Page 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

MINGGU, Wage, 24 Februari 2013/13 Rabiul Akhir 1434 H z No: 24144

Terbit 20 Halaman (A1-8, B1-12) z zHarga Eceran: Rp 2.500,-

Tahun Ke-67

Anas Mundur

Mega Curhat JAKARTA (Antara): Ketua Umum PDI Perjuangan Megawati Soekarnoputri mengatakan popularitasnya semakin hari semakin menurun dan merasa ditinggalkan media. “Wartawan kok ya ikut lupa ya, ketika mereka bicara tokoh reformasi misalnya, kok saya tidak ada. Jengkel saya,” katanya.

Lanjut ke hal A2 kol 1

Waspada/Rudi Arman

KAPOLDASU Irjen Pol. Wisjnu Amat Sastro (kanan) di dampingi Kasat Reskrim Kompol Yoris Marzuki (tengah) dan Kapolresta Medan Kombes Monang Situmorang (kiri) memegang barang bukti senpi dan pisau milik tersangka di Polresta Medan, Sabtu (23/2).

JAKARTA (Antara): Ketua Umum Partai Demokrat, Anas Urbaningrum menyatakan meletakkan jabatannya terhitung mulai hari ini, Minggu, 23 Februari menyusul langkah Komisi Pemberantasan Korupsi (KPK) yang telah menetapkannya sebagai tersangaka Kasus Hambalang. “Saya berhenti sebagai Ketua Umum Partai Demokrat,” kata Anas dalam keterangan persnya di kantor DPP Partai Demokrat, Jalan Kramat Raya, Jakarta, Sabtu (23/2).

Lanjut ke hal A2 kol 3

7 PERAMPOK DIDOR MEDAN (Waspada): Polresta Medan menembak tujuh perampok bersenjata api saat beraksi di toko jahit Dunia Taylor Jln. Gatot Subroto, Medan, Sabtu (23/2). Dari pengembangan penyidikan, petugas kembali menangkap tiga tersangka lainnya dari kawasan Kota Binjai.

Kapolda Sumut Irjen Pol. Wisjnu Amat Sastro saat memaparkan penangkapan itu di Polresta Medan, mengatakan tujuh tersangka ditangkap saat melakukan aksinya pada Sabtu pagi. Dalam penangkapan

itu, ke tujuh tersangka dilumpuhkan dengan peluru tajam karena melakukan perlawanan. Kemudian hasil pengembangan kasus itu, tiga tersangka lainnya ditangkap di kawasan Binjai.

Disebutkan Kapolda, polisi sebenarnya telah mengetahui rencana perampokan itu sejak satu minggu lalu, sehingga memantau pergerakan komplotan tersebut. “Dari informasi diterima, tukang jahit

dunia taylor bukanlah target utama mereka, melainkan distributor pulsa handphone yang perkiraan mereka mempunyai perputaran uang miliaran rupiah dalam sehari. Namun diduga sudah menge-

tahui gerak-geriknya diikuti polisi, mereka memindahkan target ke dunia taylor,” kata Kapolda di dampingi Kapolresta Medan Kombes Pol. Monang Situmorang, Kasat Reskrim Kompol Yoris Mar-

zuki, Wakasat AKP Hendra dan Kanit Jahtanras AKP Anthoni Simamora. Saat melakukan aksinya, para pelaku menyekap suami

Lanjut ke hal A2 kol 3

Sosialisasi Pilgubsu Minim TEBINGTINGGI (Waspada): Diperkirakan banyak warga kota Tebingtinggi yang belum mengetahui tata cara contreng atau coblos pada Pilgubsu. Sejumlah elemen masyarakat menuding KPU tidak maksimal melaksanakan sosialisasi soal itu. Bahkan, tidak ditemukan baliho dan spanduk di berbagai lokasi strategis terkait hal itu, meski pelaksanaan Pilgubsu tinggal hitungan hari saja. Sejumlah aktifis Parpol dan LSM, Sabtu (23/2), mengakui minimnya sosialisasi cara menggunakan hak pilih pada Waspada/Armin Nasution

GUS Irawan Pasaribu dan istrinya, Asrida Murni Siregar, tampil bersama saat kampanye di Lapangan Kebun Lada, Kel. Kebun Lada, Binjai Utara, Binjai, Sabtu (23/2).

Warga Binjai-Langkat Sepakat Pilih Sumut Sejahtera LANGKAT (Waspada): Puluhan ribu warga Kota Binjai dan Kabupaten Langkat yang menghadiri kampanye Cagubsu nomor urut 1, Gus Irawan Pasaribu, Sabtu (23/2), sepakat untuk terwujudnya Sumut yang sejahtera. Kehadiran Gus di Lapangan Amir Hamzah Tanjungpura, disambut 30 ribu warga Langkat. Dalam orasi

politiknya, Gus mengatakan, Babussalam dapat menjadi salahsatu wisata rohani di Sumut yang memiliki nilai ekonomis. “Babussalam dapat dijadikan wisata rohani yang harus ditumbuhkembangkan untuk menghasilkan nilai ekonomis dengan kunjungan dari wisatawan lokal maupun luar,” jelas Gus yang didampingi isteri Asrida Murni Siregar.

Menurutnya, visi Sumut Sejahtera sangat sederhana. Bagi pedagang mendapatkan modal tanpa agunan, petani mendapatkan bibit unggul sehingga hasil panen memuaskan, nelayan menangkap ikan tidak diganggu pukat trawl, kesehatan, infrastruktur dan pendidikan gratis 12 tahun.

Lanjut ke hal A2 kol 3

Jejak Para Gubsu

Lanjut ke hal A2 kol 1

Unsyiah Target 200 Profesor BANDA ACEH (Waspada): Universitas Syiah Kuala kembali mengukuhkan tiga guru besar. Pengukuhan itu dilakukan Rektor Unsyiah, Samsul Rizal dalam rapat senat terbuka di Gedung AAC Dayan Dawood, Sabtu (23/02). Ketiga guru tersebut, Prof. Dr. Ir. Yuwaldi Away, M.Sc sebagai guru iah besar Fakultas Teknik Elektro, Prof. Dr. Ir. M. Nasir, MP., SH sebagai guru besar Fakultas Pertanian dan Prof. Dr. rer. nat. Rinaldi Idroes, S.Si sebagai guru besar Fakultas Matematika dan Ilmu Pengetahuan Alam Unsyiah. Rektor Unsyiah dalam pi-

dato sambutannya mengatakan, pengukuhan tiga guru besar ini menjadi tonggak awal untuk mencapai target, di mana hingga tahun 2018 Unsyiah menargetkan guru besar sebanyak 200 orang. “Ini bukanlah pengukuhan tiga guru besar yang terakhir. Kita menargetkan 200 guru besar sampai 2018 mendatang,” kata Rektor Unsyiah, Samsul Rizal. Samsul Rizal memberi apresiasi untuk para pengajar Unsyiah, agar mereka yang sudah mendapat gelar S3 dapat

Lanjut ke hal A2 kol 6

Waspada/Muhammad Thariq

PARA ibu-ibu dari pengajian dan organisasi perkumpulan di Medan menyatakan kebulatan tekadnya untuk berjuang bersama Amri Tambunan dengan memilihnya pada 7 Maret mendatang, di Posko TEPAT Sumut di Jalan Iskandar Muda Medan, Sabtu (24/2). --Kampanye AmriRE di Sipirok, hal A6

Amri RE Paling Mampu Memajukan Sumut MEDAN (Waspada): Ratusan ibu-ibu pengajian di Kota Medan menyatakan kebulatan tekad untuk memenangkan kandidat gubernur dan wakil gubernur Sumut Drs Haji Amri Ta m b u n a n d a n R u s t a m Efendi Nainggolan (Amri RE) pada Pilgubsu 7 Maret mendatang. “Kami telah membulatkan tekad untuk memilih Amri RE

Manc. City Jamu Chelsea Malam Ini

Duel Strategi Mancini Vs. Benitez

Raja Inal; Martabe Yang Fenomenal NAMA Raja Inal Siregar (RIS) sudah tidak asing lagi bagi masyarakat Sumatera Utara. Ia adalah tokoh kunci di belakang konsep Marsipature Hutana Be—diambil dari bahasa Batak yang artinya membangun/membenahi kampung halaman sendiri. Konsep ini ditujukan kepada orangorang yang telah sukses di peran-tauan. Dengan konsep ini RIS menyeru untuk membangun kampung halaman. Seruan ini sudah mulai menggema di tahun pertama ia menjabat sebagai Gubernur Sumatera Utara, tepatnya dilontarkannya di Tanjung Ibus. Ia dipercaya memimpin Sumatera Utara pada Juni

Pilgubsu. Ketua LSM Teropong Demokrasi Indonesia (Torpedo) Dahrial Tanjung, mengakui hampir tidak terdengar ada sosialisasi KPU. “Saya kira KPU tidak serius melakukan sosialisasi, padahal banyak warga yang belum cara penggunaan hak suara,” ujar Dahrial. Hal senada disampaikan Wakil Ketua Partai Demokrat kota Tebingtinggi Army Fredi. Diakui, memang ada sosialisasi kepada Parpol, Ormas dan elemen masyarakat. Tapi sosialisasi itu tidak menyentuh


MANCHESTER City menghadapi ujian berat saat menjamu Chelsea pada pekan ke-27 Liga Utama Inggris di Stadion Etihad, Minggu (24/2) malam ini pukul 20:30 WIB (Live MNCTV). City dan Chelsea hanya berbeda empat poin. City berada di posisi kedua dengan nilai 53 terpaut 12 poin dari pemuncak klasemen Manchester United. Chelsea peringkat ketiga mengantongi nilai 49.

nomor urut 4 pada Pilgubsu 7 Maret. Pernyataan ini bukan slogan tapi akan kami buktikan pada hari pencoblosan, karena Amri RE paling mampu dari yang lain untuk memajukan Sumatera Utara,” kata Hj Salwah Br Hasibuan bersama ratusan ibu-ibu majelis taklim lainnya yang sengaja datang ke Posko Teman Perjuangan Amri Tambunan

Lanjut ke hal A2 kol 3


Tottenham Hotspur membuntuti pada posisi keempat nilai 48. Perebutan posisi kedua menjadi sasaran, setelah semakin sulit untuk mengejar pemuncak klasemen, MU yang mendekati gelar ke-20. Tottenham baru akan melakoni laga ke-27 pada Selasa (26/2) dinihari WIB bertandang ke West Ham United.

