua KPU Mukhsin Khalid SE, Divisi Teknis M Amin Lubis SHi, Divisi Hukum Alhusein Harahap ST, Divisi Logistik Mustafa SHi, Divisi Sosialisasi Taufik Abdi Hidayat, S.Sos Di Kab. Batubara pemilu akan dilaksanakan di 1.050 TPS yang akan menyerap 284.229 suara sesuai DPT yang ada. Jumlah DPT ini, menurut Mukhsin, hampir sesuai dengan keadaan di lapangan. (c05)

KUPT Rantut Gelar Uji Kompetensi Guru RANTAUPRAPAT (Waspada): Setelah 15 hari dilantik Bupati Labuhanbatu menjadi KUPT Kec. Rantau Utara (Rantut), Indra Bustami, SPd (Ameng), membuat gebrakan baru dengan menggelar Uji Kompetensi Guru (UKG) SD Negeri/Swasta, Sabtu (1/3) di SD Negeri 112139 Jl. Pramuka, Rantauprapat. Dalam kegiatan yang dibuka Kadisdik L.Batu Drs H Iskandar, MPd itu, Ameng di hadapan 327 peserta UKGitumengatakan,kegiatanUKGdigelar dalam rangka menyahuti program Bupati L.Batu untuk kemajuan pendidikan di L.Batu.

Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan:

Kantin Digerebek, Polisi Bekuk Empat Orang

selama ini mengoperasikan pukat gerandong telah beralih kepada usaha penangkapan lain. ‘’Kesadaran nelayan diTanjungtiram ini patut diikuti bagi yang lainnya di desa pesisir Batubara dalam upaya menjaga kondusifan di laut,’’ ujarnya, sembari mengatakan pengawasan dengan melakukan patroli menggunakan kapal cepat di titik rawan, seperti Bagan Batak/Kepal Merah perairanTanjungtiramyangmerupakanperbatasan Asahan-Batubara . Terkait keberadaan Kerambah Jaring Apung (KJA) di Pulau Salahnama, pihaknya (DKP) kini telah menempati petugas yang secara bergantian menjaga. Agar proyek bantuan Pemerintah Pusat melalui Mina Wisata tersebut terhindar dari tindakan jahil mengambil perangkat kerambah baik paku pengikat yang terbuat dari besi putih, kondisinya kini telah diperbaiki. ‘’Kerambah untuk budidaya ikan laut ini dikelola oleh Kelompok Masyarakat Pendayaguna Pulau-Pulau Kecil Mina Jaya bekerjasama dengan BUMD,’’ tukasnya. (a13)

Tidak Ingin Pujakesuma Menjadi Wadah Politik

 Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.

TG TIRAM (Waspada): Bupati Batubara meminta maaf kepada warga atas keterlambatan hadir dimalam pagelaran hiburan rakyat di Kec. Tanjungtiram, karena sebelumnya harus ke KPK. ‘’Saya tadi dipanggil pula ke KPK, sehingga terlambat kemari dan mohon maaf,’’ tukas Bupati H OK Arya Zulkarnain, SH, MM kepada lapisan masyarakat dan undangan yang hadir pada malam pagelaran hiburan rakyat di Kec Tanjungtiram yang dilaksanakan Pemkab Batubara bersama masyarakat, Sabtu malam (1/3). Pagelaran hiburan rakyat tersebut sebagai rasa kegembiraan atas pelaksanaan Pilkada Batubara 9 September 2013 lalu yang berlangsung aman dan lancar di mana mengantarkan OK Arya sebagai Bupati Batubara untuk kedua kalinya terpilih melalui jalur independen (2013-2018). Acara itu juga diisi dengan penilaian terhadap enam orang kaum ibu maupun remaja yang memakai jilbab oleh panitia. Hadir unsur Muspida/Muspika, tokoh agama, masyarakat, caleg Partai Golkar dan undangan. (a13)

Rabu 5 Maret 2014

DKP Tetap Lakukan Pengawasan Di Laut


Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: H. Akmal AZ. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Efendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: Zultamser. Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi), Hang Tuah Jasa Said (Potret).


“Jadi pantas, wajar dan malu kita sebagai guru kalaumutupendidikandiL.Batu khususnyadiKec. RantauUtaramerosotdantidakbisakitatingkatkan,” ujar Ameng yang sebelumnya juga menerapkan hal serupa di Kec. Pangkatan dan Bilah Barat. Drs. H Iskandar, MPd dalam arahannya saat membuka UKG itu menegaskan, Disdik memberikan apresiasi yang tinggi kepada Bupati L.Batuyangtelahbegitupedulidanpenuhperhatian terhadapduniapendidikandidaerahini,khususnya bagi kemajuan pendidikan anak-anak kita sampai ke perguruan tinggi. (a18)

Jalan Ujungkubu-P.Rambe Butuh Perbaikan UJUNGKUBU, Batubara ( Waspada): Sepanjang jalan Ujungkubu menuju Pematang Rambe Kec.Tanjungtiram Batubara, dipenuhi lubang-lubang yang menyulitkan warga melintas mohon mendapatkan perbaikian. “Jalan berlubang 20 -30 cm pemakai jalan sulit memilih. Kalau hujan jalan berlubang berlumpur, bila panas jalan berdebu ditambah pula kabut asap,” tukas Sofyan, warga Pematang Rambe, Selasa (4/2). Menurut Sofyan, yang penggalas sepeda mengangkut kelapa gandeng, sawit itu, kondisi

jalan dikampungnya (Pematang RambeUjungkubu) memprihatinkan, dihiasi lubang menganga dan minta perbaikan. Walau sudah lebih setahun jalan rusak, sampai kemarin belum terlihat perbaikan. Bila nasib sial, sepeda galasnya bisa patah juga pengendara sepedamotor,lebihwaspadamengelakkanlubang, kalau tak mau terjerambab masuk lubang berlumpur. “Kami minta Pemkab Batubara/PU dapat membantu mengalokasikan dana perbaikan jalan rusak lebih 1.000 meter tersebut,” harap Fiyan, panggilan sehari-harinya. (a12)

Waspada/Helmy Has

PENGENDARA sepedamotor hati-hati mengelakkan lubang di jalan Ujungkubu-Pematang Rambe.

Sumatera Utara

WASPADA Rabu 5 Maret 2014


6 SKPD Kerjasama Urus Pengungsi Sinabung KABANJAHE(Waspada): Enam satuan kerja perangkat daerah (SKPD) Pemprovsu dan Pemkab Karo dilibatkan secara langsung untuk menangani pengungsi akibat erupsi Gunung Sinabung Kab. Karo. Keenam dinas ini yakni Dinas Pendidikan, Dinas Kesehatan, Distanbun, PU, Kehutanan dan BKPD. Demikiansalahsatuhasilrapat koordinasi penanganan pengungsi Sinabung di Posko BNPB KabanjahedipimpinSekdaprovsu Nurdin Lubis, MM, Senin (3/3). Sekdaprovsu berharap, keenam SKPDinimembangunkerjasama yang baik agar masalah yang muncul di sela-sela penanganan pengungsi tidak merusak kinerja

dan sinergisitas instansi, apalagi bisa menimbulkan image jelek di belakang hari. Rapat koordinasi ini dihadiri sejumlahpejabatterassepertidari BNPB, Kementerian Sosial, BNPDSU, 6 SKPD Provsu, Sekda Pemkab Karo, 6 SKPD Pemkab Karo, DPRD Karo, Polres Karo danPengadilanNegeriKabanjahe.

Diungkapkanadanyapermasalahan belum clear di bidang pendidikan seperti klarifikasi pencairan dana dari bank ditunjuk, pendataan siswa, rehabilitasi sekolah. Di bidang pertanian menyangkut pengadaan bibit tidak sesuai iklim di Karo, pengadaanbibittembakauuntuk 500 Ha di Kec. Payung, Tiganderket, 10 ribu bibit kopi. Di bidang kesehatan menyangkut perbaikan sarana prasaranapelayanankesehatanrusak, BPJS untuk 17 ribu pengungsi di 16 desa empat kecamatan radius 7 Km yang dipulangkan. Sedangkan di bidang Peker-

jaanUmum,tindaklanjutrelokasi lahan tempat tinggal warga di tiga desa belum clear, pembangunan jalan alternatif evakuasi, pembangunan jalur lahar dingin. Menyangkut Kementerian Agama, termasuk rumah ibadah rusak parah dan ringan seperti 14 masjid, 30 gereja, 4 sekolah. Menyangkut BKPD perihal administrasi pengolahan data kurangakuntabeldantransparan, pembangunan jambur untuk berkebutuhan khusus, penggunaanlahantiduruntukkepentingan pengungsi sesuai diajukan DPRD Karo mewakili masyarakat menyimpulkan masalah tersebut

merupakan prioritas utama. Sekdaprovsu juga mengungkapkan,penyaluranbantuanbagi 17 korban awan panas juga dilakukan kepada ahli waris, total bantuan diberikan Rp11, 5 juta. Walau tidak seberapa yang di berikan,mudah-mudahanbantuan ini bisa meringankan beban para ahli waris, ujar Nurdin. Gloria br Ginting, ahli waris Surya Sembiring,25 dan Sehat Sembiring,mengatakan,bantuan ini cukup membantu keluarga yang ditinggalkan. Bantuan berupa uang tunai yang diterima akan digunakan untuk keperluan pendidikan anak. (c10/a36)

Besok Pencoblosan

Pilkada Taput Putaran Kedua Dijaga Ketat TARUTUNG (Waspada): Pemilihan Kepala Daerah (Pilkada) Tapanuli Utara, yang akan dilaksanakan, Kamis (6/3) besok, dijaga ketat aparat keamanan dari Polri, TNI, Brimob yang nantinya ditempatkan di seluruh daerah pemilihan untuk mengantisipasi kemungkinan terjadinya keributan di TPS (Tempat Pemungutan Suara) saat pencoblosan. “Untuk memaksimalkan pengamanan Pilkada Taput putaran kedua ini, 634 personil aparat kemanan sudah ditempatkan, dengan pola satu Polisi satu TPS. Hingga saat ini pengamanan yang dilakukan sudah mantap”ujar Kapolres Taput AKBP Verdy Kalele SIK, SH.MH didampingi Humas Polres Taput W Baringbing SH kepada Waspada,Selasa (4/3). Disebutkan, seluruhnya anggota pengamanan Pilkada

Taput 959 personil yang terdiri dari aparat Polres Taput dan 13 Polres tetangga. Brimob 240 personil, TNI 120 personil dan Zibom (Penjinak Bom) 10 orang. Peralatan yang diturunkan, barracuda, watercanon dan peralatan dalmas. Putaran kedua ini hanya diikuti dua pasangan calon Bupati/Wakil Bupati yakni SAURMA (Saur Lumbantobing SE-Manerep Manalu SH) dan Drs Nikson NababanDrs Mauliate Simorangkir. Seluruh TPS di Taput yang berjumlah 627 TPS sudah siap kita amankan hingga penghitungan suara,ujarnya. Ditambahkan Kapolres, anggota yang ditempatkan untuk pengamanan dari tingklat KPPS dan TPS yang selanjutnya ke PPK. “Prosesnya tetap dikawal ketat oleh aparat kemanan. Untuk itu, diimbau kepada seluruh masyarakat Taput

Ciptakan Birokrasi Pemda Profesional SAMOSIR (Waspada): Untuk menciptakan birokrasi pemerintah daerah (Pemda) profesional dengan karekteristik berkinerja tinggi, bersih dan bebas KKN, Kemenpan RI melakukan upaya melalui bimbingan teknis untuk seluruh aparatur Pemkab Samosir diikuti pimpinan SKPD di Pangururan, baru-baru ini. Hasil yang diharapkan melalui reformasi birokrasi akan mampu melayani publik, netral, sejahtera, berdedikasi dan memegang teguh nilai-nilai dasar dan kode etik aparatur negara, ujar Sekretaris Daerah Kabupaten Samosir Ir Hatorangan Simarmata. Penyusunan road map reformasi birokrasi di Kab. Samosir harus ada sinkronisasi dengan Rencana Pembangunan Jangka Menengah Daerah (RPJMD), Renstra, standar pelayanan minimal (SPM). Untuk penyusunan road map reformasi birokrasi harus dilakukan identifikasi potret perjalanan Kab Samosir minimal lima tahun sebelumnya untuk dianalisa dan menentukan apa fokus yang akan dilakukan untuk perubahan, Dia menekankan, pimpinan SKPD memberikan masukan tentang penyusunan reformasi birokrasi Samosir. (c11)

untuk datang ke TPS memberikan hak suaranya sesuai hati nuraninya dengan menjaga kekondusifan. Siapapun yang terpilih menjadi bupati/wakil bupati Taput harus kita terima bahwa itulah yang terbaik untuk bonapasogit,” ujar Kapolres. Logistik Ketua Komisi Pemilihan Umum (KPU) Tapanuli Utara, Lamtagon Manalu memastikan seluruh logistik Pilkada Taput putaran kedua sampai ke seluruh TPS, hari ini Rabu (5/3). Pendistribusian logistik Pilkada itu, kata dia, sudah sampai ke tingkat PPK, Selasa (4/3). “Logistik sudah sampai ke tingkatan PPK hari ini. Rabu (hari ini) seluruh logistik akan sampai ke 627 TPS. Ada beberapa TPS di Kecamatan Parmonangan

yang susah dijangkau jika cuaca buruk. Untuk mencapainya butuh waktu sekira empat jam dengan berjalan kaki,” jawab Lamtagon kepada wartawan, Selasa (4/3). Pendistribusian logistik Pilkada Taput putaran kedua itu, dilakukan dalam pengawasan ketat, baik dari Panwaslu Taput maupun dari aparat kepolisian sampai ke tujuan masing-masing. Selain pendistribusian logistik, KPU Taput melalui jajarannya juga sudah menyampaikan formulir C6-KWK-KPU (undangan memilih) sejak 28 Februari 2014 sampai 4 Maret 2014. Sebelumnya, Ketua KPU Taput mengatakan, untuk formulir C6 yang tidak sampai kepada pemilih, akan ditarik dari petugas

Terlibat Judi Sabung Ayam, Oknum Lurah Ditahan GUNUNGSITOLI (Waspada): Penyidik Polres Nias menetapkan oknum Lurah Pasar Gunungsitoli, WG bersama FN sebagai tersangka judi sabung ayam dan dijebloskan dalam sel tahanan Mapolres Nias. Dua orang lainnya FM dan Sua alias Kenjiro yang turut di-

amankan saat penggerebekan oleh petugas, Minggu (2/3) lalu, tidak terbukti terlibat judi sabung ayam dan hanya dimintai keterangan sebagai saksi dan diperbolehkan pulang ke rumah. OknumWG dan FN ditetapkan sebagai tersangka setelah menjalani pemeriksaan hingga

Anggaran Penghijauan Di Samosir Perlu Ditingkatkan SAMOSIR (Waspada): Kondisi Kehutanan Samosir perlu memperoleh suntikan dana yang lebih maksimal baik yang bersumber dari Dana APBD Kab, BDB, APBD Provsu dan APBN agar Program penghijauan khususnya di daerah Perbukitan yang berada di dataran tinggiBukitBarisanbisaterjagadenganbaikuntukmenjagapemanasan Global. Untuk besaran anggaran penghijauan dan berapa titik lokasi di Samosir, Kadis Kehutanan Kab Samosir Hutaurukmengatakan saya cek dulu ya. Saya lagi di luar kantor. Selanjutnya apakah Daftar Pelaksanaan Anggaran Dinas Kehutanan Kab Samosir tahun 2014, Kadis Kehutanan Hutauruk kepada Waspada, Senin (3/3) menambahkan bahwa sedang proses ada perbaikan sedikit, tanpa merinci kapan waktunya akan terealisasi mengingat Triwulan pertama 2014 sudah berjalan. Pantauan Waspada, secara keseluruhan anggaran Satuan Kerja Perangkat Daerah (SKPD) Pemkab Samosir belum memperoleh kucuran dana untuk anggaran 2014. Bupati Samosir Ir Mangindar Simbolon saat dikonfirmasi Waspada, Senin (3/3) terkait berapa anggaran penghijauan dan berapa titik lokasi di Samosir yang akan dilaksanakan untuk tahun 2014, mengatakan saya baru tiba di Jakarta ada acara APKASI, info tentang penghijauan boleh diperoleh via Kadis Kehutanan ujar Bupati. (c11)

Waspada/Dede Basri Hasibuan

KETUA DPD SP PLN WS2JB Yan Herimen (jaket merah), menyerahkan bantuan kepada koordinator pengungsi posko UKA I – II.

PPK atau PPS. Namun, bagi warga yang tidak memiliki formulir C6, sepanjang sudah terdaftar dalam DPT tetap dapat memberikan hak suara dengan menunjukkan identitas diri berupa KTP, SIM. Bagi yang tidak terdaftar dalam DPT namun penduduk Taput yang sudah berusia 17 tahun saat 10 Oktober 2013 lalu, dapat memilih dengan menunjukkan KTP dan KK. Dua hari sebelum pelaksanaan pemungutan suara Pilkada Taput putaran kedua, situasi di Kota Tarutung maupun Siborong-borong terlihat berjalan seperti biasa. Pergeseran pasukan pengaman Pilkada dari luar Tapanuli Utara, juga memberikan dampak kondusifitas jelang Pilkada putaran kedua ini. (a21)

Waspada/Bothaniman Jaya Telaumbanua

OKNUM Lurah Pasar Gunungsitoli berinisial WG ditetapkan sebagai tersangka judi sabung ayam dan digelandang petugas menuju ruang tahanan Mapolres Nias.

Senin (3/3) malam dan diduga kuat ikut bermain judi sabung ayam serta menyediakan tempat untuk arena judi sabung ayam. Kedua tersangka dijerat Pasal 303 KUHP dengan ancaman hukuman 10 tahun penjara. Kasat Reskrim melalui Kanit I Sat Reskrim Polres Nias, Ipda KS. Nasution yang dijumpai wartawan,Senin(3/3)membenarkan jika oknum Lurah Pasar Gunungsitoli,WG warga Jln. Ampera Gunungsitoli dan FN warga LingkunganVIIKel.IlirGunungsitoliresmi ditahankarenatertangkaptangan bermain judi sabung ayam di kediaman oknumWG saat petugas melakukan penggerebekan, Minggu (2/3). Ipda KS Nasution menjelaskan,selainWG,padapenggerebekan tersebut polisi juga ikut mengamankan tiga warga yang berinisial FN alias Marinus, Sua alias Kenziro dan FM alias Fa’a. Namun,darikeempatwargayang diamankan tersebut, Sua alias Kenjiro dan FM alias Fa’a tidak ditahan karena masih berstatus sebagaisaksidandikenakanwajib lapor dua kali seminggu selama kasus tersebut diproses di Mapolres Nias. (a25)

Polres Tanah Karo Tegur Pengguna 44 Mobil Pakai Rotator TANAH KARO (Waspada): Sat Lantas Polres tertulis dalam STNK, dan telah melanggar aturan Tanah hingga hari ketiga dicanangkannya Pekan yang berlaku. Pihaknya juga mengajak masyarakat untuk Tertib Berlalu Lintas oleh Direktorat Lalu Lintas melakukan teguran 44 kali terhadap pengguna meningkatkan kesadaran pengguna jalan guna mobil yang memasang lampu rotator yang tidak mentaati peraturan lalu lintas dan menjaga keselamatan berlalulintas serta menjadi “ Pelopor sesuai peruntukan. “Termasuk mobil dinas pemerintah (Pemkab) keselamatan berlalu lintas dan menjadikan yang tidak sesuai dengan aturan dan pemasangan keselamatan sebagai kebutuhan “ Kemudian melakukan koordinasi kepada stiker di body mobil yang tidak sesuai dengan warna dasar mobil yang tercantum di STNK,” instansi terkait, partai politik peserta kampanye kata Kasat Lantas Polres Tanah Karo AKP Toni guna agar pada saat pelaksanaan kampanye mentaati peraturan berlalu lintas dan juga kepada Irwansyah, SH, Senin (3/3). Dijelaskannya, pihaknya juga melakukan pihaksekolahsekolahgunamensosialisaikanadanya penindakan pelanggaran berupa tilang bagi Pekan Tertib Berlalu Lintas. (m39) pengendara yang melakukan pelanggaran yang berpotensi menyebabkan kemacetan / kecelakaanlalulintasdantidak memiliki dokumen sebanyak 52 tilang. Menurutnya, Sat Lantas Polres Tanah Karo dalam pelaksanaanPekanTertibBerlalu Lintas mengutamakan tindakanPreemtifdanPeventifserta Penagakan Hukum apalagi menjelang Pemilu Calon Legistatif tahun 2014. AKP Toni Irwansyah, SH mengimbau kepada masyarakatpemilikmobilpribadi maupun mobil penumpang Waspada/Ist umum tidak memasang stiker KASAT Lantas Polres Tanah Karo AKP Toni Irwansyah saat menutupi body mobil (Stiker Partai) karena tidak sesuai menindak pengendara yang menggunakan rotator di Berastagai, dengan warna mobil yang Senin (3/3).

Bupati Dan Warga Karimun Serahkan Bantuan 7 Truk Untuk Korban Sinabung KABANJAHE (Waspada): Pemerintah dan masyarakat Kab. Karimun Provinsi Kepuluan Riau mengimpun bantuan kemanusian untuk korbanbencanaerupsigunungSinabungKab.Karo. Bantuan tersebut diserahkan secara simbolis oleh Bupati Karimun DR H.Nurdin Basirun, S.Sos,M.Si, Senin (3/3) di kantor Bupati Karo Jalan Letjen Djamin Ginting.S, Kabanjahe diterima Sekdakab Karo dr. Saberina MARS. Bantuan kebutuhan para pengungsi Sinabung dari Pemkab dan masyarakat Kab. Karimun tersebut dibawa dengan meggunakan tujuh unit truk yang langsung dari Kab. Karimun. Sekdakab Karo atas nama Pemkab Karo dan masyarakat Karo menyampaikan terimakasih banyak. Sekdakab Karo mengatakan ,kondisi terakhir Gunung Sinabung masih dalam status Awas (Level IV) yang sudah berlangsung sejak

pertengahan November 2013. Sampai saat ini aktivitas kegempaan Gunung Sinabung masih tinggi, namun intensitasnya sudah mengalami penurunan. Sementara ini penduduk yang bermukim di radius 5 kilometer dari kawah gunung Sinabung masih tetap berada di pengungsian yang sampai 2 Maret berjumlah 15.873 jiwa atau 5002 Kepala Keluargayangberadadi33titikposkopengungsian. Bupati Karimun Nurdin Basirun mengatakan, kedatangannya berserta rombongan forum peduli bencana Sinabung terdiri dari perwakilan eleman masyarakat Karimun sebagai tanda keprihatinan dan turut perduli akan bencana Gunung Sinabung yang menimpa masyarakat Kab. Karo. Dia berharap bencana Sinabung segera berhenti dan masyarakat dapat kembali ke desanya masingmasing untuk memulihkan perekonomian. (c09)

Polres Simalungun Simulasi Pengamanan Pemilu PEMATANGSIANTAR (Waspada): Kepolisian Resort (Polres) Kabupaten Simalungun terpaksa meletuskan senjata api berkalikali dan akhirnya berhasil menggagalkan pencurian logistik pemilihan umum (Pemilu) legislatif dilakukan orang tidak dikenal (OTK). Adegan yang langsung diperagakan para personil Polres dan masyarakat itu merupakan bagiandarisimulasipengamanan Pemilu dilakukan Polres Simalungun di lapangan Kel. Serbelawan, Kec. Dolok Batunanggar, Senin (3/3) serta langsung disak-

sikan Bupati DR. JR. Saragih, SH, MM, Dandim 0207/Simalungun Letkol Inf Parluhutan Marpaung, Kapolres AKBP Andi Syahriful Taufik, SIK, M.Si, para pejabat Pemkab dan masyarakat. SimulasidipandupersonilSat Lantas Aiptu A. Simanjuntak dilaksanakan dalam lima adegan yang diawali adegan OTK yang mencoba memprovokasi warga di warung Wak Labu agar tidak menggunakan hak pilih. Bupati menyebutkan, pihaknya siap membantu pihak kepolisian dalam pengamanan Pemilu dengan mengerahkan

3.500 personil Satpol PP, Linmas dan Dishubkominfo. Kapolres menambahkan, pihaknya akan mengerahkan 665 personil kepolisian untuk mengamankan Pemilu dibantu personil Brimob, TNI, Satpol PP, Linmas, Dishubkominfo dan kelompok masyarakat. “Kami siap menghadapi segala kemungkinan yang bakal terjadi saat kampanye dan pelaksanaan Pemilu dan kami mengharapkan segala kemungkinan itu tidak terjadi serta daerah kita tetap aman dan kondusif,” ujar Kapolres. (a30/a29)

PLN WS2BJ Bantu Korban Sinabung KABANJAHE (Waspada): DPD SP dan Manajemen PT. PLN (Persero) Wilayah Sumsel, Jambi dan Bengkulu (PLN WS2JB) turut membantu pengungsi akibat erupsi Gunung Sinabung yang sampai sekarang berada di pengungsian UKA I – II. “Bantuan yang disampaikan kepada pengungsi erupsi Gunung Sinabung adalah hasil pengumpulan dari 1.100 pegawai PLNWS2JB dengan total Rp 94 juta. Semoga dapat meringankan beban saudarasaudara kita yang sedang ditimpa musibah,’’ ungkap Ketua DPD SP PLNWS2JBYan Herimen sebagai Ketua Tim Penyerahan bantuan didampinggi Manajer Rayon Kabanjahe, Tetty Tambunan kepada Waspada di sela-sela pemberian sumbangan, Sabtu (1/3). Yan Herimen menambahkan, sebelum berangkat ke Kab. Karo, General Manager PLN WS2JB Paranai Suhasfan menitipkan salam kepada seluruh pengungsi korban erupsi Gunung Sinabung dan mendoakan semoga penderitaan pengungsi segera berakhir. “Bentuk sumbangan yang dibagikan ke posko UKA I - II adalah berbentuk uang Rp84.630.000 yang dibagikan kepada 651 KK, dengan masing - masing mendapat uang saku Rp130 ribu per KK, dan sayurmayur yang bisa bertahan dalam berapa hari senilai Rp7 jutaan serta sedikit uang lelah bagi pengurus UKA I dan UKA II,’’ ujarnya. (c19)

Waspada/Dede Basri Hasibuan

BOCAHpengungsi Gunung Sinabung merindukan mainan, seperti para bocah pengungsi Sinabung di posko UKA I - II Kabanjahe, Kab. Karo. Mereka menyibukkan diri usai pulang sekolah dengan bermain seluncuran atau ayunan, ada juga memilih bermain bulutangkis.

Waspada/Edoard Sinaga

LOGISTIK Pemilu yang dicuri OTK berhasil diamankan dan OTK ditangkap pihak kepolisian, meski pihak kepolisian terpaksa melepaskan tembakan peringatan.

Waspada/Basita Bukit

BUPATI Kabupaten Karimun DR.H.Nurdin Basirun,S.Sos.M.Si menyerahkan secara simbolis bantuan untuk korban bencana erupsi G.Sinabung yang diterima oleh Sekdakab Karo dr Saberina MARS.

