Issuu on Google+

Harga Eceran Rp3.000,-

Tanker Jepang Dirompak, 3 ABK Indonesia Diculik

Demi Kebenaran Dan Keadilan

WASPADA Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

KAMIS, Pon, 24 April 2014/24 Jumadil Akhir 1435 H

No: 24559 Tahun Ke-68

Bayi Berkepala Dua Lahir Di P. Brandan

Terbit 24 Halaman P.BRANDAN (Waspada): Seorang ibu melahirkan bayi berkepala dua berjenis kelamin lelaki. Bayi tersebut lahir melalui operasi caesar di Rumah Sakit Umum (RSU) Insani, Kec. Babalan, Rabu (23/4) menjelang Subuh sekira pukul 03:00. Anak ketiga dari pasangan suami istri, Poniman, 34, dan Lasmini, 32, warga Telagasaid, Kec. Sei. Lepan, kondisinya sehat. Bayi itu dirawat di inkubator. Untuk kenyamanan sang bayi, pihak medis melarang tamu termasuk wartawan untuk menjenguk. Camat Sei. Lepan Wagito S begitu menerima kabar ada warganya melahirkan bayi berkepala dua segera ke RSU Insani. Ia menyarankan agar sang bayi dirujuk ke RSU dr Pirngadi Medan untuk mengecek kondisi kesehatannya. Ayah sang bayi termasuk kakek dan sejumlah keluarga bingung menghadapi kenyataan ini. Pihak keluarga setuju jika sang bayi dirujuk ke RSU dr Pirngadi, tapi mereka tidak mengizinkan dilakukan tindakan operasi pemisahaan. “Kalau harus dibedah, saya tidak setuju,” kata sang kakek. Poniman selaku ayah sang bayi mengaku bingung memberikan keputusan apakah bocah bungsunya ini dirujuk atau tidak ke RSU dr Pirngadi. Ini menyusul penolakan keluarganya untuk dilakukan operasi pemisahaan dengan pertimbangan risiko kesalamatan. Lahirnya bayi berkepala dua ini mengundang perhatian masyarakat. Beberapa pengunjung menduga ibu sang bayi yang berdomisili di dusun terpencil ini, kemungkinan tidak melakukan tindakan USG selama masa kehamilan. Akibatnya dia tidak mengetahui kondisi bayi dalam kandungannya.

PETALING JAYA, Malaysia (Waspada): Bajak laut bersenjata menyerang satu tanker minyak Jepang yang mengangkut 5 juta liter minyak diesel di Selat Malaka dan menculik tiga anak buah kapal (ABK) asal Indonesia Selasa (22/4). Komandan Polisi Perairan Port Klang Norzaid Muhammad Said mengatakan tanker tersebut, Naninwa Maru 1, berlayar 16 mil laut di lepas pantai Pulau Ketam, dalam pelayarannya menuju Myanmar, ketika sekelompok pria bersenjata menaikinya. “Peristiwa itu terjadi sekitar pukul 01:00 dinihari dan hanya diketahui beberapa ABK ketika mereka melihat kirakira lima atau enam orang bersenjata pistol dan golok menaiki kapal itu. “Semua korban diikat dan dikunci di dalam satu kamar,” katanya. Dua tanker lainnya kemudian mendekati tanker Jepang itu dan tiga juta liter minyak diesel disedot dari Naninwa Maru. “Mereka kemudian melarikan diri kira-kira lima atau enam jam kemudian,” tambahnya. Norzaid menambahkan bahwa ABK berusaha untuk membebaskan diri beberapa jam kemudian setelah kejadian, dan ketika melakukan hitungan, maka diketahui bahwa tiga ABK Indonesia dinyatakan hilang. “Para awak kapal terdiri dari warga Indonesia, Thai, Myanmar dan India. Namun warga Indonesia tidak terlihat. “Kami duga mereka diculik oleh bajak laut.Tanker itu kini dilabuhkan dan kami menyelidiki kasusnya,” katanya. Polisi curiga, ketigaWNI itu ikut diculik pembajak. Semua kru yang disekap dilaporkan oleh New Strait Times dalam keadaan selamat dan tidak terluka. “Kami telah mengirimkan personel kami ke lokasi dan menemukan kapal tanker Jepang itu di Pulau Angsa. Kapal tersebut kemudian kami bawa ke Pelabuhan Utara untuk penyelidikan lebih lanjut,” lanjut Norzaid. Selat Malaka merupakan kunci lalu lintas laut antara Asia menuju ke Eropa danTimurTengah. Kawasan itu terhitung rawan pembajakan karena banyaknya jumlah kargo dan kapal yang melintasi area tersebut.(thestar/m10)

Lanjut ke hal A2 kol. 1

Waspada/Asrirrais

BAYI memiliki kepala dua berjenis kelamin lelaki ini berada di ruang inkubator RSU Insansi P.Brandan, Rabu (23/4).

GOLKAR KEJAR PDIP Di Deliserdang Golkar Unggul LUBUKPAKAM (Waspada): Rapat pleno rekapitulasi penghitungan suara oleh KPUD (Komisi Pemilihan Umum Daerah) Deliserdang, untuk sementara menetapkan Partai Golkar menguasai perolehan suara Pemilu Legislatif (Pileg) 2014 dan urutan kedua dari PDI-Perjuangan.

Data Waspada peroleh Rabu (23/4), Partai Golkar unggul dengan 117.163 suara, disusul PDI-Perjuangan dengan 101.651 suara, Gerindra 94.112 suara, Partai Demokrat 80.704 suara, PAN dengan 62.167 suara, Hanura 52.962 suara, NasDem 48.471, PKS47.334 suara, PPP

44.361 suara, PKB 40.665 suara, PBB 27.039 suara dan PKPI dengan perolehan 24.162 suara. Sedangkan perolehan suara Caleg DPRD Deliserdang berdasarkan daerah pemilihan (Dapil) 1 terdiri dari Kec. Sunggal,

MEDAN (Waspada): Saling kejar suara antara Partai Golkar dan Partai Dermokrasi Indonesia Perjuangan (PDIP) terlihat pada hari ke-2 rapat pleno rekapitulasi hasil penghitungan suara Komisi Pemilihan Umum (KPU) Sumut Rabu(23/4). Sementara, rapat yang digelar mulai Rabu (23/4) pagi hingga malam di Hotel Grand Angkasa Medan berhasil menyelesaikan rekapitulasi dari sejumlah kabupaten/kota. Sesuai hasil rekapitulasi dari 8 kabupaten/kota, yakni Kota Medan, Kota Pematangsiantar, Tapanuli Selatan, Toba Samosir,

Lanjut ke hal A2 kol. 5

Lanjut ke hal A2 kol. 3

Bawaslu Minta Pemilu Ulang Di Nisel JAKARTA (Waspada): Anggota Badan Pengawas Pemilu (Bawaslu) Nelson Simanjuntak meminta Komisi Pemilihan Umum (KPU) menggelar pemungutan suara ulang (PSU) di Nias Selatan, Sumatera Utara, sebagai upaya memulihkan hak konstitusi. Meskipun, waktu PSU sudah habis karena keten-

tuannya maksimal H plus 10 setelah Pemilu Legislatif (Pileg) digelar. “Tapi ini kejadian khusus. Kami sarankan KPU untuk membuka kemungkinan PSU. Soalnya pelanggaran berakibat pada hasil,” kata Nelson di kantor KPU, Jakarta, Rabu (23/4). Nelson mengungkapkan

banyak formulir C1 atau hasil rekapitulasi di tingkat TPS yang terbakar. Dugaannya, petugas Pemilu sengaja membakar untuk menghilangkan barang bukti. “Nias Selatan dari dulu kacau. Pemilu 2004 semua

Lanjut ke hal A2 kol. 4

PPP Islah BOGOR (Waspada): Kisruh dua kubu Partai Persatuan Pembangunan (PPP) islah, setelah kubu Suryadharma Ali (SDA) dan kubu Romahurmuziy menggelar Musyawarah Kerja Nasional (Mukernas) III di Hotel Seruni III, Cisarua Bogor, Rabu (23/4). Sebelum Mukernas dibuka secara resmi oleh Plt. Ketua Umum PPP Emron Pangkapi, kedua kubu yang berseteru terlebih dahulu menggelar pertemuan untuk melanjutkan islah (damai). Namun, usai pertemuan tertutup itu, Suryadharma meninggalkan lokasi Mukernas dan memilih mengantarkan Ketua Majelis Syariah PPP KH Maimoen Zubair ke Jakarta. Kedua kubu masing-masing mengakui menerima fatwa Ketua Majelis Syariah DPP KH Maimoen Zubair yang meminta kedua belah kubu untuk berdamai. Fatwa KH Maimoen tersebut juga meminta agar semua posisi petinggi PPP yang telah dipecat untuk dikembalikan seperti semula dan menyebut belum ada koalisi dengan partai mana pun. Lanjut ke hal A2 kol. 4 Antara

GUBERNUR Sumatera Utara Gatot Pujo Nugroho menggenakan kain ulos batak kepada Dubes Iran untuk Indonesia Mahmoud Farazandeh usai melakukan pertemuan di Medan, Rabu (23/4).

Gubsu Ajak Iran Berinvestasi Listrik Dan Perkeretaapian MEDAN (Waspada): Iran melalui perusahaan Mapna Group berhasil menyelesaikan Life Time Extension (LTE) Gas Turbin (GT) 2.1 dan 2.2 PLTGU Belawan, sehingga mengurangi defisit listrik Sumatera Utara. Untuk itu, Gubsu berharap Iran dapat lebih terlibat dalam pembangunan infrastruktur khususnya listrik dan perkeretaapian. Demikian diungkapkan dalam kunjungan kehormatan

Duta Besar Iran Mahmoud Farazandeh dan Duta Besar Indonesia untuk Iran DianWirengjurit kepada Gubsu H Gatot Pujo Nugroho ST, di Kantor Gubsu Jl. Diponegoro Medan, Rabu (23/4). Kunjungan tersebut dalam rangka melaporkan rampungnya penyelesaian kerjasama pertama Republik Islam Iran melalui perusahaan Mapna Group dengan Indonesia untuk memperbaiki proyek LTE GT 2.1 dan 2.2 PLTGU Belawan.

Al Bayan

Tali Iman Oleh Tgk. H. Ameer Hamzah

Menanggapi hal itu, Gubsu mengucapkan terimakasih kepada Mapna Group. Hasil kerja perusahaan BUMN Iran itu turut membantu mengatasi krisis listrik di Sumatera Utara. Dengan rampungnya perbaikan di GT 2.1 dan GT 2.2 saat ini ada tambahan daya sebesar 2 x 145 MW. GT 2.1 sudah kembali beroperasi sejak Januari 2014 dan GT 2.2 beroperasi sejak 18 Maret lalu. Lanjut ke hal A2 kol. 6

Polisi Diduga Cabuli 5 Bocah Ditahan BANDA ACEH (Waspada): Polresta Banda Aceh menahan Briptu M, oknum polisi yang bertugas di Polda Aceh terkait kasus dugaan pencabulan lima bocah sekolah dasar di Kec. Meuraxa, Banda Aceh. Polisi menyatakan telah menemukan bukti yang cukup setelah memeriksa pelaku sejak Selasa lalu. “Kita sudah memeriksa tersangka sejak Selasa (22/4). Hari ini (Rabu-red) Briptu M resmi ditahan. Kami telah menemukan bukti yang cukup yang mengarah kepada Briptu M sebagai pelaku,” kata Waka Polresta Banda Aceh AKBP Sugeng Hadi Sutrisno, Rabu (23/4). Dia mengatakan, Briptu M akan diperlakukan sama dengan tahanan sipil dan dikenakan pidana umum. Pelaku dijerat pasal 81 junto 82 Undang-Undang no.23 tahun 2002 tentang perlindungan anak dengan ancaman 15 tahun penjara. “Dia juga dikenakan pelanggaran disiplin Polri dan Divisi Profesi dan Pengamanan (Propam) Polda Aceh sudah memeriksa pelaku,” tutur Sugeng.

China Jajaki Kerjasama Ekonomi Di Deliserdang

Barang siapa mencintai karena Allah, memberi harta karena Allah dan menahan karena Allah, maka imannya menjadi sempurna.[HR. Abu Daud] SEBUAH hadits dari Abdullah bin Mas’ud, Abdullah bin Abbas, serta al-Barra’ yang kemudian diriwayatkan oleh Ath-Thayalisi, Al-Hakim dan Ath-Thabrani dari Nabi bersabda: Tali iman yang paling kokoh adalah memberi pertolongan karena Allah, memusuhi karena Allah, mencintai karena Allah dan membenci karena Allah. Cinta karena Allah adalah menyayangi orang lain sepenuh hati karena orang tersebut punya potensi untuk baik. Menolong apabila layak ditolong, mengingatkan apabila menyimpang dari hukum Tuhan. Tetapi apabila mereka ingkar terhadap kebaikan, maka patut menahan harta (tidak membantu) karena Allah melarang kita membantu mereka yang durhaka. Lanjut ke hal A2 kol. 6

waspadamedan.com Waspada Daily

@Harian_Waspada

Lanjut ke hal A2 kol. 4

Waspada/HM Husni Siregar

BUPATI Deliserdang H Ashari Tambunan menerima cenderamata dari Konjen RRC Medan Zhu Honghai di ruang rapat Lantai II kantor Bupati Deliserdang, Rabu (23/4).

LUBUKPAKAM (Waspada) : Konsul Jenderal Republik Rakyat China Zhu Honghai mengatakan, pihaknya akan menjajaki kerjasama berbagai sektor di Deliserdang, yang tujuannya untuk meningkatkan ekonomi kedua negara. Hal itu diungkapkan Zhu dalam pertemuan dengan Bupati Deliserdang H Ashari Tambunan di ruang rapat lantai II kantor Bupati, Rabu(23/4). Sektor yang diminati yakni kerjasama sektor pendidikan, pertanian, pengairan dan infrastruktur serta sektor lain. Dalam pertemuan itu, Bupati H Ashari Tambunan didampingi Asisten I H Syafrullah S.Sos MAP,Asisten II H Redwin SH, Kadis Infokom Drs Neken Ketaren,Kepala Bappeda Ir H Irman Dj Oemar MSi,Kadis Pertanian Ir Hj Eka Sri Rejeki Yanti Danil dan Kadis Pendidikan Pemuda dan Olahraga Hj. Sa’adah Lubis SP, MAP.

Lanjut ke hal A2 kol. 7

Antara

PANGLIMA TNI Jenderal TNI Moeldoko menunjukan jam tangan merek Richard Mille RM 011 Felipe Massa Flyback Chronograph miliknya ketika memberikan penjelasan kepada wartawan di Jakarta, Rabu (23/4).

Moeldoko Banting Jam Tangan Richard Mile Rp1,1 M Imitasi JAKARTA (Waspada): Panglima TNI Jenderal Moeldoko mengaku jam tangan merek Richard Mile yang dia beli palsu (imitasi). Untuk harga jam tangan asli merek tersebut diperkirakan Rp1,1 miliar. Moeldoko membeli jam tersebut hanya seharga Rp5 juta. “Jam kayak gini kok orisinil,” kata Moeldoko saat ditemui di Hotel Borobudur, Jakarta, Rabu (23/4). Untuk memastikannya,

Moeldoko lantas memberikan jam tangan tersebut ke wartawan. Sejumlah wartawan yang masih penasaran tetap bertanya mengenai orisinalitas jam itu. Namuntanpadisangka-sangka, mantan Kepala Staf Angkatan Darat (KSAD) membanting jam tangannya, yang kemudian diambil kembali oleh anak buahnya.“SayabelijaminihanyaRp4,7 juta,” katanya sambil tertawa. Moeldoko mengaku dirinya adalah kolektor jam tangan.

Dia sengaja membeli jam tersebut karena mengagumi inovasi yang terdapat di dalamnya. “Saya ingin apa yang saya gunakan bermakna bagi diri saya. Justru pikiran saya membangun inovasi. Begitu bangun tidur akan membuat kita berpikir,” kata Moeldoko. Jam tangan yang dipakai Moeldoko sempat disoroti oleh sejumlah media di Singapura.

Lanjut ke hal A2 kol. 7

Caleg Muda Dari Partai Gerindra

Ada-ada Saja

H. Ihwan Ritonga, SE Raih No. 2 Terbesar Di Medan

Caleg Gagal, Minta Kembali Uang

MEDAN (Waspada): Caleg muda dari Partai Gerindra H. Ihwan Ritonga,SE (foto) meraih nomor 2 suara terbesar di Kota Medan di antara caleg-caleg Partai Gerindra yang ikut bertarung di daerah pemilihan (dapil) 1 Kota Medan di Kec.Medan Denai, Kec. Medan Amplas, Kec.Medan Kota dan Kec. Medan Area. Pantauan Waspada, Rabu (23/4) di Posko pemenangan Ihwan Ritonga Jl. Menteng VII No. 64 Medan sosok politisi muda yang enerjik itu memperoleh 9.512 suara, sedangkan posisi No. 1 diraih caleg Hasyim,SE (incumbent) dari PDI-P dengan 12.530 suara dan posisi ketiga Iswanda Ramli (incumbent) dari Partai Golkar dengan 8.943 suara.

Lanjut ke hal A2 kol. 1

SEORANG calon legislatif yang gagal mendulang suara di Desa Pantiagemi,Kec.Stabat, Langkat pada Pemilu 9 April 2014, meminta warga mengembalikan uang pemberiannya Rp7,5 juta, Rabu(23/4). Namun, Caleg berinisial TSA itu tidak berani meminta

Lanjut ke hal A2 kol. 2

Serampang - Di partai banyak berkepala dua - He...he...he...


Harga Eceran Rp 3.000

Korban Oknum Polisi Cabul Lima Bocah SD

Demi Kebenaran Dan Keadilan

WASPADA Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

KAMIS, Pon, 24 April 2014/24 Jumadil Akhir 1435 H

No: 24559 * Tahun Ke-68 Terbit 24 Halaman

BANDA ACEH (Waspada): Polresta Banda Aceh menahan Briptu M, oknum polisi yang bertugas di Polda Aceh terkait kasus dugaan pencabulan lima bocah sekolah dasar di Kec. Meuraxa, Banda Aceh. Polisi menyatakan telah menemukan bukti yang cukup setelah memeriksa pelaku sejak Selasa lalu. “Kita sudah memeriksa tersangka sejak Selasa (22/4). Hari ini (Rabu-red) Briptu M resmi ditahan. Kami telah menemukan bukti yang cukup yang mengarah kepada Briptu M sebagai pelaku,” kata Waka Polresta Banda Aceh AKBP Sugeng Hadi Sutrisno, Rabu (23/4). Dia mengatakan, Briptu M akan diperlakukan sama dengan tahanan sipil dan dikenakan pidana umum. Pelaku dijerat pasal 81 junto 82 Undang-Undang no.23 tahun 2002 tentang perlindungan anak dengan ancaman 15 tahun penjara. “Dia juga dikenakan pelanggaran disiplin Polri dan Divisi Profesi dan Pengamanan (Propam) Polda Aceh sudah memeriksa pelaku,” tutur Sugeng. Menurutnya, selain memeriksa kejiwaan pelaku, Polresta Banda Aceh juga mengirim dokter psikologi untukmenghilangkan trauma yang diderita bocah korban pencabulan. Meski hasil pemeriksaan menunjukkan adanya gangguan kejiwaan, pelaku tetap diproses secara hukum. “Itu (gangguan kejiwaan) tidak memengaruhi pidananya. Tidak ada kendala apapun dalam penanganan kasus ini dan sudah lima saksi kami periksa. Pelaku memang membantah melakukan perbuatan cabul,” katanya. Sugeng mengimbau orangtua bocah SD di Kecamatan Meuraxa tidak segan-segan melapor ke kepolisian jika anaknya menjadi korban Briptu M. “Korban silakan

BAYI memiliki kepala dua berjenis kelamin lelaki ini berada di ruang inkubator RSU Insansi P.Brandan, Rabu (23/4).

Lanjut ke hal A2 kol 6

Waspada/Asrirrais

Bayi Berkepala Dua Lahir Di P.Brandan P.BRANDAN (Waspada): Seorang ibu melahirkan seorang bayi berkepala dua berjenis kelamin lelaki. Bayi tersebut lahir melalui operasi caesar di Rumah Sakit Umum (RSU) Insani, Kec.Babalan, Rabu (23/4) menjelang Subuh sekira pukul 03:00. Anak ketiga dari pasangan suami istri, Poniman, 34, dan Lasmini, 32, warga Telagasaid, Kec. Sei. Lepan, kondisinya sehat. Bayi itu dirawat di inkubator. Untuk kenyamanan sang bayi, pihak medis melarang tamu termasuk wartawan untuk menjenguk. Camat Sei. Lepan, Wagito S, begitu menerima kabar ada warganya melahirkan bayi berkepala dua segera turun ke RSU Insani. Ia menyarankan agar sang bayi dirujuk ke RSU dr Pirngadi Medan untuk mengecek kondisi kesehatannya. Ayah sang bayi termasuk kakek dan sejumlah keluarga tertekan dan bingung menghadapi kenyataan ini. Pihak keluarga setuju jika sang bayi dirujuk ke RSU dr Pirngadi, tapi mereka tidak mengizinkan dilakukan tindakan operasi pemisahaan. “Kalau harus dibedah, saya tidak setuju,” kata sang kakek. Poniman selaku ayah sang bayi mengaku bingung memberikan keputusan apakah bocah bungsunya ini dirujuk atau tidak ke RSU dr Pirngadi. Ini menyusul penolakan keluarganya untuk dilakukan operasi pemisahaan dengan pertimbangan resiko kesalamatan. Lahirnya bayi berkepala dua ini mengundang perhatian masyarakat. Beberapa pengunjung menduga ibu sang bayi yang berdomisili di dusun terpencil ini, kemungkinan tidak melakukan tindakan USG selama masa kehamilan. Akibatnya dia tidak mengetahui kondisi bayi dalam kandungannya. (a02)

Dua Kubu PPP Islah Yang Dipecat Kaban Terima Suap Dari Anggoro KPK Segera Periksa Mendagri Kader Dikembalikan

JAKARTA (Waspada): Mantan Bendahara Umum Partai Demokrat M Nazaruddin, yang pernah jadi buronan jauh sebelumnya mengungkapkan dugaan mark-up Rp2,5 triliun proyek pengadaan e-KTP kini menyeret sejumlah orang termasuk Menteri Dalam Negeri Gamawan Fauzi. Kini Komisi Pemberantasan Korupsi (KPK) memulai

langkah penyelidikannya dengan menetapkan Direktur Pengelola Informasi Administrasi Kependudukan Direktorat Jenderal Kependudukan dan Pencatatan Sipil (Dukcapil) Kemendagri, Sugiharto sebagai tersangka. Selain itu, KPK juga melakukan penggeledahan di ruang kerja Menteri Dalam Negeri Gamawan Fawzi pada

Selasa (22/4). “Pada pengeledahan di ruang kerja menteri itu, beberapa berkas dokumen termasuk dokumen elektronik dibawa penyidik,” kata Juru Bicara KPK Johan Budi di kantor KPK pada Rabu (23/4). Selanjutnya Johan mengatakan, KPK segera memanggil Menteri Dalam Neger i Lanjut ke hal A2 kol 4

BOGOR (Waspada): Kubu Ketua Umum Dewan Pimpinan Pusat (DPP) Partai Persatuan Pembangunan (PPP) Suryadharma Ali (SDA) dan kubu Wakil Ketua Umum Emron Pangkapi-Sekretaris Jenderal PPP Romahurmuziy akhirnya menggelar Musyawarah Kerja Nasional (Mukernas) III PPP yang berlangsung di Hotel Seruni III, Cisarua Bogor, Rabu (23/4). Lanjut ke hal A2 kol 3

JAKARTA (Waspada): Ketua Umum Partai Bulan Bintang MS Kaban diduga menerima aliran uang suap dari PT Masaro Radiokom saat dirinya menjabat sebagai Menteri Kehutanan periode 2004-2009. Kaban, dikatakan menerima suap dari bos PT Masaro Anggoro Widjojo terkait dengan proyek kegiatan revitalisasi sistem komunikasi radio

terpadu (SKRT) di Kemenhut pada 2007 sebanyak lima kali. Jaksa KPK Ansuharlis dalam dakwaan untuk Anggoro mengungkapkan, setidaknya Kaban menerima suap dari adik kandung terpidan korupsi Anggodo Widjojo itu, setotal 45 ribu dolar AS, Rp 50 juta dan 40 ribu dolar Singapura. “Uang tersebut diberikan sebanyak lima kali,” kata jaksa,

saat persidangan perdana untuk Anggoro, di PN Tipikor, Jakarta , Rabu (23/4). Di dalam dakwaan diterangkan, pemberian pertama senilai 15 ribu dolar AS. Pemberian awal itu bermula dari pesan singkat Kaban untuk Anggoro tertanggal 6 Agustus 2007. “Skrg (sekarang) merapat Lanjut ke hal A2 kol 1

Suara 10 Kab/Kota Aceh Di DPR RI

Riefky Harsya Dan Bachtiar Aly Melenggang Ke Senayan BANDA ACEH (Waspada) : Teuku Riefky Harsya dan Nasir Djamil dipastikan kembali melenggang ke Senayan. Kedua politikus incumbent ini, berdasarkan rekap suara 10 dari 15 kabupaten/kota untuk Dapil-I Aceh, memperoleh suara tertinggi sementara. Nasir Djamil 36.959 suara, sementara Riefky Harsya 35.204 suara. Sementara partai pendatang baru, yakni Nasional Demokrat dipastikan memperoleh satu kursi DPR-RI dari Daerah Pemilihan (Dapil)-I Aceh. Kemungkinan yang akan melenggang ke Senayan adalah Bachtiar Aly, caleg Nomor-1, yang memperoleh 25.091 suara. Hingga hari kedua pleno penghitungan suara KIP Aceh , Rabu (23/4) pukul 17:00, untuk suara DPR RI, baru melanjutkan suara dari Aceh Barat. Namun, hingga sore suaranya belum juga direkap dan diperkirakan final pada Lanjut ke hal A2 kol 6 Antara

DUBES IRAN DI MEDAN: Gubernur Sumut Gatot Pujo Nugroho (kiri) menggenakan kain ulos batak kepada Dubes Iran untuk Indonesia Mahmoud Farazandeh (tengah) usai melakukan pertemuan di Medan, Sumut, Rabu (23/4). Dalam perbincangan tersebut Duta besar Iran mendatangkan perusahaan Mapna Co milik pemerintah Iran untuk menjajaki kerja sama dibidang pembangkit listrik guna mengatasi krisis listrik di Sumatera Utara.

atau enam orang bersenjata pistol dan golok menaiki kapal itu. “Semua korban diikat dan dikunci di dalam satu kamar,” katanya. Dua tanker lainnya kemudian mendekati tanker Jepang itu dan tiga juta liter minyak

TARUTUNG (Waspada): Partai Golkar menduduki ranking pertama meraih suara terbanyak dari lima daerah pemilihan (Dapil) di Tapanuli Utara atau 22.921 suara. Sementara Partai NasDem nenduduki posisi kedua memperoleh 19.472 suara dan peringkat ketiga dipegang oleh PDIP memperoleh 18.667 suara . Dari total semua perolehan suara di 5 Dapil, PDIP memperoleh 6 kursi di DPRD, Partai Golkar memperoleh 5 kursi dan Nasdem memperoleh 5 kursi. Hal itu terungkap dari hasil perhitungan suara Pemilu 2014 pada Parpol dan calon legislatif (Caleg) dalam rapat pleno terbuka yang berlangsung di Sopo Partukoan Tarutung yang diputuskan KPUD Taput, Selasa (22/4) malam. Proses rekapitulasi suara tertunda Sabtu (19/4),karena adanya keberatan beberapa saksi Parpol, dimana data

Lanjut ke hal A2 kol 4

Lanjut ke hal A2 kol 6

Tanker Jepang Dirompak, 3 ABK Indonesia Diculik PETALING JAYA, Malaysia (Waspada): Bajak laut bersenjata menyerang satu tanker minyak Jepang yang mengangkut 5 juta liter minyak diesel di Selat Malaka dan menculik tiga anak buah kapal (ABK) asal Indonesia Selasa (22/4). Komandan Polisi Perairan Port Klang Norzaid Muham-

mad Said mengatakan tanker tersebut, Naninwa Maru 1, berlayar 16 mil laut di lepas pantai Pulau Ketam, dalam pelayarannya menuju Myanmar, ketika sekelompok pria bersenjata menaikinya. “Peristiwa itu terjadi sekitar pukul 01:00 dinihari dan hanya diketahui beberapa ABK ketika mereka melihat kira-kira lima

Al Bayan

Caleg Muda Dari Partai Gerindra

Tali Iman Oleh: H. Ameer Hamzah Barang siapa mencintai karena Allah, memberi harta karena Allah dan menahan karena Allah, maka imannya menjadi sempurna. [HR. Abu Daud] SEBUAH hadits dari Abdullah bin Mas’ud, Abdullah bin Abbas, serta al-Barra’ yang kemudian diriwayatkan oleh Ath-Thayalisi, Al-Hakim dan Ath-Thabrani dari Nabi bersabda: Tali iman yang paling kokoh adalah memberi pertolongan karena Allah, memusuhi karena Allah, mencintai karena Allah dan membenci karena Allah. Cinta karena Allah adalah menyayangi orang lain sepenuh hati karena orang tersebut punya potensi untuk baik. Menolong apabila layak ditolong, mengingatkan apabila menyimpang dari hukum Tuhan. Tetapi apabila Lanjut ke hal A2 kol 2

waspadamedan.com Waspada Daily

Pemilu Di Taput, Golkar Menang Suara PDIP Menang Kursi

@Harian_Waspada

Antara

TERDAKWA kasus dugaan korupsi penganggaran proyek Sistem Radio Komunikasi Terpadu (SKRT) di Kementerian Kehutanan, Anggoro Widjojo menjalani sidang perdana dengan agenda dakwaan di Pengadilan Tipikor Jakarta, Rabu (23/4).

Dana BOS Rp100 Juta Raib Dari Mobil SIDIKALANG (Waspada): Uang BOS (Bantuan Operasional Sekolah) SMK Pergetteng Getteng Sengkut Kecupak, Kab. Pakpak Bharat sebesar Rp 100 juta raib dari mobil kepala sekolah saat parkir di Jl. Pegagan Sidikalang, Rabu (23/4). Sopian Manik, 34, kepala SMKN 1 Kecupak, Kec. PGGS, Pakpak Bharat kepada wartawan di ruang Kepala Sentra Pelayanan Kepolisian (KSPK) Polres Dairi menceritakan, dia bersama sopirnya Jonggi Sirait,

29, warga Desa Mata Kocing Salak sebelumnya mencairkan dana BOS SMK PGGS Rp100 juta dari BRI Cabang Sidikalang di Jl. SM Raja sekira pukul 12:15. Uang tersebut disimpan di bawah tempat duduk sopir, k e m u d i a n m e re k a p e r g i menyetorkan uang ke kantor Gereja Kristen Protestan Pakpak Dairi (GKPPD) Sentrum di Jl. Air Bersih Sidikalang. Setelah pulang dari Sentrum, dia bersama sopirnya mampir di salah satu rumah

Ada-ada Saja

COKLAT CALON PRESIDEN

H.Ihwan Ritonga,SE Meraih No.2 Terbesar Di Kota Medan MEDAN (Waspada): Caleg muda dari Partai Gerindra H.Ihwan Ritonga,SE meraih No.2 suara terbesar di Kota Medan di antara caleg-caleg Partai Gerindra yang ikut bertarung di daerah pemilihan (dapil) 1 Kota Medan di Kec. Medan Denai, Kec.Medan Amplas, Kec.Medan Kota dan Kec.Medan Area. Pantauan Waspada, Rabu (23/4) di Posko pemenangan Ihwan Ritonga Jl. Menteng VII No. 64 Medan sosok politisi muda yang enerjik itu memperoleh 9.512 suara, sedangkan posisi No. 1 diraih caleg Hasyim,SE (incumbent) dari PDI-P dengan 12.530 suara dan posisi ketiga Iswanda Ramli (incumbent) dari Partai Golkar dengan 8.943 suara.Ihwan Ritonga,SE dari Partai Gerindra. Lanjut ke hal A2 kol 2

makan di Jl. SM Raja Sidikalang .Sopir memarkirkan mobil Avanza BK 1734 XQ miliknya persis di samping rumah makan tersebut. Saat mau berangkat pulang ke Salak, Pakpak Bharat, Jonggi melihat kaca pintu mobil sebelah kanan sopir pecah dan uang yang disimpan di bawah tempat duduk hilang. “Kejadianya paling ada seperempat jam saat kami makan, padahal tempat kejadian itu lumayan ramai,” kata Sopian. (ckm)

Caleg Gagal Di Langkat Minta Kembali Uang STABAT ( Waspada): Seorang calon legislatif yang gagal di Langkat meminta warga mengembalikan uang pemberiannya Rp7,5 juta. Tindakan itu sempat

Lanjut ke hal A2 kol 4

Serampang Antara

Sejumlah coklat bergambar calon presiden dijual di Toko Coklat Mentari, Bekasi, Jawa Barat (23/4). Toko coklat mentari membuat coklat tersebut untuk meningkatkan penjualan dengan harga Rp 7.500 per coklat.

- Ada asap ada api - He.... he....he....


Berita Utama

A2

WASPADA Kamis 24 April 2014

China Jajaki Kerjasama Ekonomi Di D.Serdang

Waspada/HM Husni Siregar

BUPATI Deliserdang H Ashari Tambunan menerima cenderamata dari Konjen RRC Medan Zhu Honghai di ruang rapat Lantai II kantor Bupati Deliserdang, Rabu (23/4).-

dan, dihadiri perwakilan instansi dan para jurnalis. Namun, Mirza mengaku tak memiliki data rinci prihal masuknya para imigran gelap ini ke Sumut. ‘Katanya, imigrasi memberlakukan kebijakan terhadap imigran ilegal, pencari suaka dan pengungsi. Para imigran ilegal yang masuk wilayah Indonesia dapat dikenakan Tindak Pidana Keimigrasian.Mereka ditempatkan di Rudenim (rumah detensi imigrasi). Saat ini di Indonesia ada 13

Rudenim dihuni 1.656 orang. Sedangkan para pencari suaka dan pengungsi tidak dapat dideportasi ke negaranya jika mereka memiliki Kartu Identitas UNHCR sehingga mereka ditempatkan di luar Rudenim (Community House) yang saat ini ada 33 Community House sebanyak 3.949 orang. Para pencari suaka dan pengungsi yang berada di luar Rudenim dan Community House berjumlah 6.674 orang. Sedangkan yang ada di dalam ruang detensi ditjenim Imigrasi mencapai 27 orang. (m37)

dipercaya bertugas di Medan. Menurut Zhu, hubungan antara Indonesia dengan RRC sudah meningkat terutama dalam kerjasama sektor kelautan dan pertanian. Begitu juga dengan kerjasama pembangunan jalan Tol Medan-Kualanamu yang pelaksanaannya berjalan lancar tanpa hambatan. Sementara Konsul RRC Bidang Ekonomi Liu Weiguo mengaku banyak potensi sumber daya alam di Kab. Deliserdang untuk dikembangkan, seperti usaha produksi dan hortikultura. “Melihat potensi ini, Deliserdang akan kami promosikan kepada pengusaha di RRC agar kerjasama ekonomi dan perdagangan semakin meningkat, ‘’ ujar Liu melalui penterjemah Ali Wongso. Bupati Deliserdang H Ashari Tambunan menyambut baik kerjasama ini. ‘’Pemkab Deliserdang siap bekerjasama dengan siapapun termasuk dengan RRC yang memang sudah sejak lama memiliki hubungan,’’ kata Ashari dan menambahkan, Pemkab Deliserdang akan memberi kemudahan kepada setiap pihak yang akan berinvestasi didaerah ini. Dalam pertemuan itu, Kepala Bappeda Ir H Irman Dj Oemar MSi memaparkan berbagai potensi pengem-

Dua Kubu PPP ....

kembali seperti sediakala. “Kita sekarang kembali ke titik nol. Saya tidak mau lihat ke belakang lagi. Kita sekarang melihat ke depan,” kata Suryadharma sesaat sebelum Mukernas III dibuka. Menurutnya, fatwa yang telah disampaikan Ketua Majelis Syariah DPP KH Maimoen Zubair sudah diterima oleh kubu Suryadharma dan Sekretaris Jenderal Partai Persatuan Pembangunan Romahurmuziy (Romi). Ro m a h u r m u z i y p u n mengakui kedua kubu yang berseteru sepakat Islah. “Tidak ada yang menang dan kalah, yang menang adalah konstitusi partai karena ini bukan pertarungan,” kata Romahurmuziy. Dia mengatakan, kubunya selama ini menilai apa yang dilakukan kubu Suryadharma dengan mendukung Partai Gerindra menyalahi konstitusi partai. Oleh karena itu, kubu-

nya hanya berjuang untuk tetap menegakkan konstitusi yang sudah diatur oleh anggaran dasar anggaran rumah tangga partai. Pelaksana tugas Ketua Umum PPP Emron Pangkapi mengaku dia ditetapkan sebagai pelaksana tugas ketua umum. Dan hal itu sudah sesuai dengan konstitusi. “Untuk itu pula, saya ditugaskan untuk melaksanakan mukernas. Mukernas adalah lembaga kekuasaan tertinggi partai setelah muktamar,” katanya sebelum membuka mukernas. Keunikan lainnya, undangan mukernas terhadap Suryadharma tidak menyebutkan posisinya sebagai ketua umum, melainkan pejabat pemerintah di tingkat pusat dari PPP. Terkait dengan koalisi dan pencapresan, Romi menegaskan partainya akan melihat perkembangan dalam beberapa hari ke depan. (aya)

KPK Segera ....

KTP, tapi ada beberapa tempat,” kata Johan. Menurut Johan, penyidik melakukan penggeledahan di PT Quadra Solution di Menara Duta Jalan HR Rasuna Said Kavling B 9 Jakarta Selatan, Kantor Ditjen Dukcapil Jalan TMP Kalibata, Jakarta Selatan dan Kementerian Dalam Negeri. “Pertama kantor Ditjen Dukcapil, kedua di PT Qudara Solution, penggeledahan juga di Kemendagri termasuk ruang Menteri Dalam Negeri,” terangnya. Sementara tersangka Sugiharto dikenakan dalam pelanggaran Pasal 2 ayat 1 subsidair Pasal 3 Undang-undang Nomor 31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi sebagaimana diubah dengan Undang-undang Nomor 20 tahun 2001 juncto Pasal 55 ke-1 juncto Pasal 64 ke-1 KUHPidana. (j02)

LUBUKPAKAM (Waspada): Konsul Jenderal Republik Rakyat China Zhu Honghai mengatakan, pihaknya akan menjajaki kerjasama berbagai sektor di Deliserdang, yang tujuannya untuk meningkatkan ekonomi kedua negara. Hal itu diungkapkan Zhu dalam pertemuan dengan Bupati Deliserdang H Ashari Tambunan di ruang rapat lantai II kantor Bupati, Rabu (23/4). Sektor yang diminati yakni kerjasama sektor pendidikan, pertanian, pengairan dan infrastruktur serta sektor lain. Dalam pertemuan itu,

Bupati H Ashari Tambunan didampingi Asisten I H Syafrullah S.Sos MAP,Asisten II H Redwin SH, Kadis Infokom Drs Neken Ketaren,Kepala Bappeda Ir H Irman Dj Oemar MSi,Kadis Pertanian Ir Hj Eka Sri Rejeki Yanti Danil dan Kadis Pendidikan Pemuda dan Olahraga Hj. Sa’adah Lubis SP, MAP. Sementara Zhu didampingi sejumlah staf, di antaran y a Ko n s u l R RC b i d a n g Ekonomi Liu Weiguo. Dalam pertemuan itu, Zhu menjelaskan kunjungan ke Deliserdang merupakan yang pertama sejak diangkat dan

Sumut Rawan Imigran Gelap MEDAN (Waspada): Provinsi Sumatera Utara dan Riau termasuk kawasan yang rawan terhadapmasuknya para i m i g ra n g e l a p t e r u t a m a imigran yang akan mencari suaka ke Australia. “Salah satu daerah di Indonesia yang menjadi pintu masuk imigran gelap adalah daerah-daerah yang berada di Pulau Sumatera, seperti Riau dan Sumatera Utara,” kata

Direktur Penyidikan dan Penindakan Keimigrasian, Drs Mirza Iskandar. Hal itu dikatakannya usai Workshop Kerjasama Instansi dalam Penanganan Imigran Ilegal, Pencari Suaka dan Pengungsi, di Kanaya Grend Hotel, Rabu (23/4).Workshop yang digelar Kementerian Hukum dan Hak Asasi Manusia RI Kantor Wilayah Sumut, Imigrasi Kelas I Khusus Me-

Kaban Terima ....

Kemenhut. Dan pemberian uang terakhir, senilai 40 ribu dolar Singapura, berawal dari permintaan Kaban ke Anggoro lewat pesan tertanggal 28 Maret 2008. “Apakah jam 1 9 dpt (dapat) didrop (dicairkan) 40 ribu sin (dolar Singapura)”. Pesan itu ditanggapi Anggoro dengan balasan, “19.00 bisa & ke-Ysf? (Yusuf).” Uang tunai terakhir, kembali di terima Kaban, di rumah dinasnya. Selain nama Kaban, sejumlah nama anggota Komisi IV DPR RI 2004-2009, juga menerima aliran uang suap dari Anggoro. Salah satunya adalah Ketua Komisi IV DPR, HM Yusuf Erwin Faishal. Erwin menerima setidaknya 92 ribu dolar Singapura dan 20 ribu dolar AS serta Rp 925 juta. Selain itu, Sekertaris Jenderal Kemenhut, Boen Mochtar Purnama, dituduh jaksa ikut menerima suap Anggoro senilai 20 ribu dolar AS. Atas perbuatan tersebut, jaksa menjerat Anggoro dengan pasal 5 ayat 1 huruf b. Dan pasal 13 UU Tipikor 20/2001. Jika dakwaan jaksa terbukti, Anggoro terancam penjara selama 5 tahun. (rol)

saja ke rmh (rumah) dinas, kalau smpat (sempat) bgks (bungkus) rapi 15 ribu (dolar AS),” tulis Kaban dalam pesan lewat ponsel kepada Anggoro, seperti dikatakan jaksa. Permintaan tersebut, terealisasikan sehari pascaterkirimnya pesan tersebut. Selanjutnya, permintaan kedua, juga terjadi lewat pesan pendek tertanggal 16 Agustus 2007. Di dalam pesan itu, Kaban, dituduhkan jaksa, mengatakan “Ini agak emergency (mendadak), bisa kirim 10.00,-? Seperti kemarin bungkus kecil aja (saja), kirim ke rumah sekitar jam 8 gitu (begitu)”. Menanggapi pesan itu, Anggoro pun mengutus David untuk mendatangi Kaban, di rumah dinas Kemenhut di Jalan Denspasar Raya Nomor 15, Jakarta. Kiriman uang tunai untuk Suap untuk Kaban, tidak berhenti. Pada awal 2008, tepatnya pada 13 Februari 2008, lewat supir pribadinya, Isdriatmo, mengantarkan uang 20 ribu dolar AS ke Kaban. Uang itu dititipkan ke supir Kaban, Muhamad Yunus atas perintah Kaban. Sepekan setelah itu, 25 Februari 2008, Kaban kembali menerima uang Rp 50 juta, dalam bentuk travel cek, dari Bank Permata. Cek tersebut, diberikan Anggoro lewat supirnya, dan disampaikan langsung kepada Kaban di Manggala Wahana Bhakti di

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. 2. 3. 4. 5. 6.

Bxg6, MxB. h5xM+, Rh6. g7+, Rh7. Mf8, Rg6. g8(M)+, Rh5. Mg4+mat. (Jika 1. ...., Me5+. 2. MxM, Bd7. 3. Mf4, Bg7. 4. Mh6+, Rg8. 5. MxB+mat).

Jawaban TTS: TTS

Olahraga

H. Ihwan Ritonga .... Raihan suara yang diperoleh Ihwan sebagai sosok muda tidak disangka-sangka karena, Ihwan yang baru pertama kali terjun ke dunia politik dan memiliki sikap sederhana mendapat simpati baik dari kalangan muda maupun tua khususnya di daerah pemilihannya, sungguh sangat signifikan. “Mudah-mudahan dengan lolosnya Ihwan diharapkan akan mampu membawa aspirasi rakyat dalam mengemban tugasnya demi membela kepentingan masyarakat dan berperan ikut membangun kota Medan diberbagai bidang,” ujar salah seorang tim suksesnya dari Parsadaan Ritonga dohot boruna. Ketika ditanya wartawan, Ihwan dengan sikap rendah hati dan terbuka, membenarkan jumlah perolehan suara tersebut. “Berdasarkan formulir C1 dan hasil rekapitulasi tim pemenangan kita, suara untuk saya pribadi sejumlah 9.512 dan total suara partai 29.680,” ujar Ihwan. Maka dengan perolehan suara yang cukup signifikan tersebut, untuk Dapil 1, Ihwan yakin Partai pimpinan H.Prabowo Subianto itu bisa mendapatkan 2 kursi. Dijelaskannya, caleg yang memperoleh suara terbanyak setelah dirinya di dapil 1 adalah

Al Bayan ....

Jawaban Sudoku: 9 2 7 5 1 6 4 8 3

6 3 4 2 7 8 1 9 5

5 8 1 3 4 9 6 7 2

1 7 2 4 5 3 9 6 8

3 6 9 7 8 2 5 4 1

4 5 8 6 9 1 3 2 7

2 4 3 8 6 5 7 1 9

8 9 6 1 3 7 2 5 4

7 1 5 9 2 4 8 3 6

mereka ingkar terhadap kebaikan, maka patut menahan harta (tidak membantu) karena Allah melarang kita membantu mereka yang durhaka. Jadi, karena Allah juga mereka tidak boleh ditolong sebab yang bersangkutan tidak mau berhenti dari kemaksiatan. Misalnya seseorang selalu meminta sumbangan, katanya untuk membangun pondok pesantren atau masjid, tetapi sumbangan yang didapatkan itu digunakan untuk berfoya-foya. Orang yang demikian itu haram mendapat pertolongan dari umat Islam yang beriman. Utsman bin Affan ra sahabat dan menantu Rasulullah terkenal kaya dan sangat pemurah. Hartanya yang banyak

Sebelum Mukernas dibuka secara resmi oleh pelaksana t u g a s Ke t u a Um u m P P P Emron Pangkapi, kedua kubu yang berseteru terlebih dahulu menggelar pertemuan untuk melanjutkan islah (damai). Namun, usai pertemuan tertutup itu, Suryadharma kemudian meninggalkan lokasi Mukernas dan memilih mengantarkan Ketua Majelis Syariah PPP KH Maimoen Zubair ke Jakarta. Kedua kubu masing-masing mengakui menerima fatwa Ketua Majelis Syariah DPP KH Maimoen Zubair yang meminta kedua belah kubu untuk berdamai. Fatwa KH Maimoen tersebut juga meminta agar semua posisi petinggi PPP yang telah dipecat untuk dikembalikan seperti semula dan menyebut belum ada koalisi dengan partai mana pun. Sur yadharma Ali pun mengakui perseteruan dua kubu dalam partai tersebut telah usai. Kini PPP telah Godfried Lubis. Dia berharap tidak ada kecurangan lagi dalam rekapitulasi perolehan suara Pemilu Legislatif kali ini. Untuk mengantisipasi adanya kecurangan, kata Ihwan, dia telah memiliki formulir C1 lengkap, serta hasil rekapitulasi perolehan suara di tingkat PPS. Kepada warga masyarakat yang telah menggunakan hak pilihnya, khususnya masyarakat yang telah mendukungnya terhadap Partai Gerindra sehingga Partai Gerindra bisa berada diperingkat ke-3 secara nasional dan peringkat ke-3 di Kota Medan. Dan telah mempercayainya untuk menjadi wakil rakyat dari Dapil 1, caleg nomor 1 Partai Gerindra ini menyampaikan terimakasih. Menurut Ihwan, naiknya suara Partai Gerindra kemungkinan masyarakat melihat dan menilai dari sosok H.Prabowo Subianto selaku Ketua Dewan Pembina ditambah H.Gus Irawan Pasaribu selaku Ketua DPD Partai Gerindra Sumut. Kemudian saya selaku kader Partai yang diamanahkan sebagai caleg yang diharapkan focus ke dapil masing-masing. Dan DPC Partai Gerindra dipimpin oleh Boby Oktavianus Zulkarnain yang tidak mencalonkan diri, sehingga kami bisa bersinergi membesarkan partai. (m24) diberikan kepada fakir miskin, ia membeli sumur milik orang Yahudi dan diwakafkan kepada orang Islam. Ia juga pernah menyumbang unta dan kuda serta perbekalan kepada angkatan jihad Islam. Kemurahan Utsman diikuti oleh sahabat Nabi yang lain, Abdurrahman bin Auf ra, Abu Dahdah ra, dan lain-lain. Apa yang dilakukan para sahabat Nabi itu semata-mata karena Allah SWT, sebab mereka sudah memiliki kesempurnaan iman. Rasulullah pun sudah memberi jaminan kepada mereka sebagai penghuni surga. Iman yang kokoh dan sempurna itulah mereka tidak punya lagi sifat kikir dan cinta dunia. Nikmat yang mereka terima juga terpercik kepada sekelilingnya.

Gamawan Fauzi. “Jika perlu keterangan Pak Mendagri dimintai juga. Saksi bisa dari pihak BPK, pemeriksaan saksisaksi dalam waktu dekat ini lah,” katanya. Kerugian negara atas dugaan korupsi pengadaan paket penerapan Kartu Tanda Penduduk berbasis nomor induk kependudukan secara elektronik (e-KTP) tahun anggaran 2011-2012 pada Kementerian Dalam Negeri itu masih dihitung. “Pagu anggaran pengadaan paket tersebut adalah sebesar Rp6 triliun, namun nilai kerugian negaranya masih dihitung,” kata Johan Budi. Menurt Johan, ada dua tempat yang digeledah penyidik KPK di gedung Kemendagri dan satu di Menara Duta. “Saya jelaskan, kemarin itu tidak hanya dua tempat yang digeledah terkait dengan e

Tanker Jepang .... diesel disedot dari Naninwa Maru. “Mereka kemudian melarikan diri kira-kira lima atau enam jam kemudian,” tambahnya. Norzaid menambahkan bahwa ABK berusaha untuk membebaskan diri beberapa jam kemudian setelah kejadian, dan ketika melakukan hitungan, maka diketahui bahwa tiga ABK Indonesia dinyatakan hilang. “Para awak kapal terdiri dari warga Indonesia, Thai, Myanmar dan India. Namun warga Indonesia tidak terlihat. “Kami duga mereka diculik oleh bajak laut.Tanker itu kini dilabuhkan dan kami menyelidiki kasusnya,” katanya.

Ada-ada Saja .... menghebohkan masyarakat Desa Pantaigemi Kec. Stabat Kab. Langkat dan menjadi perbincangan warga, Rabu (23/4). Namun, informasi dihimpun dari warga, caleg berinisial TSA itu tidak berani meminta langsung uangnya kepada masyarakat melainkan melalui tim suksesnya. Setelah mengetahui suaranya di dua TPS desa itu hanya 35 suara, tidak sesuai dengan harapan 150 suara, TSA meminta pertanggungjawaban tim sukses (TS) berinisial B. Lantas,

Polisi curiga, ketiga WNI itu ikut diculik pembajak. Semua kru yang disekap dilaporkan oleh New Strait Times dalam keadaan selamat dan tidak terluka. “Kami telah mengirimkan personel kami ke lokasi dan menemukan kapal tanki Jepang itu di Pulau Angsa. Kapal tersebut kemudian kami bawa ke Pelabuhan Utara untuk penyelidikan lebih lanjut,” lanjut Norzaid. Selat Malaka merupakan kunci lalu lintas laut antara Asia menuju ke Eropa dan Timur Tengah. Kawasan itu terhitung rawan pembajakan karena banyaknya jumlah kargo dan kapal yang melintasi area tersebut.(thestar/m10) TS mendatangi warga meminta pengembalian uang Rp50.000 per warga. Namun masyarakat menolak mengembalikannya dengan alasan nama caleg yang ‘diarahkan’ telah mereka coblos pada 9 April 2014. Secara keseluruhan suara yang diperoleh caleg itu di Kab. Langkat hanya 1.713 suara. Posisinya tersisihkan oleh rekan-rekannya satu partai yan memiliki suara jauh lebih tinggi di beberapa Dapil. Kini caleg tersebut menghilang dan belum dapat dimintai tanggapannya. (a03)

bangan sebagai daerah kawasan strategis dan cepat berkembang di Deliserdang. Seperti Kualanamu Internasional Airport (KNIA),pembangunan jalan tol, taman rekreasi Sibolangit serta rencana pembangunan bendungan Lau Simeimei di Kec. Biru-biru dan pendidikan. (a06)

Antara

UANG TIDAK LAYAK EDAR: Petugas menunjukkan uang yang tidak layak edar yang akan dimusnahkan di Kantor Perwakilan Bank Indonesia (BI) DIY,Yogyakarta, Rabu (23/4). Bank Indonesia (BI) DIY memusnahkan uang lusuh dan tidak layak edar sekitar Rp 115 miliar per bulan pada 2014 atau turun dibandingkan catatan tahun sebelumnya yang mencapai Rp 203 miliar per bulan.

Moeldoko Banting Jam Tangan Richard Mile Rp1,1 M Imitasi J A K A RTA ( Wa s p a d a ) : Panglima TNI Jenderal Moeldoko mengaku jam tangan merek Richard Mile yang dia beli palsu (imitasi). Untuk harga jam tangan asli merek tersebut diperkirakan Rp1,1 miliar. Moeldoko membeli jam tersebut hanya seharga Rp5 juta. “Jam kayak gini kok orisinil,” kata Moeldoko saat ditemui di Hotel Borobudur, Jakarta, Rabu (23/4). Untuk memastikannya, Moeldoko lantas memberikan jam tangan tersebut ke wartawan. Sejumlah wartawan yang masih penasaran tetap bertanya mengenai orisinalitas jam tersebut. Namun tanpa disangkasangka, mantan Kepala Staf

Angkatan Darat (KSAD) membanting jam tangannya, yang kemudian diambil kembali oleh anak buahnya. “Saya beli jam ini hanya Rp4,7 juta,” katanya sambil tertawa. Moeldoko mengaku dirinya adalah kolektor jam tangan. Dia sengaja membeli jam tersebut karena menga-gumi inovasi yang terdapat di dalamnya. “Saya ingin apa yang saya gunakan bermakna bagi diri saya. Justru pikiran saya memb a n g u n i n ov a s i . B e g i t u bangun tidur akan membuat kita berpikir,” kata Moeldoko. Jam tangan yang dipakai Moeldoko sempat disoroti oleh sejumlah media di Singapura. Cerita jam tangan yang harga aslinya sekitar Rp 1,1

miliar tersebut, beredar di dunia maya. Media Singapura, www. mothership.sg, mengangkatnya dengan fakta dari foto The Straits Times yang terbit 25 Maret 2014, yakni di tangan Moeldoko jelas-jelas nampang arloji merek Richard Mille RM 011 Felipe Massa Flyback Chronograph “Black Kite” dengan harga kisaran USD100 ribu atau Rp1,1 miliar. Jenderal Moeldoko memang pejabat militer yang kaya.Daftar kekayaan yang diserahkannya kepada KPK 2013 sekitar Rp36 miliar. Menurut Moeldoko, kekayaan yang dia miliki berasal dari warisan dari mertua, juga diperolehnya selama bertugas sebagai tentara. (oz)

Riefky Hasan ....

Harsya, disusul Nova Iriansyah, 22.550 suara. Partai baru yang didirikan oleh tokoh nasional asal Aceh, Surya Paloh, yakni Nasinal Demokrat berada di urutan kedua suara partai tertinggi, yakni 92.675 suara. Bachtiar Ali memperoleh suara individu tertinggi sementara yaitu, 25.091 suara. Partai Amanat Nasional, b e ra d a d i u r u t a n k e t i g a dengan jumlah 84.669 suara. Suara Muslim Aiyub dan Anwar Ahmad bersaing keras, namun Anwar Ahmad yang Ketua DPW PAN Aceh memperoleh suara lebih tinggi, yakni, 23.959 suara, sementara Muslim Aiyub 23.136 suara. Partai Gerindra memperoleh 72.026 suara, caleg tertinggi T.A Khalid dengan 17.254 suara disusul Zainal Sabri, 13.944. PKS suara di 10 kabupaten/kota tadi memperoleh 63.915 suara dengan suara mayoritas diperoleh Nasir Djamil yakni, 36.959 suara. Angka ini, untuk sementara suara tertinggi dari semua caleg di Dapil-I Aceh. Partai Golkar memperoleh 61.638 suara, Sayed Fuad Zakaria memperoleh 26.114 suara. Namun, suara ini belum aman

untuk melenggangkan Sayed Fuad untuk kedua kalinya ke Senayan, sebab, HM Salim Fakhry,caleg nomor-4 dari Dapil-1 meski baru memperoleh 6.314 suara, setelah masuk suara dari Aceh Tenggara, maka suara Fakhry akan bertambah secara signifikan dan bisa menyaingi suara yang diperoleh Sayed Fuad Zakaria. Partai Kebangkitan Bangsa (PKB) kemungkinan akan memperoleh satu kursi dari 7 jatah kursi DPR RI dari Dapil-1. Kini suara partai yang masuk adalah 58.708 suara. Suara tertinggi diperoleh oleh Irmawan, yang tidak lain adalah Ketua Umum PKB Aceh, sebanyak 29.418 suara. Sedangkan partai lain yang kecil suaranya untuk DPR RI adalah, PPP 48.239 suara, PDI-P, 20.898 suara, Hanura, 24.415 suara, PBB dan PKPI yang tidak lewat elektoral tresehold memperoleh 18.825 dan 12.499 suara. Untuk Dapil-1, sejauh ini belum ada satu partai yang memperoleh dua kursi DPRRI. Dari tujuh kursi yang diperebutkan, masing masing partai berbagi satu kursi, yakni partai Demokrat, Nasdem, PAN, Gerindra, Golkar, PKS dan PKB. (b01/b08)

Demokrat memperoleh 23.518 suara, PAN memperoleh 3.888 suara, PPP memperoleh 258 suara, Hanura memperoleh 7.724 suara, PBB memperoleh 315 suara dan PKPI memperoleh 18.570 suara. Untuk Dapil Taput 1 hasil perhitungan suaranya sebagai berikut, Partai NasDem memperoleh 3.043 suara, PKB memperoleh 1.074 suara, PKS memperoleh 148 suara, PDIP memperoleh 3.125 suara, Golkar memperoleh 5.452 suara, Gerindra memperoleh 3.622 suara, Demokrat memperoleh 4.600 suara, PAN memperoleh 2.808 suara, PPP memperoleh 300 suara, Hanura memperoleh 6.400 suara, PBB memperoleh 13 suara dan PKPI memperoleh 3.390 suara. Dapil 2 Taput yakni, NasDem mempereh 4.194 suara, PKB memperoleh 2.345 suara, PKS memperoleh 17 suara, PDIP memperoleh 2.326 suara, Golkar memperoleh 5.191 suara, Gerindra memperoleh 2.944 suara, Demokrat memperoleh 2.143 suara, PAN memperoleh 2.974 suara, PPP memperoleh 0 suara, Hanura memperoleh 4.054 suara, PBB memperoleh 2 suara dan PKPI memperoleh 1.132 suara. Dapil 3 Taput terinci sebagai berikut, NasDem memperoleh 5.782 suara, PKB mem-

peroleh suara 3.017 suara, PKS memperoleh 19 suara, PDIP memperoleh 2.663 suara, Golkar memperoleh 3.298 suara, Gerindra memperoleh 5.296 suara, Demokrat memperoleh 1.227 suara. PAN memperoleh 4.421 suara, PPP memperoleh 4 suara, Hanura memperoleh 2.053 suara, PBB memperoleh 6 suara, PKPI memperoleh 1.844 suara. Dapil 4, NasDem memperoleh 3.713 suara, PKB memperoleh 1.528 suara, PKS memperoleh 2.243 suara, PDIP memperoleh 8.280 suara, Golkar memperoleh 5.892 suara, Gerindra memperoleh 3.898 suara, Demokrat memperoleh 3.659 suara, PAN memperoleh 2.426 suara, PPP memperoleh 2 suara, Hanura memperoleh 665 suara, PBB memperoleh 5 suara dan PKPI memperoleh 3.156 suara. Dapil 5 Taput , NasDem memperoleh 2.470 suara, PKB memperoleh 2.596 suara, PKS memperoleh 13 suara, PDIP memperoleh 2.273, Golkar memperoleh 3.088 suara, Gerindra memperoleh 1.963 suara, Demokrat memperoleh 3.477 suara, PAN memperoleh 1.605 suara, PPP memperoleh 128 suara, Hanura memperoleh 1.039 suara, PBB memperoleh 241 suara dan PKPI memperoleh 505 suara. (a21)

sekolahnya. “Dia dipanggil, kemudian dibawa masuk ke kamar. Hasil visum terjadi pembengkakan pada kemaluannya,” tutur Ibu DL. Lima Korban Pasca pengakuan DL, empat anak lainnya akhirnya menceritakan kelakuan Briptu M kepada orangtuanya. Meski demikian hanya dua orangtua yang telah melaporkan kasus tersebut ke Mapolresta Banda Aceh. Kelima bocah yang juga menjadi korban pencabulan dan bersekolah di sekolah yang sama tersebut yakni Dl, 8, MH, 10, SR, 9, NH, 9, dan TS, 9 tahun. “Setelah kami periksa ada pembengkakan pada organ vital anak saya dan 14

April lalu langsung saya laporkan ke polisi. Tapi cuma kami yang melapor. Orangtua yang lain belum berani,” kata ibu DL. Wali Kota Banda Aceh Illiza Sa’adjuddin Jamal berharap pelaku dihukum seberat-beratnya untuk memberi efek jera kepada para pelaku yang seharusnya melindungi dan mengayomi masyarakat. Kasus kekerasan seksual terhadap lima murid SD di Kec. Meuraxa ini kesekian kali yang menimpa anak-anak di Banda Aceh. Lembaga Bantuan Hukum Anak mencatat 13 kasus pelecehan seksual terhadap anak terjadi sepanjang 2013. (cb06)

Kamis (hari ini). Sebelumnya, suara di 10 kabupaten/kota yang sudah tuntas dihitung, yakni, Sabang, Aceh Besar, Banda Aceh, Gayo Lues, Singkil, Sulubulussalam, Nagan Raya, Aceh Jaya, dan Pidie jaya. Empat kabupaten lain diperkirakan akan dilanjutkan penghitungan suara pada Kamis, untuk Dapil-1 yakni, Kabupaten Aceh Tenggara, Aceh Selatan, Simeulue dan Pidie. Pada penghitungan suara yang berlangsung di gedung utama DPR Aceh kemarin, KIP Aceh terpaksa melompat dari Dapil –I ke Dapil-II Aceh. Hal ini dilakukan karena belum masuk suara dari Aceh Tenggara, Simelue, Aceh Selatan dan Pidie ke KIP Aceh. Selanjutnya penghitungan dilanjutkan menjelang petang kemarin untuk suara DPD-RI. Berdasarkan suara dari 10 kabupaten/kota yang sudah dituntaskan penghitungannya oleh KIP, dilaporkan, perolehan suara partai tertinggi untuk DPR RI diperoleh Partai Demokrat dengan mendulang 121.131 suara. Untuk suara individu Partai Demokrat tertinggi diperoleh Riefky

Pemilu Di Taput .... suara C1 yang dimiliki para saksi tidak sinkron dari data yang dibacakan petugas PPK dari beberapa kecamatan. Panwaslu dan KPUD Taput menerima beberapa temuan pelanggaran di dua TPS yakni, di TPS 1 Desa Jambur Nauli Kec. Tarutung dan TPS 2 Desa Parit Sabungan Kec. Siborongborong. Dari putusan Pleno yang dibacakan KPUD Taput, hasil penghitungan suara untuk Parpol dan Caleg DPR RI sebagai berikut, NasDem memperoleh 31.789 suara, PKB memperoleh 3.665 suara, PKS memperoleh 1.099 suara, PDIP memperoleh 27.399 suara, Golkar memperoleh 16.890 suara, Gerindra memperoleh 10.763 suara, Demokrat memperoleh 31.818 suara, PAN memperoleh 4.402 suara, PPP memperoleh 359 suara, Hanura memperoleh 11.167 suara, PBB memperoleh 335 suara dan PKPI memperoleh 2.476 suara. Perhitungan untuk Parpol dan Caleg DPRD Provinsi yakni, NasDem 24.694 suara, PKB memperoleh 11.558 suara, PKS memperoleh 1.874 suara, PDIP memperoleh 15.301 suara, Golkar memperoleh 23.472 suara, Gerindra memperoleh 10.770 suara,

Korban Oknum .... melapor ke unit perlindungan perempuan dan anak, tidak perlu takut,” kata Sugeng. Kasus dugaan pencabulan bocah SD di Kec. Meuraxa berawal dari kecurigaan orangtua DL, salah satu korban, pada 12 April lalu. Bocah kelas I SD tersebut enggan ketika disuruh orangtuanya berangkat sekolah. Menurutnya, meski tidak mengetahui kapan aksi bejat itu dilakukan pelaku, namun DL akhirnya memperlihatkan rumah Briptu M yang terletak sekitar 100 meter dari sekolah bocah berusia 8 tahun itu. Aksi bejat Briptu M, dilakukan ketika DL melintas di depan rumah pelaku sepulang dari


Berita Utama

A2

Dana BOS Rp100 Juta Raib Dari Mobil SIDIKALANG (Waspada): Uang BOS (Bantuan Operasional Sekolah) SMK Pergetteng Getteng Sengkut Kecupak, Kab. Pakpak Bharat sebesar Rp 100 juta raib dari mobil kepala sekolah saat parkir di Jl. Pegagan Sidikalang, Rabu (23/4). Sopian Manik, 34, kepala SMKN 1 Kecupak, Kec. PGGS, Pakpak Bharat kepada wartawan di ruang Kepala Sentra Pelayanan Kepolisian (KSPK) Polres Dairi menceritakan, dia bersama sopir-

nya Jonggi Sirait, 29, warga Desa Mata Kocing Salak sebelumnya mencairkan dana BOS SMK PGGS Rp100 juta dari BRI Cabang Sidikalang di Jl. SM Raja sekira pukul 12:15. Uang tersebut disimpan di bawah tempat duduk sopir, kemudian mereka pergi menyetorkan uang ke kantor Gereja Kristen Protestan Pakpak Dairi (GKPPD) Sentrum di Jl. Air Bersih Sidikalang. Setelah pulang dari Sentrum, dia bersama sopirnya mampir

di salah satu rumah makan di Jl. SM Raja Sidikalang .Sopir memarkirkan mobil Avanza BK 1734 XQ miliknya persis di samping rumah makan tersebut. Saat mau berangkat pulang ke Salak, Pakpak Bharat, Jonggi melihat kaca pintu mobil sebelah kanan sopir pecah dan uang yang disimpan di bawah tempat duduk hilang. “Kejadianya paling ada seperempat jam saat kami makan, padahal tempat kejadian itu lumayan ramai,” kata Sopian. (ckm)

Sumut Rawan Imigran Gelap MEDAN (Waspada) : Provinsi Sumatera Utara dan Riau termasuk kawasan yang rawan terhadapmasuknya para imigran gelap terutama imigran yang akan mencari suaka ke Australia. “ Salah satu daerah di Indonesia yang menjadi pintu masuk imigran gelap adalah

daerah-daerah yang berada di Pulau Sumatera, seperti Riau dan Sumatera Utara,” kata Direktur Penyidikan dan Penindakan Keimigrasian, Drs Mirza Iskandar. Hal itu dikatakannya usai Workshop Kerjasama Instansi dalam Penanganan Imigran Ilegal, Pencari Suaka dan Pe-

Bayi Berkepala Dua ... Dari Medan diberitakan, bayi kepala dua satu badan atau thoraco abdominofagus tiba di RSU dr. Pirngadi Medan pukul 20.00. Didampingi Camat Sei Lepan Wagito dan Kepala Desa Sujono bayi itu langsung mendapat perawatan di RS milik Pemko Medan ini. “Selama dalam perjalanan, kedua bayi ini menangis,” kata Wagito. Menurutnya, saat dibawa ke sini keluarga sempat keberatan. “Mereka takut anaknya langsung dioperasi pemisahan. Kami bawa ke sini, karena di sana belum ada peralatan yang memadai, maka kita menyarankan agar di bawa ke rumah sakit Medan agar di observasi oleh dokter di sini,” imbuhnya. Selang beberapa menit tiba di RS,Sekda Langkat, dr Indra Salahudin M kes tiba. Dia mengaku terkejut dengan kejadian ini dan mengetahui informasi pukul 14:00. Pasalnya, untuk di Kab. Langkat baru pertama.”Ya, kita terus berupaya untuk membantu masyarakat kita. Apalagi, orangtua ini mengantongi BPJS,” ujarnya. Dia mengaku, kondisi bayi keadaan baik. Selain kepalanya dua, bentuk fisik tubuh, tangan dan kaki bayi keadaan normal.”Hanya saja pada di tangan kanan yang ada tumbuh tulang kecil dan jantungnya kita belum tau. Mungkin malam ini tim medis akan meronsen bayi itu melihat kondisinya. Pemkab Langkat akan membantu dan melayani apa keperluan keluarga. Apalagi pihak keluarga sudah mempunyai BPJS. “Kemungkinan Pak Bupati besok Kamis (24/4) mengunjungi bayi ini melihat situasi terkini,” ujarnya. (a02/h02)

H.Ihwan Ritonga,SE Raih ... Raihan suara yang diperoleh Ihwan sebagai sosok muda tidak disangka-sangka karena, Ihwan yang baru pertama kali terjun ke dunia politik dan memiliki sikap sederhana mendapat simpati baik dari kalangan muda maupun tua khususnya di daerah pemilihannya, sungguh sangat signifikan. “Mudah-mudahan dengan lolosnya Ihwan diharapkan akan mampu membawa aspirasi rakyat dalam mengemban tugasnya demi membela kepentingan masyarakat dan berperan ikut membangun Kota Medan diberbagai bidang,” ujar salah seorang tim suksesnya dari Parsadaan Ritonga dohot boruna. Ketika ditanya wartawan, Ihwan dengan sikap rendah hati dan terbuka, membenarkan jumlah perolehan suara tersebut. “Berdasarkan formulir C1 dan hasil rekapitulasi tim pemenangan kita, suara untuk saya pribadi sejumlah 9.512 dan total suara partai 29.680,” ujar Ihwan. Maka dengan perolehan suara yang cukup signifikan tersebut, untuk Dapil 1 Ihwan yakin Partai pimpinan H.Prabowo Subianto itu bisa mendapatkan 2 kursi. Dijelaskannya, caleg yang memperoleh suara terbanyak setelah dirinya di dapil 1 adalah Godfried Lubis. Dia berharap tidak ada kecurangan lagi dalam rekapitulasi perolehan suara Pemilu Legislatif kali ini. Untuk mengantisipasi adanya kecurangan, kata Ihwan, dia telah memiliki forJawaban Problem Catur, mulir C1 lengkap, serta hasil rekapitulasi perolehan suara TTS Dan Sudoku di tingkat PPS. Dari Halaman Sport. Kepada warga masyarakat yang telah menggunakan hak pilihnya, khususnya masyarakat Jawaban Problem Catur: yang telah mendukungnya terhadap Partai Gerindra sehingga 1. Bxg6, MxB. Partai Gerindra bisa berada diperingkat ke-3 secara nasional 2. h5xM+, Rh6. dan peringkat ke-3 di Kota Me3. g7+, Rh7. dan. Dan telah mempercayainya untuk menjadi wakil rakyat 4. Mf8, Rg6. dari Dapil 1,caleg nomor 1 Par5. g8(M)+, Rh5. tai Gerindra ini menyampaikan terimakasih. 6. Mg4+mat. Menurut Ihwan, naiknya suara Partai Gerindra kemung(Jika 1. ...., Me5+. kinan masyarakat melihat dan 2. MxM, Bd7. menilai dari sosok H.Prabowo Subianto selaku Ketua Dewan 3. Mf4, Bg7. Pembina ditambah H.Gus Ira4. Mh6+, Rg8. wan Pasaribu selaku Ketua DPD Partai Gerindra Sumut. Kemu5. MxB+mat). dian saya selaku kader Partai yang diamanahkan sebagai caleg yang diharapkan fokus ke Jawaban TTS: Dapil masing-masing. Dan DPC Partai Gerindra dipimpin oleh TTS Olahraga Boby Oktavianus Zulkarnain yang tidak mencalonkan diri, sehingga kami bisa bersinergi membesarkan partai. (m24)

Ada-ada Saja ...

Jawaban Sudoku: 9 2 7 5 1 6 4 8 3

6 3 4 2 7 8 1 9 5

5 8 1 3 4 9 6 7 2

1 7 2 4 5 3 9 6 8

3 6 9 7 8 2 5 4 1

4 5 8 6 9 1 3 2 7

2 4 3 8 6 5 7 1 9

8 9 6 1 3 7 2 5 4

7 1 5 9 2 4 8 3 6

langsung uangnya dari warga.Ia mendesak B selaku tim suksesnya. Informasi Waspada himpun, sebelum Pemilu digelar, TSA memberikan uang Rp 7,5 juta kepada B selaku TS agar dibagikan kepada warga Rp50 ribu per orang. Harapannya untuk dua Tempat Pemungutan Suara di desa itu, ia meraih 150 suara. Namun, setelah Pemilu dan penghitungan suara, TSA hanya memperoleh 35 suara. Lalu, B mendatangi warga meminta pengembalian uang Rp50.000 per orang. Namun, ditolak dengan alasan nama Caleg yang ‘diarahkan’ telah mereka coblos pada 9 April 2014. Secara keseluruhan suara yang diperoleh TSA di Kab. Langkat hanya 1.713 suara. Posisinya tersisihkan oleh rekanrekannya satu partai yan memiliki suara jauh lebih tinggi di beberapa Dapil. Kini Caleg tersebut menghilang dan belum bias dikonfirmasi. (a03)

ngungsi, di Kanaya Grend Hotel, Rabu (23/4).Workshop yang digelar Kementerian Hukum dan Hak Asasi Manusia RI Kantor Wilayah Sumut, Imigrasi Kelas I Khusus Medan, dihadiri perwakilan instansi dan para jurnalis. Namun, Mirza mengaku tak memiliki data rinci prihal masuknya para imigran gelap ini ke Sumut. ‘Katanya, imigrasi memberlakukan kebijakan terhadap imigran ilegal, pencari suaka dan pengungsi. Para imigran ilegal yang masuk wilayah Indonesia dapat dikenakan Tindak Pidana Keimigrasian.Mereka ditempatkan di Rudenim ( rumah detensi imigrasi). Saat ini di Indonesia ada 13 Rudenim dihuni 1.656 orang. Sedangkan para pencari suaka dan pengungsi tidak dapat dideportasi ke negaranya jika mereka memiliki Kartu Identitas UNHCR sehingga mereka ditempatkan di luar Rudenim (Community House) yang saat ini ada 33 Community House sebanyak 3.949 orang. Para pencari suaka dan pengungsi yang berada di luar Rudenim dan Community House berjumlah 6.674 orang. Sedangkan yang ada di dalam ruang detensi ditjenim Imigrasi mencapai 27 orang. “Para pencari suaka yang melakukan permohonan kepada UNHCR, ada juga yang ditolak. Para pengungsi yang tidak mendapatkan persetujuan ditempatkan ke negara tujuan (Resettlement) akan diserahkan ke imigrasi sebagai imigran illegal,’’katanya. Menurut Mirza, UNHCR tidak sembarang lagi memberikan orang asing ke negara ketiga. Ini terbukti,baru 20 persen saja yang setujui untuk mendapatkan negara ketiga. Sementara 80 persen lagi para pencari suaka dan pengungsi yang ada di Indonesia diasumsikan bakal menjadi imigran illegal. (m37)

GOLKAR KEJAR PDIP ... Padanglawas Utara, Dairi, Tebingtinggi dan Padanglawas, perolehan suara Partai Golkar terus mengejar suara PDI Perjuangan. Di enam kabupaten/kota tersebut , Partai Golkar berdasarkan perolehan suara sah partai maupun masing-masing calon legislatif meraup 2.468.721 suara, sementara PDI Perjuangan di kabupaten/kota yang sama meraup 290.408 suara dan Partai Gerindra memperoleh 174.698 suara. Sementara, prediksi perolehan kursi DPRD Sumut dari Dapil Sumut 12 , Partai Golkar dan Demokrat mendapat masing-masing 2 kursi di DPRD Sumatera Utara dari daerah pemilihan Sumut 12,yakni Kota Binjai dan Kab. Langkat. Sedangkan total suara di Dapil Sumut 12 yakni 584.355 suara dengan alokasi 10 kursi di DPRD Sumut. Dengan demikian Bilangan Pembagi Pemilih (BPP) 58.435 suara. Prediksi DPD Sedangkan Darmayanti Lubis diprediksi bakal kembali menjadi anggota DPD RI periode 2014-2019 karena perolehan suaranya cukup signifikan. Dedi Iskandar Batubara yang suaranya juga cukup besar di beberapa daerah diprediksi bakal menjadi anggota DPD RI. Calon yang diprediksi cukup kuat untuk duduk di DPD RI untuk sementara ini ada-lah Rijal Sirait, Badikenita, Parlindungan Purba dan M. Nuh. Bisa Didiskualifikasi Sementara itu, Komisi Pemilihan Umum (KPU) Sumatera Utara kembali mengingatkan partai politik dan calon legislatif untuk DPD RI, DPRD Provinsi, DPRD kabupaten/kota serta DPD RI peserta Pemilu segera melaporkan dana kampanye tahap akhir, yakni pelaporan penerimaan dan pengeluaran dana kampanye Pemilu Legislatif 2014. Komisioner KPU Sumut Evi Novida Ginting di sela-sela acara rapat pleno terbuka KPU Sumut mengatakan, bila

Polisi Diduga ... Menurutnya, selain memeriksa kejiwaan pelaku, Polresta Banda Aceh juga mengirim dokter psikologi untuk menghilangkan trauma yang diderita bocah korban pencabulan. Meski hasil pemeriksaan menunjukkan adanya gangguan kejiwaan, pelaku tetap diproses secara hukum. “Itu (gangguan kejiwaan) tidak memengaruhi pidananya. Tidak ada kendala apapun dalam penanganan kasus ini dan sudah lima saksi kami periksa. Pelaku memang membantah melakukan perbuatan cabul,” katanya.