Lanjut ke hal A2 kol 7

JAKARTA (Antara): Gubernur DKI Jakarta Joko Widodo batal berangkat ke Medan untuk menjadi juru kampanye pasangan calon Gubernur-Wakil Gubernur Effendi Simbolon-Djumari, karena kelelahan. Jokowi rencananya Sabtu (23/2) pagi berangkat menuju Medan untuk menjadi juru kampanye sesama kader Partai Demokrasi Indonesia Perjuangan (PDIP): Effendi Simbolon-Jumiran Abdi (ESJA). “Bapak batal ke Medan,” kata salah satu staff Jokowi, Ivand Sigiro saat dihubungi kemarin. Dia mengatakan Jokowi (foto) kurang istirahat sehingga tidak bisa melakukan kampanye sesuai dengan jadwal. “Kan tahu sendiri kalau Bapak blusukan,” katanya mengenai Jokowi yang rencananya akan melakukan kampanye

Lanjut ke hal A2 kol 1

Minggu pukul 20:30 WIB (Live MNCTV)

Lanjut ke hal A2 kol 1

(TEPAT) Sumut di Jalan Iskandar Muda Medan, Sabtu (23/2). Mereka diterima tim TEPAT Medan dan Sumut secara kekeluargaan. Hj Salwah br Hasibuan merupakan Ketua Majelis Taklim Al Hidayah di Perumnas Mandala menyatakan kepada tim relawan Amri, pilihannya

Batik Corak Untuk Segala Usia

Minuman Tradisional Ala Jepang

LKS Akuntansi Asah Kemampuan Siswa

Rambutan Binjai Berjaya Di Mekarsari





Berita Utama

A2 Bupati Batubara Terima Rp7,8 M TANJUNGTIRAM (Waspada): Kementerian Kelautan dan Perikanan ke depan menyiapkan program baru berbasis industri dalam upaya meningkatkan pendapatan nelayan. Selainmelakukanpembinaan dan penyuluhan, termasuk bantuan langsung tidak saja di bidang peralatan, akan tetapi kepada kelompok maupun peningkatan SDM memberikan sekolah gratis kepada anak nelayan. “Ini kita lakukan mengingat masih banyak nelayan membutuhkan perhatian pemerintah,” tukas Menteri Kelautan dan Perikanan RI Sharif Cicip Sutardjo dalam pertemuan dengan masyarakat dan nelayan di halaman gedung peninggalan sejarah Istana Limalaras, Kec Tanjungtiram, Kab Batubara, Sabtu (23/2). Kunjungan kerja ke Batubara katanya sudah lama ditunggu untukbertemumenyapadanmenyalami masyarakat. Selain berharap mendapatkan bantuan dalam upaya meningkatkan pendapatan. Sedangkan tahun sebelumnya, lanjut menteri, Kementeriannya menyalurkan bantuan sebesar Rp 5 miliar.Sedangkan kali ini Rp 7,8 miliar lebih kepada

Pemkab Batubara dan diterima langsung oleh Bupati H OK Arya Zulkarnain, SH, MM. Bantuan tersebut meliputi untukpengadaanperikanantangkap 20 paket, Pump perikanan budi daya 31 paket, pengadaan sarana dan prasarana (pasar), pengadaan mesin pembuat es satu paket, pembuatan bangsal pengolaansatupaket,boatpengawasan dan 541 kartu nelayan. Selain itu diserahkan kartu nelayan dan diterima oleh Ruslan warga Dusun VIII Desa Bogak, Kec Tanjungtiram. BupatiHOKAryaZulkarnain, SH, MM menyambut baik kehadiran Menteri Kelautan dan Perikanan RI ke Batubara untuk bertatap muka dengan masyarakat nelayan sekaligus menyalurkan bantuan. Di samping melihat langsung potensi dan kondisi wilayahyangberhadapandengan Selat Malaka. Nelayan boleh berbangga karena menjadi sasaran bantuan. Apa lagi melihat potensi KecTanjungtirammerupakanhasil perikanan tangkap dan pengelolah ikan utama di Batubara. “Di sini potensi laut cukup besar memilikki panjang garis pantai 62 km,”ujar OK Arya. (a13)

Sosialisasi Pilgubsu Minim ... soal tata cara penggunaan suara. “Saya tahu penggunaan hak suara denganmenyoblos,karenaikutkampanyeAmriREdiSiantarkemarin,” ujar Army. Pada waktu itulah, ada peragaan penyoblosan, terang dia. SedangkanWakil Ketua Anak Tebing Bersatu (ATB) Amril Syarif, menyayangkanlambannyakinerjaKPUkotaTebingtinggi,karenabanyak masyarakatyangbelumtahupenggunaanhakmerekadalamPilgubsu. Dicontohkan, pada berbagai jalan strategis tidak ada baliho atau spanduk yang bisa dibaca masyarakat soal Pilgubsu. “Gebyar Pilgubsu tak terdengar di Tebing ini. Saya kira ini kelemahan KPU,” tegas dia. Ketua KPU kota Tebingtinggi Wal Ashri, SP, MM, membantah pihaknya tidak melakukan sosialisasi Pilgubsu. Dikatakan, pihaknya sudah melakukan sosialisasi pada lima kecamatan yang ada. Juga melakukan sosialisasi pada 15 sekolah dan menyiarkannya di dua stasiun radio. Selain itu, KPU juga sudah melakukan sosialisasi kepada Ormas dan OKP, tokoh masyarakat dan kalanan pemuda. KPU kota Tebingtinggi, menerima dana sosialisasi dari KPU Provsu sebesar Rp30 juta. Dengan dana yang ada itulah KPU melakukan berbagai upaya menyosialisasikan Pilgubsu ketengahtengah masyarakat, tandas dia. (a09)

Mega Curhat ... “Bukannya saya ingin dipublikasikan media secara besar-besaran. Tetapi masyarakat harus mengetahui kenyataan,” tambah dia. Megawati berpendapat saat ini banyak pihak yang merancang dan menjebak masyarakat untuk terus berada dalam ilusi yang jauh dari kenyataan, termasuk berupaya untuk menutupnutupi sejarah yang sebenarnya terjadi. Terkait dengan turunnya popularitas, mantan Presiden ke5 itu menduga ada pihak-pihak intelejen yang terlibat. Dirinya mengaku sangat paham peran intelejen dan cara mereka bekerja.

Jokowi Tak Jadi ... selama dua hari, yakni Sabtu dan Minggu (23-24 Februari). “Kalau besok belum tahu, menunggu konfirmasi dari Bapak,” kata Ivand mengenai mantan Wali Kota Surakarta yang sudah mengantongi surat ijin cuti untuk ikut kampanye itu. Sebelumnya Jokowi juga pernah ikut jadi juru kampanye pasangan calon Gubernur dan Wakil Gubernur Jawa Barat, Rieke Dyah Pitaloka-Teten Masduki di kabupaten Bandung.

Jejak Para Gubsu ... 1988 – Juni 1998. Marsipature Hutana Be (Martabe) adalah konsep pembangunan regional yang menjadikan putra daerah sebagai garda terdepandaerah.Konsepsekaligusbertujuanmendorongkeseimbangan pembangunan pantai Barat—karena kondisi pantai Barat yang tertinggal dibandingkan pantai Timur, seperti fasilitas infrastruktur. Kesenjangan pembangunan ini dijawab dengan konsep Martabe ini—memanggil para perantau sukses membangun kampungnya. Raja Inal percaya, perantau memiliki banyak keunggulan dibandingkan kaum kerabatnya yang bermukim di kampung. Mereka dinilai berpendidikan, punya banyak uang, punya jaringan koneksi, lebih gigih dan punya banyak pengalaman. Dengan kelebihan yang dimiliki perantau tersebut—mereka harus menjadi motor gerakan Martabe.Merekamestiberbuatsesuatusecarakolektifuntukkampung halamannya,untukorang-orangyanghidupdanmenetapdikampung tersebut seperti orang tuanya, kaum kerabatnya dan para penduduk kampungnya tanpa kecuali. Dengankharismayangdimiliki,kewibawaandankekuatankarakter pribadinya, ditambah rasionalitas konsep yang ditawarkan, gagasan Martabe mendapat dukungan hampir dari semua tokoh umat beragama, tokoh adat, kalangan pemuda dan yang tidak kalah pentingnya adalah dukungan dari media massa juga perguruan tinggi. Tidak sekedar mengajak orang lain, RIS juga melakukan sendiri membangun kampungnya. Salah satunya, pada 1996 ia mendirikan SMA Plus Martabe di Kecamatan Sipirok,Tapanuli Selatan bersama masyarakat Tapanuli Selatan. Ini adalah satu-satunya SMA plus di Tapanuli Selatan. Bagi para siswa disediakan berbagai fasilitas gratis seperti asrama, seragam, biaya makan dan lainnya. Namun untuk bisa sekolah di tempat ini perlu berjuang lebih dahulu, menunjukkan kemampuan dan prestasinya. Konsep pembangunan ini berawal dari pemikiran bahwa salah satu pendekatan yang tepat untuk meraih partisipasi masyarakat dalam pembangunan desa adalah mengadopsi nilai-nilai yang terkandung dalam horja. Makna harfiah kata horja ini berarti kerja. Tetapi secara hermenetika (pemahaman makna), maknanya lebih berarti. MasyarakatBatakmemahamihorjadidalampengertianlahirdanbatin. Dalam horja, seluruh komponen Dahlian Na Tolu turut mengambil bagian. Setiap unsur di dalam masyarakat berpartisipasi aktif. Menyukseskan horja merupakan hak dan kewajiban. Bahkan warga masyarakat yang tidak diikutsertakan di dalam mensukseskan horja akan menuntut haknya untuk ikut, meskipun keikutsertaan itu sesungguhnya merupakan pengorbanan waktu, tenaga, dan dana. Namun pengorbanan di dalam menyukseskan horja adalah pengorbanan yang ikhlas dan tulus. RIS dilahirkan di Medan pada 5 Maret 1938. Orang tuanya adalah Kario Siregar dan Rodiah Hutasuhut. Ia meninggal dunia 5 September 2005 pada umur 67 tahun, bersama Gubsu yang menggantikannya, HT. Rizal Nurdin, dalam kecelakaan pesawat Mandala Airlines pada 5 September 2005. Karirnya di dunia militer dimulai ketika lulus Akademi Militer tahun 1961. Berbagai jabatan didudukinya, antara lain sebagai Komandan Kompi (Danki) Yonif B Purwokerta (1965-1967), Karo Ops. Kowanda Ujungpandang (1967-197), Waas Intel Kodam II/BB (19751978), Asisten Intel Kodam I/ Iskandar Muda (1978-1982). Jawaban Problem Catur, Kemudian Asisten Kodam IV/ Siliwangi (1982-1983), Kasdam Dari Halaman Sport. II/BB (1983-1984), Pangdam XIII/ Merdeka (1984-1985), Pangdam III/Siliwangi (1985-1988). 1. Bf8+, MxB. Ia adalah Gubsu ke-12 dan 2. BxM+, Rg7. 13. Setelah tidak lagi menjabat sebagai gubernur, ia terpilih men3. MxBd6, Bh6. jadianggotaDPDSumateraUtara sejak tahun 2004. Kini Raja Inal 4. Me7+, Rg6. sudah tiada, tapi karya nyata5. Bg8+, Rf5 nya masih membuat namanya harum. Masyarakat Sumut kini atau Rh5. menunggu orang yang tepat untuk menjadi pemimpin seperti 6. h3xg4+mat. (Jika RajaInaldanmeneruskankonsep 1. ....., Rg7. Hitam untukmengentaskankesenjangan pembangunanyangterjadi. (m07/ mati lima langkah). Dari berbagai sumber)


SEJUMLAH warga mengamati truk pengangkut oli yang mengalami kecelakaan di Jalan Raya Cianjur - Sukabumi,Warungkondang, Cianjur, Jawa Barat, Sabtu (23/2). Kecelakaan yang melibatkan truk, angkutan kota, serta sepeda motor tersebut mengakibatkan 16 orang tewas, 7 luka berat, 4 luka ringan dan 2 rumah rusak.