Rektor IAIN P. Sidimpuan Lantik 24 Pejabat P.SIDIMPUAN (Waspada): Rektor Institut Agama Islam Negeri (IAIN) Padangsidimpuan, DR. H. Ibrahim Siregar MCL, melantik 24 pejabat eselon III, IV dan Kepala Laboratorium (Kalab) baru di aula kampus setempat, Jalan HT Rizal Nurdin, Kel. Sihitang, Kec. Sidimpuan Tenggara, Kamis (27/2). Prosesi pelantikan diawali pembacaan Surat Keputusan (SK) oleh staf kepegawaian, Okta Yuandi Tobing S.Sos.I. Acara ini dihadiri para Wakil Rektor, Kepala Biro, Yulizar, dan segenap civitas akademika IAIN Padangsidimpuan. Rektor IAIN Padangsidimpuan, DR. H. Ibrahim Siregar MCL, menyebut mutasi dan rotasi jabatan adalah hal lumrah dalam sebuah organisasi. Pelantikan ini merupakan tindak lanjut dari peningkatan status STAIN Padangsidimpuan menjadi IAIN. “Pelantikan yang kita lakukan hari ini merupakan salahsatu proses penyesuaian terhadap peningkatan status IAIN yang dulunya STAIN Padangsidimpuan,” kata Ibrahim. Dijelaskannya, saat ini sudah ada tiga orang di Kementerian Agama Wilayah Prov. Sumatera Utara yang berstatus pejabat eselon IIa. Yakni Kepala Kemenag Sumut, Kabiro IAIN Sumut, dan IAIN Padangsidimpuan. “Dulu masih dua, KakanwilKemenagSumutdanKabiroIAINSumut saja,” jelasnya. Kepada para pejabat yang dilantik, Ibrahim minta agar dapat menjaga amanah dan tanggungjawab dengan baik. Jangan sampai bersinggungan

dengan hukum. “Bantu saya dalam memimpin organisasiiniagartujuankitabisaterwujud,”pintanya. Ke-24 pejabat yang dilantik itu antara lain, Kabag Akademik dan Kemahasiswaan, Drs. Hj. Rahmiati. Kabag Perencanaan dan Keuangan, Nasrul Halim Hasibuan SAg, Kabag Umum, Irwan Rojikin SAg, dan Kasubbag Perencanaan, Ali Murni SAg. Kasubbag Keuangan dan BMN, Khairul Umti Margolang SPd.I. Kasubbag AdministrasiUmumdanKeuangan Fakultas Syariah dan Ilmu Hukum, Sukerman SAg. Kasubbag Organisasi Kepegawaian dan Penyusunan Peraturan, Nurman Hasibuan SAg. Kasubbag Adm Umum dan Keuangan Fakultas Tarbiyah dan Ilmu Keguruan, Hidayaturrahman S.Sos. Kasubbag Akademik, Kemahasiswaan dan Alumni, Marondak Harahap, SAg. Kasubbag Administrasi Akademik Biro Administrasi Umum, Akademik dan Kemahasiswaan, Ratonggi SAg. Kasubbag TU Lembaga Penjamin Mutu, Ahmad Faisal SAg, Kasubbag Adm Umum dan Keuangan Fakultas Dakwah dan Ilmu Komunikasi, Wahyudin SE. Kasubbag Kemahasiswaan, Alumni dan Kerjasama Biro Adm Umum, Muhammad Rafki SHI. Kasubbag Akademik,Kemahasiswaan dan Alumni Fakultas Syariah dan Ilmu Hukum, Anni Suaidah Nasution SAg. Kasubbag TU dan Rumah Tangga Biro Adm Umum, Maharuddin Siregar SPdI, Kasubbag TU Lembaga Penelitian dan Pengabdian Masyarakat, Samiatun S.Pd. (a27)

Sumatera Utara


WASPADA Rabu 5 Maret 2014

Kampanye Di P. Sidimpuan Rawan Konflik P.SIDIMPUAN (Waspada): Kampanye Pemilu Legislatif 2014 di Kota Padangsidimpuan diprediksi rawan konflik karena jadwal kampanye rapat umum 18 hari yang dibuat KPU banyak mempertemukan dua partai berbeda pada hari yang sama di lokasi berdekatan. “Untuk meminimalisir peluang rawan konflik, KPU Padangsidimpuanseharusnyaharus arif dan bijaksana dalam menyusun jadwal kampanye sehingga lokasikampanyeyangberdekatan tidak digunakan pada hari yang sama,” kata Divisi Pengawasan Panwaslu P.Sidimpuan, Ahmad Effendi Nasution, S.Sos kepada Waspada, Selasa (4/3) di Kantor Panwaslu, Jalan Cempaka, P.Sidimpuan. Dikatakan, berdasarkan jadwal ditetapkan KPU 1 Maret 2014, tercatat 9 dari 18 hari waktu

kapanye mempertemukan dua partai berbeda pada hari yang sama di lokasi berdekatan dan delapan hari di antaranya menggunakan Alaman Bolak Padang Nadimpu dan Stadion HM.Nurdin/StadionNaposoyangberjarak tidak sampai 1 km. Kedua lokasi iniberadadiintiKotaP.Sidimpuan. Pada hari pertama kampanye 16 Maret 2014, katanya, Partai Hanura di Stadion HM Nurdin dan PBB di Alaman Bolak. 20 Maret 2014 PAN di Stadion HM Nurdin dan Golkar di Aalam Bolak, sebaliknya 28 Maret 2014 Golkar

di Stadion HM Nurdin dan PAN di Alaman Bolal. 22 Maret 2014 PKPI di Stadion HM Nurdin dan HanuradiAlamanBolak,23Maret 2014 PKs di Stadion HM Nurdin dan NasDem di Alaman Bolak, 24 Maret 2014 PPP di Stadion HM NurdindanPKPIdiAlamanBolak. 3 April 2014 PKB di Stadion HM Nurdin dan PDP-P di Alaman Bolak, 5 April 2014 Demokrat di StadionHMNurdindanGerindra di Alaman Bolak. “Selain Stadion HM Nurdin dan Alaman Bolak yang akan digunakan pada hari yang sama, Lapangan Bola Kaki Salambue dan Lapangan Perumnas Girya Purnama Jaya Pijorkoling ditetapkan untuk Demokrat dan PAN 30 Maret nanti. Jarak Pijorkoling dengan Salambue hanya dibatasi Desa Sigulang dan jarak kedua lokasi kampanye ini

hanya sekira 1 km,” kata Ahmad Effendi. Menurutnya, pembagian wilayah kampanye selain harus mengantisipasi peluang terjadinya benturan massa, juga harus didasarkan pada Daerah Pemilihan (Dapil) sehingga mendapat perlakuan yang sama. “Dari 12 lokasi kampanye tersebut, tujuh di antaranya berada di Dapil 2,” katanya. Menanggapi hal tersebut Ketua DPD PAN Kota P.Sidimpuan, H.Erwin Nasution, SH, MM mengatakan, KPU P.Sidimpuan harus bersikap arif dan bijaksana dalam menetapkan jadwal kampanyesebabtahuninimerupakan tahun politik dan dinamikanya dprediksi naik jika dibanding 2009. “Hal-hal seperti ini harus dihindariuntukmenekanpeluang konflik,” katanya.

Secara terpisah Ketua DPC PKPI Kota P.Sidimpuan Imam Gozali Harahap mengatakan, jadwal kampanye tersebut harus direvisi sehingga kekhawatiran partai politik maupun pihak lainnya bahwa jadwal tersebut mengundang kerawanan terjadinyakonflikdapatdihindari. “Saya yakin, semua sepakat jadwaltersebutdirevisi,”kataKetua DPC PKPI. Anggota KPU Kota P.Sidimpuan Muktar Helmi Nasution, mengatakan penyusuan jadwal dan lokasi kampanye tersebut melibatkat partai politik dan disinkronkan dengan jadwal dibuatKPUProvinsiSumut.“Dari 12 lokaksi lokasi kampanye yang diizinkan Wali Kota, masingmasing partai ditawarkan untuk memilih 6 lokasi, kemudian ditetapkan KPU,” katanya. (cml)

KPU P. Sidimpuan Terima Surat Suara Kurang 2.000 P.SIDIMPUAN (Waspada): Kertas surat suara yang diterima Komisi Pemilihan Umum (KPU) Kota Padangsidimpuan dari rekanan, PT. Macananjaya Cemerlang, hingga Selasa (4/3) masih 579.531 lembar. Sedangkan yang dibutuhkan untuk Pemilu Legislatif tahun 2014 ini 581.531 atau masih kurang 2.000 lagi. “Setelah kita hitung, kotak suara yang diserahkan rekanan juga masih kurang dua. Harusnya 584, tapi yang diserahkan baru 582 kotak. Mereka janji segera mengirimkan kekurangan tersebut,” kata Divisi Logistik, Hotma Rido Ranto Siregar, Sag, MSi. Ranto menjelaskan, 579.531 surat suara yang dikemas dalam 582 kotak itu diantar manajemen

PT. Macananjaya Cemerelang kekantorKPUPadangsidimpuan, Jalan Kenanga, Selasa (4/3) pagi. Selanjutnya, dibuatkan berita acara serah terima. Rincian surat suara yang diterima itu 147.632 lembar dan 149 kotak untuk DPRD Kota Padangsidimpuan. Nanti, katanya, akan didistribusikan ke daerah pemilihan (Dapil) 1 sejumlah 54.892 lembar tambah 1.000 lagi untuk persiapan pemilu ulang. Ke Dapil 2 sejumlah 43.112 tambah 1.000, dan Dapil 3 sejumlah 46.628 tambah 1.000. Selanjutnya untuk kertas dan kotak suara DPRD Provinsi DapilVII Sumatera Utara terjadi kekurangan 2.000 lembar dan 2 kotak. KPU Kota Padangsidimpuan baru menerima 142.633 lembar dan 143 kotak, seharus-

nya144.633lembardan145kotak. Untuk DPR RI Dapil Sumut II, yang diterima KPU Kota Padangsidimpuan sebanyak 144.633 lembar dan 145 kotak. Demikian juga untuk DPD RI Dapil Sumatera Utara, yang diterima sebanyak 144.633 lembar dan 145 kotak. Kenapa jumlah surat suara untuk DPRD Kota Padangsidimpuan lebih banyak dibanding DPRD Sumut, DPR RI, dan DPD RI. Kata Ranto, hal ini disebabkan pertambahan 3.000

lembar kertas suara untuk persiapan Pemilu Ulang di tiga Dapil Padangsidimpuan. “Khusus DPRD Kota Padangsidimpuan, ada pertambahan 3.000 lembar. Kertas suara ini kita persiapkan, mana tahu ada Pemilu Ulang. Jika semua lancar, kertas suara ini kita musnahkan. Dibuat berita acara dan disaksikan Muspida serta stake holder lainnya,” terang Ranto. Pantauan Waspada, kertas dan kotak surat suara Pemilu Legislatif tersebut masih berada

di KPU Padangsidimpuan. Direncanakan, hari itu juga akan diantar ke CV. Putra Mutiara di Kel. Padangmatinggi, Kec. Sidimpuan Selatan, sebagai rekanan yang melakukan pelipatan kertas suara. “Kita beri waktu 10 hari untuk pelipatan kertas suara. Setelah itu kita periksa berapa yang rusak. Pendistribusiannya akan dilakukan secara bertahap ke seluruh kecamatan, minimal sepekan sebelum pemungutan suara,” kata Ranto. (a27)

Pemkab Madina Latih Guru Magrib Mengaji PANYABUNGAN (Waspada): Dalam rangka memperingati HUT Madina ke-15 tahun 2014 dan memasyarakatkan program gerakan mabrib mengaji (gemmar mengaji), jajaran Pemkab Mandailing Natal melaksanakan pelatihan bagi guru di aula Masjid Agung Nur Ala Nur Aek Godang Panyabungan. Kepala Bagian Kesejahtraan Rakyat ( Kesra ) Setdakab Madina M.Taufik Lubis kepada Waspada, Sabtu (1/3) mengatakan, pelatihan yang diberikan kepada guru mengaji tersebut dengan sistem 24 jam yang langsung disampaikan narasumber Dr H Muhammad Roihan Lc, MA yang dikenal sebagai pencipta buku Al- Hira. “Kegiatan bertujuan untuk meningkatkan pengetahuan dan wawasan para guru mengaji tentang metode cara belajar Alquran yang mudah dipahami,” ucapya. Menurutnya,programGerakanMasyarakatMagribMengaji(Gemmar Mengaji),merupakanbudayamasyarakatKabupatenMandailingNatal, karena sejak dulu kebiasaan ini telah menjadi tradisi yang baik bagi syiar Islam sehingga perlu dikembangkan dengan baik. Magribmengajijugasangatpentingdalammelakukanpembinaan umat, karena pengetahuan beragama sudah mulai berkurang dengan adanya pengaruh teknologi. (a28)

Kadin Madina Silaturahmi Dengan Wartawan PANYABUNGAN (Waspada): Pengurus Kamar Dagang dan Industri Kabupaten Mandailing Natal (Madina) mengadakan silaturrahmi dengan wartawan yang bertugas di Madina khususnya yang aktif bekerjasama dengan Kadin. Pertemuan dilakukan di International Paya Loting Hotel, Sabtu (1/3). Hadir tokoh ulama Madina, H.Ismail Hakim Lubis (Oji Atas), Ketua KNPI Madina,OP2M, anggota DPRD Madina, Kapolsek Panyabungan, pengurus partai, aktifis, akademisi dan sejumlah pengusaha. Acara silaturahim Kadin dengan wartawan bersama rekanrekan lainnya secara khusus diadakan sebagai rasa bangga kepada Ketua Kadin Madina, Safaruddin Haji yang telah meraih Anugerah Indonesia Best Leadership Award 2014, dari Citra Prestasi Anak Bangsa tanggal 22 Februari 2014 di Jakarta. Demikian disampaikan DirekturEksekutifKadinMadina,OsrotNasution,SHkepada Waspada, di sela-sela berlangsungnya acara. Ketua Kadin Madina, Safaruddin Haji akrab disapa Akong dalam sambutan singkatnya mengatakan rasa bangga atas penghargaan diraih Kadin Madina, yang sebenarnya bisa tercapai berkat antusias danperanaktifKadindenganrekan-rekanwartawan,dalammenyikapi berbagaidinamikaberkembangditanahairbaikitubidangpendidikan, kehutanan perkebunan, kesehatan, serta perkembangan usaha di bidang lainnya yang menyangkut hajat hidup masyarakat banyak. “Karena itu, Anugrah Indonesia Best Leadership Award 2014 ini juga milik rekan-rekan jurnalis secara khusus, dan umumnya masyarakat Madina,” ucap Safaruddin Haji. Ia juga mengatakan, anugrah penghargaan yang diraih akan menjadi motivasi untuk berkarya lebih baik untuk bangsa, meski Anugrah Award 2014 merupakan prestasi, tapi sebenarnya menjadi “cambuk” bagi Kadin dalam kiprah tugasnya. (c14)

Seribuan Warga Madina Larut Dalam Zikir Dan Doa PANYABUNGAN (Waspada): Gema zikir dan doa bersama yang dipanjatkan seribuan warga dari berbagai penjuru Kabupaten Mandailing Natal, berkumandang di lapangan Aek Godang Kecamatan Panyabungan, Selasa (4/3). Kegiatan digelar dalam rangka memperingati Hari Jadi Kabupaten Mandailing Natal XV tahun 2014 sekaligus mensyukuri nikmat Allah SWT serta berharap terhindar dan dijauhkan dari segala bencana maupun marabahaya dari masyarakat daerah itu umumnya. “Acara hari ini merupakan acara zikir dan do’a bersama atas nikmat yang telah diberikan Allah SWT kepada kita, kemudian untuk keselamatan Madina ke depan, apalagi tahun ini kita akan dihadapkan kepada agenda penting yang harus disukseskan yakni pemilu legislatif 9 April 2014 mendatang,” kata Kabag Kesra Setdakab Madina M. Taufik Lubis, SH, MM didampingi Kabag Humasy dan Protokol Arbiuddin S Harahap disela-sela kegiatan tersebut. Selainzikirdandoa,kegiatanjugadiisitausyiah disampaikan Al Ustadz H. Muhammad Hasbi Al Mawardi Lubis, S.Ag dari Medan. Hadir dalam kesempatan itu yaitu Plt Bupati Madina Dahlan Hasan Nasution, ketua DPRD As Imran Khaitamy Daulay bersama unsur Muspida Plus, Kakan Kemenag H. Muksin Batubara, kepala-kepala SKPD, ketua MUI H. Syamsir Batubara, para caleg

, pimpinan parpol, pimpian pondok pesantren, majelis taklim, OKP, ulama, tokoh masyarakat, mahasiswa, santri dan pelajar dan masyarakat yang sengaja berdatangan dari berbagai penjuru daerah itu. Berdasarkan amatan Waspada, zikir dan doa ituhampirberjalantigajammulaipukul10:00hingga 13:00, di mana seribuan warga hanyut di bawah kalimat zikir. Gema asma Allah SWT menjadikan suasanapadahariitukhikmad,malahdiantarawarga yang hadir ada yang meneteskan airmata. PltBupatiMadinaDahlanHasanNasutiondalam kesempatan tersebut mengatakan, kegiatan zikir dan doa merupakan salahsatu upaya dalam membersihkan dan menghapus segala dosa dan salah. Tidak hanya itu, dengan zikir dan doa, kita bisamenyampaikansegalakeinginansertaharapan, baik untuk kehidupan dunia maupun akhirat. Ustadz Muhammad Hasbi Al Mawardi Lubis dalam tausyiahnya mengajak warga untuk memiliki tujuan hidup dan mendapatkan kebahagian dunia dan akhirat. Turut memberikan sambutan pada kesempatanituKakanKemenagMadinaH.Muksin Batubara dan ketua DPRD Ass Imran Khaitamy Daulay.Acarajugadiisidengansosialisasipemilihan umum legislatif 9 April 2014 yang disampaikan Ketua KPU Madina Agus Salam Nasution bersama komisionernya. (a28)

KPU Madina Umumkan Jadwal Kampanye PANYABUNGAN (Waspada): KPU Madina mengumumkanjadwal,lokasi,sekaligussosialisasi kampanye kepada peserta pemilu (partai politik) di aula Hotel Rindang, Minggu (2/3). Hadir Ketua KPU Madina Agus Salam bersama anggota Maskhairani,F.SyariefSH,AkhirMada,KetuaPanwas Henri S.sos bersama pengurus partai politik. Ketua KPU melalui Divisi Hukum dan Pengawasan F.Syarief SH mengatakan, acara sosialisasi ini untuk menentukan jadwal dan lokasi kampanye, atau rapat umum bagi Parpol, sekaligus menerangkan bagiaman tata cara berkampanye sesuai peraturan. Syarief mengatakan, KPU bersama Pemkab Madina bekerjasama dalam penentuan tempat untuk berkampnye dibagi kedalam 5 zona yakni zona 1 meliputi Panyabungan, Panyabungan

Polres Madina Simulasi Pengamanan Pemilu 2014 PANYABUNGAN (Waspada): Jajaran Polres Kabupaten Mandailing Natal (Madina) menggelar simulasi pengamanan pemilu legislatif dan presiden 2014, sebagai upaya antisipasi atas pelaksanaan pesta demokrasi lima tahunan di wilayah itu. Kegiatan simulasi dilakukan baru-baru ini dipusatkan di halaman Mapolres, dihadiri Kapolres AKBP Mardiaz KD, Sik, Mhum, Plt Bupati Madina diwakili Sekdakab HMYusuf Nasution, Kajari Panyabungan Satimin, SH, perwakilan Kodim 0212/TS, komisioner KPU, tokoh masyarakat serta undangan terkait lainnya. Dalam simulasi PAM pemilu itu, pengaman lebih ditekankan pada upaya antisipasi kemungkinan adanya aksi upaya menggagalkan pelaksaan pemilu, serta bentuk tindakan lain yang bisa berdampak pada kelancaran pelaksaan. “Kami dari institusi Polri menginginkan agar pelaksaan pemilu legislatif dan presiden di Madina berjalan sesuai harapan, dan tidak ingin pesta demokrasi ini terganggu,” kata Kapolres Madina AKBP Mardiaz. Sistem pengamanan, kata kapolres, akan ditekankan pada upaya antisipasiberbagaiteknikpengamanandanpengawalan.“Adabeberapa halyangmenjadipusatperhatianpolisidalammelakukanpengamanan yaknikantorKomisiPemilihanUmum(KPU),kantorPanitiaPengawas Pemilu (Panwaslu) serta kantor pelaksana pemilu di tingkat kecamatan dan desa,” sebutnya. Sekdakab Madina M. Yusuf Nasution dalam kesempatan itu menyampaikan rasa salut dan bangga melihat kesiapan Polres Madina dalam menghadapi pemilu legislatif dan presiden 2014 itu. (a28)

Waspada/Munir Lubis

SERIBUAN warga Kab. Mandailing Natal (Madina) larut dalam zikir dan doa bersama dalam rangka menyambut HUT ke-15 Madina di Lapangan Aek Godang Kec. Panyabungan, Selasa (4/3).

Waspada/Sukri Falah Harahap

KERTAS SUARA: Pegawai sekretariat KPU Kota Padangsidimpuan membongkar serta menyusun kertas dan kotak suara yang dihantarkan PT. Macananjaya Cemerlang, Selasa (4/3). KPU baru menerima 579.531 lembar dari 581.531 kertas suara yang dibutuhkan.

IAIN P.Sidimpuan Berharap Kerjasama Dengan Waspada Ditingkatkan P. SIDIMPUAN(Waspada): Institut Agama Islam Negeri (IAIN) Padangsidimpuan berharap kerjasama dengan Harian Waspada terus ditingkatkan karena ilmu jurnalistik sangat berperan dalam pengembangan wawasan, bukan hanya terhadap mahasiswa tapi termasuk pada dosen. Dekan Fakultas Dakwah dan Ilmu Komunikasi, Fauziah Nasution,MAdidampingiWakilDekan I Dr.JuniWati Sri Rizki, S.Sos,MA, Wakil Dekan III, Fauzi Rizal,MA, Kajur Ilmu Komunikasi, Ali Amran, M.Si dan Kepala Laboratorium, Barkah Hadamean mengatakan hal tersebut, Jumat (28/2) saat menjemput tujuh mahasiswa yang melaksanakan Praktik Dakwah Lapangan (PDL) dari 6 sampai28Februari2014diKantor Biro Perwakilan Harian Waspada Wilayah Tapanuli, Jalan Imam Bonjol, P.Sidimpuan Kerjasama dengan Harian Waspada selama ini, katanya, sudahcukupbaikterutamadalam pengembanganFakultasDakwah dan Ilmu Komunikasi.Pada 2013, mahasiswa IAIN yang PDL di Kantor Biro Perwakilan Harian

Waspada Wilayah Tapanuli lima orang, namun pada 2014 meningkatmenjaditujuhmahasiswa. Pendidikanjurnalistik,terutama secara teknis bukan hanya dibutuhkan mahasiswa tapi para dosen juga sangat membutuhkannya.”Kita telah mengusulkan kepada Rektor IAIN P.Sidimpuan, Dr. Ibrahim Siregar, MCL untuk melaksanakankegiatanjurnalistik bukan hanya kepada mahasiswa namun juga di berikan kepada para dosen,” katanya Kepala Biro Harian Waspada PerwakilanTapanuli, Syarifuddin Nasution didampingi Mohot Lubis dan Sukri Falah Harahap menyambut baik harapan IAIN Padangsidimpuan untuk terus meningkatkan kerjasama pengembangan ilmu jurnalistik, terutama di wilayah Tabagsel. Jika dilihat dari hasil mahasiswa IAIN yang PDL di Waspada, katanya, banyak generasi muda di daerah ini yang memiliki bakat untuk menulis di media namun tidak dikelola dan dikembangkan dengan baik, terbukti banyak tokoh pers yang berasal dari Tabagsel.”Kegiatan jurnalis yang diperolehharustetapdiasahkare-

na ilmu jurnalistik merupakan gabungan dari beberapa bidang ilmu,” katanya. Harian Waspada, katanya, banyak memberikan ruang kepadaperguruantinggiterutama pada Perguruan Tinggi Islam untukmenuangkankaryatulisnya seperti pada kolom opini dan MimbarJumat.”Kolominiterbuka bagi umum dan jika dosen IAIN mampu mengisi kolom tersebut, akan sangat bermamfaat bagi masyarakat,” kata Syarifuddin. Ketua kelompok mahasiswa PDL di Kantor Waspada Wilayah Tapanuli, Latif Kahfi mengatakan, kegiatan PDL banyak memberikan pengalaman pada mahasiwa karena selain mendapatkan teori, juga terjun langsung ke lapangan untuk mengumpulkan data dan peraktik membuat tulisan dan berita. Sebelumnnya, Kamis (27/2), pihak IAIN Padangsidimpuan telah menjemput 24 mahasiswanya dari Kantor Kementerian Agama Kota Padangsidimpuan yang dilepas Kakan Kemenag, Drs. Efri Hamdan Harahap bersama Kasi Bimas Islam, Syahrial, S. Ag. (cml/a26)

Barat dan PanyabunganTimur. Zona II Kecamatan Puncak Sorik Marapi, Kotanopan, Tambangan, Ulu Pungkut dan Muara Sipongi. Zona III meliputi Kec. Panyabungan Selatan, Lembah Sorik Marapi, Batang Natal, Lingga Bayu dan Ranto Baek. Zona IV Kec. Sinunukan, Batahan, Natal dan Muara Batang Gadis. Zona V meliputi Kec. Siabu, Bukit Malintang, Panyabungan Utara, Hutabargot dan Nagajuang. “Sedangkan rapat umum dimulai 15 Maret5 April 2014, dengan jadwal empat partai politik per zona per harinya untuk kampanye. Dalam setiap kecamatan itu ada beberapa titik yang ditetapkan sebagai lokasi. Karena itu kita berharap kepada peserta pemilu agar benar-benar mematuhi semua peraturan dan tetap menjaga kondusifitas,” ucap Syarif. (c14)

Pemkab Dinilai Tak Serius Benahi SKPD Padanglawas SIBUHUAN ( Waspada): Pemerintah Kabupaten (Pemkab) Padanglawas (Palas) dinilai tidak serius membenahi Satuan Kerja Perangkat Daerah (SKPD) di lingkungan Pemkab Padanglawas, melakukan reformasi birokrasi sesuai tuntutan peraturan daerah (Perda) No 03 tahun 2009 dan PP 41 tahun tahun 2007 tentang struktur perangkat daerah. Demikian H. Erwin Hamonangan Pane, SH, MH, Sekretaris Komisi A DPRD Kabupaten Padanglawas kepada Waspada, Kamis (28/2), bahwa Pemkab Padanglawas dinilai tidak serius melakukan reformasi birokrasi dalam mendukung program kerja dan kegiatan Pemkab Padanglawas.Terlebih mengawali periode kedua kepemimpinan Bupati H. Ali Sutan Harahap (H.TSO) untuk tahun 2014-2019, perlu segera dilakukan pembenahan dan perbaikan dalam penempatan jabatan struktural di lingkungan Kabupaten Padanglawas. Karena, kata dia, masalah jabatan rangkap dan kualitas pejabat strukturan merupakan persoalan serius yang tidak bisa dianggap sepele, sebab sangat berpengaruh terhadap jalannya program kinerja pemerintahan dalam hal pelayanan birokrasi, pembangunan dan kemasyarakatan yang merupakan tugas dan tanggungjawab Bupati dan Wakil Bupati selaku kepala daerah, maka perlu dilakukan seleksi terhadap calon pejabat struktural yang akan ditempatkanagardisesuaikandengankompetensi yang dimiliki pejabat yang akan dipromosikan. Hal ini sangat erat kaitannya dengan pelaksanaan visi-misi yang disampaikan Bupati danWakil Bupati di DPRD dan saat kampanye, sehingga sangat dibutuhkan Sumber Daya Manusia (SDM) Pegawai Negeri Sipil (PNS) yang baik dan andal. BilaSDMPNSKabupatenPadanglawasdinilai kurang mampu, maka DPRD menyarankan agar merekrut calon pejabat struktural dari daerah lain yang telah dianggap berhasil. Jangan sampai terus mempertahankan dan membiarkan pejabat

Padanglawas dengan jabatan rangkap, karena dinilai akan membuka lebar peluang Korupsi Kolusi dan Nepotisme (KKN). Ada sejumlah pejabat yang rangkap jabatan di Pemkab Padanglawas, seperti Kaban BKD, Saiful Bahri, SH yang merangkap jabatan sebagai Plt Sekdakab, Kabag Tapem, GT. Hamonangan Daulay, S.Sos, MM merangkap Plt Asisten I, Asisten II, Drs.Choirul Insan Harahap merangkap Plt Kadispora, Asisten III, Drs. H. Hamzah Hasibuan merangkap Plt Sekretaris DPRD, dan Sekretaris Bappeda, Yanni Nurlina, SP merangkap Plt Ka Bappeda. Begitu juga dengan Plt Kadis Perhubungan, Amirhan Pasaribu, Plt Direktur Rumah SakitUmumDaerah(RSUD)SibuhuandanCamat Sosa Drs. H. Agus Salim Nasution yang menurut peraturan jabatan pelaksana tugas itu hanya enam bulan dan maksimalnya satu tahun, tetapi di lingkungan Pemerintahan Padanglawas kondisi ini merupakan hal biasa. Karena itu, DPRD Kabupaten Padanglawas mendesak Pemerintah Kabupaten Padanglawas dibawahpimpinanBupatiH.TSOdanWakilBupati Zarnawi supaya segera melakukan penataan kembali pejabat struktural di lingkungan Pemkab Padanglawas. Bagaimanapun yang lebih penting menghilangkan ekses dan pengaruh pemilihan kepala daerah (Pilkada) yang dinilai adanya keterlibatan oknum PNS, sehingga beberapa PNS d- nonjob-kan, karena dinilai mendukung salahsatu pasangan calon saat pilkada. Setelah pelantikan tidak ada lagi pasangan bupati/wakil bupati partai pengusung dan pendukung, tetapi bupati dan wakil bupati dari masyarakat Kabupaten Padanglawas, katanya. Sebelumnya Bupati Padanglawas H.TSO, ketika dipertanyakan terkait masalah jabatan rangkap dan pembenahan SKPD jajaran Pemkab Padanglawas, katanya hal itu telah menjadi perhatian serius, tetapi perlu pertimbangan matang agar tidak mempengaruhi jalannya program dan kinerja pemerintahan. (a33)

Jelang Pileg 2014

Muslimat NU Palas Nyatakan Netral


KEPALA Biro Waspada Wilayah Tapanuli, Syarifuddin Nasution (tengah pakai lobe), Dekan Fakultas Dakwah dan Ilmu Komunikasi, Fauziah Nasution, MA (tiga dari kanan) bersama dosen dan mahasiswa diabadikan di Kantor Perwakilan Waspada Tapanuli.

SIBUHUAN (Waspada): Ketua Muslimat Nahdlatul Ulama (NU) Padanglawas (Palas) Linda Suriyani Hasibuan menyatakan organisasi keagamaan wanita muslim tersebut tetap netral dalam pemilihan umum legislatif (pileg) 2014. “Muslimat NU Palas tidak kemana-mana, tapi di mana-mana, juga tidak melarang bila ada anggotanya ikutuntukberpolitik,” ujarLinda pada pelantikanpengurusMuslimatNUKec.Barumun, di Asrama Haji Sibuhuan, Minggu (2/3). Ia mengatakan, tidak ada larangan anggota Muslimat NU untuk mendukung salahsatu partai atau calon legislatif. Katanya, Muslimat NU memberikan kebebasan anggotanya untuk memilih dalam Pemilu legislatif yang akan datang. “Yang jelas, secara organisatoris dan sesuai dengan AD/ART Muslimat NU Netral,meskipun Partai Kebangkitan Bangsa (PKB) terlahir dari tubuh Organisasi NU,” tegas Linda yang juga salahsatu caleg dari PKB untuk dapil empat Palas. Dikatakan, Muslimat NU telah terbentuk di seluruh Padanglawas yang terdiri dari 12

kecamatan dan telah melantik ranting di 53 desa. Upaya pelebaran sayap tersebut akan terus dikembangkan hingga ke seluruh desa dan kelurahan di Palas. “Saat ini tidak hanya berjuang untuk bidang keagamaan saja, tetapi juga harus berjuang secara cerdas, tuntas dan ikhlas,” ujarnya. Acara disatukan dengan pengukuhan pimpinan Multazam Haji dan Umroh Cabang Padanglawas tersebut dihadiri tokoh NU Sumut yang juga pimpinan Multazam Haji dan Umroh Pusat Dr H Syafii Siregar MA. Dalam kesempatan itu, Dr Syafii mengatakan agar warga NU jangan tergiur ataupun terjebak dengan politik uang, karena jika sudah tergiur atau terjebak dengan politik uang maka idealisme untuk mendudukkan pemimpin negara dan legislatif yang jujur akan sirna. Hadir dalam kesempatan itu, Ketua MUI Palas H Sehat Muda Hasibuan LC, Sekretris MUI Palas Drs H Arisuddin Nasution, sejumlah pengurus MUI Kecamatan serta ratusan warga dan anggota Muslimat NU Palas. (a34)

Ekonomi & Bisnis

WASPADA Rabu, 5 Maret 2014

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.682 9.269 10.477 16.147 3.230

Beli 11.518 9.023 10.184 15.805 2.964

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.600 9.160 10.375 15.983 3.121





Beli 11.550 9.110 10.305 15.903 3.051

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.690 9.457 10.594 16.251 3.297

Beli 11.540 8.857 10.094 15.751 2.897

Mata Uang Jual Dolar AS 11.654 Dolar Singapore 9.194 Dolar Australia 10.388 Euro 16.061 Real Arab Saudi 3.107

Beli 11.538 9.097 10.280 15.897 3.076


IMPOR APEL Pedagang memeriksa buah apel impor sebuah toko buah di Jakarta, Selasa (4/3). Menurut laporan Badan Pusat Statistik (BPS), Indonesia mengimpor Apel sebanyak 9.428 ton atau senilai Rp 129 Miliar di Awal 2014.