Bawaslu Minta ... anggota KPU melarikan diri setelah penghitungan suara. Pemilu 2009 semua kotak suara dihitung ulang atas perintah MK,” tuturnya. Nelson mengatakan dari Panwaslu sendiri, ada 82 TPS yang direkomendasikan untuk PSU. Sementara, yang sudah direncanakan untuk PSU pada 26 April 2014 baru 35 TPS. “PSU sesegera mungkin kalau bisa. 35 TPS yang direncanakan untuk diulang banyak pelanggaran sehingga Panwas kewalahan untuk menganalisa apakah harus PSU atau menggunakan dokumen yang ada,” imbuhnya. Berdasarkan laporan terkait rekapitulasi tingkat kabupaten, lanjut Nelson, ada 13 kecamatan yang bisa direkap dari 31 kecamatan. “Di sana sedikit KPPS yang serahkan C1 ke Panwas atau saksi. Padahal itu wajib mereka lakukan. Ada kewajiban scan C1, tapi baru mereka serahkan 15 April. Ada juga upaya jemput paksa dari KPU, tapi malah jadi masalah baru, bukannya untuk membuat Pemilu lebih baik,” urainya. Atas kondisi itu, Nelson mencatat 11 parpol, kecuali Gerindra, menolak hasil pemilu di Nias Selatan sampai saat ini. Termasuk seorang anggota komisi 2 DPR RI dari PDIP, Yasona Lauli karena menilai prosesnya amburadul. (vn)

PPP Islah ... Suryadharma Ali mengakui perseteruan dua kubu dalam partai tersebut telah usai. Kini PPP telah kembali seperti sediakala. “Kita sekarang kembali ke titik nol. Saya tidak mau lihat ke belakang lagi. Kita sekarang melihat ke depan,” kata Suryadharma sesaat sebelum Mukernas III dibuka. Sekjen PPP M Romahurmuziy mengatakan para pihak yang berkonflik telah didamaikan dan melakukan perdamaian (islah) setelah dilakukan pertemuan pada Selasa (23/4) malam di Jakarta. “Setelah sekian kali seruan saya sejak pekan lalu untuk terjadinya islah, alhamdulilah semalam telah terjadi pertemuan ishlah di Hotel Parklane, Jakarta sekitar jam 21.00-23.30,” kata Romahurmuziy dalam rilis laporan dana kampanye tidak diindahkan, Parpol pemenang dan calon yang terpilih terancam diskualifikasi. Imbauan pelaporan dana kampanye di atur dalam PKPU No 17/2013, kata Evi. ‘’Sanksi tegas bagi mereka yang tidak mengindahkan adalah digugurkan kemenangannya. Sehingga kepada partai dan calon yang diprediksi maju sebagai anggota legislatif dan DPD segera melaporkan dana kampanye paling lambat 24 April pukul 18:00,’’kata Evi. Menurut Evi, satu tahapan lagi harus dilalui peserta Pemilu yakni pelaporan dana kampanye tahap akhir dan hasil audit dari Kantor Akuntan Publik (KAP). Bila tidak menyerahkan atau laporan dana kampanye yang bersangkutan ditemukan laporan fiktif, terbukti menggunakan uang negara dan dari sumber-sumber yang tidak bisa dipertanggungjawabkan, terancam diskualifikasi. Sementara, Kabag Hukum KPU Sumut, Evi Daulay menjelaskan pelaporan dana kampanye tahap akhir akan diserahkan KPU ke KAP selambatnya 26 April 2014. Dalam rentang waktu 30 hari ke depan, KAP mengaudit pelaporan tersebut untuk dinilai kelayakan dan kebenarannya. “Hasil audit KAP dilaporkan ke KPU Sumut serta KPU kapubaten/kota. Khusus untuk DPD RI, KAP melaporkan ke KPU pusat. Apabila ditemukan calon atau partai pemenang yang bermasalah laporan dana kampanye, maka KPU membuat berita acara untuk diserahkan ke KPU RI. Pusatlah nanti yang akan menetapkan keputusannya,” katanya. Bawaslu Sumut Aulia Andri menegaskan, akan mengawasi azas kepatuhan partai dan calon legislatif dengan melakukan verifikasi terhadap laporan dana kampanye yang telah digunakan. Karena, amatan kita banyak juga caleg yang merasa dirinya sudah kalah tidak perlu lagi melaporkan penggunaan dana kampanyenya. (m34)

Kasus dugaan pencabulan bocah SD di Kec. Meuraxa berawal dari kecurigaan orangtua DL, salah satu korban, pada 12 April lalu. Bocah kelas I SD tersebut enggan ketika disuruh orangtuanya berangkat sekolah. Menurutnya, meski tidak mengetahui kapan aksi bejat itu dilakukan pelaku, namun DL akhirnya memperlihatkan rumah Briptu M yang terletak sekitar 100 meter dari sekolah bocah berusia 8 tahun itu. Aksi bejat Briptu M, dilakukan ketika DL melintas di depan rumah pelaku sepulang dari sekolahnya. “Dia dipanggil, kemudian dibawa masuk ke kamar. Hasil visum terjadi pembengkakan pada kemaluannya,” tutur Ibu DL. Lima Korban Pasca pengakuan DL, empat anak lainnya akhirnya menceritakan kelakuan Briptu M kepada orangtuanya. Meski demikian hanya dua orangtua yang telah melaporkan kasus tersebut ke Mapolresta Banda Aceh. Kelima bocah yang juga menjadi korban pencabulan dan bersekolah di sekolah yang sama tersebut yakni Dl, 8, MH, 10, SR, 9, NH, 9, dan TS, 9 tahun. “Setelah kami periksa ada pembengkakan pada organ vital anak saya dan 14 April lalu langsung saya laporkan ke polisi. Tapi cuma kami yang melapor. Orangtua yang lain belum berani,” kata ibu DL. Wali Kota Banda Aceh Illiza Sa’adjuddin Jamal berharap pelaku dihukum seberat-beratnya untuk memberi efek jera kepada para pelaku yang seharusnya melindungi dan mengayomi masyarakat. Kasus kekerasan seksual terhadap lima murid SD di Kec. Meuraxa ini kesekian kali yang menimpa anak-anak di Banda Aceh. Lembaga Bantuan Hukum Anak mencatat 13 kasus pelecehan seksual terhadap anak terjadi sepanjang 2013. (cb06) pers yang diterima Antara di Jakarta, Rabu. Ia mengatakan, pihak yang berseteru yaitu kubu Suryadharma Ali dengan kubu Emron Pangkapi dan kawan-kawan dipertemukan dan dipimpin ketua Majelis Syariah DPP KH Maimoen Zubair. Dalam pertemuan tersebut, menurut dia, dihadiri oleh Suryadharma Ali (SDA), Romahurmuziy selaku Sekretaris Jenderal,Wakil Ketua Umum Hasrul Azwar dan Lukman Saifudin, serta ketua Majelis Pertimbangan DPP KH Zarkasih Nur. “Fatwa yang disampaikan mbah Moen dibacakan kembali, kemudian masing-masing yang hadir ditanyakan sikapnya. Alhamdulilah semua menerimanya. Bagi saya, karena PPP didirikan oleh para ulama dan mbah Moen adalah ulama partai yang tertinggi,tidakadakatalainkecuali saman wa thoatan, saya dengar dan saya patuhi,” katanya. Ia menambahkan, agenda selanjutnya adalah konsolidasi organisasi menyeluruh menatap pilpres yang tinggal dalam hitungan hari. “Insya Allah siang nanti akan ada pertemuan islah lanjutan antara SDA bersama seluruh DPW se-Indonesia,” katanya. (aya/ant)

Di Deliserdang ... Hamparanperak dan Labuhandeli yakni Jasa Wardani Ginting unggul dengan 7.380 suara disusul Tolopan Silitonga 6.414 suara, dr H Syofi Rizal Husni Mars 5.422 suara, Mangidar Marpaung 3.719 suara, Sudarman 3.641 suara, Alfi Syahra 3.540 suara, Iskandar 3.476 suara, Ikhwanul Ismar 3.359 suara, Noto Susilo 3.352 suara. Dapil 2, perolehan suara terbanyak dari Partai Golkar Ricky Prandana Nasution peroleh 7.384 suara, disusul PPP yakni Misman Alawi 5.949 suara, dari Partai Demokrat Jaresman Sitanggang 4.454 suara, Rakhmadsyah dari PKB dengan 4.357 suara, Munawir Fuadi dari Golkar dengan 4.164 suara, dari Demokrat Ismayadi 3.502 suara, Susi Riswati dari Gerindra 3.290 suara, Kamaruzzama dari Gerindra 2.967 suara, Mara Sakti Harahap dari PKS 2.578 suara, Abdul Manaf dari PKB 2.358 suara, Senda Muli dari PKB 2.356 suara dan Darwis dari PKS 2.343 suara. Dapil 3 Caleg dari Partai Golkar Siswo Adi Suwito memperoleh 7.059 suara, Apoan Simanungkalit dari PDIP 4.957 suara, Linda Lubis dari Demokrat 3.822 suara, NusantaraTarigan Silangit dari NasDem peroleh 3.812 suara, Said Hadi dari PKB 3.500 suara, Imran Obos dari PAN 3.496 suara, Kustomo dari Gerindra 3.200 suara, Muhammad Hidayah dari PAN 2.615 suara, Syaiful Tanjung dari PKS 2.579 suara, Hj Fatmawaty dari Demokrat 2.470 suara, Amriono dari PDIP 2.228 suara dan Pedrik Alamsyah Tanjung dari NasDem 2.142 suara. Dapil 4 dari PAN Bayu Sumantri Agung peroleh 8.000 suara, Dedi Syahputra dari Gerindra 5.229 suara, Herry Dumanter Tampubolon dari PDIP 4.168 suara, Alisman Saragih dari PDIP 4.064 suara, Benhur Silitonga dari Golkar 4.017 suara, Henny Rosmawaty Sitanggang 3.910 suara, Novia Andriani dari Gerindra 3.085 sua-

WASPADA Kamis 24 April 2014

MS Kaban Disebut Minta Uang Dan Lift Ke Anggoro JAKARTA(Antara): Mantan Menteri Kehutanan MS Kaban disebut meminta uang dan pengadaan lift kepada pemilik PT Masaro Radiokom, Anggoro, untuk meloloskan proyek pengadaan Sistem Komunikasi Radio Terpadu (SKRT) dalam Program Gerakan Nasional Rehabilitas Hutan dan Lahan (GERHAN) di Departemen Kehutanan tahun 2007. “Terdakwa memberikan uang kepada MS Kaban selaku Menteri Kehutanan karena pada 6 Agustus 2007 Anggoro menerima pesan singkat yang menyatakan: ‘skrg merapat saja ke rmh dinas, kalau smpat bgks rapi 15rb’,” kata JPU (Jaksa Penuntut Umum) KPK Andi Suharlis dalam sidang di pengadilan Tindak Pidana Korupsi (Tipikor) Jakarta, Rabu(23/4). Hal ini terungkap dalam sidang pembacaan dakwaan Anggoro Widjojo yang ditangkap di China pada Januari 2013, setelah buron selama 4,5 tahun. Atas permintaan tersebut, Anggoro pada 7 Agustus 2007 memberikan 15 ribu dolar AS kepada Kaban di rumah dinas Menhut Jl Denpasar Raya No 15 Jakarta.Pada 16 Agustus 2007, Anggoro kembali memberikan kepada Kaban 20 ribu dolar AS melalui David Angkawidjaya. “Terdakwa pada 13 Februari 2008 menghubungi Muhamad Yusuf, sopir Kaban melalui telepon dan mengatakan Hehehe...Pak tadi malam Bapak pesan ee..Suruh ngirim barang sama Pak Yusuf, kalau saya gak, Pak...Pak Is yah Pak, kemudian terdakwa memerintahkan sopir terdakwa Isdriatmoko untuk mengantarkan uang sejumlah 20 ribu dolar AS ke rumah dinas Menhut,” tambah JPU. Setelah uang diserahkan kepada Yusuf, Anggoro mem-

beri tahu Kaban melalui telepon untuk menyatakan uang pesanan sudah dititipkan ke Yusuf dan dijawab oleh MS Kaban “Oke”. Anggoro (foto) pun mengirim SMS kepada M Yusuf berisi “Titipannya jangan lupa laporkan ke Bapak ya Pak, kelihatannya mungkin Bapak mau kirim ke seseorang” dan dijawab Yusuf, titipannya sudah diambil. Kaban masih meminta Anggoro untuk menyediakan uang berupa traveller cheque (TC) 50 pada 25 Februari 2008 sejumlah Rp50 juta dan menyuruh Isdriatmoko untuk memberikan TC kepada MS Kaban di Manggala Wahana Bhakti Departemen Kehutaunan. Permintaan uang masih berlanjut pada 28 Maret 2008 karena menerima SMS dari Kaban untuk minta disediakan uang dengan mengatakan “Apakah jam 19 dpt didrop 40 ribu sin?” Kemudian dibalas Anggoro “19.00 bisa & ke-Ysf” , se-lanjutnya Anggoro menghubungi sopir Kaban, MYu-suf, “Pak tolong tanyakan mau dikirim sekarang barangnya bisa enggak gitu? Bapak ada minta kirim barang” dan dijawab Yusuf “iya Denpasar”. “Terdakwa kemudian membeli valuta asing senilai 40 ribu Singapura lalu diberikan kepada MS Kaban di rumah dinasnya Jalan Denpasar Raya No 15 Jakarta,” tambah jaksa. Sedangkan pemberian lift disepakati lewat pertemuan dihadiri Anggoro dan Ketua Umum Dewan Dakwah Indonesia Syuhada Bhari.Lift untuk Gedung Menara Dakwah sebagai pusat kegiatan Partai Bulan Bintang (PBB) maupun Ormas pendukung PBB karena Kaban adalah Ketua PBB. Anggoro memenuhi permintaan itu pada 28 Maret

2008 dengan membeli 2 lift kapasita 800 kilogram dengan biaya mencapai 58.581 dolar AS.Biaya pemasangan sebesar Rp40 juta dan biaya pengadaan sipil untuk pemasangan lift senilai RP160,65 juta. Selain Kaban, Anggoro memberikan 20 ribu dolar AS kepada Sekjen Dephut Boen Mochtar Purnama pada September 2007. Uang dari Anggoro juga mengalir ke Kepala Biro Perencanaan dan Keuangan Departemen Kehutanan Wandojo Siswanto sebesar 10 ribu dolar AS pada Oktober 2007. Anggoro juga memberikan sejumlah uang kepada Yusuf Erwin Faishal, disalurkan kepada anggota Komisi IV DPR Fachri Andi Leluasa sejumlah 30 ribu dolar Singapura, Azwar Chesputra 5 ribu dolar Singapura, Hilman Indra sejumlah 20 ribu dolar Singapura, Mukhtarudin sebesar Rp50 juta dan 30 ribu dolar Singapura, Sujud Sirajudin Rp20 juta dan Nurhadi M Musawir dari fraksi PAN sebesar Rp5 juta. Terkait perkara ini, sejumlah pihak sudah mendapat hukuman pidana yaitu Yusuf Erwin Faisal dipidana penjara 4 tahun 6 bulan ditambah denda Rp250 juta, sedangkan anggota Komisi IV Azwar Chesputra, Hilman Indra dari Partai Bulan Bintang, dan AM Fahri dari Partai Golkar dihukum penjara 4 tahun dan dendra Rp200 juta.

Gubsu Ajak Iran ...

sing turbin, sebutnya, berdasarkan kontrak menghasilkan 132 MW. Tetapi yang dihasilkan saat ini melebihi kontrak yakni 140,7 MW sampai 145 MW. Kapasitas ini diprediksi mampu memenuhi kebutuhan listrik untuk 20.000 rumah tangga. PT PLN akan mendapat keuntungan US$10,2 juta per tahun. Begitupun PT PLN (Persero) tidak menjamin pemadaman listrik di Sumatera Utara akan usai, meski Iran telah memperbaiki GT 2.1 dan GT 2.2 PLTGU Belawan yang menelan biaya Rp431 miliar. Hal itu dikatakan Direktur Operasional Jawa-Bali-Sumatera PT PLN (Persero) IGA Ngurah Adnyana yang juga hadir tidak menjamin pemadaman berakhir di Sumut. Menurut dia, masuknya GT 2.1 dan GT 2.2 belum cukup kalau cadangan listrik di Sumut belum sampai 30%. Selain cadangan listrik yang belum sampai 30%, kerusakan turbin di Belawan disebabkan pada penurunan kapasitas rumahtangga dan

adanya gangguan cuaca. Sehingga terjadi jangkauan pertumbuhan beban. Tetapi, dengan beroperasinya Nagan Raya dan Pangkalansusu diharapkan dapat menambah pasokan dan cadangan listrik. Sementara itu, Kuasa Hukum Mapna Co Eri Hertiawan didampingi Asep Ridwan menjelaskan, pekerjaan Life Time Extension (LTE) gas turbin (GT) 2.1 dan 2.2 PLTGU Belawan telah selesai. Pengerjaan tersebut berdasarkan kontrak Mapna Co dengan PT PLN (Persero). Kedua turbin itu, kata Eri, beroperasi dan memasok listrik untuk wilayah Sumbagut sejak 18 Maret 2014. Di hadapan para investor Iran dan Dubes Iran, rencananya Sumut akan dihubungkan dengan jalur kereta api. Rencana itu sudah dituangkan oleh masterplan perhubungan. Dalam kesempatan itu Gubsu mengingatkan PLN segera menyelesaikan proyek-proyeknya agar pasokan listrik di Sumut terjamin. (m28)

Kata Gubsu, Sumut saat ini sedang gencar membangun infrastruktur dan menawari Iran untuk ikut berinvestasi. Bukan hanya di sektor kelistrikan tetapi juga jalur rel kereta api. ”Semoga kerjasama pertama ini bisa terus berlanjut. Karena saat ini Sumut sedang membangun sektor infrastruktur, di mana Iran bisa juga terlibat,” sebutnya. Ajakan Gubsu ditanggapi positif. Mahmoud mengaku antusias dan berharap kerjasama pertama Indonesia– Iran ini bisa berlanjut dengan kerjasama lainnya. Dia menjelaskan, Iran sangat kuat di sektor pengembangan teknologi listrik dan juga perkeretaapian. Mahmoud yang didampingi Product & Service CEO Mapna Group Roshani M Mohammadreza berharap, hasil kerja insinyur negaranya bisa membantu Sumut mengatasi krisis listrik. Insinyur Iran sudah menuntaskan perbaikan LTE GT 2.1 dan GT 2.2. Masing-mara, Suriyani dari Golkar 3.070 suara, T Akhmad Thala’a 2.751 suara, Edison Efendy Marpaung dari Demokrat 2.562 suara, Hendry Siregar dari PAN 1.832 suara dan Sutjipto dari Demokrat 1.802 suara. Dapil 5 perolehan suara terbanyak yakni Mikail Parlindungan Purba dari Golkar 6.722 suara, Rusmani Manurung dari Hanura 6.406 suara, M Darbani Dalimunthe dari PAN 5.008 suara, M Yusuf Ketaren dari PDIP 4.634 suara, SyahrulYunan dari Hanura 2.783 suara, M Alfadil dari NasDem 2.674 suara, Edi Daniel Tarigan dari Gerindra 2.207 suara, Mbaru Ginting dari PDIP 2.076 suara, Azhari Nasution dari PKS 2.072 suara, Enda Edian Pinem dari NasDem 1.949 suara dan dari Demokrat Sri Wahyuni 1.464 suara serta Suriani Ginting 1.396 suara. Dapil 6 ditempati Thomas Darwin Sembiring dari Golkar perolehan 7.457 suara, Timur Sitepu dari PDIP 7.299 suara, Berngap dari Hanura 5.908 suara, RonaldtaTarigan dari PDIP 5.656 suara, Simon Sembiring dari Gerindra 5.489 suara, Maya Shinta Sianturi dari Golkar 5.019 suara, Kuzu SerasiWilsonTarigan dari NasDem 3.814 suara, Marlin Sitepu dari Gerindra 3.428 suara, Setiawan Sembiring dari Demokrat 2.611 suara, Enda Tarigan dari PPP 2.607 suara, Sawaluddin dari PAN 2.519 suara dan Suyatno dari PBB peroleh 2.032 suara. (c02)

Antara

Moeldoko Banting Jam Tangan ... Cerita jam tangan yang harga aslinya sekitar Rp 1,1 miliar tersebut, beredar di dunia maya. Media Singapura, www.mothership.sg, mengangkatnya dengan fakta dari foto The Straits Times yang terbit 25 Maret 2014, yakni di tangan Moeldoko jelas-jelas nampang arloji merek Richard Mille RM 011 Felipe Massa Flyback Chronograph “Black Kite” dengan harga kisaran USD100 ribu atau Rp1,1 miliar. Jenderal Moeldoko memang pejabat militer yang kaya.Daftar kekayaan yang diserahkannya kepada KPK 2013 sekitar Rp36 miliar. Menurut Moeldoko, kekayaan yang dia miliki berasal dari warisan dari mertua, juga diperolehnya selama bertugas sebagai tentara.(oz)

China Jajaki Kerjasama ... Sementara Zhu didampingi sejumlah staf, di antaranya Konsul RRC bidang Ekonomi Liu Weiguo. Dalam pertemuan itu, Zhu menjelaskan kunjungan ke Deliserdang merupakan yang pertama sejak diangkat dan dipercaya bertugas di Medan. Menurut Zhu, hubungan antara Indonesia dengan RRC sudah meningkat terutama dalam kerjasama sektor kelautan dan pertanian. Begitu juga dengan kerjasama pembangunan jalan Tol Medan-Kualanamu yang pelaksanaannya berjalan lancar tanpa hambatan. Sementara Konsul RRC Bidang Ekonomi Liu Weiguo mengaku banyak potensi sumber daya alam di Kab. Deliserdang untuk dikembangkan, seperti usaha produksi dan hortikultura. ‘’ Melihat potensi ini, Deliserdang akan kami promosikan kepada pengusaha di RRC agar kerjasama ekonomi dan perdagangan semakin meningkat, ‘’ ujar Liu melalui penterjemah Ali Wongso. Bupati Deliserdang H Ashari Tambunan menyambut baik kerjasama ini. ‘’Pemkab Deliserdang siap bekerjasama dengan siapapun termasuk dengan RRC yang memang sudah sejak lama memiliki hubungan,’’ kata Ashari dan menambahkan, Pemkab Deliserdang akan memberi kemudahan kepada setiap pihak yang akan berinvestasi didaerah ini. Dalam pertemuan itu, Kepala Bappeda Ir H Irman Dj Oemar MSi memaparkan berbagai potensi pengembangan sebagai daerah kawasan strategis dan cepat berkembang di Deliserdang. Seperti Kualanamu Internasional Airport (KNIA), pembangunan jalan tol, taman rekreasi Sibolangit serta rencana pembangunan bendungan Lau Simeimei di Kec. Biru-biru dan pendidikan. (a06)

Al Bayan ... Jadi, karena Allah juga mereka tidak boleh ditolong sebab yang bersangkutan tidak mau berhenti dari kemaksiatan. Misalnya seseorang selalu meminta sumbangan, katanya untuk membangun pondok pesantren atau masjid, tetapi sumbangan yang didapatkan itu digunakan untuk berfoya-foya. Orang yang demikian itu haram mendapat pertolongan dari umat Islam yang beriman. Utsman bin Affan ra sahabat dan menantu Rasulullah terkenal kaya dan sangat pemurah. Hartanya yang banyak diberikan kepada fakir miskin, ia membeli sumur milik orang

Yahudi dan diwakafkan kepada orang Islam. Ia juga pernah menyumbang unta dan kuda serta perbekalan kepada angkatan jihad Islam. Kemurahan Utsman diikuti oleh sahabat Nabi yang lain, Abdurrahman bin Auf ra, Abu Dahdah ra, dan lain-lain. Apa yang dilakukan para sahabat Nabi itu semata-mata karena Allah SWT, sebab mereka sudah memiliki kesempurnaan iman. Rasulullah pun sudah memberi jaminan kepada mereka sebagai penghuni surga. Iman yang kokoh dan sempurna itulah mereka tidak punya lagi sifat kikir dan cinta dunia. Nikmat yang mereka terima juga terpercik kepada sekelilingnya.


Medan Metropolitan

WASPADA Kamis 24 April 2014

A3

Polsek Medan Barat Tangkap Sembilan Pelaku Kejahatan

Waspada/Ismanto Ismail

KAPOLSEK Medan Barat Kompol Ronny Nicolas, SIK, SH (kanan) didampingi Kanit Reskrim AKP S Sembiring, SH (tiga dari kiri) memperlihatkan barang bukti gunting yang digunakan pelaku saat merampok Indo Maret.

MEDAN (Waspada): Polsek Medan Barat berhasil menangkap sembilan pelaku kejahatan yang terlibat kasus perampokan Indo Maret, pencurian kendaraan bermotor (curanmor) dan penyalahgunaan narkoba. Sembilan tersangka yang ditangkap dalam penyergapan di sejumlah lokasi, Rabu (23/4), terdiri dari AP, 21, penduduk Jln. Rotan, Kel. Petisah Tengah, Kec. Medan Petisah, terlibat kasus perampokan minimarket Indo Maret. Barang bukti yang disita dari tersangka AP berupa sepedamotror Yamaha Vega ZR BK 2032 AAP, uang Rp100.000, gunting dan lainnya. Sedangkan, dua pelaku yang terlibat kasus perampokan Indo Maret, masih dalam pengejaran. Kemudian, tersangka RA, 30, penduduk Jln. Garu III, Kel. Harjosari, Kec. Medan Amplas yang terlibat kasus pencurian sepedamotor. Polisi menyita barang bukti berupa Honda Vario BK 2427 ACQ. Tersangka M, 30, penduduk Jln. Pambon, Lingkungan VII,

Belawan Bahari yang terlibat kasus penyalahgunaan narkoba. Polisi menyita barang bukti 0,1 gram sabu. Tersangka penyalahgunaan narkoba lainnya yakni BY, 38, warga Gg. Masjid, Kel. Rengas Pulau, Kec. Medan Marelan dengan barang bukti 0,1 gram sabu, handphone dan sepedamotorYamahaVegaRBK3479AA. Tersangka MY, 53, penduduk Jln. Khaidir, Kel. Nelayan Indah, Kec. Medan Labuhan dengan barang bukti 0,2 gram sabu, alat memakai sabu. Tersangka IK, 37, penduduk Jln. Jagung, Pasar IV, Kel. Terjun, Kec. Medan Marelan dan PAH, 29, penduduk Jln. Kapten Rahmad Udin, Kel. Terjun, Kec. Medan Marelan dengan barang bukti alat memakai sabu. Kemudian tersangka NMH, 32, penduduk Jln. Sukadame, Gg. Buntu, Kel. Sei Agul, Kec. Medan Barat dengan barang bukti sabu 0,31 gram, timbangan digital, dua handphone dan alat memakai sabu. Tersangka S, 41, penduduk

Jln. Bunga Wijaya Kesuma, Kel. Tanjung Sari, Kec. Medan Selayang dengan barang bukti 0,1 gram sabu, satu amplop ganja, handphone,ratusan plastik kecil untuk bungkus sabu dan lainnya. Tersangka S, 36, penduduk Jln. Yos Sudarso, Kel. Tanjung Mulia, Kec. Medandeli dengan barang bukti lima bungkus sabu. Kapolsek Medan Barat Kompol Ronny Nicolas Sidabutar, SIK, SH didampingi Kanit Reskrim AKP S Sembiring, SH, mengatakan, kasus ini terungkap berkat kerja keras personelnya dalam mengungkap kasus kejahatan yang kian meresahkan masyarakat. Seperti kasus perampokan Indo Maret. Tersangka AP bersama dua temannya (buron) melakukan aksinya pada 20 April 2014. Pelaku masuk ke dalam toko Indo Maret Jln. Yos Sudarso, Kel. Pulo Brayan dan menodong penjaga toko dengan menggunakan gunting. “Pelaku mengambil uang Rp400.000 dan peralatan kosmetik,” jelas Ronny. (m36)

Tiga Remaja Curi Berlian Pasutri Jual Proyek Fiktif Rp175 Juta MEDAN (Waspada): Petugas Polsek Sunggal mengamankan tiga remaja berusia 14 - 15 tahun yang terlibat kasus pencurian berlian senilai Rp20 juta, Rabu (23/4). Seorang diantaranya adalah wanita yang berstatus SMP. Informasi yang diperoleh Waspada di lapangan, ketiga tersangka yang ditangkap yakni tersangka S, 14, (wanita) pelajar SMP tinggal di rumah nenek angkatnya Jln. Kaswari Medan; tersangka D, 15 dan RS, 14, keduanya penduduk Jln. Bunga Raya I yang berstatus putus sekolah. Kasus pencurian berlian itu bermula ketika korban Andaria (nenek angkat tersangka S), pergi ke Sidikalang. Kemudian, tersangka S membuka lemari dan mengambil satu butir berlian dan memberikan barang itu kepada tersangka D dan RS. Setelah itu, ketiga tersangka pergi ke Pasar Kampung Lalang

dan menjual berlian itu seharga Rp2,2 juta. Lalu uang hasil kejahatan itu digunakan untuk makan-makan dan main warnet di Jln. Setia Budi Medan. Kapolsek Sunggal Kompol Eko Hartanto, SIK yang mendapat laporan adanya kasus pencurian berlian itu, langsung menurunkan personelnya. Dari hasil penyelidikan, polisi berhasil mengamankan tersangka S dari rumah nenek angkatnya. “Kemudian, polisi melakukan pengembangan dan menangkap tersangka D dan RS tidak jauh dari kediaman korban. Setelah itu, polisi juga mengamankan pembeli berlian hasil kejahatan itu dari kawasan

Pasar Kampung Lalang,” ujar Eko. Proyek Fiktif Di tempat terpisah, petugas Reskrim Unit Jahtanras Polresta Medan menangkap pasangan suami istri (pasutri) yang diduga melakukan penipuan dengan cara menjual proyek fiktif senilai Rp175 juta. Kedua tersangka ditangkap dalam penyergapan di Jln. Pasar I Gg. Palapa Setia BudiMedan,Selasa(22/4)malam. Tersangka AL dan DA, warga Perumahan Puri Tania, Pasar II Setia Budi Medan diduga sebagai anggota sindikat penipuan modus penjualan proyek fiktif dengan cara menjual nama pejabat di dinas atau instansi tertentu. Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak ketika dikonfirmasi, Rabu (23/4) membenarkan penangkapan itu. “Saat ini keduanya masih menjalani proses peme-

riksaan,” kata Calvijn. Informasi yang diperoleh Waspada di Polresta Medan, kedua tersangka diringkus petugas terkait kasus penipuan dan penggelapan yang menyebabkan korbannya HR Siregar, 50, warga Jln. Menteng Raya Medan mengalami kerugian hingga Rp175 juta. Awalnya, pada Oktober 2013, kedua tersangka bersama abangnya berinisial AL (masih buron) yang mengaku konsultan proyek di Disdik Kota Medan, menjumpai korban di kediamannya. Mereka menawarkan proyek rehabilitasi tujuh sekolah di Medan sambil menunjukkan daftar proyek Disdik Kota Medan. Setelah menjelaskan dan meyakinkan korban terkait proyek itu, tersangka menyampaikan, kalau korban berminat pada proyek itu harus menyerahkan uang Rp250 juta.

Saat itu, tetangga korban, Safaruddin juga meyakinkan bahwa para tersangka bisa mendapatkan proyek tersebut. Setelah mendengar penjelasan tersebut, korban menyerahkan uang sebesar Rp175 juta sebagai panjar. Namun setelah ditunggu sekian lama, kedua tersangka tidak ada lagi menghubungi korban hingga berakhir tahun 2013. Selanjutnya korban melacak ke Disdik Medan ternyata pegawai di sana mengaku tidak mengenal para tersangka. Akhirnya, korban membuat pengaduan ke Polresta Medan dengan nomor LP STPL/618/III/2014/ SPKT Resta Medan tanggal 10 Maret 2014. Kemudian polisi melakukan penyelidikan dan berhasil meringkus kedua tersangka yang bersembunyi di salah satu rumah di Jln. Pasar I Gg. Palapa Setia Budi Medan,Selasa(22/4)sekitarpukul 20:.00. (m36/m39)

Pasca Penggerebekan Kampung Kubur

Polisi Tetapkan Tujuh Tersangka Judi Dan Narkoba

Waspada/Rudi Arman

KASAT Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak menginterogasi para tersangka yang terjaring dalam penggerebekan di Kampung Kubur saat eskpos di Polresta Medan, Rabu (23/4) sore.

MEDAN (Waspada): Pasca penggerebekan Kampung Kubur Jln. Zainul Arifin - Jln. Airlangga, Senin (21/4) sore, kini Polresta Medan menetapkan tujuh tersangka dalam kasus judi dan penyalahgunaan narkoba. “Dari 18 orang yang diamankan dari lokasi, kita telah melakukan pemeriksaan intensif. Hasilnya, tujuh orang ditetapkan sebagai tersangka dalam kasus judi dan penyalahgunaan narkoba,” kata Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak kepada wartawan, Rabu (23/4) sore. Kompol Calvijn menjelaskan, mereka yang dijadikan tersangka yakni RS, HO, AR, CA, AF, MS dan EP dengan barang bukti 25 mesin jackpot, 6 paket sabu, 200 koin jackpot, 30 alat memakai sabu, 100 plastik sabu, 10 bong dan 10 mancis. “Tiga tersangka penyalahgunaan narkoba yakni AF, MS dan EP akan kita serahkan ke Satres Narkoba Polresta Medan untuk penyidikan lebih lanjut. Sedangkan kasus judi, Reskrim

Unit Judi Sila yang menanganinya,” sebutnya. Untuk kasus Kampung Kubur, pihaknya tidak akan bosan terus melakukan penindakan dengan melakukan penggerebekan di lokasi, sampai lokasi tersebut bersih dari peredaran narkoba dan judi. “Saat ini kita masih memburon 6 pemilik rumah yang dijadikan lokasi permainan judi jackpot, dimana para tersangka ditangkap,” jelas Calvijn. Kata dia, Polresta Medan akan memanggil pihak kepling dan kelurahan, kenapa tidak melaporkan ada orang yang membawa masuk mesin jackpot yang cukup besar ke lokasi Kampung Kubur. “Padahal benda seperti mesin jackpot cukup besar dan mustahil tidak ada yang melihat saat masuk ke Kampung Kubur,” katanya. Calvijn menjelaskan, jajaran Reskrim Polresta Medan telah melakukan penggerebekan beberapa kali di kawasan Kampung Kubur. Tanggal 16 November 2013 melakukan penggerebekan dan menetapkan 8 tersangka kasus judi dengan barang bukti 84 mesin jackpot, uang Rp62 ribu, 4.602 koin jackpot, sabu 5 gram. Kemudian 5 Januari 2014 kembali melakukan penggerebekan dan menetapkan 10 orang menjadi tersangka kasus judi dengan barang bukti 61 mesin jackpot, 8.000 keping koin jackpot, senjata air softgun, 15 butir peluru revolver. Selanjutnya, 21 Maret 2014 menggerebek lagi Kampung Kubur dan menetapkan 7 orang menjadi tersangka kasus judi jackpot dengan barang bukti 2.000 koin jackpot, 5 sajam, senpi laras panjang, 10 peluru SS-1, serta terakhir 21 April 2014 menggerebek Kampung Kubur dengan tersangka 7 orang kasus judi dan narkoba dengan barang bukti 25 mesin jackpot, 6 paket sabu, 200 koin jackpot, bong, 100 plastik sabu, dan 10 mancis. Menurut Calvijn, penggerebekan ini sudah kesekian kalinya dilakukan di kawasan Kampung Kubur. Namun, sepertinya belum ada efek jera yang dilakukan oleh oknum bandar judi dan bandar narkobanya. (m39)

Waspada/ME Ginting

PLT Wali Kota Medan Dzulmi Eldin dan Kadispenda H Muhammad Husni (kanan) foto bersama dengan Pimpinan Wilayah PT BRI saat audiensi di Balai Kota Medan, Rabu (23/4).

Pungut Pajak Melalui Program E-Tax MEDAN ( Waspada): PT Bank Rakyat Indonesia (Persero) Tbk menawarkan kerjasama kepada Pemko Medan berupa program E-Tax. Melalui E-Tax, pungutan pajak seperti pajak hotel, restoran, tempat hiburan maupun rumah makan dapat dilakukan secara elektronik sehingga penerimaan pajak bisa diketahui secara langsung setiap hari.Yang lebih menarik, pemasukan daerah dari sektor pajak dapat meningkat dengan menggunakan sistem E-Tax. Demikian dikatakan Pimpinan Wilayah PT BRI Medan Ebeneser Girsang saat audiensi dengan Pelaksana Tugas Wali Kota Medan Dzulmi Eldin di Balai Kota Medan, Rabu (23/4). Tawaran kerjasama ini disampaikan sebagai bentuk komitmen BRI membangun sinergitas sekaligus memberi pelayanan terbaik kepada Pemko Medan. Didampingi sejumlah stafnya, Ebeneser menjelaskan program E-Tax ini telah diluncurkan

di Jakarta. Sejumlah pemerintah daerah telah menerapkan program ini dalam pemungutan pajak, salah satunya Pemerintah Provinsi DKI Jakarta. Hasilnya pemasukan Pemprov DKI Jakarta dari sektor pajak meningkat sampai 30 persen dalam waktu singkat. Jika tawaran ini disetujui, Ebeneser mengatakan, Pemko Medan tidak perlu memikirkan peralatannya. Sebab, BRI akan menyediakan berbagai fasilitas. Apabila ada kekhawatiran rusak maupun dirusak, BRI siap melakukan perbaikan. Namun Ebeneser percaya jika program ini disosialisasikan kepada masyarakat, terutama bagi wajib pajak, maka mereka akan menjaga alat tersebut. “Kami yang akan mensosialisasikannya kepada masyarakat,” ujarnya. Sementara itu, Plt Wali Kota Medan Dzulmi Eldin didampingi Kadispenda Kota Medan H Muhammad Husni menyambut baik tawaran tersebut.

Namun, tawaran itu tidak serta merta langsung diterima karena harus dibahas dan dikaji dulu oleh tim dari Dispenda, Ekbang serta keuangan. “Selain itu, kita akan melihat langsung penggunaan program E-Tax yang telah diterapkan di sejumlah daerah. Kita juga harus menyiapkan peraturan daerah (Perda) agar pelaksanaan program E-Tax ini bisa lebih efektif di tengah masyarakat, terutama bagi wajib pajak karena memiliki payung hukum,” kata Eldin. Mantan Sekda Kota Medan ini optimis para wajib pajak tidak akan keberatan dengan penggunaan program E-Tax. Sebab, seluruh hasil pungutan pajak dikembalikan kepada masyarakat dalam bentuk pembangunan. “Semakin banyak pajak yang diterima, tentu semakin banyak pembangunan yang dilakukan. Jadi saya yakin wajib pajak bisa memahaminya,” ujar Eldin. (m50)

PENGUMUMAN Para Advokat pada Bambang Santoso, S.H. & Partner Law firm, berdasarkan Surat Kuasa Khusus tertanggal 15 Maret 2014 bertindak mewakili Klien Kami NOVA WENNY SITUMEANG untuk mengumumkan hal-hal berikut: 1. Bahwa Klien Kami merupakan salah seorang ahli waris dari Alm. MANGARAJA SITUMEANG, semasa hidupnya Alm. MANGARAJA SITUMEANG memiliki bidang tanah dengan luas ± 4.300 M2 terletak di Jalan Sei Belutu Nomor 17 B Lingkungan XII Kelurahan Merdeka Kecamatan Medan Baru Kota Medan dahulu setempat dikenal dengan Jalan Pasar IX, sesuai dengan bukti surat dan keterangan saksi yang dapat dipertanggungjawabkan. 2. Bahwa semasa hidup Alm. MANGARAJA SITUMEANG dengan niat baik mengijinkan seorang yang masih terdapat hubungan keluarga (namun bukan ahli warisnya) untuk menempati bangunan yang terdapat di atas tanah tersebut, akan tetapi anak dari orang tersebut saat ini mengaku sebagai pemilik tanah dan berusaha terus mendudukinya, serta melakukan penawaran jual-beli kepada beberapa pihak, selanjutnya Klien Kami dan seorang ahli waris lain telah membuat Laporan Polisi Nomor: LP/80/I/2013/SPKT I tanggal 18 Januari 2013 dan Laporan Polisi Nomor: LP/338/III/2014/SPKT I tanggal 17 Maret 2014 di Kepolisian Daerah Sumatera Utara dan muncul dugaan keras terjadinya tindak pidana pemalsuan surat. 3. Bahwa berdasarkan hal tersebut, Klien Kami meminta kepada masyarakat, badan hukum dan instansi pemerintah untuk tidak melakukan atau menerima peralihan hak atau menerbitkan surat yang dapat menimbulkan hak dan surat-surat lainnya terkait dengan tanah tersebut, demi menghindari tuntutan hukum dari Klien Kami. Demikian pengumuman ini disampaikan terima kasih. Medan, 23 April 2014 Hormat Klien Kami

Kuasa Hukumnya dto

dto

Bambang Santoso, S.H., M.H.

Erwin Asmadi, S.H., M.H.

dto

dto

Hashfi Candra, S.H.

Trisno Baskoro, S.H.


Medan Metropolitan

A4

WASPADA Kamis 24 April 2014

DPRD: Audit Dana Medan Sehat MEDAN (Waspada): DPRD Kota Medan meminta Badan Pemeriksa Keuangan (BPK) mengaudit secara terbuka penggunaan dana Medan Sehat sebesar Rp80 miliar yang mengendap di Dinas Kesehatan (Dinkes) Kota Medan. Penggunaan dana tersebut diduga tidak transparan dan tidak diperuntukkan bagi masyarakat. “Dana Rp 80 miliar itu masing-masing Rp50 miliar untuk tahun 2014 dan Rp30 miliar untuk membayar klaim yang tertunggak tahun 2013. Demikian pula dana jasa medis sebesar Rp3,8 miliar juga harus diaudit,” kataWakil Ketua Komisi B DPRD Kota Medan HT Bahrusmyah SH, Rabu (23/4). Menurut Sekretaris Fraksi Partai Amanat Nasional (FPAN),

saat ini banyak rumah sakit provider menolak pasien Medan Sehat dalam mendapatkan pelayanan kesehatan. Alasannya, sudah tidak ada kerjasama lagi dan sulit mengklaimnya ke Dinas Kesehatan. Padahal, kata Bahrumsyah, tidak ada alasan rumah sakit provider menolak pasien Medan Sehat, karena rumah sakit tersebut masih terikat kontrak.

Dia menyebutkan, RS Pelindo dan RS Imelda yang menolak pasien Medan Sehat dan menyarankannya menjadi pasien umum. “Kalau pasien umum sudah pasti membayar.Yang kita takutkan sudah membayar, namun kartu Medan Sehat dipegang pihak rumah sakit kemudian diklaim ke Dinas Kesehatan. Artinya, ada “main” antara rumah sakit dengan pihak Dinkes,” sebutnya. Kondisi ini, menjadi ancaman bagi 350 ribu lebih masyarakat pemegang kartu Medan Sehat. Sebab, hampir setiap hari rumah sakit provider menolak pasien Medan Sehat dan meng-

anjurkan ke BPJS.“Mana mungkin bisa ke BPJS, karena sampai saat ini program Medan Sehat belum berintegrasi ke BPJS,” ujarnya. Menurut dia, hal ini terjadi akibat kelalaian atau ketidakmampuan Dinas Kesehatan dalam melaksanakan APBD. Dinas Kesehatan tidak bertanggungjawab atas anggaran yang telah dibuatnya. “Sebanyak Rp80 miliar dana program Medan Sehat tidak mampu dilaksanakan. Artinya, Kadis Kesehatan tidak mampu melaksanakannya, padahal anggaran yang diajukan berdasarkan estimasi kemampuan. Ini akan menjadi sorotan kita

dalam LKPj nanti,” tuturnya. Bahrumsyah meminta Plt Wali Kota Medan mengevaluasi Kadis Kesehatan Kota Medan, karena kejadian penolakan rumah sakit provider terhadap pasien Medan Sehat sudah berulangkali terjadi dan tidak ada perubahan. Namun, sampai saat ini tidak ada tindakan nyata dari Dinas Kesehatan untuk menindakrumahsakit“nakal”itu. Ditambahkannya, berdasarkan informasi yang diterima, RS Pirngadi Medan kontraknya telah diputus oleh farmasi dan PMI karena tidak mampu membayar sebab tidak bisa mengajukan klaim ke Dinas Kesehatan. (m30)

Pemenang Pemilu Harus Utamakan Rakyat MEDAN (Waspada): Gubsu H Gatot Pujo Nugroho ST, MSi, berharap siapapun nantinya yang secara resmi memenangkan Pemilu 2014, pada akhirnya rakyatlah yang harus diutamakan dan merasakan manfaatnya. “Hakekatnya Pemilu bukan pertarungan kalah atau menang, melainkan menuju format kemanfaatan rakyat. Jadi siapapun yang memperoleh

suara terbanyak Pemilu 2014, masyarakat harus diutamakan,” ujar Gubsu melalui Sekdaprovsu H Nurdin Lubis, SH, MM, pada Diskusi Publik Pemecahan Isu-isu Aktual bertema “Pemilu 2014, Masa Depan Politik Sumatera Utara,” di Kampus USU Medan, Rabu (23/4). Gubsu memaparkan, konsolidasi demokrasi melalui Pemilu adalah untuk kepenting-

Pembunuh Divonis Enam Tahun Penjara MEDAN (Waspada): Terdakwa Rianto Hutabarat, 21, warga Jln. Seser Lk. III, Kel. Amplas Medan, yang melakukan penikaman terhadap korban Ramot Tambunan, 30, warga Jln. Pengilar, Kec. Medan Amplas, hingga tewas divonis enam tahun penjara ,di Pengadilan Negeri (PN) Medan, Selasa (22/4). Dalam sidang putusan tersebut, majelis hakim yang diketuai oleh Marlianis itu menjerat terdakwa Rianto Hutabarat dengan pasal 351 ayat (3). “Mengadili terdakwa Rianto Hutabarat terbukti bersalah secara sah dan menyakinkan telah melakukan kekerasan yang menghilangkan nyawa orang lain dan dijatuhkan hukuman penjara selama 6 tahun,” ujar majelis hakim. Putusan itu lebih ringan 2 tahun dari tuntutan Jaksa Penuntut Umum (JPU) P Siburian yang menuntut terdakwa selama 8 tahun. “Yang meringankan terdakwa karena terdakwa dianggap masih dibawah umur,” sebut majelis hakim. Mendengar putusan tersebut, terdakwa melalui penasehat hukumnya menyatakan pikir-pikir. Begitu juga dengan jaksa yang menyatakan pikir-pikir. Dalam persidangan sebelumnya, terdakwa membantah melakukan penikaman terhadap korban. Dia mengatakan, yang melakukan penikaman itu abang kandungnya Hatoguan Hutabarat (DPO). Terdakwa mengaku hingga saat ini tidak tahu dimana keberadaan Hatoguan Hutabarat. Pasca kejadian itu abangnya langsung melarikan diri. Seperti diketahui, Ramot Tambunan, 30, terkapar bersimbah darah di Jln. Pengilar, Kec. Medan Amplas, pada Sabtu tanggal 19 Oktober 2013 lalu. Korban tewas dengan sembilan tikaman, setelah baku hantam dengan dua pelaku. Warga sekitar melihat Ramot terlibat perkelahian dengan kakak beradik yakni Hatoguan Hutabarat dan Rianto Hutabarat. Ramot yang bersimbah darah sempat dibawa ke RS Ridos beberapa ratus meter dari lokasi keributan. Namun, dia mengembuskan napas terakhir di perjalanan. Di tubuh korban Ramot didapati sedikitnya sembilan bekas tikaman. Sementara itu, Hatoguan segera kabur ke arah Terminal Amplas. Sedangkan adiknya Rianto tetap tinggal dan diamankan polisi ke Polsek Patumbak. (m38)

an bersama menuju kesejahteraan rakyat. Oleh sebab itu, menyikapi pasca Pemilu Legislatif 9 April 2014 yang secara umum berjalan baik dan lancar termasuk di Sumut, hendaklah tetap berpijak pada kepentingan rakyat dan keutuhan NKRI sehingga apapun hasilnya untuk rakyat. Pada forum ilmiah atas kerjasama Program Pasca Sarjana Studi Pembangunan USU dengan Badan Kesbangpol Linmas Sumut ini, tersimpul antara lain konsolidasi pasca Pemilu diperlukan untuk harmonisasi misi Parpol dan pemerintah untuk fokus bekerja menuju peningkatan kesejahteraan masyarakat. Ketua Program Pasca Sarjana Studi Pembangunan USU Prof DR HM Arif Nasution MA mengemukakan, demokrasi adalah pilihan.

Kalau sudah sepakat memilih demokrasi mari laksanakan sungguh-sungguh secara baik. “Demokrasi hakekatnya seyogyanya untuk memperkecil konflik dalam penyelenggaraan berkebangsaan dan berpemerintahan. Namun, jika demokrasi malah menimbulkan banyak konflik, berarti ada yang salah dalam penerapannya. Ini yang harus kita bahas,” ujarnya. Namun dalam membahas demokrasi termasuk pilihanpilihan lainnya, kata Prof Arif, hendaklah benar-benar dilandasi semangat kebangsaan yang tinggi dan tetap dalam koridor Negara Kesatuan Republik Indonesia secara utuh. Kepala Badan Kesbangpol Linmas Sumut Drs H Eddy Syofian MAP melaporkan, dialog dengan masyarakat intelektual ini akan didoku-

mentasikan dalam bentuk buku. Melalui kegiatan seri dialog demokrasi membangun konsolidasi demokrasi diharapkan kualitas indeks demokrasi di Sumut akan lebih baik lagi. Tampil narasumber yakni DR Warjio MA, PhD, HM Hanafiah Harahap, dan Drs Soetarto MSi, dengan moderator Hatta Ridho dihadiri para pakar juga tokoh politik dan tokoh masyarakat di antaranya Prof DR Marlon Sihombing, DR Amir Purba, Sanggam SH Bakkara, Ridwan Hanafiah, dan lainnya. Pada kesempatan ini, Gubsu menyampaikan apresiasi kepada seluruh masyarakat atas terlaksananya secara umum Pemilu aman dan kondusif, serta berharap tahapan selanjutnya dapat berjalan lancar. (m28)

Caleg Laporkan Dugaan Penggelembungan Suara MEDAN (Waspada): Calon anggota legislatif (Caleg) DPRD Sumatera Utara dari Partai Demokrat daerah pemilihan Deliserdang melapor ke Bawaslu Sumut terkait dugaan penggelembungan suara. Laporan tersebut disampaikan oleh Fajar Gusti selaku tim pemenangan Caleg nomor urut 1 Partai Demokrat HM Dahril Siregar, Selasa (22/4). Kata dia, pihaknya keberatan dan menolak hasil penghitungan suara di KPU Deliserdang karena diduga curang dan manipulasi suara sistemik di Kec. Sunggal dan Percut Seituan. Menurut Fajar, perolehan suara di C1 (TPS) dan D1 (PPS) berubah drastis saat di DA1 atau penghitungan di Panitia Pemilihan Kecamatan (PPK). “Untuk Kec. Sunggal, hasil rekapitulasi keseluruhan perolehan suara caleg lain berdasarkan D1 adalah 644. Namun, dalam cetak

hasil pleno di PPK (DA1) Kec. Sunggal yang dibacakan di KPU Deliserdang, menjadi 2511 suara atau terjadi penggelembungan 1867 suara,” ujarnya. Dia menjelaskan, perubahan juga pada Dahril Siregar. Dalam D1 berjumlah 798 suara tapi dalam DA1 menjadi 832. “Bawaslu dan pihak terkait diminta menyikapi persoalan ini sesuai aturan yang berlaku. Kami punya data aslinya,” kata Fajar. Sedangkan. di Desa Bandar Klippa, suara Dahril Siregar berdasarkan data D1 adalah 264, namun dalam plano yang dibaca KPU Deliserdang menjadi 1264, atau bertambah 1000. Perubahan suara, kata dia, juga terjadi di Kec. Percut Seituan. Berdasarkan data D1 suara Caleg nomor 10 PD 89 suara, namun dalam cetak hasil pleno PPK (DA1) yang dibacakan di KPU Deliserdang menjadi 380.

Hal sama juga terjadi di Desa Bandar Klippa, di mana Caleg lain berdasarkan data D1 mendapat 264 suara, tapi dalam DA1 menjadi 1264 suara. “Di Desa Sampali data D1 suara Caleg 45, tapi dalam DA1 PPK yang dibacakan di KPU menjadi 145 suara. Selain itu, Caleg yang memperoleh 68 suara, namun dalam DA1 PPK menjadi 168 suara,” sebutnya. Sementara itu, Komisioner Bawaslu Sumut Aulia Andri mengatakan, pihaknya siap menindaklanjuti laporan tersebut. “Hal semacam ini terjadi di daerah lain di Sumut. Oleh sebab itu harus ada yang bertanggungjawab,” tuturnya. Aulia menegaskan, Bawaslu akan menindaklanjuti persoalan penggelembungan suara di internal partai secara maksimal. Karena, hal itu tidak dibenarkan dalam pelaksanaan Pemilu yang bersih, jujur, dan adil. (m34)

Wagubsu Tandatangani Prasasti Gedung Workshop SMK Assyafiiyah

Waspada/Rudi Arman

KETUA KNPI Kota Medan El Adrian Shah memeriksa kesehatan sebelum mendonorkan darahnya.

KNPI Kunjungi Lapas Wanita Dan Donor Darah MEDAN (Waspada): Dalam rangka memperingati dan memeriahkan Hari Kartini ke 135, DPD KNPI Kota Medan mengunjungi Lembaga Pemasyarakatan (Lapas)Wanita Kelas II A Tanjung Gusta dan kegiatan donor darah, Selasa (22/4). Kegiatan bakti sosial ini merupakan program KNPI Medan, karena pada dasarnya warga binaan juga memiliki kesempatan yang sama untuk menjadi Kartini baru bagi keluarga dan masyarakat setelah menyelesaikan masa hukumannya. “Usai menjalani hukuman, mereka (warga binaan) harus lebih baik dari sebelumnya,” kata Ketua Lembaga Pemberdayaan Perempuan DPD KNPI Medan Hj Rahmanita Ginting MA, PhD, dihadapan ratusan warga binaan Lapas Wanita Tanjung Gusta. Rahmanita datang didampingi sekretaris Dini Hikmayani Nasution, bendahara Siti Rahma, ketua panitia Masyitah dan pengurus lainnya Aswin Jaya, Suhayri Ramadhan, Iwan Suherman, Hendra Novendri Purba, Bambang Eka, Syaiful A Sambas, Rona Pinem, Dewi Kesuma, Mimi Okvitasari, dan Herda. Menurut dia, Hari Kartini merupakan momen bagi seluruh wanita untuk lebih maju, karena perjuangan RA Kartini telah memberi peluang para wanita untuk lebih maju dalam segala bidang khususnya pendidikan dan dunia usaha. Donor Darah Sebelumnya, KNPI Medan melaksanakan donor darah berkaitan dengan hari Kartini di Hotel Grand Serela Hotel Jln. Gatot Subroto Medan, Senin (21/4). Ketua DPD KNPI Medan El Adrian Shah SE, menyampaikan semangat Kartini menginspirasi pemuda untuk memberikan yang terbaik kepada masyarakat dan donor darah merupakan salah satu jawabannya karena sampai saat ini kebutuhan darah masih cukup tinggi. “Dari kegiatan ini terkumpul 50 kantong darah,” sebut El didampingi sekretaris Khairuddin Aritonang, bendahara Aulia Hanif Parinduri, dan pengurus lainnya di antaranya May Hamdani. Dia berharap, pemuda sebagai agen perubahan dan menjadi calon pemimpin bangsa dapat meningkatkan kualitas diri menghadapi tantangan global yang akan semakin berat di masa datang. (m39)

MEDAN (Waspada): Ilmu Pengetahuan, Teknologi, Agama, dan Nasionalis (Imtagnas) merupakan salah satu syarat sebuah bangsa bisa maju. Perkembangan ilmu pengetahuan dan teknologi yang begitu pesat saat ini, menuntut dunia pendidikan harus mampu menyiapkan sumber daya manusia yang handal dan siap pakai untuk bisa bersaing di dalam dunia kerja. Hal itu disampaikanWagubsu HT Erry Nuradi pada acara penandatanganan prasasti pembangunan gedung Workshop dan Memorandum of Understanding (MoU) SMK Assyafiiyah Internasional Medan dengan PT Astra Internasional Tbk dan PT Yamaha Alfa Scorpii, di Perguruan Assyafiiyah Jln. Karya Tani No. 1 Medan, Rabu (23/4). Hadir dalam kegiatan tersebut Kapoldasu diwakili Kabid Binmas Kombes DR H Herry Subiansauri SH, MH, MSi, Ketua MUI Prof Dr H Abdullah Syah

MA, Ketua MUI Kota Medan Prof DR H Mohd Hatta, Konjen Jepang yang diwakili Suzuki, Rektor ITM Prof DR Hilmi Abdullah, Koordinator Service PT Astra Internasional Tbk wilayah Sumatera Utara Suparman, Koordinator PT Yamaha Alfa Scorpii Zainal Arifin, Kepala Dinas Pendidikan dan Muspika Kec. Medan Johor. Kata Wagubsu, Perguruan Assyafiiyah yang baru berusia empat tahun telah menunjukkan kemajuan yang luar biasa. Kerjasama ini diharapkan akan menambah pengetahuan siswa khususnya di bidang teknologi, sehingga siswa SMK Assyafiiyah diharapkan mampu menjadi wirausaha dengan menciptakan lapangan kerja sendiri. Dalam kesempatan itu,Wagubsu menyampaikan terimakasih kepada PT Astra dan Yamaha yang telah memberikan bantuan berupa dukungan teknologi kepada siswa di berbagai SMK di Sumut. “Karena dengan teknologi yang baik, agama yang

baik, dan jiwa nasional, serta kedisplinan yang baik saya yakin kita akan maju dan berkembang, bahkan lebih maju dari negara yang lain,” tuturnya. Ketua Yayasan Assafiiyah Internasional Drs HM Syafii MSi mengatakan, kerjasama ini bertujuan untuk meningkatkan pengetahuan siswa SMK Assyafiiyah dalam bidang teknologi industri otomotif. Dimana dengan ada kerjasama ini diharapkan siswa SMK Assyafiiyah nantinya setelah tamat memiliki keahlian sesuai standar dari PT Astra dan PT Yamaha, sehingga mereka bisa diterima bekerja di berbagai perusahaan otomotif termasuk di PT Astra ataupun PT Yamaha. Sementara itu, Koordinator Service PT Astra Internasional Tbk wilayah Sumatera Utara Su p a r m a n m e n g a t a k a n , pesatnya perkembangan teknologi menuntut dunia pendidikan mampu melahirkan generasi yang handal dan siap pakai. (cwan)

Waspada/Ist

WAGUBSU HT Erry Nuradi disaksikan Ketua Yayasan Assyafiiyah HM Syafii, Kabid Binmas Poldasu Kombes H Herry Subiansauri, Koordinator Service PT Astra Internasional Tbk Suparman, Koordinator PTYamaha Alfa Scorpii Zainal Arifin menandatangani prasasti pembangunan workshop SMK Assyafiiyah, Rabu (23/4).

Waspada/Ismanto Ismail

KAPOLSEK Medan Baru Kompol Nasrun Pasaribu SIK, SH, MH (kanan) didampingi Kanit Reskrim Iptu Alexander P SH (dua kanan) menginterogasi tersangka pencurian dengan modus pecah kaca mobil dan pencurian kaca spion.

Polisi Tabrak Sepedamotor Pencuri MEDAN (Waspada): Petugas Reskrim Polsek Medan Baru menangkap dua pencuri dengan modus pecahkan kaca mobil, setelah menabrak sepedamotor yang dikendarai pelaku di Jln. Ketapang, Sekip Medan. “Dari kedua tersangka yang merupakan residivis berinisial MS, 32, penduduk Jln. Brigjen Katamso, dan T, 43, penduduk Jln. Jambu, Gurupatimpus, disita barang bukti tas berisikan pecahan nikel busi, dompet, handphone, Honda Vario, dan lainnya,” kata Kapolsek Medan Baru Kompol Nasrun Pasaribu SIK, SH, MH, kepada Waspada, Rabu (23/4). Nasrun didampingi Kanit Reskrim Iptu Alexander P SH, mengatakan, kedua tersangka ditangkap pada Selasa (22/4)

malam. Penangkapan itu berawal saat dua personel Reskrim Polsek Medan Baru Aiptu Surya Prayatna dan Brigadir Amril Nasution mengendarai sepedamotor sedang melakukan patroli mengantisipasi aksi kejahatan jalanan dan pencurian sepedamotor. Setiba di Jln. Gatot Subroto dekat toko keramik, kedua petugas itu memergoki dua tersangka mengendarai sepedamotor tanpa memakai helm mendekati mobil pick up yang sedang parkir. Kemudian seorang tersangka mengambil pecahan nikel busi sepedamotor, lalu dilemparkan ke arah kaca pintu depan sebelah kiri mobil itu hingga pecah. Ketika tersangka MS hendak mengambil tas, dua personel

polisi datang mendekati mereka. Kedua tersangka langsung kabur. Petugas terus melakukan pengejaran dan menabrak sepedamotor pelaku hingga sama-sama terjatuh ke aspal. Selanjutnya, kedua pelaku yang sudah berulangkali melakukan pencurian barang dengan modus pecah kaca mobil dan pencurian kaca spion mobil itu ditangkap. Menurut Nasrun, kedua tersangka merupakan target operasi Polsek Medan Baru karena tindak kejahatan mereka cukup meresahkan. “Mereka ini sudah dua sampai tiga kali menjalani hukuman, tapi tidak jera juga,” tuturnya menambahkan, kedua personel Reskrim yang menabrak pelaku juga mengalami luka akibat terjatuh ke aspal. (m36)

Waspada/ME Ginting

PLT Wali Kota Medan Dzulmi Eldin berbincang dengan Dekan FE Unimed Kustoro Budiarta dan dosen FE Unimed Zulkarnai Siregar serta Armin Rahmansyah Nasution saat audiensi di Balai Kota Medan, Rabu (23/4).

FE Unimed Gandeng Pemko Medan Berdayakan UMKM MEDAN (Waspada): Fakultas Ekonomi Universitas Negeri Medan (Unimed) mengajak Pemko Medan memberdayakan Usaha Mikro Kecil Menengah (UMKM) lewat program pengabdian masyarakat yang ada di perguruan tinggi tersebut. Hal itu terungkap dalam pertemuan Dekan FE Unimed Kustoro Budiarta dengan Plt Wali Kota Medan Dzulmi Eldin di Balai Kota Medan, Rabu (23/ 4). Kustoro Budiarta didampingi dosen FE Unimed Zulkarnain Siregar dan Armin Rahmansyah Nasution. Sementara Dzulmi Eldin didampingi Kepala Dinas Koperasi dan UKM Medan Arjuna Sembiring, Kepala Dinas Kebudayaan dan Pariwisata Kota Medan Busral Manan. Kustoro Budiarta mengatakan, keinginan mereka menggandeng Pemko Medan untuk memberdayakan UMKM karena dalam Tri Dharma perguruan tinggi ada disebutkan pengabdian masyarakat. “Jadi, kita melakukan pendampingan pemberdayaan UMKM di wilayah Medan. Selama ini, kita sudah dengar bagaimana Pemko Medan membenahi dan mencari solusi persoalan UMKM. Kita

datang untuk melakukan pendampingan,” jelasnya. Saat ini, menurut Kustoro, Unimed sedang menggalakkan IBW (Iptek BagiWilayah) sebagai salah satu program pemberdayaan masyarakat. “Nantinya, silakan Pemko Medan tetap dengan program pemberdayaannya dan kita datang sebagai pendamping dengan bantuan dari Dirjen Dikti. Jadi, semua bisa sinkron,” kata Kustoro. “Selama ini, Pemko sudah mendorong UMKM untuk maju. Kemudian, kita datang untuk sama-sama mendorong perkembangannya. Artinya, Pemko berjalan dengan program dan pendanaannya. Kita mendampingi dengan program dan pendanaan kita. Jadi, tidak membebani anggaran Pemko,” kata Kustoro sembari menambahkan ada beberapa program yang bisa dikerjasamakan adalah usaha kecil, kemudian wisata kuliner serta industri kerajinan. Sementara, Dzulmi Eldin menyambut baik kedatangan tim FE Unimed tersebut. ���Saat ini, Pemko Medan memang terus mendorong pertumbuhan UMKM di daerah ini. Saya sambut baik. Apalagi ini pro-

gram pemberdayaan sesuai dengan misi perguruan tinggi yang memiliki kepedulian lewat pengabdian kepada masyarakat. Nantinya FE Unimed bisa langsung berhubungan dengan Dinas Koperasi, Dinas Perindustrian serta Dinas Pariwisata,” kata Eldin. Dia mengatakan, persoalan yang dihadapi UMKM itu tidak terlepas dari beberapa hal. Seperti persoalan modal, persoalan SDM, pemasaran dan bahan baku. “Mereka mampu memproduksi tapi tidak tahu kemana harus dipasarkan. Atau mungkin kualitas sumber daya manusia perlu pendampingan, nanti FE Unimed bisa melakukan pembenahan,” harapnya. Menurut Eldin, kedatangan FE Unimed untuk bergandengan dengan pendanaan masing-masing akan membuat sinergi lebih kuat sehingga UMKM di Medan bisa lebih berdaya saing. Di ujung pertemuan tersebut, Eldin langsung menugaskan beberapa kepala dinas agar menghandle tim dari FE Unimed sehingga bisa langsung action. “Kita tidak perlu menunggu karena ini harus langsung ditindaklanjuti,” tuturnya. (m50)

TNI AL Buka Pendaftaran Taruna Dan Caba PK 2014 BELAWAN (Waspada): TNI AL membuka pendaftaranTaruna Akademi Angkatan Laut (AAL) Tentara Nasional Indonesia (TNI) dan calon bintara (Caba) PKTNI AL pria dan wanita tahun2014untukwilayahSumatera Utara, Aceh, dan sekitarnya. Informasi pendaftaran bisa dilihat melalui www.rekrutmentni.ilmci.com dan pendaftaran telah dibuka dan berakhir hingga 3 Mei 2014 di Mako Lantamal 1 Jln. Serma Hanafiah No. 01 Belawan, Medan. “Calon pendaftar bisa datang langsung ke Mako Lantamal 1 atau mengunjungi website kami, pendaftaran ini gratis,” kata Aspers Danlantamal I Kolonel Laut (P) Apri

Suryanta SE, Rabu (23/4). Syarat pendaftaran di antaranya pria dan wanita warga Negara Indonesia, beriman dan bertakwa kepada Tuhan Yang Maha Esa, setia kepada NKRI yang berdasarkan Pancasila dan UUD 45 dan bukan PNS. Usia minimal 17 tahun 9 bulan maksimal 22 tahun tidak berkacamata, tidak bertato, dan mendapatkan surat keterangan berkelakuan baik dari Kepolisian. Calon bisa mendaftar secara online melalui http:// rekrutmen-tni.ilmci.com. Selanjutnya untuk mendapatkan nomor animo serta pemeriksaan fisik dilakukan pendaftaran ulang di Mako

Lantamal 1 Jln. Serma Hanafiah No.01 Belawan, Medan, dengan membawa cetakan formulir pendaftaran dan berkas asli (Akte Kelahiran, Ijazah, SKHUN SD, SLTP, SLTA sederajat, KTP calon, KTP orangtua, KTP dan KK wali bagi yang tidak bertempat tinggal dengan orangtua. “Masing- masing difoto copy 1 lembar, pasphoto hitam putih terbaru/mengkilap ukuran 4x6 sebanyak 2 lembar dan 3x4 sebanyak 1 lembar; dan membawa 2 buah stopmap warna merah untuk Taruna, warna biru untuk Bintara PK Pria, warna kuning untuk Bintara PK Wanita,” ujar Apri Suryanta. (h03)


Medan Metropolitan

WASPADA Kamis 24 April 2014

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight

Pukul

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-280 12 Palembang GA-266 13. Batam GA-270 14. Penang GA-804 15. Pekanbaru GA-276 16. Tanjungkarang GA-270

05.20 09.05 11.00 12.20 13.25 14.05 17.00 18.35 20.35 09.40 10.45 06.00 10.25 10.55 06.00 10.25

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Palembang Batam Penang Pekanbaru Tanjungkarang

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-143 GA-281 GA-267 GA-271 GA-805 GA-277 GA-271

08.00 08.55 10.15 11.20 13.05 16.00 17.30 19.35 22.10 12.35 19.05 15.45 18.00 13.20 08.45 18.00

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Bangkok 9 Bandung 10 Surabaya 11 Bandung 12 Penang 13 Pekanbaru 14 Singapura 15 Kuala Lumpur

QZ-8050 06.20 QZ- 8054 17.40 AK- 1351 08.00 AK-1355 17.55 QZ-8072 14.25 AK-1581 18.45 AK-1357 21.20 QZ-8084 14.15 QZ-7987 08.45 QZ-7611 13.15 QZ-7981 17.10 QZ-8078 06.25 QZ-8028 11.30 QZ-664 07.45 QZ-8052 13.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Penang Pekanbaru Singapura Kuala Lumpur

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-1580 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8079 QZ-8029 QZ-665 QZ-8053

08.30 10.55 07.35 17.00 16.35 18.30 21.05 16.40 11.30 09.55 19.55 08.35 12.50 10.35 15.55

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT-207 JT- 301 JT-395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.40 08.05 13.35 2010 18.00 20.40 19.30 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.05 17.20 17.50 19.45 10.25 15.55 09.20 18.25. 21.05 22.20 23.50 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur

MH-861 MH-865 NH-841

09.40 15.45 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur

MH-860 MH-864 MH-840

08.50 15.00 06.15

SILK AIR 1 Singapura 2 Singapura 3 Singapura

MI-233 MI-237 MI-235

08.40 20.35 13.15

Singapura Singapura Singapura

MI-234 MI-238 MI-236

07.35 19.50 12.20

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang 9 Jakarta

SJ-021 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021 SJ-017

13.15 15.55 16.50 10.20 17.20 12.50 07.20 16.00 08.05

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang Jakarta

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020 SJ-016

18.10 16.20 14.55 11.50 15.45 14.20 09.50 14.10 17.20

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

10.45

Jakarta

RI-093

08.55

MANDALA AIRLINE 1 Singapura RI-861

Tiba Dari

Flight

Pukul

Jadwal Perjalanan Kereta Api No KA

U28 A U30 A U32 A U34 A U27 A U29 A U31 A U33 A U37 A U38 A U39 A U40 A U41 A U42 A U43 A U44 A U35 A U36 A U45 A U46 A U47 A U48 A U49 A U50 A U51 A U52 A U53 A U54 A U55 A U56 A U57 A U58 A U59 A U60 A

Nama KA

SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SIREKS SIREKS PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA

Kelas

Dari

Tujuan

EKS/BISNIS BISNIS EKS/BISNIS EKS/BISNIS EKS/BISNIS EKS/BISNIS BISNIS EKS/BISNIS EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI

MEDAN MEDAN MEDAN MEDAN RANTAU P RANTAU P RANTAU P RANTAU P SIANTAR MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TEBING T MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN

Berangkat

RANTAU P RANTAU P RANTAU P RANTAU P MEDAN MEDAN MEDAN MEDAN MEDAN SIANTAR MEDAN TANJUNG MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TEBING TINGGI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI

07.47 10.17 15.44 23.03 07.52 14.58 17.18 23.13 08.08 14.30 07.50 06.49 13.06 13.11 19.36 17.33 05.42 18.44 05.46 05.02 07.14 06.30 09.15 08.30 12.18 10.00 13.53 13.09 16.49 14.37 19.00 18.16 21.40 20.56

Datang

13.56 15.46 22.02 04.38 14.04 10.17 22.55 04.47 11.54 18.24 12.54 11.11 18.01 17.45 00.29 22.24 07.42 20.57 06.15 05.31 07.43 06.59 09.44 08.59 12.47 10.29 14.22 13.38 17.18 15.06 19.29 18.45 22.09 21.25

JMSU Tolak Pemimpin Pro Asing MEDAN (Waspada): Jam’iyatul Mu’allimin Sumatera Utara (JMSU) menyatakan menolak pemimpin nasional yang pro asing. “Kepemimpinan nasional ke depan haruslah orang yang memiliki komitmen memperjuangkan kepentingan umat Islam, nasionalis, dan punya sikap tegas. Bukan orang yang ditunggangi kepentingan asing,” tegas Ketua JMSU Ustadz Ahmad Muttaqin Nasution kepada wartawan di Medan, Rabu (23/4). Dia menekankan, umat Islam harus kompak dalam memilih pemimpin nasional, yakni orang yang tidak bisa didikte pihak asing. Karena, jika itu terjadi maka sama saja dengan “menjual” negeri ini kepada pihak asing. Itu berarti bahwa kepentingan-kepentingan nasional bakal terpinggirkan. Pihaknya menilai, pertemuan salah seorang yang disebut calon presiden dan partai pendukungnya dengan Dubes Vatikan, Dubes Amerika Serikat serta beberapa perwakilan negara asing menjelang Pemilu presiden, merupakan bentuk nyata sikap yang pro-kepentingan asing di Indonesia. “Umat Islam harus jeli menilai hal-hal seperti ini,” katanya. Karena itu, dia mengimbau umat Islam untuk menyadari siapa calon pemimpin yang pro asing. Umat Islam harus mem-

berikan dukungan kepada calon presiden dan wakil presiden yang dipandang dapat memperjuangkan kepentingan umat. “Pada Pemilu presiden dan wakil presiden mendatang, Jam’iyatul Mu’allimin Sumatera Utara akan mengajak kaum Muslimin menolak pemimpin yang lebih mementingkan kepentingan asing di Indonesia. Dia menjelaskan, momen Pemilu yang dilaksanakan lima tahunan merupakan momen peralihan kekuasaan yang tidak lepas dari berbagai kepentingan yang “menyusup”. Karenanya, umat Islam haus ikut ambil bagian agar kepentingan umat dapat terakomodir dalam jalannya pemerintahan yang akan datang. “Kesadaran umat harus dibangun bahwa untuk menjadi seorang Muslim yang patuh kepada Tuhan, juga mesti peduli

pada perkembangan lingkungan di sekitarnya. Dengan terbangunnya kesadaran akan hidup sosial bermasyarakat, dan bernegara, maka umat akan sampai pada kesamaan kepentingan, yakni kepentingan umat Islam itu sendiri,” katanya. Pada bagian lain dia menyatakan bersyukur kepada Yang Maha Kuasa, bahwa pelaksanaan Pemilu legislatif 9 April lalu berjalan dengan aman dan lancar, walaupun masih ditemukan berbagai permasalahan. Muttaqin juga berpesan kepada para anggota legislatif terpilih untuk bersikap amanah dan tetap memperjuangkan kepentingan rakyat. “Siapapun yang mendapatkan kursi dan menjadi anggota legislatif, baik di tingkat daerah maupun pusat, semoga nuraninya senantiasa menyadari bahwa sebagai wakil rakyat harus selalu memperjuangkan kepentingan rakyat,” katanya. Sebagai orang beriman, mereka juga harus berusaha melakukanyangterbaik,karenasedang mengemban amanah yang kelak akan dimintai pertanggungjawabannya di hadapan Sang Pencipta. “Sifat amanah ini salah satu yang akan membawa bangsa ini menjadi lebih baik ke depan,” katanya. (m07)

Perampok Gembos Ban Diamuk Massa MEDAN (Waspada): Polsek Medan Kota mengamankan tersangka perampok dengan modus mengembosi (kempes) ban mobil di Jln. Juanda, Medan, Rabu (23/4). Tersangka berinisial Ak, 45, warga Jln. Utama, Kel. Kotamatsum, Medan Area, sempat dihajar massa hingga babak belur. Kapolsek Medan Kota Kompol PH Sinaga melalui Kanit Reskrim AKP Faidir Chaniago kepada wartawan mengatakan masih melakukan pengembangan kasus itu. “Tersangka melakukan perampokan bersama temannya yang masih diburon. Identitasnya sudah diketahui, saat ini masih kita lacak,” kata Faidir menduga tersangka salah satu komplotan perampok dengan modus kempes ban yang kerap beraksi di Kota Medan. Persitiwa itu terjadi Rabu sekira pukul 08:00. Tersangka Ak dan rekannya berinisial Y membuntuti mobil Toyota Avanza dikendarai Sri Rafiko, 40, warga Jln. Kelambir V, Tanjung Gusta, dengan sepedamotor matic BK

2002. Saat tiba di Jln. Juanda tidak jauh dari jembatan Sei Deli, ban belakang kanan mobil dikendarai korban kempes sehingga berhenti. Saat itu, korban turun melihat kondisi bannya. Kemudian kedua tersangka mendekat dan membuka pintu depan mobil untuk mengambil tas korban. Namun, pintu mobil terkunci, sehingga tersangka Ak langsung memecahkan kaca mobil. Mendengar suara kaca pecah dan melihat dua tersangka berada di samping mobilnya, korban langsung berteriak sehingga mengundang perhatian warga. Karena warga datang mendekat, tersangkaY yang berada di sepedamotor langsung kabur, dan tersangka Ak ditangkap kemudian dipukuli hingga babak belur. Dia sempat dibawa petugas ke RSU Bhakti Jln. HM Joni, Medan untuk pengobatan luka di kepala dan wajahnya, kemudian dimasukkan ke sel Polsek Medan Kota. Sementara tersangka membantah mengikuti mobil kor-

ban. Dia mengatakan, perampokan itu dilakukan secara spontan. “Kebetulan kami melihat mobil berhenti di jalan, kemudian timbul niat merampok tas yang ada di depan mobil,” ujarnya. Dia juga mengaku tidak punya pekerjaan tetap setelah dipecat dari perkebunan di Sosa, Padanglawas tiga bulan lalu. “Saya butuh uang menghidupi empat anak saya, terpaksa merampok,” sebutnya. Atas kejadian itu, korban mengalami kerugian sekira Rp3 juta karena kaca mobilnya dipecah. Sementara tas milik korban berisi HP dan lainnya, termasuk paku yang dimodifikasi untuk kejahatan itu diamankan petugas sebagai barang bukti. “Barang bukti paku yang dimodifikasi untuk mengempeskan ban sama dengan kasus perampokan di Jln. Suprapto beberapa waktu lalu. Kami menduga ada keterkaitan dengan kasus itu, dan masih diselidiki,” kata Faidir Chaniago.(m27)

PT. Michelin Indonesia Rilis Produk Baru Di Medan MEDAN (Waspada): PT Michelin Indonesia memperkenalkan inovasi terbaru dengan merilis produk terbaru yaitu Michelin X Coach Energy Z di Medan, Rabu (23/4). Produk ini diluncurkansejalandengankebutuhan terhadap ban radial di Indonesia yang terus meningkat. Michelin X Coach Energy Z merupakan generasi terbaru dari lini ban bus berpenumpang atau kendaraan besar. Country Director Michelin Indonesia Jean-Charles Simon mengatakan, peluncuran Michelin X Coach Energy Z merupakan bagian dari komitmen untuk memberikan mobilitas lebih baik dan lebih aman bagi pelanggan di Indonesia, terutama untuk segmen bus penumpang. Dituturkannya, pertumbuhan ekonomi Indonesia cukup konsisten sekitar 5 persen - 6 persen setiap tahun, dimana pertumbuhan masyarakat kelas

menengah di Indonesia telah meningkat selama beberapa tahun terakhir ini. Karena itu, infrastruktur menjadi sangat penting dalam meningkatkan mobilitas dan kemampuan untuk saling terkoneksi. “Kami melihat bahwa ban radialmenjadisangatpentingbagi pasarIndonesia.Dengansemakin meningkatnya infrastruktur dan kebutuhan akan transportasi, tentu dibutuhkan ban yang dapat mengurangi biaya operasional melalui efisiensi BBM serta memberikan tingkat keamanan yangtinggi.Banradialmerupakan pilihan tepat untuk kebutuhan tersebut,” ungkapnya. Sementara itu, Marketing ManajerVictor Daniel menuturkan, di Indonesia, kebutuhan akan ban radial untuk segmen bus penumpang lebih meningkat dibandingkan di segmen bus dan truk lainnya, yaitu 11,16 persen. Jika dilihat tahun 2013,

secara umum, pangsa pasar ban radial sekitar 16 persen. Tahun 2019, diperkirakan meningkat hingga 28 persen. Sementara pangsa pasar ban radial melalui Original Equipment (OE) diperkirakan mencapai 14,6 persen, meningkat tajam dari tahun 2013 sebesar 3,5 persen. “Sebagai pelopor ban radial dan memperkenalkannya pertama kali ke pasar tahun 1946, Michelin merupakan perusahaan yang terbaik untuk mengakomodasi pertumbuhan segmen ban yang berkembang ini,” ujarnya. Victor menjelaskan, keselamatan merupakan nilai utama yang telah berakar dalam DNA produk Michelin dan tidak dapat dikompromikan. Dengan menggunakan Michelin X Coach Energy Z pengemudi dan penumpang dapat menikmati perjalanan yang aman dan semakin menyenangkan. (h02)

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu

Kuala Namu- Medan

No. KA

No. KA

Berangkat

Tiba KNIA

Berangkat KNIA Tiba Medan

U62 04:00 04:37 U61 05:05 06:50 U2A 04:50 05:27 U65 07:33 08:15 U4A 06:15 06:52 U1A 08:00 08:46 U6A 07:16 07:53 U3A 09:05 09:49 U8A 08:20 08:57 U5A 09:25 10:10 U10A 09:10 09:47 U7A 10:20 11:07 U12A 10:40 11:17 U9A 11:50 12:37 U14A 11:10 11:47 U11A 12:25 13:09 U16A 12:10 12:47 U13A 13:25 14:12 U18A 13:45 14:22 U15A 14:55 15:42 U20A 14:15 14:52 U17A 15:30 16:14 U22A 15:15 15:52 U19A 16:25 17:12 U24A 16:45 17:22 U21A 17:55 18:42 U26A 17:15 17:52 U23A 18:30 19:14 U66 18:15 18:52 U25A 19:56 20:40 U68 19:17 19:54 U67 20:40 21:17 U70 20:01 20:38 U69 21:15 21:59 U72 21:10 21:57 U71 23:30 00:07 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)

A5

Waspada/Mursal AI

COUNTRY Director Michelin Indonesia Jean-Charles Simon (kanan) bersama Marketing Manajer Victor Daniel (kiri) dan Product Marketing A. Abikaryono saat peluncuran Michelin X Coach Energy Z di Medan, Rabu (23/4).