kepada Amri Tambunan karena sudah punya karya nyata dalam pembangunan khususnya di Deliserdang dua periode. Amri Tambunansosokpemimpinyang ahli di pemerintahan diyakini mempunyai strategi pembangunan yang dapat ditularkannya untuk Provinsi Sumatera Utara seperti pembangunan infrastruktur jalan, sekolah, kesehatan dan rumahbagimasyarakatyangtidak layakhuni dibenahmenjadilayak huni. Keunggulan Amri Tambunan mampu menyelenggarakan sarana dan prasarana itu dengan melibatkan partisipasi masyarakatataupihakketiga,tanpamelulu mengandalkan APBD. Khusus infrastruktur, akses jalan ke pelosok Deliserdang mudah dijangkau dengan aspal hotmix sehingga perekonomian masyarakat dapat berkembang. BegitujugaibuNaniSumarni, anggota pengajian dan pengurus Koperasi An-Nisa Azzahra di Medan dan pengurus Koperasi AnnisaWilayah Sumut Hj Leny Kawilarang yang turut datang ke Posko TEPAT secara bersamaan mengatakan, Amri Tambunan sudah teruji melalui karya-karya besarnya di Deliserdang. Dia mengharapkan jika Pak Amri

Warga Binjai ... “Semua ini bertujuan menciptakan masyarakat Sumut Sejahtera dengan patokan angka kemiskinan berada di bawah lima persen diakhirkepemimpinan,”jelasGus. Juru Kampanye Langkat sekaligus Ketua RGM Center Sumut, Yan Syahrin dalam orasi politiknya mengatakan, GusMan pemimpin Sumut paling ideal untuk kebangkitan Sumut ke depan. “Kita sudah jauh tertinggal dibanding daerah lain dalam segala hal. Untuk itu mari ciptakanperubahandenganmencoblos nomor 1 pada Pilgubsu 7 Maret yang hanya tinggal hitungan hari,” paparnya. Kaharuddin, 48, warga Tanjungpura menyambut antusias visi misi GusMan. Selaku masyarakat Sumut tentunya berharap perubahan utama di bidang ekonomi dengan visi misi Sumut Sejahtera. Hal senada dikatakan Rahmad warga Gebang yang menambahkan, kemiskinan di Sumut harus dientaskan. “Ekonomi saat ini sudah carut marut, untuk membeli Sembako dan keperluan lain harga sudah ting-

7 Perampok ... isteri pemilik toko. Ketika itu sekira pukul 08:30, komplotan perampok masuk ke toko dan mengancam Mismuna, 54 dengan senjata api. Korban kemudian diikat, sementara suaminya Syahril, 56, belum pulang dari mengantar anak ke sekolah.Tetapi saat dia pulang, langsung disekap para tersangka dengan todongan senjata. Kepada wartawan, Syahril mengatakan tidak mengetahui jenis senjata digunakan para tersangka. “Saat tidak tahu pasti, tetapi ketika itu saya baru saja pulang dari mengantar anak sekolah. Mereka pura-pura mau jahit pakaian, lalu saya dan istri saya diikat pakai lakban. Kami disekap di kamar mandi,” katanya. Sementara Kapolda mengatakan, tujuh tersangka yang ditangkap dari lokasi kejadian merupakaneksekutor,sedangkan tiga tersangka yang ditangkap di Binjai bertugas memantau target perampokan. Para pelaku sempat menggasak uang Rp200 juta milik

Anas Mundur, ... Sebelum digelar konferensi pers, Wakil Direktur Eksekutif Partai Demokrat, M Rahmat di kantor DPP PD, Jalan Kramat Raya, Jakarta Pusat, kemarin, menyatakan setelah pengunduran Anas Urbaningrum, tak ada pelaksana tugas (plt) untuk jabatan ketua umum. Sesuai AD/ART, maka harus digelar Kongres Luar Biasa (KLB). “Tidak ada plt, itu sesuai AD/ART,” ujarnya. Sementara Sekretaris Jenderal Partai Demokrat, Edhie Baskoro Yudhoyono juga tak ikut mendamping Ketua Umum.”Mas Ibas juga tak ikut,” tambah Rahmat.

Minggu 24 Februari 2013

Tengku Erry Kunjungi Pasar

Tabrakan Maut:

Amri RE Paling ...


MEDAN (Waspada): Cawagubsu pasangan GanTeng nomor urut 5, Tengku Erry Nuradi mengunjungi dua pasar di Kota Medan yakni Pasar Aksara dan Pusat Pasar, Sabtu (23/2). Dalam kunjungan silaturahmi itu, Tengku Erry disambut meriah para pedagang dan warga yang umumnya minta berfoto, berbincang bahkan menari bersama para pedagang. ‘’Pembangunan pasar merupakan kewenangan pemerintah di kabupaten/kota. Namun Pemerintah Provinsi Sumatera Utara (Pemprovsu) memungkinkan memberikan dukungan. Kita akan rangkul Kab/Kota untuk menata pasar-pasar sebagai urat nadi perekonomian masyarakat,’’ sebut Tengku Erry. Tengku Erry Nuradi yang mendampingi Cagubsu Gatot Pujo Nugroho dalam pertarungan Pilgubsu 7 Maret mendatang juga menyebutkan, ke depan Pemprovsu harus melakukan terobosan baru dalam menggerakkan roda perekonomian masyarakat. Salah satunya memperbaiki manajemen pasar tradisional agar mampu bertahan di tengah maraknya pertumbuhan pusat perbelanjaan mewah. “Melestarikan pasar tradisional memang menjadi tanta-

terpilih dapat meningkatkan lagi pembangunandiSumateraUtara. Ibu Nani Sumarni menyatakan tertarik dengan AmriTambunan karena di dalam dirinya memiliki cahaya seorang pemimpin yang berwibawa dan tegas. Selain itu AmriTambunan dikenal anti jual beli jabatan dan mengharamkan KKN. Dengan demikian, visi misinya untuk membangun Sumatera Utara dapat terwujud. Jika pemimpinnyabersihmakasecara otomatis bawahannya pasti bersih dan peduli masyarakat. Kemudian, komentar dari Ketua MajelisTaklim Medan Helvetia Dra Nurhanim Panjaitan yang juga datang bersamaan mengatakan,diasimpatikdengan Pak Amri karena rekam jejaknya lebih baik dari cagubsu lainnya dan memiliki kompetensi dalam mengelola pemerintahan. Kemudian, Pak Amri tidak pernah mengumbar janji kepada masyarakat agar memilihnya. Pak Amri selalu berfikir realistis dalam menyikapi pencolonannya dan citacitanya bersama rakyat Sumut untuk membangun provinsi ini agar namanya besar Sumut kembali bangkit dengan potensi perkebunan, kelautan, sumber daya alam dan aneka ragam etnis dan agama. Dengan rekam jejak Amri Tambunan, potensi Sumut dapat

dikelola dengan baik untuk mendorong kesejahteran rakyat bersama kabupaten/kota. Ibu Nurhanim menegaskan banyak isu yang mengaitkan pencolanan Amri RE kepada kepemimpinan sebelumnya. Namun, dia tidak akan pernah percaya sebab isu itu tidak cukup alasan dan sengaja dilontarkan oleh kelompok orang yang ingin Pak Amri RE memimpin Sumut. “Kami tetap komit dan memberi dukungan kepada Amri RE,” ujarnya disambut yel-yel ibu-ibu pengajian lainnya dengan mengacungkan empat jari tangan simbol nomor 4 Amri RE. Menurut para ibu-ibu yang komit terhadap AmriTambunan menyatakan jika suara ibu-ibu mendukung Pak Amri, insya allah keberhasilan itu akan mudah diraih. Apalagi Amri Tambunan dekat dengan ibu-ibu pengajian dan organisasi perempuan lainnya. Dalam visi-misinya jelas Pak Amri menunjukkan kepedulian terhadap perempuan dan anak. Usai menyatakan kebulatan tekadnya memilih nomor 4, Amri Tambunan melalui tim TEPATSumutmengucapkanterimakasih. Kebersamaan ini harus terus dipertahankan untuk bersama-sama membangun Sumut yang lebih baik. (m13)

gi. Kami mengharapkan semua itu dapat diatasi oleh pasangan GusMan,” ujarnya. Setelah menggelar orasi di Langkat, rombongan Gus menuju Lapangan Kebun Lada, Kel. Kebun Lada, Binjai Utara, Binjai. Sekitar 10 ribu warga Binjai menyambut Gus. Disini juga Gus menyampaikan orasi politik yang mampu memotivasi warga Binjai untuk melakukan perubahan menuju Sumut Sejahtera. Rizal, 50, warga Kebun Lada, menilai GusMan selain memberantas kemiskinan, juga diharapkanmenjadikaninfrastrukturbaik menuju Binjai dan Langkat menjadi salah satu prioritas utama. “Kita sudah lihat sendiri bagaimana kondisi jalan di sini. Di tengah kota saja banyak lubang, untuk itu kami berharap GusMan memperbaiki ini semua nantinya,” ungkapnya. Dalam kampanye akbar di dua tempat berbeda itu, selain diikuti 30 ribu massa, turut mendampingi Ny Murni Gus Irawan, tim pemenangan GusMan Center Jhon Sari Haloho, Panusunan Pasaribu,Yan Syahrin, Ketua PAN Sumut Ondim, kader Ge-

rindra, PAN dan koalisi partai pendukung, relawan dan simpatisan. Di Langkat dan Binjai, Gsu melakukan simulasi pencoblosan. Sebelum berkampanye Gus bersama rombongan menuju Perkampungan Babussalam, Kecamatan Tanjungpura, Langkat. Pada kesempatan tersebut,Tuan GuruBabussalamyangke10,Syekh HHasyimAlSyarwanimendoakan perjuanganuntukkesuksesanGus mengarungi pentas Pilgubsu. “Hanya doa dan keikhlasan hati yangbisakitaberikanuntukmendukungGus,”ujarTuanGuruSyekh H Hasyim Al Syarwani sembari melanjutkan silaturrahmi tersebut dengan melaksanakan shalat Zuhur berjamaah. Usai salat berjamaah, Gus mendapat penghargaan dengan dijamu makan siang oleh Tuan Guru Syekh H Hasyim Al Syarwani, dimana dalam budaya masyarakat Melayu Babussalam, jamuan makan oleh Tuan Guru merupakan sebuah kehormatan besar. Setelah itu, Gus bersama rombongan ziarah di makam Tuan Guru I yakni Alm Syekh Abdul Wahab Rokan.(m06)

korban. Tetapi sebelum berhasil membawa hasil rampokan itu, polisimelakukanpenggerebekan, mendobrak pintu dan menangkapparapelaku.Daripemeriksaan petugas, tujuh orang itu merupakan warga Aceh, empat asal Takengon, dua asal Lhokseumawe dan 1 asal Kutacane. Ditanya wartawan apakah di antara tersangka yang ditembak itu oknum TNI, Kapolda belum menjelaskan secara rinci dengan alasan para tersangka belum diperiksa. “Belum bisa disimpulkan karena mereka belum diperiksa, mereka masih dirawat di Rumah Sakit Bhayangkara,” katanya. Tetapi identitas pelaku yang ditembakdisebutkan,yaituSuaib, 38, Mujadi, 24,Yadi, 32, Ance Mahendra, 32, Heru, 21. Saat diringkus menggunakan kaus loreng dan sepatu PDL. Kemudian Hamdan Ismail, 43 dan S Ginting, 43. Sedangkan tiga lagi juga warga Aceh, kini ditahan di Polresta Medan. Sementara saksi mata mengatakan, saat itu mendengar suara tembakan satu kali dari luar rumah,kemudianterdengarpintu