Awal 2014, Indonesia berturut-turut dilanda beberapa musibah bencana alam di beberapa daerah. Hal tersebut tidak hanya mengancam stabilitas sosial, ekonomi masyarakat sekitar daerah bencana terancam tak bisa bangkit kembali.

30 Unit Bus Angkutan Umum Mebidang Direncanakan Akan Beroperasi MEDAN (Waspada) : Lebih kurang 30 unit bus angkutan umum Mebidang (Medan-Binjai dan Deliserdang) direncanakan akan beroperasi akhir 2014. Bus seperti angkutan Trans Jakarta ini diperkirakan kondisinya akan lebih nyaman, tepat waktu serta jaminan keamanan bagi penumpangnya, mengambil rute Binjai-Pusat Pasar, Pusat Pasar-Deliserdang melalui halte khusus. Demikian penegasan Kadis Perhubungan Sumut Anthoni Siahaan, SE, ATD, MT saat memimpin rapat dihadiri Rivman Ginting, pejabat Direktorat Angkutan Darat Dephub, para Ketua Organda Sumut, Medan, Binjai dan Deliserdang, Wakil Dirlantas Sumut AKBP Sujarno dan pejabat lainnya. Dalam pembahasan di ruang pertemuan Dishub Sumut Jln. Imam Bonjol Medan, mewakali Ketua Organda Sumut Washington Sibarani maupun Ketua Organda Deliserdang Frans Simbolan dan Ketua Organda Kota Medan Month Gomery Munthe menyatakan bingung. Masalahnya baru kali ini mereka dipanggil ikut rapat bersama membicarakan masalah itu. “Yang mereka takutkan, rute-rute yang selama ini digunakan angkutan umum bakal dilindas bus Mebidang, makanya mereka menolak kehadiran angkutan itu,” kata Sibarani. Begitupun Kadishub menjelaskan, semua persoalan yang terjadi di lapangan akan diselesaikan secara musyawarah dan bijaksana, sementara bus Mebidang mempunyai rute khusus dan tidak akan mengganggu angkutan

umum yang selama ini beroperasi. Kadishub Sumut didampingi Darwin Purba, ATD, MT, Kabid Darat Sumut menyatakan, program pemerintah ke depan setiap kota berpenduduk lebih kurang 1 juta orang harus ada angkutan bus umum seperti Trans Jakarta di Jabodetabek, dan enam kota lainnya yaitu Bandung, Jogya, Bali, Makassar maupun Palembang. Sementara Kota Medan saat ini penduduknya hampir 3 juta orang sewajarnya mempunyai angkutan handal, aman dan nyaman hingga sampai di tujuan. “Jadi, dalam menyikapi padatnya penduduk, perlu kepedulian kita semua untuk mengatasi angkutan kota,” kata Kadishub Sumut. Rivman Ginting mengimbau para pejabat Organda agar saling memahami dan mendukung kelancaran angkutan jalan ke depan di jajaran Mebidang. Pemerintah telah membeli l ebih Kurang 30 unit bus baru itu , dan nantinya akan ditawarkan ke pihak swasta melalui tender . ‘’ Bisa saja jajaran angkutan di Sumut berpeluang mengoperasikan. Keuntungan itu nantinya akan dikembalikan ke pemerintah,’’ kata Ginting. Sementara dukungan yang sama juga disampaikan Wakil Dirlantas Sumut AKBP Sujarno yang mengharapkan agar jajaran Organda di Mebidang dapat mendukung beroperasi angkutan bus penumpang umum ini. “Semua permasalahan angkutan di jalan raya akan diselesaikan dengan baik,” kata Sujarno. (m32)

Curah Hujan Rendah, Petani Bergairah Tanam Bawang Merah

OJK Pastikan Akses Keuangan Korban Bencana Tetap Terbuka MEDAN (Waspada):


Otoritas Jasa Keuangan (OJK) sebagai regulator industri keuangan merespon cepat hal tersebut. Akses keuangan kepada pelaku usaha yang terdampak bencana dipastikan tetap terbuka. Pada 22 Januari lalu, OJK telah mengeluarkan Keputusan Dewan Komisioner OJK mengenai hal tersebut. Aturan itu pada intinya memberikan kelonggaran dalam penetapan kualitas kredit dan pemberian kredit baru perbankan kepada debitur yang terkena dampak bencana alam. Ketua Dewan Komisioner

Pasokan Solar Subsidi Masih Aman MEDAN (Waspada): Pasokan solar subsidi di wilayah Sumatera Utara masih aman, begitu juga dengan konsumsi BBM solar subsudi tersebut belum ada peningkatan, meskipun pemakaian genset meningkat. Sedangkan peningkatan konsumsi terjadi pada BBM jenis premium sekitar 3 persen. Hal tersebut dikatakan External Relation Marketing Operation Region I Pertamina Fitri Erika, menjawab pertanyaan wartawan seputar peningkatan pemakaian genset akhir-akhir ini yang disebabkan pemadaman listrik di Sumut. Menurut Erika, hal tersebut dikarenakan, pemakaian genset masih didominasi industri atau pelaku usaha yang tidak memakai solar subsidi, tetapi menggunakan solar non subsidi. “Saat ini belum ada perubahan pada penyaluran pada BBM subsidi serta tidak ada permintaan yang terlalu besar dari masyarakat,” ujarnya kepada wartawan, kemarin. Dia menyebutkan, untuk rata-rata penyaluran BBM subsidi di Sumut jenis premium sebanyak 4.500 kiloliter/hari dan solar 2.900 kiloliter/hari melalui 318 SPBU dan 20 agen premium dan solar (APMS). “Untuk Februari ini peningkatan konsumsi hanya pada premium sekitar 3 persen. Sedangkan solar tetap dibandingkan Januari yakni sekitar 87.000 kiloliter perbulannya,” kata Erika. Sementara untuk kuota BBM subsidi 2014, kata Erika, secara nasional total premium dan solar 47,3 juta kiloliter. Namun secara detail per provinsi dan kabupaten/kota masih dirangkum oleh korporat mengacu data dari BPH Migas. Sedangkan data kuota BBM subsidi tahun 2013 kemarin dari PT Pertamina saja untuk realisasi BBM bersubsidi di Sumut yakni premium maupun solar masih di bawah kuota BBM yakni premium 1,7 juta kiloliter dengan realisasi 1,6 juta kiloliter atau sekitar 96 persen. Serta untuk solar kuota 1,109 juta kiloliter dengan realisasi 1,100 juta kiloliter atau 99 persen. (m41)

Dihantam Profit Taking, IHSG Berhasil Menguat Ke 4.601 MEDAN (Waspada): Walaupun Indeks Harga Saham Gabungan (IHSG) melemah siang tadi, namun sore ini IHSG ditutup di zona positif. IHSG berhasil menguat ke level R4.601,28. IHSG ditutup naik 17,08 poin atau 0,37 persen menjadi 4.601,28. Indeks LQ45 naik 2,02 poin atau 0,3 persen menjadi 771,79, Jakarta Islamic Indeks (JII) menguat 1,07 poin atau 0,2 persen menjadi 620,05, dan indeks IDX30 naik 1,09 poin atau 0,3 persen ke 396,03. Sementara di Asia, indeks Nikkei menguat 69 poin atau 0,5 persen ke 14.722, indeks Hang Seng menguat 157 poin atau 0,7 persen ke 22.658, dan indeks Straits Times naik 0,5 persen ke 3.101. Menutup perdagangan, 181 saham menguat, 121 saham melemah, dan 89 saham bergerak stagnan. Sore ini, telah terjadi transaksi sebesar Rp5,033 trilliun dari 4,056 miliar lembar saham diperdagangkan. Sektor-sektor penopang IHSG mayoritas meningkat, namun, sektor perkebunan, industri dasar, konsumsi, infrastruktur, dan manufaktur melemah. Adapun saham-saham yang bergerak di jajaran top gainers, antara lain saham PT Indo Tambangraya Megah Tbk (ITMG) naik Rp475 ke Rp25.875, saham PT Bank Mega Tbk (MEGA) naik Rp430 ke Rp2.430, dan saham PT Adira Dinamika Multi Finance Tbk (ADMF) naik Rp300 ke Rp10.475. Sedangkan saham-saham yang berada dalam jajaran top losers, antara lain saham PT Multi Bintang Indonesia Tbk (MLBI) turun Rp25.000 ke Rp1.060.000, saham PT Tigaraksa Satria Tbk (TGKA) turun Rp500 ke Rp1.800, dan saham PT Gowa Makassar Tourism Development Tbk (GMTD) turun Rp375 ke Rp5.200. (okz)

OJK, Muliaman D Hadad dalam keterangannya memaparkan, saat ini aturan tersebut berlaku untuk para pelaku usaha di sekitar Gunung Sinabung di Kabupaten Karo dan di Kota Manado Sulawesi Utara. Kebijakan serupa untuk bencana erupsi Gunung Kelud. “Saat ini, kami sedang meneliti dan mendalami bersamasama dengan perbankan nasional mengenai kondisi para nasabah di daerah-daerah yang terkena dampak langsung bencana erupsi Gunung Kelud ini,” ungkapnya. Dikutip dari aturan tersebut, perlakuan khusus tersebut secara garis besar yaitu: 1. Kredit dengan plafon maksimal Rp5

miliar yang disalurkan untuk debitur atau proyek yang berada di lokasi tersebut, penetapan kualitas kreditnya hanya akan didasarkan pada ketepatan membayar, tidak perlu memperhitungkan dua parameter lainnya yaitu prospek usaha dan kondisi keuangan. 2. Begitu juga dengan kualitas kredit yang di restrukturisasi akibat bencana alam, tanpa membedakan besarnya plafon kredit, kualitas kreditnya akan ditetapkan lancar sejak restrukturisasi sampai dengan tiga tahun setelah terjadinya bencana, baik untuk kredit yang disalurkan sebelum maupun sesudah bencana. 3. Selanjutnya untuk men-

dorong ketersediaan akses terhadap kredit perbankan, maka bank dapat memberikan kredit baru kepada debitur yang terkena dampak bencana alam dan kualitas kreditnya dinilai secara terpisah dengan kualitas kredit yang telah ada sebelumnya. 4. Perlakuan khusus penilaian kualitas kredit dan penyaluran kredit ini juga berlaku bagi penyediaan dana berdasarkan prinsip syariah. Adapun, kebijakan ini akan berlaku selama tiga tahun terhitung sejak tanggal terjadinya bencana atau sejak ditetapkan oleh Keputusan Dewan Komisioner OJK dan dapat dipertimbangkan untuk diperpanjang jika diperlukan. (vvn)

MEDAN (Waspada): Curah hujan yang masih rendah akibat musim kemarau yang melanda kawasan Kota Medan dan sekitarnya sejak akhir Januari kemarin, membuat petani khususnya asal Marelan semakin merasa bergairah untuk menanam bawang merah di lahan pertaniannya. Marlian, Ketua Kelompok Tani Anugrah, Linkungan XXVII, Kelurahan Rengas Pulau Marelan menyebutkan, rendahnya musim penghujan dan tingginya tingkat kekeringan sangat baik untuk tanaman bawang merah khususnya bagi varietas tuktuk. “Dengan musim kering yang terjadi belakangan ini, banyak petani termasuk saya memilih untuk menanam bawang merah. Sebab, cuaca seperti ini sangat bagus bagi pertumbuhan bawang merah apakah itu varietas brebes maupun tuktuk,” ujar Marlian kepada wartawan kemarin.

Pria yang akrab disapa Ian ini mengatakan, apabila bawang merah ditanam pada musim penghujan, kondisinya akan mudah membusuk. Sehingga tak jarang, kegagalan dalam memproduksi bawang merah sangat rentan terjadi dengan iklim tersebut. “Kalau musim hujan, kita harus memakai mulsa untuk menutupi tempat dimana tanaman bawang itu ditanam. Sebab apabila tanahnya basah, tanah akan berenzim. Namun, hal itu juga belum menjamin apakah bawang merah tidak akan busuk atau tidak,” jelasnya. Menurutnya, hal tersebut berangkat dari pengalaman sebelumnya, yang menanam di musim cuaca dengan curah hujan tinggi. Hasilnya, hampir seratus persen tanaman bawang merah yang ditanam gagal panen. “Sejak Februari, kami sudah kembali menanam bawang merah. Hasilnya cukup bagus, berbeda dengan sebelumnya,” ungkapnya.(m41)

Harga Beras Rp160.000 Per Zak BANDA ACEH (Waspada): Harga beras lokal di pasar tradisional Banda Aceh masih bertahan mahal. Bahkan saat ini harga di tingkat pengecer sudah m e n e m b u s R p. 1 5 0 . 0 0 0 Rp.160.000/zak (15 kg). Para ibu rumah tangga yang sedang berbelanja di pasar induk itu mengeluh. Seorang pembeli, Nurhayati,57, warga Lamlagang, Kota Banda Aceh, Selasa (4/3) kepada Waspada mengatakan, harga beras saat ini cukup mahal. Kenaikannya sudah terjadi sejak Desember tahun lalu, namun hingga memasuki Maret 2014 harganya belum juga turun. Padahal sebagian kecamatan penghasil beras sudah mulai dan selesai panen.

Menurut Nurhayati, mahalnya harga beras lokal menyebabkan daya beli jadi menurun, sebab kebutuhan bukan hanya beras masih banyak yang lain yang harus dipenuhi bahkan mendesak, katanya. Setelah beras lokal, kenaikan harga juga terjadi pada beras kemasan yang didatangkan dari luar daerah, yakni Rp.135.000 per zak (15 kg), padahal sebelumnya sekira Rp.115.000/ zak. Roslinda, juga mengaku, mereka lebih terbiasa membeli beras lokal karena langsung dari produksi petani di daerah itu atau kualitasnya lebih bagus. Masih di pasar Banda Aceh dan Aceh Besar, salah seorang pedagang beras, Mahmud,58, dikonfirmasi kemarin, membe-

narkan harga beras masih mahal. Dia mengaku membeli dari petani atau pemilik Kilang Padi juga sudah mahal mencapai Rp.135.000-Rp.140.000/zak. Sehingga wajar jika harga jual di tingkat pengecer juga mahal, kan belum dihitung ongkos angkut dari kecamatan, “katanya. Menurut pedagang tersebut, diduga tingginya harga beras di pasaran saat ini karena pasokan dari petani kurang. Sebab berbagai hal seperti gangguan penyakit pada tanaman padi sawah dan kekeringan, dan juga adanya pengalihan fungsi sawah terhadap tanaman lain seperti jagung atau tanaman semusim lainnya.(b09)

Impor Sumut Naik 11,29 Persen MEDAN (Waspada): Nilai impor melalui Sumatera Utara Januari 2014 atas dasar CIF (cost, insurance & freight) mencapai 437,66 juta dolar AS, atau naik sebesar 11,29 persen dibanding Desember 2013 sebesar 393,27 juta dolar AS. Demikian pula bila dibandingkan dengan bulan yang sama tahun sebelumnya, angka impor Januari 2014 mengalami peningkatan sebesar 7,98 persen, yakni dari 405,33 juta dolar AS pada Januari 2013 menjadi 437,66 juta dolar AS pada Januari 2014. “Dari total impor Sumut tersebut, didominasi kelompok bahan baku/penolong 63,83 persen atau senilai 279,35 juta dolar AS, barang konsumsi 21,59 persen (94,49 juta dolar AS), barang modal sebesar 14,58 persen (63,83 juta dolar AS),” kata Kepala Bidang (Kabid) Statistik Distribusi Badan Pusat Statistik (BPS) Sumut Bismark Saor Pardamean, Senin (3/3). Bismark menyebutkan, menurut golongan penggunaan barang, kelompok bahan baku penolong mengalami peningkatan sebesar 19,48 persen atau naik dari 233,81 juta dolar AS menjadi 279,35 juta dolar AS,

barang modal meningkat 11,93 persen atau naik dari 57,03 juta dolar AS menjadi 63,83 juta dolar AS, sedangkan barang konsumsi turun dari 102,44 juta dolar AS menjadi 94,49 juta dolar AS (-7,76 persen). “Nilai impor terbesar Januari 2014 berasal dari golongan barang bahan bakar mineral mencapai 141,17 juta dolar AS, disusul golongan barang mesin/ peralatan listrik sebesar 35,45 juta dolar AS, dan ampas/sisa industri makanan 32,76 juta dolar AS,” ujarnya. Bahan bakar mineral mengalami peningkatan 38,80 persen; mesin/peralatan listrik naik 44,67 persen; plastik dan barang dari plastik naik 51,40 persen; mesin-mesin/pesawat mekanik naik 32,19 persen. Gula dan kembang gula naik 76,18 persen; pupuk naik 27,53 persen; gandum-ganduman naik 21,13 persen; serta besi dan baja naik 0,21 persen. Masih Surplus Meskipun nilai impor Sumut mengalami kenaikan, namun neraca perdagangan luar negeri Sumatera Utara Januari 2014 masih mengalami surplus sebesar 282,45 juta dolar AS. “Meski surplus, neraca

perdagangan luar negeri Sumut mengalami penurunan sebesar 25,40 persen dibandingkan dengan bulan sebelumnya yang mencapai 378,61 juta dolar AS,” ujar Bismark. Begitu juga dengan bulan yang sama tahun sebelumnya, surplus nilai neraca perdagangan luar negeri Sumut mengalami penurunan hingga 36,11 persen, yaitu dari 442,13 juta dolar AS pada Januari 2013 menjadi 282,45 juta dolar AS Januari 2014. Surplus terbesar neraca perdagangan luar negeri Sumatera Utara dengan negara mitra utama selama Januari 2014 adalah dengan Jepang senilai 51,29 juta dolar AS, dengan Amerika Serikat senilai 44,00 juta dolar AS, dengan China senilai 39,38 juta dolar AS, dengan Belanda senilai 39,14 juta dolar AS, dan dengan Turki senilai 28,27 juta dolar AS. “Sedangkan yang mengalami devisit terbesar adalah dengan negara Singapura yaitu senilai 118,00 juta dolar AS, Malaysia senilai 40,44 juta dolar AS, Argentina 20,19 juta dolar AS, dengan Thailand senilai 20,07 juta dolar AS, dan dengan Australia senilai 15,48 juta dolar AS,” pungkasnya. (m41)

Waspada/Surya Efendi

PERMATA PIALA DUNIA: Empat penari menyemarakkan peluncuran program total hadiah Rp10 miliar dan nonton Piala Dunia 2014 di kantor cabang PermataBank Jl. KH Zainul Arifin Medan, Selasa (4/3).

PermataBank Luncurkan Hadiah Rp10 Miliar Dan Nonton Piala Dunia 2014 MEDAN (Waspada): PermataBank kembali meluncurkan program PermataFamillionaire berhadiah total Rp10 miliar dan paket nonton Piala Dunia 2014 di Brazil bersama keluarga. ‘’Tiket nonton sepak bola Piala Dunia 2014 di Brazil ini disediakan untuk dua nasabah, dimana tiap pemenang membawa masingmasing tiga anggota keluarga dengan total 8 orang, plus transportasi dan akomodasi,’’ Eka Sar ifah Nur, sales Suppor t Region 4 PermataBank di kantor cabang Jl. KH Zainul Arifin Medan, Selasa (4/3).

Sementara untuk hadiah total Rp10 miliar dengan pemenang utama Rp1 miliar akan diundi Agustus 2014. Sedangkan hadiah bulanan dengan untuk satu nasabah diberikan hadiah Rp500 juta. ‘’Seluruh nasabah diingatkan untuk meningkatkan saldonya dan aktif dalam bertransaksi lewat PermataBank,’’ terang Eka. Eka menambahkan, PermataBank juga telah meluncurkan edisi khusus kartu debit dan kartu kredit FIFA World Cup Brazil 2014. ‘’Banyak souvenir dan hadiah menarik lainnya yang bisa diperoleh di Permatabank,’’ demikian Eka.(m46)

Hadapi Krisis Listrik Di Sumut JMPKK Desak Pejabat Daerah Bersinerji MEDAN (Waspada) : Untuk menghadapi krisis listrik di Sumatera Utara yang telah berkepanjangan Jaringan Masyarakat Pemantau Kinerja Kelistrikan Sumatera Utara (JMPKK) Sumut mendesak pejabat daerah Sumatera Utara untuk dapat bersinerji dengan PT PLN. “Kita meminta Gubernur Sumatera Utara, DPRDSU,Walikota, Bupati, dan aparat penegak hukum untuk dapat bersinerji dengan PT PLN didalam mengatasi krisis listrik yang terjadi di Sumatera Utara,” ujar Ketua Umum JMPKK Sumut M Ridwan SE kepada wartawan di Medan, Selasa (4/3). Dalam hal ini, lanjutnya, jangan ada saling salah menyalahkan atau tuding menuding akibat dari krisis listrik di Sumatera Utara yang menyebabkan bingungnya masyarakat dan dunia usaha semakin menderita. “Jika saling tuding menuding siapa yang salah dan benar hal ini tidak menjadi penyelesaian dari krisis listrik di Sumut,” ujar M Ridwan seraya mengimbau agar Pemko/Pemkab dapat memberikan bantuan pelayanan yang baik dalam hal pembebasan tanah dan pengurusan izin-izin untuk pembangunan pembangkitan maupun jaringan. “Dalam hal ini jangan ada upaya memperlambat izin, karena ini tentunya akan memperlambat pembangunan pembangkit maupun jaringan yang berdampak terhadap semakin

lamanya memperbaiki krisis listrik di Sumut tersebut,” ujarnya didampingi penasehat Marodjahan Batubara. JMPKK juga meminta kepada masyarakat apabila tanah ataupun lahannya yang terkena pembangunan jaringan agar dapat lebih bermurah hati dapat membantu sehingga penurunan krisis listrik di Sumut semakin cepat. “Dan kita juga mendesak kepada pejabat PT PLN, agar manajemennya lebih transparan dalam menyampaikan pokok permasalahan yang terjadi kepada institusi yang terkait kepada masyarakat. Dengan demikian, hal ini dapat diketahui siapa penyebab mengapa PT PLN lama membenahi krisis listrik di Sumut. Atau paling tidak masyarakat dapat memahaminya,” ujar M Ridwan kembali. Sementara Marodjahan Batubara menyatakan agar pegawai PT PLN jangan takut didalam menjalankan tugas demi kepentingan masyarakat banyak. “Dan kita meminta kepada penegak hukum agar dapat bertindak secara profesional sehingga tidak ada rasa galau didalam melaksanakan tugasnya,” ujarnya. “Sejauh ini ada rasa was-was atau ketakutan dari pada pelaksana atau pegawai dalam memelihara mesin karena takut tersandung dengan hukum. Untuk itu kita berharap agar pegawai lebih mementingkan khalayak umum,” ujar Batubara kembali. (m38)


B6 Pemilu Aceh Bisa Gawat



Faks 061 4510025

Facebook Smswaspada

Oleh Dr Drs H.Ramli Lubis, SH, MM Mengacu lima indikator sukses Pemilu, memang terbuka peluang menghasilkan menghasilkan parlemen berkualitas negarawan.Tapi dalam kondisi sekarang ini, rasanya masih sekedar harapan.


ujuan pelaksanaan Pemilihan Umum (Pemilu) Legislatif adalah memilih keterwakilan rakyat di parlemen.Berbagaipotensiaspirasi, dan kepentingan yang banyak maupun potensi konflik akan terkonsentrasi di gedung parlemen. Maka sistem demokrasi keterwakilan ini, di antaranya untuk menetralisir berbagai riak-riak dalam kehidupan ber-masyarakat. Oleh karena beban kepentingan bangsa “ditumpahkan” kepada perwakilan di parlemen, maka sudah semestinya parlemen diisi orang-orang yang dapat meredam berbagai potensi gejolak tersebut. Dan hal seperti itu hanya bisa dilakukan oleh orang-orang yang memiliki kedewasaan, kematangan, dan kenegarawanan. Pertanyaannya kemudian adalah, mungkinkan Pemilu menghasilkan keterwakilan orang-orang yang berkualitas seperti prasyarat yang diajukan di atas? Jawabnya mungkin saja sepanjang Pemilu berlangsung sukses dan berkualitas. Sukses dan berkualitas dimaksud adalah Pemilu yang berjalan melekat pada dirinya berbagai indikator sukses dan kualias itu sendiri. KualitasPemilu,sebagaimanadiaturdalam Undang-Undang(UU)No.8Tahun2012,harus dilaksanakan secara efektif dan efisien berdasarkanasaslangsung,umum,bebas,rahasia, jujur dan adil. Rumusan ini masih bersifat paradigmatik yang belum menyentuh pada persoalan teknis. Mungkin karena ini Menteri Dalam Negeri (Mendagri) Gamawan Fauzi mengatakan, semangat Pemilu itu dapat terwujud apabila seluruh komponen bangsa saling bangsa saling bahu-membahu mendukung pelaksanaan Pemilu sesuai aturan perundang-undangan dan penghormatan hak-hak politik setiap warga Negara. Upaya memperbaiki kualitas pelaksanaan Pemilu, katanya, merupakan bagian dari proses penguatan demokrasi serta upaya mewujudkantatapemerintahanyangefektifdanefisien. Lebih jauh, setidaknya, ada beberapa hal yang bisa dijadikan indikator suksesnya pelaksanaan Pemilu berkualitas. Pertama, adalah persoalan integritas penyelenggara Pemilu dan peserta Pemilu. Tidak saja penyelenggara Pemilu yang dituntut memiliki integritas, namun juga peserta Pemilu dituntut untuk berlaku searah dengan tujuan Pemilu yang digariskan oleh undang-undang di atas. Sukses Pemilu tidak akan tercapai jika hanya penyelenggara Pemilu saja yang berintegrita tanpa mengikutsertakan peserta Pemilu. Sebaliknya sukses itu juga tidak akan tercapai jika hanya peserta Pemilu saja yang berintegritas tanpa penyelenggara yang berintegritas. Kedua, tingkat partisipasi politik masyarakat dalam Pemilu.Tentu saja semakin tinggi

+628126329716 Kepada Redaksi Waspada,Mengapa selalu memberitakan Sepakbola Luar Negeri? Sedangkan untuk PSMS dan pertandingan ISL yg sedang berlangsung tdk ada beritan ya. Apakah Wsd tdk mau memajukan sepakbola kt?