Waspada/Risky Rayanda

AKSI DAMAI: Ratusan kader dan simpatisan Prabowo Subianto menggelar aksi damai di Bundaran Majestik, Rabu (23/4).

HIPMASU Gelar Aksi Damai Mencari Figur Pemimpin Yang Berani MEDAN (Waspada): Untuk menciptakan bangsa yang disegani dunia dan menjadi macan di Asia, perlu keberanian dan karakter yang kuat dari seorang pemimpin. Sebab, faktor ini sangat penting dalam menjalani roda pemerintahan. Hal itu disampaikan Syahrial S. Hasugian saat melakukan orasi pada aksi damai yang digelar ratusan kader dan simpatisan Prabowo Subianto jadi Presiden Republik Indonesia yang tergabung dalam Himpunan Pemuda/i Masyarakat Sumatera Utara (HIPMASU) di Bundaran Majestik, Rabu (23/4). “Menjadi pemimpin yang berani bukanlah suatu hal yang mudah dilakukan. Tidak semua pemimpin memiliki keberanian dalam menjalankan tugasnya. Keberanian dimaksud yakni berani mengambil keputusan yang berisiko, berani tampil dengan prestasi dan prestise, berani menata dan mengelola institusi sesuai tujuan yang diharapkan serta berani menjalankan tugas dengan amanah,” ujar Koordinator Lapangan Syahrial S Hasugian. Jika tidak dilakukan saat ini, lanjut Syahrial, maka beban bangsa ini semakin berat, utang anak cucu semakin menumpuk. “Berbagai jenis watak manusia yang telah memimpin bangsa ini tidak juga membawa Indonesia lepas dari

belenggu kemiskinan, ketidaksetaraan, ketidakadilan, kekayaan terus dikeruk oleh bangsa asing, namun tidak memberi manfaat kepada masyarakat Indonesia,” ujarnya. “Sudah saatnya bangsa Indonesia bangkit, sudah saatnya kita menentukan pilihan untuk Indonesia yang lebih maju dan sejahtera dan sudah saatnya kita merasakan arti kemerdekaan sesungguhnya,” ujar Syahrial. Karena itu, lanjutnya, HIPMASU menyatakan mendukung penuh Prabowo Subianto Djoyohadikusumo menjadi Presiden Republik Indonesia. “Inilah saatnya pemuda harus aktif, pemuda harus turut serta melakukan perubahan terhadap bangsa ini dengan bersikap positif dan jangan hanya diam saja,” tambah Syahrial. Sementara itu, penanggungjawab aksi Octo Gabriel Simangungsong, SH menyatakan, aksi damai yang digelar ratusan pemuda/i yang tergabung dalam HIPMASU merupakan luapan emosi generasi muda yang risau melihat kondisi bangsa Indonesia. “Dalam hal ini, kita mendukung penuh apa yang menjadi luapan emosi pemuda/i dalam mencari figur pemimpin yang mereka nilai mampu membawa bangsa Indonesia menjadi macan asia,” ujar Octo. (m38)

Polisi Deteksi Keberadaan DPO Penggelapan Rp10 M MEDAN (Waspada): Polresta Medan telah mendeteksi keberadaan DPO tersangka Haryanto Tukimin yang terlibat kasus penipuan dan penggelapan uang jual beli pabrik kelapa sawit (PKS) senilai Rp10 miliar. “Sudah kita deteksi keberadaan Haryanto Tukimin dan anggota masih memburunya,” kata Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak, Rabu (23/4). Namun Kompol Calvijn belum bisa memberitahukan keberadaan tersangka apakah terdeteksi di Kota Medan atau di wilayah Indonesia atau sudah di luar negeri. Dijelaskannya, Polresta Medan telah mengeluarkan surat DPO untuk tersangka Haryanto Tukimin dengan nomor DPO/540//IV/2014/ Reskrim, April 2014 karena yang bersangkutan menghilang saat akan diserahkan ke Jaksa.

Sebelumnya, tersangka mendapat penangguhan penahanan setelah ditangkap Reskrim Unit Ekonomi Polresta Medan dari kediamannya pada 9 Desember 2013. Beberapa hari menjalani penahanan, yang bersangkutan mengajukan penangguhan dan mendapat persetujuan. Menurut informasi di Polresta Medan, setelah dikeluarkannya DPO terhadap Haryanto Tukimin, Polresta Medan membentuk tim guna melacak keberadaan yang bersangkutan dan sudah disebar ke beberapa tempat yang dicurigai menjadi lokasi persembunyiannya. Tersangka ditangkap dengan tuduhan melakukan penipuan dan penggelapan pembelian pabrik kelapa sawit (PKS) yang merugikan korbannya dr. Hari Gunawan Tandianus dan Jeff Evan Tandianus, keduanya beralamat di Jln. Bengkulu, Kel. Pandau Hilir, Kec. Medan Kota. (m39)

Datumheim Luncurkan Sistem Penyimpan Data Secara Online MEDAN (Waspada): Datumheim akan meluncurkan sistem penyimpanan data pasien secara online, aman dan terpercaya pada Jumat (25/4) dan Sabtu (26/4) di Gedung MIC Center Jln. Gagak Hitam/Ringroad Medan. Penyimpanan data ini di bawah lisensi Microsoft yang memiliki proteksi terbaik dunia saat ini. Keberadaan perusahaan yang bergerak di bidang database online ini, sangat berguna bagi kalangan rekam medis maupun sebagai fungsi data terintegrasi ke segala hal yang menyangkut dunia medis. Karena itu, Datumheim memiliki slogan ‘Masa Depan Dunia Medis.’ Datumheim juga memiliki produk DMC (Doctor Message Care). Dengan program SMS ini, bisa menambah pengetahuan masyarakat tentang medis. Dengan adanya DMC ini, masyarakat bisa mendapatkan info medis langsung melalui SMS saja, sehingga dalam situasi darurat, info tersebut dapat diakses melalui SMS dan mengurangi tingkat buta medis. Sistem ini dapat dibuka secara online melalui

internet dengan alamat DatumHeim.com yang bisa di log in bagi membernya. Dokter ahli bidang fisiologi dr. M. Azhari mengatakan, demi mewujudkan ilmu pengetahuan yang terarah dan terintegrasi dengan kemajuan teknologi informasi, maka tugas seorang dokter umum dan dokter spesialis akan semakin mudah. “Karena itu, Datumheim membuat suatu sistem kesehatan menjadi terintegrasi dengan bidang lain. Kalau suatu negara menerapkan sistem ini, maka negara tersebut tergolong negara maju di bidang medis. Dan produk ini merupakan revolusi bagi dunia medis, karena kita akan menuju era perdagangan bebas,” katanya. Sedangkan dosen FKG USU drg. Rini Octavia mengatakan, program ini sangat baik bagi para sejawat medis baik umum maupun gigi, bahkan masyarakat luas terutama bagi pemilik RS maupun klinik bisa mendapatkan manfaatnya. “Saya kira sudah saatnya dunia medis berkolaborasi dengan IT,” ujarnya. (h02)

Caleg Gerindra Harus Jujur, Berani Dan Bukan Pencuri MEDAN (Waspada): Adanya oknum yang diduga mencuri suara calon legislatif (Caleg) lain di partai sendiri (internal partai) demi untuk duduk di dewan, tentunya ini bukanlah kader partai yang baik. “Kalau ini dibiarkan akan menjadi bias dan citra buruk bagi partai,” kata Bagus, saksi dari Partai Gerindra Kota Medan kepada wartawan, Rabu (23/4). Bagus menyatakan keberatannya karena diduga salah seorang Caleg Partai Gerindra dari daerah pemilihan (Dapil) 3 mencakup Kec. Medan Baru, Medan Helvetia, Medan Petisah, dan Medan Barat diduga melakukan pengelembungan suara dari suara partai yang diarahkan ke salah satu caleg tertentu. “Makanya, kami melakukan protes ke KPU Kota Medan agar dilakukan penghitugan ulang atau membuka formulir C1 yang ada di beberapa kecamatan, semua itu bertujuan agar caleg tersebut tidak seenaknya saja mengambil suara partai yang diarahkan kepada oknum caleg tertentu,” sebut Bagus. Diterangkannya, sebagaimana amanah Ketua Dewan Pembina Partai Gerindra Prabowo Subianto jangan pilih pemimpin pembohong. Dari bahasa itu dapat ditafsirkan, Caleg DPRRI, DPRD Sumut, dan DPRD kabupaten/kota

tidak boleh berbohong dan pencuri. Mengutip pernyataan Ketua DPC Gerindra Kota Medan Boby Octavianus, Bagus menekankan agar Caleg yang tidak peduli kepada masyarakat dapat dilakukan pergantian antar waktu (PAW). Kata Bagus, kalau ada oknum tertentu yang diduga mencuri suara partai untuk bisa duduk di kursi DPRD Kota Medan, tentunya ini merupakan catatan penting bagi Ketua DPC Gerindra Kota Medan. Jika diperlukan mengambil tindakan tegas terhadap Caleg yang melakukan pencurian suara di beberapa kecamatan yang masuk dalam daerah pemilihannya. Hal yang sama juga dikatakan Dedek Sofian Marlisa, saksi Partai Gerindra. Kata dia, dugaannya suarapartaiGerindrajugadiambilolehsalahseorang Caleg DPRD Sumut dari Dapil Sumut 2. Menurut Dedek, suara Calegnya yang hilang terjadi di daerah Kec. Medan Marelan. Hal ini diketahui dari data D1 dan DA1. Pencurian suara ini bertujuan untuk mendongkrak raihan suaranya agar bisa duduk di kursi DPRD Sumut. Dia mengakui, suara yang diraih oknum Caleg itu tidak signifikan dan suara partai yang diambil berkisar 1170. “Melihat realita di lapangan seperti ini sangat tidak baik bagi Partai Gerindra,” kata keduanya. (m30)


Nusantara

A6

WASPADA Kamis 24 April 2014

Waspada/Surya Efendi

Waspada/Surya Efendi

DUA anak berusaha melintasi jembatan gantung sungai Deli dalam kondisi miring dikarenakan tali baja putus sebelah, Rabu (23/4).

PEKERJA sedang memperbaiki jembatan gantung yang putus talinya, Rabu (23/4). Jembatan yang menghubungkan Kec. Medan Marelan dengan Kec. Medan Labuhan ini putus sehari sebelumnya yang menyebabkan 7 orang kecebur.

Tali Jembatan Gantung Raja Lama Labuhan Putus BELAWAN (Waspada): Hubungan antar kelurahan, Kel.Labuhandeli dan Kel. Pekanlabuhan, Kec. Medan Belawan, terkendala setelah tali jembatan gantung Raja Lama yang menghubungkan dua kelurahan tersebut putus Selasa (22/4) pagi. Rabu (23/4) pagi, Plt.Wali Kota Medan meninjau jembatan tersebut dan menginstruksikan Dinas PU Kota Medan segera memperbaiki. Pantauan Waspada Rabu(24/4), jembatan yang mem-

bentang di Sungai Deli menghubungan Lingk. 11 Kel. Labuhandeli dan Lingk. 7, Kel. Pekanlabuhan, menjadi urat nadi bagi warga di sana.Bahkan, setiap hari jembatan tersebut menjadi akses utama warga dan anak sekolah. Informasi Waspada peroleh, peristiwa itu terjadi saat tiga kereta dikendarai Afrizan Ananda dan Safrudin, seorang lagi belum diketahui namanya melintas. Tiba- tiba jem-batan oleng dan tak lama kemudian badan jembatan miring, sehingga pengendara itu dan empat penumpangnya tercebur ke dalam

sungai.Tali jembatan putus. Hingga Rabu, belum ada tanda-tanda jembatan diperbaiki. Tetapi, kereta mereka tersangkut di tali dinding jembatan. “Mereka semua selamat karena pandai berenang. Sedangkan kereta kami tarik bersama- sama,” kata seorang warga. Tujuh orang yang jatuh dalam peristiwa itu selamat dan hanya mengalami luka ringan setelah terjebur ke sungai. “Korban luka mendapat perobatan dari klinik. Hal ini juga sudah kita laporkan ke Wali Kota dan berharap segara diperbaiki,” kata Lurah

Labuhandeli Masitai. Sementara itu, Yanis, warga sekitar me-ngatakan, awalnya jembatan itu dibangun secara swadaya oleh masyarakat pada tahun 1981. Saat pemerintahan Abdillah renovasi dilakukan terhadap talinya.Renovasi papan jembatan dilakukan pada masa kepemipinan Rahudman Harahap tahun 2009. “Titi ini sangat penting bagi kami karena menjadi penyeberangan utama bagi anak-anak mau sekolah,” kata Yanis. (h03)

Pedofil Bunuh Diri Pernah Mengajar Di JIS JAKARTA (Waspada): Polda Metro Jaya tengah melakukan penyelidikan terkait korban pedofil yang bunuh diri William James Vahey ,64, karena yang bersangkutan pernah bekerja sebagai pengajar di Jakarta International School (JIS). “Kita sedang mencari apakah ada korban selama dia bekerja di Indonesia sebagai pengajar di JIS sekitar tahun 1999 sampai 200-an,” kata Kabid Humas Polda Metro Jaya Komisaris Besar Polisi Rikwanto di Ma-

polda Metro Jaya, Rabu (23/4). Menurut Rikwanto, semua informasi sedang dikumpulkan atas ttindakan kekerasan seksual terhadap anak yang dilakukan William, termasuk mencari informasi kasus-kasus lama yang dimungkinkan untuk dibuka kembali. Pria asal South Carolina, Amerika Serikat, dinyatakan pernah menjadi buronan FBI sehingga patut diwaspadai setiap keberadaannya atau dimana menjadi tempat tinggalnya seperti di London, Teheran Iran dan Madrid.

“Di setiap negara itu pelaku diduga melakukan pelecehan seksual terhadap muridnya. Jadi patut diwasapadai,” terang Rikwanto. JIS Konsultasi Dengan UNESCO Jakarta International School mengkonsultasikan perizinan operasional sekolah ke Komisi Nasional Indonesia untuk Badan Pendidikan PBB (UNESCO) setelah TK JIS ditutup sementara oleh Kementerian Pendidikan dan Kebudayaan. ”Tadi bertemu dengan Pak Arief Rahman (Komisi Eksekutif

Proyek e-KTP Rugikan Negara Rp1,12 Triliun JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) telah menghitung kerugian sementara dari proyek penerapan Kartu Tanda Penduduk (KTP) berbasis nomor induk kependudukan secara elektronik tahun anggaran 2011-2012 di Kementerian Dalam Negeri (Kemendagri). Dugaan kerugian sementara yang dihitung dari hasil penyelidikan yang kemudian dinaikkan ke penyidikan itu sekitar Rp1,12 triliun,” kata Juru Bicara KPK Johan Budi SP di Kantor KPK, Jakarta, Rabu (23/4). Menurut Johan, penyidik menduga ada penggelembungan harga (mark-up) dalam proyek e-KTP. Salah satunya, kata Johan, terkait harga satuan pengadaan e-KTP. Johan Budi menambahkan, anggaran pengadaan proyek eKTP diberikan dalam dua termin yakni untuk tahun 2011 dan 2012. Total nilai anggaran, kata Johan, mencapai ýRp6 triliun. “Anggaran 2011 sekitar dua koma kemudian 2012 tiga koma berapa triliun. Jadi dua anggaran ini sekitar enam triliun,” ungkap Johan. Geledah Ruang Kerja Mendagri Komisi Pemberantasan

Korupsi telah menggeledah sejumlah tempat untuk mencari barang bukti dugaan korupsi pada pengadaan e-KTP, kemarin. Salah satu tempat yang digeledah adalah kantor Kementerian Dalam Negeri di Jakarta Pusat. “Termasuk juga ruangan kerja menteri dalam negeri (Gamawan Fauzi),” kata Johan Budi. Sementara tempat lain yang digeledah adalah kantor Direktorat Jenderal Kependudukan dan Catatan Sipil di Kalibata serta kantor PT Quadra Solution, Kuningan. Kedua kantor ini berada di Jakarta Selatan. Dari penggeledahan tersebut, penyidik menyita sejumlah dokumen, baik dalam bentuk kertas maupun elektronik. Menurut Johan, hari ini, penyidik melanjutkan penggeledahan di kantor Direktorat Jenderal Kependudukan dan Catatan Sipil. Saat ditanya apakah KPK akan memanggil Gamawan untuk mengonfirmasi barang sitaan itu, Johan belum bisa memastikan. “Tapi, kalau penyidik membutuhkan keterangan Mendagri, ya dia akan kami panggil,” katanya. Segera Periksa Mendagri Johan mengatakan, KPK

Komisi KNI UNESCO). Pertemuan itu untuk minta konsultasi, nasihat dan apa yang seharusnya dilakukan agar JIS bisa beroperasi kembali,” kata Kepala Sekolah JIS Tim Car di Jakarta, Rabu (23/4). Pertemuan dua pihak tersebut dilakukan di salah satu gedung di kawasan Kemendikbud. Sementara itu, orang tua siswa yang bersekolah di JIS, Dino Vega, mengharapkan dengan konsultasi itu dapat memberikan masukan kepada sekolah internasional tersebut mengenai langkah yang perlu

diambil agar bisa menggelar kembali pendidikannya. Dino yang datang berdua mendampingi Car mengatakan JIS sangat berharap sekolah tersebut kembali beroperasi seperti sedia kala meski belakangan lembaga pendidikan tersebut ternyata tidak mengantongi ijin dari Kemdikbud untuk penyelenggarakan pendidikan taman kanak-kanak. ”Saya sebagai orang tua murid mendukung apa yang dilakukan oleh JIS dan kami coba memfasilitasi pembukaannya kembali,” kata dia.(j02/ant)

Efektivitas Vaksinasi Meningitis 70 Persen

segera memanggil Menteri Dalam Negeri Gamawan Fauzi. “Jika perlu keterangan Pak Mendagri dimintai juga. Saksi bisa dari pihak BPK, pemeriksaan saksi-saksi dalam waktu dekat ini lah,” katanya. “Saya jelaskan, kemarin itu tidak hanya dua tempat yang digeledah terkait dengan e KTP, tapi ada beberapa tempat,” kata Johan. Menurut Johan, penyidik melakukan penggeledahan di PT Quadra Solution di Menara Duta Jl. HR Rasuna Said Kavling B 9 Jakarta Selatan, Kantor Ditjen Dukcapil Jalan TMP Kalibata, Jakarta Selatan dan Kementerian Dalam Negeri. “Pertama kantor Ditjen Dukcapil, kedua di PT Qudara Solution, penggeledahan juga di Kemendagri termasuk ruang Menteri Dalam Negeri,” terangnya. Sementara, Sugiharto dikenakan dalam pelanggaran Pasal 2 ayat 1 subsidair Pasal 3 Undang-undang Nomor 31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi sebagaimana diubah dengan Undang-undang Nomor 20 tahun 2001 juncto Pasal 55 ke-1 juncto Pasal 64 ke-1 KUHPidana.(j02/vn/oz)

JAKARTA (Antara): Vaksinasi meningitis adalah cara terbaik mencegah orang terkena penyakit meningitis dan mengurangi risiko penyakit meningitis sampai 70 persen. “Efektivitasnya sekitar 70-80 persen, namun ini tergantung pada sistem kekebalan masing-masing orang,” ujar dokter Divisi Alergi Imunologi Klinik, Departemen Ilmu Penyakit Dalam RSCM Iris Rengganis dalam kampanye meningitis di Jakarta, Rabu (23/4). Iris menyebut vaksinasi ini sangat dianjurkan untuk orangorang yang akan bepergian ke wilayah atau negara dengan endemik atau memiliki kasus meningitis. ”Paling lambat 10-14 hari sebelum tiba di negara tujuan karena antibodi akan terbentuk dua minggu setelah penyuntikan,” kata dia. Direktur Jenderal Pengendalian Penyakit dan Penyehatan Lingkungan, Kementerian Kesehatan RI, Tjandra Yoga Aditama mengamini dengan berkata, “Untuk memastikan perlindungan yang optimal, Pemerintah telah mengesahkan penggunaan vaksin konjugat quadrivalent untuk mencegah penularan dari empat serogroup varian meningitis.” Keempatnya adalah A,C,Y dan W-135 yang disebuit Tjandra dianjurkan untuk pelancong dan calon mahasiswa sebelum bepergian ke luar negeri, khususnya negara-negara endemis. Menurut dia, pemberian vaksin juga dapat dilakukan atas permintaan negara tujuan dan sementara itu vaksin meningitis dapat diperoleh di kantor kesehatan pelabuhan laut dan udara. Meningitis adalah penyakit yang disebabkan infeksi bakteri meningokokus yang menyerang selaput otak dan sumsum tulang belakang. Infeksi bisa terjadi karena peradangan akibat virus dan bakteri pada selaput tersebut. Penyakit ini ditularkan melalui kontak langsung dengan penderita atau paparan cairan tubuh penderita meningitis. Saat ini diketahui sejumlah negara menjadi endemis meningitis meningokokus, yakni Australia, Amerika Serikat, Arab Saudi, Gambia, Ethiopia, Guinea-Bissau dan Kenya.

Antara

PENUTUPAN TK JIS: Petugas Keamanan bersiaga di gerbang Jakarta Internasional School (JIS) di Pondok Indah, Jakarta Selatan, Rabu (23/4). Kemendikbud akhirnya mencabut izin operasional pengajaran untuk TK atau pendidikan anak usia dini (PAUD) di sekolah tersebut, menyusul kasus kekerasan seksual yang dialami murid sekolah tersebut.

Gerindra Habiskan Rp434 Miliar Di Pemilu Legislatif JAKARTA ( Waspada): Partai Gerindra menghabiskan dana sebesar Rp434 miliar selama kampanye Pemilu Legislatif (Pileg) 9 April 2014 lalu. Hal itu terlihat dari laporan penerimaan dan pengeluran dana mereka ke Komisi Pemilihan Umum (KPU), Rabu (23/4). “Jumlah total penerimaan sendiri sekitar Rp435 miliar yang berasal dari sumbangaan perseorangan, badan usaha, dan calon anggota legislatif (caleg),” kata Bendahara Umum Partai Gerindra Thomas Djiwandono di Kantor KPU. Thomas mengatakan dana sebesar itu digunakan untuk iklan di berbagai media, seperti televisi dan media cetak. Selain, uang juga dipakai untuk membiayai logistik, pertemuan terbatas, dan lain sebagainya.”Laporan keuangan ini adalah laporan penerimaan dan pengeluaran dana kampanye Partai Gerindra untuk 11 Januari 2013-17 April 2014,” ujar dia. Thomas mengklaim Gerindra akan terbuka

dalam pelaporan keuangan mereka. Partai yang dipimpin oleh Prabowo Subianto itupun siap menjalani proses audit keuangan yang akan dilakukan oleh KPU melalui kantor akuntan publik yang sudah ditunjuk. Sebelumnya, KPU mengingatkan peserta Pemilu 2014, baik partai politik ataupun calon anggota Dewan Perwakilan Daerah (DPD), untuk melaporkan penerimaan dan pengeluaran dana kampanye terakhir mereka. KPU menetapkan batas akhir dari pelaporan itu paling lambat 15 hari sesudah hari/tanggal pemungutan suara yang jatuh pada 24 April 2014 pukul 18.00 WIB. Laporan kali ini merupakan ketiga kalinya setelah yang pertama pada 27 Desember 2013, dan kedua pada 2 Maret 2013 yang lalu. Sedangkan, format laporannya adalah partai politik melampirkan para caleg mereka. Semntara anggota DPD melampirkan laporannya secara terpisah. (vn)

Nasdem Laporkan Dana Kampanye Rp277 Miliar JAKARTA ( Waspada): Partai Nasdem melaporkan pengeluaran dana kampanye mereka sebesar Rp277.461.232.504 ke Komisi Pemilihan Umum (KPU), Rabu (23/4). Nasdem mengklaim total pemasukan mereka termasuk barang dan jasa sebanyak Rp277.615.341.328. “Jumlah caleg yang melaporkan 556 dari 559. Sisanya ada beberapa orang tidak aktif dan dari awal tidak melaporkan.Yang nggak melapor cuma tiga. Yang baru masuk M Zachbiddin,” kata Ketua Badan Pemenangan Partai Nasdem Ferry Mursidan Baldan. Ferry menuturkan total saldo akhir rekening dana kampanye partainya saat ini sebesar Rp154.108.824. Menurutnya, per 17 April 2014 sudah tidak ada lagi transaksi keluar. “Kalau ada dokumen yang diperlukan, pasti kami akan serahkan nanti menyusul. Kami akan menyusun

itu,” ujar dia. Ferry melanjutkan pengeluaran paling banyak adalah untuk pembuatan alat peraga seperti kaos dan bendera yang mencapai Rp173 miliar. Sedangkan, untuk sumbangan caleg sendiri tercatat Rp173.585.221.393. Dia menegaskan rinciannya sudah tertuang di dalam laporan tersebut. “Ini akan disampaikan sebagai bagian akuntabilitas partai. Sebagai partai baru tidak boleh menggunakan dana terlarang. Sumber pasti tidak dari yang tidak jelas. Enggak boleh dari asing, itu dana terlarang,” imbuhnya. Selanjutnya, mantan anggota DPR Fraksi Partai Golkar ini mempersilakan KPU mengaudit laporan keuangan mereka sebagaimana ketentuan yang berlaku. Nasdem, kata dia, akan menunggu hasil audit dari KPU tersebut.(vn)

Pemain Timnas U-19, Reza Fahlevi Maldini Sitorus Diundang Bupati Sergai PERBAUNGAN (Waspada): Pemain Tim Nasional (Timnas) U-19 bernama lengkap Reza Fahlevi Maldini Sitorus,16, warga Lingk.Tempel, Kel.Simpang Tiga Pekan, Kec.Perbaungan Kab.serdang Bedagai diundang Bupati Sergai Ir.H.Soekirman, Rabu (23/4) ke rumah dinas Bupati di komplek Sawit Indah Kel.Batang Terap, Kec.Perbaungan. Reza merupakan putra bungsu dari 4 bersaudara dari pasangan Chairul Saleh Sitorus, 54, staf di Kelurahan Simpang Tiga Pekan, Kec. Perbaungan, sedangkan ibu kandungnya Latifah Hanum br Hasibuan, 50, PNS dan bertugas sebagai pengajar di SDN 101931 Perbaugan. Kedatangan Anggi panggilan akrab Reza Fahlevi Maldini Sitorus yang tercatat sebagai siswa SMKN I Pantaicermin seusai mengikuti ujian susulan UN didampingi ayahnya Chairul Saleh Sitorus, Kadis Pendidikan Sergai Drs.Joni W Manik MM, Kabid Dikmenjur, Drs.Janter Siregar, Kabid Sarana dan Prasarana, Dharma Eka Subakti SPd, Kepala SMKN I Pantai Cermin, Drs. BE Sipayung langsung disambut Bupati Sergai Ir.H.Soeakirman. Atas nama masyarakat Kab.Sergai khususnya Bupati Soekirman mengaku bangga atas prestasi yang dicapai Reza yang berhasil menjadi salah satu pemain Timnas U-19 yang memperkuat Tim Garuda Muda dibawah asuhan pelatih Indra Sjafri. “Prestasi yang telah dicapai tidak terlepas dari bimbingan dan dorongan orang tua serta kerja keras Reza, semoga debut Reza di Timnas U-19 mampu menjadi pelopor bangkitnya sepak bola di Kab.Sergai serta mampu membangkitkan gairah pemuda Sergai sehingga akan lahir Reza-Reza lainnya yang mampu mengharumkan nama kampung halaman, Kab. Sergai, Provinsi Sumut dan mengharumkan nama bangsa Indonesia, masyarakat Sergai sepenuhnya mendukung dan mendoakan Reza meraih prestasi puncak”, ketus H.Soekirman.

Pemkab Sergai kata Bupati, saat ini giat bekerja sama dengan panitia Forum Pemuda Pelopor Nasional guna mencari Pemuda Pelopor di berbagai bidang termasuk Pemuda Pelopor di bidang olah raga. Sementara itu Reza didampingi orangtuannya mengisahkan sejak kecil telah mewarisi bakat ayahnya yang juga seorang pemain bola mengawali karir awal bergabung di Sekolah Sepak Bola (SSB) Attagana Kel.Batang Terap Kec.Perbaungan yang sebelumnya sempat menjadi anak didik SSB Rafael Perbaungan. Tahun 2012 masuk seleksi PSDS Junior dan berhasil masuk tim inti yan selanjutnya mengikuti kejuaraan piala Suratin berhasil menjuarai Sumut dan Sumbagut. Ia juga memperkuat tim PSDS untuk Piala Suratin di Bekasi sebagai top score dengan mengoleksi 9 gol dan menjadi pemain harapan. Anggi kemudian mendapat peluang mengikuti seleksi pemain PSSI U-17 di Free Ford Timika, Irian Jaya selama satu bulan dan sempat gagal, beberapa bulan kemudian kembali mendapat kesempatan seleksi piala FC U-19, namun belum berhasil hingga akhirnya kembali mendapat kesempatan mengikuti seleksi pemain untuk menghadapi piala Asia hingga akhirnya berhasil dan bergabung dengan Timnas U-19. Anggi mengaku hanya bisa bersyukur kepada Allah SWT atas prestasi yang telah dicapai dan mengucapkan terima kasih kepada semua pihak yang telah mendukungnya selama ini terlebih kepada PSSI, hingga akhirnya dirinya bisa bergabung dalam Timnas U-19 untuk membela negara tercinta. Sementara itu Kadisdik Sergai Drs. Joni W Manik MM, keluarga besar Dinas Pendidikan Sergai memberikan apresiasi atas prestasi yang dicapai Reza.Pihaknya akan terus mendukung dan berdoa perjuangan Reza menuju prestasi puncak. Dalam kunjungan tersebut Bupati Sergai, Ir.H.Soekirman. memberikan uang saku kepada Reza Fahlevi Maldini Sitorus. (c03)

Waspada/Edi Saputra

BUPATI Sergai Ir. H. Soekirman didampingi Kadisdik Sergai, Drs.Joni W Manik MM, Kabid Dikmenjur, Drs.Janter Siregar MM, Kabid Sarana, Dharma Eka Subakti SPd menyerahkan uang saku kepada Reza Fahlevi Maldini Sitorus disaksikan ayahnya, Chairul Saleh Sitorus, Rabu (23/4) dirumah dinas Bupati di Perbaungan.


Nusantara

WASPADA Kamis 24 April 2014

A7

Soal Capres: Posisi PD Lemah JAKARTA (Waspada): Pengamat politik dari UI Effendi Gazali menegaskan jika Partai Demokrat (PD) akan tetap mengajukan capres dengan koalisi dengan partai tengah misalnya PAN, PKB, PKS dan lainnya, posisinya tetap akan lemah, karena tak ada tokoh yang akan dicapreskan sekuat Jokowi dan Prabowo. Karena itu, Susilo Bambang Yudhoyono (SBY) harus melakukan langkah cepat dengan melakukan koalisi dengan capres yang sudah ada untuk menyelamatkan konvensi itu sendiri.

“Jadi, konvensi capres PD yang akan ditutup dengan perdebatan pada 27 April itu, tak banyak manfaatnya, maka SBY harus berani melakukan koalisi sebelum partai-partai berkoalisi. Tanda-tandanya harus ada sekarang ini tanpa harus mengukur elektabilitas peserta konvensi capres. Lalu, akan dipasangkan dengan siapa?” tandas Effendi Gazali dalam dialog kenegaraan ‘Posisi konvensi Partai Demokrat di tengah dinamika koalisi’ bersama Ketua DPD RI Irman Gusman, Ketua DPP PD Andi Nurpati dan direktur eksekutif Indo-

Barometer Muhammad Qodari di Gedung DPD/MPR RI Jakarta, Rabu (23/4). Sedangkan Andi Nurpati menyatakan, Partai Demokrat masih akan melanjutkan debat konvensi Capres sampai 27 April 2014 mendatang sekaligus sebagai penutupan perjalanan konvensi capres PD selama ini. Lalu, akan kemanakah hasil konvensi akan diarahkan? PD bisa berkoalisi dengan tiga capres yang sudah ada seperti Prabowo Subianto, Jokowi, Aburizal Bakrie dan atau mengusung capres sendiri dengan berkoalisi dengan partai-partai

Di Daerah Yang Ada Kecurangan UN

Kemdikbud Siapkan Perlakuan Khusus JAKARTA (Waspada): Kementerian Pendidikan dan Kebudayaan (Kemdikbud) bersama pihak Perguruan Tinggi Negeri (PTN) akan memberi perlakuan khusus terhadap nilai-nilai UN di daerah-daerah yang terbukti melakukan kecurangan. “Akan ada perlakuan khusus. Tapi masih akan menunggu hasil investigasi kecurangan UN yang dipimpin olehWamendikbud Bidang Pendidikan,” kata Kepala Badan Penelitian dan Pengembangan, Kemdikbud Furqon saat dihubungi di Jakarta, Rabu (23/4). Saat ini investigasi baru memasuki tahap awal, sehingga belum banyak hal yang dapat dilaporkan. Bahkan tim investigasi belum sampai pada tahap mencocokkan antara jawaban yang diduga bocor, dengan kunci jawaban asli. “Tim belum melakukan pencocokan jawaban,”ungkap Furqon. Furqon juga menilai belum saatnya memutuskan apakah akan diadakan UN ulang atau tidak. Keputusan tentang UN ulang harus dikaji dari berbagai perspektif. Dan apapun hasil investigasi, akan diinformasikan kepada panitia Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN). Seperti diberitakan, kecura-

ngan UN telah terjadi di Surabaya, Jawa Timur dan Karanganyar, Jawa Tengah. Menurut Rektor Universitas Negeri Yogyakarta (UNY) RochmatWahab, hal itu membuktikan bahwa kebocoran soal UN sebagai fakta yang tidak bisa dimungkiri. Fakta ini yang membuat bobot nilai antara satu sekolah di daerah satu dengan yang lain menjadi berbeda. “Nilai sembilan di tempat yang longgar atau kompromi tidak sama dengan tempat yang jujur. Kan bisa saja, tempat yang jujur bobotnya lebih tinggi,” kata Rochmat. Hal ini pula yang membuat Rochmat berpendapat PTN harus merumuskan kembali pembobotan nilai UN antar daerah. Mengingat mulai tahun ini, nilai UN akan dimasukkan ke dalam sistem penilaian seleksi masuk PTN. Meski begitu, Rochmat mengatakan akan tetap mengacu pada kesepakatan para rektor terkait keputusan ini. Pihak rektor, kata Rochmat, akan melihat apakah mayoritas pelaksanaan UN terkendali dengan baik. “Akan ada pertemuan lagi para rektor untuk menentukan apakah nilai UN mau dipakai atau tidak, atau dipakai tapi ada koreksi berapa potongannya,” ungkapnya.

Secara teknis, kata Rochmat, hal analisis tersebut masih mungkin dilakukan. Biasanya dengan memasukkan faktor nilai rapor. “Rata-ratanya bagaimana di rapor. Misalnya nilai rata-rata 7,5. Kok ternyata di UN rata-rata 10 kan janggal,” paparnya. Tapi sampai saat ini, Majelis Rektor Perguruan Tinggi Negeri (MRPTNI) masih setuju bahwa nilai UN akan tetap digunakan dalam formula penilaian di sistem seleksi masuk PTN. Terkait informasi tentang kebocoran UN, Sekretaris SNMPTN, Bambang Hermanto mengatakan, pimpinan PTN tentu akan menunggu hasil evaluasi Balitbang Kemdikbud atas hasil UN. “Kita masih menunggu investigasi Kemdikbud, apa benar-benar yang ditemukan di beberapa daerah itu adalah kebocoran UN?” Kata Bambang. Dia menyatakan, nilai UN bukan satu-satunya variabel penentu seorang siswa masuk atau tidak dalam PTN yang diidamkannya. “Ada banyak variabel yang diperhitungkan agar seorang pendaftar SNMPTN dapat lulus di program studi yang diminatinya, salah satunya memang UN. Tapi rapor siswa juga ikut menentukan,”kata Bambang.(dianw)

yang suaranya cukup untuk mengajukan capres-cawapres. “Mengingat hasil pemilu 9 April tak ada partai yang bisa mengajukan capres-cawapres sendiri, maka secara realistis harus berkoalisi dengan partai lain. Lalu, kemana arah hasil konvensi diarahkan? Sikap itu akan ditentukan setelah 27 April nanti ketika konvensi capres PD ditutup. Bahwa komunikasi politik sudah berlangsung baik selama ini dengan berbagai politik yang ada,”katanya. Andi Nurpati menegaskan jika konvensi yang digelar PD selama ini merupakan mekanisme terbaik dalam menjaring capres-cawapres, di mana sistem itu sangat berbeda dengan hanya menunjuk capres dan cawapres yang dilakukan oleh partai lain, meski harus dikembalikan ke partai masing-masing. “Mekanisme konvensi itu dilakukan ketika SBY tak lagi bisa nyapres kembali meski elektabilitasnya tinggi,” tambah mantan anggota KPU itu. Peserta konvensi capres Partai Demokrat yang juga Ketua DPD RI Irman Gusman menegaskan jika konvensi capres yang digelar oleh PD harus ada akhirnya dan juga harus ada

hasilnya. Sebab, konvensi itu sudah berjalan dengan baik, dan baru di Indonesia karena PD mengakomodir figur dari luar partai. Tentu, itu sangat demokratis dan egaliter di tengah tumbuhnya oligarki dan dinasti politik akhir-akhir ini. “Saya ikut konvensi capres PD yang dilakukan oleh Presiden Susilo BambangYudhoyono itu karena merupakan terobosan baru dan memberikan peluang baru bagi tokoh dari luar PD. Ini untuk menciptakan terwujudnya pemilu yang dialogis, dan bukan hanya pawai, ramairamai, arak-arakan massa dan sebagainya,” tegas Gusman. Khusus menyinggung konvensi, menurut Irman Gusman yang terpilih kembali sebagai caleg DPD RI dari daerah pemilihan Sumatera Barat ini, dirinya lebih percaya hasil konvensi daripada hasil survei, karena dalam konvensi itu terjadi pertarungan gagasan untuk membangun bangsa dan negara, dan bukan hanya berdasarkan pendapat atau pilihan masyarakat yang berdasarkan citra, seperti dilakukan dalam survei selama ini. “Jadi, saya lebih percaya hasil konvensi daripada survei,” tutur Irman. (j07)

Peluang Bagi Kader Muda JAKARTA (Waspada): Ketua DPP Golkar Yorrys Raweyai mengatakan, ia bersama kader Golkar lainnya akan mendorong Rapat Pimpinan Nasional (Rapimnas) Khusus Golkar dalam waktu dekat sebagai ajang evaluasi kepemimpinan Aburizal Bakrie (ARB), termasuk tentang masa depan pencapresan ARB dan menyangkut musyawarah nasional luarbiasa (munaslub). Yorry mengatakan sejumlah kader Golkar yang dinilai bisa menggantikan ARB. “Kader senior seperti Agung, Fadel dan Priyo Budi Santoso yang saat ini menjabat sebagai Wakil Ketua DPRRI, sangat berpeluang jadi ketua umum Partai Golkar yang baru. Golkar harus beri peluang 85 persen bagi kader muda untuk memimpin,” pungkasnya pada diskusi yang diselenggarakan FFH, “Menebak Arah Angin Parpol Hadapi Pilpres 2014: Di antara Pesimis dan Realistis” di Jakarta, Rabu (23/4). Yorrys juga mengakui suara Golkar yang kecil membuat Golkar sulit bernegosiasi soal koalisi. “Saya punya hak bersuara dan meminta pertanggungjawaban ARB dan Bapilu Partai Golkar,” katanya. Sementara pakar politik Universitas Pelita Harapan (UPH) Emrus Sihombing mengatakan seharusnya Golkar mengusung cawapres untuk partai lain. “Dengan mengusung cawapres maka dapat mengamankan posisinya di dalam pemerintahan, ujarnya. Perolehan suara Golkar yang hanya sekitar 14 persen, tidak mencapai targetnya sebesar 30 persen. Makanya, ARB harus legowo untuk tidak mencalonkan diri menjadi presiden dan mengajukan kader potensial untuk maju. (aya)

Mulai 9 Mei, Seluruh Kegiatan Operasional AirAsia Pindah Ke Terminal KLIA 2 KPK Tak Boleh Tetapkan Tersangka S E PA N G ( Wa s p a d a ) : dahan operasional ke terminal KLIA 2, dimana hal ini akan AirAsia, maskapai penerbangan berbiaya hemat terbaik di dunia, mulai 9 Mei 2014 akan memindahkan kegiatan operasional penerbangan dari Low Cost Carrier Terminal (LCCT) ke terminal baru Bandara Internasional Kuala Lumpur (KLIA 2). Demikian siaran pers AirAsia yang diterima Waspada pada Rabu (23/4), dimana AirAsia telah melakukan berbagai persiapan yang diperlukan guna mendukung perpindahan operasional tersebut, sejalan dengan ketentuan di dalam Operational Readiness and Transfer (ORAT) yang mencakup antara lain uji coba airside dan operasional secara keseluruhan. Dengan dukungan yang telah diberikan oleh Malaysia Airport Holding Berhad (MAHB), AirAsia percaya dapat memenuhi ketentuan ORAT untuk memfasilitasi perpin-

baru tersebut. Adapun ORAT adalah metodologi kom-prehensif yang diterapkan guna memastikan kesiapan operasional infrastruktur bandara sejak awal hingga seterusnya. ORAT berfokus pada proses konstruksi dan tahap penyelesaian sebuah proyek, serta menyediakan keahlian yang diperlukan agar operasional berjalan sukses dan tepat waktu. Pada kesempatan ini, Grup AirAsia juga mengapresiasi pemerintah Malaysia, khususnya Perdana Menteri Malaysia YAB Datuk Seri Najib Razak, yang telah melibatkan International Civil Aviation Organization (ICAO) dalam mengevaluasi KLIA 2 dan menjamin aspek keselamatan serta keamanan jangka panjang di terminal bandara tersebut. AirAsia sangat menantikan perpindahan ke terminal baru

menjadi sebuah tahap baru dalam perkem-bangan bisnis maskapai. Konsep pelayanan terbaik yang ditawarkan oleh terminal KLIA 2 dan juga AirAsia dapat berkontribusi terhadap pertumbuhan industri aviasi serta meningkatkan pariwisata dan beberapa sektor industri terkait lainnya. Melalui terminal state-ofthe-art yang akan mulai beroperasi bulan Mei mendatang, AirAsia akan tetap beroperasi secara efisien sesuai dengan model bisnis maskapai yaitu low cost namun tetap menawarkan pelayanan optimal kepada seluruh pelanggan. AirAsia akan menginformasikan perpin-dahan ini kepada seluruh pelanggan guna memastikan proses transisi operasional yang mulus ke terminal KLIA 2.(j02)

Didasari Pertemuan Tertutup

JAKARTA (Waspada): Anggota Komisi III DPR RI membidangi hukum dari Fraksi Partai Keadilan Sejahtera (PKS) Fahri Hamzah mengharapkan langkah Komisi Pemberantas Korupsi (KPK) untuk menetapkan seseorang sebagai tersangka tidak boleh didasarkan pertemuan terbatas dan tertutup yang tidak tunduk kepada prosedur dalam hukum acara pidana dan prosedur hukum yang berlaku dan disahkan. Sebab kalau tidak, akan memunculkan dugaan lain yang menjadi motif keputusan KPK, ujar Fahri di Jakarta, Rabu (23/ 4) terkait dengan adanya dugaan masyarakat bahwa keputusan menjadikan tersangka mantan Dirjen pajak dan Ketua Badan Pemeriksa Keuangan (BPK) Hadi Poernomo (HP) berkait dengan kasus pajak PT BCA bermotif politik. KPK, menurut Fahri, harus menjelaskan secara terbuka dan jelas dasar-dasar dan langkah-langkah yang diterapkan sehingga penetapan HP sebagai tersangka tidak terkait audit BPK atas kasus Bank Century dan audit BPK kepada kinerja KPK. Dia menekankan hal ini memang penting karena KPK memiliki kewenangan yang lebih, dan kalau tidak diawasi ketat akan dapat disalahgunakan. “Perlu dicatat bahwa pertanggungjawaban yang paling penting disebutkan dalam UU KPK No. 30 tahun 2002,” tandasnya. Fahri berpendapat KPK tidak boleh menggunakan metode jurnalisme dalam upaya mencari kebenaran materil. (aya)

Waspada/Andy Yanto Aritonang

TANPA dihadiri Ketua Umum Suryadharma Ali , Wakil Ketua Umum PPP, Emron Pangkapi, yang diangkat sebagai Plt Ketua Umum bersama Sekretaris Jenderal PPP Romahurmuziy menggelar konfrensi pers usai membuka. Mukernas III PPP di Cisarua-Bogor, Rabu (23/4).

SDA: PPP Belum Koalisi Dengan Gerindra JAKARTA (Waspada): Ketua Umum DPP Partai Persatuan Pembangunan (PPP) Suryadharma Ali (SDA) meng-akui dukungannya kepada calon presiden dari Partai Gerakan Indonesia Raya (Gerindra) Prabowo Subianto masih bersifat pribadi dan bukan keputusan resmi partai secara kelembagaan. SDA mengakui bila dirinya berkeinginan agar PPP mendukung Prabowo. Hanya saja keinginan itu harus diformalkan sesuai mekanisme organisasi di PPP. “Sesungguhnya belum ada koalisi antara PPP dengan Gerindra. Walaupun saya sebagai ketua umum begitu dekatnya dengan Prabowo jalan ke sana-ke mari, tapi secara formal dan resmi belum,” katanya usai per-temuan internal dengan Ketua Majelis Syariah DPP PPP Maimoen Zubair beserta jajaran PPP sebelum pelaksanaan

Musyawarah Kerja Nasional (Mukernas) III PPP, di Hotel Seruni, Cisarua Bogor, Rabu (23/4). Saat ditanya bagaimana hal itu akan dikomunikasikan dengan Prabowo, SDA mengatakan secara pribadi akan berbicara langsung dengan mantan Komandan Pasukan Khusus itu. “Itu nanti saya jelaskan ke Prabowo,” ucapnya. Dalamkesempatanituiajuga menyebutkan bahwa KH. Maimoen Zubair meminta posisi ketua DPP tetap dijabat olehnya, sedangkan posisi Sekjen DPP PPP tetap dipegang oleh Romahurmuziy. Sementara itu Wakil Ketua Umum DPP PPP, Suharso Manoarfa, Ketua DPW PPP Jawa Barat Rahmat Yasin dan sejumlah kader yang sempat dipecat oleh SDA, kini dikembalikan ke posisinya semula. “Saya mohon maaf pada

masyarakat Indonesia, pada umat Islam yang merasa terganggu dengan perbedaan pendapat, semuanya adalah dinamika yang biasa,” ujarnya. Sebelumnya, Ketua Majelis Syariah DPP PPP KH Maemoen Zubair telah mengeluarkan fakta bahwa saat ini partainya belum berkoalisi dengan partai mana pun, termasuk Partai Gerindra yang sebelumnya telah mendapat dukungan dari kubu Ketua Umum DPP PPP Suryadharma Ali. Sementara itu, Sekretaris Jenderal PPP Romahur-muziy mengapresiasi sikap SDA yang akan menjelaskan permasalahan itu secara pribadi. Menurutnya, masalah koalisi itu memang bukan masalah partai sehingga harus diselesaikan secara pribadi. “Itu memang wewenang Pak Suryadharma secara pribadi,” ujarnya. (aya)

Warga Pujakesuma Diharapkan Aktif Sukseskan Pilpres MEDAN (Waspada): Ketua Umum Paguyuban Keluarga Besar (PKB) Pujakesuma Pusat, Komjen (Purn) Drs Oegroseno, SH, mengucapkan terima kasih kepada seluruh warga Puja-kesuma yang telah berpartisipasi aktif mensukseskan Pemilu Legislatif 9 April 2014, baik dengan cara menggunakan hak pilihnya maupun dengan ikut mengamankan penyelenggaraan Pileg. “Mensukseskan Pemilu 2014 merupakan salah satu rekomendasi Rakernas Pujakesuma 9-10 Februari 2014 lalu. Terima kasih kepada semua warga Pujakesuma,” ujar Oegroseno, di Jakarta, kemarin. Oegroseno juga mengajak semua warga Pujakesuma untuk menghormati apapun hasil dari pemilu legislatif tersebut. Jika kemudian terdapat perbedaan pandangan, diharapkan diselesaikan sesuai aturan yang ada. Kepada warga Pujakesuma yang menjadi caleg dan berhasil lolos menjadi anggota legislatif, Oegroseno mengucapkan selamat dan berharap dapat mengemban amanah tersebut sebaik mungkin. Sedangkan kepada warga Pujakesuma yang belum berhasil menjadi anggota legistilatif, Oegroseno berharap tidak putus asa namun tetap semangat

Waspada/Ist

KETUA Umum PKB Pujakesuma Pusat, Komjen (Purn) Drs Oegroseno, SH bersama Sekjen Pujakesuma Choking Susilo Sakeh (kiri) dan H Idrus Djunaidi dalam pertemuan di Jakarta, pekan lalu. untuk mengabdi kepada bangsa dan Negara. Parade Ketoprak Dor Oegroseno juga menjelaskan rencana menggelar Parade Ketoprak Dor di Medan seusai Pilpres. Salah satu rekomendasi Rakernas Pujakesuma 2014, ujar Oegroseno, pengurus wilayah provinsi dan pengurus daerah kab/kota diwajibkan membina atau menjadi bapak asuh satu grup kesenian Jawa. Parade Ketoprak Dor ini merupakan upaya mewujudkan visi Pujakesuma yakni meneguhkan Pujakesuma sebagai organisasi budaya, sosial-kemasyarakatan dan perekonomian,” Dipilihnya Ketoprak Dor,

lanjut Oegroseno, karena kesenian Ketoprak Dor adalah kesenian yang dilahirkan oleh etnis Jawa yang berada di Sumatera Timur pada masa kuli kontrak ratusan tahun lalu. Namun kesenian Ketoprak Dor kini nyaris punah karena berbagai hal. “Parade Ketoprak Dor ini diharapkan mampu membangkitkankembalikesenianini,”ujarnya. Ke depannya, Oegroseno berharap semua PW Pujakesuma Provinsi dan PD Pujakesuma Kab/Kota dapat menjadi pembina atau bapak asuh terhadap grup kesenian Jawa di daerahnya masing-masing sesuai rekomendasi Rakernas Pujakesuma 2014. (rel/m08)

HUT Ke-39, TMII Raup Puluhan Ribu Pengunjung

Waspada/Dianw

FABER-Castell Raih 7 Penghargaan Top Brand 2014. Pemberian penghargaan berlangsung di Hotel Mulia, Minggu lalu.

Faber Castell Raih 7 Penghargaan Top Brand 2014 JAKARTA (Waspada): Produsen alat tulis terbesar dan tertua di dunia asal Jerman, Faber-Castell berhasil memperoleh 7 penghargaan Top Brand 2014. Pemberian penghargaan berlangsung di Hotel Mulia, 17 April lalu. Dalam malam penghargaan tersebut produsen alat tulis yang telah berusia 253 tahun ini berhasil memperoleh penghargaan 6 Top Brand for Kids dalam kategori jenis pensil warna, pensil hitam, pensil mekanik, crayon, penghapus dan spidol warna serta 1 penghargaan kategori pensil mekanik untuk penghargaan Top Brand for Teens. “Penghargaan ini adalah bukti konsistensi dari FaberCastell untuk terus memenuhi

kebutuhan konsumen Indonesia ditengah persaingan industri yang semakin kompetitif,” ujar Managing Director PT Faber-Castell International Indonesia, Yandramin Halim ketika dihubungi, Rabu (23/4). Top Brand for Kids merupakan bentuk penghargaan yang di gagas Majalah Marketing bersama Frontier Consulting Group (FCG) yang dilaksanakan setiap tahunnya. Penghargaan Top Brand for Kids ini merupakan ekstensi Brand dari Penghargaan Top Brand, kepada puluhan brand di Indonesia yang target pasarnya adalah balita dan anak-anak. Top Brand for Kids 2014 adalah kali ke-8 ini dihasilkan melalui survei pasar atas 500 anak dan 1000 orang tua di 5 kota

yakni Jakarta, Bandung, Semarang, Surabaya, Medan. Di dalam survey pasar itu ada 145 kategori dengan menyertakan 300 merek top. Dalam survei Top Brand for Kids, responden anak terdiri dari anak laki-laki maupun perempuan yang berusia 8-12 tahun dan masih duduk di bangku sekolah dasar kelas III sampai kelas VI. Jumlah sample anak adalah 500 responden. Sedangkan responden ibu adalah wanita berusia 21-50 tahun yang memiliki anak berusia 0-4 tahun atau memiliki anak yang berusia 5-12 tahun yang tinggal bersama dalam satu rumah dan masih duduk di bangku sekolah TK atau SD. Jumlah sampel ibu sebanyak 1.000 responden. (dianw)

JAKARTA (Waspada): Taman Mini Indonesia Indah (TMII) sukses meraup belasan ribu pegunjung pada perayaan Hari Ulang Tahun (HUT)-nya yang ke- 39, Minggu (20/4). Berdasarkan pantauan Waspada, sejak pagi masyarakat sudah mulai berdatangan ke lokasi taman rekreasi edukatif yang berada di Jakarta Timur ini. Ada yang menggunakan sepeda motor, mobil dan bis besar. Tak sedikit juga yang menggunakan kendaraan umum. Pengujung yang datang bukan hanya warga Jakarta pun dari luar Jakarta yang sengaja datang untuk menikmati beragam acara yang digelar pengelola TMII berkaitan dengan HUT-nya yang ke-39. Membludaknya pengunjung karena pengelola TMII tidak memungut tiket masuk alias masuk. Pegunjung hanya dikenakan biaya parkir kendaraan yang masuk ke dalam kawasan TMII. Pengunjung yang menggunakan kendaraan sepeda motor dikenakan tarif Rp 6.000, Rp 10.000 untuk mobil, dan Rp 15.000 untuk bis. Akibat membludaknya penonton arus lalu lintas macat. Banyak pemilik kendaran marah-marah, lantaran sulit keluar dari parkirnya karena terhalang kendaraan. “Aku dah 2 jam nunggu pemilik mobil ini datang, biar bias cepat pulang,” aku Sofia ,40, wargaTangerang yang datang bersama suami dan 3 anaknya. Menurut Sofia, dia sengaja membawa ketiga anak dan suami ke TMII karena kebetulan libur sekolah dan gratis. “Gratis sih gratis tapi macatnya minta ampun. Jadianya cuma dapat capek di jalan,” gerutunya. Hal senada juga diutarakan Amir ,38, warga dari Jakarta Selatan yang datang bersama istri dan 2 anaknya. Dia mengaku sengaja datang karena TMII gratis sekaligus ingin memperkenalkan anjungan-anjungan yang ada. “Bukannya nyaman eh malah bikin pusing karena terjebak macat yang luar biasa,” akunya. Baik Sofia maupun Amir menyarankan pengelola TMII harus mencari solusi agar kondisi ini tak terulang lagi. “TMII harus menyiapkan lahan parkir yang cukup. Lalu menyediakan kendaraan massal menuju ke titik sentar TMII. Tentu armada yang disiapkan harus mencukupi, atau hanya diperuntukkan bagi orangtua dan anak-anak SD. Sementara SMP dan dewasa harus jalan kaki dari parkir. Jika cara ini dirasa kurang sempurna, ya harus semuanya terangkut,” harapnya. Menyemutnya pengunjung di TMII saat perayaan HUT-nya tahun ini, disatu sisi menguntungkan pengelola TMII, namun di sisi lain justru sebaliknya. Pasalnya ribuan orang yang datang jadi tak terkontrol, banyak yang menyampah. Pengunjung yang membawa bekal dari rumah terlihat membuang sampahnya sembarangan, bukan di tempat sampah seperti terlihat di bawah deretan pohon beringin dekat Tugu Api. Bahkan banyak pengunjung yang menggelar tikar lalu makan bersama di rerumputan yang sebenarnya dilarang dianjak.Pengunjung yang menguakan bis pun sama saja, memabuang sampah bekalnya di bawah bis di aspal jalanan. Sungguh tak sedap dipandang mata. Banyaknya pengunjung yang membuang sampah bukan pada tempatnya di TMII yang nota bene obyek wisata bertaraf Nasional ini, membuktikan bahwa masyarakat kita masih belum melek sadar wisata terutama Sapta Pesona mengenai arti pentingnya menjaga kebersihan terlebih di kawasan obyek wisata.

Waspada/Adjik

PETUGAS membersihkan sampah yang ditinggalkan pengunjung TMII. Ini tentu menjadi pekerjaan rumah buat pihak terkait terutama dinas pariwsiata daerah dan Kementerian Pariwisata yang menbawahi masalah ini untuk terus mensosialisasikan sadar wisata dan sapta pesona lebih gencar dan tepat sasaran, bukan semata meraup wisatawan dalam dan luar negeri sebanyak-banyaknya. Meskipun sempat diguyur hujan lebat hampir satu jam lebih, pengunjung yang datang ke TMII terus bertambah hingga jelang malam. Pada HUT TMII kali ini semua anjungan serentak menggelar acara hiburan mulai dari musik dan lainnya. Di Ajungan Sumatera Selatan misalnya menyuguhkan sekitar 2.000 makan gratis empek-empek. Di Anjungan Aceh, pengunjung dihibur dengan hiburan musik dangdut dengan menampilkan penyanyi dangdut jebolan KDI dan Academy Dangdut Indonesia. Begitupun anjungan Sumut, Lampung, Riau, dan Bengkulu, juga tak mau kalah menjaring pengunjung dengan hiburan musik. Selain karena gratis yang membuat ribuan orang menyemut di TMII saat HUT-nya tahun ini karena didukung informasi yang lumayan gencar, antara lain lewat media online terutama blogger. Faktor lainya, HUT-nya bertepatan dengan hari libur, masih berkaitan dengan long weekend Paskah. (adji k.)


A8 1 CM

Rp. 22.000

WASPADA 2 CM

BURSA AUTOMOTIVE Informasi Pembaca

Bursa Automotive AC BR CL ND DB

: : : : :

Air Condition Ban Radial Central Lock Nippon Denso Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

Rp. 33.000

3 CM

Rp. 44.000

DAYA DAIHATSU BANJIR HADIAH Xenia DP 20 Jt-an. Angs. 2 Jt-an, Terios DP 30 Jt-an, Angs. 3 Jt-an. Pick Up DP 10 Jt-an, Angs. 2 Jt-an. Ayla DP 20 Jt-an Angs.1Jt-an. Bunga Ringan, Proses Cepat. Hub. RISMA 0813 6146 0678

DAI H AT SU Espass Th. 96/97 Pintu sorong, W. Biru metalic. AC, VR, BR, Tape. Body kaleng2. Seperti baru. Rp. 35,5 (nego). Hub. 0 8 5 2 7 6 0 2 7 7 8 9

4 CM

Rp. 55.000

“ DAI H AT SU BERH ADI AH “ Gran Max Pick Up 1’3 DP 9 Jt’an Angs 2 Jt’an Xenia 1’0 M DP 20 Jt’an Angs 3 Jt’an Terios TS DP 30 Jt’an Angs 4 Jt’an Gran Max Minibus DDP 13 Jt’an Angs 3 Jt’an AYLA D DP 20 Jt’an Angs 1 Jt’an Hub ERWI N H P 0 8 1 2 6 3 1 5 4 1 3 2 D A I H A T S U Z E B R A E PA S S P i c k U p 05. Hitam, BK Medan Asli, Mesin, Casis Mulus, 6 Speed (Bekas angkat papan bunga) Harga Rp. 40Jt (Nego). (Boleh Bantu Kredit). Hub 0 8 5 2 9 6 1 5 5 5 0 0 - PANTHER PU Std’04, Htm, DP 20Jt angs 2Jt x 35 - D. ESPASS 1,3 PU’ 03, Htm, DP 12Jt angs 1,4Jt x 35 - S. CARRY 1,5 PU’07, Htm, DP 15Jt angs 1,9Jt x 35 Hub Yos Sudarso 42 F Glugur. 0 8 1 2 6 0 7 6 4 7 6 I SU Z U PANTHER GRAND ROYALE Th 97. 2,5. W. Merah, P. Steering, P. Window, Velg Racing, Ac Dingin, Pajak Setahun, Atas Nama Langsung, H. 60Jt Net, Mobil Cantik. HP 0 8 2 1 6 5 5 2 2 5 3 3

MERCEDES BENZ C240 A/T ELEGANCE 2002. Hitam Metalic, Sun Roof, Electric Krei Belakang. Velg 19”. Hub. 0812 6363 717 SU Z U K I GRANDVITARA JLX 2.4 MT Thn 2009. Pembelian / Pemakaian Satu tangan dari baru 10-2010, Hitam, mobil standard. HP 0813 6125 0373 (TP. 180Jt Ne go)

6 CM

Rp. 121.000

T OY OT A KIJANG SUPER NCH 96 Abu - abu met, Rp. 52Jt T OY OT A KIJANG LGX M/T 01. Bensin Biru, Rp. 100Jt. Hub HP 0 8 2 3 6 4 7 8 9 0 6 9 0821 6122 4545

8 CM Rp. 137.500

Kamis, 24 April 2014

FAX.4531010

6 CM x 1,5 kolom Rp. 165.000

BURSA

MULTAZAM UMROH

TRAVEL / WISATA

& MANASIK HAJI 2014 *UMROH REGULER 09 HR ( 19, 25 MEI, 10 JUNI 2014) *UMROH REGULER 11 HR (12 MEI 2014) *UMROH REGULER 14 HR (28 MEI 2014) *UMROH PLUS TURKY 12 HR (12 JUNI 2014) *UMROH PLUS DUBAI 11 HR (10 MEI 2014) *UMROH PLUS AQSHA DAN JORDANIA (ISRA’ MIRAJ, 24 MEI 2014) *UMROH 2 MGG AWAL, 2 MGG AKHIR, / FULL RAMADHAN 1435 H US

T O Y O T A KIJANG KAPSUL LX Bensin 02. Merah, Mdn, 1 tangan, mulus D A I H A T S U E S PA S S T h n 9 7 . R o l l i n g D o o r , Mulus,Mdn, Coklat Met. 0812 6424 995

BUTUH DANA S O LU S I DA N A C E PAT Proses 5 Jam Cair, Tanpa Usaha, Terjamin. Jaminan : SHM, HGB, SK Camat, BPKB Mobil, Spd Mtr, Mobil Kredit/Over Leasing, Bantu Pelunasan BPKB. Hub Sdr Rinaldi HP 0821 6757 1653, 0853 6100 3453

BURSA LOWONGAN DI CARI Guru TK, SD, SMP/MTS, Operator Computer Yayasan Pendidikan Darul Hikmah / TK. Melati. No Telp 0813 9796 0600 , 0822 7265 4243

BIRO JASA

BIRO JASA “SUMATERA JAYA UTAMA” MEMBANTU ANDA MENGURUS SIM - STNK - SPEKSI - HO, DLL HUBUNGI: ASU N

061-77618768 // 061-7515 0466

I nfo Pe m e sa na n I k la n H ub. PI N BB 2 6 2 4 7 F5 E H P. 0 8 7 7 1 7 8 4 4 0 3 5 - 0 8 1 1 6 0 4 6 9 0

HARGA SUDAH TERMASUK PPN 10%

PAKET UMROH TERMURAH (FLIGHT GARUDA INDONESIA) - (MES -JED-MES) Direct Flight (Tgl. 1 Mei ‘14 - 20 Juni ‘14)

L

P MANASIK HAJI H SETIAP HR SABTU : 14.00 - 16.00 WIB ON HR MINGGU : 09.00 - 11.00 WIB BERTEMPAT : MESJID AGUNG MEDAN JLN. PANGERAN DIPONEGORO

Dengan Harga 1.550 USD 3 KALI MIQAT TOUR PERJALANAN : All in + Jabal Magnit, Pemerasan Susu Unta, Musium Ka’bah, Hudaibiyah, Dll

K AN T OR PU SAT : JLN. TITI PAPAN / PERTAHANAN NO. 10 SEI SIKAMBING D MEDAN

H P. 0812.6495.8456, 0813.6137.2321 0852.0648.6301, 0823 6252 6008 TELP. 061- 4576116 FAX 061-4512319

HAJI PLUS 10.000 USD Daftarkan segera diri Anda, untuk apa menunggu lama, kami menyediakan Haji Plus d e n g a n K u o t a Te r b a t a s De nga n Fa silit a s: H ot e l Gra nd Z a m za m (H ot e l N o. 1 di Sa udi Ara bia ) Dan Travel Yang Berpengalaman

I N FO LEBI H LAN J U T H U B:

PT. AL’MUCHTAR TOUR & TRAVEL Jl. Sisingamangaraja No. 180 Medan Te lp: (0 6 1 ) 7 8 7 1 8 6 0 H P: 0 8 1 2 6 0 7 4 0 6 9 7 (SH ELLY )

AL FAATIH TOUR & TRAVEL

BURSA

BURSA

N O. POM . T R. 8 7 3 6 3 5 5 2 2

Website : http://alfaatihtravel.com Email : alfaatihtourtravel@gmail.com Facebook : alfaatihtourtravel

HP. 081362106106, 085277251151, 081264853281 H A R G A PA K E T R E G U L E R ( A ) H a rga Pa k e t U m roh unt uk t a hun 1 4 3 5 H / 2 0 1 4 M J lh. H a ri :

BUSANA/ ACCESORIES

MINYAK URUT BOXING

Umroh & Haji Services

9 ha ri 1 4 ha ri 1 2 ha ri + Duba i 1 4 ha ri + T urk i 1 4 ha ri + Aqsa

Harga / USD 1 .9 0 0 ,2 .1 0 0 ,2 .4 0 0 ,2 .8 8 0 ,3 .3 0 0 ,-

Pa k e t : M a dina h – M a k k a h M a dina h – M a k k a h M a dina h – M a k k a h – Duba i Madinah–Makkah–Turki– Dubai M a dina h – M a k k a h – Aqsa

Te r se dia : T ik e t Dom e st ik & I nt e r na siona l H ot e l Vouc he r, T r a ve l Doc um e nt

ELEKTRONIK

Jalan Denai No. 168, Medan - Sumatera Utara Telp./Fax. 061-7331115 Tersedia Harga Paket Umroh Dengan Harga Terjangkau Bisa Cicil

TERCECER

BURSA BURSA PENDIDIKAN

Informasi Pembaca Bursa Property G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

DI J U AL RM H + TAN AH Jl. Selamat Gg. Berdikari Cocok U/ Usaha Kost - Kostan dan Kontrakan, Luas Tanah Semua 482 M2, Luas Bangunan 5x10, Akte Camat. Hub.0811 6263 795

DI J U AL RU M AH & TAN AH

SERVICE KONSTRUKSI

TUMPAT/ SAL. AIR

WC WC WC 0821 6897 4333 8 4 5 .8 9 9 6

0812.631.6631

Bergaransi/ Jl.Kpt. Muslim

Jl. P. BRAYAN MEDAN

HP. 0813 7035 7291 0813 6210 8239 Ada Garansi

TUMPAT/ SEDOT Bergaransi

Rumah Permanen, LT 275 M. LB. 84m2, KT3, RM2, Vavaliun 4x4m. Teras, Air PDAM, Listrik 900 VA. Ada halaman depan, samping T. jemur. Pagar Besi, SHM. Harga Nego. TP. Jl. Sei Silau No. 112. Medan. Hub. Telp. 0813 6103 2949 - 0813 8368 0690 DI J U AL RU M AH Jl. Karya K. Berombak, Mdn Barat Gedung 2 Lantai, LT/LB : 630/600. Parkir Luas, Cocok Segala Usaha. Hub 0 8 5 2 7 6 3 1 7 2 0 8

DIJUAL 1 Unit Rumah Permanen di Jl. Karya Jaya Komp. Kencana Asri Blok II No. 42. Ukuran tanah 7x14m, U. Bangunan Type 60. Full Keramik, Kanopi depan & Samping, pagar besi keliling, posisi hook, Listrik 2200 watt, PAM, SHM. Harga 310 Jt (Nego). Hubungi: 0812 6472 4334

DI J UAL RU M AH Jl. Ayahanda / Mistar 16, SHM, 2 LT, 2 KM, 3 KT, Halaman Parkir. Hub 0 8 5 2 6 1 6 1 0 5 7 6 , 0812 6317 0204 DI J U AL / DI SEWAK AN RU K O Jl. Asrama 3 unit dijual 1,3 Milyar/unit (nego) (SHM), disewakan 40jt/Thn (nego) RU K O Jl. Gagak Hitam 2 unit dijual 1,5 Milyar/ unit (nego) SHM, disewakan 45Jt/Thn(nego) /ada sekat ruangan dari kaca dan ada AC/ siap huni 1 unit GU DAN G Di Jalan Selamat Bromo Ujung disewakan 45Jt/Thn (nego) / Luas 800 m2. Hubungi 0 6 1 - 9 1 3 1 5 6 2 0 , 0 6 1 -4 5 5 2 4 5 5 (tanpa perantara)

TANAH DISEWAKAN / DIJUAL Tanah di Marelan. Luas 25 M x 80 M = 2000 M2. Pagar tembok keliling, Cocok utk gudang, bengkel, dan usaha usaha lainnya. Sewa 28 Juta / tahun/ nego. Hub 0813 7688 4000 Dan 0811 64 1215 TAN AH / RU M AH DI J UAL

Ukuran Tanah, P= 40 M, L= 16 M. Luas= 620 M2. Bangunan, P = 21 M, L = 15 M. Luas = 315 M2. SK Camat, Lokasi Jalan Menteng Tiga Gang Silaturrahim No. 6 Medan Denai (Khusus Muslim). Hub 0813 7063 5278, 0812 6553 514

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Hub: (061) 7364920 - 7323590

BURSA ALAT MUSIK

TELAH TERCECER

PROPERTY

Dpt Diperoleh di Sumatera - Aceh

1 Lembar Asli Surat Pembagian Tanah Atas Nama Tengku MHD Adan yg dikeluarkan oleh Lurah Rengas Pulau Kec. Medan Marelan Tgl 22 Mei 2004 Luas Tanah +/- 600 mtr yg terletak di Lingk 01 Kel. Rengas Pulau Marelan. Tercecer di sekitar Jl. KL Y. Sudarso P. Brayan S/D Medan pada tgl 20 maret 2014 Belum Ditemukan

PENGOBATAN ALTERNATIF TERAPI URAT

H I LAN G Telah Hilang Surat SHM ASLI An. H.B Sibarani Pada Tanggal 10 September 1978 yang terletak di Jalan Pelangi No. 41 Medan

-Stroke -Asam Usat -Asam lambung Ringan/ Kronis (Sakit Maag) -Rematik -Keseleo -Urat kejepit -Ginjal

TELAH HILANG / TERCECER Surat Tanah Seluas +/- 250 M2, a/n. Sawen Br Perangin - angin yang terletak di Jln. Titi Papan No. 49 Lingkungan XI Kel. Sei Sikambing D Kec. Medan Barat Kodya Medan

T ELAH T ERCECER 1 Berkas Asli Surat Tanah Akte Camat Medan Marelan Bulan April 2014. Luas Tanah 142 Mtr, Terletak Di Lingk 30 Kel. Rgs Pulau Marelan. Surat tanah Tersebut A/N Megawati Syahputri. Tercecer pada tgl 20 April 2014 Di Sekitar Kantor Camat Medan Marelan S/D Kel. Rgs Pulau Belum Ditemukan T ELAH H I LAN G / T ERCECER Surat tanah / SK Camat atas nama : ARIE REISITA ILYAS. yg beralamat Desa Klambir Lima

T ERCECER STUK. BK 9096 CO. No uji : AB. 017597. A/N : Mathilde Br. Siahaan. Alamat : Jl. Menteng VII Medan. Merek : Mitsubishi

T ERCECER STUK. BK 8989 KP. No uji : MDN 41208. A/N : Dewi Maya Rangkuti. Alamat : Jl. PII Gg Aneka. Merek : Mitsubishi

T ERCECER 1 Buah BPKB No. H : 00572283 B. Atas Nama Surianto & STUK / STNK No : 055468010128594 Dengan No Pol BK 121 PQ. Atas Nama : Surianto. Tercecer di terminal Pinang Baris - Terminal Amplas . yang menemukan Hub Chaidir Sihite 0812 6969 3989. Diberi Hadiah Sepantasnya T ERCECER STUK. BK 9079 BG. No uji : Tjp 00786. A/N : Frienny. Alamat : Jl. Sm. Raja Mdn. Merek : Mitsubishi

-Lumpuh -Migran -Sakit Gigi -Darah Tinggi -Gula -Usus Turun - Kejantanan Pria

Alamat Jalan Jahe 8 No. 37 Perumnas Simalingkar (Medan). HP 0813 7535 3566 (Bpk. Handi)

BURSA KOMPUTER

OBRAL LAPTOP BESAR - BESARAN TOSHIBA 15” =1,950 JT * MERK TERKENAL * KWALITAS TERJAMIN * DIGARANSI

BURSA PERHOTELAN

TERCECER TELAH HILANG / TERCECER Surat Jual Beli Tanah yg ditanda tangani diatas materai dari HT Kamiluddin kepada Misnar bin Misran yg terletak di Jln. Amaliun Gg. Tukang No. 17 Dgn Ukuran Tanahnya 15 x 6,5 M.