di dobrak. “Sebelum penangkapan sekira pukul 06:00 saya melihat mobil parkir tidak jauh dari toko jahit, bahkan seorang di antara pelaku sempat sarapan pagi di kedai saya,” kata Eva, tetangga korban tidak menyangka akan terjadi perampokan. Untuk penyidikan, mobil Daihatsu Xenia silver BK 1505 KF melapisi plat BK 1045 ZB dan barang bukti lainnya, seperti senpi, pisau, lakban, handphone, perhiasan emas dan lainnya disita polisi. Sementara para tersangka akan dikenakan Pasal 365 KUHP, dengan ancaman penjara di atas lima tahun. Kapolresta Medan Kombes Monang Situmorang menambahkan, untuk mengantisipasi aksi kejahatan pihaknya menempatkan sejumlah personil di lokasi-lokasi rawan, termasuk di lokasi yang pernah terjadi kasus kejahatan. “Penempatan personil sudah sejak bulan puasa lalu,” kata dia berterima kasih kepada pemilik toko yang memasang CCTV, karena akan membantu pihak kepolisian dalam mengungkap kejahatan. (m39)

terus berkarya sesuai amanah Tridarma Penguruan Tinggi. “Dengan cara itulah akan lahir guru besar baru lainnya di masa yang akan datang,” ujarnya. Meski demikian, lanjut dia, seleksi semakin ketat dengan persyaratan akademik yang berat diharapkan tidak menjadi kendala bagi para dosen yang sudah bergelar doktor untuk menduduki jabatan guru besar. Menurut Samsul Rizal, keberadaan guru besar sangat penting dalam memecahkan berbagai persoalan dalam masyarakat. “Jabatan guru besar tidak terlepas dari fungsinya sebagai peneliti, penulis pemuliaan dan penyebar ilmu pengetahuan dan teknologi,” ujarnya. Kata Rektor, pengabdian kepada masyarakat hendaknya perlu difungsikan secara maksimal. “Karena kecenderungan para dosen yang belum bergelar guru besar belum menjalankan Tridarma Penguruan Tinggi secara maksimal pula,” tutur Samsul Rizal. (b07)

Selanjutnya, Anas menyatakan dirinya berhenti sebagai ketua umum karena sesuai pakta integritas yang telah ditandatanganinya. “Posisi tersangka saya itu lebih dari karena faktor-faktor nonhukum, saya punya standar etik pribadi. Kalau saya punya status hukum, saya akan berhenti. Itu standar etik pribadi saya dan itu cocok dengan pakta integritas atau tidak,” kata Anas. Dalam konferensi pers tersebut Anas menegaskan dirinya percaya proses hukum yang adil, obyektif dan transparan. Ia berharap kebenaran dan keadilan masih bisa ditegakkan. “Karena saya percaya nege-

ri kita ini berdasarkan hukum dan keadilan, bukan berdasarkan prinsip kekuasaan,” katanya. Langkah selanjutnya, Anas akan melakukan pembelaan hukum sebaik-baiknya. ”Lewat proses pembelaan hukum, bukti dan saksi-saksi yang kredibel, saya meyakini betul sepenuhnya bahwa saya tidak terlibat dalam proses pelanggaran yang disebut sebagai proses hambalang itu,” demikian Anas. Dalam kesempatan tersebut, Anas yang mengenakan jaket biru dengan logo Demokrat di dada sebelah kiri dan bordir nama“Anas Urbaningrum” di bagian kanan ini mengucapkan terima kasih dan meminta maaf kepada kader

Partai Demokrat yang memberikan kepercayaan dan mandat politik sebagai Ketua Umum Partai Demokrat periode 20102015. “Saya mohon maaf kalau saya berhenti di awal 2013 ini. Saya tidak pernah merencanakan untuk berhenti tahun 2013,” katanya. Anas tiba di kantor DPP Partai Demokrat sekitar pukul 13.50 WIB dan pidatonya berlangsung sekitar 30 menit. Anas tidak melakukan tanya jawab dengan wartawan setelah konferensi pers selesai. Kedatangannya disambut puluhan pendukungnya dan jep-retan kamera wartawan yang telah menunggunya sejak pagi.

Waspada/Surya Efendi

CAWAGUBSU nomor urut 5, Tengku Erry Nuradi berdendang ria bersama pedagang dan warga di Pasar Aksara Medan dalam kunjungan silaturahmi, Sabtu (23/2). ngan ke depan. Jangan sampai punah digilas pusat perbelanjaan mewah. Pasar tradisional menjadi penyeimbang fluktuasi harga barang dipasaran,” sebut Erry. Erry juga menegaskan, pasar tradisional yang ideal adalah pasar yang menjamin kebersihan, kenyamanan dan ketersediaan seluruh kebutuhan pokok masayarakat. “Jika pasarnya bersih dan nyaman serta tertata rapi, pembeli pasti datang. Pe-

dagang juga akan untung. Perekonomian masyarakat berjalan lancar,” yakin Erry. Usai mengunjungi Pasar Aksara, Tengku Erry bergerak menuju Pusat Pasar. Disini, para pedagang dan warga juga menanti kehadiran bupati Serdang Bedagai ini. Pedagang dan warga juga berebut berfoto dan berbincang dengan Tengku Erry. Menjelang tengah hari, Tengku Erry menikmati makan siang bersama warga di Pusat Pasar.(m46)

Chairuman Menyatu Dengan Pedagang Di Gunungsitoli GUNUNGSITOLI (Waspada): Kandidat Gubsu Dr H.Chairuman Harahap, SH, MH berkelilingdanmengunjungiratusan para pedagang di sejumlah pasar di Kota Gunungsitoli, Jumat (22/2). Chairuman didampingi isteri Ratna Sari Lubis dan Tim Pemenangan serta pengurus Partai Golkar se Kepulauan Nias mengunujungi sejumlah pasar di antaranyaPasarBeringin,Pasar Gomo, Pasar Gudang Garam, Pasar Ya’ahowu dan Pasar Luaha. Kedatangan kandidat kuat nomor urut 3 ini disambut meriah oleh masyarakat dan ratusan pedagang di lokasi tersebut. Mereka berebutan menyambut Chairuman dengan bersalaman tangan langsung. Chairuman merasa sangat terharu atas keramah-tamahan masyarakat Nias yang menyambutnya dengan antusias. Pada kesempatan itu Chairuman dengan sabar melakukan dialog sekaligus mendengar aspirasi masyarakat dan para pedagang yang mengungkapkan mereka merasa kesulitan mendapatkan tempat berjualan serta masih tingginya harga sembilan bahan kebutuhan pokok sehingga masyarakat sulit menjangkaunya. Chairuman yang didampingi dengan setia oleh isteri Ratna Sari Lubis di sela kunjungannya di sejumlah pasar di Kota Gunungsitoli kepada Waspada mengakui dirinya sangat terharu atas sambutan dan keramahtamahan masyarakat Nias. Menurutnya potensi daerah Kepulauan Nias sangat besar namun karena belum dikelola dengan baik serta minimnya fasilitas pendukung belum dapat memberikan kesejahteraan bagi masyarakat di daerah ini. Salah satu yang menjadi potensi andalan di Kepulauan Nias jika dikelola dengan baik dan didukung fasilitas yang baik yakni sektor pariwisata dan perikanan kelautan.

Unsyiah Target ...

Waspada/Bothaniman Jaya Telaumbanua

KANDIDAT Gubsu Dr H.Chairuman Harahap, SH, MH disambut antusias ratusan pedagang di sejumlah pasar di Kota Gunungsitoli, Jumat (22/2). Kepulauan Nias mempunyai potensi cukup besar dikembangkan untuk menumbuhkan ekonomi masyarakat. Sehingga konsep Membangun Mulai Dari Desa sangat relevan dilakukan di Kepulauan Nias untuk menumbuhkembangkan ekonomi masyarakat yang dimulai dari kampung atau desa, ungkap Chairuman “Dulu Kepulauan Nias sangat terkenal sebagai penghasil Kopra, tetapi kini sudah mulai berkurang. Untuk meningkatkan kembali ekonomi rakyat Kepulauan Nias, kebun kebun kelapa milik masyarakat yang ada di Kepulauan Nias harus kembali diremajakan,” tambahnya. Selain itu potensi laut di Kepulauan Nias juga sangat besar menurut anggota DPR RI tersebut, sehingga sektor perikanan bisa ditumbuhkembangkan dengan membuka pabrik pengalengan ikan. “Menurut saya, selain sektor perkebunan, potensi laut, sektor pariwisata juga bisa menjadi andalan karena Nias terkenal dengan ombaknya yang bagus, keindahan alamnya dan keramahtamahan orang masyarakat-

nya sehingga Nias dapat kita wujudkan sebagai daerah pariwisata,” tutur Chairuman. Namun semua itu menurut Chairuman terkendala karena fasilitas pedukung yang kurang. Untuk mendongkrak hal tersebut perlu ditumbuhkan ekonomi rakyat sehingga rakyat yang akan menumbuhkan fasilitas itu semuanya. “Pembangunan perekonomian di Kepulauan Nias terkendala karena kurangnya fasilitas, untuk mendongkrak itu semua perekonomian masyarakat perlu ditumbuhkan agar masyarakat itu sendiri yang menumbuhkan semua fasilitas, pemerintah hanya membangun infrastruktur, tetapimasyarakat yang akan membangun fasilitas seperti hotel, penginapan, rumah makan dan lain lain sebagainya,” ujarnya Selain mengunjungi sejumlah pasar di Kota Gunungsitoli, Chairuman rencananya bersama Plt. Ketua DPD I Partai Golkar Sumut, Andi Achmad Dara akan membuka orientasi kader Partai Golkar se Kepulauan Nias yang berlangsung hingga Sabtu (23/2). (a25)