+6285260103051 100 ulama kharismatik Aceh mendukung Irwandi=PNA.Termaktub dlm satu piagam. Lgkp dg korp dayah n terlegalisir. Di antaranya Abu Tumin, Abu Kuta, Abu Lam kawe dan Abu2 yg laen. Bisa dibuka linknya. +6285207065513 Ma’asyirol Muslimin Rahikumullah dimanapun berada n membaca opini ini : kami ingatkan kembali agr pd pemilu legislatif dpr ri - dpd ri - dprd provinsi dan dprd kabupatem/ kota pd 09 april 2014 nnti. Pastikan kita semua hadir di tps utk memberi suara sesuai dgn tuntunan syari’at islam dgn idiologi : “ i slam agama ku - calleg islam pilihan ku“. +6281260232642 Mulai dari ustadz seleb sampai M U I tidak kenal akan tuhan dan rasulnya makanya gempa jiwa itu sdh sampai kpd ummat +6285260103051 Awan gelap kezaliman dan kemunafikan maha akbar akan segera hancur berkeping2 dan hilang beterbangan ke udara hampa.. Nur dan cahaya kemenangan akan sege Allahu Akbar! Allah Maha Besar! Kita menanti fajar kebahagiaan yg telah mulai menyingsing di ufuk langit kebenaran.. Mentari kemenangan hakiki mulai kel.. ra menjelma dan telah hampir tiba.. Ambang kehancuran pemb0h0ng sejarah terbesar telah kiat dekat.. Semua b0br0k dan kenistaannya akan segera terungkap..dan kebathilan telah tenggelam.. artinya peradaban kemanusiaan telah berada di titik penghabisan.. ujung kehidupan.. alam dunia di ambang terkhatamkan +6281370899626 Kpd pngrus PLN!!klu tdk pnya kemampuan dan keahlian dlm mengurus PLN ini lbh baik kalian mndur,utk apa gnnya kalian digj hslnya 0,0 mngkn kami msyrkt Sumut khusunya kt Medan mnyumphkn anda smg dgn krja anda sprti ini akn dilaknat oleh Allah, Amin. +6281260392002 Sudah saat nya swasta tanggani Listrik +6285277489948 Bpak kapolda aceh..? Dan buat bpak kapolres se aceh, terutama aceh taming.. Kenapa bpk tindak tegas kendraan2 non BL. terumtam BK. Smakin merajarela di a ceh bodoh x kita, yang rusak jalan kta, bayar pajak nya ke medan. Polisi sumtra utara pntag x liat plat BL. +6285277850101 *Pangdam IM...Partai lokal Aceh agar berdamai demi demokrasi dan masyarakat Aceh. *Pembaca WASPADA...Jika tdk mau damai maka pd pilkada dan pemilu y.a.d partai lokal tsb di “kentuti” saja... Beresss !!! +6285277850101 Dahlan Iskan Capres ??? Uuuuuh.....urusin BUMN (PLN, PTPN) saja gak becus, apalagi ngurusi negara yg begini besar !?! Ogah aaach. +6285277850101 Sampai kapan dan apapun ceritanya, kalau BUMN/D (PLN, PTPN, dll) pasti tetap merugi, karena dijadikan lahan subur untuk di korupsi.

partisipasi politik pemilih dala Pemilu maka semakintinggipulakualitasPemiluyangterjadi.Karenamasyarakatpemilihadalahpemberi legitimasi atau mandat kepada para wakilnya untuk menjalankan fungsi legislasi, budgeting dan pengawasan dalam pemerintahan yang berlangsung lima tahun ke depan. Oleh karenanya semakin besar partisipasi rakyat memilih semakin legitimate pula Pemilu yang dihasilkan. Namun kita bisa melihat gambaran keterlibatan masyarakat memlih dalam Pemilu dari catatan sejarah. Beberapa hasil pelaksanaan Pemilu Legislatif sebelumnya mencatattrenberkurangnyapartisipasipolitikmasyarakat. Pada Pemilu 1999 tingkat partisipasi politik masyarakat mencapai 92,74 persen, Pemilu 2004 dengan 84,07 persen, dan Pemilu 2009 tingkat partisipasi masyarakat menurun menjadi sebesar 71 persen. Fenomena penurunan partisipasi politik ini seolah ditegaskan oleh hasil Pemilihan Umum Kepala Daerah (Pilkada) tahun 2013 yang hanya berkisar antara 50-70 persen. Jika tren penurunan ini berlanjut maka kondisi partisipasi politik masyarakat bisa lebih besar dari angka di Pemilu 2009. Ketiga, kesadaran politik masyarakat menjadi pemilih yang cerdas. Ada banyak faktor masyarakat memberikan suaranya atau memilih dalam Pemilu. Ada alasan yang rasional, tetapi ada juga alasan yang emosional. Alasan rasional ditengarai karena pemilih cerdas ada pula karena indikasi politik uang. Karena ada pemilih yang rasional dalam memilih,yaknikepadasiapasajayangmaumemberikan uang atau barang kepadanya (money politics). Namun pemilih yang terpengaruh politik uang-lah yang merupakan pemilih rasional yang cerdas. Sedangkan golongan ketiga, yakni pemilih yang mendasari pilihannya pada emosionalnya, maka sulit diharapkan menjadi pemilih cerdas. Keempat, iklim daerah yang kondusif akan dapat menjamin masyarakat dapat menggunakan hak pilihnya secara demokratis. Masyarakat memang harus terjamin bebas dari segala intimidasi, ancaman, dan situasi yang kurang menguntungkan ketika memilih dalam Pemilu. Untuk itu pemerintah harus memberikan jaminan situasi yang aman dan kondusif saat Pemilu berlangsung. Namun selama tahun 2013, Kemendagri mencatat ada 106 Pemilukada yang terdiri dari 14 Provinsi, 69 kabupaten, dan 23 kota. Berdasarkan hasil evaluasi penyelenggaraan Pilkada, tidak sedikit yang berdampak pada terjadinya konflik sebagai wujud ketidakpuasan terhadap hasil Pemilukada maupun pelaksanaantahapanPemilukadayangdinilai tidak konsisten serta ketidakakuratan Daftar Pemilih Tetap (DPT). Apalagi ketika merujuk

pada kondisi sosial politik nasional saat ini yangdihadapkanpadapersoalanpeningkatan eskalasi konflik sosial dan politik. Kondisi ini berpotensi berdampak menimbulkan gangguan keamanan dan ketertiban masyarakat di sejumlah daerah. Menurut catatan Pusat Komunikasi dan Informasi (Puskomin) Kemendagri, tahun 2010 terjadi 93 peristiwa konflik. Pada tahun 2011 terjadi peristiwa konflik, tahun 2012 terjadi 128 peristiwa konflik, dan tahun 2013 hingga awal September tercatat peristiwa konflik. Persoalan ancaman aksi terorisme, juga menjadi persoalan yang perlu dicermati bersama. Pada tahun 2012 tercatat sebanyak 65 kali ancaman terror, 30 kali diantaranya adalah ledakan bom, serta telah terjadi penangkapan terhadap 55 orang. Kelima, peserta, penyelengara, pemantau dan pengawas Pemilu. Apakah saling berkoordinasiataumalahterjaditumpangtindih? Hubungan lembaga-lembaga stakeholders Pemilu ini sangat penting dalam mendorong suksesnya pelaksanaan Pemilu. Ketika lembaga-lembaga ini sampai pada koordinasi maksimalnya, maka akan menghasilkan Pemilu yang dipercaya, serta berkualitas. Indokator kelima ini sejalan dengan apa yang diutarakan Ketua Komisi Pemilihan

Umum (KPU) Husni Manik menambahkan empat indikator yang menentukan kesuksesan Pemilu 2014. Sukses tersebut, katanya, terkait penyelenggaraan teknis kepemiluan, penyelenggaraan Pemilu yang jujur dan adil, partisipasi masyarakat yang meningkat, dan kualitas Pemilu yang lebih baik.Diamenambahkan,untukmewujudkan hal tersebut dibutuhkan kerjasama dengan semua komponen bangsa, baik para penyelenggara Pemilu, peserta Pemilu, pemerintah, maupun masyarakat. Penutup Jika mengacu kelima indikator sukses Pemilu di atas, memang terbuka peluang menghasilkan Pemilu berkualitas yang pada gilirannya menghasilkan anggota parlemen yang berkualitas negarawan.Tapi harus diakui bahwauntukmencapainyasulituntukdilakukan. Dari beberapa karakteristik indikator kesuksesan Pemilu tersebut, banyak di antaranya yang belum kita capai, bahkan masih jauhdariharapan.Dandalamkondisisekarang ini, rasanya Pemilu berkualitas masih sekedar harapan. Penulis adalah Mantan Wakil Wali Kota Medan.

Dinamika Pemilu 2014

+6285361973868 Rel Ganda Selatan Jawa, di Aceh jangankan Rel Ganda Rel Tunggal pun belum selesai2 dalam hal ini kami rakyat Aceh memohon pada bp Ditjen Perkeretaapian a gar lebih serius lagi dalam membangun Rel Kereta Api di Aceh agar bisa terwujut Kereta Api Cepat Banda Aceh - Medan dalam 2 tahun. +6285270475567 salamat buat ulung/ketua Iwan has wartawan waspada di Kab.batubara terpilih ketua/Ulung KELUARGA PENULIS SERUMPUN { K P S } KAB. BATU BARA Semoga dpt mempesatu kembali batang terondam yg kini mulai ada yg mencabik cabik daerah kito hanya demi sesaat sementara kerusakan dan kehancuran kita yg nerimo Ny o maju terus kps jgn takut dan mundur Batu bara negri bertuah di tinggal teringat ingat di tunggu nambah semangat bayar tunai bagi rata

Rabu 5 Maret 2014

Indikator Pemilu Berkualitas


ksi kekerasan bersenjata api meningkat di Aceh menjelang Pemilu 2014. Motifnya jelas politik karena masing-masing Parpol sejak setahun lalu sudah melakukan persiapan untuk memenangkan Pemilu 9 April nanti. Di mata Kapolri Jenderal Pol Sutarman pelaku penembakan terhadap calon anggota legislatif (Caleg) Partai Nasional Aceh, Faisal (35) berbeda dengan pelaku penyerangan posko Caleg Partai NasDem. Namun yang diperlukan bagaimana para pelakunya bisa segera ditangkap dan diadili sehingga menimbulkan rasa percaya dan aman di masyarakat Aceh. Sutarman menjelaskan, sedikitnya ada lima aksi teror di Aceh jelang Pemilu tahun ini. Beberapa di antaranya sudah terungkap, yakni pelaku penembakan Caleg Partai NasDem yang telah diketahui identitasnya.Tinggal melakukan penangkapan pada dua pelaku yang sudah dikenali identitasnya. Mudah-mudahan saja Kapolri tidak menerima laporan asal bapak senang dari Intisari: bawahannya. Masyarakat menunggu tindak lanjut yang sebenarnya, sampai ‘Bila aksi kekerasan me- parapelakunyabenar-benardapatditangmotivasinya terungkap. Jadi, bukan ningkat, rakyat takut, jum- kap, sekadar sudah diketahui identitasnya atau lah pemilih sedikit, legalitas pelaku dalam tahap pengejaran petugas. Sama dengan pelaku penembakan Pemilu Aceh menjadi ren- posko pemenangan calon legislatif Partai NasDem di Gampong Kunyet Mulee, dah’ Kecamatan Matang Kuli, Kabupaten Aceh Utara,didugamenggunakansenapanserbu M16. Kalau buktinya sudah diperoleh, seharusnya memudahkan polisi untuk mengungkap siapa pelaku sebenarnya. Sebab, yang biasa menggunakan senjata M-16 bisa diketahui kesatuannya. Kita harapkan polisi segera mengejar para pelaku kekerasan terutama dalam kasus pemberondongan Caleg PNA (Partai Nasional Aceh). Sebab, kalau polisi tidak serius dikhawatirkan sebulan menjelang hari-H Pemilu kondisi keamanan di Aceh semakin panas dan gawat, sehingga mengkhawatirkan masyarakat. Dampaknya, rakyat merasa diteror dan takut datang ke TPS untuk mencoblos dan menentukan Parpol dan Caleg pilihannya. Kalau kondisinya tidak kondusif maka jumlah pemilih Golput akan meningkat. Hal ini merugikan semua kontestan Pemilu 2014, termasuk Partai Aceh (PA) yang diperkirakan memenangkan dan mendominasi pemilihan legislatif nanti. Hemat kita, boleh saja aparat keamanan meminta seluruh masyarakat untuk tidak terpengaruh dengan aksi-aksi teror di Aceh yang berulang-ulang. Tidak cukup polisi menekankan para pelaku teror dan kekerasan dengan senjata api segera ditangkap. Alangkah baiknya jika polisi segera bertindak mengusut dan menangkap para pelakunya sehingga masyarakat melihat polisi bekerja profesional. Kalau pelakunya tidak terungkap dan tetap berkeliaran di masyarakat pastilah warga merasa khawatir. Sebab, aksi-aksi kekerasan bisa terulang kembali menjelang Pemilu yang sudah di ambang pintu. Sebab, dalam politik tidak ada kawan dan musuh abadi. Selalu menghalalkan segala cara, termasuk main kekerasan untuk meraih kemenangan dan kekuasaan. Politik memang kotor, apalagi kalau aturan mainnya abu-abu, sehingga peserta Pemilu 2014 bisa menggunakan banyak tafsir. Wajar saja kalau tahapan Pemilu di Aceh berlangsung penuh kekerasan. Justru itu, KPU, Bawaslu, Panwaslu dan sejenisnya wajib bekerja keras untuk menyukseskan jalannya pesta demokrasi lima tahunan untuk mendapatkan wakil rakyat dan pemimpin berkualitas periode 2014-2019. Meningkatnya suhu politik di Aceh harus mendapat perhatian dari semua pihak, terutama aparat keamanan. Polisi harus kerja keras, menyebar informan dan intelijennya agardapatmengendusbahayadanancamanmenjelangPemilu2014.Janganlagikebobolan. Banyaknya aksi kekerasan, teror, intimidasi, terlebih menggunakan senjata serbu M-16 tidak bisa dianggap masalah kecil.Walau kasusnya bisa dihitung dengan jari tangan, namun kalau aparat tidak siap, dampaknya bisa semakin membesar dan meluas sehingga Pemilu Aceh bisa gawat. Kalau rakyat takut, jumlah pemilih sedikit, maka legalitas Caleg terpilih menjadi rendah, karena banyaknya kasus yang menodai jalannya Pemilu tahun ini. Oleh karena itu, Polri harus profesional, jangan sampai kalah gertak dengan pelaku teror yang menginginkan Pemilu Aceh penuh dengan aksi-aksi kekerasan dan menjadi tidak demokratis dan tidak berkualitas.+


Oleh Jose Anwar Dalimunthe, SE Tanpa dukungan Parpol sangat mustahil penyelenggaraan Pemilu dapat berjalan baik.


istem Pemilihan Umum (Pemilu) di Indonesia sudah beberapa kali mengalami perombakan. Menurut Ramlan Surbakti dalam bukunya “Memahami Ilmu Politik” berpendapat bahwa tujuan dari Pemilu adalah pertama sebagai mekanisme untuk menyeleksi para pemimpin dari pemerintah dan menetapkan kebijakan umum. Sesuai dengan prinsip demokrasi yang memandang rakyat yang berdaulat, tetapi pelaksanaannya dilakukan oleh wakil-wakilnya (demokrasi perwakilan). Karena itu, Pemilu merupakan mekanisme penyelesaian dan pendelegasian atau penyerahan kedaulatan kepada orang atau partai yang dipercaya. Kedua, Pemilu juga dapat dikatakan sebagai mekanisme memindahkan konflik kepentingan dari masyarakat kepada badan-badan perwakilan rakyat melalui wakil-wakil rakyat yang memenangkan kursi sehingga integrasi masyarakattetapterjaga.Ketiga,Pemilumerupakan sarana memobilisasikan atau menggalang dukungan rakyat terhadap negara dan pemerintahan dengan jalan ikut serta dalam proses politik. Pemilu dianggap sebagai kriteria penting untuk mengukur kadar demokrasi sebuah sistem politik. MenurutValina Singka Subekti yang juga mantan komisioner KPU pentingnya Pemilu demokratis, pertama, pemerintahan akan terbentuk dalam proses Pemilu. Kedua, presiden dengan pemerintahanya akan dibentuk, ketiga, kehidupan kepartaian akan berlangsung. Artinya Pemilu menjadi kunci utama yang menentukan tertentuknya proses sistem politik yang demokratis. Itulah sebabnya, peningkatan kualitas Pemilu menjadi ukuran mendasar dalam sebuah demokrasi yang berlangsung. Belajar dari kegagalan sistem Pemilu Orde Baru, menurut Syamsudin Haris Pemilu yang mendatang harus memenuhi syarat, pertama, adanya memilih bagi masyarakat, kedua, terbukanya peluang kompetisi diantara partai politik peserta Pemilu sebagai konsekuensi logis adanya kemerdekaan berserikat bagi masyarakat, ketiga, berkurangnya secara signifikan peluang bagi birokrasi di satu pihak, dan pembatasan unsur-unsur pemerintah di hampir semua tingkat organisasi pelaksanaan dan pengawasan Pemilu serta terbukanyapeluangbagimasyarakatdanorganisasiorganisasi untuk ikut melakukan pengawasan secara sukarela terhadap hampir semua pro-

ses Pemilu. Netralitas Penyelenggara Pemilu PenyelenggaraPemilusudahharusmempunyai rekam jejak yang mumpuni. Hal ini sudah merupakan konsekuensi logis yang harus siap diterima sebagai seorang penyelenggara Pemilu. Sebab, signifikansi penyelenggara Pemilu yang berintegritas karena substansinya berhuhubungan dengan kekuasaan politik. Penyelenggara Pemilu idealnya berasal dari orang atau figur yang memiliki integritas. Karakteristik dari penyelenggara Pemilu di antaranya memiliki jiwa yang kredibeldanamanah.Halinimenjadisyaratmutlak yang harus dimiliki penyelenggara Pemilu. Karena, apabila tidak kridibel maka akan berbenturan dengan kepercayaan publik. Selain itu, penyelenggara Pemilu harus mempunyai independensi dan integritas. Selanjutnya, lembaga pengawas Pemilu mutlak harus diisi orangyang profesional dibidang kepemiluan dan kepengawasan. Menurut Joel E. Roes, seorang dianggap profe-sional harus memiliki knowledge, competent application, social responsibility, self control, dan communication sanction. Know-ledge berarti suatu jabatan yang diperoleh melalui pendidikan tinggi dengan waktu relatif yang agak lama.Competenceapplication untukmelaksanakan tugas pekerjaan tadi diperlukan suatu kecakapan dan keahlian tertentu. Orangorang yang memiliki keahlian dan kecakapan tinggi disebut profesional dan lain-lain. Selain integritas dan profesio-nalitas, penyelenggara Pemilu juga harus mempunyai mentalitas yang teruji dalam menjalankan tugasnya, sebab banyaknya do-rongan melakukan perbuatan koruptif dalam pelaksanaan proses politik. Pemilu Berkualitas Untuk mewujudkan Pemilu berkualitas dan demokratis mesti didukung suatu sistem dan perangkat hukum yang komprehensif dan integratif serta didukung oleh politik regulasi yang diarahkan memperkuat seluruh perangkat Pemilu. Bukan sebaliknya, untuk saling menyandera atau memperlemah bekerjanya secara efektif pilar-pilar demokrasi dengan cara mempertahankan hal-hal yang tidak substantif. Sejauh ini undang-undang yang mengatur tentang kepemiluan khususnya belum ada integrasi mengenai pengawasan dan penyelenggaraan. Misalnya,dalampelanggaranadministrasi

keputusannya hanya pada KPU, Kepolisian untuk pelanggaran pidana, PTUN untuk sengketa Pemilu dan Dewan Kehormatan Penyelenggara Pemilu (DKPP) untuk pelanggaran kode etik. Sementara itu dimana wewenang Badan Pengawas Pemilu (Bawaslu) dalam konteks ini? Apakah wewenang yang diberikanolehundang-undangsudahdijalankan secara maksimal? Harusnya Bawaslu juga diberikan otoritas tersendiri dalam proses terjadinya pelanggaran Pemilu yang sekarang ini marak terjadi. Selanjutnya, yang paling terpenting adalah KPU juga harus menerapkan politik regulasi yang transparan dan berorientasi terhadap pelayan publik dalam setiap proses politik yang terjadi dalam Pemilu. Sebagai contoh dalam hal daftar pemilih tetap (DPT) dimana UU No.08 tahun 2012 tentang Pemilu anggota DPR, DPD, DPRD pasal 4 ayat 4 dan pasal 38 ayat 5, hanya mewajibkan kepada PPS melalui PPK untuk diberikan kepada peserta Pemilu di tingkat kecamatan dan oleh KPU kabupaten/kotakepadaParpolpesertaPemilu di tingkat kabupaten/kota dalam bentuk softcopypalinglambat7harisetelahditetapkan. Di sini letak lemahnya UU Pemilu yang tidak melibatkan kewenangan dari Bawaslu. Harusnya KPU kabupaten/kota memberikan salinan daftar pemilih dalam bentuk soft atau hard copy kepada pengawas kecamatan atau pengawas Pemilu lapangan dan Panwas kabupaten/kota. Kalau tidak diberi wewenang, bagaimana mungkin pengawas dalam hal ini Bawaslu mampu melakukan tugas secara obejektif. Pengalaman menunjukkan pada tahun 2009 kemarin, tidak semua jajaran KPU khususnya di tingkat bawah bersedia memberikan data dan dokumen yang diberikan oleh panitia pengawas Pemilu tanpa adanyainstruksiyangjelasdarilembagadiatasnya. Inilah yang saya sebut diatas tadi tidak adanya integrasi dan koordinasi diantara penyelenggara Pemilu. Suksesi Pemilu 2014 Pemilu Legislatif, Presiden dan Wakil Presiden 2014 kelihatannya akan menjadi tantangan yang amat berat bagi penyelenggara Pemilu. Apabila Pemilu terselenggara dengan asas yang jujur, adil dan transparan dan menghasilkan wakil rakyat yang berkualitas, ini akan berdampak positif terhadap penyelanggara Pemilu. Akan terlihat apakah Pemilu 2014 akan minim pelanggaran Pemilu terjadi atau sebaliknya. Selain itu juga, suksesi kepemimpinan nasional punya arti penting dalam Pemilu 2014. Ini akan menjadi salah satu parameter demokrasi yang ada di negara kita. Selanjutnya, kehadiran peranan polisi sangat penting dalam keamaman selama berlangsung Pemilu yang kemudian memas-

tikan tanpa ada gangguan secara politik. Untuk meraih suksesi Pemilu yang berkualitasditahun2014iniharusdidukungpeserta Pemilu yang terdiri dari 12 partai politik (Parpol).Tanpa dukungan Parpol sangat mustahil penyelenggaraan Pemilu dapat berjalan baik. Harapannya, Pemilu harus melahirkan pemimpin yang amanah, jujur, berintegritas, bersih, dan mengerti dengan nurani dari yang akan dipimpinnya. Republik ini sangat membutuhkan pemimpin yang mau melayani hati nurani rakyat dan bukan untuk selalu ingin dilayani. Kemudian, yang terpenting, Pemilu harus menghasilkan pemimpin yang tidak hanya mengedepankan kepentingan pencitraan diri semata, serta pemimpin yang memahami persoalan dan solusi yang dibutuhkan negara ini. Penulis adalah Fungsionaris Presidium Korps Alumni Himpunan Mahasiswa Islam Sumatera Utara (KAHMI SUMUT).

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau email: Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata dan kartu pengenal (KTP) penulis. Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di media manapun. Isi tulisan menjadi tanggung jawab penulis.

SUDUT BATUAH * DPR, PLN dan Pemprovsu bahas krisis listrik - Hasilnya tetap padam * Dokter Malaysia akui pasien asal Medan meningkat - Apalagi setelah Pemilu * Nilai ekspor Sumut turun 51,78 juta dolar AS - Gara-gara terkena asap barangkali, he...he...he oel ak D W


WASPADA Rabu 5 Maret 2014


Sudah Satu Tahun Guru Deliserdang Menunggu Sudah satu tahun guru Deliserdang menunggui pencairan dana sertifikasi. Sebab tahun 2012 guru SD satu bulan belum dibayar, demikian juga guru SMP, SMA dan SMK dua bulan yakni November dan Desember 2012 belum dibayar. Padahal sekarang sudah masuk tahun 2014. Menjadi pertanyaan bagi guru-guru Deliserdang. Mengapa terjadi demikian? Padhal banyak daerah sudah melunasi tunggakan sertifikasinya tahun 2012. Informasi dari Jakarta semuanya sudah selesai dengan permintaan Dinas Pendidikan, Pemuda dan Olahraga Deliserdang. Jadi mengapa terjadi demikian? Hal ini perlu dipertanyakan. Seharusnya tidak ada lagi yang nemanya penunggakan pembayaran sertifikasi 2012. Oleh karena itu perlu menjadi perhatian agar hal demikian jangan terjadi lagi sebab akan merugikan guru. Dalam anggaran, semuanya jelas berdasarkan data, dasar yang menjadi program. Karena itu suatu yang aneh bila terjadi kekurangan dana padahal data yang diajukan sesuai dengan guru yang telah mendapat SK Dirjen dan mengajar 24 jam perminggu. Oleh karena itu melalui surat pembaca saya mengharapkan kiranya hal yang demikian tidak terjadi lagi dikemudian hasil. Tunggakan tahun 2012 secepatnya dibayar sebab sudah satu tertunda. Kami guru Deliserdang tak memikirkan apa-apa kecuali tunggakan tersebut dibayarkanlah maslah hukum adalah masalah penegak hukum bukan guru. Guru tugasnya mengajar dan tunggakan dua bulan diselesaikan sesuai dengan azas kepatutan dan asas sesegera mungkin. Jangan lagi ditunda-tunda sebab persoalan ini bukan persoalan sepele. Bukan hanya sudat edaran sudah cukup tapi persoalan hukum yang harus diselesaikan bila terbukti menyalahi hukum. Tapi bila tidak, yah diselesaikan pada administrasi saja. Bagi guru yang penting tunggakan dua bulan 2012 diselesaikan dengan secepatnya agar tidak menimbulkan isu yang kurang menguntungkan bagi dunia pendidikan di Deliserdang.


Guru Deliserdang

Oleh Surya Darma Hamonangan Dalimunthe

Nama dan alamat pada redaksi

Pungli Di Kantor Kelurahan “Bantan” Dengan ini saya sampaikan bahwa saya selaku warga kota Medan, merasa sangat kecewa dengan pelayanan di kantor Kelurahan Bntn (dekat SMU 11). Ketika itu saya mohon informasi biaya pengurusan Kartu Rumah Tangga. kepada seorang ibu pegawai kelurahan berinisial (J). Beliau adalah PNS kantor Lurah Bantan menjelaskan bahwa mulai dari Kepling harus sudah ada biaya, di kelurahan biayanya Rp.75.000 (tanpa tanda terima), dan di Kantor Kecamatan juga ada biaya, sampai ke kantor catatan sipil. Jadi keseluruhannya berjumlah Rp.200.000. Ini belum termasuk untuk Dia. Dengan semikian total keseluruhan biaya Rp.250.000 (tanpa tanda terima). Akhirnya dengan rasa berat hati saya menyerahkan uangnya, sambil berpikir: 1. Alangkah beratnya warga Medan, apabila ia seorang rakyat kecil yang tidak punya uang berurusan dengan pemerintah. 2. Bukankah Ibu J dan ibu Lurah adalah PNS yang digaji resmi oleh pemerintah dengan uang rakyat? Bukankah hal itu namanya pungil, yang sebenarnya uang haram. Kemudian di meja sampai saya ada seseorang bapak mengambil surat yang telah ditandatangani Lurah. Seorang ibu lain (PNS) pegawai lurah, menyerahkan surat moral PNS di kelurahaan ini, padahal ia adalah abdi negara, dan abdi masyarakat. Untuk itu saya bermohon kepada Bapak Plt. Walikota memutasikan Ibu J dan Ibu lurah tersebut, dan akhirnya beliau akan menjadi penghuni neraka. Terimakasih

Penjelasan PT. Mitra Kencana Puspita Assalamu’alaikum Wr. Wbr. Saya Drs. HM Sofyan Saadan, sebagai pimpinan PT. Mitra Kencana Puspita (MKP) melalui surat pembaca menulis ingin mejelaskan sebagai berikut: Bahwa upah BHL (Buruh Harian Lepas) wanita di PT MKP (bukan PT. Mitra Kencana Asam (MKBA) adalah Rp 17.000./hari/orang, mulai kerja pukul 07:30 s/d 11:30 wib (effektif bekerja lk 31/2 jam /hari karena ada istirahat/wolon setengah jam. Insya Allah BHL tersebut akan kita tingkatkan lagi, gaji mereka bukan Rp 15.000 sebagaimana diberitakan. Perlu disampaikan, bahwa pemilik perusahaan sebelumnya WNI yang hanya membayar Rp12.000/BHL. Upah BHL pria di PT MKP adalah Rp 20.000/hari mulai kerja pukul 07:30 s/d 11:30 wib (effektif kerja lk 3 setengah jam) dan insyah Allah akan ditingkatkan lagi. Jika dibandingkan berita BHL pria/wanita di kebun lain Rp20.000/hari mulai bekerja pukul 07:30 s/d 14:00 Wib (effektif bekreja lk 6 Jam ). Kemudian pemanen TBS (Tendan Buah Sawit Segar) PT. MKP dibayar upah Rp850/tandan TBS, jika borongan dibayar Rp 950/tandan TBS, selesai memanen para pemanen menunas pelepah tua dibayar Rp 1.500/pokok, para pemanen umumnya mendapat upah lk Rp50.000/hari dan bila musim panen puncak mereka mendapat lk Rp70.000/hari. Manajemen PT.MKP saat ini, baru memegang perusahaan dua tahun dan sudah lk 110 hektar meremajakan tanaman tua dari total 245 hektar lahan kebun. Pihak manajemen di Kabupaten Langkat telah memberikan partisipasinya untuk kepentingan umat Islam antar a lain sudah membangun Masjid, merehabilitasi Masjid di sekitar lokasi kebun, serta membantu kegiatan olahraga pemuda dan kegiatan sosial lainnya di Desa, Kec. Kabupaten Langkat. Hamdan AB yang mengaku-ngaku sebagai Humas PT. MKP tidaklah benar. Dia (Hamdan) hanya seorang centeng kebun yang mulai pikun. Demikian surat pembaca ini diperbuat dengan sebenarnya, atas perhatiannya diucapkan terima kasih Hormat Kami, Drs HM Sofyan Saadan Pimpinan PT MKP

Caleg Umbar Janji CALEG UMBAR PEMEKARAN SIMALUNGUN.Hati hati menjelang PILEG 9.APRIL 14 utk mencapai tujuan contoh nya baliho caleg DPR RI SUMUT 3 Bernama E.R.dari PD mencantumkan di balihonya Pemekaran Pasti begitu pula Caleg Js Dapil 1.SIMALUNGUN setiap sosialisasi di warung 2 ceritanya hanya Pemekaran .INGAT INGAT cerita pemekaran mulai Jabanten Damanik sampai Zulkarnain Damanik bupati simalungun hasilnya bohong .TAK MUNGKIN JR Simalungun dimekarkan sebelum aset Pemkab simalungun digadaikan kpd mata sipik seperti Kantor KPU SIM RP 3 M .Selamat umbar janji +6285760559222

Indonesia bisa mencontoh China yang menghukum berat BUMN mereka beserta para elit dan sekutu BUMN yang terbukti melakukan kejahatan terhadap kepentingan publik.