BURSA KESEHATAN

Since 1952

KENANGA CITI HOTEL

Hubungi - 0813 7508 3972 - 0853 5880 0373 - 0813 6293 3325 Pondok Kelapa no. 9B Medan Ringroad Tersedia Cicilan 12 Bln

My Residence in Medan

BURSA

J l. Sisinga m a nga ra ja N o. 8 2 Medan Te lp. (0 6 1 ) 7 3 4 .2 1 0 6

MATERIAL

SERVICE ELEKTRONIK

AC

Kulkas, M. Cuci, Kompor Gas, Dispenser, Sanyo, Pump, Genset Sur ya Te k nik Se r vic e

Tangga Stainless

Seng Tekuk

Folding Gate

Pintu Press Minimalis

Hub : 061 7725 4947 - 0813 7589 8757 Siap Ketempat

BURSA PERABOT T EM PAH AN M U RAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1.750.000 /mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 75107000

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun Hub Telp. (061) 661.8116 - (061) 661.6802 - 75107000

BURSA PERCETAKAN

Menerima pesanan dalam & lua r k ot a - Pintu besi press melipat & menikung - Pintu stainless - Pintu folding gate - Canopy / seng - Stainless - Plafon Pvc , dll

SU N J AYA Jl. Letda Sujono no. 85 Medan

Telp. 061-7340751 Hp. 085261609105

085370420832 - 081371405832 ATAP & DINDING EURODEK ALUMINIUM ZINC - AZ - 150

PAGAREURO

R

GALVANIS

T ELAH T ERCECER Surat tanah seluas 27385 M2 yg terletak di Lorong Bangun jadi Dusun Kandang Motor Desa Aek Batu Kec. Kota Pinang. a/n. Enteng S. Tercecer pd tgl 1 April 2014 dari Rantau Prapat menuju Cikampak Desa Aek Batu Kec. Torgamba Kab. Labuhanbatu Selatan

EUROMESH BAJA U-50

TELAH TERCECER 1 Berkas Asli Surat Tanah Surat Pelepasan Tanah dan Bangunan Serta tanaman Atas Nama Rini Sri Wahyuni No. 593.83/1039/SPTBT/ M.M/VIII/2010 Letak tanah Di Gg. Boy Lingk 25 Kel Rengas Pulau Marelan Seluas 200 Mtr. Tercecer di sekitar Jl. Yos Sudarso P. Brayan Sampai Medan Pada tgl 15 Jan 2014 Belum Ditemukan

R

KOLOM PRAKTIS EURO R BAJA U-50 SIAP PAKAI LEBIH PRAKTIS & HEMAT DARI BESI BETON

PRODUKSI:

PT. REZ EK I PRI M A J AYA ABADI Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.7194 Fax. (061) 415.7504 SUMUT - INDONESIA


Luar Negeri

WASPADA Kamis 24 April 2014

A9

Korban Jiwa Tragedi Feri Korsel Terus Bertambah JINDO, Korea Selatan (Antara/Xinhua-OANA): Jumlah korban jiwa akibat kecelakaan feri Korea Selatan (Korsel) naik lagi jadi 150 Rabu (23/4), saat ratusan penyelam mempercepat tugas menemukan mayat dari kapal yang karam itu. Saat operasi pencarian dan pertolongan memasuki hari kedelapan sejak feri tersebut tenggelam pada Rabu pekan lalu, 152 orang masih belum ditemukan, dan jumlah orang yang diselamatkan tak berubah, 174, demikian laporan Xinhua. Operasi pencarian ditangguhkan dan dilanjutkan, saat arus gelombang menjadi lebih cepat daripada prakiraan pada Selasa malam hari. Perairan di Pulau Jindo, tempat feri Sewol dengan bobot 6.825 ton terbalik, terkenal karena arusnya yang tercepat kedua di negeri itu. Prakiraan cuaca mengatakan arus melambat selama empat hari sampai Kamis. Temperatur air berkisar 11 sampai 12 derajat Celsius pada pagi hari, dengan gelombang setinggi 0,5 meter.

Pengunjukrasa Anti-Obama Bentrok Dengan Polisi Manila

AB Pakistan Upayakan Tutup Stasiun Televisi ISLAMABAD, Pakistan (AP): Seorang pejabat Pakistan mengatakan, angkatan bersenjata mencoba menutup televisi terkenal di negara itu Geo News TV. Pejabatitu,FakhruddinMughal,mengatakantimhukumOtoritas Regulasi Media Elektronik Pakistan mengadakan pertemuan untuk membahas permintaan angkatan bersenjata itu. Mughal mengatakan, kementrian pertahanan Pakistan mengajukan pengaduan terhadap Televisi itu. Salinan pengaduan itu disiarkan di situs Komite Perlindungan Jurnalis.Pernyataanitumengatakanangkatanbersenjatamenginginkan stasiun televisi itu ditutup karena menyiarkan ‘kampanye palsu dan berbau skandal’ terhadap Badan Intelijen Pakistan atau ISI. Televisi itumenuduhbadanmata-mataitu,mencobamelakukanupayapembunuhan terhadap pembawa acara talk show televise itu, Hamid Mir, yang ditembak dan mengalami cidera minggu lalu.(m23)

Aktivis Demo Baju Merah Thai Ditembak Mati Di Bangkok BANGKOK, Thailand (AP): Polisi di Bangkok, ibukota Thailand, mengatakan seorang aktivis pro-pemerintah yang menentang UU yang menghukum setiap pengeritik kerajaan telah tewas ditembak. Kol. Pol.ThanawatWatthanakul mengatakan Kamol DuangphasukditembakolehsekelompokpriabersenjataRabu(23/4)dihalaman parkir satu restoran di utara Bangkok.Korban, seorang penyair yang juga dikenal sebagai Mainueng Kor Khuntee, adalah anggota gerakan politikKaosMerah,yangmendukungkembalinyamantanPMThaksin Shinawatra yang saat ini mengasingkan diri di luar negeri, yang adalah kakak laki-laki PM saat iniYingluck Shinawatra. Sampai saat ini masih belum ada indikasi pelaku dan motivasi pembunuhantersebut.Mainuengdikenalsebagaiseorangpenentang aktif dari UU anti-pengeritik kerajaan. Satu kelompok pendukung UU itu baru-baru ini mengancam akan memburu siapa saja yang menentang monarkhi Thai. (m10)

Surapong: ASEAN Keluarkan Pernyataan Krisis Politik Thailand BANGKOK,Thailand (Antara/TNA-OANA): ASEAN mengeluarkan pernyataan yang mengungkapkan keprihatinan blok regional itu atas krisis politik di Thailand dan mendesak pemilihan umum segeradiselenggarakan,kataMenteriLuarNegerisementaraThailand Surapong Tovichakchaikul Rabu (23/4). Surapong, yang merangkap wakil perdana menteri sementara, menunjukkan kepada media satu rancangan pernyataan yang dikirim oleh Menteri Luar Negeri Myanmar, yang merupakan Ketua ASEAN tahun ini. Dia mengatakan, pernyataan itu sekarang sedang ditandatangani oleh masing-masing negara anggota ASEAN anggota berurutan dan diharapkan akan segera selesai. Surapong mengklaim bahwa pernyataan itu meminta Thailand untuk memecahkan krisis politik melalui dialog dan mempercepat proses pemilu, dan mengatakan Thailand adalah anggota ASEAN dan perlu untuk bergerak maju dengan blok itu. Dia mengatakan, para pemimpin ASEAN mengeluarkan pernyataan serupa pada Desember, dan menambahkan bahwa sementara ASEAN tidak dapat mencampuri urusan dalam negeri negaranegara anggotanya, blok dan masyarakat dunia sedang memantau situasi di Thailand.

Obama: Perjanjian AS Dan Jepang Untuk Pulau Sengketa TOKYO, Jepang (AP): Presiden AS Barack Obama membenarkan Rabu (23/4) bahwa perjanjian keamanan bersama Amerika Serikat dan Jepang ditujukan untuk mengamankan pulau-pulau Jepang yang disengketakan dengan China. “Kebijakan Amerika Serikat sudah jelas,” katanya dalam satu respon tertulis yang diterbitkan oleh suratkabarYomiuri Shimbun sebelum kedatangannya di Tokyo pada awal lawatannya ke empat negara Asia. “Pulau Senkaku di atur oleh Jepang” dan karena itu lah dia masuk di bawah perjanjian AS dan Jepang ,” katanya dalam tulisan itu. “Dan kami menentang setiap usaha unilateral untuk menggoyahkan pemerintah Jepang untuk mengatur pulau-pulau tersebut. Pernyataan Obama itu dimaksudkan untuk menenangkan Jepangbahwapulau-pulauyangdisengketakandenganCinatercakup dalam traktat pertahanan bilateral. Dalam sebuah wawancara menjelang kunjungannya ke Asia, Obama mengatakan AS akan menentang semua usaha pelanggaran kekuasaan Jepang atas wilayahnya. Pejabat AS telah menyampaikan komentar yang sama di masa lalu, tetapi untuk pertama kalinya Obama menyatakan dukungan secara terbuka. Presiden AS itu tiba di Jepang Rabu (23/4) dan akan mengunjungi tiga negara Asia lainnya, Korea Selatan, Malaysia dan Filipina. Obama tidak akan mengunjungi Beijing, tetapi hubungan dengan China diperkirakan akan mendominasi berbagai pertemuannya dengan para pemimpin kawasan. Lawatan ini adalah kesempatan untuk memperkuat arti penting Asia bagi AS, kata mantan Asisten Menteri Luar Negeri AS PJ Crowley kepada para wartawan. “Kebanyakan sekutu tradisional..mementingkan kehadiran kuat AS di kawasan untuk menyeimbangkan posisi dengan Cina yang agresif,” katanya. Kunjungan itu dilakukan ditengah“masa sangat penting diantara sekutu Amerika dan diantara sekutu Amerika dengan China,” tambahnya.(cnn/m10)

The Associated Press

DALAM foto yang diabadikan Selasa (22/4), para pencari dan penyelam melihat orang-orang yang diyakini terperangkap di dalam feri Sewol yang tenggelam di perairan lepas pantai selatan dekat Jindo, selatan Seoul, Korea Selatan. Satu persatu, para petugas pengawal pantai membawa mayat-mayat yang baru ditemukan di dalam kain putih dari satu boat ke satu kemah di daratan pulau itu, langkah pertama untuk mencari tahu identitas korban. Jumlah korban tewas terus bertambah pada saat tim pencari meneruskan usahanya untuk mencari ratusan korban yang masih terperangkap di lambung kapal itu.

Australia Borong 72 Pesawat F-35 Dari AS CANBERRA, Australia (AP): Australia mengumumkan Rabu (23/4) bahwa pihaknya telah meningkatkan pesanannya untuk pesawat tempur Joint Strike Fighters F-35 sebanyak 58 menjadi 72 buah yang akan beroperasi penuh pada 2023 dalam satu deklarasi kepercayaan sehubungan dengan timbulnya masalah pesawat perang siluman. Pemerintah mengharapkan tambahan 58 jet AS, yang dikembangkan oleh Lockheed Martin Aeronautics Co, akan dikenakan biayaAustralia$12,4miliar(AS$11,5 miliar), kata PMTony Abbott. “Ini adalah salah satu pembelian terbesaryangpertahananyangpernah dibuatAustralia,”kataAbbottkepada wartawan. “Ini akan memastikan

keunggulan kami.” Pembelian perangkat tempur udara besar-besaran itu disebut-sebut sebagai yang terbesar dalam sejarah pertahanan Australia.Menurut Sydney Morning Herald, Selasa, pembelian ini diumumkan PM Tony Abott dan secara resmi akan disampaikan Rabu (23/4). Abott mengatakan,

dengan membeli F-35, Australia akan bergabung dengan Amerika Serikat dan sedikit negara lainnya yangmemilikijettempurgenerasi kelima. Untukmembelipesawatyang juga disebut Joint Strike Fighter Lightning II, termasuk dengan perawatan, senjata dan suku cadangnya, Australia merogoh kocek AS$12,4 miliar atau lebih dari Rp143 triliun. Sebelumnya, Australia telah membayar untuk dua jet F-35 dan memesan 12 pesawat ini. Rencananya, pemesanan puluhan jet tempur buatan Lockheed Martin ini akan mulai dikirimkan ke Australia pada 2018 danmulaiberoperasidiAngkatan Udara Australia pada 2020. F-35 akan menggantikan HornetF/A-18yangdirencanakan

pensiun tahun 2022. Di masa depan, AU Australia akan memiliki perangkat tempur udara yang beragam. Kekuatan F-35 akan didukung oleh 24 Super Hornet dan 12 pesawat pengacau radar Growler. “Generasi kelima F-35 adalah jet tempur yang paling canggih yang pernah diproduksi di dunia danakanmemberikankontribusi vital bagi keamanan nasional kami,” kata Abbott. “Bersama dengan jet tempur Super Hornet dan Growler, F-35 akanmemastikanAustraliamampu menjagakeamananbatasregional di udara. F-35 akan memberikan kemajuan pesat kemampuan intelijen, pengawasan dan matamata dari Angkatan Udara Australia,” lanjut Abbott lagi. (m10)

Pemberontak Pro-Rusia Sandera Wartawan AS DONETSK, Ukraina (AP): Kelompok bersenjata pro-Rusia di Ukraina Timur mengaku Rabu (23/4) bahwa mereka menyandera seorang wartawan Amerika yangtelahtidakterlihatsejakSelasa dinihari. Simon Ostrovsky, seorang wartawan untuk Vice News, sedang meliput krisis Ukraina selama beberapa minggu dan telah melaporkan tentang beberapa kelompok bersenjata bertopeng yang menduduki gedung-gedung pemerintah di salaj satu kota setelah menguasai gedung pemerintah di kota lainnya di Ukraina Timur. Pemberontakpro-Rusiayang telah menduduki beberapa kantor polisi dan gedung umum lainnyadiUkrainaTimurselamalebih dari seminggu tidak menggubris adanya persetujuan yang mengatakan Rusia dan Ukraina telah menandatangani beberapa persetujuanpekanlalu,yangmendesak semua pihak agar meletakkan senjata dan meninggalkan kantor-kantor publik. Para anggota gerakan nasionalisSektorKananyangjugatelah mendudukiduagedungdiibukota Kiev selama beberapa bulan namun pihak berwenang mengata-

kan prioritas adalah menangkap kelompok bersenjata di Ukraina Timur agar mengosongkan gedung-gedung yang mereka duduki. Dalam perkembangan lainnya, Ukraina telah memulai lagi operasi militer terhadap separatis pro-KremlinSelasa malam,beberapajamsetelahWakilPresidenAS Joe Biden mengakhiri kunjungan dua harinya di mana ia memperingatkan Rusia atas tindakannya di bekas republik Soviet itu. Departemen Pertahanan AS pada saat yang sama mengumumkan akan mengirim 600 tentara ke Polandia dan negaranegara Baltik bagi “pelatihanpelatihan”. Rusia telah mengirim puluhan ribu tentaranya di perbatasan timur Ukraina. Tindakan terbaru itu menegaskan betapa kerasnya krisis itu yang telah menyebabkan hubungan-hubungan Barat dan Timur berada pada titik paling berbahaya sejak Perang Dingin berakhir. Penjabat Presiden Ukraina OleksandrTurchynov, Selasa malam mengatakan dia memerintahkan militer, untuk memulai kembali operasi terhadap pemberontak setelah menemukan dua mayat “yang disiksa secara

kejam” di kota Slavyansk yang dikuasai pemberontak di Ukraina Timur. Salah seorang dari mereka, katanya, adalah seorang yang baru-baru ini menculik anggota dewan lokal dari satu kota terdekat yang menjadi anggota partainya. Dalam satu tanda aksi kekerasan meningkat lebih jauh, yang banyak pihak khwatirkan dapat menimbulkanperngsaudara,satu pesawat pengintai Ukraina ditembaki ketika terbang di Slavyansk. Pesawat Antoov AN-30 terkena tembakan, tetapi selamat dan melakukan pendaratan darurat dan tidak ada awak pesawat yang cedera, kata kementerian pertahanan di Kiev. Organisasi bagi Keamanan dan Kerja Sama di Eropa (OSCE), yang para pemantaunya berada di negara itu, juga mengatakan bahwa pemberontak telah menculik seorang komandan polisi di kota Kramatorsk—menyebutnyaaksi“provokatif” yang “hanya dapat memperburuk ketegangan yang ada dan membantu aksi kekerasan lebih jauh”. Milisi pro-Moskow telah menguasai kantor polisi Kramatorsk Senin malam, memperluas ceng-

keraman mereka dari balai kota yang telah mereka duduki.Kiev, Moskow dan banyak negara Uni Eropa menganggap Rusia membantu pemberontak separatis Ukraina. Biden, dalam jumpa wartawannya setelah bertemu dengan pihak penguasa Kiev, memperingatkan bahwa Rusia akan semakin terkucil jika tetap berusaha “mendorong perpecahan Ukraina”, dan menegaskan AS akan mengancam memberlakukan sanksi lagi terhadap Moskow. Dalam satu percakapan telepon Selasa, Menlu AS John Kerry mengemukakan kepada Menlu Rusia Sergei Lavrov tentang kecemasannya yang dalam atas kurangadanyatindakanpositifRusia untuk menekan krisis di Ukrania timur,kataseorangpejabatDeplu. TetapiRusiamengatakanpara pemimpin baru Kiev— yang dianggapya tidak sah—disalahkan atas ambruknya perjanjian itu Rusia mengatakan kelompok ultra-nasionalis yang terlibat dalam protes selama berbulan-bulan yang menggulingkan presiden ViktorYanukovich pro-Kremlin Februari membunuh pemberontak dalam satu serangan Ahad dekat kota Slavyansk.(afp/m10)

MANILA,Filipina(AP):Polisidenganbersenjatakanpentungan, perisai dan selang air bentrok dengan lebih 100 aktivis sayap kiri yang berunjukrasa di Kedutaan AS di Manila Rabu (23/4) untuk menentang kunjungan Presiden Barack Obama dan kemungkinan perjanjian keamanan yang akan meningkatkan kehadiran militer Amerika di Filipina. Polisi anti huru-hara menghadang para aktivis yang melambaikan bendera di dekat kedutaan yang dijaga ketat namun para pengunjukrasa berhasil melewati mereka, sehingga menimbulkan perkelahian. polisi menyemprotkan air dari satu mobil pemadam kebakaran ke arah pengunjukrasa untuk membubarkan mereka. Seorang polisi kena bogem di wajahnya dalam huru-hara itu namun tidak ada yang ditangkap. Sebagian pengunjukrasa membawa bendera AS yang terbuat dari kertas dengan tulisan “Obama tidak diterima.” Obama akan tiba di Manila Senin sebagai persinggahan semalam setelah berkunjung ke Jepang, Korea Selatan dan Malaysia dalam kunjungannya ke Asia di mana dirinya berharap bisa memastikan persatuan negara-negara itu yang terlibat dalam perebutan wilayah dengan semakin meningkatnya sikap keras China. AS dan Filipina, yang merupakan sekutu dalam perjanjian, berupaya mengatasi perbedaan untuk merampungkan perjanjian keamanan baru saat kunjungan Obama. Perjanjian itu akan memungkinkan semakin banyak pasukan, pesawat tempur, dan kapal AS ditempatkan di kamp-kampmiliterFilipinasebagaipengimbangChinadansebagai pasukantanggapbencanayangsiapsiaga.Sekitar500tentaraAmerika telah ditempatkan di bagian selatan Filipina sejak 2002 untuk memberikanpelatihananti-terorismedanintelijenkepadapasukan Filipina yang memerangi militant al-Qaida.(m23)

Gerilyawan Abu Sayyaf Terlibat Penculikan Ditangkap Di Filipina ZAMBOANGA CITY, Filipina (Antara/Xinhua-OANA): Seorang anggota kelompok Abu Sayyaf yang diduga terlibat dalam penculikan orang asing di tempat pelancongan di Sipadan, Malaysia, ditangkap Rabu (23/4) pagi di Filipina Selatan, kata seorang pejabat militer. Tersangka itu, yang menggunakan nama samaran Abu Darren, ditangkap di Kota Zamboanga, Filipina Selatan. Kol. Andrelino Colina —Komandan SatuanTugas Anti-Teror Zamboanga— mengatakan tersangka tersebut berpusat di Provinsi Sulu. Colina mengatakan tersangka itu ditangkap oleh satuan gabungan intelijen polisi dan militer Filipina yang telah menguntit dia di dekat dermaga swasta di Desa Pantai Baliwasan sekitar pukul 10.30 waktu setempat, Rabu. Abu Sayyaf menculik sembilan warga negara Malaysia, 10 orang Eropa dan dua pegawai pelancongan Filipina dari Tempat Pelancongan selam Sipadan di lepas pantai Sabah, Malaysia, pada Mei 2000. Semua korban kemudian dibawa ke Provinsi Sulu, tempat mereka disandera selama lebih dari lima bulan. Mereka dibebaskan dengan imbalan uang tebusan dalam jumlah banyak.

Bluefin-21 Selesaikan 80 Persen Pencarian MH370 Di Dalam Air PERTH, Australia (AP): Kapal selam robot Bluefin-21 sampai Rabu (23/4) telah menyelesaikan kira-kira 80 persen pencarian pesawat Malaysia Airlines MH370 di bawah permukaan air. Pesawat tersebut hilang bersama 239 awak dan penumpangnya dalam penerbangan dari Kuala Lumpur ke Beijing 8 Maret lalu, demikian menurut Pusat Penyelarasan Agensi Bersama (JACC). Badan yang menyelenggarakan operasi pencarian itu mengatakan Bluefin-21 sampai kini telah menyelesaikan misi ke-10 dan belum menemui petunjuk apa pun yang ada hubungan dengan MH370. Bluefin memulai tugas itu sejak 14 April lalu. Bagaimanapun, badan tersebut tidak menunjukkan apakah kenderaan tanpa pengendali itu akan digunakan untuk misi ke11begitudiatimbuldipermukaanairdarimisiyangsedangdijalankan kini. Kawasan pencarian dalam air yang difokuskan berupa satu bulatan dengan radius 10 km di sekeliling tempat isyarat kedua dikesan alat pengesan pinger (TPL), menurut kenyataan itu Rabu. Bluefin-21, ditugaskan dengan harapan dapat menemukan sebarang serpihan pesawat yang hilang di dasar laut.Kapal selam mini itu menggunakan alat akustik untuk menghasilkan peta tiga dimensi dasar laut dan mengambil masa sekurang-kurangnya 24 jam untuk menyelesaikan setiap misinya, termasuk empat jam bagi memuat turun data yang dikumpul. Lembaga itu berkenaan juga memaklumkan ramalan cuaca Rabu menunjukkan berlaku hujan lebat, awan rendah merata tempat dengan angin timur tenggara dan laut mungkin bergelora sehingga 2.5 meter. Badan tersebut menegaskan keadaan cuaca itu juga mungkin akan menjejaskan misi pencarian pada Rabu. Bagaimana pun buat ketika ini menurut agensi itu mencari secara visual yang dirancang pada Rabu akan diteruskan dengan melibatkan sampai sepuluh pesawat dan 12 kapal meliputi kawasan seluas kira-kira 37,948 km persegi berpusat kira-kira 855 km baratlaut Perth. Usaha pencarian melibatkan sejumlah negara yang dilancarkan untuk mengesan pesawat Boeing 777-200 itu, mula-mula di Laut China Selatan dan kemudian di selatan Lautan India apabila dikatakan pesawat itu melencong daripada laluan asalnya. Setelah analisis terhadap data satelit menunjukkan kedudukan terakhir pesawat itu adalah di Lautan India, di barat Perth, Australia, PM Najib Tun Razak mengumumkan pada 24 Maret bahwa Penerbangan MH370 “berakhir di selatan Lautan India”. Dipanggil balik Operasi pencarian dari udara yang dirancang Rabu di kawasan berkedudukan 855 km dari baratlaut Perth untuk memastikan MH370 yang hilang 8 Maret lalu, terpaksa ditangguh susulan cuaca buruk. Tiga pesawat yang sudah berlepas untuk misi itu pada awal pagi telah dipanggil balik, kata JACC) dalam satu kenyataan di sini. Menurut kenyataan terkini JACC itu, cuaca buruk tersebut mengakibatkan laut bergelora dan jarak penglihatan terjejas, sekali gus membahayakan pasukan mencari. Operasi pencarian dari udara lazimnya mengambil masa lapan jam untuk perjalanan pergi-balik dan dua jam bagi menjalankan operasi mencari. Dalam pada itu, 12 kapal yang terlibat dalam misi hari ini meneruskan operasi mereka. JACC Selasa menangguhkan operasi pencarian dari udara susulan ribut tropika ‘Jack’, bagaimanapun operasi diteruskan kemudian menggunakan lima pesawat tentera. Milisi hari ini dirancang membabitkan 10 pesawat. (bnm/m10)


Sport

A10 Atletico

AP

KAPTEN Frank Lampard (kiri) kiper Mark Schwarzer puas dengan pencapaian Chelsea di markas Atletico Madrid.

Blues Puas MADRID (Waspada): Para punggawa Chelsea puas setelah menahan tanpa gol tuan rumah Atletico Madrid di Stadion Vicente Calderon. “Semua pemain benar-benar bersemangat. Kami tahu jika kami menyesuaikan antara usaha dan tekad, maka kami akan melakukannya dengan baik,” beber kiper Mark Schwarzer, seperti dikutip dari Football Espana, Rabu (23/4). Penjaga gawang veteran Australia berusia 41 tahun itu kebagian mentas, karena kiper utama Petr Cech mengalami cedera menit 18. “Kami memang tidak menciptakan banyak peluang, tapi saya pikir kami bermain bagus,” klaim Schwarzer. Hal senada dikatakan bek kanan The Blues asal Spanyol, Cesar Azpilicueta. “Ini hasil positif, kami tidak dapat menyangkalnya,” jelasnya. “Kami paham berada dalam suasana yang sulit. Kami harus berjuang dan kadangkadang menjaga bola.Yang

penting kami akan menjalani leg kedua di kandang sendiri,” tambah Azpilicueta. London Blues binaan manajer Jose Mourinho, memang tampak lebih berkonsentrasi menjaga clean sheet pada laga leg pertama semifinal Liga Champions tersebut. Menurut bek jangkung Gary Cahill, taktik bertahan perlu dilakukan mengingat Atletico sangat kuat saat mentas di markasnya. “Menyadari betapa bagus dan kuatnya Atletico di kandang musim ini, kami datang ke sini dengan gameplan. Pada akhirnya rencana kami bekerja bagus dan kami puas dengan hasil imbang ini,” ungkap Cahill. “Pelatih senang karena taktik yang dia persiapkan berhasil. Di sini kami bertahan lebih sering daripada biasanya, kami lebih kompak ketimbang biasanya. Kami kuat di kandang dan saya yakin kami nanti tampil menyerang,” tambahnya. Laga itu juga menandai

Atletico Madrid vs Chelsea 0-0 Atletico (1-4-3-3): Thibaut Courtois; Rodric Miranda, Fransisco Juanfran, Filipe Luis, Diego Godin; Diego Ribas (Arda Turan, 60'), Gabriel Fernandez, Mario Suarez (Jose Ernesto Sosa, 80'); Raul Garcia (David Villa, 86'), Koke, Diego Costa Pelatih: Diego Simeone (Argentina) Chelsea (1-4-1-4-1): Petr Cech (Mark Schwarzer, 18'); Ashley Cole, John Terry (Andre Schurrle, 73'), Gary Cahill, Cesar Azpilicueta; David Luiz; Frank Lampard, John Obi Mikel, Willian (Demba Ba, 90'), Ramires; Fernando Torres Pelatih: Jose Mourinho (Portugal) MANAJER Chelsea asal Portugal, Jose Mourinho (foto kanan), sekali lagi sukses membuktikan bahwa taktik sepakbola negatif mampu berbicara banyak di kompetisi Eropa. Permainan bertahan nan matang pasukan Mou, Selasa (Rabu WIB), terbukti ampuh membuat Atletico Madrid frustrasi pada leg pertama semifinal Liga Champions di Stadion Vicente Calderon. Mentas di hadapan publiknya sendiri, Los Colchoneros memang mampu melepaskan 26 tembakan, namun tidak ada satu gol pun yang berbuah gol hingga laga berakhir 0-0. Mou pun membuktikan, tidak ada jaminan tim yang mengontrol 69 persen pengusaan bola akan memenangi laga. Namun gaya mengelaknya yang juga terkenal matang, dia membantah Chelsea sengaja bertahan untuk mencari aman di markas pasukan Diego Simeone. “Kami berusaha menang 5-0 pada laga ini dan memastikan langkah ke final. Pemain kami tidak pernah berpikir mengakhiri laga 0-0,” dalih mantan entrenador Real Madrid, Inter Milan dan FC Porto tersebut. “Tapi, saat duel berjalan, kami merasa harus bermain aman dan tidak kebobolan. Saya tahu kami harus bekerja keras untuk tidak kalah. Tugas kami untuk menghentikan mereka, tim bertahan dengan sangat bagus,” tambah Mou melalui Marca, Rabu (23/4). Bek Atletico, Juanfran, bahkan tak sungkan memberi

69% 0 25 4 6 2 13 5 2 0

WASPADA Kamis 24 April 2014

Chelsea

Penguasaan Bola 31% 0 Skor Akhir 5 Tembakan Total 2 Tembakan Tepat 4 Tembakan Pojok 4 Penyelamatan 16 Pelanggaran 0 Offsides 3 Kartu Kuning 0 Kartu Merah *Sumber ESPN

kali pertama Fernando Torres kembali ke Vicente Calderon, setelah pergi untuk gabung ke Liverpool tahun 2007 silam. Publik tuan rumah pun memberikan sambutan hangat buat striker Spanyol tersebut. “Selama laga Anda harus fokus bertanding, tapi sebelum dan sesudahnya sambutan untuk saya di sini spektakuler. Saya selamanya berterimakasih kepada suporter atas sambutan yang mereka berikan,” tegas Torres. Dia pun menyebut, peluang kedua tim sama-sama terbuka dengan hasil ini. (m15/ant/rtr/fe/uefa)

AP

LIMA pemain bertahan Chelsea sukses meredam mesin gol Atletico Diego Costa di Vicente Calderon Stadium, Madrid, Rabu (23/4) dinihari WIB.

Atleti Alergi Taktik Tamu MADRID (Waspada): Kapten Gabriel ‘Gabi’ Fernandez Arena mengaku, Atletico Madrid alergi dengan taktik bertahan Chelsea pada leg pertama semifinal Liga Champions. Duel di Vicente Calderon Stadium, Selasa (Rabu WIB) tersebut, hanya berakhir 0-0 kendati El Atleti begitu mendominasi permainan. “Kami tidak puas, tapi laga ini masih terbuka. Atletico ingin menang dari awal sampai akhir, tetapi kami alergi menghadapi taktik bertahan mereka,” jelas Gabi, seperti dilansir Football Espana, Rabu (23/4). Baik El Atleti maupun Chelsea, memiliki rekor per-

tahanan terbaik di La Liga dan Liga Premier. Hanya saja Gabi kesal, karena timnya begitu mendominasi permainan dan bahkan mampu melepaskan 25 tembakan, namun tak satu pun yang bersarang di gawang tim tamu. “Kami paham mereka tidak akan mudah dibobol dan kami meninggalkan duel dengan perasaan kesal,” ratap Gabi. Hasil tanpa gol ini membuat Atleti tetap tak terkalahkan di Liga Champions, na-

mun mereka gagal pula menang di kandang untuk pertama kalinya pada musim 2013-2014 ini. “Kami telah mengetahui bagaimana mereka (Chelsea) akan tampil seperti itu, tapi pada akhirnya kami tak bisa mencetak gol. Tentu itu sangat disayangkan,” timpal gelandang Mario Suarez di situs resmi UEFA. “Saya bahkan tak yakin mereka melepaskan tembakan ke gawang. Kami sudah menduga Chelsea akan bermain seperti itu. Sebelumnya pelatih telah mengatakan kepada kami bagaimana laga akan berjalan dan dia tidak keliru,” jelas Suarez. Menurut bek sentral Mi-

randa, hasil 0-0 ini menciptakan drama berbahaya dengan resiko tinggi. Setiap gol berarti kian vital maknanya pada leg kedua di London, 30 April mendatang. “Chelsea bertahan dengan sangat baik dalam permainan taktikal. Mereka datang ke Spanyol dengan mentalitas bertahan, tapi di London nanti mereka akan bermain lebih ke luar dan bisa mengejutkan kami,” beber Miranda. Sedangkan bek kiri Filipe Luis menilai, skor kacamata sudah pas untuk menandai akhir laga. “Chelsea tahu apa yang akan mereka lakukan di sini, begitu pula dengan kami. Chelsea telah mempelajari cara kami bermain,” ujarnya.

sanjungan kepada Mou, yang terlihat sudah mempersiapkan duel ini dengan sangat baik. “Chelsea punya pelatih yang matang melalui Mourinho. Dia mampu mempersiapkan timnya dengan sangat bagus dalam setiap pertandingan,” pujinya lewat CanalPlus. “Kami telah menampilkan permainan yang sangat baik di Eropa dan akan terus berlanjut. Chelsea tentu akan memainkan taktik yang sama sekali berbeda di Stamford Bridge,” jelas Juanfran. Pria 51 tahun itu memang tersohor sebagai pelatih pragmatis, yang mengedepankan hasil akhir ketimbang permainan cantik atau penguasaan bola. Dengan taktik itu pula dia dua kali sukses menjuarai Liga Champions bersama Porto (2004) dan Inter (2010). Di Vicente Calderon, Mou kembali demo dengan menempatkan lima bek Ashley Cole, John Terry, Gary Cahill, Cesar Azpilicueta dan David Luiz sebagai starter. Mereka didukung tiga gelandang bertahan melalui John Obi Mikel, Ramires dan Frank Lampard. Hanya Willian bertipe gelandang penjelajah untuk menunjang kinerja striker Fernando Torres. Alhasil, kombinasi

AP

Bala Biru Media Merah

Sabtu, 26 April (GMT) 11:45 14:00 14:00 14:00 14:00 16:30

Southampton v Everton Fulham v Hull City Stoke City v Tottenham Swansea v Aston Villa West Brom v West Ham Man United v Norwich

Minggu, 27 April (GMT) 11:00 13:05 15:10

Sunderland v Cardiff Liverpool v Chelsea C Palace v Man City

Senin, 28 April (GMT) 19:00

Arsenal v Newcastle

Cech sudah berakhir,” jelas manajer Jose Mourinho melalui Sky Sports, Rabu (23/4). Cedera bermula ketika penjaga gawang Ceko itu berusaha melompat untuk membuang bola hasil tendangan sudut pemain lawan, namun kakinya tersandung Raul Garcia. Cech terjatuh dan langsung mengerang kesakitan sambil memegang lengan kanannya. Menit 70 giliran bek sentral John Terry yang jatuh-bangun menahankan sakit di kakinya. Terry baru digantikan dengan Andre Schurrle menit 73, karena menderita cedera pergelangan kaki. Cederanya dua pilar pertahanan tersebut membuat London Blues dalam kondisi sangat memprihatinkan menatap bigmatch Liga Premier di kandang Liverpool, 27 April mendatang. Karena duel di Anfield nanti sangat krusial dalam perburuan gelar musim ini, maka bala Biru itu bakal menjadi media Si Merah untuk memperkuat kansnya sebagai favorit kampiun. Mourinho sendiri mulai

Menurut entrenador Diego Simeone, dirinya telah mendapat bocoran mengenai taktik bertahan London Blues di Madrid. “Saya sejatinya sudah mendapat informasi yang jitu dari para informan kami. Dengan main bertahan, mereka akan mencuri peluang mencetak gol melalui serangan balik,” ungkapnya. “Untungnya kami sukses mengantisipasinya. Kami tidak dapat mencetak gol untuk memenangkan pertandingan. Ini duel sengit dengan kedua tim sama berjuang untuk sampai ke final,” klaim Simeone. (m15/ant/rtr/goal/espn)

Mourinho Memang Matang umpan pendek El Atleti yang kerap dilakukan Koke, Diego Ribas, Raul Garcia dan Gabi Fernandez, tidak pernah berbuah umpan matang untuk dimanfaatkan Diego Costa. “Harusnya saya berbagi opini tentang Atletico bersama para pemain saya. Saya sering menonton pertandingan mereka. Saat saya tahu hasil undian mempertemukan kami, sejak itu pula saya langsung mempelajari mereka,” beber Mou. “Saya menyiapkan diri untuk menerangkan permainan Atletico kepada pemain saya. Tapi saya tidak ada minat untuk berbagi dengan anda (awak media),” canda pria kelahiran Setubal pada 26 Januari 1963 itu. Tapi hasil tanpa gol di Madrid tersebut, dipastikan memaksa Mourinho mengubah pendekatannya pada leg kedua di Santiago Bernabeu, 30 April mendatang. London Blues mesti bermain lebih terbuka dan berani menyerang untuk mendapatkan gol penentu tiket final. “Ini laga untuk pria sejati, keras dan sangat taktis. Atletico lebih mendominasi, jadi hasil ini sangat penting bagi kami. Hasil ini membuat leg kedua akan ditentukan lewat detaildetail kecil,” papar Mourinho. Meski nantinya minus kapten John Terry, kiper utama Petr

Masalah Mirallas

MADRID (Waspada): Kiper Petr Cech (foto kiri) dan k a p t e n Jo h n Terry (foto kanan), mengalami cedera serius saat membela Chelsea pada laga leg pertama semifinal Liga Champions di markas Atletico Madrid. Cech cedera ketika laga yang berakhir 0-0 itu baru menginjak menit 16 di Vicente Calderon Stadium, Selasa (Rabu WIB), perannya kemudian digantikan Mark Schwarzer. “Musim (kompetisi) Petr

“Mereka menempatkan pemain-pemain tinggi untuk menghentikan bola-bola udara kami. Ini laga yang sangat taktis, leg kedua sepenuhnya masih terbuka. Kami akan berusaha mencetak gol di sana, sambil tetap hati-hati,” tegas Luis. Hanya dua peluang matang Atleti yang tercipta dalam duel ini. Tapi tendangan voli Diego Costa di babak pertama dan tendangan bebas Gabi dari jarak jauh, mampu diamankan kiper Mark Schwarzer, yang menggantikan Petr Cech akibat cedera di babak pertama.

JALUR MENUJU JUARA LIGA PREMIER Liverpool (80) Chelsea (75) K-Man City 3-2 T-Swansea 1-0 —— —— T-Norwich 3-2 K-Sunderland 1-2 K-Chelsea T-Liverpool T-Crys Palace K-Norwich —— —— K-Newcastle T-Cardiff *K = Kandang, T = Tandang menunjukkan isyarat ‘lempar handuk’ untuk menyaingi pasukan Brendan Rodgers, yang kini unggul lima poin atas The Blues di puncak klasemen dengan sisa tiga pertandingan lagi. “Saya akan bicara kepada manajemen tentang prioritas. Saya bukanlah orang yang paling penting di tim ini,” ungkap Mou, yang sepertinya lebih ingin memburu trofi Liga Champions. “Saya akan menjalankan apa yang menjadi keputusan klub. Saat bertemu Liverpool, saya ingin menurunkan pemain yang tidak tampil Rabu kemarin, namun saya harus bicara kepada klub,” papar

Man City (74) T-Liverpool 2-3 K-Sunderland 2-2 K-West Brom 3-1 T-Crys Palace T-Everton K-Aston Villa K-West Ham

pria Portugal tersebut. Rotasi besar-besaran memang mesti dilakukan Mourinho, mengingat Biru gantian menjamu Atletico pada 30 April. “Saya tidak bisa memutuskan sendiri. Saya hanya satu potong, saya hanya pelatih dan tidak lebih,” dalih Mourinho. “Kami mewakili sepakbola Inggris dan menjadi satu-satunya tim Inggris di kompetisi Eropa. Spanyol punya empat dan mereka semua diberi kondisi untuk meraih kesuksesan. Saya tahu apa yang akan saya lakukan, tetapi saya bukan klub,” pungkasnya. (m15/ant/afp/sky/espn)

LONDON (Antara/AFP): Harapan Everton menembus zona Liga Champions menipis akibat Kevin Mirallas (foto) terpaksa mengakhiri musim lebih cepat, karena mengalami cedera pangkal paha. “Kevin Mirallas akan absen pada tiga pertandingan tersisa musim ini,” demikian bunyi pernyataan di situs resmi Everton, Rabu (23/4). Winger asal Belgia berumur 26 tahun harus ditandu keluar lapangan setelah mencetak gol kedua ketika The Toffees menang 2-0 atas Manchester United akhir pekan lalu di Liga Premier. Mirallas tampil impresif belakangan ini, mencetak tiga gol dan melepas tiga assist pada lima penampilan terakhir-

Cech dan gelandang veteran Lampard, The Blues punya senjata simpanan untuk ‘membunuh’ Los Rojiblancos. Demba Ba, Oscar, Andre Schurrle dan Eden Hazard yang segera sembuh, jadi jaminan mutu untuk merobek jala gawang Thibaut Courtuis. “ Hasil imbang bukanlah luar biasa, tetapi hasil ini gambaran dari jalannya pertandingan. Jika kami bisa mencetak gol, maka itu bagus. Tapi kami tidak bisa, maka semuanya akan ditentukan di Stamford Bridge,” pungkas Mourinho. *Jonny Ramadhan Silalahi

FIFA Tunda Sanksi Barca

Reuters

nya untuk membantu Everton mendekati finis di empat besar, bersaing dengan Arsenal. “Itu bukan cedera besar, tapi masalahnya memerlukan (pemulihan) sampai lima atau enam pecan. Kelihatannya itulah skenario terburuk,” ujar manajer Everton, Roberto Martinez. Mirallas berarti absen melawan Southampton, Manchester City, dan Hull City.

ZURICH (Antara/AFP): FIFA menunda sanksi larangan transfer pemain yang dijatuhkan kepada Barcelona, setelah klub itu mengajukan banding terkait kasus transfer Neymar Junior. Ketua Komite Banding FIFA Larry Mussenden, Rabu (23/4), menyetujui bahwa dengan banding itu berarti hukuman El Barca ditangguhkan. Menurut Mussenden, kompleksitas masalah, tanggal awal periode pendaftaran berikutnya pada 1 Juli 2014 dan kenyataan Komite Banding FIFA, tampaknya tidak dalam posisi untuk mengambil keputusan pada masalah utama. “Sehingga banding klub di depan Pengadilan Arbitrasi Olahraga masih akan diputuskan sebelum dimulainya masa pendaftaran pemain berikutnya,” jelas Mussenden. Komite Disiplin FIFA menjatuhkan hukuman larangan transfer pemain pada 2 April, setelah menyatakan Barca bersalah atas pelanggaran serius pada aturan pemain di bawah umur. Mereka juga mendenda Asosiasi Sepakbola Spanyol karena memperbolehkan kontrak tersebut. Barca sudah mengajukan banding terhadap apa yang akan menjadi pembatasan dramatis dalam kegiatan transfer mereka dan meminta hukuman itu ditangguhkan. Sebab mereka sangat ingin membeli kiper baru untuk menggantikan posisi Victor Valdes.

Motivasi Final Marchisio

Semifinal I Liga Europa Malam Ini (GMT) Sevilla (Spanyol) v Valencia (Spanyol) Benfica (Portugal) v Juventus (Italia) *SCTV live mulai pkl 02:05 WIB

AFP

19:05 19:05

AFP

SETELAH melewati hadangan Lyon di perempatfinal, Claudio Marchisio (kanan) cs ingin melaju ke final dan menjuarai Liga Europa.

TURIN, Italia (Waspada): Prospek tampil di kandang sendiri pada final Liga Europa, memperkuat motivasi para punggawa Juventus untuk menembus partai puncak sekaligus menjadi jawara. “Kami tahu (final di Turin] sejak awal, ketika kami memulai penyisihan grup Liga Champions,” jelas gelandang JuveCluadio Marchisio lewat laman resmi UEFA, Rabu (23/4). Bianconeri tersingkir di babak penyisihan grup Liga Champions, tetapi terus melaju di Liga Europa. Agenda final di Juventus Stadium pun dengan cepat memulihkan luka Si Nyonya Tua. “Kami tidak lolos dan harus melakoni fase gugur di Liga Europa. Fakta bahwa final akan digelar di rumah sendiri

memberikan motivasi ekstra,” ungkap Marchisio. Namun lawan Super Juve di semifinal, SC Benfica, pun punya motivasi tak kalah besar. Setelah sukses memastikan diri menjuarai Super Liga Portugal, akhir pekan lalu, pelatih Jorge Jesus malah langsung meminta pemain Benfica segera fokus menatap kunjungan pasukan Conte. “Kami telah mencapai target utama kami musim ini, tapi musim ini bisa berakhir dengan kebahagiaan lebih ketimbang sekarang. Jadi mari kita tunda selebrasi dan berkonsentrasi pada laga melawan Juventus,” tegas Jesus. Os Aguias menambah rekor sebagai kolektor trofi terbanyak Liga Portugal dengan 33 titel, sehingga diyakini sangat bersemangat menularkan suksesnya ke Benua Biru. “Kami memiliki grup fantastis dan tak pernah menyerah,” pungkas Jesus. (m15/goal/uefa)


Sport

WASPADA Kamis 24 April 2014

A11 Target Tinggi PS Pidie Jaya

Waspada/Sapriadi

MANAJER Marketing PS Bintang Jaya, Armen Margolang didampingi Sekretaris Tim H Azwar Mahmud dan pelatih baru Abdul Rahman Gurning (2 kiri) memberi keterangan kepada wartawan di Stadion Mutiara Kisaran, Rabu (23/4).

Kijang Gunung Ganti Pelatih

MEUREUDU (Waspada): PS Pidie Jaya (Pijay) memasang target tinggi dalam mengikuti kompetisi Divisi I PSSI musim ini. Tim dari kabupaten termuda di Aceh itu target promosi ke Divisi Utama Liga Indonesia musim depan, meski baru dua tahun berkiprah di Divisi I. “Bupati Pidie Jaya, H Aiyub Abbas, mengharapakan kepada manajemen tim agar tidak main-main dalam mempersiapkan tim. Manajemen harus serius menangani tim, sehingga target promosi bisa terpenuhi,” ujar Sekum PS Pijay, Helmi Daud SE, Rabu (23/4). Menurutnya, kompetisi Divisi I sekarang hanya khusus bagi pemain berusia di bawah 23 tahun. Sehingga kekuatan tim hampir merata dan pihaknya yakin PS Pijay nantinya bisa meraih tiket promosi ke Divisi Utama Liga

Indonesia tahun depan. “Harapan berlaga di kasta kedua kompetisi sepakbola nasional juga menjadi keinginan semua kalangan. PS Pijay sudah melewati tahapan Divisi III, Divisi II, dan saat ini akan berjuang menjadi yang terbaik di Divisi I,” tambah Helmi. Seperti diketahui, dalam kompetisi Divisi I tahun ini, PS Pijay masuk Grup I bersama PSGL Gayo Lues sebagai tuan rumah, Persal Tapaktuan (Aceh Selatan), Persidi Idi (Aceh Timur), PSAB Aceh Besar, dan Aceh Utara FC. Menghadapi ketatnya kompetisi musim ini, skuad Malem Dagang terus melakukan persiapan. PS Pijay sudah memilih 22 pemain inti hasil seleksi beberapa waktu lalu. Para pemain muda itu didominasi putra daerah Pidie Jaya. (b09)

Tetapkan A Rahman Gurning KISARAN (Waspada): PS Bintang Jaya memberhentikan Zulkhairi Lubis sebagai pelatih kepala untuk digantikan Abdul Rahman Gurning. Kabar yang berhembus, pergantian itu dampak dari kegagalan skuad Kijang Gunung meraih poin penuh saat menjamu Persiraja Banda Aceh. Seperti diketahui, PS Bintang Jaya gagal mengemas poin penuh setelah ditahan Laskar Rencong 1-1 dalam laga lanjutan Divisi Utama Liga Indonesia 2014 Grup I di Stadion Mutiara Kisaran, Selasa (22/ 3). Tidak hanya itu, Bintang

Jaya juga gagal mencuri poin di kandang PSPS Pekanbaru dalam laga perdananya pada 15 April lalu. CEO PS Bintang Jaya, H Erwis Edi Pauja Lubis melalui Manajer Marketing Armen Margolang didampingi Sekre-

232 Peserta O2SN SLTP Bireuen BIREUEN (Waspada): Kadis P dan K Bireuen, Drs Nasrul Yuliansyah MPd diwakili Kabid Dikdas Abdullah SPd, membuka resmi Olimpiade Olahraga Siswa Nasional (O2SN) tingkat Sekolah Lanjutan Tingkat Pertama (SLTP) Kabupaten Bireuen, Rabu (23/4). Dalam acara pembukaan O2SN di Lapangan Sekolah Sukma Bangsa Cot Keutapang, Kecamatan Jeumpa itu, Abdullah menyampaikan penghargaan dan terima kasih kepada para Kepala UPTD, Kasek serta pembina olahraga di masing-masing UPTD yang telah mengirim utusannya untuk bertarung dalam enam cabang O2SN 2014. Keenam cabang olahraga dimaksud adalah atletik, bulutangkis, catur, bola voli, karate, dan pencak silat. Pertandingan akan berlangsung hingga Kamis (24/4) ini di dua lokasi, yakni di Sekolah Sukma Bangsa dan GOR Geulumpang Payong Kecamatan Jeumpa. “O2SN kali ini untuk mendukung pembinaan olahraga pelajar. Atlet-atlet terbaik dari event ini berhak mengikuti O2SN tingkat Provinsi Aceh. Sedangkan UPTD yang tampil sebagai juara umum berhak atas piala bergilir dan dan pembinaan. (b12)

taris Tim H Azwar Mahmud, saat konferensi pers di Stadion Mutiara Kisaran, Rabu (23/4), enggan menjelaskan prihal pergantian Zulkhairi. Armen berkilah jika pergantian pelatih adalah masalah internal. Saat ini pihak manajemen hanya fokus mengevaluasi tim, agar PS Bintang Jaya bisa tampil lebih baik. Dan pergantian pelatih menjadi bagian dari penyegaran tim. “Pergantian pelatih dan pemain itu hal biasa. Selanjutnya kita fokus membenahi tim agar dapat tampil lebih baik, mengingat kita punya target maksimal tahun ini, yakni merebut tiket promosi ke In-

donesian Super League (ISL),” ucap Armen. Setelah ditetapkan sebagai pelatih baru PS Bintang Jaya, Abdul Rahman Gurning, menyatakan siap mengemban amanah dan tugas barunya bersama Kijang Gunung. Dia mengaku segera mengkaji komposisi pemain yang ada saat ini. Disinggung kemungkinan Bintang Jaya akan merekrut pemain baru, Rahman belum bisa memastikan karena dirinya masih mengevaluasi kemampuan pemain yang ada saat ini. “Tapi tidak tertutup kemungkinan kami akan merekrut pemain baru jika tim membutuhkan,” jelasnya.

Soal stamina pemain yang dinilai menjadi penyebab kegagalan Bintang Jaya meraup poin penuh dari Persiraja, Rahman mengaku akan berusaha meningkatkan stamina pemain, walau waktunya singkat karena pada Jumat (25/4) besok, sudah harus menghadapi PSAP Sigli. Begitu pun, Rahman berani menargetkan tiga poin saat menjamu PSAP. “Kita akan gunakan semua cara yang positif agar Bintang Jaya bisa menang dalam laga nanti,” pungkas Rahman yang sebelumnya sukses membawa PSPS Pekanbaru promosi ke ISL. (a15)

Lima Tim Raih Poin Sempurna Turnamen Futsal Pelajar BANDA ACEH (Waspada): Lima tim meraih nilai sempurna pada dua pertandingan hari pertama turnamen futsal pelajar se-Kota Banda Aceh memperebutkan Piala Bergilir Wagub Aceh di Diaz Sport Center, Rabu (23/4). Kelima tim dimaksud adalah SMA Fatih Bilingual School dan SMAN 6 di Grup B, SMAN 9 dan SMAN 4 (Grup C) serta SMAN 10 Fajar Harapan (Grup D). Kelimanya sukses mengantongi nilai 6 dari dua kemenangan. SMA Fatih berhasil memuncaki klasemen Grup B karena menang selisih gol dari

SMAN 6. Begitu juga SMAN 9 yang unggul selisih gol dari SMAN 4 di posisi pertama Grup C. SMAN 10 Fajar Harapan memimpin di Grup D. Sedangkan Grup A, SMAN 5 yang unggul selisih gol dari SMAN 1 berada di peringkat pertama dengan mengemas 4 poin. Turnamen yang diikuti 20 tim ini menyediakan hadiah dana pembinaan total Rp46 juta, masing-masing Rp15 juta untuk juara I, Rp10 juta (juara II), Rp7 juta (juara III), dan Rp5 juta (juara IV). Panitia juga menyiapkan hadiah untuk top skor Rp2 juta, pemain terbaik Rp2 juta, dan tim terbaik Rp5

juta. Ketua Panitia, Azhar SH, mengatakan pelaksanaan turnamen di hari pertama berjalan mulus tanpa ada kendala berarti. “Hanya saja, tadi ada insiden kecil, di mana salah seorang pemain terpaksa dirujuk ke RSUZA akibat mengalami patah tangan,” ujarnya. Sebelumnya, turnamen dibuka resmi Staf Ahli Gubernur Bidang Pemerintahan, Ridwan Hasan SH MH didampingi Plt Kadispora Aceh Asnawi SPd MPd, Ketua KONI Aceh H Zainuddin Hamid, serta para Kabid di jajaran Dispora Aceh. (b04)

Apresiasi Buat Liga Futsal STIK-P

Waspada/Dede Juliadi

SISWA SMPN 4 Langsa, Faturahman (kanan), saat bertanding di ajang O2SN Kota Langsa dan berhasil tampil sebagai juara.

Faturahman Wakil Kota Langsa LANGSA (Waspada): Siswa kelas X SMP Negeri 4 Langsa, Faturahman, akan mewakili Kota Langsa dalam Olimpiade Olahraga Siswa Nasional (O2SN) cabang catur tingkat Provinsi Aceh. Itu setelah Faturaman tampil juara di tingkat Kota Langsa, baru-baru ini. “Sebelumnya, Faturahman kami utus mengikuti O2SN Kota Langsa karena kemampuannya dalam bermain catur. Dia kerap dengan mudah mengalahkan para guru saat kemampuannya diuji,” ujar Kepala SMPN 4 Langsa, Sopian Hamid, Rabu (23/4). Dikatakan, saat ini Faturahman dalam masa pembinaan sekolah untuk terus meningkatkan kemampuan lewat latihan rutin. Faturahman mempelajari permainan catur lewat komputer, khususnya untuk mendalami strategi jitu mengalahkan lawan. “Jika melihat dari permainan Faturahman yang terus meningkat, kami optimis dia bisa juara di tingkat Provinsi Aceh dan tampil di tingkat nasional. Untuk itu kami berharap dukungan dari semua pihak, khususnya Pemko Langsa dan Dinas Pendidikan,” ucap Sopian. (m43)

Problem Catur

MEDAN (Waspada): Kegiatan Liga Futsal khusus internal civitas akademika Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) 2014 yang digelar dalam rangka memeriahkan Dies Natalis ke-27, mendapat apresiasi dari sejumlah kalangan, termasuk mantan wasit Sumut M Ishak Siregar. Ishak mengatakan liga futsal yang digelar setiap tahunnya sangat positif, khususnya bagi mahasiswa. Tentu, peserta yang terdiri atas mahasiswa, alumni, dan dosen di STIK-P itu dapat lebih menjalin silaturahim dan menjaga kekeluargaan, apalagi kegiatannya juga tergolong ber-

gengsi di kampus orange itu. “Jujur masing-masing peserta pasti punya kesibukan, makanya saya salut meskipun sibuk mereka tetap ada waktu berkumpul bersama untuk main futsal. Selain itu, kegiatan ini pastinya mengajak kita lebih suka berolahraga. Memang banyak kegiatan seperti ini di kampus lain, tapi kebanyakan tidak bertahan lama, berbeda dengan STIK-P yang sudah rutin dan memasuki tahun kedelapan,” terang pria yang telah berprofesi sebagai wasit sejak 1983 ini, Rabu (23/4). Ditambahkan, ini bukan pertama kalinya liga futsal STIK-P digelar, semakin tahun

Waspada/Arianda Tanjung

TTS TOPIK

kegiatan ini juga dikemas semakin menarik seperti tahun ini bertemakan ‘Piala Dunia’. Normansyah, wasit lainnya, mengakui gelaran liga futsal STIK-P selalu menghadirkan kejutan dan warna baru. “Ciri khas peserta wajib memakai kostum klub atau negara menjadikan pertandingan jadi enak ditonton. Tak hanya tim putra, tim putri juga demikian. Meski sebatas internal kampus, penyelenggaraannya tergolong profesional dan mengikuti aturan yang sebenarnya,” tambah Norman. “Satu hal lagi yang saya apresiasi, mungkin STIK-P salah satu kampus yang terus giat mengadakan futsal putri. Ke depan, saya harap liga ini terus dipertahankan, agar suasana persaudaraan di STIK-P semakin erat,” pungkas Ishak sembari memberi acungan jempol kepada panitia dan tim jawara. (cat) PUKET II STIK-P Suprapti Indah Putri SP MIKom didampingi Puket III Austin Antariksa SSos MIKom menyerahkan cenderamata kepada wasit M Ishak Siregar dan Normansyah.

Waspada/Arianda Tanjung

STRIKER Pro Duta FC, Ghozali Siregar, termotivasi memberikan kemenangan bagi timnya saat menghadapi PS Kwarta di Stadion Teladan Medan, Jumat (25/4) besok.

Motivasi Tinggi Ghozali, Donny MEDAN (Waspada): Striker Pro Duta FC, Ghozali Siregar, termotivasi memberikan kemenangan bagi timnya saat menghadapi PS Kwarta Medan dalam laga lanjutan kompetisi Divisi Utama Liga Indonesia 2014 Grup I di Stadion Teladan Medan, Jumat (25/4) besok. Ghozali pun mengaku mengetahui kekuatan PS Kwarta yang saat ini dibesut Slamet Riyadi. Diakuinya, saat ini banyak perubahan terjadi di skuad Burung Sumatera, khususnya di lini pertahanan dan tengah dengan mendatangkan sejumlah amunisi baru. Namun Ghozali menilai skuad Pro Duta tidak kalah kualitas dengan Kwarta. Ghozali pun menilai kedua tim punya peluang sama memenangkan laga dan dia mengingatkan rekan-rekannya untuk tampil maksimal di pertandingan besok. “Fokus dan tenang itu yang terpenting, agar instruksi yang diberikan pelatih bisa dijalankan dengan baik. Tapi hingga saat ini memang

KONI Turun Target Jadi 4 Emas JAKARTA (Waspada): Komite Olahraga Nasional Indonesia (KONI) menurunkan target dari sembilan medali emas menjadi empat medali emas saja dalam ajang Asian Games di Incheon, Korea Selatan, September mendatang. “Target 9 emas akan sulit tercapai karena ada berbagai persoalan selama persiapan tim dan atlet, seperti uang saku yang terlambat, pengadaan peralatan latihan yang pas-pasan, serta suplai suplemen dan multivitamin tidak optimal,” ujar Ketua Umum KONI sekaligus Ketua Dewan Pelaksana Prima, Tono Suratman, Rabu (23/4). “Dukungan pemerintah saja kurang, bagaimana bisa target tinggi? Justru yang paling masuk akal itu adalah target empat medali emas seperti di Guangzhou empat tahun lalu,” ucap Tono, tanpa merincikan cabor apa saja

8

7

6

5

4

3

2

1

A

B

C

D

E

F

G

H

berpotensi meraih medali emas. Sebelumnya di Asian Games 2010, Indonesia merebut 4 medali emas dari dua cabang, yakni satu emas dari bulutangkis dan tiga emas dari perahu naga. Hal berbeda diungkapkan Kasatlak Prima, Suwarno. Dia justru mengatakan dari 21 cabang yang diproyeksikan untuk Asian Games, 14 cabor di antaranya menyanggupi menyumbang emas. Cabor dimaksud di antaranya bulutangkis, wushu, equestrian (berkuda), boling, dayung, balap sepeda (BMX), soft tenis, dan sepak takraw. “Manajer dari 14 cabang olahraga ketika menanggapi soal medali, sudah menyatakan menyanggupi bisa meraih satu medali emas. Kalau ditanya realistis, itu kan mereka para pengurus cabor yang menyanggupi. Kalau saya si tetap optimistis,” pungkas Suwarno. (m42/ant)

UPT Ranto Dominasi O2SN Atim IDI (Waspada): Unit Pelaksana Tugas (UPT) Disdik Ranto Selamat tampil sebagai juara umum Olimpiade Olahraga Siswa Nasional (O2SN) Kabupaten Aceh Timur tahun 2014, di SDN 1 Kuta Baro, Kecamatan Idi Tunong, Selasa-Rabu (22-23/4). Ketua Panpel O2SN Aceh Timur, Agussalim, menyebutkan UPT Ranto Selamat menjadi juara umum setelah meraih medali emas cabor atletik putra dan putri, catur putra dan putri, bulutangkis ganda putra, sejumlah perak dan

OLAHRA GA OLAHRAGA

perunggu. Untuk cabor sepakbola yang diikuti tujuh UPT, tampil sebagai juara adalah UPT Julok, runner-up UPT Idi, dan posisi ketiga diduduki UPT Peureulak. “Seluruh peserta yang tampil sebagai juara akan dibina lebih lanjut untuk mengikuti O2SN tingkat Provinsi Aceh pada Mei mendatang. Sedangkan sepakbola tahun ini tidak dipertandingkan di tingkat provinsi,” kata Agussalim. (b24)

Sudoku

Putih melangkah, mematikan lawannya enam langkah.

Jawaban di halaman A2.

belum ada instruksi apapun diberikan pelatih terkait siapa saja pemain lawan harus diwaspadai,” katanya. “Tapi yang jelas kami punya motivasi tinggi tampil di kandang sendiri dan targetnya adalah kemenangan. Apalagi di dua pertandingan sebelumnya kami hanya bermain seri,” ujar Ghozali, menambahkan mencetak gol prioritas kedua baginya karena terpenting tim menang. Gelandang Donny F Siregar juga mengaku termotivasi memberikan kemenangan bagi Pro Duta dalam laga derby Kota Medan. Menurutnya, kemenangan menjadi harga mati demi mengangkat posisi Pro Duta di klasemen sementara Grup I. “Kami sudah mempersiapkan segalanya baik secara teknis maupun mental. Hanya dengan kemenangan kami bisa mendongkrak posisi Pro Duta ke papan atas klasemen dan menjaga asa lolos ke babak 16 Besar,” ujar Donny. (cat)

MENDATAR

MENURUN

1. Klub sepakbola Spanyol, disisihkan Atletico Madrid di Liga Champions 2014. 5. Usia, biasa disingkat “U” dalam turnamen sepak bola. 8. Liga Italia dalam bahasa Itali (dua suku kata, tulis tanpa spasi). 10. Singkatan National Basketball Association. 11. Kota di China penyelenggara pesta olahraga Asian Games tahun 2010. 12. Tulis AS——, klub sepakbola Italia. 13. AC——, klub sepak bola Italia. 14. International Association of Athletics Federations. 16. Negara tuan rumah turnamen tenis “Melbourne Cup”. 17. Negara tempat pengadilan arbitrase olahraga internasional. 19. Kode negara Andorra dari Komite Olimpiade Internasional (IOC). 21. Sundul bola. 22. Kode negara Tanzania dari IOC. 23. Klub sepakbola Jerman, didahului kata Bayer 04. 25. Klub sepakbola Inggris, semifinalis Liga Champions 2014. 26. Sepedamotor balap cross country.

1. Cabang olahraga Asian Paragames 2010 dimana Indonesia memperoleh emas. 2. Kode negara Chad dari IOC. 3. Kode negara Libya. 4. Pesta olahraga penyandang cacat di China tahun 2010 (lihat klu No. 1 Menurun). 6. Singkatan Menteri Pemuda dan Olahraga. 7. Kode negara Republic South Africa. 9. ———Kasparov, Grandmaster Soviet, mantan juara dunia catur. 11. Pertandingan (jamak Inggris). 14. Kode negara Italia dari FIFA. 15. Negara asal petinju Manny “Pacman” Pacquiao. 16. Klub sepakbola Inggris, disponsori Emirates. 18. Stop——, jam penghitung kecepatan. 20. Reli paling ganas (jarak 9000 Km dari Argentina ke Chile tahun 2011). 21. Permainan olahraga beregu dengan satu bola kecil dan satu alat pemukul. 24. Kode negara El Salvador.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan kurang dari 15 menit. Jawabannya di halaman A2 kolom 1.

9

3

7 5 4 9 8 3 1

3 7 4 1 2 3

2

1 5 7 7 2 5 2

8 6 9 9 7 6 3

1

6 ****241


Sport

WASPADA Kamis 24 April 2014

A11

George Jadi Buah Bibir INDIANAPOLIS, AS (Waspada): Permainan gemilang Paul George dalam Game 2 NBA Playoff, Rabu (23/4), menjadi buah bibir. Hal ini disebabkan George berperan menjadi motivator kemenangan Indiana Pacers atas Atlanta Hawks. Kalah di game perdana, Pacers memasuki pertandingan kedua dengan tensi tinggi. Maklum, sehari sebelumnya Evan Turner dan Lance Stephenson terlibat keributan kecil saat latihan di Bankers Life Fieldhouse. Beruntung, kemenangan yang menjadikan seri imbang 1-1 sedikit meredam ketegangan di PENAMPILAN apik Paul George bagi Indiana Pacers di Game 2 NBA Playoff melawan Atlanta Hawks, Rabu (23/4), menjadi bahan pembicaraan orang banyak. -AP-

ruang ganti pemain. Berkat George, Pacers menang 101-85. Publik tuan rumah pun menjadi saksi kegemilangan George yang menoreh 27 angka 10 rebound. Di mata coach Pacers, Frank Vogel, George muncul di saat timnya memang butuh pemimpin. “Permainan apik Paul (George) itulah yang menjadi alasan dia layak menjadi MVP. Paul selalu melakukan segalanya, dia bertahan pemain terbaik tim lawan, rebound, mengejar bola, dan memasukkan poin. Jika tampil seperti itu tiap pertandingan, Paul benar-benar pemain yang lengkap dan salah satu terbaik di NBA,” puji Vogel. Pacers sendiri sempat tertinggal di awal kuarter ketiga, namun George tak tinggal diam. Tak mau dipermalukan di

kandang untuk kedua kali, anak-anak Pacers bangkit dan tiada henti mencetak poin demi poin ke keranjang Hawks. Luis Scola menambah 20 poin bagi Pacers yang juga mendapat donasi 15 angka dari George Hill. Top skor Hawks di Game 1, Jeff Teague, kali ini hanya mendulang 14 poin. Pemain paling subur bagi Hawks disandang Paul Millsap dengan 19 angka. Toronto Raptors juga sukses menyamakan kedudukan usai menang atas Brooklyn Nets 100-95. DeMar DeRozan menjadi pahlawan Raptors dengan 30 poin, sedangkan Nets dipimpin Paul Pierce dengan 15 angka. Saat tim lain meraih kemenangan untuk menyamakan seri, Chicago Bulls malah kembali tersungkur dan tertinggal 0-2 dari Washington Wizards. Lewat overtime, tim Banteng Merah tumbang 99-101. Bradley Beal memimpin Wizards kala mencetak 26 angka dan predikat top skor Bulls hasil mengemas 25 poin dipegang DJ Augustin. (m33/ap)

Perubahan Skrenario PS Kwarta MEDAN (Waspada): Usai mencuri satu poin dari PSMS Medan dalam laga Selasa (22/4) lalu, PS Kwarta kembali menghadapi ujian berat saat menghadapi Pro Duta FC di Stadion Teladan Medan, Jumat (25/4) besok. Namun pelatih PS Kwarta, Slamet Riyadi, mengaku menyiapkan skenario perubahan. Terutama di sektor tengah dan depan, Slamet harus merombak skuadnya. Cederanya Zulkarnain dan Ismail membuat komposisi ideal yang selama ini dipersiapkan berubah. Namun penggantinya juga diyakini tidak kalah

berkualitas. Ade Rio Karo Sekali tampaknya menjadi pilihan menggantikan Ismail. Pada laga kontra PSMS, pemain yang akrab disapa Karo itu dinilai bermain cukup apik sejak masuk di menit 12 di sektor sayap kanan. “Karo baru pertama kali main di level Divisi Utama.

Awalnya agak sedikit kaget. Tapi setelah 10 menit babak kedua dia bisa lebih tenang. Saya pikir dia nanti bisa untuk diandalkan,” ujar Slamet. Selain itu, pada babak kedua ketika menghadapi PSMS, Slamet melakukan perubahan krusial. Jorge yang awalnya menempati pos striker dikembalikan ke tengah. Sementara Antoni diminta main lebih melebar ke sayap kiri. Praktis keseimbangan lini tengah dijaga Suandi dan Ahmad Junaedi. “Di babak kedua memang saya mengembalikan posisi

MANAJER Marketing PS Bintang Jaya, Armen Margolang didampingi Sekretaris Tim H Azwar Mahmud dan pelatih baru Abdul Rahman Gurning (2 kiri) memberi keterangan kepada wartawan di Stadion Mutiara Kisaran, Rabu (23/4).

Jorge dari striker ke tengah. Karena itu kita bisa memenangkan lini tengah. Suandi dan Junaedi saya duetkan sehingga mereka yang mengatur ritme. Jadi Jorge lebih fokus membantu serangan,” kata mantan pelatih Pro Duta FC itu. Perubahan seperti itu sangat mungkin dilakukan kembali oleh Slamet saat bersua Pro Duta. Pasalnya permainan Burung Sumatera memang jauh lebih menggigit di babak kedua. Selain itu, diakui Slamet timnya lambat panas dan hal itu tak boleh lagi terjadi. Menghadapi Pro Duta,

Waspada/Sapriadi

Rahman Gurning Jadi Pelatih Kijang Gunung KISARAN (Waspada): PS Bintang Jaya memberhentikan Zulkhairi Lubis sebagai pelatih kepala untuk digantikan Abdul Rahman Gurning. Kabar yang berhembus, pergantian itu dampak dari kegagalan skuad Kijang Gunung meraih poin penuh saat menjamu Persiraja Banda Aceh. Seperti diketahui, PS Bintang Jaya gagal mengemas poin penuh setelah ditahan Laskar Rencong 1-1 dalam laga lanjutan Divisi Utama Liga Indonesia 2014 Grup I di Stadion Mutiara Kisaran, Selasa (22/ 3). Tidak hanya itu, Bintang Jaya juga gagal mencuri poin di kandang PSPS Pekanbaru

dalam laga perdananya pada 15 April lalu. CEO PS Bintang Jaya, H Erwis Edi Pauja Lubis melalui Manajer Marketing Armen Margolang didampingi Sekretaris Tim H Azwar Mahmud, saat konferensi pers di Stadion Mutiara Kisaran, Rabu (23/4), enggan menjelaskan prihal pergantian Zulkhairi. Armen berkilah jika pergantian pelatih adalah masalah internal. Saat ini pihak manajemen hanya fokus mengevaluasi tim, agar PS Bintang Jaya bisa tampil lebih baik. Dan pergantian pelatih menjadi bagian dari penyegaran tim.

“Pergantian pelatih dan pemain itu hal biasa. Selanjutnya kita fokus membenahi tim agar dapat tampil lebih baik, mengingat kita punya target maksimal tahun ini, yakni merebut tiket promosi ke Indonesian Super League (ISL),” ucap Armen. Rahman mengaku segera mengkaji komposisi pemain yang ada saat ini. Disinggung kemungkinan Bintang Jaya akan merekrut pemain baru, Rahman belum bisa memastikan karena dirinya masih mengevaluasi kemampuan pemain yang ada saat ini. “Tapi tidak tertutup kemungkinan kami akan me-

Motivasi Tinggi Ghozali, Donny MEDAN (Waspada): Striker Pro Duta FC, Ghozali Siregar, termotivasi memberikan kemenangan bagi timnya saat menghadapi PS Kwarta Medan dalam laga lanjutan kompetisi Divisi Utama Liga Indonesia 2014 Grup I di Stadion Teladan Medan, Jumat (25/4). Ghozali pun mengaku mengetahui kekuatan PS Kwarta yang saat ini dibesut Slamet Riyadi. Diakuinya, saat ini banyak perubahan terjadi di skuad Burung Sumatera, khususnya di lini pertahanan dan tengah dengan mendatangkan sejumlah amunisi baru. Namun Ghozali menilai skuad Pro Duta tidak kalah kualitas dengan Kwarta. Ghozali pun menilai kedua tim punya peluang sama memenangkan laga dan dia mengingatkan rekan-rekannya untuk tampil maksimal di pertandingan besok. “Fokus dan tenang itu yang terpenting, agar instruksi yang diberikan pelatih bisa dijalankan dengan baik. Tapi hingga saat ini memang belum ada instruksi apapun diberikan pelatih terkait siapa saja pemain lawan harus diwaspadai,”

katanya. “Tapi yang jelas kami punya motivasi tinggi tampil di kandang sendiri dan targetnya adalah kemenangan. Apalagi di dua pertandingan sebelumnya kami hanya bermain seri,” ujar Ghozali, menambahkan mencetak gol prioritas kedua baginya karena terpenting tim menang. Gelandang Donny F Siregar juga mengaku termotivasi memberikan kemenangan

bagi Pro Duta dalam laga derby Kota Medan. Menurutnya, kemenangan menjadi harga mati demi mengangkat posisi Pro Duta di klasemen sementara Grup I. “Kami sudah mempersiapkan segalanya baik secara teknis maupun mental. Hanya dengan kemenangan kami bisa mendongkrak posisi Pro Duta ke papan atas klasemen dan menjaga asa lolos ke babak 16 Besar,” ujar Donny. (cat)

Waspada/Arianda Tanjung

STRIKER Pro Duta FC, Ghozali Siregar, termotivasi memberikan kemenangan bagi timnya saat menghadapi PS Kwarta di Stadion Teladan Medan, Jumat (25/4) besok.

TTS TOPIK

Problem Catur

rekrut pemain baru jika tim membutuhkan,” jelasnya. Soal stamina pemain yang dinilai menjadi penyebab kegagalan Bintang Jaya meraup poin penuh dari Persiraja, Rahman mengaku akan berusaha meningkatkannya, walau waktunya singkat karena pada Jumat (25/4) be-sok, sudah harus menghadapi PSAP Sigli. Begitu pun, Rahman berani menargetkan tiga poin saat menjamu PSAP. “Kita akan gunakan semua cara yang positif agar Bintang Jaya bisa menang dalam laga nanti,” pungkas Rahman yang sebelumnya sukses membawa PSPS Pekanbaru promosi ke ISL. (a15)

Slamet menganilisis kekuatan mantan klubnya yang mengandalkan kecepatan para penyerang dan permainan ball possesion. Karena itu ia akan coba mempersempit ruang gerak. “Mereka punya penyerang-penyerang yang cepat seperti Ghozali, Rahmad,dan Fiwi. Pemain bawah kita harus lebih ketat lagi soal penjagaan terhadap lawan. Tidak boleh dikasih jarak atau terlalu mudah mereka menguasai bola,” bebernya. (cat)

Waspada/Arianda Tanjung

PELATIH PS Kwarta, Slamet Riyadi, akan melakukan perubahan skema permainan dalam menghadapi Pro Duta FC di Stadion Teladan Medan, Jumat (25/4) besok.

Optimis Sumut Juara Kejurnas Sepakbola PPLP MEDAN (Waspada): Manajer tim sepakbola pelajar Sumut, Hadi Khairul (foto), mengaku optimis timnya menjuarai Kejurnas Antar Pusat Pendidikan Latihan Pelajar (PPLP) di Kabupaten Bogor, Jawa Barat, 24 April hingga 1 Mei mendatang. “Ini tentunya bukan hanya optimis manajer tim, namun masyarakat Sumut agar tim sepakbola pelajar Sumut dapat memperoleh juara di Kejurnas PPLP,” kata pria akrab disapa Hadi Bento di kantornya Jl Setia Budi Medan, Rabu (23/4). Hadi Bento juga menjadi Manajer Tim Sumut saat menjuarai Pekan Olahraga Pelajar Nasional (Popnas) di Riau/ 2011 dan di Jakarta/2013 serta Popwil se-Sumatera/2013 di Medan. Namun Hadi Bento belum merasa puas sebelum merengkuh juara pada Kejurnas PPLP. “Tahun lalu di Aceh dan tahun sebelumnya di Papua kami menempati posisi ketiga. Dua-duanya karena kalah dari tuan rumah di semifinal. Walau itu bukan alasan, tapi pe-

ngaruhnya memang kami rasakan,” aku Hadi Bento. Kadispora Sumut, Ir Khairul Anwar MSi, menyampaikan dukungan dan harapan Gubsu Gatot Pudjo Nugroho agar tim Sumut bisa menorehkan prestasi terbaik. Untuk itu, dia menyarankan kepada pemain untuk tampil prima sepanjang kompetisi. “Harapan kami tentu Sumut bisa juara seperti yang diraih pada Popnas 2013. Ini target yang realistis bagi kami,” ungkapnya. Tahun ini kejurnas diikuti 16 tim dari Pusat Pendidikan dan Latihan Pelajar (PPLP) Provinsi maupun kabupaten/ kota dan sekolah olahraga. Berdasarkan jadwal yang dikeluarkan panitia, pada Ke-

8

7

6

5

4

3

2

1

A

B

C

D

E

F

G

H

Waspada/Setia Budi Siregar

jurnas yang berlangsung selama sepekan ini, tidak ada hari libur selama kompetisi. Dengan waktu yang terbatas, 16 tim akan dibagi menjadi 4 grup. Juara dan runner-up grup akan lolos ke perempatfinal (8 besar) yang menggunakan sistem gugur. Lang-

Medan Tuan Rumah Kejurnas Motoprix MEDAN (Waspada): Kota Medan menjadi tuan rumah putaran kelima Kejurnas Motoprix Region I/Sumatera yang akan berlangsung di Sirkuit Multifungsi IMI Sumut, Jl Pancing/Willem Iskandar Medan, 3-4 Mei mendatang. “Putaran kelima bakal menjadi puncak persaingan dari para pebalap se-Sumatera, karena semua racer paWaspada/ist pan atas akan ambil bagian,” ujar Ketua Panpel, Constantin Pasaribu (foto), dari Crane Club Indonesia didampingi Sekretaris Panpel Chandra, Rabu (23/4). Menurut pria akrab disapa Tantin ini, Medan menjadi kota kelima menggelar Kejurnas Region I, setelah sebelumnya berlangsung di Muara Tebo ( Jambi), Manna (Bengkulu), Pekanbaru (Riau), dan Sawah Lunto (Sumbar). “Kami dari Panpel yakin dan bertekad Kejurnas di Medan berjalan lancar dan sukses. Apalagi kegiatan juga mendapat dukungan dari Ketua Pengprov IMI Sumut, Ijeck yang ingin Sumut menuai sukses ganda,” ucap Tantin. “Bagi para racer, kita juga mengimbau untuk mempersiapkan diri sejak dini, karena seperti biasanya Kejurnas akan menerapkan sistem transponder pada setiap motor yang digunakan,” ungkap Tantin, sembari menambahkan informasi dan pendaftaran peserta di Radio Star FM Medan atau contact person 081377410309. Kelas yang diperlombakan dalam Kejurnas Motoprix Region I/Sumatera adalah kelas MP1, MP2, MP3 (bebek 125 cc tuneup pemula), MP4 (bebek 110 cc tune-up pemula), serta kelas MP5 (bebek 125 cc std pemula), MP6 (bebek 110 cc std pemula), OMR Yamaha Matik Std, dan Vespa Std 200 cc. (m47)

Waspada/Arianda Tanjung

PUKET II STIK-P Suprapti Indah Putri SP MIKom didampingi Puket III Austin Antariksa SSos MIKom menyerahkan cenderamata kepada wasit M Ishak Siregar dan Normansyah.