Duel Strategi Mancini ... Sebagai tuan rumah, tidak mudah bagi City untuk meraih tiga poin. Apalagi The Blues memiliki sederetan pemain pengalaman yang berhasil meraih gelar Liga Champions Eropa musim lalu. Belajar dari kemenangan AC Milan atas Barcelona 2-0 di babak 16 Besar Liga Champions Eropa membuktikkan sepakbola penuh dengan kejutan. Bukan mustahil, Chelsea mempermalukan Ctiy di rumah sendiri. Ketika Chelsea ditukangi pelatih asal Italia Roberto de Matteo, Si Biru menjadi sebuah tim yang memiliki pertahanan solid ala grandell Italia. Permainan itupula yang mengantarkan Chelsea menjadi juara Liga Champions dengan mengalahkan sederetan klub papan atas Eropa seperti Barcelona dan Bayern Munich. Kini Chelsea ditangani Rafael Benitez. Maestro yang sebelumnya menangani Liverpool berbeda dengan Roberto de Matteo. Sampai pekan ke-26, Chelsea kebobolan 28 gol dan lebih banyak ketimbang City 24 gol. Masuknya Demba Ba pada bursa transfer Januari lalu dari Newcastle United menunjukkan Benitez ingin mempertajam lini depan membantu Fernando Torres. Pemain beragama Islam ini menyampaikan keyakinannya Chelsea akan merepotkan Manchester City. “Saya berpikir kami akan mengambil kesempatan untuk dapat menempel dan terus berupaya meraih posisi kedua yang sekarang ditempati Manchester City,” kata Demba Ba dilansir dari Sky Sports, Sabtu (22/2). Demba Ba menyampaikan kesiapannya untuk diturunkan. Chelsea, Kamis (20/2) memetik kemenangan atas Sparta praha 2-1. Sekarang bagaimana keberanian Rafael Benitez mengintruksikan John Tery Cs mengadopsi pertahanan grandell ala Italia untuk “mematikan” pergerakan Sergio Aguero dan Carlos Tevez sebagai playmaker. Disiplin dan kekompakkan Si Biru akan menyulitkan The Citizen menembus gawang Chelsea yang dikawal Petr Cech. Dari reuni kedua tim lima pertandingan terakhir, City dan Chelsea berimbang masing-masing meraih dua kemenangan dan sekali imbang. Striker City Sergio Aguero berharap menghadapi bigmatch lawan Chelsea, timnya bisa meraih kemenangan. Pada pertandingan terakhir di liga utama, City takluk di tangan Southampton dengan skor 3-1. Striker asal Argentina itu berharap kemenangan besar melawan Leeds United 4-0 di ajang FA Cup lalu, bisa memberikan semangat dan kepercayaan rekan setimnya. “Ini (kemenangan di FA Cup) menolong kami untuk melakukan hal-hal yang lebih baik dan memberikan kami kepercayaan untuk pertandingan melawan Chelsea,” ujar Aguero di City TV, kemarin. “Ini akan menjadi pertandingan hebat dan sulit, tapi jelas kami ingin bangkit dan menang. Kami mencoba untuk tidak kehilangan banyak poin di liga, untuk itu kami akan mengamankan semuanya dengan tiga poin,” sambungnya. City mendapatkan keuntungan pada laga nanti, karena memiliki waktu istirahat lebih banyak dibandingkan The Blues. Sebab pasukan Rafael Benitez itu baru saja menyelesaikan pertandingan leg kedua melawan Sparta Praha. (m18/sky sports)

Lima Pertemuan Terakhir 25/11/2012: Chelsea 0-0 Manc. City (EPL) 12/8/2012: Chelsea 2-3 Manc. City (Community Shield) 22/3/2012: Manc. City 2-1 Chelsea (EPL) 13/12/2011 : Chelsea 2-1 Manc. City (EPL) 20/3/2011: Chelsea 2-0 Manc. City (EPL)

WASPADA Minggu 24 Februari 2013


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Hajrul Azhari Ritonga, Arianda Tanjung. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Sumut - Aceh


Penasihat Gubernur Aceh Dicekal Masuk Malaysia BANDA ACEH (Waspada): Keimigrasian Malaysia mencekal Penasihat Gubernur Aceh berinisial ZS yang berkunjung ke negara itu. Pencekalan tersebut dilakukan berdasarkan Akta Imigrasi Malaysia terkait pasal Keselamatan Negara. Informasi yang Waspada peroleh, Sabtu (23/2), ZS yang juga Komisaris Perusahaan DaerahPetroleumAcheh,nomorPasport T-349249 itu, tiba di LCCT Sepang, 20 Februari pukul 14:10 waktu setempat dengan pesawat terbang bernomor penerbangan AK 1306 dari Jakarta. ZS masuk

ke Malaysia bersama istrinya Cut Azalia Rahmi, Sulaiman Aziz, Muhammad Djuli beserta istri Shadia Marhaban. “ZS dicekal masuk Malaysia, berdasarkan akta Imigrasi Malaysia terkait pasal keselamatan negara.Yang dicekal hanya ZS saja. Dia dideportasi bersama istrinya ke Jakarta pada hari itu juga pukul 22:55 waktu setempat dengan pesawat terbang nomor penerbangan QZ 8197,” kata sumber di Malaysia. Menurut sumber, Pemerintah Malaysia mengidentifikasi ZS, pria kelahiran 1 Januari 1946 itu, pernah melakukan penyelundupan senjata dari Thailand ke Aceh

via Malaysia pada saat konflik GAM di Aceh. Alasan lain, juga karena keamanan menjelang Pemilu di Malaysia pada Maret-April 2013 mendatang. Disebutkan juga, setelah ditangkap di Imigrasi Malaysia, ZS diserahkan ke Petugas Special Branch (SB), karena yang bersangkutan bersikap arogan dan tidak kooperatif antara lain dengan tidak mau menjawab setiap pertanyaan petugas dan mengakumempunyaipasporWN Swedia. Namun, saat dimintai petugas, yang bersangkutan tidak bisa menunjukkan pasport Swedia tersebut. Setelah dideportasi, di Jakarta

ZS melaporkan hal itu kepada Jusuf Kala sehingga Jusuf Kala meneleponDutaBesarRIdiMalaysia agar mengupayakan ZS bisa masuk lagi ke negara itu. Namun, hingga saat ini belum dikoordinasikan ke Pemerintah Malaysia tentang kemungkinan tersebut, karenatidakadayangdapatmenjamin ZS tidak akan melakukan penyelundupan senjata seperti pada masa konfik Aceh. Kepala Biro Humas Setdaprov Aceh Nurdin F. Jose mengaku pihaknya belum mendapat informasi tentang pencekalan tersebut.“Sayabelummendapatinformasi tentang hal itu, nanti saya cek dulu,” ujarnya. (b05)

Kuala Langsa Pintu Gerbang Pelabuhan Internasional Aceh LANGSA (Waspada): Dibukanya jalur pelayaran LangsaPenang, langkah awal menjadikan Pelabuhan Kuala Langsa sebagai pintu gerbang pelabuhan internasional di Provinsi Aceh. Dibandingkan dari Pelabuhan Belawan, Sumatera Utara, jarak tempuh Kuala Langsa ke Penang relatif lebih dekat. Demikian diutarakan Wakil Gubernur Aceh Muzakir pada launching peresmian pelayaran perdana kapal ferry yang menghubungkanKualaLangsadengan Penang, Malaysia di Pelabuhan Kuala Langsa, Sabtu (23/2). Hadir pada kesempatan itu, Wali Kota Langsa Usman Abdullah,Wakil Ketua MPR RI Farhan Hamid, anggota DPR RI dan Ketua Pemantau Ostus AcehPapua Marzuki Daud, Kapolres Langsa AKBP Hariadi, Dandim 0104/Atim Muhammad Hasan, Dirut PTPN IWargani, Ketua PN Langsa Efendi,muspida, muspida plus Kota Langsa dan Aceh beserta undangan. Hanya saja, menurut Muzakir, hubungan geografis yang dekat itu selama ini belum dimanfaatkan untuk hubungan kerjasama pelayaran antara kedua wilayah. Selama bertahun-tahun rakyat Aceh selalu menggunakan jasa pelabuhan Belawan jika ingin berangkat ke Penang dengan kapal komersil. Begitu juga dengan hasil bumi Aceh, lebih banyak diekspor melalui pelabuhan Belawan. “Kitasebenarnyatahubahwa ada potensi geografis yang menguntungkan, tapi jika kita tidak mampu memanfaatkan kelebi-

hanitu,makakitaselamanyaakan terus bergantung kepada daerah lain,” katanya. Menyadari kelemahan itu, terangnya, perlu sebuah terobosanyangmemaksaagarkitaberani berubah. Upaya Pemko Langsa yang membuka jalur pelayaran Kuala Langsa-Pulau Penang adalah salah satu bentuk terobosan yang pantas kita beri apresiasi. “Saya memahami, untuk membukajaluriniperluperizinanyang tidak mudah. Tidak hanya izin dari pemerintah pusat, tapi juga izin dari pihak Malaysia. Namun semua upaya itu berhasil diselesaikan oleh pemerintah Kota Langsa,” katanya. Dengan dibukanya jalur ini, sudah pasti akan banyak manfaat yang bisa diperoleh masyarakat Aceh dan Malaysia. Di antaranya, jalur ini akan memperlancar promosi pariwisata, memudahkan masyarakat untuk berkunjung ke Penang dan sebaliknya. Sebagaimana yang kita ketahui, di Malaysia sendiri ada sekira 2,5 warga keturunan Aceh yang berdiam di Malaysia. Tentunya jalur ini akan memudahkan mereka jika ingin pulang ke kampung halaman. Kemudianaktivitaspelayaran ini akan mendorong bangkitnya ekonomi masyarakat sekitar. Melalui pelabuhan ini juga kita berharap agar arus investasi yang masuk ke Aceh bisa dipercepat, karenanya lewat jalur ini perlu memperkuat kemitraan investasi regional. “Pembukaan jalur pelayaran ini juga kita harapkan semakin memperkuat kerjasama bilateral antara pemerintah Malaysia dan Indonesia,” paparnya.

masih dalam wilayah Aceh tentu jumlah calon peserta UN itu tidak berubah, tapi hanya terjadi pergeseran lokasi saja,” kata Laisani yang sedang mempersiapkan sosialisasi kebijakan UN 2013 keseluruh Aceh mulai pekan ini. Sekretaris Panitia UN Aceh Zulkarnaini, merincikan jumlah calon peserta UN 2013 untuk jenjang SMA jurusan IPA dan IPS sebanyak 45.007 siswa, MA jurusan Bahasa, IPA, IPS dan Keaga-

WAKIL Gubernur Aceh Muzakir Manaf didampingi Wali Kota Langsa Usman Abdullah menggunting pinta sebagai tanda dimulainya launching pelayaran perdana ferry dari Langsa-Penang, Malaysia di Pelabuhan Kuala Langsa, Sabtu (23/2). Dia kembali menegaskan, pembukaan jalur ini merupakan langkah awal dari banyak pihak yang ingin kita capai ke depan. Setelahini,menyusulpembangunan cargo ekspor-impor di Pelabuhan Kuala Langsa. Dengan demikian, kerjasama bisnis antara pengusaha Malaysia dan Aceh bisa diperkuat. Wali Kota Langsa Usman Abdullah mengatakan, dengan adanya jalur baru untuk kapal ferry Penang-KualaLangsadiharapkan dapat meningkatkan dan memperkuat kerjasama bilateral kedua negara baik dari segi politik, ekonomi,soasialdankebudayaan serta investasi dan pariwisata. “Denganadanyajalurpelayaran ini nantinya rute pelayaran

ini akan dilayani oleh kapal Feri MV Suka Express berkapasitas 138 orang dengan tujuh orang kru, serta Kapal fery Kenangan 3 dengan kapasitas 192 orang dan tujuh orang kru, dengan jadwal pelayaran dari Penang - Kuala LangsasetiaphariSenindanRabu. Sedangkan, rute Kuala Langsa Penang setiap hari Selasa dan Kamis pukul 09:00,” katanya. Sementara itu, harga tiket untuk orang dewasa Rp 500.000 dan untuk anak-anak dibawah usia 12 tahun Rp 350.000 Pulang Pergi. Guna kelancaran operasi fery ini kita telah memenuhi syarat yang ditetapkanolehpemerintahsesuai dengan Peraturan Pemerintah RI Nomor 20 tahun 2010 tentang angkutan perairan. (m43)

maan sebanyak 12.102 siswa serta SMK sebanyak 10.563 siswa. “Total calon peserta untuk sekolah menengah dan kejuruan sebanyak 67.736 siswa, termasuk di dalamnya 64 siswa SMA Luar Biasa,” ungkap Zulkarna ini yang menyebut waktu pelaksanaan UN jenjang SMA/MK/ MA dan SMALB ini pada 15-18 April 2013. Sementara calon peserta UN untukjenjangSDsebanyak77.286

murid,MIsebanyak17.463murid, dan SDLB sebanyak 145 murid. SelanjutnyaSMPsebanyak60.856 siswa,MTssebanyak21.319siswa, dan SMPLB sebanyak 133 siswa. Sedangkan jumlah calon peserta sementara UN untuk paket C jurusan IPA sebanyak 11 orang dan jurusan IPS sebanyak 1.696 orang, Paket C kejuruan enam orang, Paket A/Ula sebanyak 132 orang serta Paket B/Wustha sebanyak 914 orang. (b06)