“atlampir pakai baju rombeng.” Mungkin tidak lama lagi beginilah bunyi kalimat bermain anak-anak yang pantas dialamatkan kepada elit-elit sistem (PLN dan sekutunya) yang telah menghasilkan ‘matlam’ (mati lampu) berkepanjangan di Sumatera Utara selama lebih satu dekade terakhir. Mereka bagai mak lampir yang tidak hanya meneror dengan gelap-gulita di malam hari dan rugi derita di siang hari, tapi juga membunuh melalui efek samping kebakaran dan keracunan asap genset. Elit-elit PLN dan sekutunya di Sumut dan Jakarta pada hakikatnya berjiwa ‘rombeng’, semewah apapun penampilan mereka di luar. Tetapi mereka rombeng yang ‘hebat’, sehingga tidak tersentuh siapapun, dari presiden hingga penegak hukum, dari akademisi hingga praktisi, dari rakyat hingga wakilnya. Mereka kebal kritik, dapat terus menerus berbohong, menjanjikan ‘angin surga’ bahwa masalah listrik di Sumut akan selesai kalau ada ini dan itu, kalau selesai ina dan inu. Pegal linu pikiran dan perasaan dibuatnya ketika matlam terus berlanjut. Seharusnya semua orang selain daripada PLN dan sekutunya bersatu melawan mereka. Rasanya tidak ada lagi musuh bersama yang paling penting

‘diperangi’ selain mereka di Sumut. Tindakan mereka mungkin belum mencapai tingkat ‘kejahatan atas kemanusiaan’, tetapi bagaimana dengan ‘kejahatan terhadap kepentingan publik’? Cuap-cuap di media massa dan kicaukicau di media sosial terbukti belum mempan melawan kejahatan ini. Dalam makalah advokasi RUU KUHP Seri #4 Lembaga Studi dan Advokasi Masyarakat (ELSAM) yang ditulis oleh Syahrial M. Wiryawan berjudul ‘Kejahatan terhadap Kepentingan Publik dalam Rancangan KUHP’ (2005), ditulis bahwa kejahatan terhadap kepentingan publik memang belum popular dalam literatur hukum pidana di Indonesia. Kejahatan terhadap kepentingan publik juga belum dikenal sebagai satu kategori dari jenis kejahatan dalam hukum pidana nasional. Lebih lanjut, makalah tersebut memaparkan bahwa daya rusak kejahatan terhadap kepentingan publik biasanya memiliki efek yang luas dan besar, menggunakan modus operandi yang kompleks, memanfaatkan kelemahan otoritas hukum, politik, ekonomi, dan profesi. Pelakunya biasanya adalah orang-orang atau kelompok yang memiliki kekua-saan politik, ekonomi serta akses terhadap teknologi atau pengetahuan tertentu seperti pejabat publik,

perusahaan swasta, dan kaum birokrat atau profesional yang berada di dalamnya. Di tengah proses transisi demokrasi di Indonesia yang belum sepenuhnya menjamin perlindungan terhadap kepentingan publik secara adil, dan pantas—lemahnya posisi tawar masyarakat terhadap pejabat pemerin-tah dan pegawai perusahaan—perlu penegasan bahwa motif paling mendasar dari kejaha-tan terhadap kepentingan publik adalah motif ekonomi dan tindakan ilegal memupuk keun-tungan dengan mengorbankan kepentingan orang banyak. Jelas bahwa tindakan PLN yang bagai ‘matlampir’ selama ini merugikan kepentingan serta hajat hidup orang banyak. Namun, siapa-kah yang mendapat keuntungan pribadi dari tindakan ini? Jawabannya sedikit sebanyak dapat ditemukan pada opini Dr. Ir. ZA. Dalimunthe berjudul ‘Listrik Asahan Masih Diminati?’ (Waspada, 24 Februari 2014). Perusahaan Jepang mendapatkan manfaat, para elit Orde Baru yang masih bercokol sampai sekarang juga begitu. Kalau INALUM go public, lagi-lagi mereka yang beruntung! Dalam tradisi hukum Islam, kejahatan terhadap kepentingan publik sangat serius dan berat hukumannya. Kalau diterapkan, mungkin oknum pegawai PLN dan sekutunya tidak lagi ‘ketawaketawa dalam hati’ dan bersikap ‘anjing menggonggong kafilah berlalu’ menghadapi krisis listrik di Sumut. Mungkin banyak yang akan mengundurkan diri, dan para pengganti mereka akan bekerja sangat serius. Bagaimana tidak, dalam tradisi Islam, hukuman untuk

kejahatan terhadap kepentingan publik berkisar dari hukuman cambuk hingga hukuman mati! Elit Indonesia bisa mencontoh elit negara China yang menghukum berat BUMN mereka beserta para elit dan sekutu BUMN tersebut yang terbukti melakukan kejahatan terhadap kepentingan publik. Satu contoh adalah ketika dua perusahaan minyak terbesar China dihukum tidak boleh membangun pabrik baru atau mengembangkan pabrik yang ada karena gagal mengontrol polusi pabrik mereka. Itu baru polusi, belum lagi kejahatan yang menghasilkan korban jiwa. Ketika pipa minyak salah satu dari perusahaan ini meledak di sebuah kota, membunuh 62 orang dan mencederai 136 lagi, para elit China menghukum perusahaan tersebut dengan denda maksimum di bawah undang-undang, meminta kembali 80 persen gaji dua pejabat tertinggi cabang perusahaan tersebut dalam setahun terakhir, mencabut hak naik pangkat pejabat tertinggi pusat perusahaan tersebut beserta beberapa manajer yang bertanggungjawab, menghukum wali kota tempat pipa tersebut meledak, dan memidanakan lima belas orang terkait ke pengadilan. Kalau saja hal ini dilakukan oleh elit kita, mungkin dari dulu sudah tidak ada lagi ‘matlampir’ di Sumut! Wallahu a’lam bishshawab.

Penulis adalah alumnus Teknik Sipil Universitas Nasional Singapura.

Memilih Listrik Atau Caleg Oleh Choking Susilo Sakeh Kita memang tidak pernah serius mengelola negara. Hanya untuk mengurus listrik saja kita tak pernah mampu bahkan dalam tempo yang sedemikian lama.


ndaipun saya memprovokasi, pasti tidak akan ada pengaruhnya. Sebab, saya bukanlah panutan dan kebetulan saya memang tidak punya bakat menjadi provokator. Namun, agaknya kita perlu menjadikan kebrengsekan PLN— satu-satunya perusahaan listrik milik negara itu sebagai salah satu aspek di dalam memilih calon legislatif (Caleg) pada Pemilihan Umum (Pemilu) Legislatif 9 April mendatang. Maksud saya, dari rentang waktu kurang lebih 10 tahun kondisi byarpet listrik di Sumatera Utara, maka kita bisa mengamati apa dan bagaimana reaksi para legislator Sumut baik yang duduk di kursi terhormat DPRD kab/kota, DPRD provinsi maupun di DPR-RI dan DPD di Senayan. Dari ribuan jumlah para wakil rakyat itu, kita sama tahu, kebanyakan mereka adalah barisan diam membisu. Ada juga sebagian kecil anggota dewan yang sekedar ngomong, semata agar dibilang wakil rakyat yang punya kepedulian terhadap penderitan rakyat. Dan cuma segelintir yang ngomong sembari melakukan tindakan nyata: baik berupa mendatangi PLN dan pihak terkait sambil marah-marah. Kita pun bisa mengamati bagaimana reaksi para calon legislator ‘wajah baru’ yang akan bertarung pada Pemilu Legislatif nanti. Sama seperti pendahulunya, para Caleg kelompok ini pun kebanyakan diam tak bersuara. Ada memang segelintir mereka yang mencoba bersuara, dan hanya sedikit sekali yang melakukan aksi nyata. Bahwa soal jejak rekam, kredibiliitas dan lain sebagainya

dari para Caleg memang perlu jadi bahan pertimbangan kita untuk memilih siapa yang layak. Namun agaknya kita perlu bersepakat, bahwa kepedulian para Caleg terhadap krisis listrik di daerah ini sepertinya harus menjadi pertimbangan utama bagi para pemilih. Sebab, pertama, kita sama mengetahui bahwa sudah banyak nyawa tewas terbakar bersamaan kebakaran yang melanda pemukiman akibat memasang lilin, lampu teplok atau genset yang meledak. Kedua, miliaran Rupiah peralatan elektronik menjadi rusak karena seringnya listrik hidup-mati sesukanya. Ketiga, masyarakat terpaksa harus mengeluarkan biaya tambahan misalnya untuk ke dokter karena mengalami gangguan fisik dan psikis karena stres dihajar mati lampu. Atau mengeluarkan biaya tambahan membeli bahan bakar minyak untuk genset maupun untuk kenderaan bermotor karena jalanan macet akibat lampu jalanan tak berfungsi. Keempat, pelajaran sekolah maupun pelajaran agama para anak-anak kita terkendalanya karena keterbatasan penerangan akibat padamnya aliran listrik. Kelima, terbuka peluang terjadinya korupsi-kolusi-nepotisme antara para fihak karena kondisi yang sering gelap akibat mati listrik. Keenam, dan seterusnya dan seterusnya. Demikianlah, sadar atau tidak, listrik dan pemadaman listrik yang telah sekian lama itu sangat berdampak negatif kepada banyak hal di dalam kehidupan manusia. Pada era teknologi sekarang ini, listrik merupakan kebutuhan vital terha-

dap seluruh hajat hidup manusia, tentunya termasuk terhadap kehidupan berbangsa dan bernegara. Karenanya, jargon yang wajib dikumandangkan semestinya adalah ‘listrik sehat, rakyat kuat, rekening pun tak pernah telat”. Bukan seperti sekarang ini, “listrik boleh sesukanya, namun rekening jangan coba-coba” Dengan demikian, yang ingin saya katakan dari kondisi carut-marutnya krisis listrik di Sumatera Utara ini adalah: bahwa kita memang tidak pernah serius (baca: main-main!) dalam mengelola negara. Hanya untuk mengurus listrik saja—salah satu aspek dari sekian banyak hajat hidup bangsa—kita tak pernah mampu bahkan dalam tempo yang sedemikian lama. Karenanya, tidaklah mengejutkan jika kita pun ternyata gagap mengurus aspek-aspek lainnya. Termasuk mengurus hal yang sesungguhnya teramat sangat penting: menciptakan aparat yang bersih dan bermoral! Bahwa moral semestinya menjadi segala-galanya jika bangsa ini mau maju, berwibawa dan sejahtera. Kebrengsekan listrik di Sumatera Utara saya yakini berawal dari rendahnya moralitas para pengelolanya, termasuk juga rendahnya moralitas para penyelenggara negara sebagai pemilik perusahaan listrik dan para wakil rakyat sebagai pengawas perusahaan listrik milik negara. Petinggi perusahaan listrik bekerja tanpa moral, pemerintah dan wakil rakyat juga sami mawon: Bekerja tanpa moral! Dengan demikian, semestinyalah kita memanfaatkan momen Pemilu Legislatif dan Pemilu Presiden untuk mencari orang-orang yang diperkirakan siap bekerja dan siap mengabdi kepada bangsa dengan moralitas yang tinggi. Mari kita cari Caleg yang bermoral, mari cari presiden yang bermoral! Boleh jadi tidak terlalu tepat jika saya katakan bahwa salah satu indikasi Caleg bermoral

adalah sejauhmana tingkat kepedulian mereka terhadap hidup-matinya aliran listrik di rumah kita. Namun, setidaknya kita bisa menafsirkan bahwa kepedulian para Caleg terhadap krisis listrik di Sumut adalah juga kepedulian mereka terhadap kehidupan berbangsa dan bernegara. Maaf, saya menggampangkan kriteria bermoral atau tidaknya seorang Caleg. Dan karenanya, mumpung masih ada waktu sekitar lima minggu lagi menjelang hari pencoblosan Pemilu Legislatif, maka wahai para Caleg petahana maupun Caleg wajah baru, mari rame-rame menunjukkan kepedulian Anda terhadap masalah listrik di Sumut—sebagai bukti bahwa Anda adalah Caleg bermoral. Bentuk kepedulian itu bisa bermacam-macam, terserah bagaimana kreativitas anda untuk memperlihatkan kepada pemilih bahwa anda sesungguhnya adalah Caleg yang benar-benar peduli terhadap ma-salah listrik di daerah ini, bahwa anda peduli terhadap penderitaan masyarakat Sumut, bahwa anda peduli terhadap kehidupan berbangsa dan bernegara masyarakat daerah ini. Akan halnya kepada para pemilih yang sudah punya pilihan, selayaknya meninjau ulang pilihan anda tersebut dengan menambahkan kriteria Caleg peduli listrik. Sedangkan pemilih yang belum punya pilihan, masih ada waktu untuk mengamati sejauhmana kepedulian para Caleg terhadap listrik Sumut. Terhadap pemilih yang sudah berniat tidak memilih, saya tak punya saran sama sekali, kecuali hanya berdoa semoga Anda beruntung. Saya menduga, jangan-jangan Anda memang sudah punya pilihan: memilih listrik yang bermoral! Penulis adalah Mantan Ketua Panswaslu Sumatera Utara.


B8 06:00 GO SPOT 07:30 Dahsyat 10:30 INTENS 11:00 SILET 12:00 SEPUTAR INDONESIA SIANG 12:30 BUKA - BUKAAN 14:00 Indonesian Idol 16:00 CEK AND RICEK 16:30 SEPUTAR INDONESIA 17:00 CINTA ANAK CUCU ADAM 19:15 ANAK - ANAK MANUSIA 21:00 TUKANG BUBUR NAIK HAJI THE SERIES 22:30 Box Office Movie


06:30 SL Inbox 08:45 Halo Selebriti 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:30 Liputan 6 Petang 17:00 Get Married The Series 2 18:15 Diam-Diam Suka 19:45 Tiba-Tiba Cinta 21:00 Emak Ijah Pengen Ke Mekah 22:30 I Like This

07:00 Animasi Spesial 07:30 Animasi Spesial 08:30 Mister Maker Comes To Town 1 09:00 Pose 09:30 Layar Unggulan 11:00 Diantara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 14:00 Tuntas 14:30 Lintas Petang 15:00 Animasi Spesial 16:30 Animasi Spesial3 17:30 Tendangan Si Madun Returns 18:30 Mnctv Sport Platinum-1 21:00 Raden Kian Santang 22:00 Suka-suka Uya 23:30 Cerita Pilihan 00:30 Midnite Great Sale 01:00 Lintas Malam

08:25 Curious George 08:55 Gon 09:25 Little Krisna 11:25 Topik Siang 11:55 Seputar Obrolan Selebriti 12:55 Mr. Bean 13:25 Tom & Jerry 13:55 Bima Sakti 14:25 Little Krishna 14:55 Bernard Bear 15:25 Curious George 15:55 Gon 16:25 Marsha & The Bear 16:55 Pesbukers 19:25 Campur-Campur 20:25 Pesbukers Best Of The Best 21:55 Sinema Spesial 23:55 Cakrawala

07:30 Semarak Sinema Spesial 08:30 Sinema Pagi 10:30 Live Kiss Pagi 11:30 Live Patroli 12:00 Sinema Pintu Taubat Siang 14:00 Hot Kiss 15:00 Live Fokus 15:30 Trending Topic 16:30 Berani Nekat 17:00 New Famili 100 18:00 Audisi D’Academy 20:00 Sinetron Unggulan : Bara Bere 21:00 Sinetron Unggulan 22:00 Sinema Unggulan

08:05 8 Eleven Show 12:00 Metro Siang 13:00 Wideshot 17:00 Metro Hari Ini 18:00 Prime Time News 19:30 Lebih Dekat 20:05 Mata Najwa 21:30 Otoblitz 22:00 Top 9 News 2 2 : 3 0 St a n d Up Comedy Show 23:05 Realitas 23:30 Metro Sport

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

WASPADA Rabu 5 Maret 2014

07:30 Saatnya Kita Joged 09:30 Sinema Indonesia Pagi 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:15 Show Imah 16:45 Reportase Sore 17:30 Oh Ternyata 18:30 Slide Show 19:30 YKS 22:30 Bioskop TransTV 01:00 Reportase Malam

07:00 Live News Apa Kabar Indonesia Pagi 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Ruang Kita 14:30 Live News Kabar Pasar 15:30 Live News Kabar PEMILU 16:30 Sorotan Kasus 17:00 Live News Kabar Petang 19:00 Meja Bundar 20:00 Live News Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Menyingkap Tabir 22:30 Kabar Arena

08:00 Kungfu Panda 08:30 Chuggington 09:00 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Siang Seru Sama Sule 14:00 Seleb On Cam 14:30 Spot On 15:00 Fokus Selebriti 15:30 Lawan Tawa 16:30 Ada Ada Aja 17:30 Spongebob Squarepants 19:00 Big Movies 21:00 Big Movies 23:00 Big Movies

07:30 Selebrita Pagi 08:15 Spotlite 09:15 Syafa’at 10:00 Ceplas Ceplos LIVE 11:30 Redaksi Siang 12:00 Selebrita Siang 12:45 Laptop Si Unyil 13:15 Bocah Petualang 13:45 Dunia Binatang 14:15 Tau Gak Sih 14:45 Mancing Mania 15:15 Jejak Petualang 15:45 Orang Pinggiran 16:15 Redaksi Sore 17:00 Opera Van Java 18:30 Hitam Putih 19:30 On The Spot 20:30 CCTV 21:15 ILK (Indonesia Lawak Klub) 22:15 Bukan Empat Mata 23:30 Dua Dunia 01.00 Redaksi Malam **m31/G

David Beckham Difavoritkan Anak-anak Bacakan Dongeng

Potret diri (selfie) Ellen DeGeneres (paling depan) bersama beberapa artis diantaranya Jared Leto, Jennifer Lawrence, Meryl Streep, Bradley Cooper, Peter Nyong’o Jr, Channing Tatum, Julia Roberts, Kevin Spacey, Brad Pitt, Lupita Nyong’o dan Angelina Jolie memecahkan rekor Twitter saat membawakan acara penyerahan Piala Oscar 2014/ap

‘Selfie’ Ellen DeGeneres Pecahkan Rekor Twitter

Potret diri (selfie) pembawa acara Ellen DeGeneres saat membawa acara penyerahan Piala Oscar 2014 bersama sederet bintang lainnya menjadi foto paling banyak dibagi di Twitter. Dalam foto itu, DeGeneres berfoto bersama Meryl Streep, Jennifer Lawrence, Julia Roberts, Brad Pitt, Angelia Jolie, Lupita Nyong’o, dan Jared Leto. Aktor Bradley Copper, juga ada di foto itu, bertugas memegang kamera. “Kami dapat e-mail dariTwitter, kami memecahkan (rekor) Twitter. Kami membuat sejarah,” kata DeGeneres, seperti dikutip dari laman Reuters. Foto itu dibagi, atau di-retweet, lebih dari dua juta kali saat siaran Academy Awards ke-86. Foto itu melewati rekor sebelumnya, kemenangan Barack Obama saat terpilih lagi menjadi Presiden Amerika Serikat. Foto lainnya yang populer, termasuk selfie DeGeneres dengan Liza Minelli, diambil setelah sang pembawa acaranya be-

rkomentar tentang penampilan aktris dan bintang Broadway itu. 43 juta penonton Siaran langsung Anugerah Oscar telah menarik perhatian 43 juta penonton di Amerika Serikat atau yang terbanyak dalam satu dekade penyelenggaraan Academy Awards, dan mengundang 14,7 kicauan di Twitter. Namun kebanyakan penonton menganggap siaran terlalu lama kendati sangat menyukai pembawa acara Ellen DeGeneres. Oscar telah menjadi tontonan paling banyak dilihat di luar siaran olah raga yang pada 2004 menarik perhatian 43,6 juta penonton. Pemilihan DeGeneres sebagai pembawa acara telah menarik penonton muda, jauh berbeda dari tahun lalu saat penyelenggara berjudi memilih komedian Seth MacFarlane sebagai pembawa acara. DeGeneres dianggap setara dengan host-host kondang di masa lalu seperti Bob Hope dan

Johnny Carson. Brian Lowry, kolumnis televisi pada majalah Variety menyebut monolog pembuka perempuan pembawa acara ini telah membangkitkan hasrat untuk mengulang lagi melihat acara ini. Perempuan komedian 56 tahun ini menyampaikan guyonan-guyonan segar, termasuk yang dilontarkannya kepada aktris Jennifer Lawrence dan selorohannya mengenai 12 Years a Slave mengatakan rasis jika film ini tidak mendapat Oscar Film Terbaik. Karen Valvy dari Entertainment Weekly menyebut Ellen DeGeneres telah membuat mereka yang tak ingin menonton Oscar berubah menjadi ingin menontoninya, sedangkan Tim Goodman dari Hollywood Reporter mengatakan DeGeneres telah mengerek kemenarikan tontonan Oscar tahun ini yang disebutnya telah diproduksi dengan buruk karena begitu lama sampai-sampai DeGeneres sendiri terlihat membosankan

pada 30 menit terakhir acara. Dengan mengundang DeGeneres, produser acara tampaknya ingin menggaet lebih banyak penonton muda. Sedangkan bagian paling banyak menarik penonton adalah saat pengumuman pemenang kategori film terbaik. Perhelatan tahun ini juga menjadi bukti kehebatan media sosial, terutama yang paling banyak dibicarakan orang adalah foto selfie DeGeneres bersama sejumlah bintang. Foto ini telah menciptakan rekor paling sering di-retweet dalam Twitter, sejauh ini sudah melewati angka 2 juta tweet, di samping membuat layanan Twitter terganggu selama 20 menit. Twitter Inc menyebutkan 14,7 juta tweet berkaitan Oscar telah dikirim selama siaran langsung Oscar, sedangkan data keseluruhan aktivitas media sosial dari Nielsen selama acara berlangsung, naik 75 persen dibandingkan dengan tahun lalu, demikian Reuters.(ant)

Mantan pesepakbola timnas Inggris David Beckham terpilih sebagai sosok difavoritkan anak-anak untuk membacakan dongeng. Anak-anak juga memilih penyanyi Katty Perry sebagai sosok diidolakan membacakan dongeng. Kedua pesohor itu terpilih menurut sebuah penelitian terbaru dilakukan Sainsbury dengan mengikutsertakan sebanyak 2000 orang, orang tua dan anakanak berusia 4-10 tahun. Ant & Dec, Cheryl Cole, dan Lady Gaga berada di urutan berikutnya dalam lima selebritis favorit dipilih anak-anak untuk membacakan dongeng. Hasil penelitian seperti dilansir Female First memperlihatkan, sebanyak 89 persen anak-anak mengatakan menyukai bila selebritis membacakan untuk mereka cerita. Satu dari lima anak laki-laki memilih David Beckham (23 persen), sementara kebanyakan anak perempuan memilih Katy Perry (18 persen). Tak hanya itu, hasil temuan yang muncul sebelum Hari Buku Dunia pada tanggal 6 Maret mendatang ini juga menemukan beberapa statistik menarik tentang orang tua dan pola membaca mereka. Hampir setengah atau 49,9 persen dari orang tua mengakui lebih cenderung membacakan buku cerita yang karakter tokohnya ingin anak-anak mereka tiru. Kemudian, sekitar sepertiga

dari mereka atau sekitar 35 persen berharap dapat meluangkan waktu membacakan cerita pada anak-anak mereka. The Gruffalo dan Disney Tangled merupakan buku populer

orang tua. “Senang sekali mengetahui The Gruffalo adalah buku paling favorit dipilih anak-anak,” ujar juru bicara Sainsbury seperti dilansir Female First.(ant)

Mantan pemain sepakbola Inggris David Beckham (kanan) melakukan aksi foto ‘selfie’ diri dan anak-anaknya (kiri-kanan) Brooklyn, Romeo, Cruz dan Harper, sebelum peragaan busana koleksi Musim Gugur 2014 Victoria Beckham di New York Fashion Show/rtr

Raih Oscar, Frozen Berkisah Tentang Kerajaan

Deepika Padukone Puji Shah Rukh Khan Dalam acara Koffe with Karan, Deepika Padukone mengaku kepada Karan Johar presenter acara talk show itu bahwa ia sangat menyenangi Ranveer Singh. Namun ketika bersama Priyanka Chopra dalam acara itu bintang filmYeh Jawaani hai Deewani ini berbicara mengenai hubungannya dengan Ranbir Kapoor. “Itu pertama kali saya merasakan benar-benar jatuh cinta,” aku Deepika waktu itu Ketika ditanya Karan Johar apakah ia menyenangi Ranbir, Ranveer atau Saif, ia memilih Ranveer. Padukone beberapa waktu lalu menjadi pusat kontroversi dalam satu acara talk show langsung bersama Sonam Kapoor yang menyatakan bahwa Ranbir Kapoor adalah mantan kekasih dua aktris cantik ini. Aktris berusia 27 tahun ini menceritakan pada Digitalspy tentang pengalamannya bermain film bersama Shah Rukh Khan dalam Chennai Express. Deepika memuji Shah Rukh Khan sebagai aktor hebat dalam sejarah film Bollywood. “Khan adalah aktor romantis yang hebat, kapan saja ia mendapat kesempatan melakukan peran romantis, Khan melakoninya dengan baik dan sepenuh hati sehingga ia digelari aktor Bollywood paling romantis,” puji Deepika. Aktris cantik ini bersama Shah Rukh Khan berada di London untuk mempromosikan film Chennai Express disutradarai Rohit Shetty. Bersama aktor ganteng ini Deepika juga terbang ke Dubai menggelar konser melibatkan aktris cantik Bollywood lainnya seperti Madhuri Dixit dan Jacqueline Fernandez. Tidak ketinggalan penyanyi Yo Yo Honey Singh, Neeti Mohan dan Meing Chang. ”Penonton dapat menyaksikan atraksi raja Khan di Dubai untuk pertama kali setelah peluncuran film Chennai Express dan dideklarasikan sebagai film blockbuster terbesar dalam sejarah sinema Bollywood,” ungkap satu pernyataan.

dipilih orang tua untuk dibacakan pada anak-anak mereka. Lalu, karakter Brave yang percaya diri (29 persen) dan Superman tidak egoistis (26 persen) adalah model peran paling difavoritkan

Frozen dinobatkan sebagai Film Animasi Terbaik dalam perhelatan Oscar 2014. Frozen berhasil unggul dari The Croods, Despicable Me 2, Ernest & Celestine dan The Wind Rises. Piala penghargaan diterima Chris Buck, Jennifer Lee dan Peter Del Vecho. Mereka berterima kasih untuk para keluarga dan penggemar yang mendukung film animasi tersebut. Seperti dilansir LA Times, nominasi ini adalah kali pertama bagi Jennifer Lee juga menulis naskah untuk Frozen. Chris Buck sebelumnya dinominasikan untuk Surf’s Up pada 2007 silam. Frozen berkisah tentang dua bersaudara Puteri Anna dan Puteri Elsa dari kerajaan Arendelle. Puteri Elsa tidak sengaja membekukan kerajaannya karena tidak mampu mengendalikan kekuatannya. Dia pun melarikan diri dan bersembunyi. Anna pergi mengejarnya demi mengembalikan keadaan kerajaan seperti sedia kala juga memperbaiki hubungannya Elsa. Sementara itu, Film Animasi Pendek Terbaik diraih Mr Hublot berkisah tentang karakter eksentrik yang kehidupannya berubah sejak didatangi hewan peliharaan robot. Seperti dikutip dari AFP, piala Oscar ini merupakan nominasi serta penghargaan pertama bagi sutradara Laurent Witz dan Alexandre Espigares. Mr Hublot mengalahkan film animasi pendek lain seperti Feral, Get a Horse! dan Possessions serta Room on the Broom.(ant)

Acha Septriasa Merasa Sejuk Di Hagia Sofia

Deepika Padukone Deepika dan Shah Rukh Khan baru-baru ini syuting film Happy NewYear arahan Farah Khan kebanyakan lokasi syutingnya di Dubai. Konser di Dubai berlangsung di Dubai Cricket Stadium. Dikhabarkan kedua bintang Bollywood ini juga mengusung konser di Australia dan new Zealand. Deepika dan Khan juga terlibat dalam film Om Shanti Om. Nur

Acha Septriasa, pemeran Hanum dalam film berjudul 99 Cahaya Di Langit Eropa, mengaku merasa sejuk ketika berada dalam Museum Hagia Sophia dan Masjid Biru (Blue Mosque) di Istanbul, Turki. “Ketika masuk Hagia Sophia dan Blue Mosque rasanya sejuk,” kata Acha saat konperensi pers terkait film 99 Cahaya Di Langit Eropa Bagian II di Jakarta, Senin. Artis kelahiran Jakarta 25 tahun lalu ini mengaku mendapat pengalaman berbeda saat masuk ke dalam Mezquita, masjid kini menjadi gereja di Cordoba, Spanyol. “Masuk ke Mezqueta justru seperti terasa panas,” ujar dia. Ia menyayangkan kondisi sisa-sisa peninggalan Islam dalam masjid kini merupakan gereja tersebut, termasuk kondisi kaligrafi pada dinding bangunan sengaja dirusak. Begitu pula nasib peninggalan berbau Islam lainnya yang disingkirkan. “Kebebasan beragama dan kebesaran Islam ketika itu terpaksa harus hilang,” ujar dia. Namun kekaguman justru ia rasakan ketika berada di dalam Hagia Sophia karena menemukan ornamen-ornamen Islam bersanding dengan ornamen Kristen. Baik Islam maupun Kristen dapat dipelajari secara gamblang di Hagia Sophia. “Seharusnya memang tidak ada tembok untuk mempelajari kedua agama,” ujar wanita berdarah Minangkabau juga merupakan penyanyi ini.(ant)