Apresiasi Buat Liga Futsal STIK-P MEDAN (Waspada): Kegiatan Liga Futsal khusus internal civitas akademika Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) 2014 yang digelar dalam rangka memeriahkan Dies Natalis ke-27, mendapat apresiasi dari sejumlah kalangan, termasuk mantan wasit Sumut M Ishak Siregar. Ishak mengatakan liga futsal yang digelar setiap tahunnya sangat positif, khususnya bagi mahasiswa. Tentu, peserta yang terdiri atas mahasiswa, alumni, dan dosen di STIK-P itu dapat lebih menjalin silaturahim dan menjaga kekeluargaan, apalagi kegiatannya juga tergolong bergengsi di kampus orange itu. “Jujur masing-masing peserta pasti punya kesibukan, makanya saya salut meskipun sibuk mereka tetap ada waktu berkumpul bersama untuk main futsal. Selain itu, kegiatan ini pastinya mengajak kita lebih suka berolahraga. Memang banyak kegiatan seperti ini di kampus lain, tapi kebanyakan tidak bertahan lama, berbeda dengan STIK-P yang sudah rutin dan memasuki tahun kedelapan,” terang pria yang

OLAHRA GA OLAHRAGA

telah berprofesi sebagai wasit sejak 1983 ini, Rabu (23/4). Ditambahkan, ini bukan pertama kalinya liga futsal STIK-P digelar, semakin tahun kegiatan ini juga dikemas semakin menarik seperti tahun ini bertemakan ‘Piala Dunia’. Normansyah, wasit lainnya, mengakui gelaran liga futsal STIK-P selalu menghadirkan kejutan dan warna baru. “Ciri khas peserta wajib memakai kostum klub atau negara menjadikan pertandingan jadi enak ditonton. Tak hanya tim putra, tim putri juga demikian. Meski sebatas internal kampus, penyelenggaraannya tergolong profesional dan mengikuti aturan yang sebenarnya,” tambah Norman. “Satu hal lagi yang saya apresiasi, mungkin STIK-P salah satu kampus yang terus giat mengadakan futsal putri. Ke depan, saya harap liga ini terus dipertahankan, agar suasana persaudaraan di STIK-P semakin erat,” pungkas Ishak sembari memberi acungan jempol kepada panitia dan tim jawara. (cat)

Sudoku

Putih melangkah, mematikan lawannya enam langkah.

Jawaban di halaman A2.

sung dilanjutkan partai semifinal dan final tanpa waktu jeda. “Hal seperti ini sudah biasa dan semua tim tidak mempermasalahkannya karena memang semua pemain sudah terbiasa latihan keras setiap hari sepanjang tahun,” tambah Pelatih PPLP Sumut, Safei Pilly, didampingi dua asistennya Supriono dan Wiluyo Santoso. Tim Sumut yang membawa 22 pemain, mengandalkan beberapa pemain berpengalaman di tingkat junior seperti Indra Kelana, David Sitanggang (adik pemain timnas Paulo Sitanggang), dan Kapten Iqbal Bahari. Tim Sumut berangkat ke Bogor via KNIA, Kamis (24/4) ini. (m18)

MENDATAR

MENURUN

1. Klub sepakbola Spanyol, disisihkan Atletico Madrid di Liga Champions 2014. 5. Usia, biasa disingkat “U” dalam turnamen sepak bola. 8. Liga Italia dalam bahasa Itali (dua suku kata, tulis tanpa spasi). 10. Singkatan National Basketball Association. 11. Kota di China penyelenggara pesta olahraga Asian Games tahun 2010. 12. Tulis AS——, klub sepakbola Italia. 13. AC——, klub sepak bola Italia. 14. International Association of Athletics Federations. 16. Negara tuan rumah turnamen tenis “Melbourne Cup”. 17. Negara tempat pengadilan arbitrase olahraga internasional. 19. Kode negara Andorra dari Komite Olimpiade Internasional (IOC). 21. Sundul bola. 22. Kode negara Tanzania dari IOC. 23. Klub sepakbola Jerman, didahului kata Bayer 04. 25. Klub sepakbola Inggris, semifinalis Liga Champions 2014. 26. Sepedamotor balap cross country.

1. Cabang olahraga Asian Paragames 2010 dimana Indonesia memperoleh emas. 2. Kode negara Chad dari IOC. 3. Kode negara Libya. 4. Pesta olahraga penyandang cacat di China tahun 2010 (lihat klu No. 1 Menurun). 6. Singkatan Menteri Pemuda dan Olahraga. 7. Kode negara Republic South Africa. 9. ———Kasparov, Grandmaster Soviet, mantan juara dunia catur. 11. Pertandingan (jamak Inggris). 14. Kode negara Italia dari FIFA. 15. Negara asal petinju Manny “Pacman” Pacquiao. 16. Klub sepakbola Inggris, disponsori Emirates. 18. Stop——, jam penghitung kecepatan. 20. Reli paling ganas (jarak 9000 Km dari Argentina ke Chile tahun 2011). 21. Permainan olahraga beregu dengan satu bola kecil dan satu alat pemukul. 24. Kode negara El Salvador.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan kurang dari 15 menit. Jawabannya di halaman A2 kolom 1.

9

3

7 5 4 9 8 3 1

3 7 4 1 2 3

2

1 5 7 7 2 5 2

8 6 9 9 7 6 3

1

6 ****241


Sport

A12

Pacers Samakan Kedudukan INDIANAPOLIS, AS (Waspada): Tim unggulan, Indiana Pacers, sukses meraih kemenangan pertama pada babak playoff basket NBA 2014, sementara di laga lain Chicago Bulls kembali menelan kekalahan.

PENGUMUMAN LELANG Dengan perantaraan Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Kisaran, PT. Bank Negara Indonesia (Persero) Tbk, Kantor Cabang Rantau Prapat akan melaksanakan lelang atas barang milik kekayaan negara berupa : No

1

Jenis Kendaraan

Thn

PKB

STNK

No. BPKP

No. Polisi

Mobil Toyota 2 0 0 3 2 7 . 1 0 . 2 7 . 1 0 . 6650270-B BK 2013 Vios 1500 cc 2013 1415 M/I NGP42R YH EEMGK

Warna

Uang Jaminan

Nilai Limit

Rp. Rp. Hitam M e t a l i c 15.000.000,- 75.000.000,-

Yang akan dilaksanakan pada : Hari/Tanggal : Selasa/29 April 2014 Pukul : 13.30 WIB Tempat Lelang : PT. Bank Negara Indonesia (Persero) Tbk. Kantor Cabang Rantau Prapat Jln. Ahmad Yani No. 60/62 Rantau Prapat Syarat-Syarat Lelang : 1. Besarnya uang jaminan penawaran lelang paling sedikit 20% dari nilai limit dan paling banyak sama dengan nilai limit. Uang jaminan disetorkan oleh peserta lelang ke rekening Penampungan Lelang KPKNL Kisaran pada Bank Sumut Cabang Kisaran Nomor Rekening 260.01.02.003629-0, paling lambat 1 (satu) hari sebelum pelaksanaan lelang 2. Pemenang lelang diwajibkan membayar pelunasan harga lelang dalam waktu 3 (tiga) hari kerja setelah ditunjuk sebagai pemenang lelang 3. Apabila pemenang lelang tidak melunasi kewajibannya, maka ia dinyatakan wan prestasi dan uang jaminan lelang akan disetorkan ke Kas Negara sebagai pendapatan negara 4. Peserta lelang dapat melihat barang yang akan dilelang sampai dengan 1 (satu) hari sebelum pelaksanaan lelang 5. Penawaran lelang dilakukan dengan cara lisan dan naik-naik 6. Keterangan lebih lanjut dapat menghubungi PT. Bank Negara Indonesia (Persero) Tbk Kantor Cabang Rantau Prapat, Jln. Ahmad Yani No. 60/62 Rantau Prapat, Telp. (0624) 23897 Rantau Prapat, 24 April 2014

PT. Bank Negara Indonesia (Persero) Tbk,. Kantor Cabang Rantau Prapat

Ketua Panitia Lelang

Menghadapi Atlanta Hawks, Pacers sempat kalah 93-101 di game pertama. Namun, Paul George dan kawan-kawan berhasil membalas di game kedua dengan skor telak 101-85 dalam laga di Indianapolis, AS, Rabu (23/4), untuk membuat hasil sementara menjadi imbang 1-1. George kembali jadi motor serangan Pacers dengan 27 poin. Luis Scola berhasil mencatatkan 20 poin meski jadi pemain cadangan. George Hill pun ikut menambah 15 poin. Pacers sempat mencatatkan 19 poin beruntun pada tiga menit terakhir kuarter tiga lalu dilanjutkan pada tiga menit pertama kuarter empat. Saat itu, tuan rumah sampai unggul telak 87-65. Kedudukan kedua tim kembali imbang 1-1, dari sistem best-of-seven games. Game ketiga akan digelar pada hari Kamis waktu setempat, Jumat pagi, dan giliran Atlanta yang jadi tuan rumah. Toronto Raptors juga sukses menyamakan kedudukan usai menang atas Brooklyn Nets, 100-95. DeMar DeRozan jadi pahlawan Raptors dengan 30

poin. Bintang Nets, Paul Pierce, hanya bisa mencetak 15 poin saja. Saat tim lain meraih kemenangan untuk samakan kedudukan, Bulls malah kembali tersungkur sehingga saat ini tertinggal 0-2 dari Washington Wizards. Tim “Banteng Merah� itu tumbang dengan skor tipis 10199 lewat babak overtime. Bulls tampak kurang panas pada laga di kandang sendiri tersebut. Mulai pada dua kuarter akhir mereka bisa mengejar ketinggalan dari Wizards untuk menyamakan kedudukan 91-91. Sayang, D.J Augustin cs gagal

Rapat Umum Pemegang Saham (RUPS) Tahunan Kepada Yth: Para Pemegang Saham PT. ABATASA IMAMI ABADI 1. FARADILLA ISHAK 2. ANDRIYANI ISHAK Di - Tempat. Perihal : Undangan Rapat Umum Pemegang Saham (RUPS)

PT. ABATASA IMAMI ABADI. Dengan hormat, Berkaitan dengan akan dilaksanakannya Rapat Umum Pemegang Saham (RUPS) PT. ABATASA IMAMI ABADI yang akan diselenggarakan pada: Hari/tanggal : Kamis / 08 Mei 2014 Waktu : Pukul 10.00 WIB s/d selesai Tempat : Meeting Room Inna Dharma Deli Jln. Balai Kota No. 2 Medan 20111 Maka dengan ini kami mengundang para pemegang saham PT. ABATASA IMAMI ABADI untuk menghadiri Rapat Umum Pemegang Saham (RUPS) tersebut dengan agenda sebagai berikut: I.

RUPS TAHUNAN : 1. Persetujuan Laporan pembukuan keuangan PT. ABATASA IMAMI ABADI mengenai jalannya perseroan. 2. Pengesahan Laporan Keuangan PT. ABATASA IMAMI ABADI.

II.

RUPS - LB : 1. Persetujuan Penambahan Modal Dasar dan Modal disetor PT. ABATASA IMAMI ABADI. 2. Persetujuan Penambahan Pesaham PT. ABATASA IMAMI ABADI. 3. Perubahan susunan Direksi dan Dewan Komisaris PT. ABATASA IMAMI ABADI. 4. Persetujuan Aset pribadi menjadi asset PT. ABATASA IMAMI ABADI.

Demikian undangan Rapat Umum Pemegang Saham PT. ABATASA IMAMI ABADI untuk tahun 2013 ini kami sampaikan. Atas perhatian dan kerjasamanya kami ucapkan terimakasih. Medan, 22 April 2014 Hormat kami,

PT. ABATASA IMAMI ABADI dto.

FARADILLA ISHAK Direktur Utama

Pasang Iklan Telp. 4528431 HP. 081370328259

Email: iklan_waspada@yahoo.co.id waspada.iklan@gmail.com

WASPADA Kamis 24 April 2014

Hasil playoff hingga Rabu Wilayah Barat: San Antonio Spurs 1-0 Dallas Mavericks Houston Rockets 0-1 Portland Trail Blazers Los Angeles Clippers 1-1 Golden State Warriors Oklahoma City Thunders 1-1 Memphis Grizzlies Wilayah Timur: Indiana Pacers 1-1 Atlanta Hawks Chicago Bulls 0-2 Washington Wizards Toronto Raptors 1-1 Brooklyn Nets Miami Heat 1-0 Charlotte Bobcats mengimbangiWizards di babak OT. Bulls hanya bisa menambah delapan poin, sementara Wizards cetak 10 poin. Bulls pun kembali telan kekalahan dan tertinggal 0-2. Mereka bisa tersingkir cepat jika telan dua kekalahan lagi. (Esp/m47)

PEMAIN Indiana Pacers, Paul George (24) dijepit dua pemain Atlanta Hawks dalam laga playoff NBA di Indianapolis, AS, Rabu (23/4). Pacers menang 101-85.

AP


Sport

A12 Pedrosa Penasaran Rio Hondo BUENOS AIRES (Waspada): Rider Repsol Honda, Dani Pedrosa (foto), penasaran dengan Sirkuit Autodromo Termas de Rio Hondo yang akan mementaskan MotoGP Argentina, Minggu (27/4) nanti. Pebalap berusia 28 tahun itu sedang berusaha mengum-

pulkan banyak informasi mengenai sirkuit yang memiliki

PENGUMUMAN LELANG Dengan perantaraan Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Kisaran, PT. Bank Negara Indonesia (Persero)Tbk, Kantor Cabang Rantau Prapat akan melaksanakan lelang atas barang milik kekayaan negara berupa : Jenis Kendaraan

Thn

PKB

STNK

No. BPKP

No. Polisi

Warna

1 Mobil Toyota Vios 1500 cc M/I NGP42R EEMGK

2003

27.10. 2013

27.10. 2013

6650270-B

BK 1415 YH

Hitam Metalic

No

Uang Jaminan

Nilai Limit

Rp. Rp. 15.000.000,- 75.000.000,-

Yang akan dilaksanakan pada : Hari/Tanggal : Selasa/29 April 2014 Pukul : 13.30 WIB Tempat Lelang : PT. Bank Negara Indonesia (Persero) Tbk. Kantor Cabang Rantau Prapat Jln. Ahmad Yani No. 60/62 Rantau Prapat Syarat-Syarat Lelang : 1. Besarnya uang jaminan penawaran lelang paling sedikit 20% dari nilai limit dan paling banyak sama dengan nilai limit. Uang jaminan disetorkan oleh peserta lelang ke rekening Penampungan Lelang KPKNL Kisaran pada Bank Sumut Cabang Kisaran Nomor Rekening 260.01.02.003629-0, paling lambat 1 (satu) hari sebelum pelaksanaan lelang 2. Pemenang lelang diwajibkan membayar pelunasan harga lelang dalam waktu 3 (tiga) hari kerja setelah ditunjuk sebagai pemenang lelang 3. Apabila pemenang lelang tidak melunasi kewajibannya, maka ia dinyatakan wan prestasi dan uang jaminan lelang akan disetorkan ke Kas Negara sebagai pendapatan negara 4. Peserta lelang dapat melihat barang yang akan dilelang sampai dengan 1 (satu) hari sebelum pelaksanaan lelang 5. Penawaran lelang dilakukan dengan cara lisan dan naik-naik 6. Keterangan lebih lanjut dapat menghubungi PT. Bank Negara Indonesia (Persero) Tbk Kantor Cabang Rantau Prapat, Jln. Ahmad Yani No. 60/62 Rantau Prapat, Telp. (0624) 23897 Rantau Prapat, 24 April 2014

PT. Bank Negara Indonesia (Persero) Tbk,. Kantor Cabang Rantau Prapat

Ketua Panitia Lelang

panjang 4,8 kilometer tersebut. Setelah absen sejak 1999, Argentina akhirnya kembali menggelar balapan MotoGP. Seri kali ini digelar di Sirkuit Termas de Rio Hondo. Sebagian besar pebalap MotoGP belum pernah menjajal Sirkuit Termas de Rio Hondo. Hanya sejumlah pebalap satelit yang pernah merasakan sirkuit dengan 14 tikungan ini pada tes yang dilakukan Juli 2013. Pedrosa mengatakan, pekerjaan rumahnya semakin banyak jelang tampil di MotoGP Argentina. Runner-up MotoGP 2007, 2010, dan 2012 itu mengaku sedang berusaha menggali informasi mengenai sirkuit tersebut sekaligus berharap karakter trek cocok dengan motor Repsol Honda. “Setelah Austin, saya tidak sabar untuk bertanding di Argentina. Saya ingin segera melakukan sejumlah lap di sirkuit untuk merasakan bagaimana kinerja motor. Saya ingin segera mempelajari sirkuit baru ini,” ujar Pedrosa, Rabu (23/4). “Saya tidak tahu banyak mengenai trek ini dan sedang berusaha melakukan pekerjaan rumah dengan melihat peta dan video sirkuit. Saya

berusaha mempelajarinya sebanyak mungkin sebelum tiba di sana. Tapi, pastinya sulit untuk mempelajarinya tanpa menunggangi motor,” sambungnya. Saat ini, The Spaniard berada di posisi kedua klasemen sementara MotoGP 2014 de-

Kepada Yth: Para Pemegang Saham PT. ABATASA IMAMI ABADI 1. FARADILLA ISHAK 2. ANDRIYANI ISHAK Di - Tempat. Perihal : Undangan Rapat Umum Pemegang Saham (RUPS)

PT. ABATASA IMAMI ABADI. Dengan hormat, Berkaitan dengan akan dilaksanakannya Rapat Umum Pemegang Saham (RUPS) PT. ABATASA IMAMI ABADI yang akan diselenggarakan pada: Hari/tanggal : Kamis / 08 Mei 2014 Waktu : Pukul 10.00 WIB s/d selesai Tempat : Meeting Room Inna Dharma Deli Jln. Balai Kota No. 2 Medan 20111 Maka dengan ini kami mengundang para pemegang saham PT. ABATASA IMAMI ABADI untuk menghadiri Rapat Umum Pemegang Saham (RUPS) tersebut dengan agenda sebagai berikut: RUPS TAHUNAN : 1. Persetujuan Laporan pembukuan keuangan PT. ABATASA IMAMI ABADI mengenai jalannya perseroan. 2. Pengesahan Laporan Keuangan PT. ABATASA IMAMI ABADI.

II.

RUPS - LB : 1. Persetujuan Penambahan Modal Dasar dan Modal disetor PT. ABATASA IMAMI ABADI. 2. Persetujuan Penambahan Pesaham PT. ABATASA IMAMI ABADI. 3. Perubahan susunan Direksi dan Dewan Komisaris PT. ABATASA IMAMI ABADI. 4. Persetujuan Aset pribadi menjadi asset PT. ABATASA IMAMI ABADI.

Demikian undangan Rapat Umum Pemegang Saham PT. ABATASA IMAMI ABADI untuk tahun 2013 ini kami sampaikan. Atas perhatian dan kerjasamanya kami ucapkan terimakasih. Medan, 22 April 2014 Hormat kami,

PT. ABATASA IMAMI ABADI dto.

FARADILLA ISHAK Direktur Utama

Kamis 24 April 2014

Popovich Pelatih Terbaik NBA

Rapat Umum Pemegang Saham (RUPS) Tahunan

I.

WASPADA

Pasang Iklan Telp. 4528431 HP. 081370328259

Email: iklan_waspada@yahoo.co.id waspada.iklan@gmail.com

ngan torehan 36 poin. Pedrosa tertinggal 14 angka dari rekan setimnya yang juga juara bertahan, Marc Marquez. “Saya tidak sabar bertemu fans di Argentina. Ini adalah kunjungan pertama saya ke Argentina,” sebut Pedrosa. (m33/mgp)

NEW YORK, AS (Waspada): Pelatih San Antonio Spurs, Gregg Popovich (foto), terpilih sebagai Pelatih Terbaik NBA untuk tahun ini. Hal ini yang membuat dirinya telah memenangi penghargaan tersebut sebanyak tiga kali, Rabu (23/4). Di bawah asuhan Popovich, Spurs mencatat rekor terbaik 62-20 untuk mengamankan keuntungan kandang sepanjang pasca-musim reguler. Prestasi ini menjadikan Popovich bergabung dengan Don Nelson dan Pat Riley sebagai sosok yang telah menerima penghargaan tersebut sebanyak tiga kali. Setelah membawa Spurs kepada musim penuh kesuksesan ke-15 dengan 50 atau

lebih banyak kemenangan, Popovich total mengumpulkan 380 angka, termasuk 59 suara peringkat pertama dari panel yang berisi 124 jurnalis dari AS dan Kanada. Pelatih Phoenix Suns, Jeff Hornacek, menjadi runner-up dengan 339 angka diikuti Tom Thibodeau (Chicago Bulls/159). Spurs, tim model konsistensi di bawah Popovich, merupakan satu-satunya tim yang mencatatkan rekor 30 kemenangan di kandang (32-9), dan tandang (30-11), setelah mereka bangkit dari kekalahan di seri “tujuh pertandingan” melawan Miami Heat pada final NBA musim lalu. Selain itu, Spurs memimpin NBA dengan selisih nilai per pertandingan yakni 7,8 de-

AP

ngan rata-rata 105,4 angka per pertandingan sedangkan kemasukan 97,6, dan mencatatkan 19 kemenangan beruntun yang mengunci laju kemenangan terpanjang peringkat kelima di NBA. (m33/ap)


Sumatera Utara

WASPADA Kamis 24 April 2014

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:25 12:39 12:26 12:33 12:34 12:31 12:28 12:23 12:30 12:30

‘Ashar 15:41 15:52 15:42 15:47 15:45 15:45 15:40 15:36 15:42 15:41

Magrib 18:33 18:48 18:33 18:42 18:42 18:36 18:34 18:29 18:37 18:37

‘Isya

Imsak

Shubuh Syuruq

Kota

19:43 19:58 19:43 19:52 19:51 19:45 19:43 19:39 19:46 19:46

04:49 05:00 04:50 04:55 04:59 04:58 04:53 04:49 04:55 04:54

04:59 05:10 05:00 05:05 05:09 05:08 05:03 04:59 05:05 05:04

L.Seumawe 12:33 L. Pakam 12:26 Sei Rampah12:25 Meulaboh 12:37 P.Sidimpuan12:24 P. Siantar 12:25 Balige 12:25 R. Prapat 12:22 Sabang 12:40 Pandan 12:26

06:16 06:27 06:16 06:22 06:24 06:24 06:19 06:15 06:21 06:20

Zhuhur ‘Ashar 15:43 15:38 15:37 15:48 15:39 15:38 15:39 15:36 15:49 15:40

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur

‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:41 18:33 18:32 18:44 18:30 18:31 18:31 18:28 18:48 18:32

19:50 19:42 19:41 19:53 19:39 19:41 19:40 19:37 19:58 19:41

04:57 04:51 04:50 05:02 04:52 04:51 04:52 04:49 05:03 04:53

05:07 05:01 05:00 05:12 05:02 05:01 05:02 04:59 05:13 05:03

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:26 12:28 12:38 12:30 12:27 12:34 12:22 12:33 12:26 12:25

18:32 18:34 18:46 18:36 18:34 18:41 18:29 18:39 18:31 18:31

19:41 19:43 19:55 19:45 19:44 19:51 19:38 19:48 19:40 19:41

04:53 04:54 05:01 04:57 04:53 04:59 04:48 05:58 04:52 04:50

05:03 05:04 05:11 05:07 05:03 05:09 04:58 05:08 05:02 05:00

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:23 12:30 12:28 12:24 12:26 12:23 12:23 12:32 12:26 12:21 12:23

15:38 15:45 15:41 15:36 15:39 15:37 15:37 15:43 15:40 15:35 15:36

18:28 18:35 18:34 18:30 18:32 18:28 18:27 18:40 18:32 18:26 18:29

19:37 19:44 19:43 19:40 19:41 19:37 19:37 19:50 19:41 19:36 19:38

04:51 04:58 04:54 04:49 04:52 04:50 04:50 04:56 04:53 04:48 04:49

05:01 05:08 05:04 04:59 05:02 05:00 05:00 05:06 05:03 04:58 04:59

06:23 06:17 06:16 06:28 06:17 06:17 06:17 06:14 06:29 06:19

15:40 15:41 15:48 15:44 15:39 15:45 15:35 15:45 15:39 15:37

06:19 06:19 06:27 06:22 06:18 06:24 06:14 06:24 06:18 06:16

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:16 06:23 06:20 06:15 06:17 06:15 06:15 06:22 06:18 06:13 06:15

Lokasi Penyulingan Crude Oil Ilegal Di Besitang Terbakar BESITANG (Waspada): Lokasi dapur penyulingan crude oil (minyak mentah) ilegal di pinggiran Jalinsum Medan-Aceh tak jauh dari Pos PJR Poldasu, tepatnya di Dusun IX, Desa Bukitselamat, Kec. Besitang, Rabu (23/4) pagi musnah terbakar. Kobaran api baru berhasil dipadamkan 3 jam kemudian setelah tiga unit mobil pemadam kebakaran dari Pemkab Langkat diturunkan ke lokasi. Dalam insiden ini belasan drum BBM habis terbakar, sementara seorang pengelola berinisial As, 35, menderita luka bakar ringan. Salah seorang warga bermarga Manulang yang rumahnya berada persis di seberang jalan lokasi penyulingan, mengaku terkejut begitu mendengar ledakan bak seperti suara petir. “Saya ke luar rumah dan melihat asap hitam membumbung tinggi dari lokasi penyulingan,” ujarnya. Wanita berdarah Batak itu

mengaku tidak mengetahui penyebab pasti terjadinya kebakaran. “Rasanya tidak ada kepentingan saya untuk mencari tahu,” ujarnya seraya menambahkan, kegiatan penyulingan minyak ini sudah berlangsung lama. Informasi diperoleh, pekan lalu seorang remaja kelas VIII SMP, Rosnita Br. Nainggolan, 14, warga Dusun 11, tewas akibat menderita luka bakar serius. Korban terbakar saat ibunya mengisi minyak yang diduga dibeli dari hasil penyulingan ilegal ke tabung lampu teplok, kemudian menyambar. Remaja itu sempat dirawat di salah satu rumah sakit di Me-

Pedagang Kebun Lada Dan Pasar Tapiv Binjai Sesalkan Kadispenda MEDAN (Waspada): Puluhan pedagang tradisional pasar pagi Kebun Lada dan pasar Tapiv Binjai menyesalkan sikap Kadispenda Tobertina Sitepu dan jajarannya, yang tega menggugurkan atau menghapus hak pedagang lama/pemilik/penyewa. Hal itu disampaikan Ardath Sitepu, Koordinator pasar Kebun Lada/pasar Tapiv Binjai), bersama M.Sirait, pemilik kios pasar Kebun Lada, H. Manullang, pemilik meja pasar Kebun Lada Binjai, serta ibu-ibu pedagang lainnya, Elita, Yuni, Asun, Atik dan Siti Mariam di redaksi Waspada, Selasa (22/4). “Nasib kami teraniaya terutama setelah pasar pagi Kebun Lada dan pasar tapiv direnovasi. Hak-hak kami sebagai pedagang lama dihapus, begitu juga meja dan kios sebagian dijual kepada pihak lain sementara kami yang sudah berjualan hampir 30 tahun, diusir,” ujarnya. Terhadap permasalahan ini, kami sudah berdelegasi ke kantor DPRD Binjai tiga kali, tapi kurang mendapat tanggapan. DPRD hanya menyebut pihaknya sudah menyampaikan agar Kadispenda mengembalikan hak-hak pedagang sesuai KPP (Kartu Pengenal Penyewa). Sedangkan KPP asli ditahan Kadispenda Binjai, dengan alasan akan diperbarui.Ternyata sudah empat bulan KPP tak dikembalikan. Ironisnya Kadispenda membuat alasan, pedagang yang tak punya KPP tidak berhak punya kios atau meja. Anehnya lagi, Kadispenda ternyata tidak konsekuen, karena ada sebagian pedagang mendapat kios atau meja, padahal disewakannya kepada pihak lain. “Kami minta dikembalikan ke tempat semula sesuai janji Kadispenda sebelum pasar direnovasi. Juga minta Wali Kota M. Idaham jangan tutup mata terhadap masalah ini,” tegas Ardath Sitepu. Kami juga mendatangi Polres Binjai untuk mengadu. Tapi pihak Polres mengatakan jangan tergesa-gesa membuat LP karena masalah ini sudah ditindaklanjuti DPRD Binjai. Polres menunggu hasil putusan DPRD, ujar Ardath. (m24)

dan, namun karena luka bakar yang dideritanya cukup parah, korban akhirnya menghembuskan nafas terakhir, Sabtu (19/4). Menurut beberapa sumber kepada Waspada, pemilik dapur selama ini membeli crude oil hasil penambangan ilegal dari daerah Peureulak, Aceh Timur dan sebagian dari Desa Halaban termasuk Tanjungpura. Minyak mentah ilegal ini dipasok menggunakan truk dilengkapi wadah fiber.

Di Kab. Langkat, banyak terdapat lokasi penyulingan minyak yang dikelola secara tradisional. Kalau beberapa waktu lalu ada kalangan pengusaha yang ditangkap, namun belakangan ini bisnis bahan bakar minyak (BBM) ilegal ini makin menjadi-jadi dan berlangsung mulus. Kades Bukitselamat, Ir. Effendy Tarigan berharap, aparat berkompeten dapat menseterilkan daerahnya dari aktivitas

penyulingan minyak. “Kalau bisa jangan ada lagi tempat penyulingan atau pengoplosan minyak karena dampaknya bisa merugikan masyarakat,” tegasnya. Kapolsek Besitang, AKP Biston Situmorang dikonfirmasi Waspada membenarkan terjadinya peristiwa kebakaran di lokasi penyulingan minyak. “Saya sudah memerintahkan Kanit Reskrim melakukan penyelidikan ke lapangan,” katanya. (a02) Waspada/Andi Nasution

Soal Rencana Kenaikan Airportax Bandara KNIA:

SALAH satu ruas jalan kabupaten di Kec. Patumbak, kondisinya benar-benar memprihatinkan.

PT AP 2 Menambah Fasilitas

Menanti Polesan Infrastruktur Bupati Deliserdang Yang Baru

KUALANAMU, Deliserdang (Waspada): Meski belum ada ketetapan resmi soal rencana kenaikan Passenger Service Charge (PSC) atau airportax secara bertahap per 1 Mei mendatang untuk tiga bandar udara, namun pihak PT Angkasa Pura 2 sudah mempersiapkan penambahan fasilitas untuk peningkatan pelayanan. Ke tiga itu yakni Kualanamu International Airport (KNIA), Deliserdang, Sumatera Utara, Bandara Raja Fisabilillah, Tanjungpinang dan Bandara Sultan Syarif Hasim, Pekanbaru, “Ini tantangan karena dengan menaikkan airportax, peningkatan pelayanan kepada pengguna jasa bandara merupakan keharusan. Untuk mengimbanginya, pihak PT Angkasa Pura 2 akan melakukan penambahan fasilitas bagi para pengguna jasa moda transportasi udara, khususnya di Bandara Internasional Kualanamu,” ujar Plt. General Manager PT AP 2 Kualanamu, Ali Shopian kepada

Waspada, Rabu (23/4). Ali didampingi bidang Kehumasan HM Wasfan Wahyu Widodo merinci, rencana awal/tarif baru airportax untuk penerbangan domestik akan dinaikkan menjadi Rp75 ribu dari Rp35 ribu, namun kenaikan awal secara bertahap Rp60 ribu. “Untuk internasional tarif lama Rp75 ribu secara bertahap akan naik menjadi Rp120 ribu dari rencana Rp200 ribu,” sebut Ali yang juga Airport Service Manager. Begitu pun Ali mengaku, hingga kemarin belum mendapat kepastian dari pusat soal kenaikan airportax tersebut. “Menunggu kebijakan pusat, namun untuk Kualanamu kita sudah mempersiapkan fasilitas mini car, untuk penumpang yang lumpuh serta fasilitas penumpang pesawat yang akan menuju stasiun kereta arah kota Medan dan lainnya,” sebut Ali optimis. Pantauan Waspada, personel PT AP 2 terkait divisi operasional merapatkan ketertiban parkir dari perusahaan angkutan

moda transportasi, terdiri atas bus dan taxi. “Saya berharap pada 1 Mei pihak stakeholder angkutan pengguna jasa bandara yang beroperasi di Bandara Kualanamu sudah bisa action untuk ketertiban ini, khususnya di terminal kedatangan agar tidak semrawut,” ujar Guntur Kinanta dari Divisi Operasional. Sementara dari pihak panitia pelelangan tender cleaning service terkait kebersihan terminal bandara dipimpin Mardiono dan H. Prio Ambardi, sedang menilai proses belasan perusahaan yang melakukan demo atau praktek langsung membersihkan lantai di kedatangan internasional. “Dari proses demo ini, Insya Allah kita bisa melihat langsung dan secara transparan kualitas perusahaan yang mengikuti tender, profesional atau sebaliknya,” jelas Prio dan Mardiono bersamaan, di lokasi demo belasan perusahaan tersebut. (m16)

UN SMP Di Langkat Diikuti 17.108 Siswa STABAT (Waspada): 17.108 Siswa tingkat SMP sederajat di Kab. Langkat akan mengikuti ujian nasional pada 5 - 8 Mei mendatang. Kadis Pendidikan Langkat H. Sujarno, Rabu (23/ 4), menuturkan belum menerima laporan adanya peserta UN yang drop out (DO). Peserta tersebar di 62 SMPN, 4 MTSN, 4 SMP terbuka, di 85 SMP swasta dan 100 MTS swasta. Sujarno berharap peserta UN mempersiapkan diri, mempelajari bidang studi yang telah diajarkan agar hasil ujian memuaskan. Informasi lain diperoleh, 1.954 guru sebagai pengawas ujian telah disiapkan dan aparaturjJajaran Dinas Pendidikan Langkat akan meninjau beberapa sekolah yang akan menjadi ruang ujian, apakah terdapat kerusakan untuk diperbaiki.(a03)

Waspada/Khairul K Siregar

SEJUMLAH petugas mengawasi jalannya pembersihan PKL di kawasan Pasar Gambir Desa Bandar Klippa, Kec. Percut Seituan.

PKL Kembali Ditertibkan PERCUT SEITUAN (Waspada) : Tim Terpadu terdiri dari Muspika Percut Seituan, petugas Dinas Perhubungan, Dinas Pasar dibantu Satpol PP Deliserdang, Selasa (22/4) kembali menertibkan Pedagang Kaki Lima (PKL) di sepanjang jalan Lintas BatangkuisMedan. Camat Percut Seituan, H. Hadisyam Hamzah, SH yang ditemui di sela-sela penertiban mengatakan, penertiban terhadap PKL ini karena mereka membentang dagangannya di badan jalan sehingga mengganggu arus lalulintas. Selain itu, kawasan tersebut dikenal sebagai Daerah Milik Jalan, meliputi jalan, trotoar dan parit di mana jalan itu berarti hanya dipergunakan bagi pengguna jalan, bukan untuk tempat berdagang. “Jika mereka ingin berdagang seharusnya cari tempat atau lokasi yang nyaman, jangan menggganggu kelancaran arus lalulintas,” kata Hadisyam. Hadisyam juga menyebutkan, pembersihan terhadap PKL ini dilakukan karena keberadaan mereka (pedagang-red) ditempat itu sudah cukup lama sehingga perlu dibersihkan karena sangat mengganggu keindahan kota Percut Seituan. Hadisyam juga menjelaskan, setelah dibersihkannya seluruh pedagang di Jalan Gambir Pasar VIII, maka di kawasan itu akan dijadikan taman untuk menambah keindahan. Di samping itu, guna mengantisipasi kembalinya para PKL sehingga memacetkan arus lalulintas, pihaknya akan menurunkan sejumlah petugas seperti DLLAJ dan lainnya.(crul)

Waspada/ Syahri ilham Siahaan

BUPATI Labura H. Kharuddin Syah menyapa warga saat blusukan ke Desa Rombisan, Kec. Aeknatas.

Bupati Kunjungi Desa Rombisan AEKKANOPAN (Waspada): Bupati Labuhanbatu Utara (Labura) H. Kharuddin Syah, SE masih terus blusukan ke desa-desa memantau perkembangan dan permasalahan yang dihadapi masyarakat. Saat berkunjung ke Desa Rombisan Kec. Aeknatas, Rabu (23/4), H. Buyung menemukan beberapa masalah tentang catatan sipil. H. Buyung di dampingi Asisten I Pemerinrahan Habibuddin Siregar, S.STP, M.AP, Kepala Dinas Sosial dan Tenaga Kerja Muhammad Asril, S.Sos serta Kabag Humas dan Infokom Muhammad Ikhsan, S.STP, M.AP, dalam blusukannya langsung bertemu warga. Bupati mengatakan turun langsung ke desa sangat banyak manfaatnya. Sebab kalau tidak

turun langsung, maka permasalahan dan perkembangan yang dihadapi masyarakat tidak akan diketahui. “Seperti awal 2014 lalu, saya keliling ke seluruh kecamatan dan desa untuk melihat langsung hasil pekerjaan di tahun 2013. Hasilnya, saya temukan pekerjaan yang kurang baik dan langsung saya perintahkan diperbaiki,” tegas H. Buyung. H. Buyung juga menyebut, saat berkunjung ke Desa Rombisan masih menemukan beberapa permasalahan masyarakat seperti pengurusan akta kelahiran serta buku nikah. Sampai saat ini masih ada warga belum punya buku nikah karena ketika menikah hanya menggunakan cara agama. “Hal seperti ini jangan sampai terjadi

lagi, kalau orangtuanya tidak punya buku nikah, dipastikan anaknya tidak bisa punya akta kelahiran,” jelas H. Buyung. Sementara Asisten I Pemerintahan Habibuddin Siregar, berjanji menindaklanjuti sesuai perintah bupati, untuk berkoordinasi dengan Kepala Dinas Catatan Sipil, Kepala Kantor Kementerian agama dan Camat Aeknatas, guna menyelesaikan masalah tersebut. “Jika yang sudah nikah tapi belum punya buku nikah, maka Kementerian Agama akan menikahkan kembali secara agama dan secara Negara. Dan terhadap anak yang belum punya akta kelahiran, pihak Dinas Catatan sipil akan menyelesaikannya,” kata Habibuddin. (c08)

Ketua TP PKK Deliserdang:

Perjuangan Kartini Harus Jadi Motivasi Bagi Kaum Perempuan LUBUKPAKAM (Waspada): Perjuangan Kartini harus menjadi motivasi bagi kaum perempuan di Indonesia, agar bisa berbuat lebih baik lagi. Terlebih, ibu Kartini sosok wanita yang sepanjang hidupnya memperjuangkan hak-hak wanita. “Kartini berjuang dengan gigih agar para putri bangsa bisa mendapat pendidikan lebih baik,” kata Ketua TP PKK Deliserdang, Ny. Hj. Yunita Ashari Tambunan Br Siregar pada pembukaan seminar tentang perjuangan RA Kartini diseleng-

garakan Dharma Wanita Persatuan Dinas Dikpora Deliserdang, di Gedung Cadika Pramuka Lubukpakam, kemarin. Atas perjuangan Kartini, kini kaum perempuan telah sama kedudukannya dengan kaum laki-laki. Baik pendidikan, bidang pemerintahan mau pun bidang lainnya. Karenanya, kaum perempuan juga sangat berperan terhadap terlaksananya pembangunan.Sebabwanita(perempuan) adalah tiang negara. “Apabila baik wanitanya, maka baiklah negaranya, tapi

apabila buruk wanitanya maka buruk pulalah negaranya,” ujar Hj. Yunita Br Siregar. Pada kesempatan itu Ny. Hj. Yunita bersama Ketua GOPTKI Ny. Hj. Asdiana Zainuddin, Ketua Dharma Wanita Persatuan Ny. Hj. Titik Asrin Naim mengajak kaum perempuan di Deliserdang untuk bergandeng tangan merencanakan dan melaksanakan kegiatan atau program yang dapat menyentuh bagi keluarga mau pun masyarakat, sehingga dirasakan manfaatnya untuk diterapkan di keluarga.(a06)

SEPENINGGAL Drs H. Amri Tambunan sebagai Bupati Deliserdang periode 20042009 dan 2009-2014, kondisi Kab. Deliserdang khususnya di bidang infrastruktur sebenarnya sangat menurun. Bahkan infrastruktur jalan dapat dikategori tahap memprihatinkan, terlebih di daerah pedalaman. Bila dilihat secara kasat mata, infrastruktur di Deliserdang cukup memadai, apalagi melihat infrastruktur di wilayah yang dekat atau pun ibukota Kabupaten yakni Lubukpakam. Tapi kalau kita melihat langsung seperti di Kec. Patumbak yang terdiri dari 8 desa, kondisi jalan kabupatennya dapat dikategori sangat tidak layak. Sejak 2009-2014 infrastruktur jalan di kecamatan tersebut tak mengalami kemajuan. Pemandangan memprihatinkan itu dapat disaksikan saat memasuki kawasan Kec. Patumbak. Tidak jauh dari perbatasan wilayah Kec. Medan Amplas dengan Patumbak, yakni Desa Patumbak Kampung. Belum lagi kondisi drainase yang kurang berfungsi sehingga air sering menggenangi badan jalan, ditambah minimnya lampu penerang jalan. Beranjak ke desa berikutnya seperti Desa Patumbak II dan Desa Marindal I, kondisi

jalan kabupaten tetap dipenuhi lubang dan drainase yang tak memadai serta minimnya lampu penerangan jalan. Ironisnya, di Desa Marindal I yang berbatasan dengan wilayah Kec. Medan Johor, infrastruktur yang masuk dalam wilayah Kota Medan cukup baik dan terawat. Mengenai infrastruktur jalan ini, sangat menyulitkan masyarakat dan para sopir kendaraan yang melintas. “Padahal di awal kepemimpinan terlebih di periode kedua Amri Tambunan, kami sangat berharap ada kemajuan dan perbaikan infrastruktur khususnya jalan,” ujar Bobi, warga Desa Patumbak Kampung kepada Waspada, Selasa (22/4). Menurutnya, hancurnya infrastruktur jalan dipicu maraknya dump truk pengangkut material galian C ilegal yang diduga melebihi tonase yang melintas, ditambah kurangnya perawatan jalan oleh Pemkab Deliserdang. “Kalau drainase dan lampu penerangan jalan ya memang seperti ini dari dulu, tidak ada peningkatan,” sebutnya. Delitua-Namorambe Beralih ke kecamatan tetangganya yakni Delitua dan Namorambe, kondisinya hampir sama. Mulai dari Jalan Pamah menghubungkan Delitua dengan Namorambe, lubang menganga di badan jalan menghantui para pengendara. Tak sampai di situ, di Desa Delitua, Desa

Ujung Labuhan, Desa Batu Penjemuran, Desa Jati Kesuma, Desa Kuta Tengah, Desa Namo Lundur, Desa Tangkahan dan Desa Suka Mulia Hilir, lobang besar ada di badan jalan. Penyebabnya juga sama dengan di Kec. Patumbak, yakni maraknya dump truk pengangkut material galian C ilegal yang diduga melebihi tonase. “Tak ada pengawasan dan tak ada perawatan jalan,” kata Saiful, warga di sana. Lebih miris, masih ada desa yang jalannya belum tersentuh pembangunan dilengkapi dengan tidak adanya lampu penerangan jalan termasuk drainase, di antaranya Desa Seruwe, Lubang Ido, Cinta Rakyat, Rumah Mbacang, Salang Tungir, Namo Mbaru, Desa Jabah, Lau Mulgab dan Desa Gunung Klawas. Kini Deliserdang dipimpin bupati baru, Ashari Tambunan yang notabene adik kandung Amri Tambunan, berpasangan dengan Wabup Zainuddin Mars. Warga di Deliserdang khususnya wilayah yang jauh dari Ibukota Kabupaten, menanti polesan kepemimpinan Ashari Tambunan, sekaligus mengejar ketertinggalan pembangunan di Deliserdang dibanding kabupaten/kota lainnya di Sumut. *Andi Nasution

Di T. Tinggi Golkar Bertahan, Demokrat Dan PDIP Turun TEBINGTINGGI ( Waspada): Hasil rekapitulasi penghitungan perolehan suara Pemilu 2014 yang dilaksanakan KPUD kota Tebingtinggi, selama dua hari, (21-22/4), menunjukkan Partai Golkar mampu mempertahankan kursi DPRD. Bahkan, partai berlambang pohon beringin itu ke luar sebagai pemenang selama empat kali Pemilu era Reformasi. Partai Golkar meraih lima kursi DPRD kota Tebingtinggi. Penghitungan suara dipimpin Ketua KPU Abdul Khair, S.Ag serta empat komisioner lainnya, disaksikan Panwaslu dan saksi-saksi dari partai politik di aula TC Sosial, Jalan RS Umum. Rapat rekapitulasi terkesan berlangsung bertele-tele, karena kurangnya pemahaman KPUD maupun saksi-saksi Parpol soal mekanisme penghitungan, sehingga memakan waktu lama. Salah satu penyebab lamanya penghitungan suara, adalah dibukanya seluruh plano untuk 171 tempat pemungutan suara (TPS) di Kec. Rambutan/Bajenis atas permintaan saksi Parpol. Padahal, Panwaslu merekomendasikan agar plano yang dibuka hanya pada TPS yang diduga bermasalah. Namun Ketua KPU justru memerintahkan membuka seluruh plano yang ada di Dapil III, meski sebenarnya kebijakan itu melanggar kode etik. “Inilah penyebab berlarut-larutnya penghitungan suara,” ujar sumber dari aparat keamanan. Sementara Partai Demokrat dan PDIP harus menelan pil pahit kehilangan satu kursi dari yang dimiliki sebelumnya. Partai Demokrat hanya mendapat tiga kursi dan sebelumnya empat kursi. Demikian juga PDIP hanya mendapat dua kursi dari sebelumnya tiga kursi. Akibat berlarutnya penghitungan suara, hasl dari seluruh penghitungan itu baru selesai Selasa (22/4) pagi. Perkiraan 25 anggota DPRD Kota Tebingtinggi yang akan duduk di periode 2014-2019, untuk Dapil I Kec. Padang Hilir 5 kursi di antaranya Ibrahim Nasution (Partai Golkar), Sofiani Tambunan (PDIP), Chairil Mukmin Tambunan (Partai Demokrat), Wakidi (PKS) dan Ir Husin ST alias Aliang (Gerindra). Dapil II Tebingtinggi Kota-Padang Hulu 9 kursi di antaranya Yuridho Chap (Golkar)

dan Ir Pahala Sitorus (Golkar), Adlan Lubis (Gerindra), Muliadi (PKB), Henri Rivai (Nasdem), Muhammad Syahril dari (PKS), Ir Zainal Arifin Tambunan (Demokrat), Kaharudin Nasution (Hanura) dan H. Samsul Bahri (PKPI). Dapil III Rambutan-Bajenis sebanyak 11 kursi diantaranya, Hendra Gunawan (Golkar), Basyaruddin Nasution (Golkar), Agustami (Demokrat), Nasib Sambungan Silalahi (Nasdem), Murli Purba (PBB), Ogamota Hulu (Hanura), Asnawi Mangkualam (PPP), Edy Syahputera (PKPI), Fahmi Tanjung (PAN), Waris (PDIP) dan Muhammad Hazly Hasibuan (Gerindra). KPU Diadukan Terkait itu, beberapa jurnalis/wartawan yang meliput penghitungan suara di kantor KPU mengadukan salah seorang komisioner KPU kota Tebingtinggi ke Mapolres Tebingtinggi. Dua jurnalis media elektronik yang melapor itu, yakni Rudianto Purba dan Abdullah Sani dan seorang lagi jurnalis media cetak Saptha Nugraha Isa, dengan terlapor Ridwan Napitupulu, SH. Ketiganya, melaporkan komisioner KPU itu dengan sangkaan menghalangi tugas wartawan, sehingga melanggar UU No.40/1999 tentang Pers. Kepolisian selanjutnya mengeluarkan surat Laporan Polisi (LP) No.LP/223/IV/2014/SPK tanggal 21 April 2014. “Kami merasa dilecehkan oleh komisioner KPU Ridwan Napitupulu, karena itu kami laporkan dia melanggar Pasal 18 ayat (1) UU Pers,” tegas Saptha Nugraha Isa. Tak hanya sampai mengadu ke polisi, Sapta Nugraha Isa, juga mengadukan Ridwan Napitupulu, SH ke PWI Cabang Sumut. Pengaduan itu dilakukan, karena yang bersangkutan merupakan anggota PWI Cabang Sumut. “Saya resmi tadi mengadu ke PWI,” ujar Sapta, Rabu (22/4). Komisioner KPU Ridwan Napitupulu, SH, membantah melarang dan mengusir jurnalis saat melakukan liputan. Dikatakan, yang berhak masuk saat penghitungan itu hanya peserta, sedangkan untuk wartawan nantinya akan dilakukan konfrensi pers. “Jadi kita tak pernah mengusir, tapi minta agar keluar dan akan dilakukan konfrensi pers,” katanya.(a09)


B2 Saksi PDIP Korban Penganiayaan Segera Melapor Ke Kompolnas BERASTAGI (Waspada): Usai membuat laporan ke Polda Sumatera Utara (Poldasu) Selasa (22/4) atas dugaan penganiaan diduga dilakukan oknum Polres T. Karo pada Senin (21/4) malam, dalam rangka mengamankan rapat rekapitulasi surat suara Pileg di hotel Horison Berastagi, Julianus Paulus Sembiring, 35, warga Kabanjahe Kab. Karo segera melapor ke Komisi Kepolisian Nasional (Kompolnas). “Saya sudah membuat laporan ke Poldasu tertera dalam Nomor : STTPL /463/IV/2014/SPKT.”I” pada 22 April 2014 atas nama pelapor Julianus Paulus Sembiring. Selanjutnya akan saya laporkan perkara penganiayaan atas diri saya yang terjadi pada Senin malam dalam rapat rekapitulasi surat suara Pileg ke Komponas,” ungkap korban, Julianus Sembiring kepada Waspada melalui telepon seluler, Selasa (22/4). Dijelaskan, saa dia melapor ke Poldasu, pihak kepolisian sangat membantu. “Yang menerima laporan Brigadir Azis Simangunsong, SH, dan diketahui oleh atas nama Kapoldasu KA SPKT Ub Pamin Siaga SPKT SHIF “I“ AKP Lintong Sitanggang,” ungkapnya. Selanjutnya, lanjutnya, dia sudah melakukan koordinasi kepada kepolisian untuk dalam berapa hari ini dia tidak bisa hadir dalam pemanggilan berikutnya, karena dia akan pergi ke Jakarta membuat melapor ke Kompolnas. Kapolres T. Karo AKBP Alberd Sianipar kepada Waspada saat dikonfirmasi pada malam usai peristiwa tersebut membantah adanya pemukulan terhadap korban.” Tindakan petugas hanya mengamankan yang bersangkutan ke luar ruangan, karena ribut dengan saksi lainnya. Tidak ada pemukulan,” ungkapnya. (c19)

Caleg Demokrat Diprediksi Menjadi Ketua DPRD Karo KABANJAHE (Waspada): Ketua Dewan Pimpinan Cabang (DPC) Partai Demokrat (PD) Kab. Karo Sumatera Utara (Sumut) DR (HC) Kena Ukur Karo Jambi Surbakti yang juga Bupati Karo, merasa senang atas kemenangan Partai Demokrat yang dipimpinnya melaju pesat pada pemilihan anggota legislatif (Pileg) 9 April 2014 lalu. “Meski secara nasional suara Demokrat mengalami penurunan, tapi jauh bebeda dengan suara Demokrat di Kabupaten Karo yang justru naik hingga 300 persen suara perolehan,” kata Karo Jambi kepada Waspada melalui telepon selular Rabu (23/4). Menurutnya, di masa jaya Demokrat pada Pemilu 2009, Partai Demokrat besutan Presiden Susilo Bambang Yudhoyono itu justru hanya memperoleh dua kursi di DPRD Karo, tapi sekarang Partai Demokrat mendapat 6 kursi untuk DPRD Karo. Ini kenaikan yang sangat signifikan hingga 300 persen. “Selain memperoleh 6 kursi suara hasil rekapitulasi KPUD Karo, Partai Demokrat menjadi pemenang di Karo. Enam kursi porsi yang diperoleh Demokrat, juga bersamaan dengan PDIP dan Gerindra. Tapi perolehan suara Demokrat yang terbesar mencapai 33 ribu suara mengalahkan dua partai yang sama meraih kursinya,” kata Karo Jambi. Bupati Karo itu menyatakan, dengan perolehan suara terbanyak dan sebagai pemenang Pileg dipastikan kader Demokrat akan menduduki Ketua DPRD Kabupaten Karo. “Untuk Ketua DPRD Karo sudah dipastikan akan diduduki kader Demokrat, sebagai pimpinan dewan nantinya,” katanya. Namun, siapa yang akan menjadi pimpinan dewan dari kader Demokrat itu, Karo Jambi belum bisa mengungkapkannya. Meski diketahui seorang putrinya bernama Nora Else yang akan duduk sebagai wakil rakyat Karo, apakah akan direkomendasikan sebagai ketua dewan, hal itu belum mau dikomentarinya. (c19)

Sumatera Utara

WASPADA Kamis 24 April 2014

Gubsu: Rp1,2 T Perbaiki Jalan Nasional Di Dairi SIDIKALANG (Waspada): Untuk memperbaiki jalan nasional di wilayah Dairi pada 2014 ini dialokasikan Rp1,2 triliun bersumber dari ABPN. Hal tersebut dijelaskan Gubsu Gatot Pujo Nugroho kepada wartawan usai pelantikan Bupati dan Wabup di Sidikalang, Selasa (22/4). Menurut Gubsu, sudah menghubungi Kadis PU Provsu bahwa jalan nasional di wilayah Dairi mendapat perbaikan tahun ini di antaranya jurusan Sidikalang-Kutacane dan Sidikalang-Samosir. Dananya sudah ditampung dan perbaikan dilaksanakan tahun ini. Hal tersebut dipertanyakan

wartawan mengingat badan jalan nasional jurusan Sidikalang-Kutacane, Sidikalang-Samosir-Humbahas, mengalami rusak berat di beberapa titik, seperti jurusan Sidikalang-Samosir. Bahkan, sekira 20 km badan jalan nasional di penuhi kubangan. Pantauan Waspada di lapa-

ngan, kerusakan jalan tersebut terlihat mulai dari Desa Bangun Kec. Parbuluan hingga tapal batas Dairi dengan Humbahas. Puluhan kubangan menganga berisi air hujan dan menimbulkan becek sehingga menyulitkan pengguna jalan. Kerusakan tersebut sudah lama berlangsung. Begitu juga dengan jalan nasional Sidikalang-Kutacane. Di beberapa titik terdapat kubangan terutama di kawasan Kec. Tigalingga hingga ke kawasan Kec. Tanah Pinem. Sedangkan bahu jalan yang longsor di Desa Bakkal Kec. Siempatnempu Hulu, terlihat sudah mendapat perbaikan. (a20)

Proyek Miliaran Di Simalungun Dimonopoli Rekanan Tertentu SIMALUNGUN (Waspada): Sejumlah proyek pembangunan bersumber dari anggaran pendapatan dan belanja daerah (APBD) Kab. Simalungun,Tahun Anggaran 2014 yang nilainya di atas Rp500 juta hingga miliaran rupiah dimonopoli salahsatu rekanan asal Serbelawan, Kec. Dolok Batu Nanggar. Praktik monopoli proyek pekerjaan oleh rekanan tersebut menjadi bahan pergunjingan di kalangan masyarakat dan rekanan lainnya dan dianggap akan mematikan secara pelan-pelan kalangan rekanan pribumi. Seperti halnya pembangunan proyek kantor bupati dan gedung Harungguan berikut interior dan mobilernya yang dikerjakan pada tahun anggaran 2013 dikuasai oknum rekanan tertentu dengan total nilai mencapai Rp20 miliar. Dan pada tahun anggaran 2014 ini, kembali dilakukan pembangunan bangunan pendukung di pelataran halaman kantor bupati senilai Rp3,9 miliar lebih. “Pendeknya, anggaran

proyek di atas Rp500 juta sampai miliaran rupiah dimonopoli rekanan non pribumi,” cetus R. Silalahi, salahseorang rekanan. Memang, lanjut Silalahi, nama perusahaan yang mendapatkan proyek selalu berbeda-beda. Tetapi, itu hanya siasat rekanan saja yang diduga sudah bekerjasama dengan oknum tertentu. Nama perusahaan bisa saja berbeda, tapi dikabarkan orangnya tetap sama. “Jika hanya satu pengusaha saja yang mendapatkan pekerjaan dengan nilai yang besar, bisa bangkrut perusahaan lain, karena hanya mendapatkan pekerjaan yang kecil-kecil saja, dan saya menduga ada indikasi permainan dalam proses pelelangan proyek yang bernilai ratusan juta hingga Rp1 miliar ke atas, sehingga bisa dimenangkan satu pengusaha saja,” ujar Silalahi. Dia mencontohkan proyek lanjutan pengerjaan kantor bupati di Pematang Raya senilai Rp3,9 miliar lebih dan pekerjaan penembokan di komplek satuan

kerja perangkat daerah (SKPD) hampir Rp1 miliar dan pengadaan baju seragam hansip bagi petugas Linmas pengamanan Pemilu 2014 senilai lebih Rp1 miliar dikerjakan pengusaha berinisial A yang berdomisili di Serbelawan,Kec. Dolok Batu Nanggar. Silalahi berharap Pemkab Simalungun tidak melakukan diskriminasi terhadap pengusaha atau rekanan untuk mendapatkan pekerjaan proyek pembangunan daerah yang dibiayai APBD TA 2014. Sementara itu pihak Pemkab Simalungun yang dikonfirmasi melalui Kepala Dinas Perhubungan dan Kominfo, Mixnon Andreas Simamora membantah adanya permainan dalam proses pelelangan proyek pembangunan yang dibiayai APBD TA 2014. “Tidak benar ada permainan, karena proses pelelangan proyek dilakukan sesuai mekanisme dan terbuka melalui layanan pengadaan secara elektronik (LPSE),” kata Simamora. (a29)

Waspada/ Mulia Siregar

Kepala Badan P2KB Pematangsiantar, drg. Rumondang Sinaga, MARS (kanan) langsung memantau persiapan 2.000 siswa yang akan menggelar tarian Martumba, dari atas tribun stadion Mar toba Pematangsiantar, Rabu (23/4).

2.000 Siswa Menari Martumba Di Acara Gebyar GenRe PEMATANGSIANTAR (Waspada): 2.000 Siswa dari berbagai sekolah lanjutan tingkat atas (SLTA) se Kota Pematangsiantar dipersiapkan untuk ditampilkan dalam acara Gebyar GenRe (generasi berencana) bertajuk ‘Ikrar Menunda Usia Perkawinan’, Rabu (23/4). Mereka masih terus mematangkan diri berlatih di lapangan sepakbola stadion Martoba Pematangsiantar. Kepala Badan Pemberdayaan Perempuan dan Keluarga Berencana (P2KB) Pematangsiantar, drg. Rumondang Sinaga, MARS tampak terus mengikuti pelaksanaan pelatihan kepada ke 2.000 siswa yang diberikan sejumlah guru yang memiliki sertifikat khusus pelatih tari di kota itu. Kepada Waspada, Rumondang Sinaga mengatakan, ke 2.000 siswa itu nantinya akan menampilkan tarian Martumba, yaitu tarian tradisional masyarakat Tapanuli Tengah, dalam satu gelar acara yang dilakukan pada Sabtu (26/4).

Gebyar GenRe dengan menampilkan tarian Martumba tersebut nantinya akan juga digelar secara serentak dan bersamaan di delapan kabupaten/kota di Sumut. Pagelaran tarian rakyat secara klosal yang sengaja menampilkan gadis-gadis dan pemudapemuda berasal dari bangku sekolah itu, nantinya diharapkan dapat dicatatkan dalam rekor MURI. Ke delapan kabupaten/kota yang menggelar tarian Martumba di hari yang bersamaan itu adalah, Pematangsiantar, Serdang Bedagai, Langkat, Tapanuli Tengah, Tebingtinggi, Binjai dan Medan. Wali Kota Pematangsiantar, Hulman Sitorus, SE bersama ketua PKK kota Pematansiantar, Nyo. Hulman Sitorus menurut Rumondang Sinaga cukup serius dan mendukung, Kota Pematangsiantar masuk dalam daftar daerah yang menggelar acara Gebyar GenRe yang disponsori BKKBN perwakilan Sumut, Sabtu mendatang itu. (c16/Crap)

100 Personil Korem 022/PT Ikuti Bimtek PEMATANGSIANTAR (Waspada): Danrem 022/PT yang diwakili Kasrem 022/PT Letkol Arm Anton Irianto Popang, SH menerima tim dari Pusat Teritorial Angkatan Darat (Pusterad) Kolonel Inf Utoh Zaendy, S.Sos dan rombongan di aula Makorem 022/PT, Jl. Asahan Km.3,5 Pematangsiantar, Selasa (22/4). Kedatangan Tim dari Pusterad bertujuan memberikan Bimbingan Teknis (Bimtek) Metode Pembinaan Territorial (Binter) dalam kegiatan terpadu Pusterad tahun 2014 yang diikuti 100 orang prajurit jajaran Korem 022/PT. Danrem 022/PT Kolonel Inf Teguh Arief Indratmoko dalam sambutan tertulisnya yang dibacakan Kasrem 022/PT Letkol Arm Anton Irianto Popang, SH mengatakan sangat mengapresiasi kegiatan Bimtek Metoda Binter,

karena dengan adanya kegiatan itu diharapkan dapat memberikan pencerahan dan pemahaman tentang berbagai hal yang berkaitan dengan Bimter, hingga seluruh satuan dapat menyamakan persepsi dan memiliki kemampuan tentang penyelenggaraan Binter di satuan dalam menghadapi fenomena perkembangan lingkungan strategis dalam era globalisasi saat ini. Kolonel Inf Utoh Zaendy, S.Sos membacakan sambutan tertulis Danpusterad Mayjen TNI Zahari Siregar yang menyebutkan maksud dan tujuan dilaksanakannya kegiatan itu untuk menyamakan persepsi tentang penyelenggaraan Binter di satuan bawah, sekaligus untuk mendapatkan masukan berupa pendapat maupun saran revisi. (a30)


Sumatera Utara

WASPADA Kamis 24 April 2014

B3

Sopir Angkot Blokir Jalinsum Padangsidimpuan-Sibolga P.SIDIMPUAN(Waspada): Puluhan sopir angkutan kota lin 01, 03, dan 07, melakukan aksi blokir Jalinsum jurusan Padangsidimpuan-Sibolga di Lingk. Flamboyan, Kel. Palopat Maria, Kec. Sidimpuan Hutaimbaru, Rabu (23/4). Aksi ini merupakan bentuk protes sopir angkot terhadap Wali Kota Padangsidimpuan Andar Amin Harahap, dan kepada pegawai Dinas Perhubungan dan Kominfo, karena dinilai tidak tegas menegakkan aturan tentang pengoperasionalan Terminal Hutaimbaru. Yusuf, sopir angkot, kepada Waspada menuturkan, Dinas Perhubungan hanya mau untung saja dari kutipan retribusi terhadap setiap angkutan tapi samasekali tidak peduli terhadap nasib para sopir. Aksi ini menurut sopir angkot lainnya, Marhan, dilatari adanya angkutan L300 jurusan Sibolga-Sidimpuan yang tidak

mau memindahkan loket ke terminal. Kemudian melanggar kesepakatan untuk menurunkan sewa di terminal. “Kami ‘menangkap’ angkutan jenis L300 dari Batangtoru, Tapanuli Selatan, yang tidak menurunkan sewa di terminal. Alasannya, semua sewa hendak ke stasiun angkutan luar kota di Terminal Pijorkoling,” katanya. Marhan bersama sopir angkot yang lain memeriksa surat jalan dari loket yang ditunjukkan sopir L300. Memang benar tertulis kalau semua sewa itu akan ke stasiun angkutan luar kota, dan setiap orang dimintai ongkos Rp25 ribu. “Namun ada sewa yang mengaku kalau dia bukan

hendak ke luar kota, tapi ke pusat pasar Sidimpuan untuk berbelanja. ‘’Lalu kami emosi, apalagi pegawai Dishub yang di terminal itu membiarkan dan menyuruh sopir L300 itu pergi membawa sewanya,” ujar Marhan. Pantauan Waspada, aksi blokir jalan ini mengakibatkan arus lalulintas macat total 3 kilometer. Banyak pengguna jalan yang mengeluh karena perjalanan dan aktivitasnya terhambat. Sopir truk pengangkut LPG 3 Kg milik CV. Harapan Baru, S Manulang, juga mengeluh. Katanya, dia dari Aek Godang, Kab. Padanglawas Utara, dan hendak mengantar LPG ke agen yang ada di Sibolga dan Kab. Tapanuli Tengah. Akibat blokir

jalan ini, perjalanan jadi tertunda. Arus lalulintas mulai bergerak setelah sejam kemudian personil Sat Lantas Polres Padangsidimpuan tiba di lokasi. Sejumlah petugas tampak sibuk memerintahkan sopir angkot untuk membuka ruang bagi perlintasan kendaraan lain yang terjebak macet akibat aksi tersebut. Sehari sebelumnya, Selasa (22/1), puluhan sopir angkutan L300 jurusan Sidimpuan-Batangtoru-Sibolga melakukan unjukrasa ke Kantor Wali Kota Padangsidimpuan. Mereka menuntut ketegasan wali kota atas pengoperasionalan Terminal Hutaimbaru, karena selain kutipan retribusi Rp3

ribu kepada Dinas Perhubungan, di dalam terminal, mereka juga harus bayar Rp10 ribu kepada pemuda setempat (PS) atau preman terminal. (a27)

Panwaslu Palas Usulkan Pemilihan Ulang SIBUHUAN (Waspada): Menyusul aksi walk out (WO) saat pelaksanaan rekapitulasi perhitungan suara ditingkat KPU Kab. Palas dan banyaknya kejanggalan selama proses penyelenggaran pemilu legislatif sudah selayaknya dilakukan pemilihan ulang di Padanglawas (Palas). Menurut Divisi Hukum dan Tindak Lanjut Pelanggaran Panwaslu Padanglawas, Sunardi Daulay, Rabu (23/4), pihaknya akan melakukan advokasi terhadap temuan pelanggaran, termasuk hilangnya C-1 dari sejumlah TPS di Kec. Sosa. Dimana, menurut pernyataan PPK Sosa, dalam kejadian khusus model DA-2 KPU, keberatan saksi yang ditandatangani Raja Mahmud Lubis, Ketua PPK Sosa, mengenai hilangnya dokumen pemilu tingkat PPS 11 kotak suara. Maka, terkait peristiwa hilangnya kotak suara itu, Panwaslu Padanglawas akan melakukan advokasi, meneliti dan membuat kajian serta merekomendasi, apakah dokumen yang hilang itu ada hubungannya dengan hasil rekapitulasi tingkat KPPS dan PPS. Karena, bila dokumen hasil perolehan suara hilang, maka hasil rekapitulasi perhitungan perolehan suara di tingkat PPK Kec. Sosa sumber dokumennya dipertanyakan dari mana, begitu juga pasca kerusuhan, dimana KPU Palas mengambilalih rekapitulasi perhitungan perolehan suara tingkat PPK Kec. Sosa. Apalagi, hampir setiap kecamatan ditemukan kejanggalan, seperti perbedaan angka perolehan suara pada C-1 PPK, Panwas dan saksi. Sepanjang proses pelaksanaan rekapitulasi perhitungan perolehan suara tingkat KPU Kab. Palas, kata dia, hanya untuk Kec. Batang Lubu Sutam dan Kec. Hutaraja Tinggi yang tidak ada permasalahan, sementara 10 kecamatan lainnya ada masalah dan kejanggalan. Kemudian, jelas Sunardi, dari awal proses penyelenggaraan pemilu legislatif di Kab Palas 25 laporan dan temuan pelanggaran yang terregistrasi, sebagian ada yang tidak memenuhi syarat, ada yang direkomendasi ke KPU Palas, namun masih ada waktu KPU untuk menyampaikan klarifikasi tertulis sebelum disampaikan ke Bawaslu provinsi ataupun ke DKPP, katanya. (a33)

Kemenag Tapteng Bedah Rumah TAPTENG (Waspada): Sebagai bentuk pengabdian kepada masyarakat, Kemenag Tapanuli Tengah mengadakan bedah rumah di Lingk. II, Kel. Lopian, Kec. Badiri. Peletakan batu pertama dilakukan, Rabu (23/4) oleh Kepala Kemenag Tapteng Drs. H. Sarmadan Nur Siregar, yang merupakan promotor dari kegiatan ini. Dia menyebutkan, tujuan kegiatan bedah rumah ini untuk membangun komunikasi dengan masyarakat, sebagai wujud dari visi Kemenag Tapteng, sebab kepedulian kepada kaum duafa merupakan ajaran agama. Bedah rumah ini merupakan hasil sumbangan dari seluruh pejabat struktural, fungsional dan pegawai di lingkungan Kementerian Agama Tapteng. “Saya berharap bedah rumah ini menjadi bait Alquran dalam artian seluruh penghuninya membaca Alquran dan khusus anaknya yang merupakan siswa MAN menjadi guru ngaji dan menjadikan lingkungan sekitar rumah menjadi taman baca Alquran,” katanya. Dia menambahkan bedah rumah ini merupakan langkah awal pelayanan konseling terhadap siswa yang keluarganya mengalami keterbelakangan ekonomi sehingga anak tersebut menjadi lebih percaya diri, giat belajar dan berprestasi. Dijelaskan, rumah yang dibedah adalah milik Taryono dan Lela Hanum Lubis. orangtua siswa MAN Pandan. Kondisi rumah sangat memprihatinkan berlantaikan tanah beratap rumbia dan dinding gedek dengan sebagian terpal. Setiap hujan rumahnya bocor. Melihat kondisi ini masyarakat sangat antusias untuk membangun rumah ini, di mana semua komponen dari KUA se-Tapteng, Madrasah se-Tapteng, dan masyarakat Badiri bersedia gotong royong secara bergantian. Ketua Panitia Bincar Halomoan Siregar bersama Lurah Lopian dan tokoh masyarakat Badiri mengucapkan terimakasih kepada Ka.Kankemeg Tapteng yang telah banyak berbuat di Tapteng, khususnya di Kec. Badiri. Mereka melihat kegiatan ini mungkin merupakan yang pertama dan satu-satunya yang dilakukan di lingkungan Kementerian Agama Tapanuli Tengah. (m37/rel)

Waspada/Sori Parlah Harahap

BUPATI Padanglawas Utara Drs H. Bachrum Harahap memukul beduk pertanda secara resmi dibukanya MTQ VII Tingkat Kab. Paluta, Selasa (22/4) malam.

Bupati Buka MTQ VII Paluta GUNUNGTUA (Waspada): Bupati Paluta Drs H Bachrum Harahap secarresmi membuka Musabaqah Tilawatil Quran (MTQ) VII Tingkat Kabupaten Padanglawas Utara (Paluta), Selasa (22/4) malam, yang dipusatkan di Lapangan Merdeka, Alun-alun Pasar Gunugtua, Kec. Padangbolak. Sebelumnya digelar pawai ta’ruf Musabaqoh Tilawatil Quran (MTQ) VII dan mengambil start di halaman Masjid Raya Gunungtua. Iringan pawai dimeriahkan penampilan drum band dan diikuti seluruh kafilah dari sembilan kecamatan sePaluta.

Bupati Paluta, Drs H Bachrum Harahap memberikan apresiasi setinggi-tingginya kepada segenap panitia serta masyarakat atas partisipasinya dalam penyelenggaraan MTQ VII tingkat Kab. Paluta. “Melalui kegiatan ini, semoga syiar agama Islam dapat semakin berkibar. Selain itu, semoga kegiatan ini juga menghasilkan para peserta terbaik yang siap tampil dalam MTQ tingkat Provinsi Sumatera Utara,” ujarnya. Kakan Kemenag Paluta Drs H Azaman Harahap mengungkapkan, pelaksanaan MTQ diharap dapat menjadi cermin

dalam memacu prestasi bagi qari dan qariah. Ketua penyelenggaraan MTQ Tongku Palit Hasibuan SE Ak Msi yang juga Plt Sekda Paluta dalam laporannya mengatakan, para kafilah MTQ perwakilan dari setiap kecamatan se-Kab. Paluta akan mengikuti delapan jenis cabang perlombaan secara perorangan untuk golongan putra/putri dan secara tim dengan personal gabungan putra dan putri. Pelaksanaan MTQ berlangsung 22 hingga 24 April 2014. ‘’Total jumlah peserta MTQ Paluta 2014 yakni 289 peserta,’’ ujar Tongku Palit. (a35)

CSR Percepat Madina Bebas Malaria PANYABUNGAN ( Waspada): Kepala Kantor Pusat Penanggulangan Malaria Madina dr. Syarifuddin mengatakan, program Corporate Social Rersponsibility (CSR) atau tanggungjawab sosial dunia usaha, merupakan potensi kuat untuk mempercepat target pencapaian Kab. Mandailing Natal bebas malaria. “Guna mencapai kesuksesan berkelanjutan, dunia usaha tidak cukup hanya mengejar keuntungan, tetapi harus bertanggungjawab secara sosial dan lingkungan bagi komunitas lokal dan masyarakat luas, termasuk tentang pengembangan CSR di bidang penanggulangan malaria,” ucap Syarifuddin kepada Waspada di Panyabungan, baru-baru ini. Menurutnya, pihaknya sangat mengharapkan kemitraan dengan lembaga pemerintah, swasta, masyarakat dan lembaga lainnya. Dia berkeyakinan upaya memberhasilkan

penanggulangan malaria di daerah ini hanya dapat dicapai melalui kepedulian bersama. “Agar CSR lebih efektif berkontribusi dalam upaya penanggulangan malaria di Madina, diperlukan advokasi dan informasi tentang lokasi permasalahan serta kegiatan berkaitan dengan penanggulangan malaria itu,” katanya. Syarifuddin menjelaskan, berdasarkan data yang dihimpun jajaran Kantor Pusat Penanggulangan Malaria, Dinas Kesehatan, RSUD Panyabungan dan RS Permata Madina, kasus malaria positif di daerah itu pada 2012 mencapai 7.696 kasus. Jika dilihat dari tingkat incidence kasus positif malaria per kecamatan, kejadian positif malaria tertinggi berada di Kec. Panyabungan dengan jumlah 3.842 kasus dan terendah berada di Kec. Pakantan enam kasus. Ia mengungkapkan, dalam upaya pencegahan malaria di

Madina, program CSR dapat diarahkan kepada beberapa kegiatan utama seperti pengadaan kelambu berinsektisida bagi seluruh rumahtangga di wilayah CSR terpilih, melaksanakan sosialisasi penanggulangan malaria. Pengadaan brosur atau leaflet maupun media promosi lainnya dengan tujuan meningkatkan pengetahuan masyarakat, melakukan pelatihan kader untuk berperan aktif dalam upaya penanggulangan malaria, melaksanakan pelatihan juru malaria desa dan memfasilitasi pembentukan pos malaria desa. Kemudian, pengadaan obat-obatan, alat dan bahan laboratorium yang diperlukan dalam upaya pemeriksaan dan penemuan penderita malaria, termasuk sarana dan prasarana pemeriksaan malaria di desa atau daerah yang sulit dijangkau, seperti kendaraan operasional T3 (test, treatment dan tracking).(a28)

Waspada/Sukri Falah Harahap

PULUHAN sopir angkot lin 01, 03, dan 07 memblokir Jalinsum Sidimpuan-Sibolga, Rabu (23/4). Arus lalulintas macat total sekira 3 Km.

Syariful Mahya Bandar Unggul Di P.Sidimpuan P.SIDIMPUAN ( Waspada): Mantan Kakanwil Kementerian Agama Sumatera Utara, Drs.H.Syariful Mahya Bandar, MAP unggul dalam perolehan suara calon DPD (Dewan Perwakilan Daerah) Sumut di Kota P.Sidimpuan yang ditetapkan KPU setempat 21 April 2014 dengan angka 23.843 suara disusul Damayanti Lubis 12.827 suara. Informasi diperoleh Waspada, Rabu (23/ 4), berdasarkan rekapitulasi hasil penghitungan suara pemilu legislatif tahun 2014, perolahan suara calon DPD RI di masing-masing kecamatan yang ada di Kota P.Sidimpuan dikuasai sepenuhnya Syariful Mahya Bandar menyisihkan 23 colon DPD lainnya. Dari 97.623 suara sah untuk calon DPD RI, 23.843 suara atau 24,4% suara dikantongi mantan Kakanwil Kemenag tersebut. Suara yang diraih Syariful Mahya Bandar terdiri dari 9.786 suara di Kec.P.Sidimpuan Utara, 6.614 di Kec.P.Sidimpuan Selatan, 2.459 di Kec.P.Sidimpuan Hutaimbaru, 1.748 di Kec.P.Sidimpuan Batunadua, 2.414 di Kec.P.Sidimpuan Tenggara dan 822 di kec.P.Sidimpuan Angkola Julu.Sedangkan peringkat kedua dibawah Prof.Damayanti Lubis diraih Drs.H.Ibrahim Sakti Batubara dengan

Hari Kartini Di Martabe

dr. Lula Kamal Bahas Kesehatan Wanita BATANGTORU (Was-pada): Tambang Emas Mar-tabe di Kec. Batangtoru, Kab.Tapanuli Selatan, me-meriahkan Hari Kartini 2014 dengan lomba vokal grup dan turnamen sepakbola khusus kaum perempuan. Selain itu juga digelar seminar sehari dengan pembicara tunggal dr. Lula Kamal dari Jakarta, Senin (21/4). Lula Kamal yang juga dikenal sebagai bintang iklan, presenter televisi, dan aktivis anti narkoba, membawakan materi seputar persoalan kesehatan wanita. Mulai dari pola hidup bersih sehat (PHBS), jenis penyakit yang biasa menyerang wanita, dan cara pencegahannya. “Saya kagum dengan banyaknya perempuan yang bekerja di Tambang Emas Martabe. Mereka Kartini-Kartini tangguh, karena mampu mengerjakan pekerjaan yang sama dengan pria. Ada yang masih gadis, dan banyak pula ibu rumah tangga,” kata Lula di awal paparannya. Demikianpun, di tengah sibuknya bekerja, para Kartini harus tetap perhatikan kesehatan. Karena semua yang diperoleh dari hasil bekerja ini akan sia-sia jika tubuh sudah diserang penyakit. Seperti kanker payudara dan kanker servick yang jadi penyebab kematian wanita di Indonesia. “Perempuan Indonesia harus sehat, aktif, dan aktualisasikan diri dengan segala perkem-

Waspada/Ist

Kakankemenag Tapteng saat peletakan batu pertama bedah rumah di Lingkungan II Kelurahan Lopian Kecamatan Badiri kemarin.