Peresmian Tiga Lembaga Publik Di Aceh Tengah TAKENGEN (Waspada): Meski era globalisasi telah berkembang, namun etnik Gayo masihmenjagatradisinyadengan baik. Pelestarian budaya ini menyebabkan Aceh Tengah begitu dikenalhinggaditingkatnasional. Hal ini dikatakan Azwar Abubakar, Menteri Pendayagunaan Aparatur Negara dan Reformasi Berokrasi RI, Sabtu (23/2), saat meresmikan tiga lembaga publik di Aceh Tengah, berlangsung di lapanganpacuankuda,HMHasan Gayo,Pegasing. Adapun tiga instansi dimaksud yakni; LPB RRI

KABANJAHE(Waspada):GunamemenangkankandidatGubernur danWakil Gubernur Sumut Drs Haji AmriTambunan dan RE Nainggolan (Amri RE) pada Pemilihan Kepala Daerah (Pilkada) Sumut. 7 Maret 2013,timTemanPerjuanganAmriTambunan(TEPAT)Sumut melakukan konsolidasi hingga ke desa dan Tempat Pemungutan Suara. “Saat ini seluruh tim TEPAT mulai dari provinsi, kabupaten/ kota, kecamatan hingga kelurahan/desa di Sumut sedang melakukan pemantapan tim. Pemantapan ini untuk persiapan menghadapi Pilkada Sumut 7 Maret. Kita berharap seluruh tim bergerak dan merapatkan barisan memenangkan pasangan Amri RE, dan itu direspons positif oleh masyarakat yang didatangi,” kata Ketua TEPAT Sumut Upar Pulungan saat turun di Kabanjahe,Tanah Karo, kemarin. Sejumlah masyarakat di Karo menginginkan gubernur dan wakil gubernurkedepanyangberpengalamandipemerintahandanmampu mengelola multi etinis/agama di Sumut. Figur pemimpin itu ada pada Amri RE. “Cagubsu dan Cawagubsu nomor urut 4 ini diyakini mampu merangkul seluruh potensi. Hal itu dilihat dari slogannya membangun dalam kebhinekaan,” kata RudiTarigan bersama ratusan masyarakat di sana yang ditemui tim TEPAT. Untukitu,lanjutUpar, konsolidasiTEPATdikabupaten/kotahingga kecamatan dan desa di Sumut tidak menemui kendala. Ini mengingat sosok AmriTambunan yang memiliki“benang merah” dengan sejumlah daerah di Sumut. Amri lahir dari seorang ayah pejuang, yakni H DjamaluddinTambunan,yangpernahmenjadipemimpindi Labuhanbatu, Asahan, dan Pematangsiantar-Simalungun. Begitu juga jejak rekam AmriTambunan yang lahir diTanjungbalai, Asahan, lalu besar di di Labuhanbatu dan pernah bersekolah di Sipirok, Tapsel, kampung sang ibunda, Almh Hj Nurbanun Siregar. Karir Amri sebagai pejabat karir juga sangat memudahkan tim TEPAT untuk bergerak ke kabupaten/kota sampai ke desa-desa yang merupakan simpul-simpul daerah basis Amri RE, zona lain seperti Paluta, Palas, Madina, Tanah Karo, Langkat dan Deliserdang. Amri memulai karir PNS-nya dari staf kelurahan di Medan, lalu pindahkeTanjungmorawa,Deliserdangmenempatisejumlahjabatan, mulai dari camat, asisten, hingga pembantu bupati. Amri kemudian ditugaskan ke Dinas Pendapatan Sumut, lalu menjadi Kabiro Humas Pemprovsu, Sekda Medan, Kepala Badan Infokom Sumut, dan terakhir Bupati Deliserdang dua periode. “Dengan jejak rekam yang sudah mengakar di berbagai daerah di Sumut, memudahkan timTEPAT membentuk posko pemenangan Amri REdiSumut,”kataPulunganterutamadiTanahKaro.Tim,menurut Upar,menemuilangsungpararelawanTEPATditingkatdesadanmenemui tokoh-tokoh masyarakat, tokoh agamat dan simpul-simpul yang ada. Kondisi itu, tambah Pulungan, dipermudah lagi oleh jejak rekam orang tua AmriTambunan, H DjamaluddinTambunan yang pernah menjadi Ketua Lembaga Perekonomian NU Sumut dan sang ibu Hj Nurbanun Siregar yang pernah menjadi Ketua PW Muslimat NU Sumut. “H Amri Tambunan adalah putra pejuang yang religius. Sedangkan Amri adalah ahli pemerintahan yang handal. (m13)

Rawat Pasien Seperti Keluarga Sendiri Waspada/Dede

247.643 Calon Peserta UN 2013 Di Aceh BANDA ACEH (Waspada): Sedikitnya 247.643 pelajar dari jenjang sekolah dasar sampai sekolah menengah, termasuk calon peserta dari ujian paket A, B dan C di Aceh, akan mengikuti Ujian Nasional (UN) tahun ajaran 2012/2013. “Jumlah calon peserta UN tersebut masih rekap sementara, karena batas akhir laporan calon peserta UN masih kita tunggu sampai 25 Februari 2013 ini,” kata Laisani, Ketua Panitia UN Aceh, Sabtu (23/2) di Banda Aceh. Malah untuk calon peserta UN Paket A, B dan C, katanya, masih dalam proses pendaftaran. “Peserta UN untuk paket A, B dan C yang waktu pelaksanaannya bersamaan, masih kita tunggu laporannya sampai akhir Februari 2013 ini,” tuturnya. Jadi, tegas Laisani yang juga KepalaBidang(Kabid)Pendidikan Menengah dan Kejuruan pada Disdik Aceh ini, jumlah calon peserta UN tahun 2013 ini bisa saja bertambah karena ada siswa pindahan dari luar Aceh yang belum terdaftar. “Kalau perpindahan siswa

Menangkan Amri RE, TEPAT Sumut Konsolidasi Hingga Ke Desa

Takengen, Kantor Imigrasi dan STAINGajahPutih (GP)Takengen. “Dengan diresmikannya ketigalembagaini,kamiberharap ke depan daerah Gayo ini bisa lebihmajudisegalabidang.Bukan saja dari sisi budaya maupun pendidikan melalui penegerian STAIGP,namun,bidang informasi serta pembangunan kantor imigrasi, hendaknya bisa mempermudah pelayanan ke masyarakat,” jelasnya. Lainnya,dia mengimbau bagi universitas yang telah statusnya dinegerikan seperti STAIN GP supaya berhati-hati melakukan penerimaan mahasiswa dalam jumlah besar. Ini guna menjaga mutu dan karakter universitas tersebut. Sehingga mampu melahirkan tamatan berkualitas.

“Biasanya kalau sebuah perguruan tinggi sudah dinegerikan, akan terjadi penambahan jumlahpeminatdarisebelumnya. Dari itu seleksi ketat haruslah dilakukan sehingga nantinya mahasiswa tamatan STAIN bisa menjadi ukuran pendidikan di daerah,” terangnya. Ditambahkan, dengan dibangunnya kantor Imigrasi Takengen,hendaknyadapatmempermudah pelayanan bagi masyarakat, khususnya di tiga kabupaten lainnyadinaungiseperti;GayoLues, AcehTenggara dan Bener Meriah. “Selama ini untuk mengurus kepentingan keimigrasian untuk 4 kabupaten di wilayah tengah Aceh ini harus dilakukan di luar daerah seperti Lhokseumawe. (cb09/b32).

Ratusan Kepala Madrasah Ikuti Raker BERASTAGI (Waspada) : Ratusan Kepala Madrasah tingkat MI (Madrasah Ibtidaiyah),MTs (Madrasah Tsanawiyah) dan MA (Madrasah Aliyah) negeri dan swasta sejajaran Kantor Kementerian Agama Kabupaten Deliserdang mengikuti Rapat Kerja (Rapat kerja) di Hotel Sibayak Berastagi, Kamis lalu. Kegiatan dibuka Kepala KantorWilayah Kementerian Agama Sumatera Utara Abd Rahim didampingi Kepala Kantor Kementerian Agama Delisedang Dur Brutu dan Kepala Seksi Pendidikan Madrasah Torang Rambe. Penanggungjawab kegiatan Torang Rambe didampingi ketua panitia Muhammad Asrul dan sekretaris Akhyar mengatakan, Rakor dilaksanakan dalam rangka menyahuti surat edaran Direktur Pendidikan Madrasah tentang penguasaan baca tulis Alquran dan kultur madrasah berbasis Alquran demi tercapainya Panca Prestasi Madrasah yaitu prestasi akhlak mulia, prestasi ilmu keagamaan, prestasi sains dan teknologi, prestasi bahasa dan budaya serta prestasi olahraga dan seni. Terkait dengan itu, kata Torang, maka perlu dilakukan rapat koordinasi sehinggatercapaiciripendidikanmadrasahdalammembina jiwaagamadanahklakpesertadidikyangmenjadiidentitassebenarnya dari pendidikan madrasah yang perlu menjadi perhatian bagi kepala madrasah sehingga madrasah menjadi lembaga pendidikan nomor satudinegeriini.KepalaKantorWilayahKementerianAgamaSumatera Utara Abd Rahim memberi apresiasi kepada Kemenag Deliserdang atas dilaksanakannya rapat kerja tersebut dan berharap pada kepala madrasahagarterusmenambahperbendaharaan ilmupengetahuan dengan belajar dan memperluas wawasan karena guru adalah sumber ilmu pengetahuan. (m37)

LUBUKPAKAM (Waspada): Pelaksana Harian Bupati Deliserdang Zainuddin Mars mengharapkan ke depan pasien tidak akan berbondong-bondong lagi berobat ke luar negeri. “Padahal sesungguhnya kita juga mampu melakukannya. Keistimewaan mereka adalah karena kesungguhan dan menghayati profesinya sebagai perawat sehingga dalam merawat pasien pun tak ubahnya bagai merawat keluarga maupun anak sendiri,” tutur Plh Bupati saat memberi sambutan pada pelantikan Pengurus Persatuan Perawat Nasional Indonesia (PPNI) Kab. Deliserdang, Jumat (22/2). Pelantikan yang berlangsung di aula Medika Dinas Kesehatan Deliserdang, Lubukpakam, itu dilakukan oleh Ketua PPNI Sumut Evi Karota Bukit, dihadiri Plh Bupati Deliserdang Zainuddin Mars, dan Sekretaris Dinkes M Nisrajudi. Pengurus PPNI Deliserdang periode 2013-2018 yang dilantik sebagai Ketua Samohot Simarmata, Sekretaris Jepri Siregar AMK, Bendahara Heppy Barus SKM dibantu wakil-wakil dan ketua–ketua bidang serta anggota departemen. Ketua PPNI Sumut Hj Evi Karota Bukit dalam pidato pelantikannya mengatakan,dengankepengurusanPPNIDeliserdangyangbaru,diharapkan munculnya tenaga-tenaga perawat yang profesional. (m16)