Acha Septriasa


WASPADA Rabu 5 Maret 2014

B9 Polres Agara Musnahkan 97 Kg Ganja KUTACANE (Waspada): Jajajan Kepolisian dari Mapolres Aceh Tenggara bersama instansi terkait, Selasa (4/3) memusnahkan 97 kg ganja kering hasil tangkapan petugas di berbagai lokasi. Penyulutan api pemusnahan daun ganja kering bersama puluhan botol minuman ringan kadaluarsa di halaman Mapolres tersebut, dilakukan Wakapolres Kompol Syafrinizal, Kasat NarkobaIpdaBuryaniTanjung,KepalaSekretariatBNK AgaraT.Adisyah Bintang Selian, Sekretaris Dinkes Agara Alpansyah dan Pengacara Beni Murdani. Kapolres Aceh Tenggara, AKBP H.Trisno Riyanto melalui Kasubbag Humasnya AKP AwaluddinMUnthekepadaWaspadadiruangkerjanya, Selasa (4/3) mengatakan, 97 kg ganja kering yang dimusnahkan tersebut ,hasil tangkapan pihak kepolisian yang bertugas di Pos Perbatasan Lawe Pakam yang memisahkan Agara dengan Kabupaten Karo (Sumut). Semuaganjakeringdanminumankadaluarsa yang diamankan dan dimusnahkan pihak

kepolisian itu, hasil operasi rutin yang dilakukan sejak Januari hingga Pebruari 2014 ini, dengan jumlahdantersangkayangbervariasidanpelakunya berasal dari Tanah Karo 6 orang, Aceh Tenggara 1 orang dan dari Gayo Lues 1 orang. Adapun rincian 97,793,668 kg ganja yang diamankan dan dimusnahkan itu , urai Awaluddin, diantaranya dibawa tersangka AD alias Inen Ria sebanyak 2,8 kg ,DN Bin Rianto seberat 1,46 kg,, SSP alias Alam Bin M.Saleh Cs seberat 14,877 kg, SHD Alias Adi Bin Jamin seberat 56,759 kg, Sedangkan modus operandi yang dilakukan pelaku atau tersangka untuk meloloskan ganja keringdariposperbatasanLawePakambermacammacam dan senantiasa berubah-ubah, namun karena sigapnya petugas Polisi di Pos Perbatasan lawePakamyangdipimpinPetersonSimangunsong dan personil kepolisian, dalam dalam beberapa bulan saja, petugas berhasil mengamankan dan menggagalkan lolosnya ganja ke sumut via Aceh Tenggara.(b26)

Sudah 4 Juta Jiwa Korban Narkoba

Waspada/Ali Amran

PETUGAS kepolisian di Mapolres Agara tengah mengumpulkan barang bukti ganja seberat 97 kg yang akan dimusnahkan, Selasa (4/3)

Polisi Serius Tangani Kasus Honorer K2

BIREUEN (Waspada): Hingga saat ini, diperkirakan lebih dari 4 juta jiwa penduduk Indonesia menjadi korban narkoba. Jumlah tersebut nyarissamadenganjumlahpendudukSingapura, yakni sekira 4,35 juta jiwa. “Sudah 4 juta penduduk jadi korban narkoba, jangan anda korban berikutnya,” ucap Kepala Badan Narkotika Nasional Kabupaten (BNNK) Bireuen, Agussalim HSA saat membuka acara Pelatihan Kader Dasar Penyuluh Anti Narkoba di SMP Negeri 1 Samalanga, Selasa (4/3). Lebih lanjut Agsussalim mengatakan, dari jumlahtersebuthanyabelasanribukorbannarkoba yang kini sedang dilakukan rehabilitasi di lembaga rehab pecandu narkoba di Indonesia. Keterbatasan ini antara lain diakibatkan berbagai keterbatasan, termasuk minimnya ketersediaan lembaga rehab itu sendiri. “Di Aceh juga belum ada lembaga rehab,” ucap Agussalim. Hukuman penjara bagi korban pemakai narkoba tidak terjamin akan membebaskan mereka dari ketergantungan terhadap barang haram itu. Apalagi, kadang-kadang kita mendengar berita tentang adanya narapidana (napi) yang menjadi bandar narkoba. Menurut Agussalim, kelompok yang pal-

ing rentan terhadap penyalahgunaan narkoba satu di antaranya adalah kalangan pelajar di tingkat menengah. “Mayoritas pecandu narkoba berawal dari coba-coba pada saat masih remaja yang kemudian berubah menjadi ketergantungan narkoba,” kata Agus. Pada saat sudah ketergantungan narkoba, banyak pelajar yang terjerumus lebih dalam lagi menjadi pengedar barang haram tersebut. “Karena kalau sudah menjualnya sehingga keuntungannya dapat dimanfaatkan untuk pakai sendiri”, ucap Agussalim. Dengan demikian, kata Agussalim, pelajarsalahsatupeluangyanghendakdimanfaatkan oleh bandar narkoba. Karenanya,diamengajakparapesertapelatihan Kader Dasar Penyuluh Anti Narkoba di Kecamatan Samalanga ini dapat menjadi tenaga penyuluh yang andal dalam mensosialisasikan bahaya narkoba terhadap kawan-kawan di sekolahnya maupun di lingkungan tempat tinggal mereka. Kepala SMP Negeri 1 Samalanga, Jailani mengatakan, menjadi pecandu narkoba memang dilatarbelakangi oleh berbagai faktor, namun yang paling dominan adalah sikap coba-coba yang dipengaruhi oleh kawan sepermainan. (b17)

Pengumuman MenPAN Bisa Dibatalkan TAKENGEN (Waspada): Pihak kepolisian mengakui serius “menggali” data persoalan tenaga honor K2 yang dinyatakan lulus oleh MenPAN, namun yang bersangkutan tidak pernah honor, atau masa honornya diragukan. “Kita serius. Keterangan pelapor sudah kita minta. Kita sedang kumpulkan data pendukung,” jelas Kapolres AcehTengah AKBP

Artanto melalui Kasat Reskrim AKP Raja Gunawan, Selasa (4/ 3) di ruang kerjanya. Kini pihak kepolisian sudah meminta keterangan 4 saksi. Bila bukti pendukung kuat, maka aka nada tersangka.Tersangka bukan hanya yang dinyatakan lulus honorer K2, namun instansi yang mengeluarkan surat honorer, tetapi yang lulus tidak honor, juga akan dikenakan jeratan hukum. Sementara di tempat terpisah, ratusan tenaga honorer K2 kembali mendatangi DPRK Aceh Tengah. Tenaga honorer ini dalam persidangan DPRK Aceh Te-

Memiliki Ganja, WN Malaysia Ditangkap Polisi Bireuen BIREUEN(Waspada):MatSaatbinDesa,51,WargaNegaraMalaysia, ditangkap PolantasPolresBireuendi JalanBireuen–Takengonkawasan Teupin Mane, Kecamatan Juli Bireuen, Senin (3/3). WN Malaysia beralamat Jalan Bunga Melur No 4 Komplek Taman Surya Jaya Kuala Lumpur Malaysia bersama dua rekannya Rahmat warga Medan (Sumut) dan Murdani warga Juli Teupun Mane Bireuen ditangkap Polantas Polres Bireuen dalam serangkaian razia. Kenderaan yang ditumpang mereka kedapatan memiliki ganja kering. Kasat Narkoba Polres Bireuen AKP AjiWisa Prayoga mengatakan, WNMalaysiabersamaduarekannyaitumenggunakansedanHonda City Nopol BK, dalam mobil terdapat dua linting ganja siap isap. WN Malaysia itu memiliki dokumen keimigrasian yang lengkap. Dia dijerat Undang-undang Nomor 35 tahun 2009 tentang narkotika. Tersangka terancam hukuman minimal empat tahun penjara maksimal 10 tahun penjara, ujar Kasat Narkoba. (b12)

Bentengi Diri Dari Bahaya Narkoba BLANGKEJEREN (Waspada): Ratusan masyarakat di Desa Cempa, menghadiri penyuluhan tentang bahaya narkoba yang dilaksanakan oleh BNNK Gayo Lues di Masjid Desa Cempa, Kecamatan Blangkejeren. Sebagai Pemateri Kasat Narkoba Gayo Lues, Iptu. Agam Suprapto yang diwakili oleh Kanit Satnarkoba Bripka Rajiman. Kegiatan itu bertemakan Melalui Penyuluhan Kita Bebaskan Masyarakat Dari Bahaya Narkoba. Sosialisasi ini bertujuan agar masyarakat mengerti bahanya narkoba bila mengkonsumsinya, apalagi menyimpan obat-obatan terlarang. “Untuk mengantisipasi maraknya peredaran obat-obatan dan jenis narkoba yang semakin merajalela di masyarakat tersebut, tentunya kita harus bisa membentengi diri dengan mengetahui jenisdanakibatbilamengkonsumsinarkoba,termasukhukumannya, “ ungkap Rajiman. Dikatakan, Narkotika adalah zat atau obat dari tanaman atau bahan tanaman, sintetis/semi sintetis yang dapat menurunkan atau mengubah kesadaran, mengurangi sampai menghilangkan rasa nyeri dan dapat menimbulkan ketergantungan. (cjs)

Masih Banyak Maksiat Di Aceh TAPAKTUAN (Waspada) : Penceramah kondang ustadz Syamsul Arifin Nababan menyatakan keprihatinannya terhadap pemberlakuan Syariat Islam di Aceh. Karena hingga saat ini belum diterapkan secara maksimal. “Pemberlakuan Syariat Islam belum berjalan secara konsisten dan konsekwen sehingga menjadi ironis. Masih banyak ditemui perbuatan maksiat seperti prostitusi, praktik judi dan peredaran minuman keras,” katanya dalam tausiahnya pada Peringatan Maulid Nabi Besar Muhammad SAW, di Masjid Agung IstiqamahTapaktuan, Senin (3/3). Pada acara yang dihadiri Forum Komunikasi Pimpinan Daerah (Muspida), Kepala SKPK dan ribuan warga yang memadati komplek masjid ibu kota Kabupaten itu, Nababan tidak merinci lokasi maksiat dimaksud.Tetapi hanya menyatakan upaya pemberantasan harus mendapat dukungan penuh dari masyarakat. Seharusnya masyarakat Aceh patut bersyukur karena pemberlakuan Syariat Islam merupakan rahmat. Sebab dari Sabang sampai Meuroke, hanya Provinsi Aceh yang berlaku Syariat Islam. Selain meminta dukungan masyarakat dalam penerapan Syariat Islam, Nababan juga mengingatkan masyarakat agar mewaspadai kegiatan misionaris, pemurtadan dan pendangkalan aqidah yang kini dilaporkan telah merambah wilayah pantai barat selatan Aceh. (b30)

ngah menyampaikan tuntutan sehubungan dengan dikeluarkan pengumaman kelulusan oleh MenPAN. Sidang DPRK yang dipimpin M Nazar, para tenaga honor ini meminta agar tenaga honorer yang terhitung sejak 2005 harus diangkat pemerintah sebagai PNS. Bupati dan DPRK harus menolakkelulusanK2yangdiumumkanMenPAN,karenatahapanmekanisme rekrutmen banyak yang dilanggar. Dinasterkaittidakdibenarkan mengeluarkan surat apapun untuk tenaga honor yang diluluskan

MenPANini,selainitupihakDPRK tidak menganggarkan biaya terhadap 457 tenaga honorer yang lulus. Untuk menjernihkan persoalandilapanganharusdibentuk tim turun ke lapangan. Tim tersebut terdiri dari tenaga honor, unsur DPRK, pemerintah, LSM, pers dan pihak kepolisian. Para tenaga honorer ini juga meminta kejelasan dari pihak terkait, terutama Dinas Pendidikan dan Kesehatan yang memiliki tenaga honorer cukup banyak di Aceh Tengah. Para tenaga honor meminta pengumumanyangdisampaikan

MenPAN tentang kelulusan K2 dibatalkan. Wajadal Muna, Ketua Komisi A DPRK Aceh Tengah menjelaskan, tim Panselnas di Jakarta tidak ada mengirimkan daftar nilai kepada pejabat pembina kepegawaian di daerah. “Tidakadadikirimnilaisudah melanggar tahapan seleksi dan Pemda Aceh Tengah belum meluluskan siapa yang berhak lulus. Karena ada tahapan yang vital dilanggar, maka pemerintah daerahberhakmenolakkelulusan yangdiumumkanMenPAN,”kata Muna. (b32)

Zaini Kecam Penembakan Kader PNA PNA: Pembunuhan Terencana BANDA ACEH (Waspada): Gubernur Aceh Zaini Abdullah juga menyampaikan turut berduka cita yang sedalam-dalamnya atas kejadian yang menyedihkan, sekaligus memilukan yang telah menodai perdamaian Aceh tersebut. ‘Saya atas nama Pemerintah Aceh menyesalkan peristiwa ini dan turut berduka atas peristiwa yang menodai perdamaian Aceh ini,’ ujar gubernur. Kepada semua pihak Gubernur mengimbau untuk terus menjaga dan merawat perdamaian Aceh, karena Pemilu 2014 tidakakanberartijikaperdamaian terusik. “Perdamaian lebih utama dari segalanya dan wajib dijunjung tinggi,” paapr Zaini. Oleh karena itu, ia meminta kepada pihak keamanan dan penegak hukum untuk mengusut tuntas kejadian tersebut. “Siapapun pelaku dan apapun motifnya harus segera diusut, kemudian disampaikankepublikdantindak sesuai hukum yang berlaku,” papar gubernur “Kepada seluruh rakyat Aceh, sayamengimbauagartidak

resah. Pererat kebersamaan agar pertumpahandarahdiAcehsegera dapat kita hentikan,” paparnya. Sementara para pimpinan, kader dan keluarga besar Partai Nasional Aceh (PNA) menyampaikanrasadukayangmendalam atas meninggalnya Faisal, caleg PNADaerahPemilihanIISawangMeukek, Aceh Selatan. Faisal, 36, tewas setelah diberondong dengan 46 tembakan menggunakansenjataapidikawasan Gunong Seumancang, Desa LadangTuha, Keucamatan Meukek, Aceh Selatan, Minggu (2/3). Ketua DPP-PNA, Irwansyah, kepada wartawan, Selasa (4/3), mengatakan, pihaknya memandangbahwapembunuhanterhadap Faisal dilakukan dengan sangat terencana dan sistematis. Menurut dia, tindakan pembunuhan tersebut merupakan bukti kepanikan yang melanda kelompokyangselamainimemusuhi PNA dan hal ini dilakukan dengan maksud untuk meneror caleg dan kader PNA. “Kita ketahui, kelompok yang memusuhi PNA merasa tidak nyaman dan terancam, terutama

dengan makin kuat dan masifnya dukungan masyarakat kepada PNAdikawasanPantaiBaratSelatan,” tutur pria yang akrab disapa Tgk Muksalmina ini. Disebutkan, pembunuhan atas Faisal dan pembunuhan lain yang menimpa kader dan caleg PNA, adalah kejahatan yang luar biasa dan tidak bisa diselesaikan dengan prosedur normal biasa. “Ini adalah teror yang merongrong negara dan kenyamanan masyarakat,” tegasnya. Untuk itu, lanjut Irwansyah, DPP-PNA meminta Presiden RI, Menko Pulhukam dan Kapolri untuk segera turun tangan menangani kekerasan demi kekerasan yang terjadi kalau ingin perdamaian di Aceh tetap terjaga. Kepada seluruh pengurus dankaderPNA,diamengingatkan untuk tetap mengedepankan hukum dalam segala tindakan, namun jangan lengah dalam membela diri dan masyarakat. “Kader dan pengurus PNA harus membantu tugas-tugas polisi dalam menangkap pelaku kekerasan di Aceh,” tuturnya. (b04)

Satlantas Polres Langsa Razia Ranmor LANGSA (Waspada): Satuan Lalulintas (Satlantas) Polres Langsa menggelar razia penertiban kelengkapan sepeda motor yang tidak memakai helm, kaca spion, surat-surat kendaraan, surat izin menggemudi (SIM) di sejumlah Jalan Ahmad Yani, Kota Langsa, Selasa (4/3). Kapolres Langsa, AKBP H Hariadi melalui Kasat Lantas AKP Kamilamengatakan,raziakelengkapan kendaraan sepeda motor iniyangdigelarselamaduaminggu inimasihbersifatimbauankepada masyarakat agar mengendarai sepeda motor dapat melengkapi surat-surat kendaraan, seperti SIM, STNK, helm dan kaca spion. Menurut Kamila, setelah raziaimbauan ini kitalaksanakan, nantinya akan kita lakukan razia dalam bentuk penindakan tegas kepada pengendara yang tidak memilikikelengkapankendaraan bermotornya. Jadi,lanjutKamila,kitaberharap ke depan setelah imbauan

ini masyarakat dapat mematuhi kelengkapan dalam berkendara. Untuk itu, Kasat Lantas kembali mengimbau masyarakat Kota Langsa agar dapat meleng-

kapi kendaraannya dalam menggunakansepedamotornyadijalanan. Sehingga ke depan, korban kecelakaan lalu lintas dapat diminimalisir sedini mungkin. (m43)


KEPALA Badan Narkotika Nasional Kabupaten (BNNK) Bireuen Agussalim saat memberikan arahan kepada peserta Pelatihan Kader Dasar Penyuluh Anti Narkoba di SMP Negeri 1 Samalanga, Selasa (4/3)

Wabup Agara : Belum Ada Penambahan Honorer K-2 KUTACANE (Waspada) :Wakil Bupati Agara Ali Basrah menegaskan, sampai saat ini belum ada kabar resmi dari pemerintah pusat untuk penambahan CPNS yang berasal dari honorer K-2 untuk Kabupaten Aceh Tenggara. Penegasan itu disampaikan Wakil Bupati Ali Basrah, Selasa (4/3), beberapa saat setelah menerima audiensi perwakilan masyarakat dan honorer K-2 yang mengaku kecewa dan meminta Pemkab Aceh Tenggara mengusulkan penambahan CPNS dari honorer K-2. Sampai saat ini, secara resmi belum pernah menerimalagisuratdaripemerintahpusattentang penambahan honorer K-2 untuk diangkat menjadi CPNS, yang ada baru 163 orang yang telah selesai mengikuti ujian beberapa bulan lalu. Diterangkan Ali Basrah, kedatangan perwakilan lembaga dan honorer K-2 tadi, juga menyinggung usulan penambahan pengangkatan CPNS dari honorer K-2, karena masih ada honorer yang telah lama mengabdi, tapi tak masuk dalam daftar nominatif dan ada lagi yang lulus

pada pengumuman baru-baru ini, merupakan honorer bodong. Terkait sinyalemen lulusnya honorer bodong pada pengumuman K-2,Wabup menegaskan akan terus berupaya melakukan proses seleksi yang selektif dengan memfokuskan perhatian pada persyaratanpemberkasansesuaiPPyangmengatur tentang rekrutmen CPNS dari honorer. “Kalau ada yang terbukti honorer bodong dan tidak bisa membuktikan keabsahan persyaratan yang dibutuhkan, dipastikan tidak akan diusulkan menjadi CPNSs ke Menpan-RB, dan dipastikan tidak akan diusulkan NIP-nya, sebab itu saya minta warga yang memiliki bukti menyerahkan bukti yang dibutuhkan kepada saya,” kata Wabup. “Sedangkan terhadap penambahan pengangkatan honorer K-2 menjadi CPNS, kendati belum ada lampu hijau dari Kementerian PAN-RB, namun usulan tersebut sepanjang benar-benar honornya, kitaakanupayakandiusulkanlagi,namunapakeputusannya nanti terserah kepada pemerintah pusat, karena kita hanya sebatas mengusulkan saja,” papar Wabup. (b26)

Hadapi UN, Disdik Abdya Tambah Jam Belajar MANGGENG RAYA (Waspada) : Jelang pelaksanaan ujian nasional (UN) pada 14 April 2014 mendatang, Dinas Pendidikan Aceh Barat Daya memberlakukan jam belajar tambahan bagi para siswamulaidaritingkatsekolahdasar(SD),sekolah menengahpertama(SMP)dansekolahmenengah atas (SMA) sederajat. Kadis Pendidikan Abdya Yusnaidi melalui sekretarisnya Edwar Taufik kepada wartawan Selasa (4/3) mengatakan, program tambahan jam belajar bagi siswa tersebut merupakan upaya untuk meningkatkan kualitas dan mutu pendidikan serta untuk mendongkrak nilai dan angka kelulusan di ajang UN nantinya. “Jam belajar tambahan ini kita berlakukan pada siang hari, artinya siswa sekarang wajib belajar pagi hingga sore hari,” ungkapnya.

Selaintelahmemberlakukanjambelajartambahan, lanjut Taufik, pihak Disdik Abdya juga sudah melakukan sosialisasi UN kepada wali siswa agar paraorangtuasiswatahutentangbagaimanaproses kelulusan anak melalui UN itu. Lebih lanjut dikatakan Taufik, hingga saat ini koordinasi dengan pihak sekolah semakin ditingkatkan, bahkan Kadis Pendidikan Abdya telah memetakan hasil UN tahun lalu di hadapan seluruh kepala sekolah, dengan tujuan dapat mengetahui secaralangsungdimanaletakkelemahandankekurangan hasil UN pada masa itu. “Harapannya, seluruh kepala sekolah dapat memperbaiki di mana letak kekurangan yang selama ini melanda hasil UN di Abdya, paling tidak hasil UN tahun ini harus lebih baik dari tahun-tahun sebelumnya,” papar Taufik.(cza)

Syariat Islam Di Aceh Jalan Di Tempat


Petugas Satlantas Polres Langsa sedang melakukan razia penertiban sepeda motor di Jalan A.Yani, Kota Langsa, Selasa (4/3)

IDI (Waspada): Meskipun berbagai upaya telah dilakukan dan mengalokasikan dana untukmembawaperubahandalammengharumkan Provinsi Aceh melalui budaya Islam, namun melihatperkembanganditengahumatsepertinya Syariat Islam (SI) sepertinya sulit merangkak dan mencapai titik kejayaan sebagaimana pada masa Sultan Iskandar Muda. “Pemprov Aceh melalui Dinas Syariat Islam (SI), Bagian Keistimewaan Aceh dan Badan Pemberdayaan Pembinaan Dayah terus mengusulkan dan menjalankan berbagai program mendukung pelaksanaan SI di Aceh, tapi bertahun-

tahunAcehmenerapkanSIhinggakinibelumterlihat aura Aceh yang lebih Islami,” kata DirekturYARA, Safaruddin, Selasa (4/3). Dia juga menyayangkan alokasi anggaran, baik APBKdanAPBAyangtidaksedikituntukmengawasi pelaksanaan SI di Aceh, tetapi tidak dijalankan secara maksimal, namun fakta di lapangan SI jalan di tempat dan tidak ada yang menghasilkan. “Berbagai kasus yang terjadi di masyarakat masih menggunakan hukum pidana yakni KUHP, padahal berbagai kasus bisa diselesaikan oleh Polisi Wilayah Hisbah dengan syarat memiliki penyidik atau juru periksa,” kata Safaruddin. (b24)


WASPADA Rabu 5 Maret 2014

B11 Enam Ambulans Dinkes Abdya Jadi Besi Tua

Siswa SMA Ikuti Ujian Berstandar Nasional TAKENGEN (Waspada): Sebanyak 1.962 siswa tingkat SMA/ SMK di seluruh Kabupaten AcehTengah, mengikuti ujian sekolah berstandar nasional untuk mata pelajaran pendidikan Agama Islam. Ujian tersebut dilaksanakan secara serentak di seluruh sekolah di daerah itu, Senin (3/4). Ujian pendidikan agama Islam itu, hanya dilangsungkan selama dua jam dan khusus diikuti siswa dari SMA/SMK. Kepala Kementerian Agama Aceh Tengah Hamdan, Selasa (4/3) mengatakan, berdasarkan wacana pemerintah kegiatan ujian sekolah berstandar nasional ini, di tahun 2015 akan diperuntukan sama dengan bidang studi yang lain. “Jadi harapan kita, kedepana mata pelajaran agama bisa menjadi pelajaran yang akan diujian nasionalkan,” kata Hamdan. (b33)

MANGGENG RAYA (Waspada) : Sebanyak 6 unit ambulans aset Dinas Kesehatan Aceh Barat Daya terancam jadi besi tua. Pasalnya kendaraan bertuliskan ‘Puskesmas Keliling’ itu saat ini teronggok di pekarangan parkir Dinkes Abdya. Amatan Waspada, Senin (3/3), 6 unit ambulans yang sedianya dipakai untuk operasional masing-masing puskesmas di Abdya itu kini terparkir di pekarangan kantor Dinkes Abdya tanpa perawatan, sebagian ban mobil itu malah sudah tertanam lumpur dan dikerubuti semak-semak yang makin meninggi. Demikian juga dengan kondisi bodi mobil yang semakin keropos dan melepuh karena tiap saat diterpa hujan dan terik mentari tanpa dibuat peneduh. “Mobil ambulans ini sudah terparkir di sini sekian bulandanmenungguprosesDUM,”ungkapMartunis,KadisKesehatan Abdya di ruang kerjanya, Senin (3/3). Kondisi 6 unit ambulans itu memang sudah tidak layak pakai lagi untuk operasional puskesmas karena dalam sudah rusak, andai pun diperbaiki ongkos tambah bahan yang diperlukan harga sudah melebihi dari harga mobil dimaksud. Kadis Pengelolaan Kekuangan dan Kekayaan Daerah (DPKKD) Abdya Iskandar mengatakan, proses DUM sejumlah aset daerah berbentuk mobil termasuk 6 unit ambulans di Dinkes Abdya masih menunggu proses dari atasan. “Proses DUM yang kita inginkan tidak bisa secepat kilat, kita tunggu saja,” katanya. (cza)

Program Pembangunan Harus Berdasarkan Kebutuhan LANGSA (Waspada): Untuk mewujudkan Kota Langsa sebagai kota utama perdagangan dan jasa tentu saja diperlukan sejumlah dana, untuk itulah diperlukan program pembangunan prioritas yang disusun berdasarkan kebutuhan, bukan keinginan. “Pasalnya, APBK kita terbatas, tidak semua dapat dibiayai dari APBK Kota Langsa,” ujar Wakil Wali Kota Langsa Marzuki Hamid, saat membuka Musyawarah Rencana Pembangunan (Musrenbang) RKPK Kota Langsa tahun perencanaan 2015, di aula Sekretariat Daerah Kota Langsa, Selasa (4/3). Untuk itu, peran serta masyarakat dalam pembangunan daerah harus ditingkatkan, sinergi dan koordinasi secara intensif dengan pemerintah provinsi dan pusat untuk mendapatkan dukungan dana APBN dan APBA Provinsi Aceh juga perlu ditingkatkan, serta sinergitas dengan stakeholder untuk menggerakan Corporate Social Responsibility (CSR) kerjasama antar pemerintah danswastasangatdiperlukandalamrangkamempercepatakselesari pembangunan di Kota Langsa. “Selain iitu, Pemerintah Kota Langsa juga telah membentuk Tim Percepatan Pembangunan dan Pengembangan Ekonomi Kota Langsa (TP3EKL), demi mewujudkan Kota Langsa sebagai pusat industri, jasa dan perdagangan,” katanya. Kepala Bappeda Aceh diwaliki Kepala bidang Perencanaan EkonomidanKetenagakerjaanZulkiflmenyampaikanperencanaan adalah suatu proses yang bersifat sistematis, terkoordinir dan berkesinambungan, sangat terkait dengan kegiatan pengalokasian sumber daya, usaha pencapaian tujuan dan tindakan di masa depan. (cms)

SMPN Unggul Sigli Terapkan Pola Pesantren SIGLI (Waspada): SMPN Unggul, Sigli, Kabupaten Pidie, telah setahun menerapkan pola pendidikan berbasis pesantren atau dayah. Pola ini berlangsung maksimal, dengan memanfaatkan waktu di luar jam pelajaran umum. Kepala SMPN Unggul, Sigli, Maidan, Selasa (4/3) menjelaskan, pola belajar berbasis dayah/pesantren yang telah diterapkan dengan memanfaatkan waktu di luar jam pelajaran umum, yaitu mulai pukul 16:20 sampai 22:00, para murid sudah dapat membacakan Kitab Kuning. Wakil Bupati Pidie M Iriawan didampingi Kadis Pendidikan Laisani menjelaskan kolaborasi pendidikan umum berbasis dayah merupakan cerminan pendidikan sekolah/madrasah. Sebab, pesantren merupakan lembaga yang tetap eksis untuk mengatasi moral generasi muda. Adapun sekolah negeri berbasis pesantren akan memadukan dua sistem. (b10)

Warga PiJay Jadikan Parit Sebagai MCK MEUREUDU (Waspada): Meski telah 10 tahun lebih berpisah dengan Kabupaten Pidie, ratusan kepala keluarga di Desa Cot Meukasoe, KecamatanTrienggadeng, Kabupaten Pidie Jaya masih menggunakan parit sebagai tempat Mandi Cuci Kakus (MCK). Pemandangan ini setiap hari dilakoni, ratusan warga desa pedalaman itu, karena hampir setiap rumah tidak memiliki kakus dan sumber air bersih yang bisa digunakan untuk MCK. Demikian pantauan Waspada, Selasa (4/3). Ida, 40, salah seorang ibu rumah tangga asal Desa Meukasoe, KecamatanTrienggadeng, mengungkapkan ia dan hampir seluruh warga desa dimaksud terpaksa menggunakan parit yang melintang di kawasan desanya itu untuk keperluan MCK. Sebab, karena hampir semua rumah warga tidak memiliki sumber air seperti sumur. Meskipun ada sumur di rumah, harus digali dalam capai 25 meter. Dengan kondisi ekonomi yang morat marit, warga di sana tidak memiliki biaya untuk diongkoskan menggali sumur. Sebenarnya, kata Ida, warga di sini sangat membutuhkan MCK, karena itu merupakan kebutuhan mendasar, yang bisa digunakan setiap waktu. (b10)

Bandara Rembele Akan Diperluas Waspada/Syafrizal

SEBANYAK 6 unit ambulans aset Dinkes Abdya dalam kondisi rusak parah terparkir di halaman belakang kantor itu. Foto direkam Senin (3/3)

Gubernur Harus Tindak Pejabat Arogan BANDA ACEH (Waspada) : Demokrasi yang sedang dibangun di Provinsi Aceh kembali rusak akibat ulah pejabat Pemprov Aceh yang memukul mahasiswa yang sedang berunjuk rasa di depan kantor Gubernur Aceh, Senin (3/3). “Pemukulan yang dilakukan tersebut sangat tidak terpuji dan telah mencoreng citra Pemprov Aceh.” kata Raihal Fajri, Executive Director Katahati Institute Raihal Fajri menyebutkan