Selatan, Partai Goklar memperoleh 5.393 suara. Caleg nomor urut 7. Abdul Adi Safran Harahap SH memperoleh peringkat pertama dengan perolehan 1.497 suara, disusul caleg nomor 4. H Amir Syariffuddin Nasution ,BSc 1.468 suara, kemudian caleg nomor urut 2 Syafran Oloan Nasution memperoleh 1.455 suara. Dapil Padanglawas dua, Kec. Sosopan Ulu Barumun dan Lubuk Barumun, Partai Golkar memperoleh 2.870 suara. caleg nomor urut 5. Aminuddin Harahap memperoleh peringkat pertama dengan perolehan 947 suara, di susul nomor 4. Ir H Zulkifli Harahap dengan perolehan 789 suara, kemudian caleg nomor 1. Fajar Harahap yang memperoleh 613 suara. Dapil Padanglawas tiga, Kec.Huristak, Aek Nabara Barumun, Sihapas Barumun dan Barumun Tengah, Partai Golkar memperoleh 2.944 suara. caleg nomor urut 5. Amran Pikal S.SosI memperoleh peringkat pertama dengan perolehan 978

suara, di susul oleh caleg nomor 2. Haspan Mulia Daulay SP dengan perolehan 816 suara, kemudian caleg nomor 1. H Amir Husin Hasibuan yang memperoleh 816 suara. Dapil Padanglawas empat, Kec. Sosa dan Batang Lubu Sutam , Partai Golkar memperoleh 5.725 suara. caleg nomor urut 1. MHD Hamidi Pasaribu. memperoleh peringkat pertama dengan perolehan 1.854 suara, di susul caleg nomor 6. MulkanYahya Lubis dengan perolehan 1,651 suara, kemudian caleg 4. H Raja Muda yang memperoleh 1.057 suara. Dapil Padanglawas lima, Kec. Hutaraja Tinggi, Partai Golkar memperoleh 3.583 suara. caleg nomor urut 1. H Syahwil Nasution memperoleh peringkat pertama dengan perolehan 1.519 suara, di susul oleh caleg nomor 2. Heksantia Nurul Huda Sp dengan perolehan 1.323 suara, kemudian caleg 5. Ibnu Kotob SE yang memperoleh 187 suara. Sama halnya perolehan

bangan. Biasakan pola hidup bersih dan sehat. Makan, tidur, dan olahraga teratur. Jangan lupa keluarga dan bersosialisasi dengan masyarakat sekitar,” katanya. Berbicara mengenai perempuan, ujar dr. Lula, saat ini banyak yang ingin terlihat langsing. Mereka melakukan diet dengan cara mengurangi jenis dan porsi makanannya. Bahkan ada yang berbuat ekstrim, dengan cara samasekali tidak mengonsumsi makanan berlemak. Padahal lemak itu penghasil hormon bagi tubuh. “Jika tidak ada lemak, maka tidak ada hormon yang dihasilkan tubuh. Metabolisme tubuh akan berkurang, mudah terserang penyakit, menurunkan tingkat kesadaran, dan bahkan mengakibatkan kemandulan bagi perempuan yang sudah dan akan menikah,” terang Lula. Penyakit yang banyak menyerang perempuan saat ini, adalah kanker payudara dan servick. Biasanya, pasien akan datang berobat ke dokter setelah kankernya tingkat stadium tiga atau empat, atau setelah tidak tahan dengan rasa sakitnya. Padahal kanker payudara itu bisa dicegah sejak dini, dengan cara memeriksanya sendiri minimal sekali sebulan. Caranya, perhatikan apa ada benjolan di area payudara hingga ke bawah ketiak. Atau bisa juga periksakan ke dokter, bidan, atau perawat. (a27)

Waspada/Sukri Falah Harahap

KARTINI: dr. Lula Kamal memberi penjelasan seputar persoalan kesehatan wanita, pada peringatan Hari Kartini 2014 di Pelangi Camp Tambang Emas Martabe.

Golkar Menang Di Palas SIBUHUAN (Waspada): Partai Golkar menang di Kab. Padanglawas (Palas) dengan memperoleh 20.515 suara atau 16.37 persen sehingga dipastikan merebut kursi di setiap daerah pemilihan (dapil) dari lima dapil untuk daerah yang dimekarkan dari Tapsel 2007 tersebut. Hal itu terbukti dari hasil pleno terbuka rekapitulasi penghitungan suara oleh Komisi Pemilihan Umum Daerah (KPUD) setempat yang dipimpin Ketua KPUD Syarifuddin Daulay S.Ag dan merampungkan rekapitulasi penghitungannya, Senin, (21/4) malam. Saksi Partai Golkar Kab. Palas Miftahuddin Harahap yang juga Wakil Sekretaris DPD Golkar Palas usai rekapitulas tersebut mengatakan, partai yang dipimpin H Ali Sutan Harahap (TSO) untuk tingkat kabupaten itu memperoleh suara terbanyak di sejumlah kecamatan dan dapil. Dapil Padanglawas satu, Kec. Barumun dan Barumun

perolehan 10.758 suara. Peringkat keempat ditempati Dedi Iskandar Batubara dengan meraih 9.618 suara, disusul Drs.H.Rijal Sirait sebanyak 7.941 suara, Muhammad Nuh, M.Sp sebanyak 6.458, Rudolf Marzuoka Pardede 2.927 suara, Ir.Benny Pasaribu 2.755, Rahmat Hidayat,SE 2.464 dan Darwin Hamonangan Lubis 2.156 suara Calon DPD Sumut lainnya yang ikut bertarung memperebutkan empat tiket wakil Sumut ke senayan hanya memperoleh suara di bawah 2.000. Jika merujuk pada hasil suara sah untuk masing-masing tingkatan, total suara sah untuk calon DPD RI jauh dibawah total suara sah tingkat DPRD Kota P.Sidimpuan yang mencapai 107.824 suara. Ini menunjukkan bahwa suara tingkat DPRD P.Sidimpuan lebih banyak 10.201 dari total suara sah calon DPD RI. Suara sah tingkat DPRD Provinsi Sumatera Utara s 102.543 dan tingkat DPR RI 13.231 suara. Zainuddin, Tim Pemenangan Calon Anggota DPD RI Periode 2014-2019 di Kota P.Sidimpuan mengatakan, perolehan suara yang diraih Syariful Mahya Bandar murni pilihan masyarakat tanpa money politic atau politik transaksional. (cml)

suara untuk caleg DPRD Provinsi . Partai Golkar juga memperoleh suara terbanyak di Dapil Sumatera Utara 7 Kab. Padanglawas dengan memperoleh 17.582 suara. Di daerah ini Caleg Nomor urut 10. H Syarifuddin Hasibuan memperoleh peringkat pertama dengan perolehan 4.844 suara, disusul caleg nomor 2. H Yasir Ridho Loebis Sh,ST, MSP yang memperoleh 2.686 suara, kemudian caleg nomor 1. Ir Doli Sinomba Siregar sebanyak 2.149 suara. Namun untuk perolehan suara DPR RI di Kab Padanglawas yang termasuk dapil Sumatera Utara 2 Partai Golkar hanya memperoleh ranking lima dengan perolehan 12.540 suara. Suara terbanyak diperoleh caleg nomor 1. Rambe Kamerul Zaman M.Sc MM dengan perolehan 3.184 suara, disusul Caleg nomor 2. Neil Iskandar Daulay 2.854 suara dan caleg nomor 3. Drg Regina Tetty Mary Hutapea Msc yang memperoleh 2.736 suara. (a34)

Bupati Paluta Tandatangani MoU Dengan Kejari P. Sidimpuan GUNUNGTUA (Waspada): Bupati Padanglawas Utara (Paluta) Bachrum Harahap bersama Kejari Padangsidimpuan Nadda Lubis menandatangani memorandum of understanding (MoU) tentang penanganan masalah hukum bidang perdata dan tata usaha negara, di aula Kantor Bupati Paluta, Jalinsum GunungtuaPadangsidimpuan, Kilometer 4, Kec. Padangbolak, Senin (21/ 4). Penandatanganan piagam kerjasama ini dibuat sebagai wujud komitmen pemerintah daerah dalam menyediakan lembaga profesional untuk menangani berbagai permasalahan bidang hukum perdata dan tata usaha negara yang dialami pejabat pemerintahan. Menurut Kepala Kejaksaan Negeri (Kejari) Padang Sidimpuan Nadda Lubis, MoU ini dilakukan berdasarkan UU No 16 tahun 2004 tentang Kejaksaan RI, UU No 32 tahun 2004 tentang Pemerintah Daerah dan UU No 37 dan 38 tentang pemekaran daerah yang bertujuan untuk menangani bersama. Bupati Paluta Bachrum Harahap menyambut baik terselenggaranya penandatanganan MoU ini merupakan salahsatu bukti kekompakan penyelenggara negara di Paluta. Bachrum menambahkan kegiatan ini dilakukan sebagai wujud kepedulian Pemkab Paluta dan dalam rangka supremasi hukum khususnya bidang perdata dan tata usaha negara. Untuk itu, kata Bupati, melalui nota kesepakatan ini kiranya mampu menyelesaikan masalah hukum yang terjadi pada Pemkab Paluta baik di dalam maupun di luar pengadilan serta menyelenggarakan penyuluhan hukum, penerangan hukum sesuai dengan pelaksanaan tugas masing-masing. (a35)


Sumatera Utara

B4 Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta).

Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Efendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Efendi, Hamdani, Rizky Rayanda. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra, Agustian Akhmad. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Munawardi Ismail, (Koordinator Liputan) Muhammad Zairin, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar. Singkil: Tarmizi Ripan, Mansurdin.

Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.  Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.  Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.  Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Perketat Pengawasan Pupuk Bersubsidi Di Labusel KOTAPINANG (Waspada): Komisi Pengawas Pupuk dan Pestisida Kab. Labusel diminta untuk memperketat pengawasan dalam proses tata niaga pupuk bersubsidi pupuk bersubsidi. Hal tersebut perlu dilakukan untuk mempersempit ruang gerak penyelewengan. Desakan itu disampaikan Ketua Aliansi Penyelamat Indonesia (API) Kab. Labusel, Rustam Sitompul SH kepada Waspada, Rabu (23/4). Menurutnya, penyelewengan dalam proses tata niaga pupuk bersubsidi ditengarai masih marak terjadi di daerah ini. “Seperti yang terjadi di Desa Aek Raso, Kec. Torgamba sesuai berita Waspada baru-baru ini, ada kios menjual pupuk NPK melebihi HET yang telah ditentukan,” katanya. Lebih jauh dikatakan, penyelewengan lain yang sering terjadi yakni penyaluran pupuk bersubsidi tidak tepat sasaran atau tidak hanya ke petani (yang berhak mendapat subsidi pupuk), melainkan kepada konglomerat kebun. Kondisi itu, kata dia, diperparah adanya dugaaan Rencana Definitif Kebutuhan Kelompok (RDKK) yang diusulkan kelompok tani. “Indikasi penyelewengan dalam distribusi pupuk bersubsidi ini terjadi akibat longgarnya pengawasan, karena tidak melibatkan petani atau organisasi petani. Saya sendiri kemarin baru membeli pupuk NPK dari salah satu kios di Kec. Torgamba harganya luar biasa Rp180 ribu/zak,” katanya. Kabag Administrasi Perekenomian, Syahman yang juga Sekretaris Tim Komisi Pengawas Pupuk dan Pestisida Kab. Labusel sebelumnya mengatakan, pihaknya tetap melakukan pengawasan terhadap distribusi dan tata niaga pupuk bersubsidi. Namun, kata dia, ketika tim turun ke lapangan untuk melakukan kroscek, kios bersangkutan tutup. “Tadi kita sudah datangi kios pupuk di Desa Aek Raso yang dikabarkan menjual pupuk NPK/Pohnska melebihi HET, namun kios tersebut tutup,” katanya. (c18)

Kamis 24 April 2014

Rekapitulasi Di T. Balai Diwarnai Walk Out Saksi

WASPADA

Redaktur Pelaksana Opini, Artikel & Agama: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: H.Akmal AZ Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Efendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: Zultamser. Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); ; T. Junaidi (Hiburan); Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi), Hang Tuah Jasa Said (Potret).

WASPADA

Waspada/Rasudin Sihotang

Kasat Narkoba Polres Tanjungbalai AKP H M Jungjung Siregar (tengah) menegaskan kepada pengunjukrasa bahwa kasus tersebut tetap diproses di Sat Narkoba Polres bukan Dit Narkoba Poldasu.

Polres ‘Digeruduk’ Massa Isu Pengambilalihan Kasus TANJUNGBALAI (Waspada): Ratusan orang mendemo Mapolres Tanjungbalai terkait isu pengambil-alihan satu kasus narkoba oleh Dit Narkoba Poldasu yang tersangkanya diduga ‘anak main’ oknum di pejabat Poldasu. “Kami ingin kasus ini tuntas di tangan Sat Narkoba Polres Tanjungbalai bukan di Poldasu. Sebab kalau diserahkan ke Poldasu, maka kami yakin tersangka ini akan dibebaskan karena ‘kartu trup’ oknum pejabat Poldasu itu ada padanya,” kata pendemo di depan Mapolres, Rabu (23/4). Tersangka RS alias TT, warga Kota Tanjungbalai ditangkap saat baru membeli narkoba jenis sabu dari Teluknibung. Dari tangannya petugas menyita barang bukti berupa satu paket sabu seberat 2,7 gram. Tak berapa lama ditangkap, beredar isu bahwa pejabat Polres Tanjungbalai ditelepon seorang pejabat Mapoldasu agar melimpahkan kasus tersebut

ke Dit Narkoba Poldasu. Masyarakat sekitar rumah tersangka yang tak ingin ada tangkap lepas, langsung berunjukrasa menuntut agar kasusnya diselesaikan di Polres Tanjungbalai. “Atas nama masyarakat kami apresiasi Kapolres AKBP ML Hutagaol dan Kasat Narkoba HM Jungjung Siregar karena telah menangkap pengedar narkoba,” kata pendemo. Menurut orator, ketidakpercayaan terhadap penanganan Dit Narkoba muncul karena banyaknya tersangka bandar maupun pengedar narkoba ditangkap lalu dilepas kembali. Kasat Narkoba, HM Junjung Siregar membenarkan pihaknya menangkap RS alias TT,

karena diduga memiliki narkoba jenis sabu-sabu. Jungjung mengingatkan bahwa pihaknya tidak akan menyerahkan proses hukum tersangka ke Mapoldasu karena bisa menyelesaikannya sendiri. “Selain TKP nya di kota ini, barbutnya juga terlalu sedikit untuk diserahkan ke Mapoldasu. Kami mampu untuk menanganinya sesuai prosedur dan undang undang yang berlaku,” ujarnya. Ditambahkan, dugaan mengenai isu intervensi dari Dir Narkoba Poldasu tidak benar. Pantauan Waspada di Mapolres, sejumlah petinggi Mabes Polri berpangkat Kombes, Kompol, AKP, dan Iptu turun ke Tanjungbalai. Petinggi Polri dari Jakarta itu dikabarkan alam mengorek informasi dari RS mengenai kebobrokan Dit Narkoba Poldasu termasuk siapa-siapa saja yang pernah ditangkap lalu dilepas. (a32)

Pengarusutamaan Gender Strategi Capai KKG RANTAUPRAPAT (Waspada): Sebagai amanah dari Permendagri Nomor 67Tahun 2011 tentang Pedoman Umum Pelaksanaan Pengarusutamaan Gender (PUG) di Daerah, dinyatakan Pengarusutamaan Gender merupakan suatu strategi untuk mencapai KKG (Kesetaraan dan Keadilan Gender). Demikian dikatakan Plt. Sekdakab L.Batu H. Ali Usman Harahap, SH saat membuka Pelatihan Analisis Gender Kegiatan Advokasi dan Fasilitasi PUG Bagi Perempuan, Rabu (23/4) di Ruang Data dan Karya Kantor Bupati L.Batu yang dihadiri para

Asisten dan Kepala SKPD. Ali Usman menambahkan, dalam rangka mewujudkan pembangunan yang berkeadilan antara laki-laki dan perempuan, maka perlu adanya perencanaan dan penganggaran responsif gender yang dalam pelaksanaannya harus menghapus hambatan struktural. Kabag PUG Biro PPAKB Provsu Dra. Hj. Mahamah, MSi, saat itu mengapresiasi kegiatan pelatihan ini. Karena katanya, merupakan ikhtiar bersama dalam mewujudkan kesetaraan dan keadilan gender melalui implementasi strategi PUG di

L.Batu yang pada gilirannya nanti ditandai dengan adanya anggaran responsif gender di masing-masing SKPD. Kepala BP2KB L. Batu Lidiyawati Harahap, S.Psi. M.AP dalam laporannya menjelaskan, kegiatan pelatihan ini dilaksanakan Rabu samai Jumat (2325/4), dengan peserta para pejabat perencana dari setiap SKPD dan sembilan kecamatan seL.Batu yang berjumlah 41 orang. Sedangkan nara sumber dari Biro PPAKB Provsu, Pusat Studi Wanita USU Medan dan Kepala Bappeda selaku Ketua Pokja PUG L.Batu. (a18)

Minta C Plano Dibuka Caleg Diamankan Polisi RANTAUPRAPAT (Waspada): Akibat berteriak meminta agar C Plano (kertas bertuliskan hitungan suara di TPS) dibuka secara transparan, salah seorang Calon Legislatif(Caleg) diamankan sejumlah personil Kepolisian dari Mapolres Labuhanbatu, Senin (21/4) malam sekitar pukul 21:35. Pengamatan di lokasi, Hasanuddiun Hasibuan, Caleg yang tidak dapat memasuki ruangan rekapitulasi guna mengikuti proses perhitungan tersebut, sejak siang memang sudah mulai berteriak agar penyelenggara membuka C Plano demi menjaga keterbukaan sekaligus menghindari dugaan adanya permainan. Dirinya menilai terdapat perbedaan jumlah dari Model C1 (TPS) dengan D1 (Ke-

lurahan). Namun malam itu, saat dirinya berteriak di sebelah gedung tempat rekapitulasi, tiba-tiba Kabag Ops Polres Labuhanbatu Kompol Esron Hutagaol menariknya di antara kerumunan warga serta simpatisan yang sedari tadi mendengarkan pembacaan yang dipimpin Ketua KPU Kab. Labuhanbatu Hj. Ira Wirtati tersebut. Akibatnya, spontan suasana yang tadinya hening sedikit terganggu, terlebih Hasanuddin sempat berontak dengan sikap yang diterima. Perlawanan yang diperlihatkan seorang Caleg itupun tidak membuat surut petugas kepolisian. Dibantu dengan puluhan personil lain, akhirnya Hasanuddin berhasil diamankan sekaligus dibawa keluar pintu masuk

KPU dengan secara paksa. “Saya tidak merusuh di sini pak, saya hanya minta agar C Plano dibuka, hanya itu. Tidak ada saya memukuli orang atau berbuat rusuh,” teriaknya disela-sela dirinya saat didorong sejumlah oknum kepolisian. Aksi nekat Hasanuddin Hasibuan mendapat berbagai tanggapan. “Kalau hanya berteriak seperti itu saya kira hal biasa, lagi pula yang diminta dibuka itu C Plano. Kalau memang ada kecurigaan, ya itulah cara meluruskannya,” sebut Irawan yang hadir malam itu. Sementara ada juga yang menganggap jika kondisi itu dibiarkan akan dapat memancing kerusuhan lainnya. “Bisa jadi yang lainnya nanti terpancing,” sebut Faisal Harahap. (c07/a18)

Harus Bangga Mempunyai Pahlawan-pahlawan Wanita RANTAUPRAPAT (Waspada): Kita harus merasa bangga mempunyai pahlawan-pahlawan wanita yang menganggap bahwa pendidikan adalah masalah mendasar yang sangat penting bagi kehidupan. “Kebanggaan tersebut kita teruskan dengan upaya untuk mengangkat harkat dan martabat kaum perempuan serta semangat ingin maju melalui peningkatan pengetahuan dan pendidikan formal dan bukan

hanya berputar pada masalah pupur, dapur dan kasur,” kata Bupati Labuhanbatu dr. H. Tigor Panusunan Siregar, SpPD dalam arahannya pada Peringatan Hari Kartini ke- 50 dan Pencanangan Bulan Bakti Sosial IBIKB-Kesehatan Kab. Labuhanbatu Tahun 2014, Selasa (22/4) di Rantauprapat. Menurut Tigor, peranan kaum perempuan tidak bisa terlepas dari dukungan keluarga dan peluang serta kesempatan

Waspada/Budi Surya Hasibuan

BUPATI Labuhanbatu dr H Tigor Panusunan Siregar, SpPD disaksikan Unsur Muspida terlihat memukul gong pada Pencanangan Bulan Bakti Sosial IBI-KB-Kes Tahun 2014.

yang ada. Saat ini di Kabupaten Labuhanbatu persentase kaum perempuan yang bekerja lebih kurang 20 persen, sedangkan profesi yang didominasi kaum perempuan seperti PNS, Guru, Tenaga Kesehatan serta Pedagang, dengan jumlah yang relatif sama dengan kaum lakilaki. Sebelumnya, Ketua IBI Labuhanbatu Hj. Rolbariah, SKm selaku panitia pelaksana menjelaskan, rangkaian kegiatan Peringatan Hari Kartini Ke-50 dan Bulan Bakti Sosial IBI-KB-KES ini adalah memberikan pelayanan IUD dan Implant di sembilan kecamatan, Pelayanan MOW dan MOP di RSUD Rantauprapat pada tanggal 13 Maret, Pelayanan MOP, IUD dan Implant pada tanggal 31 Maret lalu di Kantor UPT BP2KB Kec. Rantau Utara, Lomba Desain Spanduk dan Yel-Yel serta Senam Massal yang telah dilaksanakan pada tanggal 11 April 2014 di Lapangan Ikabina Rantauprapat. (c07)

TANJUNGBALAI (Waspada): Kendati diwarnai protes dan aksi walk out sejumlah saksi parpol, rapat pleno KPU Tanjungbalai untuk rekapitulasi Pemilihan Legislatif 2014 akhirnya rampung Selasa (22/4) sekira pukul 03.30. Suasana di area kantor KPU Tanjungbalai sama seperti sehari sebelumnya, tetap dalam pengawalan ketat aparat kepolisian dan TNI. Dalam perhitungan rekapitulasi. Suasana sempat memanas saat saksi parpol mengutarakan temuan kesalahan dalam penulisan angka dan perhitungan suara di tingkat PPS dan PPK, sehingga KPU didesak menghitung ulang atau membuka kotak suara. Para saksi parpol meminta PPK menjelaskan berbagai temuan terhadap selisih suara yang ditemukan. Bahkan, Ketua KPU Amrizal juga turut menerangkan bahwa tanggapan dari masing-masing saksi parpol sudah dijawab PPK. Pasca dibuka kembali, rapat pleno rekapitulasi kembali berkutat pada tanggapan perselisihan suara dari masing-masing saksi parpol, yang belum selesai hingga pukul 00:00, di mana dari enam kecamatan baru empat kecamatan yang terselesaikan. Untuk menjaga hal-hal yang tidak diinginkan dan riak-riak pendemo yang meminta agar pleno dihentikan, maka Kabag Ops Polres Tanjungbalai meminta agar pleno tersebut dihentikan sebelum adanya petunjuk atau pernyataan resmi dari KPU kota itu.

Ketua KPU Amrizal SE didampingi anggota KPU Jamin Damanik, S.Sos, Gustan Pasaribu S.Sos, Irfan S.Sos dan Dahwani S.Ag kemudian berunding, dan akhirnya Amrizal SE mengetuk palu pertanda pleno di skor 10 menit untuk menunggu jawaban dari KPU Pusat dan Provinsi. Saat rapat pleno kembali dibuka, sejumlah saksi parpol tidak mau masuk ke ruang sidang dan mengatakan walk out. Hanya ada lima saksi parpol yaitu Golkar, PPP, Gerindra, PKB dan Demokrat ditambah satu saksi calon DPD, PPK dan Panwaslu. Rekapitulasi akhirnya dapat diselesaikan sekira pukul 03:30 dengan pengawalan ketat dari ratusan personil Polres Tanjungbalai, TNI AL dan TNI AD yang dihadiri langsung Dandim 0208/AS. Sementara hasil perolehan suara Caleg DPRD Tanjungbalai Dapil I yaitu, partai NasDem 965, PKB 1.090, PKS 1.044, PDIP 3.220, Golkar 5.266, Gerindra 1.610, Demokrat 1.080, PAN 1.077, PPP 2.085, Hanura 1.561, PBB 121 dan PKPI 45 suara. Dapil II, partai NasDem 1.813, PKB 2.104, PKS 881, PDIP 3.823, Golkar 8.507, Gerindra 3.486, Demokrat 2.596, PAN 1.808, PPP 2.029, Hanura 2.564, PBB 279 dan PKPI 469 suara. Sementara Dapil III yaitu, partai NasDem 1.825, PKB 2.029, PKS 921, PDIP 2.986, Golkar 9.502, Gerindra 2.011, Demokrat 2.626, PPP 1.840, PBB 668 dan PKPI 40 suara. (a14)

Saksi Sesalkan Rekom Panwaslu L. Batu RANTAUPRAPAT (Waspada): Sejumlah saksi dari partai politik peserta Pemilu 2014 yang mengikuti proses rekapitulasi penghitungan suara di aula KPU Kab. Labuhanbatu, Rantauprapat, Selasa (22/4) menyesalkan rekomendasi yang dikeluarkan Panwaslu kabupaten setempat. Pasalnya, rekomendasi bernomor: 201/ Panwaslu LB/IV/2014 tertanggal 18 April yang berisikan agar KPU melakukan hitung ulang surat suara khususnya di Tempat Pemungutan Suara (TPS) VI (enam) dan X (sepuluh) Kelurahan Negeri Baru serta TPS XIII Desa Tanjung Haloban, Kec. Bilah Hilir akibat adanya kesalahan penafsiran suara sah, dinilai saksi kurang berdasar. “Rekomendasi yang dikeluarkan Panwaslu kami nilai tidak berdasar, apalagi laporan yang diterima tidak memiliki tanggal. Ini sama saja dengan seperti surat kaleng. Kami minta kepada Ketua KPU tidak mengindahkan ini dan kami menolak kehadiran Panwaslu diruang ini. Karena, gara-gara hitung ulang surat suara ini kerja kita tidak selesai-selesai,” tegas Idris Pansyuri saksi dari PKS. Hal sama diutarakan Okto saksi dari partai Gerindra. Bahkan dirinya menyebutkan bahwa Panwaslu Labuhanbatu inkonsistensi,

disebabkan sempat menolak aduan/laporan karena dianggap telah melewati batas yang telah ditentukan. “Panwaslu inkonsistensi, kami menilainya rekomendasi ini suka-suka saja,” ujarnya disambut dukungan saksi partai lainnya. Sebelumnya kekesalan diperlihatkan M Rusly selaku saksi maupun Koordinator Badan Pemenangan Pemilu (Bapilu) PKB Kab. Labuhanbatu. Dia mengatakan, bahwa laporan terkait keluarnya rekomendasi hitung ulang surat suara tersebut bisa saja sudah kedaluarsa. Anggota Panwaslu Kab. Labuhanbatu M. Edry Yusuf mengaku, bahwa laporan yang mereka terima sama sekali tidak melewati batas waktu yang sudah ditentukan dan layak untuk dikeluarkan rekomendasinya. “Suratnya kami terima belum lewat batasnya,” aku Yusuf. Sedangkan Ketua KPU Kab. Labuhanbatu Hj. Ira Wirtati menegaskan akan tetap melaksanakan rekomendasi dari Panwaslu sesuai dengan Peraturan KPU Nomor 27 tahun 2013. “KPU wajib menjalankan rekomendasi dari Panwaslu. Terkait apakah rekomendasi itu dikeluarkan sesuai peraturan, itu bukan kewenangan kita menjawabnya. Jika nantinya rekom itu cacat hukum, berarti kita akan kembali mematuhi hasil hitungan suara sebelum ini,” ujar Hj Ira Wirtati. (c07)

Golkar Labusel Tolak Rekapitulasi Dapil 4 Dan 5 KOTAPINANG (Waspada): DPD II Golkar Kab. Labusel menolak hasil pleno rekapitulasi perhitungan suara Pemilu Legislatif 2014 untuk DPRD Kabupaten Daerah Pemilihan (Dapil) 4 Kec. Torgamba B dan Dapil 5 Kec. Sungaikanan dan Kec. Silangkitang yang telah disahkan KPU, Senin (21/4). Partai berlambang pohon beringin itu berencana membawa perkara itu ke Mahkamah Konstitusi (MK). Hal itu diungkapkan Ketua DPD II Golkar, Rahmadi didampingi Sekretaris Syamsul Rizal Pulungan, dan beberapa fungsionaris lainnya kepada Waspada di Kotapinang, Selasa (22/4). “Kita akan bawa berbagai masalah dalam pelaksanaan Pemilu ke MK. Khusus untuk KPU Kab. Labusel dan Panwaslu Kab. Labusel akan kita laporkan ke DKPP terkait profesionalisme mereka sebagai penyelenggara,” kata Rahmadi menegaskan. Menurutnya, alasan penolakan mereka terhadap rekapitulasi perhitungan perolehan suara di Dapil 4 dan 5 karena ditemukan banyak kesalahan penjumlahan di beberapa TPS. Parahnya, lanjut dia, meski pihaknya sudah meminta agar KPU membuka lembar C-1 plano untuk memastikan selisih suara, namun tidak terkabul. “Pada rekapitulasi, Minggu (20/4), kita minta agar dibuka C-1 plano. Lalu dibuka tiga TPS di Dapil 4 dan hasilnya suara Golkar bertambah 16 suara. Namun karena waktu tidak memungkinkan lalu pleno diskors. Seharusnya, pada pleno 21 April dilanjutkan, namun pada hari H justru

tidak dilanjut. Ini ada apa?,” katanya heran. Lebih jauh dikatakan, kesalahan paling parah dan aneh terjadi di Dapil 5. Menurutnya, jumlah suara di dalam C-1 yang dimiliki seluruh saksi tidak ada yang sama. Namun, kata dia, seluruh C-1 itu ditandatangani petugas KPPS. “Seperti di TPS 3 Desa Mandalasena, Kec. Silangkitang, suara NasDem di salah satu C-1 yakni 2 suara, namun di C-1 yang lain 3 suara,” katanya. Rahmadi menyebutkan, estimasi perolehan kursi Golkar di Dapil 5 seharusnya dua kursi, sesuai data C-1 yang mereka miliki. Namun berdasarkan pleno yang telah diputuskan KPU, Golkar diperkirakan hanya mendapat satu kursi. “Banyak kejanggalan yang dilakukan KPU dan Panwas, di Desa Torganda misalnya, saksi tidak dibenarkan masuk ke TPSI dan tidak diberikan salinan C-1,” katanya. Syamsul Rizal menambahkan, pihaknya menduga terjadi mobilisasi massa pada pemungutan suara 9 April lalu, karena ada pemilih di sejumlah TPS melebihi DPT. Bahkan, kata dia, pemilih menggunakan KTP atau KK di Kec. Sungaikanan mencapai 838 orang dan Kec. Silangkitang 381 orang. Komisioner KPU Kab. Labusel Effendi Pasaribu yang dikonfirmasi mengatakan, dari awal perhitungan mulai dari tingkat TPS hingga PPK tidak ada partai yang melakukan keberatan. Namun pada pleno KPU yang lalu partai-partai itu baru menyampaikan keberatannya. “Seharusnya dari awal mereka sudah melakukan keberatan, bukan berarti di tingkat KPU tidak boleh melakukan keberatan,” katanya. (c18)

Daswa: Terimakasih Kepada Masyarakat DASWA menyatakan terimakasih kepada masyarakat yang telah memberikan dukungan, sehingga dirinya masuk nominasi 10 Besar dalam mengikuti audisi Academy Dangdut Indonesia. “Semua ini tak terlepas dukungan diberikan masyarakat maupun fans pendukung kepada saya, sehingga masuk Nominasi 10 Besar dalam audisi Academy Dangdut Indonesia di Indosiar,’’ tukasnya di sela-sela kunjungannya ke Batubara saat bertemu warga di lapangan Walet Putih, Desa BenWaspada/Iwan Has teng Kec Talawi, Selasa DASWA foto bersama dengan pengurus Walet Putih dan fans (22/4). pendukungnya di Kec. Talawi, Kab Batubara. Kedatangan Daswa memang sengaja untuk bertemu dengan ma- berjudul ‘’Dawai Asmara’’ petikan H. Roma syarakat maupun fans pendukung sebagai rasa Irama, berduet dengan Basariah/Makngah ucapan terimakasih atas prestasi yang diraih menambah suasana meriah dan keakraban dalam mengikuti audisi baru-baru ini melalui fans pendukung dengan idolanya. ‘’Kita poling SMS dikirimkan. harapkan pertemuan ini tidak sebatas di sini, Dalam pertemuan dengan masyarakat dan dan dapat berkelanjutan. Semoga Daswa sukses pendukungnya, pria asal Bedagai Kab. Sergai dalam menjalankan karir,’’ sebut seorang warga. tersebut berkesempatan melantun kan seSebelumnya, Daswa telahj melakukan kunjumlah lagu di atas panggung hiburan yang jungan ke Asahan bertemu dengan masyarakat diiringi dengan keyboard Nahdalia Rentak pendukungnya di sana, dan dilanjutkan ke Melayu pimpinan Firdaus (Daus). Batubara, Kec Talawi, dan Pagurawan, Kec. Salah satu tembang lagu dibawakan Daswa Medang Deras. (a13)


Universitaria

WASPADA Kamis 24 April 2014

SU ARA AKADEMIK SUARA

Pesimis Caleg Terpilih Amanah Erwan Efendi Pemilihan umum calon anggota legislatif sudah usai meskipun diwarnai dengan berbagai persoalan, kecurangan dan money politics. Komisi Pemilihan Umum (KPU) akan menetapkan siapa para sosok calon anggota legislatif (caleg) yang berhasil duduk di gedung parlemen yang terhormat baik di tingkat pusat, provinsi dan daerah. Secara duniawi orang yang memenangkan pertarungan memperebutkan jabatan publik sebagai anggota dewan atau jabatan publik lain seperti menteri, gubernur, dan bupati dalam pikirannya segera tergambar memperoleh bermacam kenikmatan hidup.Merekaakanmendapatkanberbagaifasilitassebagaipejabat negara, pundi-pundi rezeki bakal menjulang, dan status sosial menjadi warga negara yang terhormat pun digenggamnya. Dari sudut pandang spiritualitas ada makna yang dalam, ketika seseorang itu menduduki jabatan publik. Ketika jabatan publik itu melekat, sebenarnya mereka telah memegang amanah sebagai seorang pemimpin. Pemimpin yang memegang amanah dapat dilihat sejak seseorang itu berproses untuk mendapatkan jabatan publik. Bagi orang yang menggengam amanah, tentu awalnya tidak berambisi menginginkan jabatan publik. Tapi kalau banyak orang mempercayakan tugas-tugas kepemimpinan, maka dia sanggup menerima kepercayaan yang diberikan kepadanya. Kesanggupan seorang pemimpin amanah terus direalisasikan dengan tanggung jawab saat menjalankan kepemimpinannya. Tanggung jawab dalam arti mampu melaksanakan tugas dengan baik, sehingga di bawah kepemimpinannya lingkungan menjadi lebih sejuk, anggota merasa dilindungi, dan organisasi menjadi lebih maju. Selanjutnya pemimpin amanah dapat dipercaya saat menjalankan kepemimpinannya. Pemimpin yang layak dipercaya apabila jujur, adil, dan selaras antara kata yang diucapkan dengan tindakan yang dilakukan. Pemimpin yang amanah mampu mengutamakan kepentingan publik dibanding dengan kepentingkan pribadi. Maksudnya adalah seorang pemimpin amanah akan berani melakukan tindakan tidak popular. Dia tidak tega melakukan tipu muslihat dan tidak lagi berpikir periode mendatang harus menjabat lagi. Jika tindakan yang dijalankan memberi kemaslahatan banyak orang dan demi kepentingan publik, dia akan berani mengambil keputusan, meski resiko akan dicerca banyak orang dan berdampak negatif bagi citra dirinya. Agar pemimpin berani melakukan tindakan tidak popular, dia perlu memiliki mental teguh pendirian atau konsisten terhadap setiap gagasan serta perilaku yang dijalankan. Teguh pendirian ini sebagai modal utama pada seorang pemimpin tahan terhadap kritikan orang-orang yang tak suka dengan langkah-langkah kepemimpinannya. Sekarang masalahnya apakah idealisasi mengenai pemimpin amanah itu tertancap di kalbu para calon anggota legislatif (caleg) yang terpilih? Rasanya masih sangat sedikit mereka yang memiliki kemampuan moral menjadi pemimpin amanah. Barangkali publik menyaksikan anggota dewan yang seharusnya membela dan melindungi kepentingan rakyat, justru mendzalimi rakyat. Ini dibuktikan tidak sedikit dari anggota dewan yang tersandung korupsi untuk menggelembungkan rekening pribadi. Sama halnya dengan pejabat publik lain di jajaran eksekutif dari daerah sampai pusat, pidato politik yang disampaikan saat kampanye ternyata hanya menjadi slogan kosong. Sebagian diantara mereka telah bertindak tidak jujur. Seperti Komisi Pemberantasan Korupsi menemukan banyak kecurangan pemimpin eksekutif dengan menyelewengkan uang negara untuk menumpuk kekayaan sendiri. Perilaku politik mereka juga jauh dari ciri-ciri sebagai pemimpin amanah. Sepak terjang mereka untuk meraih posisi kadang meninggalkan etika dan nilai moral. Pintu hati mereka sudah tertutup syahwat untuk meraih kekuasaan. Akibatnya rakyat hanya sebagai objek dan program-program yang dijalankan sebatas menjadi komoditas yang digunakan sebagai batu loncatan untuk meraih tujuan sempit sekedar mempertahankan jabatan. Jadi kita pesimis kalau para caleg terpilih bisa amanah.Semoga.

SOSOK

Syofyan: UISU Tak Bersaing Syofyan, SE, Msi, sosok yang satu ini tentu tak asing lagi bagi kalangan civitas akademika Universitas Islam Sumatera Utara (UISU) Medan. Bukan karena posisinya sebagai orang nomor dua di kampus itu, tetapi juga karena keramahannya dan senang bercanda dengan siapa saja termasuk kalangan wartawan kampus. Dengan candanya membuat para pegawai sendiri tak terlalu canggung dan sungkan untuk berurusan Waspada/ist dengannya. Sebagai seorang dosen, sudah tentu sosok lelaki ini disenangi banyak kalangan mahasiswanya S1 maupun S 2 UISU. Karena urusan dengannya tak terlalu sulit. Sebagai Pembantu Rektor I, tentu saja membuatnya selalu sibuk dengan urusan akademik, terutama dalam upayanya menjadikan UISU menjadi kampus yang mampu melahirkan lulusan yang berkualitas. Untuk urusan akreditasi, pihaknya akan berjuang membuat 29 Program Studi di UISU akan memperoleh akreditasi A. “Saat ini 29 Prodi di UISU sudah ajukan Borang akreditasi yang sebagian besar dengan nilai B,”ucap Syofyan, Rabu (23/4) di kampus UISU Jalan Karya Bakti Medan. Syofyan menyatakan rasa optimisnya bahwa untuk tahun akademi 2014/2015 UISU akan menargetkan sebanyak 3000 calon mahasiswa baru, atau rata 300-400 mahasiswa untuk masingmasing sembilan fakultas yang ada di UISU. “Sekarang ini UISU telah bersatu, jadi tak ada lagi saingan dari dalam UISU sendiri seperti tahun-tahun sebelumnya, karena itu Insya Allah UISU akan mampu mengembalikan kejayaan masa silamnya,”ucap Syofyan sambil tersenyum. Syofyan sependapat dengan rektor Dr Ir Mhd Asaad, Msi, agar kalangan civitas akademika menyambut dengan rasa syukur atas bersatunya UISU. Artinya masing-masing pihak menunjukkan potensinya untuk membesarkan kembali UISU. Rasa syukur itu harus ditunjukkan dengan sikap kerja keras, dan tidak merasa diri menjadi sombong.(m26)

UMSU Buka Penerimaan Mahasiswa Baru Gelombang I MEDAN (Waspada): Universutas Muhammadiyah Sumatera Utara (UMSU) telah membuka penerimaan mahasiswa baru (PMB). Pusat pendaftaran di kampus utama UMSU Jalan Mukhtar Basri Medan. Untuk tahun akademi 2014-2015 UMSU menerima 5500 calon mahasiswa baru,”kata Ketua Panitia PMB UMSU Dr. Muhyarsyah, MM kepada wartawan di kampus Jalan Mukhtar Basi Medan, Sabtu (12/4). Fakultas yang menerima pendaftaran mahasiswa baru seperti Fakultas Kedokteran , Fakultas Agama Islam, Fakultas Ilmu Pendidikan dan Ilmu Keguruan, Fakultas Pertanian, Fakultas Ilmu Sosial dan Ilmu Politik, Fakultas Ekonomi S1 dan D3, Fakultas Hukum dan Fakultas Teknik. Sedangklan untuk Program Pascasarjana antara lain, Program Magister Ilmu Hukum, Magister Manajemen, Magister Kenotariatan, Magister Ilmu Komunikasi, dan Magister Akuntansi. Untuk penerimaan mahasiswa baru tahun ini, UMSU membuka dua gelombang pendaftaran. Gelombang I mulai 3 Maret sampai 13 Juni dan tes masuk 14 Juni 2014. Gelombang II dimulai 14 Juni sampai 11 Juli dan tes masuk 12 Juli 2014. Sedangkan gelombang III dibuka mulai 12 Juli sampai 15 Agustus dan tes masuk 16 Agustus 2014. (m49)

B5

Wakil Dekan I FTI ITM:

Pendidikan Kunci Pemberantasan Kemiskinan MEDAN (Waspada): Keberhasilan negara-negara maju mencapai tingkat pertumbuhan ekonomi yang baik karena didukung sektor pendidikan. Dari sektor itu telah lahir banyak sumber daya manusia (SDM) unggulan yang mampu menggerakkan proses produksi di semua lini perekonomian. “Jika Indonesia ingin mengubah nasib dengan cepat, negeri ini harus mengutamakan pembangunan pada sektor pen-

didikan,” kata Wakil Dekan I Fakultas Teknik Industri Institut Teknologi Medan (FTI ITM) Ir. H. Hermansyah Alam, S. Kom,

MT, MM, Sabtu (19/4). Menurut Hermansyah, pembangunan sektor pendidikan tidak cukup dengan hanya menganggarkan dana yang besar. Namun, program-program yang akurat dan efektif juga sangat penting untuk segera dikerjakan. Selain itu, negara Indonesia harus memiliki kurikulum yang memadai. Sebaliknya, tidak sedikit negara yang masih dihadapkan ke-

pada kemiskinan akibat tingkat pendidikan yang sangat rendah. Bahkan, terdapat negara-negara yang pembangunan ekonominya masih berjalan di tempat (stagnan) hanya disebabkan oleh rendahnya kemampuan alokasi anggaran negara terhadap pemenuhan anggaran pendidikan nasional. Hermansyah berpendapat, untuk pembentukan indeks pembangunan manusia (IPM) yang dapat mengukur tingkat kesejahteraan suatu bangsa, faktor pendidikan merupakan salah satu indikator komposit

selain faktor kesehatan dan daya beli masyarakat. “Karena itu, pembangunan pendidikan menjadi isu penting dan berperan strategis bagi kemajuan taraf kesejahteraan penduduk setiap negara,” kata Hermansyah. Diakuinya, dari segi pembiayaan upaya untuk meningkatkan peran pendidikan di Indonesia sebagai indikator pembentuk IPM memang belumlah begitu besar. Hal itu ditunjukkan dengan masih rendahnya anggaran pengeluaran bagi pembiayaan pembangunan

pendidikan nasional yang tercantum pada Anggaran Pendapatan dan Belanja Negara (APBN) yang rata-rata masih di bawah 10 persen. Sementara itu di beberapa negara ASEAN, alokasi anggaran sudah mencapai rata-rata antara 20 hingga 40 persen. “Memang IPM tidak sekadar angka, karena yang terpenting adalah sejauh mana kita peduli akan akses masyarakat dalam memperoleh pelayanan jasa pendidikan sebelum mencapai kesejahteraannya atau taraf hidup yang layak,” tuturnya. (m49)

UMSU Taat Azas

Waspada/Suyono

REKTOR UMN Alwasliyah Drs. H. Kondar Siregar, MA (paling kanan) dan Ketum PB Alwasliyah Prof. Dr.Yusnar Yusuf Rangkuti, MA (paling kiri) mengulosi Rektor UUM Prof. Dr. Datuk Mohamed Mustafa Ishak (tengah).

Kerjasama Dengan UUM

UMN Alwasliyah Gelar Seminar MEDAN (Waspada): Universitas Muslim Nusantara (UMN) Alwasliyah Medan bekerjasama dengan University Utama Malaysia (UUM) menggelar Seminar Internasional diiikuti utusan 20 perguruan tinggi se-Indonesia yang memiliki program studi BK (Bimbingan Konseling) serta sejumlah delegasi dari Malaysia di Hotel JW Marriot Medan, belum lama ini. Rektor UMN Drs. H. Kondar Siregar, MA mengatakan di kampus UMN Alwasliyah Jl.Garu IIA Medan, Rabu (23/4), kegiatan dengan tema “Jejak Kaunselling Nusantara Kaunsellling Sejagat” Makuma dirangkaikan dengan bakti sosial atau pengabdian masyarakat dihadiri Koordinator Kopertis Sumut Prof. Dr. Dian Armanto, MPd. PhD, wakil Rektor III Drs. MilhanYusuf, MA, sekretaris BPHUMN, Sekretaris PW Alwasliyah Sumut H.Yulizar Parlagutan Lubis dan Rektor ITM Prof. Dr. Ilmi Abdullah, MSc, Ketua PB Alwasliyah Prof. Dr. H.

Yusnar Yusuf Rangkuti, MA dan Rektor UUM Prof. Dr. Datuk Mohamed Mustafa Ishak, Majelis Pendidikan PB Alwasliyah Drs. H. Ismail Effendi, MA berlangsung meriah dan sukses. H. Kondar Siregar mengatakan, UMN Alwasliyah tetap konsisten melakukan berbagai aktifitas pendidikan. “Kami lebih dari lima tahun sudah menjalin hubungan kerjasama dengan UUM di antaranya kerjasama seminar internasional, pertukaran mahasiswa dan dosen serta berbagai aktifitas lainnya bidang pendidikan,” ujarnya. “Ini merupakan agenda rutin bagi UMN Alwasliyah, dan diharapkan kerjasama dengan UUM mampu membuka jaringan ilmu pengetahuan yang lebih luas serta saling tukar informasi menyikapi proses konselling di tengah-tengah masyarakat,” kata H.Kondar Siregar. Rektor UUM Prof. Dr. Datuk Mohamed Mustafa Ishak menjelaskan, saat ini pelaku kriminalitas seperti anak membunuh

ibu dan gap sosial lain terjadi akibat stres. Orang seperti ini perlu mendapat bantuan konseling dan ini jangan sampai menjadi penyakit masyarakat. “Orang bermasalah bukan saja secara individual, tetapi bisa dibiarkan karena dapat merugikan diri sendiri dan kelompok. Perkara yang kecil dibuat menjadi besar,” kata Datuk dan menghargai setinggi-tingginya kegiatan ini. Dalam kesempatan itu Datuk Mohamed Mustafa menganugrahkan dua scholarship (beasiswa) bagi warga UMN Alwasliyah untuk mengambil program studi master (S2) dan Phd (S3) di UUM secara gratis. Di UUM ada sekitar 30 ribu mahasiswa dari 40 negara tersebar yang berasal dari Indonesia. Ketum PB Alwasliyah Prof. Dr. H. Yusnar Yusuf mengungkapkan rasa syukur dan bangga atas kerjasama ini untuk mendorong UMN melangkah lebih baik menuju universitas ternama.(m24)

IAIN SU Gelar Seminar Kontekstualisasi Hadis MEDAN (Waspada): Fakultas Syariah IAIN SU melaksanakan seminar nasional Kontekstualisasi Hadis di Era Modren dengan nara sumber Prof. Dr. Ali Musthafa Ya’kub dan Direktur Pascasarjana IAIN SU Prof. D.r H. Nawir Yuslem, MA di aula Kampus II Jalan Willem Iskander Medan Estate, Senin (14/4). Rektor IAIN SU Prof. Dr. H. Nur A. Fadhil Lubis, MA diwakili Pembantu Rektor II Prof. Dr. H. Hasan Bakti Nasution, MA ketika membuka kegiatan itu menyampaikan apresiasinya kepada Fakultas Syariah IAIN SU. “Sejatinya seminar ini menyampaikan, semangat syariah harus menjadi landasan yang kuat di tengah masyarakat agar kehidupan selalu dalam tuntunan yang diturunkan Allah dan Rasul Nya. “Semangat memasyaratkan syariah dan mensyariahkan masyarakat menjadi hal yang harus kita dukung bersama,” kata Hasan. Menurut dia, semangat itu harus terus ditingkatkan karena etika dalam kehidupan sehari-

Waspada/ist

NARASUMBER dan peserta foto bersama usai seminar. hari semakin jaun dari tuntunan. “Hal ini dibuktikan dengan semakin suburnya budaya skulerisme yang menghalalkan segala cara untuk sampai pada tujuan yang diinginkan,” ungkap Hasan. Pembantu Rektor II juga berharap kegiatan ilmiah tingkat nasional dan internasional dapat menjadi agenda rutin di keluarga besar IAIN SU. Hal ini sebagai memberikan pencerahan dan peningkatan pemahaman terhadap ilmu yang terus berkembang, kata Hasan. Dikatakan, seminar juga menjadi salah satu tugas perguruan tinggi yang terangkum dalam Tri Dharma, yakni pen-

didikan, penelitian dan pengabdian kepada masyarakat. “Ketiga nilai luhur ini diimplementasikan dalam berbagai kegiatan guna kemajuan perguruan tinggi dan kesejahteraan masyarakat,” katanya. Dekan Fakultas Syariah IAIN SU, Dr. H. Saidurrahman menyatakan, seminar dirangkai dengan peluncuran Praktikum Kewirausahaan dan peluncuran buku serta pertemuan Dekan Fakultas Syariah se Indonesia. “Hal ini menjadi komitmen Fakultas Syariah untuk memasyarakatkan syariah dan mensyariahkan masyarakat,” kata Dekan (m49)

MEDAN (Waspada): Sebagai salah satu perguruan tinggi swasta (PTS) terkemuka di Sumatera Utara, Universitas Muhammadiyah Sumatera Utara (UMSU) senantiasa taat azas terutama dalam pengisian borang akreditasi institusi yang bertujuan untuk penjaminan mutu universitas. “UMSU selalu patuh atas aturan yang ditetapkan Dikti Kemendikbud menyikapi pengisian borang akreditasi institusi dan akreditasi program studi,” kata Rektor UMSU Dr. Agussani, M. AP, Sabtu (19/4) UMSU tambahnya, eksis dalam pengisian borang akreditasi baik di program studi yang terdapat di setiap fakultas dan saat ini mematuhi pengisian borang akreditasi institusi universitas. Hal ini dibuktikan dari semua di fakultas yang terdapat di UMSU memiliki akreditasi B. Salah satu manfaat yang didapat dari kegiatan worshop ini bagi Pusat Penjaminan Mutu (PPM) UMSU akan memperbaiki dan menata kembali semua bentuk ketentuan yang telah ditetapkan guna diterapkan di universitas. Sehingga masyarakat mengetahui kondisi PTS dan kampus yang sehat. Sedangkan hasil yang akan dicapai dari kegiatan worshop ini, lulusan UMSU akan diterima dan mendapat pengakuan masyarakat

dan pengguna lulusan. “Bagi PTS yang tidak terakreditasi maka ijazahnya tidak sah dan tak mendapat pengakuan publik, sebaliknya melalui program akreditasi ini maka lulusan PTS yang terakreditasi ijazahnya dapat melanjutkan ke jenjang pendidikan lanjutan dan diterima sebagai PNS karena memiliki civil effect,” ujar rektor. Menyinggung tentang larangan kelas jauh yang tidak diperbolehkan dan melanggar ketentuan, UMSU saat ini tidak melakukan hal itu. Pasalnya, seluruh kegiatan akademik baik proses pembelajaran, penelitian dan pengabdian kepada masyarakat dipusatkan di kampus dan tidak ada kerjasama dengan perguruan tinggi swasta pihak manapun. Menanggapi diberlakukannya UU No 12 tahun 2012 yang mewajibkan akreditasi prodi dan akreditasi institusi dengan batas akhir masa transisi 10 Agustus 2014 ini, UMSU sudah siap untuk menyahui ketentuan tersebut. Menurutnya, kewajiban akreditasi institusi sudah diamanahkan dalam UU tersebut, sehingga tidak ada alasan untuk tidak melakukannya. Bagi UMSU ketentuan apapun yang telah digariskan oleh Dikti Kemendikbud harus ditaati dan dipatuhi agar universitas dari sisi akademik berjalan tertib dan lancar. (m49)

Waspada/Rizky Rayanda

ROMBONGAN mahasiswa jurusan Komunikasi dan KPI Fak. Dakwah dan Komunikasi IAIN Sumut dipimpin Indra Maulana Sinaga dan Herry bersama Kepala Humas Waspada H.Erwan Efendi usai melakukan pertemuan di lantai 3 Gedung Bumi Warta Waspada Medan, Selasa (22/4).

Mahasiswa FDK IAIN SU Penelitian Di Waspada MEDAN (Waspada): Sebanyak 16 mahasiswa jurusan Komunikasi dan Penyiaran Islam (KPI) Fakultas Dakwah dan Komunikasi IAIN Sumatera Utara melakukan kunjungan ke Redaksi Harian Waspada sekaligus melakukan penelitian pada media cetak tersebut. Rombongan mahasiswa dipimpin ketua kelompok Indra Maulana Sinaga dan Hery dengan berbekal surat dosen pembimbing M.Yose Rizal Saragaih,S. Ag, M. Kom diterima Kepala Humas Waspada H. Erwan Efendi di ruang rapat lantai 3 Gedung BumiWarta Waspada Jl. Suprapto No. 1 Medan, Selasa (22/4). Indra mengucapkan terimakasih kepada pimpinan Harian Waspada sebagai surat kabar yang peduli terhadap dunia pendidikan bahkan diakui kredibiltasnya yang telah berkenan menerima kami dalam rangka silaturrahmi sekaligus melakukan penelitian. “Kehadiran kami di Waspada yang baru pertama kali ini memiliki arti tersendiri dan sangat penting”, kata Indra. Mereka berharap silaturahmi akan menambah pengetahuan dan wawasan tentang bagaimana proses awal cara kerja redaksi terdiri dari wartawan, redaktur, hingga siap cetak dan sampai ketangan para pembaca yang meliputi daerah tingkat II se Sumut dan Aceh. Indra dan teman-teman berharap bahwa sesungguhnya kunjungan ini bukan yang terakhir kalinya, tapi akan berlanjut dimasa mendatang sesuai dengan program. Kepala Humas Waspada H. Erwan Efendi sangat mengapresiasi para mahasiswa jurusan Komunikasi dan Penyiaran Islam (KPI) Fakultas Dakwah dan Komunikasi IAIN Sumut yang melakukan penelitian. Karena akan menambah

ilmupengetahuan dan wawasan dalam keilmuan khususnya jutusan KPI. H. Erwan memaparkan panjang lebar sejarah berdirinya Waspada oleh H. Mohd.Said dan Hj.Ani Idrus yang juga tokoh Pers sejak 11 Januari 1947 dan kini Waspada sudah berusia 66 tahun, dengan motto “Demi kebenaran dan keadilan” dengan orientasi politik nasionalis religius Waspada dan tidak mengesampingkan beritaberita penting lainnya seperti politik, ekonomi, budaya, kesehatan, olahraga, Sumatera Utara, Aceh dan lain-lain tetap eksis sampai saat ini dan dicintai oleh masyarakat. Waspada bukanlah surat kabar yang semata-mata memberitakan kriminal saja. Tap itu juga sebagai pelengkap. Dalam menjalankan tugasnya setiap wartawan tetap menjunjung tinggi kode etik jurnalistik, dan beradadalam bingkai serta dilindungi Undang-Undang Pokok Pers No.40 tahun 1999. Erwan juga menyebutkan sebagai media nasional Waspada telah banyak memperoleh penghargaan dari pemerintah RI antara lain dari Presiden Mewagawti Soekarno Putri untuk Hj. Ani Idrus dengan Bintang Maha Putra Utama dan masih banyak lagi. Apalagi sekarang ini, lanjut H. Erwan Waspada menampilkan halaman khusus yaitu Universitaria yang menyangkut berita-berita kampus tiap hari Kamis. Dan ini tentunya membuka peluang bagi mahasiswa di Sumut untuk menyalurkan bakat menulisnya atau menyampaikan aspirasinya tentang kegiatan kampus termasuk masalah politik, sosok rektor perguruan tinggi maupun para wakil rakyat. Apalagi di era reformasi ini, semua orang berhak menyatakan pendapatnya.(m24)

Menerka Sistem Pendidikan Dan Pelakunya MENGAMATI pergerakan pendidikan kampus di medan. Bukan hal lumrah lagi kalau risau mahasiswa tentang peranannya sendiri sebagai mahasiswa dan mengalami penurunan derajat tidak seperti dekade-dekade sebelumnya. Mahasiswa yang pada dasarnya dianggap sebagai agen perubahan kini seperti terdampar pada selat kebimbangan. Dikarenakan apa yang dimaksudkan sebagai mahasiswa cenderung lebih kearah lanjutan pendidikan sma. Tidak sebagai acuan yang bisa diharapkan sebagai pembangun masa depan indonesia. Aktivitas akademik adalah hal utama bagi mahasiswa. Apabila akademis menjadi tolak ukur seorang mahasiswa, maka itu dapat di patahkan dengan banyaknya pengangguran dari golongan mahasiswa yang memiliki nilai kelulusan yang tinggi. Siapa yang disalahkan apabila agen perubahan itu menjadi seorang pengangguran ? Tentu tidak ada yang mau disalahkan bukan ? Akademik yah tetap akademik. Tetapi soft skill lebih penting dari itu. Kita sebagai mahasiswa sebaiknya membuka diri untuk menghadapi ujian yang sesungguhnya setelah tamat dan bukan hanya berbekal PKL ( Praktek Kerja Langsung ) yang ada pada mata kuliah di berbagai jurusan. Setelah itu tak ada lagi yang bisa diharapkan kecuali menguatkan kemampuan atau potensi diri yang kita miliki. Cara mengembangkan potensi diri itu bukan hanya pada jadwal perkuliahan. Setidaknya mengikuti UKM ( unit kegiatan mahasiswa ) yang ada di kampus. Seperti ukm ; seni, pers, mapala,

By Arief Sinaga Mahasiswa UMSU

olahraga, religius dll. Tidak hanya itu di kampus juga seharusnya memiliki himpunan mahasiswa jurusan yang dapat memacu kawan-kawan untuk fokus pada jurusan yang kita pilih. Dan tetap, dosen dan birokrasi kampus harus mendukung kegiatan yang dilakukan mahasiswa-mahasiswanya. Persoalannya sekarang apakah sudah sinkron pihak kampus dan mahasiswanya? Apabila belum, cobalah cari solusinya. Bukan terus menerus mengemis. Alangkah lebih baiknya kita melakukan kegiatan dahulu lalu meminta dukungan dari pada sebaliknya. Karena kita sebagai mahasiswa tak semerta-merta hanya bisa mengharapkan pihak kampus. Pelajaran yang lebih real itu berada saat kita mencari dan mengasah kemampuan kita sendiri. Tidak bergantung pada siapapun. Mahasiswa- mahasiswi di medan pada umumnya hanya berlaku pada apa yang diberikan dosennya. Nah, kecenderungan itu yang harus kita perbaiki. Pendidikan tidak menjamin siapapun menjadi sukses dalam bidangnya. Sebab, kesuksesan hanya berada didiri kita sendiri. Bila kita terpaku pada buku dan teori-teori, sudah pasti kegamangan akan kita dapatkan. Keaslian ilmu itu bukan terletak pada teorinya tetapi pada aplikasinya. Bagaimana kita dapat menentukan nasib kita kedepan, sementara kita hanya bisa disuapkan ilmu dari dosen dan buku-buku tanpa aplikasi. Sistem pendidikan tetap begitu. Sudah ada pakem dari

Waspada/ist

kurikulum. Dan pelaku dari sistem pendidikan itu yang membuatnya dapat disebut terdidik. Memperbaiki diri untuk fokus pada satu bidang itu lebih baik. Untuk fokus, kita perlu kontrol dari diri kita sendiri. Mengevaluasi kegiatan kita sebagai mahasiswa lalu memperbaiki segala sesuatu yang kurang dari kemarin-kemarin. Jangan sampai memalukan negeri ini, hehe... Kita mahasiswalah yang seharusnya membuat bangsa ini maju. Dan ruang lingkup yang lebih kecil, tanamkanlah mental yang kokoh untuk dapat bermanfaat bagi orang lain. Sistem pendidikan di kampus adalah kebutuhan untuk kita lulus sebagai sarjana. Ilmu yang sesungguhnya itu terletak pada lingkungan masyarakat. Keutuhan ilmu yang didapat di perkuliahan akan diuji setelah kita lulus menjadi sarjana. Kita boleh berharap pada sistem pendidikan kampus untuk mengambil titel. Mahasiswa sebagai pelaku dalam pendidikan dan agen perubahan mengemban beban besar akan keberlangsungan negara ini. Kita benahi diri kita, Kita gali lagi ilmu dari eksternal kampus, kita kembangkan potensi dan lakukanlah kegiatan yang dapat bermanfaat bagi nusa dan bangsa. ***


Opini

B6

WASPADA Kamis 24 April 2014

TAJUK RENCANA

PPP Islah Dukungan Ke Prabowo Mengambang

K

etua Umum DPP PPP Suryadharma Ali (SDA) menyatakan menerima dan siap menjalankan fatwa yang disampaikan Ketua Majelis Syariah Maimun Zubair untuk berdamai (islah) dengan kubu Sekjen Partai Persatuan Pembangunan (PPP) M Romahurmuziy (Romi). Kita mencatat, tiga poin dari putusan yang diambil Ketua Majelis Syariah PPP meliputi: Pertama, kewajiban islah antara kubu bertikai, utamanya antara Ketua Umum DPP PPP Suryadharma Ali dan Sekjen DPP PPP M. Rohmarrumurziy. Kedua, islah berarti kembali kepada asal semula, bahwa SDA adalah Ketua Umum dan Rohmarrurmurziy adalah Sekjen. Ketiga, islah juga berarti tidak ada pemecatan, pemberhentian atau rolling kepengurusan dari pihak-pihak yang bertikai. Hemat kita, perpecahan atau pecat memecat yang terjadi dalam internal DPP PPP jelas merugikan partai berlambang Kabah dan mengusung jargon rumah besar umat Islam. Kerugian teramat besar bisa terjadi andai perpecahan itu tidak segera diselesaikan dengan Islam. Wajar kalau para ulama prihatin melihat kondisi yang terjadi di PPP saat ini. Pertama, dukungan kepada Capres Intisari: Prabowo Subianto (Gerindra) tidak akan ‘Dukungan PPP ke salah diterimaKPUsehinggabisaberakibatkegagalan pencapresan Prabowo. Apalagi satu Capres (Prabowo) perolehan suara PPP dalam pemilu lalu 6,7 persen sehingga tidak buruk baru sah bila diteken SDA mencapai walaupun peningkatannya sedikit sekali sebagai Ketum dan Romi dibanding pemilu 2009. Harusnya DPP PPP masih bersyukur suaranya tidak sebagai Sekjen’ menurun walau SDA menghadiri kampanye akbar Gerindra di Senayan. Kedua, bila perpecahan berlanjut atau islah sampai gagal partai ini bisa semakin mengecil dan diprediksi pada pemilu 2019 bakalan tinggal nama karena dilanda konflik internal terus-menerus. Dukungan masyarakat pada PPP bakal berkurang jauh dan berpindah ke parpol Islam lainnya atau ke parpol nasionalis. Ketiga, tokoh-tokoh PPP tidak akan mendapat jatah menteri pasca Pilpres Juli mendatang bila KPU menolak dukungan PPP karena kepengurusannya dualisme. Soal jatah menteri ini memang krusial, dan menjadi akar permasalahan konflik hingga terjadi pemecatan dalam DPP PPP dan DPW. Mendukung Prabowo jelas berisiko di mata pengurus lainnya, apalagi dukungan SDA kepada Prabowo hanya keputusan sepihak diri Ketum PPP. Bukan berdasarkan putusan Rapimnas PPP. Bahkan nama Prabowo tidak masuk dalam daftar tokoh-tokoh yang sudah diputuskan dalam rapat pengurus sebelumnya. Justru itu, seruan islah kepada seluruh pihak positif dan seharusnya disikapi dengan kepala dingin oleh kedua belah kubu yang bertikai. Sebab, kedua kubu (SDA dan Romi) sama-sama mempunyai dukungan dan alasan yang kuat pula. Bila keduanya sama-sama ego dan ngotot, merasa benar sendiri maka islah bakalan gagal dan PPP rugi besar. Jadi, seruan Ketua Majelis Syariah Maimun Zubair harus dijadikan pegangan oleh kedua belah pihak yang bertikai.Yang utama islah terwujud dulu, soal dukungan capres dinomorduakan dulu untuk menyikapi perbedaan pendapat di internal partai dalam dua pekan ini. Mengenai fatwa Ketua Majelis Syariah DPP PPP menyebut PPP belum menentukan arah berkoalisi dengan partai mana pun, termasuk Gerindra, jelas menguntungkan capres PDIP Joko Widodo (Jokowi). Sebagian DPP PP menginginkan PPP berkoalisi denganJokowikarenapeluangmenangnyajauhlebihbesarketimbangPrabowoberdasarkan hasil survei. Semakin terlihat kalau perpecahan dalam internal DPP PPP bermuara pada dukungan capresdandapatapasetelahpilpres.KubuSDAmenggunakanjabatannyauntukmemberikan dukungan ke Prabowo. Kubu Romi mengira SDA sudah mendapatkan ‘’sesuatu’’ dari dukungan sepihak SDA sehingga berupaya menggagalkannya. Dan upaya Romi dkk membuahkan hasil dengan keluarnya fatwa dari Majelis Syariah PPP belum secara resmi menjalin koalisi dengan Partai Gerindra, dan persoalan koalisi ini akan dibahas kembali pada pertemuan islah. Sampai saat ini dukungan ke Prabowo masih mengambang. Bisa saja putusan islah nanti tidak sejalan dengan keinginan SDA, tapi bisa juga proses islah berjalan lancar. Sebab, dukungan PPP ke salah satu capres (berkoalisi) baru sah bila diteken SDAsebagai Ketua Umum dan Romi sebagai Sekjen.+

APA KOMENTAR ANDA SMS 08116141934

Faks 061 4510025

Facebook Smswaspada

+6285207065513 Sejatinya pasangan Calon Presiden/Cawapres yg akan berkompetisi pd Pilpres 09 Juli 2014 mendatang cukup 2 atau 3 kompetisi Nagarawan , Profesional serta Islami yg dipandang mampu , cakap , cerdas intelectual serta cerdas emosional disamping bersih , jujur , ojo dumeh dlm bts2 toleransi.

Pemimpin Harapan Oleh M Ridwan Lubis Belum tersedianya forum ideal bagi seorang calon pemimpin memaparkan gagasan tentang masa depan—masyarakat hanya disuguhi calon pemimpin yang bukan diukur dari prestasi tetapi lebih karena popularitasnya.

M

elahirkan seorang pemimpin melalui proses demokrasi tentulah bukan hal sederhana. Karena ia diharapkan akan mampu memperoleh dukungan mayoritas rakyat dan kemudian mampu mempertanggungjawabkan masa depan wilayah Indonesia yang begitu luas—penduduk nomor empat terbesar di dunia, kemajemukan sangat kentara, tajamnya perbandingan penduduk di perdesaan dan perkotaan, pendidikan yang lebih mengandalkan formalitas belum sampai substansi serta kompetensi— dan masih banyak lagi kondisi permasalahan bangsa Indonesia. Tetapi, betapapun beratnya persoalan yang sedang dipikul bangsa ini, sebagai manusia beriman, tentulah kita tidak boleh berputus asa. Pemimpin yang akan datang ini meneruskan agenda pembangunan yang sudah maupun belum terlaksana pada pemerintahan sebelumnya. Namun tampaknya masih sulit bagi sebagian masyarakat untuk menjatuhkan pilihannya. Terkesan adanya keterlambatan munculnya figur yang akan menjadi pemimpin bangsa. Sekalipun berbagai konvensi telah dilakukan serta pencarian bibit dari partai-partai, namun tetap masih dirasakan sulitnya tokoh yang memperoleh dukungan mayoritas rakyat. Salah satu indikator dari terjadinya kemacatan penyemaian bibit menjadi pemimpin di Indonesia secara sekilas tergambar dari konstalasi perpolitikan nasional yang masih lebih didominasi politik-transaksi melalui permainan politik uang. Sebelum pemilihan anggota legislatif yang lalu tergambar optimisme dari bakal calon pemimpin yang dibangun melalui pembentukan opini oleh media

+6285262435798 Dan apabila kelimanya tidak tercapai kata sepakat saya minta kelimanya sms saya . Karena saya sangat memahami jiwa rakyat indonesia yang sangat lama merasakan sakit dan sangat membutuhkan ramuan yang mujarab dari kelima orang orang yang berjiwa besar :Machfud .Md,Prabowo .S,Aburijal bakrie,Wiranto dan Haritanoe.S.Kalian semua adalah gambaran dari 5 pulau terbesar diindonesia yang akan bersinar di 5 benua di bumi tempat kita berpijak. +6281934236660 Buat Pak Gubsu dan Pak Wali Kota Medan: tolong lah pak penerangan lampu jalan di jln.pales 4 kel.simpang selayang kec.medan tuntungan di pasang lampu jalan nya pak. hanya kami yg tidak memiliki lampu jalan pak +6282167170674 Ibu Megawati ketua umum partai politik PDI Perjuangan kenapa begitu yakin pak Jokowi menjadi presiden.apakah Jokowi mampu mengatasi permasalahan bangsa yang begitu sangat complek.memimpin negara bukan seperti memimpin sebuah provinsi.dari sabang sampai merauke adalah Indonesia itulah negara kita dan apakah pak Jokowi mampu menjadi presiden tahun 2014 s/d 2019 nanti. +6285261172936 Hati hati makan dike dai nasi (RM) di Medan & Binjai (dekat lapa ngan tanah merah ) ada RM yg memasuk kan lagi bekas sisa sayur yang lebih, bekas hidangan yang ki ta makan ke tempat baskom semula tem pat sayur (estlase) dan dihindangkan kembali pada pemesan baru :)hati hati lah kawan jangan ter ulang dua kali masuk dan makan RM nya +6282167170674 Ustad Guntur Bumi telah mencoreng muka umat islam diseluruh Indonesia.berkedok melakukan pengobatan secara islam memakai ayat ayat Alqur’an rupanya hanya kedok belaka mencari keuntungan pribadi.banyak sudah umat islam yang telah tertipu oleh UGB.bukan penyakit pasien yang sembuh tetapi uang habis jutaan.UGB sama sekali tidak ada kepandaiannya dalam ilmu pengobatan.mengapa ayat ayat alqur’an dipakai untuk menipui orang dengan pura pura memberi pengobatan kepada setiap pasiennya. +6285297814315 Saya harap pada keperintahan mohon kPPS benar benar di tatar dulu sebelum pemilu karena byk ber salahan karena bj saksi dari pks seramgam malah ada sebagian kPPS tdk boleh pk bj aneh nya ada mandat tdk di boleh kan masuk padahal ada mandat mau saya pebesar takut ana pemilu tdk jalan ahir saya diam kan ht saya curahkan dgn sms aja agar plong pikiran saya +6285278662461 kepada yth BAPAK KETUA K.P.K.,GUBERNUR.SUMUT,DAN BAPAK INSPEKTORAT SUMUT agar meninjau,memeriksa kembali proyek pembangunan dr DAFTAR ALOKASI BANTUAN KEUANGAN PROV.SUMUT PADA A.P.B.D 2013.utk kabupaten ASAHAN sebesar 425.662.350.000.rupiah .dng jumlah 347 paket proyek. klu dengan dana sebesar itu maka sudah pasti ASAHAN INI MAJU..ini malah sebaliknya TAK JELAS mana proyek yg dibiayai provinsi dan mana yg mana dibiayai kabupaten.DOKUMEN lontong PROYEK abal\abal.. +6285261172936 STTB (ijazah) a/n Budi man SMP Neg 13 Ban da Aceh di Baiturahm an kotamadia Banda Aceh - anak Ruslianto ijazah tsb ada dirum ah kami silahkan am bil - hubungi HP kami :)kepada Waspada terima kasih / kasih an mungkin diperlu kannya +6285362468659 Assalamu ‘alaikum.Yth Bapa Muhammad TWH. Saya baru tahu bahwa Bapa pernah di “Mimbar Umum.” Pertama kali saya tahu nama Bapa di “Bintang Sport.” Bioskop Deli di Jl Perdana, di Jl Bali Gedung Kesenian dan kantor ODB. Bapa Ali Hasjmy nginap di Hotel de Boer(?) ya kan? Wassalam: cuk abdul sukor +6288262009493 Perhitungan sy salah banyaknya poster atau gambar caleg diwarung kopi yg beragam partai, membuat memilih berkurang ternyata memperbanyak yg ikut milih.

massa bahwa kemenangan tebal akan diraih namun faktanya masih jauh dari kenyataan. Dengan mengacu kepada kesibukan yang terjadi di kalangan pimpinan partai-partai politik untuk memperoleh kepastian siapa yang akan menjadi pemimpin negara yang akandatangmakahalitumenunjukkanbetapa sulitnya menghasilkan seorang pemimpin Indonesia. Kenapa hal itu bisa terjadi. Argumen pertama adalah adanya keterlambatan partai politik mempersiapkan calon pemimpin atau setidaknya sulit untuk diperoleh ketegasan karena mereka sesungguhnya belum memilikikonsep yang jelas konsep tentang figur yang akan ditampilkan. Lalu, apabila kemacatan ini terus berlangsung apakah belum waktunya diminta partisipasi organisasi kemasyarakatan utama seperti NU dan Muhammadiyah untuk mengajukan calonpemimpinbangsa.Memang,kitabelum memiliki mekanisme baku dalam sistim rekrutmen maka oleh karena itu sistem penjaringan bakal calon pemimpin lebih menyandarkan pertimbangan opini yang dibangun media massa. Padahal belum tentu media massa berhasil memperkenalkan calon pemimpin yang ideal itu. Argumen kedua, adalah belum tersedianya forum yang cukup ideal bagi seorang calonpemimpinuntukmemaparkangagasan tentangmisimasadepannyasehinggapotensi kemampuan yang ada pada diri mereka kurang terekspose keluar sehingga luput dari pengamatan masyarakat. Akibatnya, masyarakat hanya disuguhi calon pemimpin yang bukan diukur dari prestasi masa lalunya akan tetapi lebih karena popularitasnya. Argumen ketiga, para calon pemimpin yang telah diperkenalkan oleh media massa

lebihdidoronguntukmenunjukkanminatnya yang demikian besar untuk menjadi pemimpin namun visi yang dibangun oleh kapasitas keperibadiannya belum sempat diuji oleh masyarakat. Sehingga masyarakat masih diliputi perasaan was-was akan keandalan pribadi seorang calon yang telah tampil dalam pemberitaan di media massa. Ketika bangsa Indonesia hendak menentukan kualifikasi pemimpin yang akan mengantarkan bangsa ini menuju masyarakat yang adil, makmur, sejahtera lahir dan batin tentulahmerekaperlumengkajiulangtentang sosok yang mereka cari. Seorang pemimpin Indonesia hendaklah memahami betul konsep kebangsaan Indonesia yang demikian kaya dengan kemajemukan namun dapat ditemukan titik simpul yang mempertautkan kemajemukan dalam semangat gotong royong. Dengan gotong royong maka semua warga negara memiliki hak dan tanggung jawab yang sama. Ide tentang tradisi gotong royong yang menjadi daya pengikat bagi masyarakat multikultural adalah kesediaan untuk saling mengakui keberadaan, menghormati serta saling mendukung kelebihan masing-masing. Tradisi gotong royong inilah yang menjadi akarbudayaIndonesiasehinggamerekahidup dalam format persatuan nasional. Hampir setiap suku bangsa kita memiliki pola yang sama tentang gotong royong sekalipun denganformulasiyangberagamnamunsaling memili kemiripan. Kemudian, salah satu agenda penting dari pemimpin yang akan datang adalah penegakan hukum secara tegas pada semua sektor kehidupan berbangsa dan bernegara sehingga terwujud kepastian keseimbangan hak dengan kewajiban. Oleh karena model kepemimpinan yang kita lalui beberapa dekade yang lalu lebih mengacu kepada pola kepemimpinanotoritermakasubstansikehidupan demokrasi berjalan sangat lambat. Dan sekalipun iklim sekarang telah bergerak ke arah demokrasiakantetapimasihlebihdidominasi sekedar pemenuhan prosedural. Karena itu, berbagai penyimpangan kekuasaan yang dimulai dari atas semakin

merambah ke lapisan bawah tanpa ada kemampuan menahan lajunya penyimpangan itu. Tidak bisa dibayangkan bahwa gagasan otonomi daerah yang dahulu begitu idealuntuklebihmendinamisasipotensipembangunandidaerahtetapiternyatalebihmerupakan arena pertarungan baru di dalam memonopoli sumber daya alam. Selanjutnya, komitmen terhadap Pancasila lebih bersifat sekedar kebanggaan masa lalu. Pada era sebelum Reformasi kita berada pada sistim kehidupan berbangsa yang otoriter bahkan cenderung feodal dan sekalipun ada upaya yangseriusdaripemerintahansekaranguntuk membongkarpraktikpenyalahgunaankekuasaan itu tetapi perkembangannya telah terlanjur menggurita sampai ke level yang paling rendah. Peningkatan kesejahteraan rakyat melalui peningkatankehidupanekonomiadalahsuatu program yang tidak dapat ditunda karena akan membawa dampak berganda. Oleh karena itu, pemimpin yang akan datang hendaklah memiliki konsep yang jelas tentang kondisi perkonomian bangsa. Pendidikan adalah merupakan kunci dari semua upaya menuju terwujudnya sebuah bangsa yang berkeunggulan. Karena itu, pemimpin yang akan datang hendaknya berani untuk melakukan investasi yang memadai baik dana maupun sumber daya manusia guna membuka kesempatan seluas-luasnya bagi puterapurteri bangsa yang potensial untuk menjadi tenaga pembangunan yang berkeunggulan karena tanpa itu maka bangsa Indonesia tetap menjadi bangsa konsumen. Denganpendidikan,makainsanIndonesia akan semakin cerdas, berbudi pekerti serta meningkat keimanan dan ketakwaannya. Terakhir, Indonesia ke depan akan semakin luas terkait dengan pergaulan internasional dalam berbagai sektor. Karena itu, pemimpin yangakandatanghendaklahmempersiapkan diri sebagai juru bicara dan representasi seluruh komponen bangsa Indonesia.