Kantor Dinsosnakerkop Sergai Dibobol SEIRAMPAH (Waspada): Kantor Dinas Sosial Tenaga Kerja dan Koperasi Kab. Serdang Bedagai di Dusun VI, Desa Firdaus, Kec. Sei Rampah, Jumat (22/2) dinihari sekitar pukul 05:30 dibobol orang tak dikenal (OTK). Walaupun pelaku yang diduga lebih dari satu orang membuka dua brankas Dinsosnakerkop dengan menggunakan alat secara paksa, namun uang yang hanya Rp100 tidak diambil, begitu juga pada brankas kedua, yang berisikan uang Rp9 juta, juga tidak diambil pelaku dan pelaku hanya mengambil dua unit laptop dan kamera digital. Sebelum memasuki ruang brankas yang berada di lantai atas, persisnya di ruang Kadis Sosnakerkop Karno Siregar, diduga pelaku masuk melalui lantai satu kantor Badan Pemberdayaan, Perempuan, Anak dan KB Sergai dan beraksi dengan terburu-buru. Selanjutnya mulai dari lantai satu setiap ruangan pelaku menyisir dengan membuka pintu dengan cara paksa, terbukti saat dilakukan olah tempat kejadian perkara (TKP) oleh pihak Polres Sergai semua berkas berserakan dan meja serta pintu menganga. Kadis Sosnakerkop Sergai Karno Siregar mengatakan, hanya dua unit laptop yang hilang, sedangkan uang yang ada di dua brankas tidak diambil. Buktinya uang sebanyak Rp9 juta dan Rp100 aman berada di tempatnya. Karno menduga karena kelelahan para pelaku mengambil tiga botol minuman ringan di lemari pendingin yang berada di ruangan kerjanya dan menyisakan tiga botol kosong di lantai bawah. Atas peristiwa pencurian tersebut pihak Dinsosnakerkop Sergai telah melaporkannyakePolresSergaiuntukditindaklanjutigunamengungkap para pelaku. Sedangkan Kasat Reskrim Polres Sergai AKP Denny Boy P melalaui KBO Reskrim Iptu E Panjaitan ketika dikonfirmasi, pihaknya telah menerima laporan tersebut dan tengah melakukan penyelidikan dengan mengumpulkan keterangan dari saksi setelah melakukan olah TKP. (c03)

Ganja Tak Bertuan Di LP T. Tinggi TEBINGTINGGI (Waspada) : Ganja tak bertuan kembali ditemukan di Lembaga Pemasyarakatan (LP) Jalan Pusara Pejuang, Tebingtinggi,Kamis(21/2)siang.Ganjayangtidakdiketahuipemiliknya itu ditemukan seberat 375 gram. Sebelumnya, tepatnya sekira sebulan, 23 Januari 2013, juga ditemukan di kamar mandi blok 08 F Lapas, ganja tak bertuan seberat 1 kg. Kali ini barang tak bertuan itu kembali ditemukan tersangkut di atas kawat duri tembok beton (tembok paling atas) yang berpagar kawat duri di atas kamar blok C lapas tersebut. Hingga kini belum diketahui siapa pemilik barang haram tersebut. Temuan barang haram itu menjadikan LP yang dihuniratusannarapidanadidugamenjaditempatperedarannarkoba. Barang itu pertama sekali ditemukan AhmadYurlis, 33, petugas Lapas yang sedang melakukan pengecekan bersama petugas lainnya di blok C. Pada saat AhmadYurlis mengecek blok C, terlihat sebungkus plastik asoi merah tersangkut di kawat duri yang ada di ujung pagar/ tembok Lapas blok C. Curiga melihat bungkusan plastik asoy itu, AhmadYurlis, M. Mauli Sardi dan beberapa petugas Lapas lain mengambil bungkusan plastik itu dengan sebilah bambu. Ketika diambil, setelah dibuka berisi tiga bungkus ganja yang sudah dibungkus dengan lakban bening.Temuan itu dilaporkan kepada Kalapas, Budi Argap Situngkir. Saat dikonfirmasi, Kalapas membenarkan temuan tersebut. Dirinya menduga bahwa barang bersirip tujuh itu sengaja dilempar dari luar tembok. (a11)

Ikan Tangkapan Nelayan Di Danau Toba Berkurang PARAPAT (Waspada): Masyarakat di pinggiran Danau Toba, Parapat yang beroperasi sebagai nelayan tradisional dalam hampir enam bulan belakangan ini mengaku ikan hasil tangkapan mereka dari danau air tawar tersebut terus berkurang. “Sudah enam bulan ini ikan hasil tangkapan kami di danau ini (Danau Toba) berkurang,” kata seorang warga pinggiran Danau Toba, Parapat, Ramses Sinaga, 34, kepada Waspada, Rabu (20/2). Sinaga yang mengaku sudah cukup lama melakukan pekerjaan menangkap ikan di danau air tawar itu ketika ditemui saat mendarat dan menurunkan ikannya di Pantai Ajibata, mengatakan, tangkapan mereka setiap hari hanya berkisar 10 sampai 15 kg ikan. Jenis ikan yang paling banyak tertangkap jaring nelayan tradisional di pinggiran Danau Toba itu adalah ikan pora-pora atau di daerah itu disebut juga dengannamaikanMegawati.DisebutikanMegawati,karenaMegawati Soekarno Putri, ketika itu menjabat sebagai Presiden RI dan menabur kan ikan bertubuh kecil-kecil itu ke DanauToba yang asal ikan itu sendiri dibawa dari perairan di Sumatera barat (Padang). Selain ikan pora-pora, juga ikan jair juga bisa tertangkap nelayan di danau itu. Dan untuk memenuhi kebutuhan hidup keluarganya, para nelayan mengaku terpaksa ikut membuka usaha keramba jaring apung di danau tersebut, dengan usaha pembesaran ikan jair dan ikan nila yang harga jualnya saat ini cukup baik. (c16)


A4 Banyolan

WASPADA Minggu 24 Februari 2013


Proyek Pembangunan Jembatan Pada suatu hari seorang dari partai politik datang ke sebuah kampung untuk melakukan kampanye pemilihan kepala daerah. “Kita akan membangun sebuah jembatan yang besar di kampung ini.”Salah seorang waga di situ bertanya, “Tapi pak, di sini tidak ada sungai, buat apa membangun jembatan?” Politisi itu pun dengan senyum ramahnya menjawab, “Kalau begitu, nanti tentu saja kita akan membangun sungai...

Pulang Karena Antrian Klinik Panjang Seperti halnya pada hari-hari biasa, sebuah klinik selalu penuh didatangi banyak pasien, dan dokter tetap memeriksa semua pasien secara bergilir dengan tenang. Sesudah menunggu gilirannya kurang lebih selama 2 jam, seorang kakek berdiri dari tempat duduknya dan berjalan menuju ke arah pintu masuk klinik dengan gerak langkah yang lamban. Begitu melihat bayangan kakek tersebut, petugas penerima pasien klinik itu segera menghampirinya dan menanyanya: “Bapak mau ke mana? Tunggu saja di sini, jangan pergi, tak lama lagi tentu akan sampai giliran Bapak.” “Kalau aku disuruh menunggu di sini terus, salah-salah bisa mati mendadak. Bagaimanapun aku toh akan mati, maka lebih baik aku mati di rumah saja!”

Tak Diizinkan Bicara Saat Makan Bapak tidak pernah mengijinkan anaknya berbicara pada waktu sedang makan. Sekali peristiwa, pada waktu makan siang, sang Bapak melihat mimik anaknya agak gelisah, seakanakan ada sesuatu yang mau diomongkannya. Maka itu Bapak berkata kepadanya: “Kamu mau bicara? Bicaralah!” “Pak, lalat enak ya?” tanya si anak. “Tidak!” jawab sang Bapak, “Kamu menanyakan hal ini ada apa?” “Tadi di piring Bapak ada seekor...” Bapak: “????”

Adik Nangis Terus Antok bolak-balik mengatakan kepada ibunya yang sedang memasak bahwa adiknya menangis terus,,, Lalu ibunya menyuruh Antok membujuk agar adiknya tidak menangis. Antok berlari ke tempat adiknya menangis. Nggak lama Antok datang lagi ke ibunya: “Udah Antok suruh diam, tapi ngga bisa, Mak,,,!” Dengan sabar ibunya menyuruh Antok untuk mengajak adiknya jajan. Antok seketika berlari ke tempat adiknya menangis. Nggak lama Antok datang lagi ke ibunya:

“Udah Antok ajak jajan, tapi ngga bisa juga, Mak,,,!” Dengan agak kesal, kembali ibunya menyuruh Antok untuk membujuk adiknya berhenti menangis dengan memberi adiknya uang Rp. 10.000,- Antok kembali berlari cepat ke arah adiknya menangis. Nggak lama, Antok datang lagi ke ibunya: “Tetep ngga bisa, Mak. Padahal Antok udah ngulur-ngulurin uang itu ke adik,,,” “Emang kenapa adik lu sampe dibujuk tiga kalio dibujuk, sampe pake duit segala yang terakhir tetep nggak mau, Antok,,,!” Tanya ibunya rada heran. Antok ngejawab pelan: “Adik nyebur ke sumur, mak,,!”

1 6

4 0 2

4 9 A 7 9 6

22.30 00.30

Nabrak Nenek Seorang nenek yang nyebrang jalan hampir ketabrak motor. Pengendara motor marah: “Nenek bego! Nyebrang jalan gak liat2!” Nenek sewot : “Lo yg bego!! Nabrak neneknenek aja gak kena..!!”

5 3 4 2 0 7 7 5 B 6 A 9 A 9 2 5 1 6 A B


B A 6

A 9

Nama: .................................................. Alamat: ................................................ No. KTP/SIM/Kartu Pelajar: ..............................



1. Sejarah 6. Belum pernah ada sebelumnya 9. Huruf ke-9 abjad Yunani 10. Ruang besar, bangsal 11. Tata Usaha 13. Berdagang 14. Perwira (pangkat dalam militer) 16. Tugas, kewajiban 18. Sunyi 20. Kasihan 22. Nahdlatul Ulama 23. Berjumpa 24. Rambut putih 27. Alat untuk memutar rantai pada sepedamotor 28. Pengasingan, pengucilan 30. Berjalan perlahan secara sembunyisembunyi 32. Peluru kendali 33. Alat penerangan 35. Kesenian Jepang melipat kertas 37. Makamah Konstitusi 38. Bola masuk ke gawang 40. Tidak boros 41. Cocok, tepat 42.Wadah kecil dari timah untuk candu 43. Penggaris 44. Tempat di akhirat bagi orang-orang yang dihukum 46. Kereta kuda 48. Bermacam-macam 49. Bebek 50. Nyawa 51. Jasad orang meninggal yang diawetkan

1. Huruf China 2. Siap sedia 3. Pakaian wisuda 4. Pikiran, akal 5. Raudhatul Atfal 6. Alat musik yng mempunyai nada rendah 7. Bulu di atas mata 8. Universitas Terbuka 10. Putaran, kisaran (Inggris) 12. Umur 14. Atau (Inggris) 15. Ampas, endapan (tentang minyak, gula, dsb) 17. Pelapis paling bawah 19. Tempat ibadah umat beragama Hindu 21. Tidak bisa berkata-kata atau bicara 24. Hewan melata yang jalannya menjalar 25. Papan reklame 26. Batu permata transparan berwarna biru, sapir 27. Gross National Product 28. Pengairan sawah 29. Pasta untuk menggosok gigi 30. Badan usaha (pemerintah) yang mengeluarkan kertas berharga untuk diperjualbelikan 31. Mengerjakan sesuatu meski tidak mau 34. Sesuatu yang dipercayakan oleh orang lain 36. Sebutan kerhotmatan, kebangsawanan 37. Kuburan 39. Benda untuk menyembuhkan penyakit 41. Besi ukuran kecil yang ujungnya runcing 43. Pakaian wanita bagian bawah 45. Alat pada kendaraan untuk menghentikan laju kendaraan 47. Daerah Istimewa

Adhana Putri Sihombing, Air Teluk Kiri Dusun II, Keb Asahan


: ....................................................