Kepala Biro Umum Pemerintah Aceh, Mustafa memukul kepala seorang mahasiswa yang telah ditangkap oleh polisi saat membubarkan unjuk rasa menuntut penyelesaian kasus korupsi di Aceh khususnya kasus korupsi yang terjadi di Universitas Syiah Kuala (Unsyiah) Banda Aceh. “Seharusnya, pejabat pemerintah bukan memukul mahasiswa, tapi mereka harus menghormati penyampaian pendapat yang disampaikan mahasiswa untuk pemberantasan korupsi di Aceh,” papar Raihal Fajri. Penyampaikan pendapat di manapundankapanpun,menurut Raihal, merupakan hak dasar

setiap masyarakat Indonesia dan diatur dalam Undang-Undang. Negarakhususnyapejabatnegara tidak boleh melarang atau menghalang-halangimasyarakatuntuk menyampaikan pendapat. “Jikapununjukrasayangdilakukan oleh mahasiswa dari BEM Hukum dan BEM FISIP Unsyiah tidak mengantongi izin, maka yang harus melakukan penindakanbukanlahPegawaiNegeriSipil (PNS)ataupejabatPemprovAceh, itu merupakan wewenang kepolisian,” ujar Raihal. Menurut Raihal, pemukulan salahseorangmahasiswa, Ahmad Irawan oleh Kepala Biro Umum Pemerintah Aceh telah memper-

tontonkan sikap arogan oleh pejabat pemerintah, dan hal ini juga telah mencoreng citra Pemprov Aceh di mata masyarakat. “Sikap arogan tersebut juga mencerminkan bahwa Pemprov Acehanti terhadap kritik dan tidak menghargai pendapat dari masyarakat,” ujar Raihal. Raihal menambahkan, Gubernur Aceh harus menindak tegas pejabat daerah yang arogan dan main hakim sendiri karena tindakan tersebut merusak citra pemerintah. Raihal juga mendesak aparat kepolisiansegeramenindaklanjuti laporan mahasiswa terkait pemukulan yang dilakukan Kepala Biro Umum Pemprov Aceh. (b08)

Petani Bisa Dapat Asuransi Pertanian BANDA ACEH (Waspada): Anggota Komisi IV DPR RI, M Ali Yakob meminta para petani di Aceh untuk mengenal dan memahami UU Nomor 19 Tahun 2013. Anjuran ini disampaikan Ali mengingat UU tersebut mengatur secara khusus hak-hak para petani sebagai bagian dari proteksi pemerintah terhadap sektor pertanian. “Paling tidak terdapat tujuh strategi perlindungan petani yang termuat dalam UU Nomor 19Tahun 2013. termasuk asuransi pertanian.” kata Ali Yakob Senin (5/ 3) siang di Banda Aceh. Ali menyebut diantaranya yakni perlindungan sarana dan prasarana produksi pertanian, sistem peringatan dini, kepastian usaha, ganti rugi gagal panen akibat kejadian luar biasa, perlindungan harga komoditas pertanian,penghapusanpraktikekonomi biaya tinggi, dan penanganan dampak perubahan iklim

serta asuransi pertanian “Karenanyaparapetanimesti pahamUUituagarsewaktu-waktu bisa menuntut hak-haknya dari pemerintah,” tambahnya lagi. Dewasa ini, perubahan iklim menjadi momok yang sangat menakutkan bagi para petani. Perubahan cuaca kadang kala tidak terjadi sesuai dengan fase yang sudah diprediksikan oleh pihakpihak terkait seperti Badan Meteorologi dan Geofisika (BMKG). Akibatnya,musimhujanyang kemudian mengakibatkan banjir dan merusak pertanian warga bisa terjadi kapan saja. Bahkan di Aceh dalam beberapa tahun terakhir, musibah banjir terjadi dimana-mana. Selain karena faktor infrastruktur pengelolaan air, tentunya problema perubahan iklim tak bisa abaikan sebagai penyebabnya. Sebaliknya, fase musim kemarau justru bisa terjadi berkepanjangan. maka tak heran bebe-

rapa waktu lalu, para petani di Aceh dihadapkan dengan masalah kekurangan air di lahan-lahan pertaniannya. Bahkan di beberapa tempat, kekurangan air tersebut sudah mematikan tanaman padinya dan terancam gagal panen. Ali menegaskan, pemahaman dan penguasaan subtansi UU Nomor 19 Tahun 2013 tentang perlindungandanpemberdayaanpetaniakanmembantupetanimengatasi masalah-masalah Dewan PerwakilanRakyatRepublikIndonesia tersebut. Para petani memiliki modal berupaketentuanhukumsehingga persoalan-persoalan pertanian dapat dijadikan prioritas penyelesaian oleh pemerintah, khususnya para pelaksana pemerintahdaerah.Masihmenurut politisi Partai Demokrat ini, UU Nomor 19 Tahun 2013 juga memuat hak-hak para petani atas

informasi teknologi pertanian untuk menunjang pengetahuannya dalam menggarap lahan secara moderen. Informasi itu bisa didapatkan melalui pertemuan-pertemuan khusus, maupun melalui medium-medium lainnya untuk menambahkapasitasparapetani. Dia berharap, para petani dapat mengakses UU Nomor 19Tahun 2013sejakdinimelalui kelompokkelompoktaniyangadadimasingmasing gampong. “Memang kalau kita pikir, ngapain para petani membaca undang-undang. membosankan dan bisa jadi nggak ada waktu. Tapi ini penting. Minimal para kelompok tani yang mempunyai kemampuan lebih perlu untuk mentransfer informasi tersebut kepadapetanilainnya.Agarmereka sadar bahwa hak-haknya diatur dan dijamin oleh negara,” demikian Ali Yakob.(b08)

Pemkab Pidie Segera Laksanakan Qanun Ternak

Waspada/Muhammad Riza

SEORANG ibu asal Desa Cot Meukasoe,Kecamatan Trienggadeng, Pidie Jaya, sedang mencuci pakaian di parit desa tersebut, berlatarkan seng sebagai penutup kakus. Foto direkam, Selasa (4/3)

Tiba (light, asal, waktu)

Berangkat (light, tujuan, waktu)

Garuda Indonesia GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45


FY 3400 Penang*


Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

SIGLI (Waspada): Pemkab Pidie dalam waktu dekat, segera melaksanakan Qanun Nomor 07/2012, tentang penertiban pemeliharaan ternak. “Sekira pertengahan atau akhir Maret 2014, ini kita akan melaksanakan perintah tertuang dalamqanunNo.07/2012,tentang penertiban hewan ternak. Kita harapkan semua elemen masyarakatdapatmendukung,”kataKadis Pertanian dan Peternakan Pidie Anas Abdullah, Selasa (4/3). Menurut Anas, harusnya amanah dalam qanun itu sudah dapat dilaksanakan pada awal Februari2014.Namunterkendala dengan beberapa proses administrasiyangbelumlengkap.Antara lain, penerbitan Surat Kerja (SK) tim. Sebetulnya sebanyak empatSKsebagaipayunghukum dalam pelaksanaan kegiatan itu

sudah selesai dikerjakan, hanya sajabelumditandatanganibupati. Malah Pemkab Pidie telah menyiapkanlahanseluas5hektare sebagai tempat penampungan hewan ternak di kawasan Kecamatan Padang Tiji, lengkap denganlahanpakanternaktersebut. Nantinya, seluruh hewan ternak yang ditangkap petugas akan dikarantinakan di tempat penampungan tersebut. Masyarakat yang merasa kehilanganhewanternakjugabisa menghubungi petugas penjaga hewan ternak itu di pos penampungan tersebut, dan boleh mengambilnya kembali setelah membayar biaya administrasi. “Kita sudah membuat draf sanksi bagi masyarakat yang melepashewanternaknya.Sanksi pertama, membayar biaya penangkapan, Biaya pengangkutan

ketempatpenampungansementara,danbiayapemeliharaanserta dan perawatan selama di tempat penampungan sementara. Dan dalamjangkawaktu14harihewan tersebuttidakdiambilpemiliknya, maka akan dilelang,” kata Anas Sebenarnya, sanksi ini berbentuk pembinaan dan member efek jera kepada masyarakat pemilik ternak supaya tidak melepas hewan ternaknya secara liar di jalan raya, karena bisa berdampak buruk pada pengguna jalan, sertamengurangikeindahankota. Anas menjelaskan, dalam melaksanakan amanah qanun ini,pihaknyajugaakanmelibatkan semua unsure listas sektoral, termasuk camat, kepala mukim dan geuchik. Wakil Bupati Pidie M Iriawan membenarkan bila dalam waktu dekat ini, Pemkab Pidie akan se-

gera melaksanakan qanun penertiban hewan ternak. Dia juga mengimbau masyarakat supaya dapat menjaga dan merawat hewan ternaknya dengan baik, serta tidak lagi melepas hewan ternak yang dapat mengganggu ketertiban umum. (b10)

REDELONG (Waspada): Pemerintah pusat melalui Kementerian Perhubungan akan memperluas Bandar Udara (Bandara) Rembele, di Kecamatan Bukit, Kabupaten Bener Meriah. Diperkirakan, areal bandara kebanggaan masyarakat dataran tinggi Gayo itu, akan ditambahseluas80hektaresehinggabisadigunakanpesawatberbadan besar. Dana yang digelontorkan untuk perluasan bandara tersebut, sebesar Rp218 miliar yang bersumber dari APBN. Berkaitan dengan adanya program perluasan Bandara Rembele, Pemkab Bener Meriah, mulai melakukan pertemuan dengan masyarakat pemilik lahan yang diperkirakan terkena perluasan bandara tersebut. “Untuk biaya penggantian lahan yang terkena perluasan itu, bersumber dari APBA. Sedangkan untuk anggaran perluasan bersumber dari APBN sebesar Rp218 miliar,” kata Bupati Bener Meriah, Ir Ruslan Abdul Gani, Selasa (4/3). Untuk proses pembebasan lahan tersebut, lanjut Ruslan, pihak Pemkab Bener Meriah bersama Badan Pertanahan Nasional (BPN), ditugaskan untuk melakukan verifikasi lahan-lahan yang terkena perluasan Bandara Rembele. Namun, untuk soal besaran ganti rugi yang menentukan panitia penafsir atau auditor. “Harga yang tentukan bukan pihak pemda, tetapi ada tim auditor. Kita berharap bisa cepat diselesaikan,” katanya. Bandara Rembele, di Kecamatan Bukit, Kabupaten Bener Meriah, sejak dibangun memiliki landasan pacu sepanjang 1.400 meter hanya bisa digunakan jenis pesawat penumpang berkapasitas sekitar 10 orang. Namun dengan adanya perluasan itu sehingga landasan pacu akan diperpanjang diperkirakan menjadi 2.500 meter dengan kucuran dana sebesar Rp218 miliar. (b33)

Mahasiswa Aceh Dan Pengurus YPIM Peringati Maulid MEDAN (Waspada) : Puluhan mahasiswa asal Aceh penghuni asrama dan pesantren Miftahussalam di Jalan Darussalam Medan, memperingati Maulid Nabi Muhammad SAW, mendapat perhatian besar dari kaum muslimin dan muslimat, Sabtu (1/3). Acara ini dilangsungkan di komplek Yayasan Pendidikan Islam Miftahussalam (YPIM), di mana anak-anak mahasiswa dan para pelajar Aceh selama ini mondok di komplek tersebut. Panitia mengusung thema “Jadikan momentum Maulid Nabi Muhammad SAW untuk memperingati kembali ukhuwah Islamiah dan suri tauladan yang mulai pudar.” Sementara pembicara kunci dalam peringatan maulid tersebut adalah ustadz Tengku Musliadi Mhd. Nazar yang khusus diundang dari Bireun, Aceh. Mengawali acara diperdengarkan pembacaan kitab suci Alquran oleh Khairi Lubis, qori internasional . Sedangkan Ketua Dewan HarianYPIM yang diwakili Abubakar Hasan menyampaikan kata sambutan sekaligus para mahasiswa diingatkantekunmenimbailmupengetahuanagardapatberkompetisi di era global. Dani Saputra selaku ketua panitia pelaksana menyampaikan terima kasih kepada semua pihak terutama donatur yang ikut membantu menyukseskan peringatan maulid tersebut. Bahkan Rizal Mahfud, selaku ketua asrama dan Pesantren Miftahussalam juga menyampaikan ucapan terima kasih atas dukungan warga asal Aceh di Medan, seperti acara tahun-tahun sebelumnya. (rel/m32)

Keluarga Geucyik Sulaiman Terima Santunan LHOKSEUMAWE (Waspada): Wali Kota Lhokseumawe Suaidi Yahya bersama Irwan Ibrahim, Kepala Badan Pelayanan Jaminan Sosial (BPJS) Ketenagakerjaan Lhokseumawe, Selasa (4/3) menyerahkan santunan kepada keluarga almarhum Sulaiman, Geucyik Hagu Teungoh, Banda Sakti, Lhokseumawe, senilai Rp21 juta lebih. Irwan Ibrahim menjelaskan, santunan Rp21 juta merupakan santunan dari program jaminan kematian dan Rp488.000 merupakan tabungan hari tua. Jumlah tabungan yang sedikit karena almarhum menjadi anggota BPJS Ketenagakerjaan selama 4 bulan. Suaidi Yahya usai menyerahkan santunan kepada keluarga almarhum mengatakan, ke depan, BPJS-kan semua perangkat gampong di antaranya kepala dusun. (b18)

Jalan Bukit Seulemak Beselemak BIREM BAYEUN (Waspada): Ketikamusimpenghujantibajalan menujugampongBukitSeulemak di Kecamatan Birem Bayeun, Kabupaten Aceh Timur, penuh lumpur (beselemak), sementara saatmusimpanassekaranginiruas jalanitupenuhgundukanyangsulit dilaluikendaraanrodaduamaupun roda empat. Pengamatan di lapangan, badan jalan Bukit Seulemak yang merupakan salah satu kawasan pedalaman di Aceh Timur yang memiliki sumber daya alam

cukup potensial seperti bidang perkebunan dan pertanian masyarakat terlihat hanya hanya tanahliat,tanpaadanyabebatuan sepanjang jalan menuju gampong Bukit Seulemak itu. Rustam, warga Birem Bayeun, Selasa (4/3) mengatakan, badanjalanBukitSeulemaktersebut harus dilakukan pengerasan, karena kondisi jalan itu saat ini tidak ada bebatuan sehingga ketika hujan turun terlihat layaknyakubangankebau.“Sulituntuk lintasi warga bila menggunakan

kendaraan baik roda dua maupun roda empat,” paparnya. Dalam kesempatan itu, dirinya mengharapkan Dinas Pekerjaan Umum agar dapat melakukan perbaikan ataupun peningkatanjalanBukitSeulemak menjadi lebih baik dari saat ini. Kepala Badan Perencanaan PembangunanDaerah(Bappeda) Aceh Timur Husni Thamrin mengungkapkan, untuk tahun 2014 ini, jalan gampong Bukit Seulemak akan dilakukan perbaikan. (cri)


KONDISI jalan gampong Bukit Seulemak, Kec, Birem Bayeun, Aceh Timur yang mengalami kerusakan parah dan butuh perbaikan segera

B10 Aceh Demokrat Belum Tentukan Calon Wakil Walikota Banda Aceh BANDA ACEH (Waspada): Partai Demokrat Kota Banda Aceh menyatakan belum membahas siapa yang akan diusung sebagai calon Wakil Wali Kota Banda Aceh. “Kamibelummembahassiapa yang akan diajukan sebagai calon wakil walikota,” kata Ketua Dewan Pimpinan Cabang (DPC) Kota Banda Aceh Yudi Kurnia di Banda Aceh. PosisiWakilWalikota Banda Acehhinggakinikosongmenyusul ditunjuknya Illiza Saaduddin Dja-

mal yang sebelumnya menjabat wakil walikota sebagai pelaksana harian Wali Kota Banda Aceh menggantikan Mawardy Nurdin yang meninggal dunia beberapa waktu lalu. Yudi Kurnia menyebutkan, secara aturan, 60 hari setelah walikota berhalangan tetap, maka wakilnyadilantiksebagaiwalikota. Sedangkan posisi wakil diajukan oleh partai pengusung. Yudi Kurnia yang juga Ketua DPRK Banda Aceh menyebutkan, Partai Demokrat dan sejumlahpartaipengusung,sepertiPAN, PPP, dan Partai Sira (partai lokal), hinggakinibelummembahasnya.

KIP Aceh Tengah Deklarasi Damai TAKENGEN (Waspada): Dalam rangka sosialisasi tahapan Pemilu 2014, KIP Aceh Tengah akan menggelar kegiatan sosialisasi dan pendidikan pemilih Pemilu antara lain gerak jalan, karnaval atau kirab dan deklarasi Pemilu damai. Demikian dikatakan Asri Bukit, anggota Komisioner KIP Aceh Tengah yang juga menangani bidang kehumasan kepada wartawan, di ruangan kerjanya kantor KIP Belang Bebangka, Kecamatan Pegasing, Kabupaten Aceh Tengah, Selasa ( 4/3). “Pelaksanaan gerak jalan menyongsong pemilu jujur dan adil, kegiatannya akan dilaksanakan 9 Maret 2014. Adapun peserta gerak jalan berjumlah 1.500 orang, yang melibatkan stakeholder Pemilu dan masyarakat umum,” kata Asri Bukit. Dia juga menambahkan, untuk kegiatan kirab atau karnaval dilaksanakan 15 Maret 2014. Menurutnya, kegiatan ini dilanjutkan dengan deklarasi kampanye damai yang akan melibatkan seluruh partai politik peserta pemilu. (b33)

Wali Nanggroe Ajak Peserta Pemilu Jaga Perdamaian BANDA ACEH (Waspada): Wali Nanggroe Aceh, Tgk. Malik Mahmud Al-Haytar mengingatkan semua partai politik (parpol) peserta Pemilu, dan simpatisannya untuk menjaga kehormatan dengan tetap menjunjung tinggi nilai-nilai dan perdamaian. “Agar semua berjalan sesuai dinamika dan perdamaian Aceh tetap terjaga, kita sebagai bangsa yang berpendidikan tinggi, hendaknya bersikap lebih arif,’ ujarWali Nanggroe Aceh pada rakor pemilu legislatif 2014, Senin (3/3) di kantor gubernur, Banda Aceh. Wali Nanggroe juga mengajak segenap elemen masyarakat untuk menyukseskan pemilu sesuai dengan fungsi masing-masing. Kepada para mubaligh,Wali berpesan agar menyampaikan kepada seluruh masyarakat untuk berpartisipasi pada pemilu 9 April mendatang. Malik Mahmud juga meminta penegak hukum untuk memberikan rasa aman kepada masyarakat dan jangan bersikap diskriminatif dalam bertindak. “Marilah berikhtiar menyukseskan Pemilu. Semoga berjalan dengan penuh kedamaian, adil dan bermartabat,” tandasnya. (b06)

Kecewa Dicoret Jadi Caleg BANDA ACEH (Waspada) : Pencoretan M Khoni sebagai Caleg DPRK Kabupaten Simelue berbuntut panjang. Kader PDI Perjuangan itu melaporkan lembaga penyelenggara Pemilu yakni KIP Simeulue, Panwaslu Simeulue dan Bawaslu Aceh ke DKPP. Pelaporan itu disampaikan Kuasa Hukum M Khoni (Caleg DPRK PDI Perjuangan Simeulue) Imran Mahfudi, Selasa (4/3). “Kami telah melaporkan 11 penyelenggara pemilu di Aceh ke Dewan Kehormatan Penyelenggara Pemilu (DKPP) karena diduga telah melakukan pelanggaran kode etik penyelenggara pemilu terkait masalah pencoretan M Khoni dalam DCT DPRK Simeulue.” ungkap Imran Mahfudi. Menurut Imran, ketua dan anggota KIP Simeulue diduga telah melakukan pelanggaran kode etik karena dalam verifikasi ulang terhadapberkaspencalonanMKhonipada25Februari2014berbeda dengan hasil verifikasi yang pernah mereka lakukan pada 22 Oktober 2013. “Ini merupakan suatu hal yang tidak lazim, orang-orang yang sama melakukan verifikasi dokumen yang sama, tapi hasilnya berbeda, dan terkait mengulur-ngulur waktu pelaksanaan verifikasi ulang sebagaimana perintah Bawaslu Aceh sehingga M Khoni tidak memiliki waktu lagi untuk mengajukan gugatan pada PTTUN Medan,” kata Imran. (b08)

Kodim 0110 Abdya Gelar Patroli Bersama BLANGPIDIE (Waspada) : Terhitung sejak 1 Maret, Kodim 0110 Aceh Barat Daya (Abdya) mulai menggelar patroli bersama denganaparatkepolisian,patroliyangberjalansetiapmalamtersebut akan digelar hingga selesai penghitungan suara pemilu nanti. “Dalam rangka pengamanan wilayah, serta mencegah munculnya gangguan keamanan, kita sejak tanggal 1 maret kemarin hingga penghitungan suara pemilu nanti, akan menggelar patroli bersama dengan aparat kepolisian, patroli tersebut akan kita lakukan setiap malam dengan sasaran daerah yang rawan terjadinya upaya gangguan keamanan,” ungkap Dandim 0110 Abdya, Letkol Arm E.Dwi Karyono.AS, Selasa (4/3). Patroli yang melibatkan ratusan personil yang terdiri dari para Babinsa di masing-masing kecamatan itu, menurut dandim Letkol Arm E.Dwi Karyono.AS adalah sebagai bentuk antisipasi terjadinya gangguan menjelang pemilu yang kini dianggap mulai menjurus ‘panas’, namun demikian menurut Dandim kondisi di wilayah Abdya sejauh ini masih cukup kondusif. “Pengamanan wilayah ini adalah tugas pokok dan wajib bagi kita sebagai TNI, dan saya tegaskan agar semua pihak untuk dapat saling menjaga lingkungan masing-masing, jangan mencoba memancing suasana, sebab saya tidak ragu untuk bertindak tegas dan keras jika sudah menyangkut keamanan daerah serta masyarakat, jadi jangan buat keributan di wilayah kami jika memang tidak ingin berhadapan langsung dengan kami nantinya,” ujar Dandim yang juga menyampaikan harapannya kepada semua lapisan masyarakat untuk bersama menjaga keamanan di lingkungan masing-masing, dengan saling berkomunikasi terhadap setiap gerak gerik yang dianggap menjurus munculnya gangguan keamanan. (cb05)

“Kami diinternal Partai Demokrat juga belum membahasnya.MungkininikarenaadatAceh dan keluarga almarhum masih berkabung,” kata Yudi Kurnia. Ia menyebutkan penentuan wakil walikota juga harus melalui pemilihan di DPRK. Sebelumnya, partai pengusung mengajukan sejumlah nama kepada walikota. Nanti,walikotamemilihduanama untuk dipilih dalam sidang paripurna khusus. “Saya belum bisa menyebutkan siapa yang akan dicalonkan. Jadi, tunggu saja nanti setelah nama-nama calon diajukan partaipengusung.Namacalondiajukan setelah pelantikan wakil wakil kota sebagai Wali Kota Banda Aceh,” kata Yudi Kurnia. Ketua DPP Partai Demokrat Aceh Nova Iriansyah mengatakan, pihaknya maupun pengurus pusat tidak akan mengintervensi calon wakil walikota yang akan diajukan DPC Partai Demokrat Kota Banda Aceh. “Nanti diusulkan tentu kader

partaiterbaik.Jadi,kamidiprovinsi tidak akan mengintervensi keputusan DPC Kota Banda Aceh. Asal, pemilihan calonnya sesuai mekanisme partai,” ungkap Nova Iriansyah. Sementara itu, Nova Iriansyah, anggota DPR RI asal Aceh ditunjuk sebagai pelaksana tugas harian Ketua Partai Demokrat Aceh menggantikan Mawardy Nurdinyangmeninggalduniabeberapa waktu lalu. “Penunjukan sebagai pelaksana tugas ketua partai ini menyikapituntutanadministasi.Apalagi, jelang pemilu butuh administrasi yang baik,” kata Nova Iriansyah di Banda Aceh, kemarin di Banda Aceh. Ia mengatakan penunjukkan dirinya berdasarkan keputusan Dewan Pengurus Pusat (DPP) Partai Demokrat yang diketuai Susilo BambangYudhoyono tertanggal 28 Februari 2014. “Walaupun keluarga Partai Demokrat masih berkabung, namun roda partai juga harus ber-

jalan, sehingga DPP bersikap menentukan pelaksana tugas ketua. Apalagi kebutuhan saat ini kian mendesak menghadapi pemilu 9 April 2014,” katanya. Sementara itu, T Riefky Harsya, fungsionaris DPP Partai Demokrat, mengatakan, penunjukkan Nova Iriansyah sebagai pelaksana tugas ketua setelah mempertimbangkan masukan dari berbagai pihak, termasuk dewan pempinan cabang atau DPC. “DPP melihat Nova Iriansyah paling tepat melaksanakan tugas ketua. Dan 23 DPC atau pengurus partaidikabupaten/kotamendukungnya,” kataT Riefky yang juga Sekretaris Fraksi Partai Demokrat di DPR RI. T Riefky menegaskan, program Partai Demokrat yang telah disusun Mawardy Nurdin terkait menghadapi pemilu legislatif 9 Aprilmendatang,tetapdijalankan pelaksana tugas Nova Iriansyah. (cb01)

Soal Tewasnya Caleg PNA

Kondisi Aceh Makin Tak Kondusif LANGSA (Waspada): Aksi teror berupa kekerasan, penganiayaan, pemukulan, pembakaran,sampaipadapembunuhan brutalmenimpakader,simpatisan anggota partai terus terjadi di bumi Serambi Mekkah Aceh. Demikian ungkap Ketua Achenes Australia Association Tgk Sufaini Syekhy kepada wartawan, Senin (3/3)melaluipesanelektroniknya. “Politik itu memang harus ada yang dikorbankan, pertanyaannya apakah kita rela dan tega saudara seumat dan seagama, serta sebangsa kita jadikan korban?,” tegasnya. Katanya,sehubungandengan tewasnya Faisal, caleg PNA Sawang–Meukek, Aceh Selatan, yang diberondong oleh orang tak dikenal, Minggu (2/3), ini indikasi kondisi Aceh tidak kondusif menjelang Pemilu. Jelas partai telah

menghancurkanpersatuanrakyat Aceh yang menyebabkan sesama anak bangsa bertikai hanya garagara ingin merebut kekuasan untuk mencari jabatan. “Kami mengecam keras kepada pihak yang menembak anggotaPNAdankitadesakPolda untuk secepatnya mengungkap dan menangkap pelaku serta menindak tegas kepada pelaku penembakan.AcheneseAustralia Association tetap komit untuk mengawasiperdamaianHelsinky di Aceh dan mengutuk keras semua kekerasan yang terjadi dan mengorbankan rakyat,” tuturnya. Lanjut Syekhy lagi, dengan semakin meluasnya kekerasan bersenjatadiAcehini,masyarakat jangan tinggal diam. Masyarakat harus berani melaporkan kepada aparat berwajib untuk mempercepat pengungkapan kasus kri-

minal tersebut.Termasuk apabila ada hal-hal yang mencurigakan dan mengancam perdamaian Aceh. “Kita menuntut Pemerintah Aceh, sebagai milik seluruh masyarakat Aceh harus bisa membawakesituasiyangaman,damai dan harus bisa menghentikan kekerasan di Aceh yang semakin tidakterkendalikarenaperbedaan politik.SelainituadaWaliNanggroe sebagai simbol pemersatu rakyat Aceh,dimanaWaliNanggroeketika rakyat terpecah belah,” paparnya. “Kita minta rakyat bersatu paduuntukmenghentikanpihakpihak yang berusaha merusak perdamaian Aceh. Tentunya ini harus mendapat dukungan dari semuapihakbaikulama,kalangan mahasiswa, mantan TNA, tokohtokoh dan masyarakat secara umum,” ujar Syekhy (m43)

Rabu 5 Maret 2014

Waspada/Muhammad Zairin

LEPAS SAMBUT: Gubernur Aceh, Zaini Abdullah, menyematkan tanda kehormatan kepada mantan Kapolda Aceh Irjen Pol Herman Effendi dan Kajati Aceh, TM Syahrizal pada malam lepas sambut Kapolda Aceh dan Kajati Aceh, Senin (3/3) malam di Anjong Monmata Banda Aceh.