Penulis adalah Guru Besar UIN Syarif Hidayatullah Jakarta.

Medan Pasca-Rahudman Oleh Budi Agustono Sudah menjadi rahasia umum bahwa dalam rapat-rapat dinas dengan Plt Wali Kota Medan mulanya para pimpinan SKPD itu ada yang mangkir alias tidak datang.

S

etelahmenantihampirsetahunatas kasus yang menimpa Wali Kota Medan non aktif, akhirnya Rahudman Harahap, Selasa, 15 April 2014 mendapat hukuman di Lembaga Pemasyarakatan Tanjung Gusta Medan. Ia mendapat hukuman penjara karena kasus korupsi saat menjabat Sekretaris Daerah KabupatenTapanuli Selatan tahun 2005. Berita penangkapan mantan Wali Kota Medan ini tidaklah mengejutkan karena rumor yang beredar di publik ia pasti akan mendapat hukuman, hanya soal menunggu waktu. Sejak menjabatWali Kota Medan tahun 2010 sampai dinonaktifkan dari jabatannya, Rahudman seorang wali kota yang berani mengambil keputusan, tegas dan berpengaruh. Dalam mengambil keputusan ia tidak mudah diintervensi orang lain. Semua keputusan strategis diambilnya sendiri, termasuk memutasikan pejabat eselon II dan III di Pemko Medan. Karena pengambilan keputusandilakukannyasendiri,Rahudmanmenjadi seorang pimpinan puncak di wilayah ini yang mandiri dan tidak mudah didikte siapapun. Meski mandiri dan percaya dengan diri sendiri, tetapi ia mengerti dengan siapa berhadapan, dan apa yang perlu dikerjakan agar orangyangdihadapiterserapdalampengaruh dirinya.InilahyangmenjadimodalRahudman dalam melayarkan kota Medan. Gayakepemimpinansepertiinibukannya tidak memunculkan masalah. Dengan memutasikan para pejabat di Pemko Medan atas keputusannya sendiri menyebabkan sosokmantanSekretarisDaerahTapanuliSelatan ini menjulang menjadi magnit kekuasaan lokal. Ia sepenuhnya yang menentukan siapa yang berhak menduduki jabatan-jabatan strategis di Pemko Medan. Siapapun yang dimustasikan atau diangkat menjadi pejabat kota Medan mulai dari sekretaris daerah, KepalaSatuanKerjaPerangkatDaerah(SKPD), camat, lurah dan kepala lingkungan tidak pernah ada yang mempersoalkan. Jika ada, itu hanya sekadar riak dalam lautan luas yang

tidak membawa makna apapun. Demikian kuat pengaruhnya sehingga kuasa lokal sepenuhnya berada di tangannya. Sewaktu Rahudman menjabatWali Kota Medan,DewanPimpinanCabang(DPC)Partai Demokrat Medan akan memilih ketua partainya.Waktu itu Rahudman menjadi calon kuat memimpin partai ini. Ia menjadi salah seorang calon, karena Rahudman tidak berpartaidanmemerlukansandaranpolitikuntuk memperkuat posisi politiknya dalam menjalankan kekuasaan. Ketika dirinya menjadi salah satu kandidat Ketua DPC Partai Demokrat Medan bukannya tanpa alasan, karena partai berlambang Mersi ini memerlukan orangyangmemilikijabatandipemerintahan. Sebagai Wali Kota Medan, tentu Partai Demokrat melirik Rahudman lantaran ia memiliki sumber daya ekonomi dan politik yang tidak tertandingi oleh calon lainnya. Nama Rahudman semakin bersinar. Namun ketika ia di non aktifkan sebagai orang nomor satu di wilayah ini, perlahan-lahan nama Rahudman sebagai calon Ketua DPC Partai Demokrat redup. Seturut dengan itu pengaruh politiknya terus menyusut. Sampai sekarang pun belum ada tanda-tanda pemilihan Pelaksana Tugas Ketua DPC Partai Demokrat Medan yang dipimpin Soetan Bhatoegana ini. Dengan dinonaktifkannya Rahudman, maka naiklah Wakil Wali Kota Dzulmi Eldin menjadi Pelaksana Tugas (Plt) Wali Kota Medan. Sebagaimana menjadi perbincangan publik, mulanya Dzulmi Eldin mendapat hambatan dalam menjalankan pemerintahannya. Ia mendapat kesulitan mengendalikan dan mengawasi para pejabat di Pemko Medan. Meski telah dinonaktifkan, tetapi pengaruh Rahudman terhadap pimpinan SKPD masih kuat, bahkan ada yang masih tetapmenganggapnyatetapsebagaipimpinan tertinggi di Pemko Medan. Sudah menjadi rahasia umum bahwa dalam rapat-rapat dinas dengan PltWali Kota Medan mulanya para pimpinan SKPD itu ada yang mangkir alias tidak datang. Hal

ini menyulitkan Dzulmi Eldin melakukan koordinasi kerja dalam urusan pemerintahan. Tidak hanya pimpinan SKPD, di kalangan camat masih ada yang memperlihatkan kecenderungannyakepadamantanatasannya itu. Situasi seperti ini membuat birokrasi Pemko Medan mengalami disorientasi sehingga memperlambat Dzulmi Eldin melakukan koordinasi dan konsolidasi kepada bawahannya. Jika birokrasi mengalami keterbelahan, program kerja pemerintahan tidak akan berjalan dengan baik. Berhadapan dengan keadaan ini, memutasikan pimpinan SKPD yang kinerjanya tidak maksimal bukan pula persoalan mudah. Tetapi jika ini terus berlarut menghambat kinerja Dzulmi Eldin. KinimantanWaliKotaMedanRahudman berada di Lembaga PemasyarakatanTanjung Gusta Medan. Setelah tidak lagi menjadiWali Kota Medan pengaruh politik Rahudman terhadap pejabat eselon II dan III tidak sebesar sebelumnya. Aura pengaruh kekuasaannya makin hari makin berkurang. Terlebih lagi jika Surat Keputusan Menteri Dalam Negeri (Mendagri) tentang pemberhentian sebagai Wali Kota Medan terbit akan semakin memperkuat posisi politik Dzulmi Eldin. Tetapi dengan keluarnya SK Mendagri ini tidak dengan sendirinya ia diangkat sebagai Wali Kota Medan definitif. PengangkatanWali Kota permanen masih memerlukan proses dan waktu yang panjang. Saatinimasajabatan DzulmiEldintinggal 15 bulan lagi dan akan berakhir Juli 2015 mendatang. Untuk mengokohkan kepemimpinannya Dzulmi Eldin segera melakukan pertama, konsolidasi jajaran birokrasi Pemko Medan. Lima belas bulan bukanlah waktu yang panjang untuk sebuah pemerintahan. Kedua, melakukan lobi dengan DPRD Medan menggelar rapat paripurna pengusulan Plt Wali Kota menjadiWali Kota Medan definitif. Sebaiknya rapat paripurna pengusulan ini dilakukan pada masa bakti Ketua dan anggota DPRD Medan 2010 – 2015 yang akan berakhir September mendatang. Jika rapat paripurna pengusulan ini dilaksanakan beberapa bulan ke depan tentu memudahkan Dzulmi Eldin melakukan lobi politik memuluskan proses pengusulanWali Kota Medan definitif. Sebaliknya jika rapat paripurna digelar setelah September mendatang, lobi politik akan semakin panjang dan melelahkan karena ketua dan anggota DPRD Medan masa bakti 2010 – 2015 telah berakhir,

dan diganti dengan Ketua dan DPRD Medan 2015–2020yangkomposisiketuadananggota wakil rakyatnya berbeda dari masa sebelumnya. Ditambah lagi dengan masuknya wajah dan partai baru di DPRD Medan ini tentu memerlukan adaptasi dan lobi politik agar pengusulan PltWali Kota menjadiWali Kota permanen berjalan lancar. Publik menunggu gerakan Dzulmi Eldin melakukan konsolidasi dengan bawahannya untuk membangun stabilitas pemerintahannya, sembari melakukan lobi ke DPRD Medan agar sesegera mungkin menggelarrapat paripurna pengusulanWali Kota Medan permanen. Dengan demikian roda pemerintahan Pemko Medan akan berjalan efektif. Penulis adalah Sekretaris Program Studi Magister Ilmu Sejarah, Fakultas Ilmu Budaya, USU.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau email: opiniwaspada@yahoo.com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata dan kartu pengenal (KTP) penulis. Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di media manapun. Isi tulisan menjadi tanggung jawab penulis.

SUDUT BATUAH * Keberagaman di Sumut harus dikelola dengan baik - Biar menjadi percontohan * Krisis listrik di Sumut cukup kompleks - Bahkan kayak tradisi tahunan * Blusukan Bupati DS dapat apresiasi para tokoh - Mana tau bisa dua periode,he...he...he o k D Wa

el


Opini

WASPADA Kamis 24 April 2014

B7

Koalisi Partai Islam, Utopiskah? Pasar Tradisional Jl.Muara Takus Kampung Madras Minggu, 03 Nopember 2013 yang lalu istri Saya berbelanja ke pasar tradisional jl. Muara Takus Kampung Madras Medan. Di sana, istri saya melihat sebuah losd, atapnya sedang diganti. Sesampai di rumah lalu menceritakan kepada saya tentang ketertarikannya kepada atap genteng losd itu. Sayang Bang, daripada dibuang begitu saja, lebih baik kita beli., ungkapnya. Masalahnya saya belum membuka sebuah badan usaha kontraktor dan atau mempunyai sebuah panglong penjualan bahan-bahan bekas bangunan di Medan. Lagipula tidak ada gedung tertentu milik sendiri yang dapat memanfaatkan genteng-genteng lama itu untuk dipakai. Sehingga tidak ada motivasi saya untuk menyelamatkan genteng-genteng itu. Masalahnya, di situ masih ada 4 losd lama yang atapnya masih menggunakan genteng sejenis. Sebagian atapnya ada yang sudah disisip dengan seng gelombang. Dan ada sebagian yang sisi ujungnya sudah hancur. Pertanyaannya, kenapa sistem penggantian atap lost itu tidak disatupaketkan dengan perbaikan atap genteng losd lainnya. Sehingga genteng-genteng yang lama itu masih bisa digunakan untuk menyisip losd lama yang masih ada di lokasi tersebut. Ketika saya mengunjungi pasar tersebut, dan bertanya tentang renovasi atap losd tersebut--sampai saat ini saya cenderung mengatakan renovasi-. Sementara Pemko Medan menggunakan frasa revitalisasi pasar-pasar tradisional di Medan. Penjual itu mengatakan bahwa, bagian depan losd tersebut akan dihilangkan–redesain? Apakah karena akan dirubuhkan maka tidak ada opsi untuk menggunakan atap genteng yang dibuka. Tetapi pertanyaan selanjutnya, apakah semua losd itu akan dirubuhkan? Semoga program revitalisasi pasar-pasar tradisional yang dilakukan oleh Dinas Pasar Kota Medan dengan tambahan dana pinjaman puluhan miliar itu benar-benar sesuai dengan konsep revitalisasi yang diwacanakan. Setidaknya supaya tidak menjadi temuan yang akan memalukan bagi para pejabat di Dinas Pasar Medan di kemudian hari. Salam Sejahtera, Miduk Hutabarat Konsultan Pembangunan di IPRI Jl. Mesjid Syuhada 42 MEDAN 20131

Pesawat Tidak Dibajak Tapi Hilang Jika anda benar, apabila perkiraan anda meleset, apalagi menyangkut orang banyak dan bersifat nyata, anda harus menjelaskan mengapa perkiraan anda meleset atau tidak tepat. jangan anda berani lempar batu sembunyi tangan. ya, orang jadi korban oleh anda. Saya siap jadi pembela Malaysia, nantinya, akibat ketegasan Malaysia. Saya mendukung sampai saat ini, kebijaksanaan Malaysia. Pesawat tidak dibajak, tapi hilang. Penulis, dari kevin bohong. teknologi bisa direkayasa, kerena buatan manusia. Buatan tuhan saja bisa direkayasa. Bumi tidak mengambang dan tidak berputar. bumi bertingkat, paling tinggi daerah bersalju, dan tidak tahu batas rimbanya. +6288262009493

Dedi Sahputra

Foliopini

dedisahputra@yahoo.com

Dunia Narasi Sejak kemarin KPU menghitung suara para Caleg. Beberapa nama muncul bakal mengisi ruang parlemen. Mereka pada umumnya adalah orang-orang yang popular, dan hampir tidak ada yang tak popular. Padahal, popularitas, kata aktor Orson Welles, harusnya tidak menjadi prioritas untukmemilihpolitisi.Jikabergantungpada popularitas, maka Donald Duck dan Muppets yang akan mengambil kursi di parlemen. Nyatanyaparlemen,jugaparapemimpin di negeri ini tidak saja diisi para Donald Bebek dan Muppets tetapi ada juga oleh Petruk, si Gumarapus, sampai si Borjong, cuma karena mereka popular. Lantas mengapa bisa seperti itu? Apa yang sebenarnya terjadi? *** Putrisayaitukinimulaimemasukimasa remajanya. Tapi kebiasaannya bermain sendiri di dalam kamar belum berubah. Terkadang dia kumpulkan kursi-kursi ruang tamu berjejer dan meneduhinya dengan seprei. Ada kalanya dia mengumpulkan semua bantal di rumah kami danmembuatbentengbentengan di kasurnya. Dalam sendirinya itu saya mendengar dia bicara,asyiksekalikedengarannya. Si sulung yang memang suka usil pada adiknya itu coba mengganggunya, tapi gadis kecil ini marah luar biasa. Sebagai penjaga perdamai keluarga, saya pun datang membantunya. Ada dua alasan mengapa saya bertindak seperti itu. Pertama, karena tindakan mengganggukebahagiaanoranglainadalah perilaku yang salah. Untuk itu saya perlu menyadarkan si sulung akan tindakannya tersebut. Kedua,sigadiscilikinisedangmenikmati imajinasinya yang seluas cakrawala itu. Dia sedang mengeluarkan segala objek dalam bayangannyamenjadilebihnyata.Iniadalah masa platonic, saat ia mengeluarkan segala gumpalan-gumpalan keindahan yang dirasakannya. Saya bisa dengan mudah mengetahuinya karena saya punya pengalaman yang sama. Suatu ketika di masa SMP kami dulu hujan turun setengah deras. Kami duduk di serambi kelas, semua terdiam, saya memicingkan mata. Bayang-bayang pepohonan yang memantul dari air yang tergenang itu menghadirkan dunia lain yang lebih eksotis, lebih estetis, dan misteri. Di masa sebelumnya, di sebuah ladang kami membalutkan jalinan daun nangka di kepala, tangan dan pinggang. Kami pun berperan sebagai pendekar gagah perkasa, juga rupawan. Kami baru bubar ketika hari menjelang sore, atau ketika salah seorang

dari kami memangis karena “anunya” dihinggapi tengu (tungau). Sekarang, saat menulis kolom ini, saya juga sering berperangai seperti putri saya itu. Rangkaian kata-kata yang Anda baca ini adalah kelebatan-kelebatan masa lalu, dan tatapan saya yang mengarah ke depan. Ia adalah refleksi dari hutan-hutan yang saya geluti, dari pandangan kepada para gunung, dari film yang saya tonton, dari musik yang saya dengar, dan dari seluruh keindahan yang bersemayam. *** Kalau rangkaian kata-kata itu datang dari pengalaman-pengalaman, maka kemudian orang akan memberi makna dari setiap kata-kata yang dihasilkannya. Tak peduli ia berwujud tulisan dan ucapan, ia akan dimaknai dari sudut padang berbeda. Sama berbedanya ketika segala keindahan imajinasi itu di-convert menjadi katakata.Dankarenaberbeda,iabisasajaprofan. Tapi sepanjang naratif, orang akan menelannya dengan sukarela. Karena pada dasarnya manusia, seperti kata Walter Fisher, adalah mahluk naratif (pencerita), yang lebih memahami cerita ketimbang argumentasi. Cerita yang bagus akan lebih membujuk ketimbang argumentasi yang baik. Selanjutnya, pertimbangan inilah yang menjadi dasar bagi keyakinan dan perilaku seseorang. Mengapanaratif?Karenasesungguhnya manusia menemukan bahwa dunia ini sebagaiduniayangdiisidengancerita-cerita. Di antara cerita itulah setiap kita berjumpalitan. Tak peduli sejelek apapun aslinya dirimu, jika pesan tentang dirimu disampaikan dalam bentuk cerita yang melamunkan, engkau akan segera diingat. Sekarang tataplah orang-orang yang pupoler itu. Resapilah makna kehadirannya di tengah-tengah dirimu. Mereka semua berasal dari narasi yang mengelilingimu. Di zaman sekarang narasi itu ada di manamana. Ada di layar televisi, di koran-koran, diradio,dipapanbillboardtepijalan,bahkan sampai di dinding-dinding rumahmu. Di dunia narasi yang hiruk pikuk inilah orang-orang itu muncul dan menjadi popular.Padahalkeindahanimajinasiitusejatinya senyap. Itu sebabnya semakin orang memahami makna kata-katanya, akan semakin sering ia diam. Jadi popularitas itu sebetulnya dosa dunia narasi. Bahkan manusia paling bengis sekaliber George W.Bush tahu itu. Satu momen yang palingmembanggakandalamhidupkuadalah, aku tak menjual jiwaku demi popularitas, katanya.(Vol.460, 24/4/2014)

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

Oleh Ahmad Arif Ginting Kalau lima partai Islam ini benar-benar bersatu, PDI Perjuangan,Golkar,dan Gerindra akan kelimpungan mencari partner koalisi.

H

asil hitung cepat (quick count) pesta demokrasi tanggal 9 April kemarin mengejutkan banyak orang. Parpol (partai politik) Islam yang digadang-gadang akan terjungkal, justru mengalami bouncing (lonjakan) suara. Sebaliknya,partainasionalisyangdielu-elukan malah mendapat punishment (hukuman) dari rakyat. Pertanyaan krusial pun seketika menghadang partai berbasis ideologi dan atau massa Islam; mampukan mereka berpadu sehingga bisa menjadi tuan di rumah sendiri? Suara Islam Dalam Sejarah Meski hasil akhir perhitungan suara baru akan diumumkan bulan depan, hasil hitung cepat tersebut bisa menjadi gambaran awal bagi tren peningkatan suara Parpol Islam. Secara umum, raihan suara Parpol Islam berfluktuasi, sama halnya dengan Parpol nasionalis. Capaian Parpol Islam kali ini pun– berdasarkan data kasar yang telah masuk atau hasil hitung cepat- harus diakui bukan yang terbaik. Menurut Firman Noor , jika dirunut dari sejarah perjalanan partai-partai Islam dalam Pemilu maka Pemilu tahun 1955 pada era Demokrasi Liberal masih tetap yang terbaik, yakni partai-partai Islam saat itu mampu meraihsuaradanmenguasaiparlemenhingga sekitar 44,4 persen. Jumlah itu menurun drastis pada masa Demokrasi Terpimpin, pasca dipaksanya Partai Masyumi (partai Islam terbesar saat itu) membubarkan diri oleh Soekarno. Pada masa ini kelompok Islam di parlemen hanya memiliki kursi tak lebih dari 15,3 persen. Ini merupakan masa tersulit yang pernah dihadapi oleh partai-partai Islam yang saat itu tinggal menyisakan beberapa partai, semisal NU, PSII, dan Perti. Pada masa Orde Baru, dalam enam kali Pemilu, partai-partai Islam (1971) dan PPP (1977, 1982, 1987, 1992, dan 1997), memeroleh suara rata-rata 21,9 persen. Pada masa yang penuhdenganrekayasapolitikitu,partaiIslam mampu bertahan dari tekanan luar biasa Rezim Soeharto yang sempat pada awal pemerintahannya mengidap semacam Islamofobia. Setelah Orde Baru berlalu, suara partai-partai Islam kembali mengalami peningkatan. Hingga 15 tahun berjalannya reformasi suara partai-partai Islam (termasuk Pemilu 2014), rata-rata berada dalam kisaran 33,1 persen. Hasil terbaik hingga sejauh ini tetap Pemilu 2004, yaitu 39,95 persen suara atau setara dengan 42,15 persen kursi mampu diraup.Danmeskijelaslebihtinggiketimbang hasilPemilu2009,hasilPemilu2014tampaknya

akan sedikti lebih rendah dari capaian tahun 1999,yaitupartai-partaiIslammampumeraih suara hingga 37,56 persen. Hal yang membuat istimewa Pemilu kali ini bahwa hasil itu diraih saat citra partaipartai Islam coba untuk dibusukkan atau setidaknya dinafikan dalam percaturan politik nasional. Media, yang menjadi salah satu titiklemahpartai-partaiIslam,menjadisarana yang efektif untuk melakukan hal-hal tersebut. Tidak mengherankan jika partai Islam sekali saja melakukan kesalahan, langsung dipojokkan habis-habisan. Di sisi lain kerjakerja bernas partai-partai Islam seolah hilang ditelan bumi. Kondisi-kondisi inilah yang menyebabkanbanyakorang-bahkanseorang Yusril Ihza Mahendra pun- demikian pesimistisnya melihat masa depan partai Islam. Mengapa Selalu Kalah? Eep Saifullah Fatah (2000; 106), mengutip Ruth McVey, menegaskan kalangan Islam hanya terposisikan sebagai “palu” (hammer). Dijadikan perkakas oleh kekuatan di luar dirinya untuk memukul sesuatu yang didefinisikan sebagai“musuh bersama”.Tugas sang palu pun berakhir setelah sang musuh terpukul koma atau mati. Sang palu lalu ditaruhkembaliditempatperkakasdalamgudang sejarah. Parpol-parpol di kalangan islam, lanjut Eep, terbagi ke dalam empat kategori. Pertama,ParpolyangmenjadikankomunitasMuslimsebagaibasisatautargetmassanya.Kedua, Parpol yang memakai label Islam sekalipun tidak berasas Islam. Ketiga, Parpol yang menjadikanIslamsebagaiasasnya.Keempat,Parpol yang agenda dan platform-nya secara tegas melayani kepentingan dan ideologi kalangan Islam. Adakekhawatiranyangperludiperhatikan bahwa pelaku politik Islam terjebak pada kekeliruan-kekeliruan lama. Di antara banyak kekeliruan politik kalangan Islam yang bisa ditemukan di masa lalu, lanjut Eep (2000; 156-163). Ada lima kekeliruan mononjol yang seyo-gianya diingat untuk tidak diulang kembali di masa berikutnya. Pertama, kalangan Islam kerap kali gampang atau lebih suka marah ketimbang melakukan politisasi. Kemarahan adalah luapan emosionalspontanyangtidakmemilikitarget, agenda dan platform. Kemarahan adalah sesuatu yang ad hoc, tidak berdimensi jangka panjangapalagipermanen.Kemarahankerap kali tak banyak berarti dan tidak banyak memengaruhi perkembangan politik yang berjalandisekitarnya.Sementaramelakukanpolitisasi berarti membangun aksi atau gerakan yang memiliki target, agenda, platform serta

berjangka panjang bahkan permanen. Pengaruh dari politisasi terhadap perkembangan politik di sekitarnya bisa jadi signifikan. Kedua, kalangan Islam kerap lebih senang mengurus kulit, bukan isi. Soal-soal substantif kerap kali justru luput dari perhatian. Sementara pada saat yang sama sosal-soal artifisial justru diurusi. Ketiga, politik kalangan Islam kerap lebih terpesona pada keaktoran (figur, pelaku), bukan pada isme atau wacana yang diproduksinya. Sejarah politik Islam di masa Orde Baru menunjukkan betapa kalangan Islam kerap kali terjebak untuk mendefinisikan kawan dan lawan berdasarkan figur atau keaktoran, bukan isme atau wacana. Keempat, politik kalangan Islam kerap kali dilakukan sebagai reaksi dan bukan proaksi. Agenda dan opini publik biasanya diciptakan oleh kalangan lain dan kalangan Islam sibuk bereaksi atas agenda atau opini publik yang telah terbentuk itu. Kalangan Islam sangat jarang mengambil inisiatif menciptakan agenda dan opini publik lebih dulu (proaktif). Ibarat pemain silat, kalangan Islam pun lebih banyak sibuk menangkis dan bukan mempersiapkan serangan-serangan. Kelima, kalangan Islam sangat kerap dan senang membuat kerumunan dan bukan barisan. Sebuah kerumunan bisa saja terdiri dari banyak orang, namun sangat rentan lantaran tidak memiliki agenda,platform, program, kepemimpinan, jaringan dan rencana-rencana aksi yang dikonsensuskan di antara mereka. Sebaliknya, sebuah barisan sekalipun beranggotakan sedikit merupakan sebuah kekuatan yang tangguh lantaran memiliki platform, program, kepemimpinan, jaringan dan rencana-rencana aksi yang dikonsensuskan di antara mereka.

Keharusan Berkoalisi Lonjakan suara Parpol Islam dalam Pileg (pemilihanumumlegislatif)kemarinmerupakan momentum positif bagi sentimen Islam politik. Bila dihimpunkan–seperti hasil quickcount; PKB 9,18 persen, PAN 7,48 persen, PKS 7,07 persen, PPP 6,75 persen, dan PBB 1.47 persen, suara Parpol Islam mencapai 31,95 persen. Jumlah tersebut tentu sangat signifikanuntukmembentukkoalisipengajuan Capres (calon presiden). Bahkan, kalau lima partai Islam ini benarbenar bersatu, PDI Perjuangan, Golkar, dan Gerindra akan kelimpungan mencari partner koalisi. Namun, menurut Samsudin Adlawi, peluang besar itu akan terbuang sia-sia jika partaiIslamtersebutmasihmenomorsatukan egonya. Jangankan membuat kompak dua atau beberapa partai, ada beberapa partai Islam yang pecah kepengurusannya. Lalu mereka membuat tandingan partai baru. Sebagai penutup, kita berharap koalisi Parpol Islam jangan merasa rendah diri berhadapan dengan koalisi Parpol nasionalis. Ingat, al-haq bila nizham yaghlibuh albathil bi nizham, kebenaran yang berserakan akansangatmudahdikalahkankebatilanyang berpadu! Peluang dan kesempatan tidak datangduakali.Bilamomentumpositifterhadap sentimen Islam politik kali ini tidak dimanfaatkan dengan baik (baca; amanah). Bisa saja pada Pemilu yang akan giliran Parpol Islam mendapat punishment dari pemilih. Wallahu a’lam.

Penulis adalah Pendiri Pustaka Dan Bimbel Gratis RUMAN (Rumoh Baca Aneuk Nanggroe) Aceh.

Demokrasi? Oleh Nirwansyah Putra Orang-orang mengatakan soal pembatasan kekuasaan dan perlindungan rakyat. Kekuasaan harus dikendalikan sistem dan rakyat mesti menjadi pengadil utama. Kita setuju, meski agak geli membacanya. eperti lebah. Sarangnya begitu teratur, sebuah heksagon yang saling berdampingan.Ketikamerekamencari makan di luar, di kumpulan bunga-bunga, tak ada keributan yang terjadi. Mereka tak perlu ajaran soal antri. Tak ada pula kecemburuan ketika seekor lebah mendekati bunga yang sangat cantik dan berhasil memproduksi madu yang begitu banyak. Tidak ada yang merasa tidak adil ketika seekor lebah lainnya hanya mendapatkan bungabunga yang tak pernah dilirik manusia karena keburukannya;bunga-bungayangtakpernah mendapatkan porsi di puisi-puisi manusia. Mereka hidup dengan seekor ratu, yang memberi mereka jaminan eksistensi dan survivalitas di kemudian hari. Mereka tak perlu memilih ratu seperti layaknya manusia memilih pemimpin-pemimpinnya.Tak ada bantahan. Lebah hidup terus seiring waktu berputar di atas muka bumi. Di sebelahnya ada sarang semut. Kehidupan mereka terorganisir walau mereka tak pernah mendapatkan kuliah mengenai manajemen organisasi. Mereka mencari dan menyimpan makanan untuk di masa depan, walau mereka tak pernah membaca bukubuku dan kursus investasi. Mereka keluar dan kembali lagi ke sarangnya dengan disiplin, walau mereka tak pernah mengikuti ceramah kaum motivator yang berbusa-busa. Mereka tak pernah memilih pemimpin mereka, tapi merekatahuyangmanapemimpindanmana yang dipimpin. Lebah dan semut adalah di antara dua hewan yang disebut dan diceritakan dalam Alquran. Mereka tidak mengenal demokrasi. Mereka hidup aman, nyaman hingga kini.

S

Demokrasi? Pemilu 9 April 2014, adalah prosedur demokrasi, suatu tatanan yang masih menjadi kesepakatan sebagian umat manusia saat ini, termasuk kita di sini. Di situ, substansinya adalahrakyatyangmenjadipemilikkedaulatan. Distribusi dan peralihan kekuasaan dipergilirkan dengan mekanisme yang diinginkan agar tidak berdarah-darah, tidak rusuh, konflik dan seterusnya. Kekuasaan memang punya hasrat untuk destruktif. Kita bukan ingin membahas hal seberat itu dalam ruang secuplik ini. Namun kita menyadari, bahwa untuk negara seluas dan sebesar di Indo-

nesia, di mana hidup beraneka suku bangsa, membutuhkan model negara dan pemerintahan yang tepat untuk ke depannya. Perubahan kekuasaan selalu punya potensi berdarah-darah. Itu, konon, tidak dimaui oleh demokrasi.Walau untuk hal ini, kita juga akan merasa bahwa demokrasi sungguh naif dan berwajah ganda. Ketika Amerika Serikat (negara yang mengklaim dan diklaim sebagai kampiundemokrasi)menginvasiAfghanistan, Irak dan Somalia kemarin, dengan mengatasnama bendera demokrasi, maka sesungguhnya demokrasi sudah tidak pantas lagi untuk terus-menerus dipuja-puja. Indonesia pun sudah punya pengalaman buruk soal demokrasi yang melenceng ini. Patut dicatat, substansi yang diinginkan oleh demokrasi itu, seperti keadilan kekuasaan, perlindungan hak asasi manusia dan seterusnya, bukanlah monopoli ajaran dalam demokrasi.Sebelumdemokrasidisebutorang, hal-hal seperti keadilan, perdamaian dan moralitas, sudah menjadi makanan seharihari umat manusia. Islam berada di garis ter-depan untuk hal ini. Jadi, demokrasi dan para pendukung paham ini, tidak punya hak untuk mengatakan seluruh substansi yang diperjuangkannya hanya milik dia dan dia pula yang memulai. Memang, ada trauma sejarah soal perebutan kekuasaan ini. Model kerajaan, atau monarki, disebut-sebut membuat manusia terpisah antara yang disembah dan yang menyembah. Padahal, setiap manusia mempunyai level yang sama. Model kerajaan hidup begitu lama di atas dunia dan karena itu pula ada yang menganggap ini sudah ketinggalan zaman, hanya berlaku bagi manusia zaman dulu yang dianggap orang modern sebagai tidak beradab dan berbudaya. Tapi argumen seperti ini pun lucu juga. Beberapa negara maju di dunia justru memakai bentuk monarki. Inggris merupakan wakil Eropa yang masih konsisten memakai bentuk yangbegini.Rajatidakbolehdipilih,sementara Perdana Menteri dipilih langsung oleh rakyat. Ada dua bos besar, kepala negara dan kepala pemerintahan. Tidak semata Inggris. Negaranegara Timur Tengah kebanyakan juga memakai model ini. Tetangga kita di ASEAN, Malaysia, Brunei Darussalam, Thailand, menerapkanmodelyangsamadenganInggris. Walau dipilih rakyat, namun Perdana Menteri

sebagai kepala pemerintahan wajib menyalam dan menunduk di hadapan raja. Saya kira, entah kompromi akademik yang bagaimana harus menjelaskan ambiguitas ini: di manakah sesungguhnya kekuasaan itu berada? Di atas itu semua, kita sebenarnya hidup dalam tahap yang merisaukan. Sudah sejak 1945 kemarin, moda demokrasi menjadi pilihan.Walau sesungguhnya sebagai generasi penerus yang lahir jauh pascakemerdekaan, kita bisa saja mengajukan gugatan baru mengenai revelansi pilihan para orang tua kita tersebut. Kita layak memertanyakan dengan sungguh-sungguh, benarkah model yang seperti ini telah memberi kita keadilan pembangunan dan kesejahteraan bagi masyarakat luas. Rakyat Indonesia telah berkorban cukup banyak untuk penerapan model demokrasi ini. Agaknya, eksperimen demokrasi yang diberlakukan oleh kaum elit telah membuat kita berkali-kali jatuh di lubang yang sama: keterpurukan. Demokrasi parlementer pernah membuat kabinet jatuh bangun sehingga pembangunan mogok. Demokrasi terpimpin yang diterapkan Soekarno lebih gawat lagi. Adayangbilang,waktuitupolitiktelahmenjadi panglima. Tapi pihak yang kritis malah balik bertanya: politikkah yang menjadi panglima ataukah Soekarno yang menjelma menjadi diktator? Kemudian di era Soeharto, demokrasi justru telah menjadi sistem pembenar bagi kekuasaan represif dan koruptif dari Soeharto. Para lingkar Soeharto yang ingin mendekat ke Soeharto mengatasnamakan rakyat untuk memilih the smiling general ini secara berulang kali. Tapi toh, rakyat juga yang menjatuhkan Soeharto dari kursinya. Sebelumnya, akibat Demokrasi Pancasila yang diterapkan Soeharto,telahmembuatekonomikitaseperti menara gading. Tidak ada ekonom yang tidak sepakat kalau pembangunan sungguh tak merata, hanya dinikmati kaum elit semata. Dalam tulisan ini sebenarnya kita ingin bertanya, adakah demokrasi berdampak riil padamasyarakat?Pemiluyangmenjadiprosedur demokrasi malah semakin tergerus pemilihnya. Dari cukup tinggi di masa pasca Reformasi (Pemilu 1999) kemudian kian lama kian jatuh. Kalau memang semakin banyak yang tidak ingin menyalurkan hak politiknya dalam Pemilu, rakyat memang pantas bertanya tentang urgensi Pemilu. Bila demokrasi tak memersoalkan tingkat partisipasi pemilih, maka akan semakin penting juga sebuah gugatan, apakah pemilu memang boleh dianggaptidakadadantidakdiikuti?Bilaboleh tidak diikuti, lantas apa urgensinya dilaksanakan? Ini pertanyaan kita bagi argumen penyelenggarayanghampirselalusenadamenunjuk telunjuknya pada partisipasi politik di negara-

negara maju, seperti Amerika Serikat, yang memang tidak pernah tinggi partisipasi politiknya.Karenaketiadaanargumensusulan mengenai hal ini, maka seakan-akan benarlah suatu argumen yang mengatakan bahwa Pemilu tak lain hanyalah prosedur tetap demokrasi semata. Apapun yang dihasilkan instrumen demokrasi ini, bukan lagi menjadi masalah besar. Ini menjadi alibi demokrasi ketika kekuasaan yang dihasilkan pasca-Pemilu justru dipegang oleh (kaum) diktator dan otoritarian. Kalau berdemokrasi hanyalah soal dilaksanakannya Pemilu secara periodik, maka kitatakpunyaalasanuntukmenyerangkekuasaan diktator Soeharto selama Orde Baru. Toh, prosedur demokrasi sudah dijalankan. Kita juga menjadi tak punya argumentasi ketika atas nama demokrasi,Vladimir Putin menjadi Presiden Rusia, Perdana Menteri dan kemudian memenangkan pemilihan presiden kembali. Semua, toh, dilakukan atas nama demokrasi. Bila kita menganggap “demokrasi” ala Rusia tidak benar, lalu siapakah yang benar? Apakah demokrasi ala Amerika Serikat yang membenarkaninvasikenegaralainatasnama demokrasi? Kita melihat hal ini terus terjadi pascareformasi. Karena itu, menarik bila kita melayangkanpertanyaanbesarnya:masihkah demokrasi dianggap penting? Orang-orang mengatakan soal pembatasan kekuasaan dan perlindungan terhadap rakyat. Kekuasaan harus dikendalikan oleh sistem dan rakyat mesti menjadi pengadil utama. Kita setuju soal itu, tapi lagi-lagi agak geli membaca itu. Pasalnya, kita justru dihadapkan pada fakta yang bertolak belakang dengan itu. Misalnya saja soal dinasti politik. Setelahsisuamiberkuasa,makagiliranistrinya, kemudian anak, sepupu, menantu dan punya hubungan kekerabatan dengannya. Demokrasi tidak punya jawaban soal itu karena siapapun yang maju ke pentas pemilihan punya hak politik yang sama bukan? Di Amerika Serikat saja pernah ada Dinasti Kennedy, Dinasti Bush, kok. Semut Dan Lebah Ini bukan soal fatalis melihat kondisi sekarang.Bagaimanapun,sistemdemokrasihingga kini masih kita sepakati. Ini wajib untuk kita hormati.Tapi tentu, ijtihad untuk terus-menerus menemukan model yang baru dan bernas untuk kehidupan berbangsa dan bernegara yang semakin kompleks yang semakin mendekatkan kita pada cita-cita kemerdekaan dulu, janganlah pernah dihentikan. Bila kita tidaksudahtidakmampulagiberijtihad,maka lebihbaikkitabertanyasajakepadaparasemut dan lebah. Penulis adalah Staf Pengajar FISIP UMSU.


Agenda

B8 06:00 GO SPOT 07:30 Dahsyat 10:30 INTENS 11:00 SILET 12:00 SEPUTAR INDONESIA SIANG 12:30 BUKA - BUKAAN 14:00 Indonesian Idol 16:00 CEK AND RICEK 16:30 SEPUTAR INDONESIA 17:00 CINTA ANAK CUCU ADAM 19:15 ANAK - ANAK MANUSIA 21:00 TUKANG BUBUR NAIK HAJI THE SERIES 22:30 Box Office Movie

CATATAN

06:30 SL Inbox 08:45 Halo Selebriti 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:30 Liputan 6 Petang 17:00 Get Married The Series 2 18:15 Diam-Diam Suka 19:45 Tiba-Tiba Cinta 21:00 Emak Ijah Pengen Ke Mekah 22:30 I Like This

07:00 Animasi Spesial 07:30 Animasi Spesial 08:30 Mister Maker Comes To Town 1 09:00 Pose 09:30 Layar Unggulan 11:00 Diantara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 14:00 Tuntas 14:30 Lintas Petang 15:00 Animasi Spesial 16:30 Animasi Spesial3 17:30 Tendangan Si Madun Returns 18:30 Mnctv Sport Platinum-1 21:00 Raden Kian Santang 22:00 Suka-suka Uya 23:30 Cerita Pilihan 00:30 Midnite Great Sale 01:00 Lintas Malam

08:25 Curious George 08:55 Gon 09:25 Little Krisna 11:25 Topik Siang 11:55 Seputar Obrolan Selebriti 12:55 Mr. Bean 13:25 Tom & Jerry 13:55 Bima Sakti 14:25 Little Krishna 14:55 Bernard Bear 15:25 Curious George 15:55 Gon 16:25 Marsha & The Bear 16:55 Pesbukers 19:25 Campur-Campur 20:25 Pesbukers Best Of The Best 21:55 Sinema Spesial 23:55 Cakrawala

07:30 Semarak Sinema Spesial 08:30 Sinema Pagi 10:30 Live Kiss Pagi 11:30 Live Patroli 12:00 Sinema Pintu Taubat Siang 14:00 Hot Kiss 15:00 Live Fokus 15:30 Trending Topic 16:30 Berani Nekat 17:00 New Famili 100 18:00 Audisi D’Academy 20:00 Sinetron Unggulan : Bara Bere 21:00 Sinetron Unggulan 22:00 Sinema Unggulan

08:05 8 Eleven Show 12:00 Metro Siang 13:00 Wideshot 17:00 Metro Hari Ini 18:00 Prime Time News 19:30 Lebih Dekat 20:05 Mata Najwa 21:30 Otoblitz 22:00 Top 9 News 2 2 : 3 0 St a n d Up Comedy Show 23:05 Realitas 23:30 Metro Sport

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

WASPADA Kamis 24 April 2014

07:30 Saatnya Kita Joged 09:30 Sinema Indonesia Pagi 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:15 Show Imah 16:45 Reportase Sore 17:30 Oh Ternyata 18:30 Slide Show 19:30 YKS 22:30 Bioskop TransTV 01:00 Reportase Malam

07:00 Live News Apa Kabar Indonesia Pagi 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Ruang Kita 14:30 Live News Kabar Pasar 15:30 Live News Kabar PEMILU 16:30 Sorotan Kasus 17:00 Live News Kabar Petang 19:00 Meja Bundar 20:00 Live News Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Menyingkap Tabir 22:30 Kabar Arena

08:00 Kungfu Panda 08:30 Chuggington 09:00 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Siang Seru Sama Sule 14:00 Seleb On Cam 14:30 Spot On 15:00 Fokus Selebriti 15:30 Lawan Tawa 16:30 Ada Ada Aja 17:30 Spongebob Squarepants 19:00 Big Movies 21:00 Big Movies 23:00 Big Movies

07:30 Selebrita Pagi 08:15 Spotlite 09:15 Syafa’at 10:00 Ceplas Ceplos LIVE 11:30 Redaksi Siang 12:00 Selebrita Siang 12:45 Laptop Si Unyil 13:15 Bocah Petualang 13:45 Dunia Binatang 14:15 Tau Gak Sih 14:45 Mancing Mania 15:15 Jejak Petualang 15:45 Orang Pinggiran 16:15 Redaksi Sore 17:00 Opera Van Java 18:30 Hitam Putih 19:30 On The Spot 20:30 CCTV 21:15 ILK (Indonesia Lawak Klub) 22:15 Bukan Empat Mata 23:30 Dua Dunia 01.00 Redaksi Malam **m31/G

Vokalis Samsons JagokanVirzha

Virzha

Semakin banyak saja masyarakat memprediksi Nowela, dan Virzha akan bertarung di babak Grand Final Indonesian Idol 2014 nanti. Tidak terkecuali, vokalis band Samsons, Aryadinata. Vokalis menggantikan posisi Bams itu mengaku kepincut dengan karakter, dan kemampuan bernyanyi Virzha berasal dari Aceh. “Gue suka Virzha, dia penyanyi punya karakter, asyik dilihatnya,” ujar Aryadinata saat dijumpai di Studio 1 RCTI, Jakarta, Senin (21/4). Arya juga berharap, jagoannya tersebut akan masuk babak Grand Final, dan keluar sebagai juara. “Kalau saya lihat, Virzha supporter-nya banyak, dan dia berkualitas. Saya menilai dia akan masuk Grand Final nantinya,” tutup dia. Laga Indonesian Idol 2014 semakin memanas setelah pada pekan lalu Gio akhirnya harus angkat koper. Kini, peserta tersisa tinggal Virzha, Nowela, Husein, Yuka, dan Ubay.(okz)

The SIGIT

The SIGIT Siap Getarkan Publik Medan THE SIGIT salah satu band indie Indonesia sudah dikenal di Indonesia bahkan luar negeri seperti Australia, Jepang dan Eropa akan melakukan konser eksklusif pertamanya di kota Medan. Setelah lama dinanti-nanti kehadirannya, PT Gelora Djaja selaku sponsor acara akan mengemasnya dalam satu acara yaitu FUNATIC MUSIC. Acara ini berlangsung Jum’at (25/4) di Pardede Hall Medan mulai

pukul 19.00. Event FUNATIC MUSIC ini akan bertemakan Adrenaline Fun, sangat cocok dengan genre music dari THE SIGIT. Lewat lagunya tak asing lagi ditelinga penggemarnya yaitu Horse, Black Amplifier, Clove Doper, atau Soul Sister siap menghentak kota Medan. “Event ini diadakan sebagai bentuk apresiasi untuk anak muda kota Medan dan sekitarnya yang fanatik dengan kreati-

vitas khususnya dalam bermusik. The SIGIT kami pilih karena memang sudah banyak yang menantikan aksi panggung mereka. Juga prestasi mereka yang sukses tour konser di luar negeri seperti Australia dan Jepang baru-baru ini kiranya bisa menyebarkan virus positif dalam bermusik kepada anak-anak Medan” ujar Romanus Depari, Area Marketing Manager Medan, PT.Gelora Djaja. Tak hanya THE SIGIT, event

FUNATIC MUSIC juga akan menampilkan band Hardcore kebanggaan kota Medan yaitu Fingerprint, aksi special DJ Rico dan MSB Breakers. Untuk pembelian tiket bisa di distro/clothing dan studio musik kota Medan seperti Tauko Medan,Victory, Rockmen, Snug, Store, Lockers, Rumah Sepatu, Invisi-ble, Faithful, Mitha, Kirana dan The Insurgent Army Medan (The Sigit Fans Club).(m19)

Efek Keramahan Raisa Penyanyi Raisa mengatakan menjadi pribadi yang ramah membuat dia bahagia dan membantunya meraih sukses. “Sebagai orang memiliki kepribadian yang ramah, aku sangat percaya bahwa dengan menunjukkan sikap bersahabat pada semua orang, maka kebahagiaan dan kesuksesan akan menyertai diri kita dengan sendirinya,” katanya dalam konferensi pers di Jakarta, Selasa. Menurut penyanyi kini menjadi bintang iklan beberapa produk itu, keramahan adalah salah satu bentuk apresiasi terhadap dukungan orang lain kepada dia dan karirnya. Raisa juga mengatakan bahwa dia berhasil mencapai posisinya saat ini dengan tekad kuat, kerja keras dan optimisme. “Dengan tekad dan kemauan keras untuk selalu belajar dan mencoba hal baru, aku bisa mencapai posisi seperti sekarang,” kata Raisa.

Guardians of the Galaxy

Film Guardians of the Galaxy Menuai Kritik Film Guardian of the Galaxy produksi Marvel Studio dikritik analis film seperti permainan judi ketika film itu memasukkan kasting asli karakter tidak sesuai dengan publik bukan pembaca komik tidak seperti produksinya Iron Man, Thor dan Captain America menjadi hit. Guardians of the Galaxy dibintangi Zoe Saldana bintang film Avatar, Chris Pratt aktor film Parks and Recreation, Bradley Cooper pemeran film Ame-

rican Hustle, Dave Bautista (WWE) danVin Diesel. Produksi ini juga menonjolkan Lee Pace, Michael Rooker, Karen Gillan, Djimon Hounsou, John C Rilley, Glenn Close, Ophelia Lovibond, Peter Serafinowicz dan Benicio Del Toro dengan sutradara James Gunn dirilis Agustus mendatang. Chris Pratt, Zoe Saldana dan Dave Bautista sangat menonjol dalam gambar-gambar bersama tim kapal Milano. Detail film

Marvel digarap James Gunn ini juga ditulis dalam artikel USA Today. Film ini memadukan berbagai konsep dan lokasi dari komik Guardian karya Dan Abnett dan Andy Lanning. Tim melarikan diri dari Kyln, satu penjara intergalaktik dibangun untuk mengembangkan dunia dan melarikan diri ke Knowhere, bosnya dewa ruang angkasa dan kumpulan binatang liar dipimpin Collector diperankan Benicio Del Toro. Me-

reka dikejar Ronan dimainkan Lee Pace dan Nebula digawangi Karen Gillan setelah menghancurkan kekuatan Star-Lord dilakoni Pratt dapat membinasakan galaksi. Produksi Marvel terpusat pada cerita seorang pilot Amerika bernama Peter Quill bergabung dengan sekelompok superhero setelah mencuri bola penuh kekuatan dipegang bandit Ronan dimainkan Lee Pace, demikian Digitalspy. Nur

Raisa

Gerbang KDI 2014 Dimulai

Julia Roberts/newsplies.com

Julia Roberts Tentang Kematian Saudara Tirinya Aktris Julia Roberts akhirnya buka mulut tentang kematian saudara tirinya, Nancy Motes. Motes,37 meninggal Februari silam ditemukan paramedis di lantai kamar mandi di sebuah rumah di Los Angeles dengan obat-obatan di sekitar tubuhnya, kata Kantor Coroner County LA. Dia dikabarkan meninggalkan pesan bunuh diri tempat dia menulis tentang keterasingannya dalam keluarganya. Seperti dikutip dari Hollywood Reporter, saat keluarga mengeluarkan pernyataan setelah kematiannya bahwa mereka terkejut dan hancur, Roberts tetap bungkam. Namun dalam sebuah wawancara diterbitkan dalam WSJ Magazine, Roberts ditanyai tentang kematian Motes. Penulis mengatakan bahwa wajahnya mengeras dan dia mulai menitikkan air mata. “Itu menghancurkan hati,” kata dia. “Ini baru 20 hari. Tidak ada kata-kata yang bisa menjelaskan apa yang kami alami dalam 20 hari terakhir. Tapi kamu harus terus menatap ke depan. Kamu tidak ingin sesuatu buruk terjadi pada siapa saja, tapi ada banyak hal tragis dan menyedihkan yang tidak dapat dijelaskan terjadi di dunia. Tapi dengan situasi penuh tantangan dan rasa putus asa, kami harus menemukan jalan, sebagai keluarga. Sungguh sulit merumuskan kalimat tentang itu selain keluarga saya yang penuh air mata.”(ant)

Usai berlangsungnya audisi Kontes Dangdut Indonesia (KDI) 2014 di enam kota yakni Makassar, Yogyakarta, Surabaya, Medan, Jakarta dan Bandung, 36 Kontestan Gerbang KDI 2014 telah berkumpul di Jakarta untuk mengikuti tahapan seleksi selanjutnya yakni Gerbang KDI 2014. Adapun Gerbang KDI 2014 berlangsung mulai Senin (21/ 4) hingga Jumat, (27/4) disiarkan langsung dari Studio 3 MNCTV pukul 18.00. Di setiap episode, enam calon kontestan dari berbagai kota audisi secara acak akan tampil dan menunjukkan

penampilan terbaiknya untuk mendapatkan dukungan sebanyak-banyaknya dari Pemirsa MNCTV agar terpilih menjadi kontestan KDI 2014. Enam orang tampil di episode perdana Gerbang KDI 2014 antara lain adalah Ita (audisi Surabaya), Syamsir (audisi Yogyakarta), Thalia (audisi Jakarta), Nita (audisi Yogyakarta), Yanti (audisi Makassar) dan Wangi (audisi Bandung). Enam kontestan Gerbang KDI 2014 membawakan lagulagu dangdut telah populer. Ita membawakan lagu Jera dipopulerkan Elvy Sukaesih. Seda-

ngkan Thalia menyanyikan tembang Melayu berjudul Laila Canggung. Sementara Nita wakil audisi Yogyakarta membawakan lagu Sejuta Luka. Tak ketinggalan Yanti juga memberikan penampilan terbaik melalui lagu Sang Pujangga dan Syamsir, satu-satunya kontestan pria dalam episode ini akan membawakan Gembala Cinta. Penampilan enam calon kontestan ini mendapat komentar dari para penasihat terdiri dari Elvy Sukaesih, Jaja Miharja, Ikke Nurjanah, Bertha dan Purwacaraka. Dipandu host Okky Lukman, Valen ‘Jebret’, Nassar dan

Ayu Lia. Acara makin meriah dengan kehadiran para senior KDI yakni Maya dan Selfi (KDI 1), Nurdin dan Rahman (KDI 4) serta Fika (KDI 6). Dua orang dengan dukungan sms tertinggi yaitu Ita (Audisi Surabaya) dan Syamsir (Audisi Yogyakarta) berhasil lolos ke Kontes KDI 2014. Sedangkan Thalia (Audisi Jakarta) merupakan satu dari empat orang pilihan penasihat diberikan Wild Card dan akan kembali unjuk kemampuan di Gerbang Wild Card Jumat, 27 April 2014.(m19)

Susah makan Raisa mengaku sempat susah makan saat masih duduk di Taman Kanak-kanak. Agar mau makan, ia mengatakan sering disogok es krim oleh ibunya. “Dari kecil aku enggak suka makan. Ibuku waktu itu nyogok makan aku sama es krim. Jadi dari kecil es krim itu udah jadi sogokan ibuku,” ujarnya. Raisa mengatakan sejak kecil memang gemar mengonsumsi es krim. Kesukaannya pada makanan ini pun berlanjut hingga dewasa. Dalam seminggu ia mengaku hampir selalu mengonsumsi es krim. “Dalam seminggu aku pasti makan es krim. Yang aku suka dari es krim pasti teksturnya, karena kalau rasanya enak tapi teksturnya kurang kayaknya tetep aja kurang enak. Terus aku suka lapisannya yang crunchy,” akunya. Menurut Raisa, mengonsumsi es krim adalah salah satu cara memberi hadiah pada diri sendiri. “Kalo aku duduk, sambil hang out sama temen-temen terus makan es krim, ngerasa dimanjain, tenang,” katanya. Raisa pun tersanjung saat terpilih menjadi duta merk salah satu produk es krim. “Aku merasa naik kelas karena bisa terpilih sebagai brand ambassador. Aku tersanjung juga cukup ge-er,” kata Raisa.(ant)

Tom Hank

Tom Hanks Bintangi Thriller Perang Dingin

Kontes Gerbang KDI 2014

Tom Hanks akan kembali bekerjasama dengan sutradara Steven Spielberg dalam film thriller mengenai Perang Dingin. Aktor peraih Oscar ini akan membintangi proyek Perang Dingin belum diberi judul dan skenarionya ditulis Matt Charman diproduseri Marc Platt tersebut. Film ini diangkat dari kisah nyata James Donovan, pengacara yang masuk ke pusaran Perang Dingin ketika merundingkan pembebasan Gary Powers, pilot pesawat mata-mata U-2 yang ditembak jatuh Uni Soviet. Jika jadi digarap maka ini adalah kemitraan keempat Hanks dan Spielberg setelah Saving Private Ryan, The Terminal, dan Catch Me If You Can. Namun mereka berdua juga pernah sama-sama memproduseri mini seri Band of Brothers.(ant)


Ekonomi & Bisnis

WASPADA Kamis 24 April 2014

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.697 9.370 10.961 16.218 3.235

Beli 11.533 9.120 10.662 15.874 2.968

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.645 9.271 10.814 16.124 3.133

KURS BI

KURS BANK BNI

KURS BANK BCA

KURS BANK MANDIRI

Beli 11.595 9.221 10.744 16.044 3.063

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.740 9.533 11.047 16.275 3.293

Beli 11.540 9.8.93 10.547 15.775 2.893

Mata Uang Jual Dolar AS 11.648 Dolar Singapore 9.273 Dolar Australia 10.847 Euro 16.097 Real Arab Saudi 3.105

Beli 11.532 9.174 10.735 15.934 3.074

Antara

HARI KONSUMEN NASIONAL Wakil Presiden Boediono (kanan) didampingi Mendag Muhammad Lutfi (kedua kanan) berbincang dengan Direksi GarudaFood Group Fransiskus Johny (kedua kiri) dan Corporate Communications & Relation Departement Head GarudaFood Group Dian Astriana (kiri) ketika mengunjungi stan GarudaFood di acara puncak peringatan Hari Konsumen Nasional Tahun 2014 di Jakarta, Rabu (19/ 4). GarudaFood Group mendukung gerakan Hari Konsumen Nasional.

Indonesia Tuan Rumah Penjurian Karya Cipta Para Pengrajin JAKARTA (Waspada): Untuk pertama kalinya Indonesia ditunjuk menjadi tuan rumah penjurian World Crafts Council (WCC) Award of Excellence for Handicrafts. WCC Award merupakan penghargaan bergengsi di tingkat internasional terhadap hasil cipta para pengrajin yang dapat menghasilkan karya yang unggul. “Penunjukkan ini merupakan bentuk penghormatan dunia kepada bangsa Indonesia atas kemampuan kita dalam menyelenggarakan acara berskala internasional,” kataWakil Menteri Perdagangan Bayu Krisnamurthi, diajang pameran Inacraft Indonesia di Jakarta, Rabu (23/4). WCC Award of Excellence for Handicrafts baru diluncurkan di kantor Kementerian Perdagangan, Jakarta, Selasa 22 April 2014. Acara peluncuran tersebut dihadiri oleh berbagai perwakilan komunitas atau lembaga/yayasan yang membina kerajinan. Yakni perwakilan UNESCO Jakarta, Ketua Komite Nasional Indonesia untuk UNESCO, dan perwakilan Indonesia National AHPADA Chapter. Menurut Bayu, WCC Award bertujuan

menciptakan karya yang unggul (excellent), baik dalam kualitas, desain, keaslian, dan inovasi, sehingga dapat menjaga keberlangsungan warisan budaya. Dalam penjurian ini pihak Kemendag akan bekerjasama dengan Dewan Kerajinan Nasional (Dekranas). Sementara itu, 29 pengrajin dari kelompok usaha mikro, kecil, dan menengah yang memiliki potensi bisnis menjanjikan akan berunjuk produk di ajang pameran kerajinan terbesar Inacraft Indonesia, yang dimulai dari 23-27 April 2014. Ke 29 pengrajin ini merupakan mitra binaan dari Bank Negara Indonesia (BNI) yang diajak untuk memamerkan produk-produk kerajinan bermutu dengan harapan akan terbuka pasar baru bagi pengembangan bisnis kerajinan mereka. Perhelatan tahunan ini dibuka secara resmi oleh Presiden Susilo Bambang Yudhoyono yang juga berkesempatan hadir mengunjungi stand Mitra Binaan BNI. Hadir juga pada kesempatan tersebut Direktur Utama BNI Gatot M Suwondo dan Wakil Direktur Utama BNI Felia Salim. (j03)

Pengetahuan Bidang Keuangan MasyarakatIndonesiaTerendahDiAsia

Manajemen Penyimpanan Beras Bulog Belum Maksimal JAKARTA (Waspada): Menteri Pertanian Suswono, Rabu (23/4), berpendapat semakin menurunnya kualitas beras untuk rakyat miskin (Raskin) yang didistribusikan Perum Badan Urusan Logistik (Bulog) kepada masyarakat, akibat manajemen penyimpanan beras yang diterapkan Hasil evaluasi Komisi Pemberatasan Korupsi (KPK) terhadap penyaluran Raskin menemukan bahwa beras yang disalurkan tidak sesuai dengan standar kualitas beras medium, seperti berbau apek, berkutu,

B9

belum maksimal. berwarna kuning. Akibat beras yang tidak tepat kualitas, beras Raskin justru lebih banyak dijual kembali oleh penerima, sehingga menciptakan praktik pemburuan rente. Menurut Suswono, manaje-

Konsumsi BBM Untuk PLN 1,84 Juta KL JAKARTA (Waspada): PT PLN (Persero) mencatat konsumsi Bahan Bakar Minyak (BBM) untuk memenuhi kebutuhan pembangkit listrik pada kuartal pertama 2014 mencapai 1,84 juta kiloliter (KL). Kepala Divisi BBM dan Gas PLN Suryadi Mardjoeki, di Jakarta, Rabu (23/4), mengatakan volume tersebut sedikit lebih tinggi dibandingkan periode sama 2013 sebanyak 1,77 juta KL.”Kenaikan (3,95 persen) pemakaian BBM ini dikarenakan antara lain peningkatan penjualan listrik,” katanya. Di tambah lagi, menurut dia, sejumlah pembangkit listrik terutama di Medan, Sumut masih mengalami kekurangan gas, sehingga mesti diganti dengan BBM. Konsumsi BBM pada kuartal pertama tersebut merupakan 28,75 persen dari target 2014 sebesar 6,4 juta KL. Pada 2013, pemakaian BBM PLN mencapai 7,4 juta KL. Selain Medan, konsumsi BBM terbesar lainnya adalah Bali. Untuk gas, lanjut Suryadi, konsumsi sampai Maret adalah 109,8 triliun British thermal unit (TBTU) atau naik 12,8 persen dibandingkan periode sama 2013 sebesar 97,3 TBTU. “Kenaikan konsumsi gas terutama di Jawa terutama berasal dari FSRU Jabar,” katanya. (ant)

men penyimpanan beras yang baik diperlukan. Karena saat ini beras yang digunakan untuk Raskin sebenarnya sudah sesuai dengan standar. “Itu SNI 4, jadi relatif cukup baik. Apalagi, pemerintah mengganti beras Raskin cukup banyak, hampir Rp8.000-an. Jadi, beras ini relatif cukup baik kualitasnya dengan kadar air 14 persen kalau tidak salah,” ungkap Suswono, saat ditemui di Kementerian

Keuangan, Jakarta. Suswono mengakui, menyimpan beras, apalagi dalam waktu yang cukup lama bukan hal yang mudah. Selain itu, biaya yang dikeluarkan tidak murah. Meskipun dari sisi harga, biaya tersebut telah dimasukkan dalam harga yang ditetapkan. Ke depannya, lanjut Suswono, karena saat ini Bulog semakin banyak menyerap beras dari

produksi nasional, persediaan yang disimpan adalah dalam bentuk gabah. Sehingga kualitasnya dapat lebih baik ketika disalurkan. Selain itu, Unit Pengolahan Gabah dan Beras (UPGB) yang ada di Bulog dapat dimaksimalkan untuk menjaga kualitas beras. “Sehingga, beras yang dibagikan relatif fresh dibandingkan yang disimpan di gudang lebih dari enam bulan,” ujarnya. (vvn)

Samsung Luncurkan TV Melengkung Pertama Di Indonesia JAKARTA (Waspada): PT Samsung Electronic Indonesia (SEIN) menghadirkan televisi Curved UHD TV HU9000 dengan desain panel melengkung ke dalam pertama di Indonesia. “Samsung selalu membuat inovasi terbaru dengan TV panel melengkung. Dan ini baru Samsung punya,” kata Dirut PT Samsung Electronic Indonesia Yooyoung Kim pada acara peluncuran Curved TV di Jakarta, Rabu (23/4). TV dengan ukuran yang cukup besar yakni 55 inci dan 65 inci ini memiliki teknologi yang cukup canggih dibuat dengan radiu 4,2 m yang merupakan ukuran kelengkungan TV paling ideal dalam menonton TV. “Konsumen bukan saja mendapatkan standar yang tinggi tetapi juga mendapat pengalaman menonton seperti di dalam bioskop,” tegas Kim. Sementara itu, Senior Product Manager Samsung Ubay

Bayanudin mengatakan, dalam Curved TV ini dilengkapi teknologi ultra high defenition (UHD) upscalling, Purcolor dan future ready. ‘’Dengan adanya teknologi UHD Upscalling dimana detail tayangan melalui proses upsalling dengan 4 langkah sehingga dalam menyajikan gambar yang jelas dan sama dengan aslinya,’’ tambahnya. “Proses upscalling 4 langkah ini akan menganalisai gambar asal, menghilangkan noise kemudian mengupcale konten sumber menjadi gambar bersolusi UHD dengan detail dan lebih jelas,” tegasnya. Sementara untuk Purcolor, menurut Ubay, teknologi ini mereproduksi warna sealami. Mungkin dengan meminimalisir hilangnya elemen warna dan mampu mengekspresikan warna yang lebih akurat. Bila 2013 lalu, TV memiliki 27 point untuk warna, namun di TV yang baru ini sudah mempunyai 192 point

atau meningkat sekitar 70 kali lipat. Sedangkan untuk future ready, tambah Ubay, menyediakan standar penyiaran UHD melalui one connevt box yang mudah dipasang dan dilepas. Inovasi ini didukung hardware yang sudah terupgrade termasuk CPU, GPU, Momory dan piranti lunak lainnya. “Jadi para konsumen akan lebih nyaman untuk menonton dan TV juga bisa di up date setiap tahun.” Ubay juga menambahkan, dengan desain lengkung yang dilengkapi juga fitur depth Enhancer membuat pemirsa merasa seolah- olah menjadi bagian dari tayangan film yang ditonton. Apalagi gambar yang tajam dengan memiliki 8 juta piksel atau 4 kali lebih banyak dari piksel selama ini. Harga Samsung Curved ini untuk ukuran 55 inci dijual sekitar Rp69,99 juta per unit dan untuk ukuran 65 inci di jual sebesar Rp 89,99 juta unit.(J03)

Berkeliling Ke Rumah Warga Mengangkut Sampah Waspada/Sugiarto

Regional Head Smartfren Sumbagut Jefry Batubara (kanan) memperlihatkan produk terbaru.

Smartfren Targetkan Kuasai Pasar Smartphone MEDAN (Waspada): PT Smartfren Telecom Tbk menargetkan menguasai pangsa pasar smartphone terlaris dengan angka penjualan sekitar 50 ribuan hingga kuartal pertama tahun ini. Hal ini ditunjukkan Smartfren dengan merilis empat produk smartfren terbaru yakni Andromax C2, G2, i3 dan i3S, di Medan, Selasa (22/4). Regional Head Smartfren Sumbagut Jefry Batubara mengaku, sampai kuartal pertama tahun ini Andromax merupakan salah satu smartphone terlaris di tengah kompetisi dengan vendor ponsel asing. “Meski permintaan tinggi namun Smartfren masih bertahan dengan harga jual yang terjangkau, namun tetap dengan kualitas prosesor tinggi serta desain lebih elegan,” ujarnya seraya mengatakan, produk yang baru diluncurkan tahun ini, harga jual yang dibanderol mulai Rp749 ribu hingga Rp1,5 juta. Jefry menjelaskan, untuk kesemua seri terbaru itu, smartfren membenamkan teknologi tercanggih dari Qualcomm, yakni teknologi snapdragon audio+ guna meningkatkan output suara yang dihasilkan serta snapdragon quickcharge yang mampu membuat proses pengisian baterai 30 persen lebih cepat. Smartfren juga meluncurkan produk Mobile Broadbandnya, diberi nama Mini Router Smartfren Connex M1 yang memiliki kemampuan sebagai wireless storage dan juga power bank dengan kapasitas 4400 mAH. (m41)

UDARA Kota Medan begitu gerah sejak pukul 11:00. Panah hari itu bahkan mencapai angka 33 derejat celcius. Namun seorang lelaki berusia 58 tahun itu bersemangat dan terus bergerak dari rumah ke rumah warga di Kelurahan Petisah Tengah, memungut sampah. ‘’Tidak ada kata menyerah. Bahkan saya bersyukur kepada Allah, papar Tamamul Akhyar, saat bertemu Waspada di Jln. Sriwijaya, Selasa (22/4). Dengan sepeda motornya, Tamamul, membonceng tong sampah. Setiap hari sampah dari lebih kurang 1000 rumah dia angkut. Sejak pukul 07:00, ayah empat anak itu mulai ke luar rumahnya di Jln. Lembaga PemasyarakatanTanjung Gusta. Dia mengangkut sampah dari rumah masyarakat di Jln. Gajah Mada, Jln. Rotan, Jln. Maja Pahit dan kawasan Perpustakaan Medan. Tamamul Akhyar, sudah 18 tahun bekerja sebagai mengangkut sampah, di bawah koordinasi Dinas Kebersihan Kota Medan. Ke empat anaknya kini sudah berumah tangga, dua diantaranya merantau ke Jakarta. Sementara putra kedua-

nya sudah bekerja sambil melanjutkan kuliah di salah satu perguruan tinggi di Jakarta. “Mungkin dia akan diwisuda akhir bulan ini,’’ kata Tamamul. Bekerja sebagai pengangkut sampah, Tamamul, mengaku memperoleh gaji 1.650.000 per bulan dari Dinas Kebersihan. ‘’Cukup tidak cukup, yang penting ada pekerjaan,’’ katanya.

Dia tidak menampik, terkadang ada juga pemilik rumah yang iba melihatnya bekerja. Kadang-kadang mereka memberikan uang. Ada Rp 10.000, ada juga yang memberikan Rp 20.000. ‘’Alhamdulillah. Saya masih sehat dan masih bisa bekerja. Yang penting bisa mendapatkan uang halal,’’ kata Tamamul. * Abdullah Dadeh

Waspada/Abdullah Dadeh

Tamamul Akhyar dengan tong sampah di sepeda motornya berkeliling dari rumah ke rumah untuk mengangkut sampah ke tempat penampungan terakhir.

JAKARTA (Waspada): Fungsi Otoritas Jasa Keuangan (OJK), selain menjadi regulator, pengawas perbankan, pasar modal, dan Industri Keuangan Non Bank (IKNB), juga harus sesuai dengan UU No. 21 Tahun 2011. “Terkait dengan edukasi dan perlindungan konsumen, sebagian besar masyarakat belum memiliki informasi yang memadai mengenai layanan dan produk lembaga keuangan formal,” ujar Direktur Literasi dan Edukasi OJK Agus Sugiarto, saat ditemui di acara Gerakan Nasional Literasi Keuangan Indonesia 2014 di Surabaya, Rabu (23/4). Agus menyebut, masyarakat Indonesia umumnya yang memiliki akun lembaga bidang keuangan, pengetahuannya masih sangat minim. Terendah di Asia. Dari persentase, Indonesia memiliki 20 persen pada urutan terakhir di bawah Filipina yang memiliki 27 persen pengetahuan bidang keuangan. “Dengan Thailand dan Malaysia, yang masing-masing memiliki tingkat pengetahuan bidang keuangan 75 persen dan 66 persen, Indonesia masih kalah jauh. Juga dengan India yang mencapai 35 persen. Apalagi dengan Singapura, yang tingkat pengetahuan bidang keuangannya mencapai 96 persen,” ujar Agus. Besaran persentase ini, Agus melanjutkan, membuat perlindungan pada konsumen keuangan ditandai dengan tingginya pengaduan konsumen keuangan belum optimal. Kondisi ini memunculkan lima permasalahan utama, yaitu informasi yang asimetris, perlakuan yang

tidak adil, dan kualitas layanan yang tidak memadai. “Termasuk, di antaranya penggunaan data pribadi konsumen serta kurang efektifnya penanganan pengaduan,” katanya. Untuk diketahui, pada 22 November 2011, saat UU OJK disahkan, pengawasan pasar modal dan IKNB masih berada di Bapepam-LK dan pada 31 Desember 2012, pengaturan dan pengawasan pasar modal dan IKNB beralih ke OJK. “Dalam hal ini, UU Bank Indonesia mengamanatkan pembentukan lembaga pengawasan sektor jasa keuangan. Kemudian, pada 1 Januari 2014, OJK mulai beroperasi secara penuh,” jelas Agus. Sebagai catatan, transisi dari BI dan Bapepam-LK ke OJK meliputi transisi kewenangan SDM, dokumen, dan penggunaan kekayaan. Sementara itu, OJK terbentuk sebagai respons atas kompleksitas di sektor jasa keuangan. Meliputi perkembangan sistem keuangan dan permasalahannya. Sementara itu, visi dari OJK adalah menjadi lembaga pengawas industri jasa keuangan, melindungi kepentingan konsumen, dan mewujudkan industri jasa keuangan sebagai pilar perekonomian nasional. Misi OJK dibagi menjadi tiga, yaitu mewujudkan terselenggaranya seluruh kegiatan di sektor jasa keuangan secara teratur, adil, transparan, dan akuntabel. Mewujudkan sistem keuangan yang tumbuh secara berkelanjutan dan stabil. Selanjutnya, melindungi kepentingan konsumen dan masyarakat.(vvn)

BPJS Ketenagakerjaan Jalin Kerjasama Dengan Kejaksaan Tinggi Sumut MEDAN (Waspada) : Badan Penyelenggara Jaminan Sosial (BPJS) Ketenagakerjaan menjalin kerjasama dengan Kejaksaan Tinggi Negeri Sumut, guna meningkatkan efektifitas penanganan masalah hukum bidang Perdata dan tata Usaha Negara baik di dalam maupun di luar pengadilan, Kerjasama bertujuan mengoptimalkan pelaksanaan tugas dan fungsi antara BPJS Ketenagakerjaan dan Kejati Sumut itu dituangkan dalam nota kesepahaman ditandatangani Kepala Kejaksaan Tinggi Sumut Bambang Setyo Wahyudi dan Kepala BPJS Ketenagakerjaan Wilayah Sumbagut Pengarapen Sinulingga, di Kantor Kejaksaan Tinggi Sumut, kemarin. “Kerjasama kita ini berupa, pemberian bantuan hukum pertimbangan hukun dan tindakan hukum lainnya. Pada pelaksanaannya, saat kita butuh bantuan hukum pihak kejaksaan tinggi, BPJS TK lebih dulu menyampaikan permohonan tertulis disertai dokumen-dokumen berkaitan dengan permasalahan yang dimintakan bantuan hukum, pertimbangan hukum dan tindakan hukum lainnya kepada Kejaksaan Tinggi Sumut,” jelas Kepala BPJS Ketenagakerjaan Wilayah Sumbagut Pengarapen Sinulingga. Lebih lanjut dikatakan Pengarapen, kerjasama ini memang perlu dilakukan, mengingat BPJS Ketenagakerjaan merupakan suatu badan hukum publik didirikan berdasarkan hukum dan peraturan perundang-undangan yang

berlaku di Republik Indonesia. Selain itu, berdasarkan Undang-Undang No. 40 tahun 2004 tentang Sistem Jaminan Sosial Nasional (SJSN) dan Undang-Undang no.24 tahun 2011 tentang BPJS memiliki fungsi menyelenggarakan program Jaminan Kecelakaan Kerja, Jaminan Kematian, Jaminan Hari Tua dan Jaminan Pensiun. Sementara berdasarkan Undang-Undang No. 16 Tahun 2004 tentang Kejaksaan Republik Indonesia, Kejaksaan Tinggi Sumut di daerah meliputi daerah Provinsi Sumut memiliki kedudukan menjalankan salah satu fungsi di bidang Perdata dan Tata usaha Negara serta fungsi lain berdasarkan undang-undang. “Untuk menjalankan fungsi itu, kita memandang perlu bekerjasama antara BPJS Ketenagakerjaan dengan Kejatisu. Oleh karena itu, kita buatlah nota kesepahaman ini,” papar Pengarapen seraya menambahkan dalam rangka untuk meningkatkan kompetensi teknis, kedua belah pihak dapat melakukan workshop, seminar sosialisasi serta pendidikan dan latihan. Kepala Kejaksaan Tinggi Sumut dalam acara itu mengenalkan para stafnya yang hadir kepada Kepala BPJS TK Pengarapen Sinulingga dan rombongan, di antaranya, Asdatun I Made Astiti Arjana, As Intek Jaja Subagja dan lainnya. Sedangkan dari BPJS hadir Kepala Cabang Medan Satria Dharma, Kepala Belawan Panji Wibisana, Kepala Binjai Taviv Adrianto, Kepala PemasaranWilayah Sumbagut Rajaswaldi. (m38)

Asus Targetkan 1,5 Juta Unit Terjual JAKARTA ( Waspada): Sukses dengan sejumlah produk andalannya, ASUS kembali meluncurkan smartphone terbaru ASUS yakni Zenfone untuk kawasan Asia Tenggara di Ballroom Hotel Pullman, Jakarta Barat, kemarin. Chairman ASUS Jonney Shih bersama CEO ASUS Jerry Shen dalam acara peluncuran smartphone terbaru menjelaskan. “Fitur utama yang ditawarkan ZenFone yakni PixelMaster, sebuah teknologi kamera yang menjadikan pengambilan foto dan video Waspada/Ist lebih terang walaupun dalam CHAIRMAN ASUS Jonney Shih (kiri) bersama CEO ASUS Jerry Shen kondisi yang minim cahaya sehingga tampilannya terlihat meluncurkan secara resmi kehadiran smartphone terbaru ASUS ZenFone di Ballroom Hotel Pullman, Jakarta Barat, kemarin. eksklusif dan lengkap. Dikatakan, smartphone ini dibenamkan pengguna. prosesor Intel Atom memiliki efisiensi energi “ASUS ZenFone hadir dalam pilihan layar dan kinerja tinggi. “Kami selalu yakin, teknologi berukuran 4 sampai 6 inci dan berbagai pilihan terbaik adalah teknologi yang digunakan orang warna serta seluruh model ZenFone telah banyak. Jadi, saat memulai perjalanan kami dilengkapi lapisan Corning Gorilla Glass 3 untuk dalam ‘in search of incredible’ kami berusaha kehandalan dan daya tahan lebih baik terhadap menghadirkan ponsel paling luar biasa untuk goresan,” jelasnya. dinikmati semua orang,” ujarnya. Untuk ZenFone ada tiga buah yang Selain itu, fitur unggulan yang dibenamkan diperkenalkan dengan harga mulai Rp1.099.000 pada smartphone ini adalah ASUS ZenUI (user untuk ASUS ZenFone 4, Rp2.099.000 untuk interface), ini merupakan tampilan antar muka ASUS ZenFone 5, dan Rp3.099.000 untuk ASUS baru khusus yang dikembangkan berkonsep ZenFone 6. freedom, expression, dan connection. “Secara keseluruhan, Zenfone sampai akhir ZenFone ini tambah Jonney memiliki desain tahun ditargetkan terjual 1,5 juta unit. Produk yang indah dibalut dengan material berkualitas ini diharapkan sudah dapat dipasarkan di tinggi dan fungsionalitas ASUS ZenUI secara seluruh Indonesia paling cepat akhir April ini,” lengkap menghadirkan kemewahan bagi pungkasnya. (m38)


Aceh

B10 Gara-gara Rekannya Yang Tak Mau Mengaji Ditampar Petugas

Napi Rutan Benteng, Sigli Mengamuk SIGLI (Waspada): Ratusan nara pidana, di Rumah Tahanan (Rutan) Benteng, Sigli, Kabupaten Pidie, Selasa (22/4) sekira pukul 09:30 mengamuk. Aksi itu terjadi akibat salah seorang Napi, ditampar petugas Lapas, karena enggan mengikuti pengajian.

Kapolres Pidie, AKBP Sunarya.Sik,kepadaWaspada,membenarkanterhadapkejadiantersebut. Menurut Sunarya, sudah menjadi agenda rutin di Rutan Sigli,setiapSelasadanJumatdigelar pengajian. Semua Napi dan petugas wajib mengikuti kegiatan tersebut. Namun, salah seorang Napi saat itu atas nama Zarmi bin M.JafaraliasGusdur,38wargaSeulimum,AcehBesarkedapatanpetu-

gasLapasatasnamaMuhammad, 47yangmelakukanpatroliberada dalam kamar No 4. Setelah menampar satu kali padapipibagiankiriolehMuhammad. Lalu Muhammad, menemukankembaliseorangNapiatas nama Marzuki bin MTaib, 43, terlambat datang pada pengajian, dan napi bersangkutan duduk persis di pintu masuk Musola. Petugas bernama Muhammad

tersebutpunlangsungmelayangkan tangannya ke muka Marzuki sebanyakduakali,hinggamenyebabkan pelipis sebelah kiri Marzuki terluka. Melihat temannya yang diserang petugas sedang mengikuti pengajian tersebut. Spontan saja semua Napi bangkit dan menyerang petugas Rutan itu, dan aksi keributan di dalam Lapas tidak bisa dihindarkan.