Tugas Di Aceh Punya Tantangan Tersendiri BANDA ACEH (Waspada): Gubernur Zaini Abdullah mengharapkan Irjen Pol Herman Effendi dan TM Syahrizal yang telah mengakhiri masa tugasnya di Aceh sebagai Kapolda dan Kajati, dengan sejumlah prestasi mengagumkan tidak melupakan daerah Aceh. “Melaksanakan tugas di Aceh ibarat berada di laut yang bergelombang. Kondisi ini yang menghadirkan anggapan kalau bertugas di Aceh mempunyai tantangan tersendiri, terutama tantangan di bidang keamanan dan penegakan hukum,” kata Gubernur Zaini Abdullah. Menurut Zaini, hal itu bisa dipahami, sebab Aceh merupakan wilayah yang masih mendapat sorotan nasional dan internasional, sehingga jika sedikit saja ada hal unik terjadi, berbagai sorotan dan analisis akan muncul mengiringinya. Gubernur yakin pemerintah pusat paham betul dengan situasi itu, sehingga pejabat yang ditempatkan di Aceh pasti memiliki latar belakang tidak sembarangan. “Pejabat itu tentu memiliki kemampuanleadershipdanmanajerialyangbaik,” cetusnya, Senin (3/3) malam di Anjong Monmata, Banda Aceh. Pada acara lepas sambut yang dihadiri Brigjen Pol M. Husein Hamidi dan Tarmizi, SH, MH, yang menjabat sebagai Kapolda dan Kepala Kejaksaan Tinggi Aceh itu, Zaini mengatakan langkah bijak pemerintah ini justru membuat rakyat Aceh

menjadi lebih tenang. Hal itu, sebutnya, terbukti ketika pada November2012KapolrimelantikIrjenPolHerman Effendi sebagai Kapolda Aceh, dan sebelumnya pada Juni 2012, Jaksa Agung melantik Teuku MuhammadSyahrizalsebagaiKepalaKejaksaanTinggi Aceh. Hasilnya, tambah gubernur, selama hampir dua tahun keduanya bertugas di Aceh, mereka mampu menjalankan tugas dengan sangat brilian. Baik Herman Effendi maupun Syahrizal samasama sangat dekat dengan masyarakat dan ulama. Di bawah kepemimpinan Syahrizal, tahun laluKejaksaanTinggiAcehmendapatpenghargaan terbaik nomor 5 di Indonesia. Begitu juga dengan PoldaAceh,dalamduatahunbelakanganinimampu menekan angka kriminal yang terjadi di Aceh. “Tidak berlebihan jika saya mengatakan kepemimpinan dua sosok ini telah menghadirkan pencitraan positif terhadap penegakan hukum di Aceh. “Kita harus merelakan keduanya menempati pos yang akan menjadi wilayah kerja mereka yang baru,” tandas gubernur. Irjen Pol Herman Effendi selanjutnya ditempatkan sebagai perwira tinggi di Mabes Polri, sedangkanTeuku Muhammad Syahrizal mendapattanggungjawabbarusebagaiDirekturIIIBidang Intelijen Kejaksaan Agung RI. (b06)

Situasi Aceh Panas, Polda Tingkatkan Pengamanan BANDA ACEH (Waspada): Situasi Aceh jelang pelaksanaan Pemilu9Aprilsemakinmemanas, kepolisian daerah Aceh akan tingkatkan pengamanan di seluruh daerah yang dianggap rawan. “Kita terjunkan 2/3 personel di jajaran Polda Aceh untuk meningkatkan pengamanan di wilayah Aceh menjelang pelaksanaan pemilu 9 April mendatang agar tercipta kondisi aman dan nyaman,” kata Kapolda Aceh Brigjen PolMHuseinHamidiusaupacara lepassambutkapoldalamadiMapolda Aceh, Selasa (4/3). Kapolda menambahkan, seluruh polres telah meningkat-

kan razia untuk memperkecil ruang gerak para pelaku tindak kriminal di wilayah Aceh. “Polisi jugaakan terus melakukan patroli secara rutin, juga akan ada unit khusus yang akan menjaga tiaptiap TPS nantinya,” terangnya. Polda Aceh berharap kepada seluruh peserta pemilu agar saling menjaga dan mengendalikan simpatisan atau pendukung supaya tertib jelang pemilu ini. “Kita sudah melaksanakan deklarasi damai yang dilaksanakan di provinsi dan di kab/kota, dengan adanya kebersamaan itu masyarakat berharap tidak ada lagi kejadian kekerasan di Aceh,”

kata kapolda. Jendral asal Pidie ini menegaskan,apabilamasihadaoknum maupun pihak yang masih melakukan tindakan kriminalitas dan kekerasan pada pemilu ini maka akan kami tindak tegas secara ketentuanhukumyangberlakutanpa ada pilih kasih dan pandang bulu. Terkait kasus penembakan di Aceh Selatan, kapolda menyatakan,kasustersebutmasihdalam pemeriksaansaksiolehkepolisian Polres Aceh Selatan dibantu tim dari Polda Aceh. Pihaknya berharapkasustersebutsegeraterungkap danmenangkappelakunya.(cb01)

Media Ikut Memantau Pemilu BANDA ACEH (Waspada) : Badan Pengawasan Pemilu (Bawaslu) Aceh bersama Komisi Penyiaran Indonesia (KPI) Aceh, Selasa (4/3) menandatangani nota kesepahaman bersama (MoU) gunamensukseskanpelaksanaan Pemilu yang tertib pada 9 April 2014 mendatang. Ketua Bawaslu Aceh, Akhalani, mengatakan, salah satu butir nota kesepahaman bersama tersebutterkaitkomitmenKPIuntuk ikut melakukan pemantauan pemilu, seperti kampanye-kampanye calon legislatif (caleg) yang

ditayangkan di media elektronik, di antaranya televisi serta radio. Hal itu untuk mewujudkan kelancaran pelaksanaan pemilu, terutama saat masuk ke tahap kampanye. Media dinilai sangat berperan dalam melakukan pengawasan ini.”Sebagaimana diatur, media merupakan sarana terpenting dalam menyukseskan pemilu,” katanya. Askhalani berharap, media dapat memantau pemilu, dan memberi informasi tentang penerapan pelaksanaan pemilu. Ketua KPI Aceh Muhammad

Hamzah, mengatakan, pelaksanaanMoUdimaksudbertujuan untukmenyukseskanpemilu2014 baik legislatif maupun presiden. Menurut Hamzah, pengawasan terhadap media perlu dilakukan mengingat banyak pemilik media menyalahgunakan frekuensi yang sebenarnya merupakan milik publik untuk kepentingan kampanye partai tertentu. Dia berharap, media baik televisi maupun radio menyadari hal itu dantidakmenggunakanfrekwensi publik yang dinilai semakin meresahkan. (cb06)

Tarik Menarik Simpatisan Dengan Caleg LHOKSEUMAWE (Waspada): Sejumlah caleg terus berupaya untuk mendapatkan simpati lebih banyak dengan berbagai cara dan pengaruh, akibatnya terjadi tarik menarikdi antara pemilih di Aceh secara umum dan khususnya di Lhokseumawe. “Karena adanya pengaruh ini kami merasa terbebani, ada rasa tidak enak, dan ada kalanya

memang tertekan. Asal saja tidak sampai menekan, saya kira masih terasa aman. Dalam keadaan sepertiinikamimemangdalamposisi serbasalahsendiri,”kataMukhtar,45, salah seorang penduduk di Kota Lhokseumawe, Selasa (4/3). Apalagi dengan timbulnya berbagai kerusuhan, tindakan saling menyerang antara simpatisan atau pengurus partai yang

berseberangan, tentu membuat perasaan tidak nyaman. Demikianpulayangdikatakan oleh Muhadhar, 54, bahwa beberapa caleg juga mendekatinya denganharapandiamemberikan suara untuk si caleg tersebut. Sejauh hanya meminta, katanya, tidak masalah. Asalkan jangan memaksa sampai menekan dengan ancaman. (b14)

PNA Banda Aceh Targetkan 5 Kursi DPRK

Dandim 0110 Abdya Letkol Arm E.Dwi Karyono.AS


BANDA ACEH (Waspada) : Partai Nasional Aceh (PNA) menar-getkan meraih satu fraksi atau minimal 5 kursi dari 30 kursi di DPRK Banda Aceh. Angka menguasai tujuh kursi parlemen tersebut, dinilai para pengurus DewanPimpinanWilayah(DPW) setempat, tidak terlalu mengadangada. Ketua Dewan Pimpinan Wilayah (DPW) PNA Kota Banda Aceh, Marwan Muhammad,

Selasa (4/3) menyatakan, target PNA dalam Pemilu Legislatif 2014 minimal mendapat satu kursi dalam satu Daerah Pemilihan (Dapil). “Kita yakin target ini akan tercapai karena kita punya peluang dalam Pemilu 2014 ini,” kata Marwan optimis. Dikatakan Marwan, pemilihan anggota legislatif di Kota Banda Aceh dalam Pemilu 2014 ini dibagi dalam 5 Dapil yang meliputi 9 kecamatan. Jadi target satu

kursisetiapdapilakanbisadicapai. PNA mengusung 35 caleg atau penuh 120 persen untuk dipertandingkan dalam Pemilu Legislatif. “Sebanyak 30 caleg itu telah kami persiapkan segalanya,” jelas Marwan. Marwan meminta 30 caleg dan seluruh kader serta simpatisan PNA agar berpolitik secara sehat tanpa berupaya menyikut lawan atau kandidat yang merupakan rival mereka. (b09)

Waspada/Gito Rolies

MANTAN Kapolda Aceh Irjen Pol Herman Efendi menyerahkan bendera pataka kepemimpinan kepada Kapolda baru Brigjen Pol M Husein Hamidi pada upacara pelepasan kapolda lama di halaman Mapolda Aceh, Selasa (4/3)

PWI Aceh Gelar Pelatihan Liputan Pemilu Damai BANDA ACEH (Waspada): Peranan pers atau media massa sangat dibutuhkan dalam mendorong Pemilu damai, khususnya di Aceh. Media diharapkan juga memberikan sumbangan pemikiran dalam menciptakan pemilu yang damai ini. Persatuan Wartawan Indonesia (PWI) Aceh melalui Sekolah Jurnalisme Indonesia (SJI) PWI Aceh bersama Dishubkomintel Aceh menggelar pelatihan jurnalistik bagi wartawan yang akan meliput pemilu legislatif 9 April mendatang. Pelatihan yang digelar, 10 -11 Maret 2014 ini, dilaksanakan di aula PWI Aceh, Simpang Lima, dengan menghadirkan lima pemateri, masingmasing dari KIP Aceh, Panwaslu Aceh, PWI Aceh, IJTI Aceh dan AJI Banda Aceh. “Kita berharap hasil dari pelatihan ini dapat memberi pencerahan kepada wartawan yang bertugasmeliputpemiludiAcehagardapatmenjaga

keseimbangandalampemberitaansehinggadapat menjaga kondisi damai ini,” ujarWakil Ketua PWI Aceh Bidang Organisasi T Anwar Ibrahim, Selasa (4/3). Ditambahkannya,kondisisaatinimemerlukan kehati-hatian wartawan, terutama dalam menghasilkan karya jurnalistik sehingga mampu menghasilkantulisanyangmenjadibahanpembelajaran dan penyejuk bagi masyarakat luas. Direktur Diklat PWI Aceh yang juga Kepala Sekolah Jurnalisme Indonesia, Iranda Novandi, menambahkan, tujuan dari kegiatan ini untuk memberi pemahaman dalam menyampaikan informasi mengenai pemilu damai melalui media massa, meningkatkan pengetahuan wartawan di Aceh tentang Pemilu Damai serta menjadi ajang pertukaran ide (exchange of idea) dalam menciptakan Pemilu Damai di Aceh. (b04)

Polsek Rantau Selamat Simulasi TPS RANTAU SELAMAT (Waspada): Polsek Rantau Selamat, Aceh Timur, yang merupakan wilayah hukum Polres Langsa melakukan pelatihan dan simulasikepadapetugasLinmasdiwilayahtersebut terkait persiapan dan pengamanan TPS menghadapi Pemilu 9 April mendatang di lapangan kantor Camat Rantau Selamat, Selasa (4/3). KapolsekRantauSelamat,IptuSutrisnokepada wartawan mengatakan, pemberian materi dan pelatihan kepada petugas Linmas Kecamatan Rantau Selamat mengenai tugas dan peran selama pemilu, mulai dari tahap persiapan sampai tahap

pengucapan sumpah calon yang terpilih. Selanjutnya melaksanakan simulasi pengamanan di TPS. “Dengan harapan masing-masing anggota Linmas mengerti dan memahami tugas dan perannya selama pemilu, serta masyarakat akan merasa aman pada saat melakukan pencoblosan kertas suara. Kemudian dengan harapan Linmas dan Polri siap mengamankan pemilu 2014,” tutur Sutrisno. Acara pelatihan dan pemberian materi kepada petugas Linmas diakhiri dengan pelaksanaansimulasipengamanTPSyangdipimpin Kapolsek Rantau Selamat. (m43)



WASPADA RABU 5 Maret 2014

Viviz, Crossover Baru Subaru Yang Menawan Subaru kembali menampilkan Viviz Concept Car di pameran Geneva Motor Show, yang digelar di Geneva, Swiss, pekan ini. Crossover masa

depan ini disiapkan untuk mengisi kekosongan yang ditinggalkan Tribeca. Viziv generasi kedua ini merupakan pengembangan dari Viziv

generasi pertama yang sudah diperkenalkan pada ajang serupa di tahun lalu. Pada generasi kedua ini, Subaru Viziv ini mendes-


Subaru Viviz Concept Car .

kripsikan evolusi terbaru dari bahasa desainnya yang tentunya dibarengi dengan teknologi terkini dari Subaru. Subaru memang belum memaparkan secara rinci baik penampilan maupun teknologi dari Viziv generasi kedua ini. Namun diduga dari bentuk lampu depan dan grille serta lampu kabutnya, Viziv generasi kedua lebih mendekati ke model yang akan diproduksi, ketimbang hanya sekadar model konsep seperti yang sebelumnya ditampilkan pada Viziv generasi pertama. Dengan menyajikan penampilan baru crossover masa depan ini membuktikan kalau Subaru siap bertarung di kelas crossover yang semakin berkembang pasarnya beberapa tahun belakangan ini. Selain Viziv generasi kedua, Subaru juga akan memajang mobil balap terbarunya yang berbasis dari model WRX STi. Model balap terbaru ini akan ikut berkompetisi dalan ajang balapan Nürburgring 24 Hours yang berlangsung 19 sampai 22 Juni mendatang. (mkc/m47)

New Ford Focus Pamer Kecanggihan Ford Motor Company telah menampilkan di Mobile World Congress di Barcelona. Facelift dari Ford Focus 2014 ini, yang juga dipajang di arena Geneva Motor Show 2014 ini, diklaim sebagai Focus paling canggih yang pernah dibuat oleh produsen mobil asal AS tersebut. New Focus canggih yang akan menjadi kendaraan Ford Eropa pertama yang menawarkan sistem konektivitas dalam-mobil yang diaktifkan dengan perintah suara SYNC 2, di antara serangkaian teknologi-teknologi baru yang meningkatkan kualitas hidup yang ditampilkan secara perdana di Eropa. Sistem konektivitas dalammobil canggih Ford menampilkan resolusi tinggi, layar sentuh warna delapan inci dan perintah suara canggih untuk akses yang lebih mudah ke audio, navigasi, climate control dan telepon selular kompatibel. Sistem navigasi SYNC 2 juga menawarkan untuk pertama kalinya di Eropa tampilan split-screen dengan detil perempatan, penyebutan nama jalan, persimpangan jalan raya 3D dan pemandangan landmark, serta panduan perjalanan Michelin. SYNC sekarang telah terpasang di lebih dari delapan juta kendaraan Ford di jalan sejak diluncurkannya di Amerika pada tahun 2007. SYNC 2, sistem generasi kedua ini lebih intuitif dan memungkinkan pengendara untuk memberikan destinasi navigasi “one-shot” yang lebih mudah. Cukup menekan tombol perintah suara dan

mengatakan “I’m hungry” akan memunculkan daftar restoran lokal. New Ford Focus meningkatkan nameplate terlaris dunia dengan desain eksterior lebih berani, lebih emosional, interior baru intuitif dan dikerjakan dengan sempurna, serta peningkatan yang besar pada penghematan bahan bakar. “Kami tidak puas dengan menjadi nomor satu, kami ingin membuat orang terkagum dengan versi baru yang mempesona dari Focus yang akan membangun reputasi kendaraan ini dengan memperkenalkan teknologi canggih,” kata Stephen Odell, presiden Ford Eropa, Timur Tengah dan Afrika. “New Focus akan memungkinkan pengendara untuk dengan mulus beralih antara layar sentuh dan perintah suara, dan juga mengatur sistem dalammobil yang lebih dari sebelumnya, sementara memungkinkan mata pengendara untuk tetap memperhatikan jalan dan tangan tetap memegang kemudi.” New Focus merupakan kendaraan Ford pertama yang menawarkan parkir lurus (Perpendicular Parking), teknologi

parkir hands-free baru yang membantu pengendara mundur memasuki lahan parkir yang bersebelahan dengan mobil lain. Focus saat ini memperkenalkan bantuan parkir paralel Active Park Assist yang, dengan menekan tombol, menggunakan sensor ultrasonik untuk mencari ruang parkir dan dapat mengarahkan kendaraan sementara pengendara mengatur pedal gas dan rem. Tambahan dua sensor baru pada bagian belakang new Focus memungkinkan Perpendicular Parking untuk beroperasi dengan cara yang sama. Sensor tambahan juga memungkinkan Ford untuk menawarkan untuk pertama kalinya di Eropa teknologi-teknologi yang membantu pengendara selagi mereka bermanuver saat keluar parkir, Cross Traffic Alert memperingatkan pengendara saat mundur keluar dari tempat parkir akan keberadaan kendaraan yang akan melintas di belakang mereka. Park-Out

Assist membantu pengendara saat keluar dari tempat parkir paralel. Setelah pengendara memilih baik sisi kiri maupun kanan, sistem mengoperasikan kemudi sementara pengendara mengoperasikan pedal gas dan rem New Focus juga akan dilengkapi untuk pertama kalinya dengan teknologi MyKey Ford. MyKey memungkinkan pemilik untuk melakukan pengaturan pada kunci, biasanya untuk para pengendara muda yang dapat membatasi kecepatan tertinggi, mengurangi volume maksimum dari sistem audio, dan dapat menonaktifkan keduanya jika pengendara dan penumpang tidak menggunakan sabuk pengaman. Sistem ini dapat mencegah pengendara menonaktifkan teknologi keselamatan seperti Electronic Stability Control dan Active City Stop, yang dapat membantu mengurangi atau mencegah resiko tabrakan pada kecepatan rendah. (mkc/m47)

New Ford Focus - net

New MegaPro Injeksi Perkokoh Honda Di Segmen Sport Kehadiran Honda New MegaPro FI yang melengkapi deretan kuda besi Honda sukses menjadi perbincangan di kalangan pecinta otomotif roda dua tanah air. Hadir dengan mengaplikasi teknologi Injeksi yang irit bahan bakar dan ramah lingkungan, serta desain

yang lebih atraktif dengan mempertahankan karakter MegaPro yang macho dan tangguh serta kenyamanan berkendara jauh menjadikan New MegaPro FI idola baru dan semakin memperkokoh sport Honda Indonesia. Untuk wilayah Sumut


Seorang model pose di depan Honda New Mega Pro.

sendiri, Honda New MegaPro FI meluncur akhir pekan lalu, menjawab kerinduan para pecinta sport yang mengaplikasi teknologi tercanggih dan ramah lingkungan. Semarak launching New MegaPro FI yang berlangsung di Merdeka Walk Medan terbukti berhasil menarik perhatian masyarakat kota Medan yang sepanjang hari terus memadati lokasi acara berlangsung dan menikmati beragam hiburan. Ketangguhan New MegaPro FI juga terbukti dengan kehadiran tim ekspedisi Nusantara bersama 12 riders yang memulai perjalanan sejauh 80.000 km sejak 22 Februari lalu dari titik nol Sabang menuju titik nol Khatulistiwa, Pontianak. Melalui Ekspedisi Nusantara, Honda semakin membuktikan kualitas Sport Honda terutama New MegaPro FI, Honda Verza 150 dan CB150R Streetfire. Leo Wijaya, General Manager Indako Trading Co selaku main dealer Honda di wilayah Sumut mengungkapkan, Honda mempersembahkan New Honda MegaPro FI sebagai produk yang ke-12 dalam jajaran produk berteknologi PGM-FI. Pihaknya meyakini Honda New MegaPro FI akan diterima dan diminati masyarakat Sumut, karena selain memiliki beragam keunggulan, sport Honda yang terkesan sporty dan dinamis ini juga teruji ketangguhannya melalui Ekspedisi Nusantara. “Honda akan terus berupaya

mengembangkan produk agar dapat memberikan manfaat baru bagi konsumen di setiap segmen. Kami yakin, New Honda MegaPro FI ini akan memuaskan konsumen sehingga dapat semakin memperkuat penetrasi kami di segmen sport “, ujar Leo Wijaya New Honda MegaPro FI hadir dengan mengusung konsep Mass Forward Gravity yang menampilkan garis-garis tajam agresif, mengusung mesin baru 150cc, SOHC, 5-Kecepatan yang telah dilengkapi dengan teknologi PGM-FI. Mesin baru ini memi-liki performa yang bertenaga, responsif, dan hemat bahan ba-kar serta lebih ramah lingku-ngan. Mesin baru ini telah mam-pu memenuhi regulasi peme-rintah tentang tingkat kebisi-ngan suara knalpot dan juga memenuhi standar emisi EURO 3. Dengan diaplikasikannya teknologi PGM-FI, New Honda MegaPro FI mampu mencapai konsumsi bahan bakar 46,2 km/ liter (metode ECE-R40) atau lebih irit 10% dari versi sebelumnya. Gunarko Hartoyo, Corporate and Marketing Communication Manager CV Indako mengungkapkan, menghadirkan produk-produk baru dengan teknologi injeksi memang sudah menjadi komitmen Honda untuk pemenuhan strategi tahap lanjut teknologi injeksi kepada masyarakat, khususnya di Sumut. (adv/m47)


Daihatsu Ayla.

Alasan Mengapa Daihatsu Ayla Digemari Daihatsu Ayla sejak beberapa waktu lalu telah resmi mengaspal di Tanah Air dengan sepaket keunggulan yang dimilikinya. Mobil yang diproyeksikan sebagai mobil ramah lingkungan dan mobil murah ini menjadi andalan Daihatsu. Dalam waktu yang tak berapa lama saja, Daihatsu Ayla telah menjelma menjadi keluarga baru Indonesia, sebagai mobil dengan harga terjangkau. Ada beberapa alasan mengapa Daihatsu Ayla menjadi pilihan keluarga Indonesia, di

antaranya: Irit bahan bakar dan ramah lingkungan, harga yang cukup murah untuk mobil city car, spare part banyak tersedia di dealer-dealer Daihatsu, desain yang futuristik baik eksterior ataupun interior, interior longgar dan nyaman, mampu memuat lima orang penumpang dewasa. Daihatsu Ayla juga memiliki spesifikasi yang menunjang performanya di jalanan hingga kehadirannya semakin digemari. (m07)

Spesifikasi Daihatsu Ayla : * Tipe Mesin = 1 KR-DE, 3 silinder * Kapasitas mesin (cc) = 1000 * Daya maksimum = 65 ps pada putaran mesin 6000 rpm * Torsi maksimum = 8,7 kgm pada 3600 rpm * Berat kosong mobil (kg) = 745 * Panjang x Lebar x Tinggi (mm) = 3580 x 1600 x 1530 * Daya muat penumpang = 5 (maks), 4 (optimal) * Sistem transmisi = manual 5 kecepatan dan automatic 5 kecepatan * Akselerasi = 14,7 detik mencapai kecepatan 100 km/ jam * Velg = alloy/ racing (tipe X), dan kaleng (tipe D dan M) * Sistem Audio = radio FM/ AM, CD, MP3 (support USB dan head unit) * Rem = cakram berventilasi (depan), tromol (belakang) * Konsumsi bahan bakar = 1 Liter Bensin untuk 22 Kilometer * Sistem pasokan bahan bakar = EFI / fuel injection.

POM 2014 Telah Temukan Resep Memenuhi Keinginan Masyarakat Diikuti 13 APM Direktur Operasional Dyandra Promosindo, Bambang Setiawan, selaku penyelenggara ajang Pameran Otomotif Medan (POM) 2014 mengakui pihaknya telah menemukan resep untuk memenuhi keinginan masyarakat Medan yang hadir di gelaran tersebut. “Setelah dua tahun berturut-turut menorehkan kesuksesan dan mendongkrak jumlah transaksi kendaraan di Kota Medan, dengan dikunjungi 36.024 orang dan membukukan transaksi lebih dari Rp 200 milyar, penyelenggaraan POM tahun ini diyakini akan kembali menarik perhatian masyarakat Medan dan sekitarnya,” ucap Bambang Setiawan di Medan, Selasa (4/3). “Dua tahun menghadirkan POM di Kota Medan, membuat kami postitif telah menemukan resep yang tepat untuk memenuhi keinginan masyarakat Medan,” tuturnya di hadapan wartawan, didampingi GM Divisi Otomotif Lia Indriasari dan Manager Divisi Otomotif Abiyoso Wietono. Bambang juga menyebutkan, optimisme panitia juga mendapat dukungan yang sama dari para Agen Pemegang Merek (APM) yang mengikuti pameran. Medan akan membuka rangkaian pameran otomotif yang digelar Dyandra Promosindo pada 2014 dengan digelarnya POM 2014 di MICC, Santika Premiere Dyandra Hotel & Convention Medan, Rabu

sampai Minggu (5-9/3). Pameran yang telah memasuki tahun ketiga ini, dibuka Plt Wali Kota Medan Drs. H. Dzulmi Eldin, MSi pada Rabu pagi. Dikatakan, pertumbuhan industri otomotif Indonesia yang diprediksi akan terus berkembang dan didukung dengan asumsi positif yang datang dari pengamat ekonomi bahwa pertumbuhan ekonomi Sumut 2014 diprediksi akan menyentuh angka 6,2 persen dan melampaui pertumbuhan ekonomi Nasional, terus menarik para pemain industri otomotif Indonesia untuk secara serius menggarap Kota Medan. Dan pada POM tahun ini, 13 brand yang diwakili para APM kembali

berkomitmen menghadirkan produk dan teknologi terkini. Lia Indriasari menyebutkan, 11 merek mobil penumpang akan memamerkan produk mereka, yakni Chevrolet, Daihatsu, Ford, Honda, Hyundai, KIA, Mitsubishi, Nissan, Renault, Suzuki dan Toyota bersama dua merek kendaraan komersial yaitu HINO dan Isuzu. Sementara dari lini roda dua premium, Ducati akan memperkenalkan produk terbaru Monster 796. “Kehadiran berbagai varian kendaraan terkini di POM 2014, seakan memberi jaminan semaraknya penyelenggaraan kali ini. Harapan kami, semangat para APM peserta akan memicu antusiasme pengunjung yang tinggi untuk datang ke arena pameran,” tutur Lia Indriasari. Abiyoso Wietono menam-

bahkan, POM 2014 juga diisi program baru, yakni Lelang Barang Otomotif berupa kesempatan untuk melakukan penawaran produk otomotif yang mereka incar mulai dari harga satu rupiah, dan stand up comedy. Kemudian foto model hunt, dance competition, program helm murah, miss motor show serta kehadiran artis penyanyi Endah n Resha. Kepedulian terhadap dunia pendidikan akan ditunjukkan lewat program sosial Student Goes To Dyandra’s yang mengajak siswa/i mendapatkan pengetahuanmobil-mobil berteknologi terbaru. Sementara seluruh nominal yang dihasilkan dalam program Lelang Barang Otomotif, akan disumbangkan kepada korban erupsi Gunung Sinabung. (m47)

Waspada/Armansyah Th

Direktur Operasional Dyandra Promosindo, Bambang Setiawan, didampingi GM Divisi Otomotif Lia Indriasari (kiri), dan Manager Divisi Otomotif Abiyoso Wietono memberikan keterangan di Medan, Selasa (4/3).

Yamaha Peringkat 1 Consumer Reports Yamaha meraih posisi sebagai brand kendaraan roda dua yang paling bisa diandalkan. Ini berdasarkan analisa Consumer Reports yang menempatkan Yamaha di rangking teratas. Siaran pers Yamaha Indonesia mengutip analisa Consumer Reports terhadap 4.681 motor keluaran 2009 sampai 2012. Hasilnya,Yamaha tertinggi rating-nya karena dari setiap 10 motor Yamaha hanya ada 1 motor yang mengalami kerusakan. Disusul posisi kedua Kawasaki dan ketiga Honda. Sementara 1 dari 4 motor Harley Davidson terkena masalah dan BMW 1 dari 3 motor. Menurut analisa tersebut, dari berbagai merek motor yang disurvei, ternyata lampu, saklar dan instrumen lainnya merupakan sumber permasalahan yang paling sering dialami pengguna motor hingga 21 %. Problem lainnya pada rem, kelistrikan dan sistem bahan bakar dengan persentase 15 sampai 16 %. “Hasil studi Consumer Reports ini membuktikan kualitas nomor satu motor Yamaha. Mesin dan teknologinya selalu jadi incaran konsumen yang paham membeli motor karena kualitasnya. Di Indonesia sendiri apalagi dengan kemajuan tek-

nologi saat ini, Yamaha sudah mengaplikasikan teknologi Fuel Injection pada 9 motornya yaitu Vixion, Mio J, Soul GT, X-Ride, Jupiter Z1, Force, Xeon RC, GT125 dan Fino FI,” ujar Manajer Divisi Promotion and Motorsport PT Alfa Scorpii, Joni Lie. Kualitas nomor satu produk Yamaha khususnya di Indonesia salah satunya lagi karena Environment Survey. Istilah ini juga yang dalam prakteknya selalu membuat motor-motor Yamaha tahan banjir, tahan debu, irit, perawatannya mudah murah. Environment Survey adalah survey yang dilakukan Yamaha mengenai beberapa aspek menyangkut kondisi Indonesia yang jadi perhatian khusus untuk produk-produknya. Salah satunya fenomena banjir yang kerap menyerang Indonesia dan kualitas bahan bakar yang kurang baik di rural area. Desain sepeda motor Yamaha dirancang tahan banjir dan debu. Tim risetYamaha juga memperhatikan kebiasaan konsumen saat berkendara di kondisi jalan yang sering macet di Indonesia menggunakan Customer Behavior Survey, yang umumnya mereka berkendara di range kecepatan 20 sampai 60 km/

jam. YMJET-FI (Yamaha Mixture Jet-Fuel Injection) rancangan tercanggih teknologi FI saat ini solusi terkini berkendara di jalan macet. Teknologi YMJET-FI membuat campuran sempurna yang membuat motor sangat irit. “Tapi jika mau kencang dan tinggal tarik gas, FI teknologi Yamaha langsung ngacir,” ujar Joni Lie. Soal ketahanan mesin, dijamin garansi 5 tahun dengan teknologi diAsil Cylinder dan Forged Piston terkenal sangat tahan hingga 50.000 km membuat kondisinya masih seperti baru. Ini tidak dimiliki kompe-

titor. Fitur-fitur motor Yamaha yang membuatnya lebih tahan banjir yakni, air intake system (berfungsi mengurangi resiko dari kotoran tanah dan cipratan air), filter udara (dirancang khusus sanggup menyaring debu dengan ukuran terkecil bahkan abu vulkanik gunung berapi yang halus), muffler construction (mengurangi resiko kemasukan air), couplers & cap (komponen kelistrikan -ECU, spark plug, MAQS- lebih aman dari korsleting), dan battery (letaknya tinggi dibawah jok sehingga tidak mudah terendam air saat banjir). (m47)


Mesin dan teknologi Yamaha selalu jadi incaran konsumen.

Waspada, rabu 5 maret 2014  
Waspada, rabu 5 maret 2014  