Situasikeributanitubisadinetralisir,setelahsebanyak500anggota polisidarijajaranMapolresdipimpin Kapolres Pidie AKBP Sunarya tibadilokasi.“Pelakudalamproses pemeriksaan dan akan dilakukan penahanan,karenapelakuterbukti melanggarpasal351KUHP.Karena pelakumelakukanpenganianyaan hingga menyebabkan korban mengalami luka memear” demikian AKBP Sunarya. (b10)

Daftarkan Anak Untuk Calon Polisi, Rumah Dilalap Api BIREUEN (Waspada): Nasib Ermawati,37, warga Desa Meunasah Tunong Kec.Peudada, Bireuen. benar-benar menyedihkan. Pasalnya, pada saat dia berangkat ke Banda Aceh untuk mendaftarkan putra pertamanya untuk menjadi calon anggota polisi, dansuaminyamasihmenjadi Tenaga Kerja Indonesia (TKI), rumah tempat tinggalnya bersamakeluargaselamainilangsung rata dengan tanah, setelah dilalap api Selasa (22/4) dinihari. Keluarga tersebut menderita kerugian yang ditaksir mencapai puluhanjuta,untungnyatidakada korban jiwa dalam musibah yang sangat menyedihkan tersebut. Informasi yang diperoleh Waspada Selasa (22/4), rumah konstruksi kayu beratap rumbiya tempat tinggal pasangan MazmiErmawatidananak-anaknyasaat ditinggal pergi terbakar rata dengan tanah yang diduga kuat sumber apinya dari korslet listrik di bagian atap rumah. Menurut keterangan saksi mata,rumahmilikMazmidiketahui terbakar setelah apinya membumbung di bagian atap. Tidak lama warga datang untuk menolongnyayangdisusulmobil pemadam kebakaran milik Pemkab setempat, namun cepatnya api melalapnya sehingga rumah tersebut tidak berhasil diselamatkan. “Saat kami keluar apinya telah membesar di bagian atapnya, Ermawati bersama anak keduanya telah berangkat ke Banda Aceh Senin (21/4) untuk mendaftarkananakpertamanyamenjadi calon anggota polisi,” kata Mahyeddin, 60, dan isterinya Nuarini, 58, orang tua Mazmi. (cb02)

Kasus Korupsi Terkesan Ditutupi LANGSA (Waspada): Banyaknya kasus korupsi dan pidanalainnyayangtidakdapatdilanjutkankemejahijaualiasberhenti di tengah jalan, belum lagi kasus yang terkesan sengaja ditutupi. Hakinisemakinmembuatkesenjangan hukum di negeri ini tampak vulgar, khususnya di Provinsi Aceh. Sesepuh GM FKPPI, Tgk WaylayangbiasadisapaAgustam Efendi pada wartawan mengatakan itu, Rabu (23/4). “Jangan menjadikan panglima sebagai hukum yang harus dipatuhi, tetapi jadikan hukum sebagai panglima. Sehingga kita semuasamadimatahukum,tidak ada perbedaan antara penguasa dan rakyat jelata. Lihat saja, kasus korupsi yang terjadi di Provinsi Acehyangsaatiniterjadisamasekali tidak pernah tersentuh KPK. Belumlagikasus-kasuspidanasaatsaat kampanye yang baru-baru ini dilaksanakan, semuanya mengambang,” sebutnya. GM FKPPI Kota Langsa mengajak para Ormas, OKP, LSM, ulama untuk sama-sama memantau tindakan ketidakadilan yang dilakukan oleh orang-orang yang sedang berkuasa di negeri ini. Jika korupsi tidak ditindak tegas, jelas yang dirugikan tetap masyarakat. (m43)

Kamis 24 April 2014

Miliaran Anggaran JKA Dan Jamkesmas Diduga Raib BIREUEN (Waspada): Miliaran rupiah anggaran Jaminan Kesehatan Aceh (JKA) dan Jaminan Kesehatan Masyarakat (Jamkesmas) 2013 yang kini berubah menjadi Badan Penyelenggara Jaminan Sosial (BPJS) diduga telah raib. Namun belum diketahui dimana dana tersebut raib. Akibatnya para pegawai di RSUD dr Fauziah Bireuen kelabakan dan kebingungan karena sampai sekarang dana tersebut belum mereka terima. Informasi yang diperoleh Waspada dalam beberapa hari terakhir ini, sejumlah pegawai di BLU RSU dr Fauziah Bireuen, mengeluh kepada pihak terkait yang belum menyalurkan anggaran BPJS sampai sekarang ini, padahal, kata mereka dana BPJS tersebut telah dikucurkan sejak Januari lalu. Anehnya sampai sekarang mereka belum menerimanya. Informasi lainnya, miliaran rupiah dana JKA dan Jamkesmas sejak pertengahan 2013 telah raib, buktinya, dana tersebut sampai sekarang belum dicairkan atau belum diterima para awak medis di RS milik Pemkab Bireuen. Para awak medis di RSU tersebut meminta kepada pihak terkait untuk mengusut dimana keberadaannya dan kemana dibawanya dana JKA dan Jamkesmas tahun lalu itu, karena sampai sekarang belum ada kejelasannya. “Dana BPJS itu sampai bulan ke empat TA 2014, belum juga dikucurkan untuk membayar seluruh hak pekerja dilingkunganrumahsakitini,”katasejumlahtenaga medis di RSUD dr Fauziah Bireuen. Menurut keterangan yang dihimpun dari sejumlah petugas medis, dana tersebut sangat besar sehingga menarik bagi oknum-oknum tertentu untuk ’menggelapkan’ oleh sebabnya hal itu perlu penelusuran pihak terkait sehingga terungkap dimana dana yang besar tersebut sekarang berada. Keterangan lainnya, sejak berstatus Badan Layanan Umum (BLU) RSU dr Fauziah, berhak

mengelola seluruh dana program kesehatan nasional maupun daerah yang hanya dicatat sebagai sumber PAD, namun tidak perlu disetor ke kasda. Karena harus digunakan untuk membiayai semua kebutuhan pelayanan kesehatan. “Sampai sekarang insentif sekitar 900 lebih pegawai RSU belum dikucurkan, dana JKA tahun lalu juga masih menunggak dua bulan dan Jamkesmas empat bulan belum dibayar, inilah yang perlupenyelidikanpihakberwajibsupayadiketahui oleh publik kemana dana dan siapa yang telah meraibnya, karena itu dana publik juga,” kata seorang medis yang tidak menyebut namanya. Selama ini, sambung petugas medis lainnya, belum cairnya dana tersebut sampai sekarang ini para awak medis di RSU tersebut terkesan bekerja tanpa dibayar.“Supaya masalah di RSUD menjadi jelas pihak pemkab harus menelusuri atau mengauditnya,” harap mereka. Dirut RSU dr Fauziah, dr Mukhtar MARS, yang dikonfirmasiWaspada, Selasa (22/4), melalui telefon selularnya, menjelaskan, perubahan program Jamkesmas menjadi BPJS dari Departemen Kesehatan(Depkes)RI,memilikitunggakanrealisasi anggaran tahun 2013 lalu sebesar Rp 1,58 triliun untuk seluruh Indonesia. Sehingga semua dana itu kini tersangkut di Departemen Keuangan (Depkeu) RI. Proses pencairan rencananya secara nasional segera direalisasi dalam waktu dekat ini. “Saya sudah mendapat SMS dari Dinkes Aceh meminta RSU dr Fauziah menghitung seluruh tunggakan itu. Sedangkan dana BPJS akan disalurkan dalam pekan ini untuk kebutuhan Januari dan Februari. Namun, akibat belum adanya Pedo-man Pelaksanaan (Manlak), kita harus menunggu PermenkesRItentangpolapembagianjasa,”jelasnya. “Kita berharap dalam waktu dekat, dana BPJS sudah dapat dicairkan. Sedangkan sisa tunggakan tahun lalu, sudah di Depkeu RI menunggu realisasi secara nasional,” tambahnya. (cb02)

Pulang Mencari Ikan, Warga Batubara Tewas Tenggelam Waspada/Muhammad Riza

KAPOLRES Pidie AKBP Sunarya.Sik, sedang berusaha menenangkan napi yang mengamuk di dalam tahanan Rutan Sigli, Selasa (22/4).

Petani Ganja Diberdayakan Ke Tanaman Alternatif BANDA ACEH (Waspada): Dalam penurunan produksi ganja, khususnya di Provinsi Aceh, pihak Badan Narkotika Nasional (BNN)mulaimengimplementasikan program pemberdayaan alternatif dengan melakukan kegiatanpembekalanpetanidalampengembangan komoditi kakao (coklat) dan Nilam. Kegiatan yang diikuti 50 peserta yang menyasar lokasi bekas ganjaseluas15hektaredipusatkan di Desa Mesalee, Kecamatan Indrapuri, Kabupaten Aceh Besar, Selasa(22/4).Inidilakukansebagai menindaklanjuti rapat kerja dalam rangka pemberdayaan alternatif dengan stakeholder beberapa waktu lalu di Indrapuri. BerdasarkanDataP4GNBNN Maret 2014, bahwa sejak tahun 2011 hingga 2013 telah terjadi penurunan signifikan jumlah area ganja yang disita di Indonesia termasuk di Provinsi Aceh. Dimana pada tahun 2011 disita seluas 309 hektar,tahun2012menurunmenjadi 89,5 hektar dan tahun 2013 menurun menjadi 66 hektar. Grafikpenurunanitumenunjukkan kesadaran masyarakat petani di pedesaan khususnya di Provinsi Aceh untuk tidak menanam ganja lagi telah meningkat disamping juga banyak faktor lainnya, disamping semakin gencarnya operasi yang dilakukan aparat berwajib. Hal itu terungkap dalam sambutan Kepala BNN yang di-

bacakan Deputi Pemberdayaan Masyarakat BNN Irjen pol. Drs. V. Sambudiyono, MM dalam acara Pembekalan Petani melalui komoditicoklatdannilamdigedung pertemuan BPP Indrapuri (22/4). Dalam kesempatan itu Sambudiono mengajak petani untuk meningkatkan keterampilan usaha taninya, agar meningkat pendapatan dan mengubah lingkungan dan kawasan Indrapuri menjadi centra produksi nilam dan kakao di Aceh Besar, sehingga diharapkan dapat mengubah image dan citra Indrapuri yang semulamenjadibasispenanaman ganja menjadi centra produksi agroindustri nilam dan kakao. Berdasarkan catatan kepolisian pada operasi ganja, setiap tahun sejak 2012 di Indrapuri teridentifikasi telah terjadi penanaman gelap ganja seluas 2,5 hektar di Desa Mareu, 8 Juli 2012 dan di Desa Meaureu seluas 3 hektar, 2 Februari 2013). Kejadian berulang dan tiap tahun di lokasi yang sama sudah menjadi rahasia umum bahwa lahan ganja tidak mudah dirubah dalam waktu singkat, katanya. Oleh karenanya di tahun 2014, BNN mengajak masyarakat sekitar lokasi basis penanaman ganja untuk mengubah cara berusahatanihanyamengandalkan produk olahan palawija dan padi ini dapat mencoba mengembangkankomoditilainyangmenjanjikan seperti kakao dan nilam.

Disebutkan, Kecamatan Indrapuri salah satu lokasi yang akan diubahmenjadiwilayahkomoditi unggulan kakao dan nilam di kawasan Aceh besar, diikuti 3 lokasi lainnya, Lamteuba, Kuta Malaka dan Montasik. Diharapkan dengan partisipasi aktif dari stakeholder dan masyarakat petani khususnya di wilayah Mesalee yang dalunya dan beberapa tahun lalu masih teridentifikasi terjadi penanaman ganja, ke depan diharapkan masyarakat mulai sadar untuk hidup sehat, halal dan bangga mengembangkan wilayahnya dengan komoditi unggulan berpotensi dapat mendongkrak pendapatannya. Ditambah Sambudiyono, hasilnyatadapatdirasakanpetani dan masyarakat dari program dilaksanakan Badan Narkotika Nasional (BNN) dan Badan Narkotika Nasional Provinsi (BNNP) Aceh, kini di lokasi-lokasi yang diberdayakanBNNdanBNNPtelah tergerak melakukan penanaman danmemberikantambahanpendapatan sejak tahun 2010 di Lamteuba,MontasikdanKutaMalaka. Pada pencapaian hasil yang dilaporkan tahun 2013, terinformasikanbahwapetanitelahmendapat hasil sebesar Rp. 62,2 Juta dari hasil penjualan panen nilam, kunyitdancabaidibeberapalokasi. Kini petani juga memiliki asset tanamankopi,jabon,kunyit,cabe dan alat-alat produksi yang siap dipanenhingga5tahunkedepan.

Disebutkan, kisah keberhasilan program AD dapat dilihat pada pilot project sebelumnya di wilayah Lamteuba. kemukiman Lamteuba yang terkenal tanahnya subur, sejak lama telah dijadikan lahan bertanam kunyit sebagai tanaman alternatif, disampingtanamanpadidankebun lainnya.Bilamasapanentiba,para tengkulak dan pedagang sanggup menampung hasil panen petani denganhargayangtidakmenentu. Hasil kunyit dan lainnya yang dikembangkan masyarakat oleh pedagangPengumpuldipasarkan ke Pasar Seulimum, yang selanjutnya dikirim ke pedagang besar di Medan, Sumatera Utara. Keadaan inilah yang dirasakan para petani belum mampu mendongkarak pendapatan dan ekonomi di wilayah tersebut, sehingga masihbanyakyangtergiurmelakukan pekerjaan sampingan menanam ganja, meskipun resikonya besar. Selama 3 tahun terakhir BNN telah memberikan “kail” berupa modalkerjauntuktanamdanmodal ilmu pembekalan tanaman komoditi, kini hasilnya telah dapat dinikmati petani. Semoga menjadiinspirasidanmotivasibagipetani lainnya termasuk di Indrapuri, Aceh Besar untuk ikut serta mensukseskan program alternatif development, sehingga terus berkurang tanaman ganja, semakin sehat dan cerdas masyarakat dalam mengembangkan pola hidup sehat kreatif dan prospektif, harap Sambudiono.(b09)

10 Rumah Rusak Diterjang Puting Beliung REDELONG (Waspada): Angin puting beliung merusak 10 rumah warga di sejumlah kampung di Kecamatan Wih Pesam,KabupatenBenerMeriah, Selasa (22/4). Musibahanginkencangyang melanda kawasan itu, menerjang tiga kampong, di antaranya Sukaramai Atas, Sukaramai Bawah dan Kampung Bukit Pepanyi. Meski beberapa rumah warga rusak, namun tidak ada korban jiwamaupunlukadalamkejadian

itu. Menurut penuturan Admi, Sekretaris Desa (Sekdes) Kampung Sukaramai Atas, saat kejadian pada, Selasa (22/4), ketika musibah itu terjadi, kondisi cuaca memang sedang dibalut mendung serta hujan gerimis yang disertai angin kencang. Tiba-tiba angin berputar kencang dan menerbangkan beberapa atap rumah warga di Kampung Sukaramai Atas.“Ada atap rumah warga yang terbang sejauh 200 meter.

Sebagian mendarat di atas pohon,” kata Admi. Dikatakan, ketika musibah anginputingbeliungitu,melanda kawasan Kampung Sukaramai, warga yang rumahnya sempat diterbangkananginmerasapanik dansebagianberlariuntukmenghindari tertimpa puing-puing rumah yang rusak. “Ada empat rumah warga yang rusak berat di Kampung Sukaramai. Namun berungtungtidakadakorbanjiwa dalam kejadian itu,” ungkapnya.

IDI Aceh Sepakati Deklarasi Sabang 2014 SABANG (Waspada): Ikatan Dokter Indonesia (IDI) Provinsi Aceh menyepakati Deklarasi Sabang 2014 dalam Musyawarah Wilayah IHI Aceh yang berlangsung di Sabang, 20 April lalu. Ketua Ikatan Dokter Indonesia (IDI) Kota Sabang Minar Mushari, usai Muswil IDI Aceh, Senin (21/4) mengatakan, sebagai organisasi profesi dokter mendukung program Jaminan Kesehatan Nasional (JKN) dan berkomitmen dalam perwujudanpeningkatanmutupelayanan kesehatan kepada masyarakat yang berkeadilan dan sempurna. Muswil IDI Aceh yang berlangsung dari tanggal 18-20 April di Kota Sabang diikuti 155 peserta dari kabuapeten/kota se Aceh secaraaklamasimemilihkembali Fachrul Jamal sebagai Ketua IDI Aceh dan menyepakati Deklarasi Sabang 2014. (b31)

WASPADA

Waspada/Khairul Akhyar

ATAP rumah warga yang terbang akibat diterjang angin uting beliung di Kampung Suka Ramai, Kecamatan Weh Pesam, Bener Meriah, Rabu (23/4)

Sementararumahwargayang rusak di antaranya tujuh unit di KampungSukaramaiAtas.Empat rumah warga di kampung itu, mengalami rusak berat yaitu milik Armia,Rajali,AsnawidanMAmin. Sedangkan rumah rusak ringan milikHanafiah,Muham-maddan M Yusuf. Sedangkan dua rumah rusak di Kampung Suka-ramaia Bawah, milik Anwar dan Abdul Gani. Satu rumah rusak di Kampung Bukit Pepanyi milik M Yusuf. “Warga yang rumahnya rusak berat, sementara mengungsi ke rumah tetangga,” papar Admi. CamatWih Pesam, Mawaradi mengatakan,paskamusibahangin putting beliung yang menerjang Kampung Sukaramai Atas dan SukaramaiBawah,pihaknyalangsung berkoordinasi dengan Dinas Sosial serta Badan Penanggulangan Bencana Daerah (BPBD) setempat. “Alhamdulillah, bantuan masa panik sudah langsung bisa kita salurkan untuk para korbananginputingbeliung.Memang benar ada empat rumah yang rusak parah dan sebagian rusak sedang serta rusak ringan,” tutur Mawardi. Wakil Bupati Bener Meriah Rusli M Saleh, didampingi Sekda T Islah, Kepala BPBP dan Kadis Sosial, Rabu (23/4) melakukan pengecekan ke lokasi musibah angin puting beliung di Kampung Sukaramai, Kecamatan Wih Pesam. Dalam kunjungan itu, Rusli M Saleh, memberikan bantuan kepada para korban yang rumahnya rusak diterjang angin kencang. (b33/cb09)

LANGSA (Waspada): Seorang Anak Buah Kapal (ABK) KM Bahari, Arsyad Satria bin Ahmad, 41, warga Lorong Bogak Dusun 7, Tanjungtiram, Kab. Batubara, Sumatera Utara, tewas tenggelam saat bersandar di Tempat Penampungan Ikan (TPI) Km 8 Kuala Langsa, ketika hendak membongkar ikan, Rabu (23/4) sekira pukul 09:00. Saksi yang mengetahui terjatuhnya korban, Zakir mengatakan, sebelum korban jatuh mereka barupulangdarimelautmenggunakanKMBahari.

Namun saat kapal bongkar ikan, mereka naik ke darat untuk minum-minum, sementara korban kembali menuju ke kapal untuk mengangkat tong ikan dan melompat ke kapal, tiba-tiba korban terjatuh dan langsung tenggelam. Saat dilakukan pencarian, korban tidak juga ditemukan dan berselang 1 jam kemudian jasad ditemukan warga. Kapolres Langsa AKBP Hariadi melalui Kapolsek Langsa Barat Iptu Budi NasuhaWaruru yang dikonfirmasimembenarkankejadiantersebut.(m43)

Waspada/Dede

PETUGAS saat melakukan pemeriksaan terhadap jenazah Arsyad saat berada di ruang IGD RSUD Langsa, Rabu (23/4)

Sopir Angkutan Mogok, Penumpang Terlantar BIREUEN (Waspada): Sejumlah sopir angkutan umum, mini bus jenis Mitshubishi L 300 melakukan aksi mogok di terminal bus Bireuen, Rabu (23/4). Akibat aksi ini, penumpang sempat terlantar beberapa jam di terminal. Informasi yang diperoleh, aksi mogok tersebut dilakukan sebagai bentuk protes mereka kepada sopir angkutan kota (angkot). Para pengemudi supir L 300 ini mengaku dilarang menaikkan penumpang jarak dekat dari Peudada ke Kota Bireuen atau pun dari Matangglumpangdua ke Bireuen atau sebaliknya. “Aksi protes ini kita lakukan karena selama ini beberapa sopir L-300 sempat dilarang oleh sopir Labi-Labi (angkot) di kawasan Simpang Kaye Jato dan Titi Rumbia,” ujar seorang sopir L 300 yang meminta identitasnya dirahasiakan. Ketua Organda Bireuen, Azis Fandila melalui Wakil Ketua II, Abdul Manan Isda mengatakan, pihaknya akan mencari solusi perselisihan antar sopir angkutan umum, termasuk trayeknnya. “Untuk mencari solusinya, maka pengurus Organda Bireuen akan bermusyawarah dengan masing-masing perwakilan, baik dari sopir L300 maupun sopir Labi-labi,” katanya. Sementara sempat terjadi konflik antara awak mini bus labi-labi dengan awak mopen L-300 di Bireuen yang nyaris terjadi bentrok fisik antara

kedua awal bus penumpang di Bireuen, namun berakhir damai di Mapolsek Kota Juang, Rabu (23/4). Bentrok kedua awak mini bus sempat tegang para awak labi-labi menurunkan secara paksa penumpang L-300 yang mengambil penumpang jarak dekat Bireuen – Marang Glunmpang Dua dan Bireuen – Peudada. Tidak hanya menurunkan penumpang, pihak awak mini labi-labi meminta denda secara paksa Rp50ribukepadaparasopirL-300yangmengambil penumpang jarak dekat. Kapolsek Kota Juang AKP Syamsul bersama petugas Dishub dan Polantas Polres Bireuen telah menyelesaikan bentrok awak mini bus labi-labi dengan awak minibus L-300 yang berakhir damai. Ketua pengurus mini bus labi-labi Bireuen Hendra Patra mengatakan, konflik yang sempat terjadi antara awak mini bus L-300 karena telah melanggar kesepakatan bersama 30 November 2013. Ketua pengurus mini bus L-300 Azmi mengatakan,mopenL-300sebenarnyatidakmengangkut penumpang jarak dekat Peudada – Bireuen – Matang Glumpang Dua, akan tetapi ada mengambil penumpang Peudada bepergian ke Lhokseumawe bukan ke Bireuen. (b17/b12)

Waspada/AR Djuli

PENGURUS mini bus labi-labi Hendra Patra saling bersalaman terkait konflik awak minibus labi-labi dengan minibus L-300 di Polsek Kota Juang, Rabu (23/4)


Aceh

WASPADA Kamis 24 April 2014

Parlementaria DPR Kota Banda Aceh Dewan Apresiasi Suksesnya Pileg Di Banda Aceh Dewan Perwakilan Rakyat (DPR) Kota Banda Aceh memberikan apresiasi atau penghargaan yang tinggi dan setulus-tulusnya kepada semua semua pihak yang telah mendukung suksesnya penyelenggaraan Pemilu Legislatif (Pileg) di Kota Banda Aceh. “Alhamdulillah pemilihan umum legislatif di Kota Banda Aceh telah terselenggara dengan baik, sukses, lancar, tertib, aman dan damai,”ucap Ketua DPRK Banda Aceh Yudi Kurnia,SE pada acara sidang paripurna istimewa, dalam rangka memperingati HUT Kota Banda Aceh ke-809 di gedung DPRK Banda Aceh, Selasa (22/4). Kata dia, dewan sangat bersyukur, karena proses pelaksanaan dan penyelenggaraan pemilu tersebut tidak mengalami gangguan dan kendala sama sekali, baik pada masa kampanye, masa minggu tenang maupun masa pencoblosan. “Tentunya kesuksesan tersebut karena partisipasi aktif dan andil yang sangat besar dari semua pihak, mulai dari masyarakat pemilih, perangkat gampong, tokoh pemuda, geuchik, teungku, imam masjid, perangkat kecamatan, para camat hingga Panwaslu dan KIP Kota Banda Aceh,” jelas Yudi, yang juga politisi Partai Demokrat ini. Untukitu,dewanberharapsemangatkebersamaandankekompakan pada setiap kegiatan pesta demokrasi yang telah ada ini, dapat terus dipertahankan dan ditingkatkan lagi pada masa mendatang, sehingga citra dan martabat masyarakat madani dapat terimplementasikan juga melalui pesta demokrasi seperti ini, ungkapnya. Hal senada juga dikatakan Plh.Walikota Banda Aceh Hj.Illiza Sa’aduddin Djamal,SE, bahwa pelaksanaan pemilu legislatif 2014, telah berjalan dengan sukses dan aman. Dikatakan Illiza, sejumlah kasus kekerasan menjelang pemilu legislatif ini tidak menjadi halangan dari keinginan kita untuk memilih wakil-wakil di DPRK,DPRA, DPR-RI dan DPD. “Hal ini adalah sebuah bukti bahwa kita semua semakin paham dan dewasa dalam menjalankan agenda besar demokrasi ini, ujar Illiza, yang juga Ketua DPC PPP Kota Banda Aceh itu. Sementara itu, data hasil rapat pleno KIP Banda Aceh, pada Minggu (20/4), diketahui perolehan suara untuk DPRK Banda Aceh, terdiri Partai Nasdem (12.743 suara), Demokrat (9.484 suara), Golkar (8.645 suara), PPP (8.508 suara), PA (8.265 suara), PKS (7.818 suara), Gerindra (6.582 suara), PAN (6.582 suara), PDA (5.780), PNA (4.028 suara), PBB (4.301 suara), PKPI (2.306 suara),PKB (2.280 suara), Hanura (1.487 suara) dan PDI-P (1.152 suara). Dengan demikian perolehan kursi masing-masing parpol yaitu, Partai Demokrat mendapat 5 kursi, Nasdem, Partai Keadilan Sejahtera (PKS), dan Partai Aceh masing-masing 4 kursi, Golkar, PAN dan PPP masing-masing 3 kursi, Gerindra 2 kursi, PDA dan PKPI masing-masing satu kursi.(*)

Tanpa Alasan Yang Jelas

KIP Aceh Tengah Larang Wartawan Meliput TAKENGEN (Waspada): Komisi Independen Pemilihan (KIP) Aceh Tengah ‘borgol’ kebebasan pers saat berlangsungnya rapat pleno rekapitulasi suara Pileg 2014 di Hotel Renggali, Takengen. Pasalnya, para wartawan dari sejumlah media cetak dan elektronik selain dilarang masuk ke ruang rapat, juga ada yang diusir ketika mengikutiberlangsungnya pleno yang digelar KIP sejak 21 April lalu dan hingga hari ini Rabu (23/4) rapat tersebut masih berlangsung akibat ‘molor’. Pelarangan mengikuti pleno oleh KIP AcehTengah ini disesalkan para insan pers di sana. Ini lantaranKIPdinilaimengangkangi Undang-Undang (UU) No. 40 tahun 1999 tentang kebebasan pers dan UU-RI No.14 tahun 2008 tentangketerbukaaninformasipublik. “Saya menyesalkan sikap KIP

yang melarang wartawan mengikutipleno.Merekadidugadengan sengaja menutup-nutupi perjalanan rapat. Saya diusir ketua KIP. Kesannya KIP tak menghargai profesi jurnalistik. Ini melanggar undang-undang,”sesalRoniJuanda, wartawan media cetak lokal kepada Waspada Rabu (23/4). Kekecewaan senada juga dikeluhkanMuhadi,anggotaPWI AcehTengah-BenerMeriah.Iajuga mengaku sempat hadir untuk meliputi pleno. Namun dilarang masuk oleh petugas pengaman, meskisebelumnyatelahdijelaskan tujuan pentingnya informasi tahapan pemilu bagi publik. “Ini adalah tahapan dari sebuah pesta demokrasi. Artinya informasi pleno ini harusnya jadi hak publik. Dan saya kira tidak ada dasar bagi mereka (KIP) melarang wartawan untuk mendapatkan akses guna pemberitaan,” katanya. Sementara, Julihan Darussalam, Ketua PWI Aceh Tengah-

Bener Meriah, secara terpisah mengatakan, sangat mengecam tindakan KIP yang menghalanghalangitugasinsanpers.Iamenilai tindakan tersebut merupakan salah satu bentuk belum transparannya KIP dalam menyampaikan informasi tahapan pemilu bagi kebutuhan hak publik. “Harusnya KIP Aceh Tengah tidakperlumelakukanpelarangan maupunmengusirwartawansaat sedang dalam bertugas. Hal ini tentu sangat bertentangan dengankebebasanpersdankebutuhan informasi bagi publik,” jelasnya. Tekait persoalan tersebut, hingga berita ini diturunkan Rabu (23/4) siang, Ketua KIP Aceh Tengah, Marwansyah saat dihubungiWaspada secara berulang melalui selularnya tidak aktif. Dan belum diketahui secara resmi alasan KIP setempat melarang insan pers untuk mengikuti berlangsungnya pleno rekapitulasi suara Pileg 2014 di Gayo Lut ini. (cb09)

Dua Ratusan Peserta Bersaing Rebut Jatah Masuk PTN KUTACANE (Waspada) : Sedikitnya dua ratusan siswa dari dua Kabupaten, bersaing merebut 15 jatah untuk lulus masuk ke Universitas dan Perguruan Tinggi Negeri di berbagai daerah. DuaRatusansiswayangmengikutitestingdiSMAN1Kutacane, Selasa (22/4) tersebut, 150 orang berasal dari kabupaten Gayo Lues dan 50 siswa lagi berasal dari Aceh Tenggara. Kadis Dikpora Agara, Syahrizal Selian kepadaWaspada, selasa (22/4)diselapelaksanaantestingProgramAfirmasiPendidikanTinggi mengatakan,programyangdiikutiduaratusansiswaitumerupakan programbeasiswakhususbagisiswadariAcehyangberminatmengikuti dan belajar di Perguruan Tinggi Negeri di pulau Jawa. Khusus untuk Aceh Tenggara, jatah yang disediakan masuk Perguruan Tinggi Negeri berkualitas seperti ke ITB Bandung, Universitas Indonesia, UGM, Insitut Tekhnologi Surabaya, IPB Bogor, Universitas Airlangga dan universitas berkualitas lainnya. Mereka yang lulus ini, kata Syahrizal, nantinya akan digambleng selama beberapa bulan di Universitas Syahkuala Banda Aceh, sedangkan biaya kuliah siswa yang lulus masuk Perguruan Tinggi itu ditanggung oleh Kementerian Pendidikan Dan Kabudayaan. Jurusan yang disediakan untuk jatah delapan siswa tersebut yakni di kedokteran Umum, kedokteran gigi, Farmasi, Pertambangan, kehutanan dan beberapa jurusan lainnya, bahkan untuk siswa yang lulus ikut testing di Agara itu , tiap bulannya akan menerima uang bulanan sebanyak Rp.1 Juta per orang dalam setiap bulannya. Khusus untuk Aceh Tenggara dan Aceh lainnya, program ini bukan untuk wilayah atau daerah tertinggal, namun merupakan program untuk peningkatan mutu pendidikan di Aceh yang terbilang masih lemah dibandingkan daerah lainnya.(b26)

Tiba (light, asal, waktu)

GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35

12:50

SJ 011 Medan/Jakarta

13:35

12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45

14:00

FY 3400 Penang*

14:20

Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Waspada/Maimun Asnawi

MUHAMMAD Thaib, Bupati Aceh Utara, SuaidiYahya,Walikota Lhokseumawe foto bersama dengan Marsda. TNI. Hadiyan Sumitaatmadja, Panglima Komando Pertahanan Udara Nasional, Rabu (23/4) siang di Pendopo Bupati Aceh Utara.

Panglima KOHANUDNAS RI Marsda. TNI. Hadiyan Sumitaatmadja:

Udara Indonesia Aman ACEH UTARA (Waspada): Komando Pertahanan udara Nasional(KOHANUDNAS)Republik Indonesia sampai saat ini baru memiliki 20 radar mata-mata yang dipasang mulai dari Sabang sampai Maroke. Dan selama ini ke 20 radar mata-mata tersebut mampu melihat setiap saat pesawat asing yang terbang melintasi teritorial Indoensia, namun tidak sanggup dicegat karena belum memiliki alat yang memadai. Hal tersebut disampaikan Marsda. TNI. Hadiyan Sumitaatmadja,PanglimaKomandoPertahanan Udara Nasional, Rabu (23/ 4) siang di Pendopo Bupati Aceh Utara dalam kunjungan kerjanya ke Provinsi Aceh. MenjawabWaspada,Hadiyanmengatakan,maksimal Indonesia harus memiliki 32 radar mata-mata. Begitupun selama ini, pihaknya mendapat bantuan radar penerbangan sipil. Dan selama ini, radar matamata Indonesia setiap saat mampu melihat pesawat asing yang terbang melintasi udara Indonesia. Memang jumlah pesawat asing yang terbang di udara Indonesia jumlahnya tidak sampai puluhan. Untuk melakukan penyergapan terhadap pesawat asing itu, kata Hadiyan, Indonesia belum memiliki ‘tangan’. Meskipun demikian, sampai saat ini, kondisi keamanan udara Indonesia cukup aman. “Belum lama ini, mungkin bapaksudahtahumelaluipemberitaan media massa baik cetak

maupun elektronik, kalau kita pernah memaksa turun pesawat asing yang terbang tanpa izin dan pesawat itu kita turunkan di Bandara Polonia Medan. Inilah buktinya kalau radar mata-mata Indonesiamampumelihat,”kataMarsda. TNI. Hadiyan Sumitaatmadja. MenjawabWaspada, Hadiyan mengakui untuk memenuhi kekurangan radar sebanyak 12 radar mata-mata membutuhkan biaya yang tidak sedikit dan kata dia, membeli alat untuk menciptakankeamananmemangmahal. Ditanya kendala apa yang sedang dialamiolehKOHANUDNASsaat ini, dia mengatakan, kalau pihaknya harus mengakui jumlah anggaranyangdiplotuntukpertahanan keamanan udara belum mencukupi. Begitupun dia menolak untuk menyebutkan jumlahnya. Pada kesempatan itu Hadiyan menyebutkan beberapa jenis alatpertahanan keamananudara seperti pesawat tempur, radar, peluru kendali dan sejumlah unsur lainnya yang mempunyai kemampuan pertahanan udara. Dalam radar RI kemarin itu juga tidak pernah melihat pesawat MH370melintasiudaraIndonesia. Kalaumemangtertangkapdiradar, KOHANUDNAStetapakanmemberikan informasi tersebut. “Katanya MH370 terbangnya ke selatan.Tapi sekarang apa ada di selatan. Dan selama ini kita berhasil melihat pesawat asing yang terbang di udara Indonesia

berasal dari berbagai negara, seluruhduniaada.Merekaselama ini terbang tidak mengurus izinnya. Hanya itu saja yang kita ketahui,”katanya.Serayamengatakan kemampuan radar yang ada di Kota Lhokseumawe cukup bagus. Pada kesempatan itu, Hadiyanmenyebutkan,kunjungannya ke Provinsi Aceh dalam rangka kunjungan kerja untuk mengevaluasi kinerja dan kata dia, kunjungan tersebut bukan hanya di Aceh tapi ke semua provinsi dan setelah dievaluasi semuanya dalam kondisi bagus. Di akhir wawancara dengan insan pers di Aceh Utara, Hadiyan mengucapkan terimakasih banyakatasjamuandariBupatiAceh Utara dan Walikota Lhokseumawe yang dinilai luar biasa dan atas penyambutan tersebut dia merasa sangat diistimewakan. “Terimakasihsekalilagi,”ucapnya. Bupati Aceh Utara H. Muhammad Thaib dan Walikota Lhokseumawe SuaidiYahya mengucapkanterimakasihtelahbersedia singgah di tempat tugasnya dan itu merupakan sebuah kehormatan. Muhammad Thaib juga mengatakan, hubungan dengan pihak Radar dan bahkan denganaparatkeamananlainnya baik TNI mapun Polri cukup bagus. Hendaknya hubungan seperti itu akan terus terbina sepanjang masa dan dilaporkan kondisi keamanandiAcehperlahan-lahan semakin kondusif. (b18)

900 Polisi Kawal Pleno KIP Aceh

Berangkat (light, tujuan, waktu)

Garuda Indonesia

Lima Perempuan Dominasi Calon Legislatif SABANG (Waspada):Wali Kota Sabang Zulkifli H Adam mengatakan, dalam upaya pengarustamaan gender, dalam Pileg yang berlangsung 9 April lalu, menurut hasil rekap suara di KIP Sabang, lima perempuan akan mendominasi dalam legislatif untuk lima tahun ke depan. Wali Kota Sabang mengatakan hal itu pada acara pembukaan Rapat Koordinasi Pokja Vocal Point yang berlangsung di aula Bappeda Sabang, Rabu (23/4). Kata dia, keterwakilan perempuan di DPRK Sabangperiodeberjalanhanyaduaorang,kedepan mencapailimaorangdaninipertandakaumwanita sudah maju selangkah dalam rangka mengambil peran dalam pembangunan bangsa. Pada bagian lain, kataWali Kota Sabang, dalam upaya meningkatkan harkat dan martabat serta pemberdayaan masyarakat daerah ini, Gubernur Aceh menginstruksikan untuk mengalokasikan 10 persen anggaran APBK tahun 2014 untuk program pembangunan perumahan tidak layak huni. Pemko Sabang mengalokasikan sebesar 20 persen

untuk rumah tidak layak huni. Dari Kementerian Perumahaan Rakyat juga menyediakan sebanyak 450 unit rumah layak huni termasuk biaya reha-bilitasi rumah tidak layak huni. Kabid Data dan Gender Kementerian Pemberdayaan Perempuan dan Perlindungan Anak, Endangni dalam paparannya mengataka, misi Kementerian Pemberdayaan perempuan dan Perlindungananakyaitumendorongterwujudnyakebijakan yang responsif gender dan peduli anak untuk peningkatan kualitas hidup dan perlindungan perempuan, serta pemenuhan hak tumbuh kembang dan perlindungan anak dari tindak kekerasan. Kepala BPM, KB dan PP Kota Sabang Kemala Dewi mengatakan, rencana aksi bidang Pemberdayaan Perempuan dan Perlindungan anak antara lain peningkatan jumlah kebijakan pelaksanaan PUG di berbagai bidang pembangunan seperti Dinas Pendidikan, Dinas Kesehatan, Disperindagkop. Peningkatan jumlah kebijakan pengembangan kabupaten/Kota layak anak. (b31)

Pileg Ulang, KIP Subulussalam Koordinasi KIP Aceh SUBULUSSALAM (Waspada): Terima rekomendasi Panitia Pengawas Pemilu (Panwaslu) Kota Subulussalam untuk Pileg ulang di Tempat Pemungutan Suara (TPS) 02 dan 03 Subulussalam, Komisi Independen Pemilihan (KIP) setempat akan berkoordinasi dengan KIP Aceh, bahkan bila perlu Komisi Pemilihan Umum (KPU) RI. Syarkawi Nur, Ketua KIP Subulussalam, Rabu (23/4) soal rekomendasi itu mengatakan, perlunya koordinasi hingga ke KPU RI karena Pileg agenda nasional. Diakui, pihaknya baru akan menentukan sikap jika telah berkoordinasi dengan KIP Aceh dan atau KPU RI. SepertidisampaikanEdiSuhendri,KetuaDivisi Hukum Penanganan dan Pelanggaran Panwaslu setempat, Selasa, dari beberapa laporan dugaan Pileg curang yang diterima, Pileg ulang di TPS 02 dan 03 Subulussalam karena terbukti ada warga mencoblos dua kali, seperti yang dilaporkan Sobirin Hutabarat, caleg Partai Damai Aceh (PDA) setempat.

Dugaan itupun didukung bukti-bukti kuat, keterangan saksi, KPPS dan terlapor. Seperti Berita Acara Rekap Hasil Penghitungan Perolehan Suara Parpol dan Calon Anggota DPR, DPRA, DPRK Kab/Kota serta Calon Anggota DPD Tingkat Kab/Kota dalam Pemilu 2014, Minggu (20/4),kejadiankhususataukeberatansaksidituangkandalamModelDB2diajukanSyahrilTinambunan (PAN), Saudi (Gerindra) dan Zeger Rudi (PDA). Menurut Syahril, ditemukan pemilih ganda di TPS 1 dan 2 Desa Lae Motong, melanggar PKPU No. 26 tahun 2013 Bab V Bag pertama pasal 61 ayat 2 poin d. Sementara saksi Gerindra, Saudi menilai, KIP tidakpedulikecurangandiPPKSimpangKiri,seperti penambahan dan pengurangan suara. Sedangkan alasan saksi PDA, Zeger Rudi, PPK merubah suara tidak sah menjadi sah, pemindahan TPS 17, surat keberatan saksi tak dituangkan pada model DA dan tidak ada penyelesaian tingkat PPK. (b28)

Di Abdya, PA Berkurang 2 Kursi

Periksa Kinerja KIP Agara KUTACANE (Waspada) : Terkait dugaan buruknya kinerja penyelenggara Pemilu, Komisi Nasional Pengawas Aparatur Negara (KomnasWaspan) meminta Dewan Kehormatan Penyelenggara Pemilu (DKPP) memeriksa kinerja KIP Agara. Demikian press realese yang diterima Waspada dari Direktur Eksekutif Komisi Nasional Pengawas Aparatur Negara Rudy Hartono Pulungan, Rabu (23/4) di tengah berlangsungnya rapat Pleno Rekapitulasi suara oleh pihak KIP yang dipusatkan di GOR Sepakat Segenep Kutacane. Sejak awal berlangsungnya pemungutan suara, setidaknya ada enam pelanggaran yang telah dilakukan penyelenggara, mulai dari molornya waktu penghitungan suara, banyaknya formulir C1 yang tidak tersedia di TPS sehingga banyak saksi partai yang tidak memiliki Formulir C1 Yang dibutuhkan. Tidak ditempelkannya hasil rekapitulasi di TPS sehingga publik tidak dapat mengakses hasil penghitungan suara di TPS. Tidak hadirnya saksi ketika saksi dan juga tidak ditempelkannya hasil rekapitulasi di PPS dan lemahnya kiinerja Panwas Kabupaten Agara dalam melakukan pengawasan terhadap kinerja KIP, ditambah banyaknya tercecer C1 kosong yang sudah bersetempel basah di masyarakat. Lemahnya kinerja dan pelanggaran penyelenggara , urai Rudi Pulungan, malah berlanjut sampai pada dimulainya proses rekapitulasi di tingkat PPK dan KIP, hal itu disebabkan karena banyaknya data yang tidak sinkron antara dokumen C1 saksi parpol dengan pihak PPK. (b26)

B11

BANDAACEH(Waspada): Rapat pleno penghitungan suara pemilihan umum legislatif oleh komisi independen pemilihan (KIP) Aceh berlangsung dibawah pengawalan ketat aparat kepolisian. Sejumlah petugas yang dibagi dalam dua sif ditempatkan di dalam dan luar gedung dewan perwakilan rakyat Aceh untuk mengantisipasiberbagaikemungkinan. PantauanWaspada,sejakpagi sejumlah personil kepolisian dari Mapolresta dan Polda Aceh telah disiagakan di gedung Dewan Perwakilan Rakyat Aceh di jalanTeuku Daud Beureueh Banda Aceh.S elain personil bersenjata lengkap,

sejumlah kendaraan milik kepolisian juga disiagakan di luar gedungDPRA, tempat digelarnya rekapitulasi. Petugas yang berjaga di pintu pagar dan masuk, memeriksa suratundangandariKIPbagiwarga yang ingin masuk ke gedung dewanperwakilanrakyat.Mereka yang diperkenankan masuk hanyasaksiparpoldanPanitiaPemilihanKecamatansertaperwakilan partai politik yang membawa undangan. “Ada 900 personil yang kita siagakan.Merekadibagi dua,”kata WakilkepalakepolisiankotaBanda Aceh, AKBP Sugeng Hadi kepada Waspada Selasa (22/4).

Menurut Sugeng petugas yang disiagakan dibagi menjadi dua, yang bertugas sejak pagi hingga siang dang siang hingga sore hari. Mereka lanjutnya, berasal dari berbagai kesatuan yang bertugas di Polda Aceh dan Polresta Banda Aceh. “Kami berharap pelaksanaannyaberlangsungtertibtanpa gangguan,”ujar Sugeng. SelainundangKIPAcehyakni saksi partai politik dan calon DPD maupun Panitia Pemilihan Kecamatan (PPK), rapat pleno KIP AcehyangdipimpinlangsungKetua KIP Aceh Ridwan Hadi dihadiri para pejabat pemerintah Aceh.(cb06)

MANGGENG RAYA (Waspada): Dari 25 jumlah kursi DPRK di Aceh Barat Daya (Abdya), Partai Aceh (PA) mendapat 7 kursi sesuai dengan hasil rapat pleno Komisi Independen Pemilihan (KIP) Abdya Senin sore (21/4) lalu. Angka tersebut jelas penurunan dari angka pemilu legislatif (Pileg) tahun lalu, dimana masa itu Partai Aceh berhasil meraih 9 kursi untuk DPRK Abdya. Meskipun begitu, Partai Aceh tetap meraih kursiterbanyakdibandingkandenganpartaipolitik peserta pemilu lainnya di Abdya, PA meraih 2 kursi di Daerah Pemilihan (Dapil) 1 wilayah Kuala Batee dan Babahrot dengan perolehan suara 5.280, 3kursidiDapil2wilayahBlangpidie,SusohdanJeumpa dengan 7.295 suara, kemudian di Dapil 3 PA meraih 2 kursi wilayah Lembah Sabil, Manggeng,TanganTangan dan Setia dengan 4.258 suara. Adapun hasil rekapitulasi suara partai politik

dalam rapat pleno KIP Abdya yang berhasil dihimpun Waspada Selasa (22/4) untuk Dapil 1 (Kuala Batee, Babahrot) merebut 7 Kursi DPRK, Jumlah suara sah seluruh partai: 18.659, Jumlah suara tidak sah: 2.538, Total: 21.197 Untuk Dapil 2 (Blangpidie, Susoh dan Jeumpa) merebut 10 kursi DPRK, Jumlah suara sah seluruh partai: 28.171, Jumlah suara tidak sah: 2.808, Total: 30.979, sedangkan Dapil 3 (Lembah Sabil, Manggeng,Tangan-TangandanSetia)untuk8KursiDPRK, Jumlah suara sah seluruh partai: 23.455, Jumlah suara tidak sah: 2.674, Total: 26.129. Untuk penetapan nama anggota wakil rakyat yang bakal duduk di DPRK, Ketua KIP Abdya Muhammad Jakfar mengatakan setelah berlangsungnya pleno di Kantor KIP provinsi Aceh sampai tanggal24Aprilmendatangbaruakandiumumkan. “Setelah pleno di KIP Aceh baru kita umumkan,” katanya.(cza)

Ulama Harus Ada Di Setiap Desa BLANGKEJEREN (Waspada) : Seluruh para TengkudiGayoLueshadirdalamRakor yangdiadakan di Kantor Kemenag Gayo Lues, Rabu (23/4). Acara tersebut mengambil tema “Kita Satukan Persepsi Dalam Menengakkan Syari’at Islam,”. Dalamacarayangdihadiriolehbeberapatokoh penting dalam penegakan syariat islam di Gayo Lues ini, membahas diantaranya tentang kesiapan DinasSyariatIslam,upayapemerintahmenjadikan pemerintahan Aceh yang Islami, dan peran para ulama-ulama desa dalam mendakwahkan syariat Islam di kampungnya. Demikian dikatakan Bupati Gayo Lues, Ibnu Hasim, pada acara pembukaan, Rakor Menyatukan Persepsi Dalam Menegakkan Syariat Islam di Gayo Lues. Hadir mewakili Kapolres, mewakili

Dandim, Kepala Dinas Syariat Islam, para ulama, Tengku dan imam seluruh Gayo Lues. Ketua MPU Gayo Lues, Tgk. Mua’za berharap kepada setiap unsur masyarakat, dan lembagalembaga untuk bisa menegakkan, dan menjaga kelangsungan syariat Islam di Gayo Lues sampai akhir nanti. Di Aceh bisa dikatakan semuanya Islam, hanya sajagenerasiIslamsekaranginitidaksepakatdengan Islam. Dia pun mengajak semua umat Islam, khususnyadiGayoLues,untukmembangunkansyariat Islam di Gayo Lues bersama-sama. Upaya mendakwahkan Syariat Islam di Gayo Lues, para Dai, Imam, Tengku dan Ulama Desa sangat ber peran penting dalam menyebarkan syariat Islam. (cjs)

Salim Fakhri Hampir Dipastikan Lolos Ke Senayan KUTACANE (Waspada): Informasi dihimpun Waspada, Rabu (23/4), dari berbagai sumber, Caleg DPR RI Partai Golkar dari dapil 1, dengan nomor urut 4, H.M, Salim Fakhry,SE,MM, hampir dipastikan lolos ke Senayan. Pasalnya dari 7 kandidat Golkar di dapil 1, Salim Fakhry, unggul dalam perolehan suara dari total suara 15 kabupaten. Sementara itu, dalam rapat pleno KIP di GOR Kutacane, yang dihujani intrupsi terkait indikasi penggelembungan suara di kecamatan Darul Hasanah, ketika dilakukan perhitungan dengan membuka kotak suara, justru ditemukan hasil suara Salim Fakhri “terkebiri” lebih dari 130 suara. Dalam rapat pleno Selasa malam (22/4), yang berlangsung hingga menjelang dini hari, ketika masuk penghitungan rekapitulasi perolehan suara di kecamatan Darul Hasanah, dengan berbagai asumsi, indikasi yang mengarah pada dugaan penggelembungan suara mengarah pada Caleg DPR RI dari partai golkar, secara spesifik, dugaan “mendongkrat suara Salim Fakhri, caleg nomor urut 4 . Dimana semula hasil suara yang diperolehan sesuai hasil laporan saksi sejumlah 2626. Denganpertimbangankeraguan,unsurcuriga, adanya penggelembungan suara pada C1, menyahuti intruspsi saksi partai Gerindra, PKS, Nasdem dan Demokrat, dalam rapat pleno yang dipimpin ketua KIP Aceh Tenggara Dedy Muliady ,ST, itu, Ketua Panwas Aceh Tenggara Surya, menyetujui dilakukan pembukaan kotak suara untuk menyesuaikan jumlah perolehan suara, antara C1 dengan yang tercatat di pleno itu. Namunsetelahdibukasejumlah15kotaksuara, tidak ditemukan indikasi penggelembungan suara. Justru ditemukan lebih dari 130 suara sah yang semestinya masuk dalam perolehan suara Salim Fakhry, tidak masuk dalam rekap.

Arnol, saksi dari Golkar kepadaWaspada, Rabu (23/4), mengatakan, di dalam kotak itu justru suara Salim Fakhry “terkebiri”, di satu sisi, protes saksi beberapa partai ini menguntungkan perolehan suara Caleg Golkar, meski semula diduga ada penggelembungan, justru kotak suara “berkata”, suara Salim Fakhry nyaris hilang lebih dari 130 suara. Dan selanjutnya, kata Arnol, saksi Golkar meminta tidak dilanjutkan acara membuka kotak suara, pasalnya indikasi yang diprasangkakan tidak terbukti, dan diminta dilanjutkan penghitungan rekap,mengingatterbatasnyawaktu.Bahkanprotes yang dilakukan saksi partai lain, justru tidak sesuai dengan agenda rapat pleno. Para Saksi lain justru lebih banyak berbicara soal dugaan pelanggaran-pelanggaran di dalam pelaksanaan pemilu legislatif, hal ini semestinya disampaikanlangsungkepadaPanwas,bukanjustru dibahas berlarut di ajang rapat pleno, ujar Arnol PenyampaianArnolinidisambutolehPanawas, sehingga proses rapat pleno kembali berjalan normal, dari sejumlah 16 kecamatan se-Aceh Tenggara,praktis hanya tiga kecamatan, Bambel, Bukit Tusam dan Babussalam, yang belum bahas hingga berita ini diturunkan. Namun sesuai jadwal tahapan, bila hari ini Rabu (23/4) tidak bisa dituntaskan, mengingat Jumat(25/4)rekapitulasisudahdijadual-kansampai ke KIP Aceh, maka proses selanjutnya akan menjadi wewenang KIP Aceh, ujar Arnol. Dari posko Salim Fakhry, sesuai hasil data perolehan dari 15 kabupaten, untuk caleg DPR RI, dapil 1Aceh,sebutFaisal,datayangdihimpundarirelawan yang dikirim hampir dapat dipastikan H.M. Salim Fakhri di peringkat pertama mengalahkan perolehansuaraSayedFuadZakaryayangmenjadiperingkat kedua unggul dari sejumlah 7 caleg DPR RI partai Golkar Dapil 1 Aceh. (b25)


B12 Aceh Gajah Liar Rusak Areal Pertanian TAKENGEN (Waspada): Sekelompok gajah liar merusak hektaran area pertanian di Kp. Bergang, Kec. Ketol, Aceh Tengah, Rabu (23/4). Meskibelumdiketahuiberapa jumlah kerugian akibat‘amukan’ gajah ini, namun warga mulai cemas, khawatir serangan hewan berbelalai itu merambah ke permukiman penduduk. “Hektaran kebun kami yang

ditanamipisang,pinangdansebagiancabaitelahdirusakgajah.Hari iniwargamulaitakutuntukberaktivitasdiladang,”kataKabri,warga Bergang. Hinggakini,lanjutnya,kelompok gajah ini masih belum beranjak meninggalkan area di sekitar pertanian. Masyarakat dibantu timBKSDAdanpetugasdariDinas Kehutanan Aceh Tengah sedang berupaya mengusir gajah liar tersebut untuk kembali ke habitatnya. “Kami sedang mengawasi gajah-gajahini.Jumlahnyasekitar

15 ekor. Saat ini kami sedang berusaha untuk melakukan pengusiran sehingga tidak merambah ke permukiman warga dan tidak membahayakan penduduk,” jelas Zulpan Diara Gayo, Kabid Pengawasan, Konservasi dan Perlindungan Hutan, Aceh

Tengah yang dihubungi secara terpisah. Menurutnya, selain melakukan tindakan pengusiran, pihaknya juga sedang mengupayakan pemantauan guna mengawasi perpindahan gajah di area pertanian seluas 100 hektare.

“Sejauh ini fokus kita menghalau gajah untuk tidak ‘menyeberang’ ke permukiman warga. Namun, bila gajah-gajah ini nantinya akan mengganggu juga dan membahayakan penduduk, tentu harus dilakukan tindakan,” papar Zulpan. (cb09/b32/b33)

16 Pejabat Eselon IV Dilantik IDI (Waspada): Setelah Dispenduk Capil melantik sejumlah pejabat struktural dalam lingkungannya, kini giliran Dinas Pendapatan, Kekayaan dan Keuangan Daerah (DPKKD), Badan Perencanaan, Pembangunan Daerah (BAPPEDA) dan Dinas Kebudayaan, Pariwisata, Pemudan dan Olahraga melalui pelantikan terhadap pejabat eselon IV. Prosesi pelantikan dipusatkan di instansi masing-masing dan dilakukan kepala SKPK terkait, Rabu (23/4). Kepala DPKKD Aceh Timur,T Munzar melantik tiga pejabat yakni Subki (Ka UPT DPKKD), Adliwijaya (Pj Kasub Bagian Keuangan), Erwin Ardiyanto (Pj Kasi Penilian dan Pengadaan). Selanjutnya, Kepala Bappeda Aceh Timur Husni Thamrin melantik enam pejabat strukturalnya yakni Nurmwati (Pj Kasubbid Pengembangan Sumber Daya Alam dan Lingkungan Hidup), Salman Darajat (Kasubbid Pertanian), Yuli Rahmadhani (Kasubbid PengembanganKualitasSDM,KeistimewaanAcehdanKebudayaan), Jamaluddin (Kasubbid Data dan Pengendalian Pengendalian Pembangunan), Irmayanto (Pj.Kasubbid.Penelitian dan Pengembangan) dan Ramli (Kasubbid Pengembangan Infrastruktur, Iptek dan Perhubungan). (b24)

Waspada/M Ishak

KEPALA DKKD Aceh Timur T Munzar melantik pejabat eselon IV di DPKKD Aceh Timur di Idi, Rabu (23/4)

Golput Di Bireuen 79.293 Orang BIREUEN ( Waspada): Angka golongan putih (Golput) atau warga masyarakat yang tidak mengggunakan hak pilih di Kabupaten Bireen dalam Pileg 9 April 2014 masih tergolong tinggi mencapai 79.293 orang (27 persen) dari total DPT 296.473 orang. Ketua KIP Bireuen Mukhtaruddin,SH, MH (foto) menjelaskanhalitukepadaparawartawan di kantornya Selasa (22/4). Hasil penghitungan perolehan suara dalam rapat pleno yang digelar KIP Bireuen Senin (21/4) terungkap dari total 296.473 pemilih yang terdaftar di DPT yang menggunakan hak pilihnya sebanyak 217.180 pemilih terdiri dari 100.741 orang laki-laki dan 116.439 perempuan. Dijelaskan, jumlah yang menggunakan hak pilihnya sebanyak 202.262 orang merupakan suara sah dan 14.918 suara tidak sah atau rusak. Di TPS perkotaan Kecamatan Kota Juang dari total DPT 35.771 yang menggunakan hak pilihnya pada pemilu Legslatif 9 April 2014 hanya 22.695 pemilih. Sebanyak 13.976 pemilih yidak menggunakan hak pilihnya (Golput). DPT pemilih di kecamatan Peusangan sebanyak 35.497 yang menggunakan hak pilihnya 27.290 orang dan sebanyak 8.207 orang Golput, ujar Mukhtaruddin. (b12)

Maimun Asnawi

PARA warga sedang menyaksikan petugas pemadam kebakaran saat memadamkan kobaran api dari dalam Ruko milik M. Ali di Simpang Ardath, Gampong Meunasah Mesjid, Muara Dua, Kota Lhokseumawe, Selasa (22/4) pukul 14:00.

Satu Ruko Hangus Terbakar LHOKSEUMAWE (Waspada): Satu unit rumah toko (Ruko) di Simpang Ardath, Gampong Meunasah Mesjid, Kecamatan Muara Dua, Kota Lhokseumawe, Selasa (22/4) sekitar pukul 14:00 hangusterbakar.Tidakadakorban jiwa dalam peristiwa tersebut. Begitupunkerugianditaksirmencapai ratusan juta rupiah. PantauanWaspada di lokasi kejadian,puluhanpetugaspemadam kebakaran dari Kota Lhokseumawe sedang berusaha memadamkan kobaran api yang menghanguskan Ruko tersebut. Begitupun, petugas pemadam tidak berhasil menyelamatkan bangunandanseluruhisinya.Menurut beberapa warga yang ditemui Waspada di lokasi kejadian mengatakan, mobil pemadam kebakaran sampai di lokasi kejadian setelah setengah jam peristiwa itu terjadi.

“Tidak ada yang bisa diselamatkankarenapetugaspemadam datangterlambat.Begitupunpara petugas berhasil menyelamatkan beberapabangunanlainnyayang letaknyaberdekatandenganRuko yangterbakaritu.Kalautidak,bisabisa beberapa bangunan lainnya ikut menjadi korban,” kata beberapa warga yang enggan disebutkan namanya. Para warga juga mengatakan, saat peristiwa itu terjadi, pemilik Ruko sedang tidak di tempat, karena sedang berada di RS bersalin menunggu anaknya melahirkan. Parawargajugatidakmengetahui dari mana sumber api berasal. Mereka hanya mengatakan, mengetahui kejadian kebakaran karena melihat kepulan asap di udara. Saat petugas pemadam sedang berusaha memadamkan kobaran api, tiba-tiba Muham-

mad Ali, pemilik Ruko pulang dari RS dan melihat Rukonya sedang dilalap si jago merah. Karena sedang dalam keadaan panik, M. Alilangsungberusahamenerobos petugas untuk masuk ke dalam Ruko bermaksud menyelamatkan barang. Namun usaha M. Ali dicegah para warga. Jika dibiarkan, maka M. Ali akan ikut menjadi korban keganasan si jago merah tersebut. Kepada Waspada, M. Ali membenarkandiabarumengetahuikejadian itu saat pulang dari RS. Kondisi tersebut membuat dia panik, seluruh tubuhnya bergetar. KepadaWaspada M. Ali juga mengaku, di Ruko itu dia menjual berbagai kebutuhan rumah tangga, termasuk menjual LPG. Hingga berita ini diturunkan, korban belum mengetahu dari mana sumber api berasal. (b18)

IDI (Waspada): Setelah 15 peserta di SMKN 2 Peureulak, gini giliran peserta lainnya mengikuti UjianNasional(UN)susulanyang dipusatkan di SMAN 1 Idi, Rabu (23/4). Pelaksanaan UN berjalan dengan baik dengan dua bidang studi. Keduanya bernama M Zuhri

FahmidariSMASwastaBungiong JeumpaIdidanMuhammadRizal dari SMK Negeri 2 Peureulak. Keduanya dibenarkan mengikuti UN susulan karena dokter telah menyatakan keduanya sakit pada saat UN hari kedua berlangsung, Selasa (15/ 4) lalu.

Zaini Tegur SKPA Berkinerja Rendah BANDA ACEH (Waspada): Gubernur Aceh Zaini Abdullah menegur keras para SKPA yang berkinerja rendah, karena progres keuangan dan uplod lelang belum mencapai target yang ditetapkan. Gubernur Aceh No: 903/12800 tanggal 21 April2014perihalteguranPertamaCapaianKinerja APBA 2014 - 17 April 2014 dibagi tiga kelompok, yakni kepada 15 SKPA yang progres keuangan dan upload lelang belum mencapai target. SKPA itu terdiri dari Dinas Pendidikan Aceh, Dinas Cipta Karya Aceh, Dinas Bina Marga Aceh, Dinas Pendapatan dan Kekayaan Aceh, Dinas Pengairan Aceh, Badan Penanggulangan Bencana Alam Aceh, Biro Administrasi Pembangunan Setda Aceh serta Badan Pemberdayaan Perempuan dan Perlindungan Anak, Selanjutnya, Badan Ketahanan Pangan dan Penyuluhan Aceh, Badan Pembinaan Pendidikan Dayah Aceh, Dinas Kesehatan Hewan dan Peternakan Aceh, Dinas Perkebunan Aceh, Dinas Sosial Aceh, DinasTenaga Kerja dan Mobilitas Penduduk Aceh dan BLUD Rumah Sakit Ibu dan Anak. Kemudian lima SKPA yang progres keuangan belum mencapai target terdiri dari Dinas Syariat Islam, Sekretariat DPP KORPRI Aceh, Kantor Penghubung Pemerintah Aceh serta Sekretariat lembagaWali Nangroe dan Dinas Keuangan Aceh. Sementara teguran gubernur itu kepada 16 SKPA yang beberapa paket lelang belum upload terdiri dari Dinas Pemuda dan Olahraga Aceh, Dinas Kelautan dan Perikanan Aceh, Dinas PertanianTanaman Pangan Aceh, Dinas Perhubungan,

Kominfotel Aceh serta Dinas Perindustrian dan Perdagangan Aceh, Berikut Dinas Kebudayaan dan Pariwisata Aceh, Dinas Kesehatan Aceh, BLUD Rumah Sakit Umum Daerah dr. Zainoel Abidin, Badan Perencanaan Pembangunan Daerah Aceh, Sekretariat Dewan Perwakilan Rakyat Aceh, Inspektorat Aceh, Sekretariat Baitul Mal Aceh, Sekretariat Majelis Adat Aceh, BLUD RS Jiwa, Dinas Registrasi Kependudukan Aceh dan Badan Pengendalian Dampak Lingkungan Aceh. Gubernur meminta agar SKPA tersebut memperbaiki kinerja sehingga target dapat dicapai pada 30 April 2014 dan akan dilakukan evaluasi khusus tanggal 2 Mei 2014. Pada bagian lain, Gubernur Zaini Abdullah mengucapkan selamat dan apresiatif kepada SKPA dengan progres keuangan dan aktifitas lelangnya sudah mencapai target, antara lain Badan Arsip dan Perpusatakaan Daerah, Badan Pemberdayaan Masyarakat Aceh, Badan Pelayanan Perizinan Terpadu Aceh TermasukSekretariatMajelisPermusyarawatan Ulama, Satuan Polisi Pamong Praja danWilayahtul Hisbah Aceh,Sekretariat Majelis Permusyarawatan Ulama, Badan Kepegawaian Pendidikan dan Pelatihan Aceh, Juga Badan Investasi dan Promosi Aceh, Badan Kesbang Politik dan Linmas Aceh, Sekretariat Daerah Aceh, Dinas Pertambangan dan Energi Aceh, Dinas Koperasi dan UKM Aceh dan Sekretariat Majelis Pendidikan Daerah Aceh. (b06)

Doa Bersama Peringati Setahun Pemerintahan SAKA TAPAKTUAN (Waspada):Sebagai wujud rasa syukur, peringatan satu tahun masa kepemimpinan Bupati Aceh Selatan, T Sama Indra-Kamarsyah (SAKA), Selasa (22/4) malam, diperingati dalam bentuk doa bersama, dipimpin MohdYunus Thaiby di hall pendopo bupati, di Tapaktuan. Doa bersama dihadiri ratusan warga, para alimulama,ForumKomunikasiPimpinanDaerah (Muspida), SKPK dan tokoh masyarakat itu, berlangsung khidmat. Pembacaan samadiyah, tahlil serta zikir, terdengar menggema di komplek rumah dinas pimpinan daerah itu. Bupati Sama Indra mengakui tanpa disadarinya, masa pemerintahannya telah berjalan satu tahun. Ini terjadi karena padatnya aneka kegiatan rutinitas yang dijalaninya sehari-hari. Nuansa itu sangat jauh berbeda dengan pengalamannyaketikamasihmenjabatsebagaiPimpinan Bank Aceh, Cabang Tapaktuan dan Sigli, beberapa waktu lalu. Di lembaga perbankan ini, perjalanan waktu terasa lama, karena kegiatannya

terbatas pada persoalan keuangan dan nasabah. “Mengurus daerah, ternyata jauh berbeda dengan mengelola keuangan di perbankan,” ucapnya. Dalam kesempatan itu bupati juga mengingatkan bahwa persoalan Aceh Selatan tidak boleh diutak-atikdandikotak-kotakkan,dimanawilayahnya mulai dari Labuhanhaji Barat hingga ke Trumon Timur. Guna mempercepat pembangunan dan menjemput fajar nuansa depan, rasa kebersamaan, kekompakan dan persatuan menjadi dasar utama. Tidak ada istilah saling curiga sesama warga Aceh Selatan, terutama pada jajaran SKPK dan lembaga daerah lainnya. Bupati juga bertekad akan terus meningkatkan kedisiplinan aparatur dalam rangka mewujudkan pemerintahan yang baik dan bersih sehingga mendapat tempat di hati rakyat. Dengan demikian akan munculpartisipasiaktifsegenaplapisanmasyarakat dalam pembangunan di berbagai sektor. (b30)

KadisPendidikanAcehTimur Abdul Munir membenarkan sebanyak 17 peserta dalam wilayahnya mengikuti UN susulan. “Bidang studi yang diikutkan dalam UN susulan ini yakni Matematika dan Kimia bagi peserta asalSMAdanMatematikapeserta dari SMK,” katanya. (b24) Waspada/Zamzamy Surya

SUASANA pembacaan doa bersama menandai peringatan setahun masa pemerintahan Bupati Aceh Selatan T Sama Indra-Kamarsyah (SAKA), di hall pendopo di Tapaktuan, Selasa (22/4)

Golkar Bertahan Di Aceh Singkil PAN Kedua Dan PA Ketiga

Waspada/M Ishak

DUA PELAJAR mengikuti UN Tahun 2014 susulan di SMAN 1 Idi, Aceh Timur, Rabu (23/4)

Pramuka Sebagai Gerakan Pendidikan Non Formal LANGSA(Waspada):Gerakan pramuka sebagai gerakan pendidikan pada jalur pendidikan non formal merupakan bagian yang takterpisahkandarisistempendidikan, dan juga merupakan kesinambungan gerakan kepanduan nasional Indonesia pada masa lampau. “Gerakan ini bertujuan menumbuhkan tunas bangsa menjadigenerasimudayangberkepribadian, berwatak dan berbudi pekerti luhur, memiliki kecerdassan dan keterampilan yang tinggi, sehatjasmanisertabermanfaatbagi masyarakatsekitarnya,”ucapKetua Majelis Pemimpin Cabang (Ma-

bicab) Gerakan Pramuka Kota LangsayangjugaWaliKotaLangsa Usman Abdullah, saat melantik pengurusKwartirCabang(Kwarcab) Gerakan Pramuka Kota Langsa periode 2013 - 2018, di halaman pendopo Langsa. Untuk merealisasikan tujuan tersebut, katanya, maka gerakan pramuka diarahkan kepada berbagaiprogramberupapendidikan mentaldankepribadian,keterampilan serta karya bhakti untuk membantu masyarakat dalam bidang pelestarian lingkungan hidup, peningkatan perekonomian keluarga, kesehatan dan pendidikan serta bidang sosial

budaya. Sehingga tidak heran jika masa lampau sebagian besar siswa SD hingga SMA berminat menjadi anggota pramuka aktif. Ketua Harian Kwartir Cabang Daerah (Kwarda) Aceh, Ramli Rasyid,menyampaikangerakanpramukaadalahgerakanpendidikan non formal, yang merupakan bagian dari sistem pendidikan nasional yang bersifat sukarela, non politik dan terbuka untuk semua unsur, tanpa membedakan asalusul, ras, golongan, suku bangsa dan agama. Dengan tujuan menumbuhkan tunas bangsa agar menjadi generasi yang lebih baik. (cms)

Waspada/M Ishak

SEKDA Aceh Timur M Ikhsan Ahyat menyerahkan seperangkat komputer kepada Desa Mandiri yang diterima Kepala BPMPKS Aceh Timur Elfiandi di Idi, Rabu (23/4).

LOGICA2 Kumpulkan Kepala SKPK IDI (Waspada): Menjelag akhir program Juni 2014 mendatang, LOGICA2 mengumpulkan sejumlah Kepala SKPK, termasuk di antaranya dari lembaga vertikaldipusatkan di aula Bappeda Aceh Timur di Idi, Rabu (23/4). Distric Program Koordinator LOGICA2 Aceh Timur, Alfadhil mengatakan, kegiatan tersebut dilaksanakan secara umum untuk persiapan replikasi/adopsi program kerja sama Australia-Indonesia. “Nantinya, beberapa program LOGICA2 yang akan direplikasi ataupun diadopsi antara lain pelayanan mutu, PATEN, pencapaian SPM (pendidikan dan kesehatan), layanan terpadu dan anak korban kekerasan, penilaian kinerja kepala sekolah, penguatan kapasitas camat dan aparaturnya, dan gampong mandiri,” ujarnya. (b24)

Kamis 24 April 2014

Dua Peserta Ikuti UN Susulan

Syahril Tinambunan Lapor Panwaslu Ke Polisi SUBULUSSALAM (Waspada): Kecewa laporannya tidak ditanggapi dengan alasan tidak didukung bukti kuat, Syahril Tinambunan melaporkan Panitia Pengawas Pemilu (Panwaslu) Subulussalam ke Polres Aceh Singkil. Menunjukkan salinan surat kepada Kapolres Aceh Singkil, tembusan ke Panwaslu Aceh dan Subulussalam serta Kejari dan Pengadilan Negeri Singkil, Syahril Tinambunan, DPRK aktif dan caleggagaldenganselisihsuaradiinternPANDapil2Kec.Penanggalan selaku Ketua DPD PAN Subulussalam menilai, tidak merekomendasi Pileg ulang di TPS 02 dan 03 Desa Lae Motong, Kec. Penanggalan tidak masuk akal karena bukti-bukti cukup kuat. MenurutSyahril,laporkanPanwaslukepihakKepolisianRIadalah salah satu sikap yang harus diambil. “Anggota saya saat ini sedang mengantarkansuratpengaduankePolresAcehSingkil,”paparSyahril saat ditemui di Sekretariat PAN Subulussalam, Selasa (22/4). (b28)

WASPADA

Waspada/M.Syafrizal

KETUA Majelis Pemimpin Cabang (Mabicab) Gerakan Pramuka Kota Langsa Usman Abdullah melantik pengurus Kwartir Cabang (Kwarcab) Gerakan Pramuka Kota Langsa priode 2013 – 2018, Rabu (23/4)

SINGKIL (Waspada): Partai Golkar peringkat pertama suara terbanyak pada Pileg 2014 di Kabupaten Aceh Singkil, kemudian disusul PAN dan PA berdasarkan hasil rekapitulasi KIP setempat, Sabtu - Minggu (19-20/4). Golkar diprediksi menyabet Lima dari 25 kursi di DPRK setempat, kemudian Partai Demokrat peringkat keempat, partai yang dipimpin SBY itudiprediksi memperolehtigadari25kursilegislatif karena unggul di tiga dari empat Dapil. Sedangkan PAN dan PA hanya unggul di dua Dapil dan diperkirakan menyabet masing-masing dua kursi. Berdasarkan data yang diperoleh, Selasa (22/ 4) Partai Golkar (5) memperoleh 11.561 suara dari empat Dapil dengan catatan Dapil I, 4 023, Dapil II, 3259, Dapil III, 2306, Dapil IV, 1973 Kemudian peringkat Kedua PAN (8) memperoleh 4 320 suara, berasal dari Dapil I, 2131, Dapil II, 1688, Dapil III, 426, Dapil IV, 75. Seterusnya peringkat Ketiga PA (13) dengan jumlah 4 196 suara, Dapil I, 798, Dapil II, 1339, Dapil III, 512 Dapil IV, 1547. Peringkat Keempat Partai Demokrat (7). de-

ngan perolehan 4 114 suara, Dapil I, 1 251, Dapil II, 1348, Dapil III, 1 033, Dapil IV 482, Seterusnya perolehan suara berdasarkan urtut partai, (1). Nasdem jumlah 3 632 suara, Dapil I, 1 464, Dapil II, 807, Dapil III, 132, Dapil IV, 1229. dan (2). PKB jumlah 3 352 suara, Dapil I, 487, Dapil II, 1531, Dapil III, 116, Dapil IV, 1 418. Serta (3). PKS jumlah 2 023 suara, Dapil I, 519, Dapil II, 367, Dapil III, 959, Dapil IV, 178. Dan(4) PDI-P jumlah 2 275 suara, Dapil I, 1 255, Dapil II, 779, Dapil III, 119, Dapil IV, 122. (6) P Gerindra jumlah Dapil I, 841, Dapil II, 976, Dapil III , 1092, Dapil IV, 1093 dan (9) PPP jumlah 1 663suara, DapilI,1439,DapilII,17,DapilIII,11,Dapil IV, 196. serta (10) P Hanura jumlah 3 688 suara, Dapil I, 1344, Dapil II, 603, Dapil III, 1 510, Dapil IV, 231. (11) PDA jumlah 1 757 suara, Dapil I, 544, Dapil II, 1203, Dapil III, 3, Dapil IV, 7. Lalu (12) PNA jumlah 674 suara, Dapil I, 132, Dapil II, 37, Dapil III, 481, Dapil IV, 24. Selanjutnya (14) PBB jumlah 3 491 suara, Dapil I, 940, Dapil II, 1546, Dapil III, 8, Dapil IV, 997. dan serta (15) PKPI jumlah 3 636 suara, Dapil I, 551, Dapil 1269, Dapil III, 1228, Dapil IV, 588 suara. (b27).

Kasus Box Puskesmas Ie Alang

MaTA : Ada Oknum Yang Dilindungi BANDAACEH(Waspada): Masyarakat Transparansi Aceh (MaTA) mendesak kepolisian membuka kembali pengusutan kasus Bantuan Operasional Kesehatan (BOK) Puskesmas Ie Alang Kec.Kuta Cot Glie Aceh Besar. Kasus yang ditangani oleh Polres Aceh Besar tersebut dinilai memenuhi unsur tindak pidana korupsi dan terindikasi melindungi oknum tertentu. “Dalam surat pemberitahuan perkembangan hasil penyidikan Polres Aceh Besar, hanya dua oknum Puskesmas yang ditetapkan sebagai tersangka. Padahal jika ditelisik ada oknum lain yang tidak ditetapkan sebagai tersangka, karena posisinya juga berpotensi dan bertanggungjawab atas penyalahgunaan dana,” kata Koordinator Bidang Antikorupsi dan Monitoring Peradilan, Badan Pekerja Masyarakat Transparansi Aceh (MaTA) Baihaqi kepada Waspada Selasa (22/4) kemarin. Dikatakan, dalam kasus BOK Puskesmas Ie AlangAcehBesar,MaTAmencurigaiadanyaupaya untukmeringankansanksihukumkepadaoknum yang terlibat. Hal ini terlihat dari pengusutan kasusyang tidak menggunakan Undang-undang Pemberantasan Tindak Pidana Korupsi dalam pengusutan. Padahal lanjutnya, sesuai analisis MaTA, kasus tersebut terindikasi tindak pidana korupsi. “Kasus ini memenuhi unsur sebagaimana disebut dalam UU nomor 20 tahun 2001 jo UU

nomor 31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi, pasal 3. Dimana pelaku dapat dipidana penjara seumur hidup atau paling singkat 1 tahun dan paling lama 20 tahun denda paling sedikit lima puluh juta rupiah dan paling banyak satu miliar,”ujarnya. Menurut Baihaqi, dakwaan yang dialamatkan kepada terdakwa kasus BOK Puskesmas Ie Alang yang kini disidangkan di Pengadilan Negeri Jantho Aceh Besar, bukan dakwaan tindak pidana korupsi. Padahal kedua terdakwa yakni SH selaku kepala Puskesmas dan F selaku bendahara merupakan penyelenggara negara yang juga menggunakan anggaran negara. “ Polda Aceh kami desak menjadikan kasus BOK di Puskemas Ie Alang Aceh Besar sebagai pintu masuk untuk melihat pengelolaan dana BOK di Puskesmas lain. Tidak tertutup kemungkinan kasus serupa juga terjadi di Puskesmas yang lain, apalagi penggunaan dana BOK Puskesmas kurang diperhatiakan,”tegasnya. MaTA juga berharap kepada Pemerintah Daerah turut memantau penggunaan dana BOK dan juga mengintensifkan pengawalan sehingga penggunaanya sesuai dengan cita-cita pemberian dana BOK. “Satu hal yang penting dilakukan oleh Pemerintah adalah menginstruksi seluruh Puskesmas mempublishpenggunaandanaituditempat-tempat umum, sehingga masyarakat dapat berpartisipasi memantau penggunaan dana,”pungkasnya.(cb06)


Waspada,Kamis 24 April 2014