Alamat sesuai KTP : . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .................................................... ---------------------------------------------- potong di sini ---------------------------------------------

Pelesir Upin & Ipin Kisah Unggulan Ayo Main Grebek Nusantara Mata Pancing Amazing Bollywood Jendela Inspirasi Sore Somad Legenda MD The Series 21.00 Raden Kian Santang 22:30 BPL 01.00 BPL

gunting di sini TTS Berhadiah Jawab dan gunting TTS Berhadiah di atas kemudian kirimkan ke PT Harian Waspada Jalan Brigjen Katamso No.1 Medan/Jalan Letjend Suprapto No.1 Medan. Tulis nama dan alamat lengkap serta nomor pengenal. Jawaban paling lambat diterima Jumat 1 Maret 2013, pukul 16:00. Bagi pengirim yang dapat menjawab semua pertanyaan dengan tepat dan benar akan diberi hadiah berupa uang tunai sebesar Rp50.000,-untuk satu orang pemenang. Semua jawaban yang benar akan diundi. Pengumuman pemenang akan diumumkan pada Minggu 3 Maret 2013 beserta jawaban yang benar di halaman yang sama. Hadiah dapat diambil di kantor Harian Waspada bagian Sekretaris Redaksi (jam kerja), setelah tiga hari pengumuman pemenang diterbitkan.

Pemenang Sudoku Berhadia Minggu Lalu

7 B 2 4 0

Tom & Jerry Crayon Sinchan Doraemon Larva Dahsyat Infotainment Intens Seputar Indonesia Siang Penyegaran Rohani Idola Cilik Tom & Jerry Seputar Indonesia Yang Muda Yang Bercinta Cinta 7 Susun Layar Drama Indonesia Tukang Bubur Naik Haji The Series Box Office Movie Seputar Indonesia Malam

07:00 07:30 08:30 10.00 10:30 11:30 16.00 17.00 17:30 18:00 19.00

Berbeda Keyakinan Budi seorang pemuda yang setelah sekian lama hidup sendiri menemukan Lina kekasih pujaan hatinya tapi pernikahan mereka tidak berlangsung lama karena perbedaan keyakinan. Amir: “Kenapa sob sampai kalian bercerai, apa masalahnya?” Budi: “Kita berbeda keyakinan mir, aku ngga tahan lagi.” Amir: “Bukannya kalian seagama?” Budi: “Memang sob…” Amir: “Lantas kenapa sampai bercerai karena perbedaan keyakinan?!” Budi: “Selama ini aku selalu yakin bahwa aku ini ganteng, tapi Lina tidak bisa menerima keyakinanku itu dan selalu mempermasalahkannya.” Amir: ….



18.30 19.30

Ayah1 : Anakku skrng sdh jdi kapolda di daerah sumatra..!! Ayah2 : Ehmm..klo anakku skrng.,jdi pilot dimskapai pnerbngan australi.. Ayah : Eehmm..,klo anakku skrng sdah jdi ASTRONOT.,krjaannya di luar angkasa Ayah 1&2 : “Bukanx anak kamu jdi TKI.?? Ayah3 : Benar.,anakku skrang sdah jdi astronot.,!! klo gak percaya kutelpon! lalu ayah3 menelpon anaknya & terdengar suara dari hp yang dispeaker : “nomor yg anda tuju sedang berada di luar jangkauan..” Ayah : Benarkan.,anak sya kerjax di luar angkasa...!!! Ayah 1&2 : “**@@%•$£...!


2 0 9 1 B 3 1 B 3 5 7 4 8 6 6 A 9 0 0 8

12.30 13.00 15.00 16.30 17.00

Anakku Seorang Astronot

Gunakan angka 0 sampai 9 ditambah dua abjad -- A dan B -- untuk mengisi kotak-kotak kosong. Tidak boleh ada pengulangan angka dan huruf pada lajur mendatar dan menurun, serta di dalam kotak 4x3 bergaris tebal. Tingkat kesulitan: sedang (***). Tersedia hadiah Rp50.000,- untuk seorang pemenang. Antar kupon yang sudah terisi angka yang anda yakini benar ke kantor Waspada Jl. Brigjen Katamso 1 Medan paling lambat Jumat. Jawaban bisa juga dikirim ke faksimile (061) 4510025. Jawaban dan pemenangnya dimuat pada edisi Minggu (3/3). ------------------------------------------------------ potong di sini --------------------------------------------------------


07.00 07.30 08.00 08.30 09.00 11.00 12:00


B 3 6 0 A 1 5 4 9 8 2 7 7 2 5 1 3 6 9 8 BA4 0 4 8 A 9 7 0 B 2 1 5 6 3

0 9 5 1 A 2 6 8 3

AB 3 5 7 8 1 4 2 9 6 7 8 2 4B A 6 5 0 3 1 6 1 4 0 3 2 9 8 7 AB B3 6 8 5 4 0 2 9 7 A 9 4 8 1 2 7 3 6 B 0 5 0 7 5 B 9 6 A 3 4 1 8

4 0 B 2 8 1 7 A3 5 9 1 2 7 9A 3 5 0 6B 4 5 9 A 6 4 0 B 7 1 8 2

Pemenang TTS Berhadia Minggu Lalu Nuzulul Qodri, Jl. Darussalam, Karya Bakti No. 18 Medan


07:00 Ultraman Max 07:30 Dufan The Defender 08:00 Metal Fight Beyblade Baku 08:30 Scan2Go 09:00 Dragon Ball Z Kai 09:30 Inazuma Eleven 10:00 Sinema Pagi Akhir Pekan 12:00 Patroli 12:30 Sinema Siang 14.30 TBA 15.30 Fokus 16.00 Tukar Nasib 17.00 Drama Seri Indonesia 18:00 SinemaTV Unggulan Sinta Terakhir Cinta Untukmu 20.00 Sinema Pintu Taubat 22:00 Sinema Unggulan

09:00 09:30 10:00 10:30 12:00 12.30 13:00 15:00 16:30 17:00 19.00 21:00 22:00 23:00

MLS Soccer Tinju Legendaris Soccer One Hot Sport Live News Kabar Siang Globe Trackker Season Damai Indonesiaku Nama & Peristiwa Live News Kabar Petang Apa Kabar Indonesia Malam Indonesia Lawyers Club Live News Kabar Malam Nama & Peristiwa Radio Road Show

07.00 09.00 09:03 10:00 12:00 12:30 12.34 14.30 16.00 16.30 17.30 18.00 19.30 20.30 22.30 22.30 22.33

07:30 08.00 08:30 09:00 09:30 10:00 10:30 11:30 12:00 13:00 14:00 14:30 15:00 17:30 17.35 18:30 21.00 22:00

07.05 08.05 08.30 09.30 10.05 11.05 12.00 13.30 14.30 15.30 17.05 18.30 19.05 20.05 21.05 22.05 23.00 23.05 23.30

Inbox Liputan 6 Terkini Hot Shot SCTV FTV Pagi SL Liputan 6 Siang Usaha Anda SCTV FTV Siang Status Selebriti Hip Hip Hura Liputan 6 Petang Cookies Biang Kerok Cilik Ji Ung Pendekar Cabe Rawit SCTV SInetron : Ustad Fotocopy SCTV FTV Liputan 6 Terkini SCTV FTV

Fenomania Agung Sedayu Aku Ingin Sembuh Haier Inspire Living Properties In Harmony Semua Bisa Plesir Neo Planet Remaja Topik Siang Klik ! Mantap Total Football Kampiun Sepakbola Nasional ISL Topik Petang Pesbukers ISL Rangking Selebriti Sinema Aksi

Jalan Jalan Asyik Menu And Venue Agung Sedayu Agung Sedayu Dulux Inspire Sudut Pandang Woman On Top Pas Muslim di Xin Jiang Lestari Kick Andy Metro Hari Ini Metro This Week Mario Teguh Just Alvin! Love Me As I Am Musik + Headline News Destroyed in Seconds Metro Sports

08:00 Bolt 10:00 Obsesi 11:00 Buletin Siang 12:00 M a n t u M a n t u Morotin Mertua 13.00 Fun Teenlicious 13:30 Super Boy 14:00 GPS 14:30 100% Ampuh 16:00 Fokus Selebriti 16:30 Naruto 17:30 BoBoi Boy 18:00 K-Pop 19:00 Sketsa Tawa 20:00 Barclay Premier League 22.30 Big Movies

TRANS 7 07.00 07.30 08.30 09:00 09:30 10:00 10:30 11:00 11:30 12:00 12:30 13:00 14:30 15:00 15:30 16:30 17.30 18.00 19.00 20:30 22.00 00.30

RNB Selebrita Pagi Party Kaca Mata Gak Nyangka Wollipop Spotlite RAN Redaksi Siang Akhir Pekan Selebrita Siang Galeri Sepak Bola Indonesia One Stop Football Mancing Mania Sing n Run Iseng Banget Redaksi Sore Breaking World Sebelas Dua Belas Hitam Putih PAS Mantab Mister Tukul Vamos Liga

07.00 Mozaik Islam 07:30 Semangat Pagi 08.00 Benu Buloe 08:30 Buah Hati 09.00 Ceriwis 09:45 Ala Chef 10:30 Ngulik 11.00 Insert Siang 12:00 Bioskop Indonesia 13:30 Bosan Jadi Pegawai 14:00 Sketsa 15.00 Bingkai Berita 15:30 Gengges 16: 00 Insert Investigasi 16.45 Reportase Investigasi 17:15 Lollylove 18:00 Indonesia Mencari Bakat 3 20.00 Bioskop TRANS TV SPesial 21:00 Bioskop Trans TV 22:00 Bioskop Trans TV **m31/G

Medan Metropolitan

WASPADA Minggu 24 Februari 2013


TEPAT Medan Utara Bertekad Menangkan Amri-RE Satu Putaran Waspada/Arianda Tanjung

KEPALA SMP AL Ulum Terpadu Nur Rahimah S SPdi (tengah) didampingi Wakepsek Bidang Kesiswaan M Nurhadi Amri SPdi (kanan) foto bersama dengan siswa.

SMP Al Ulum Terpadu Gelar Pramuka Dan Outbond MEDAN (Waspada): Untuk meningkatkan kedisiplinan dan kemandirian dalam bersikap SMP Al Ulum Terpadu menggelar latihan Pramuka dan outbond yang diikuti puluhan siswa di Bumi Perkemahan Sibolangit, Sabtu-Minggu (16-17/2). Yayasan Amanah Karamah Prof Dr H Nawir Yuslem, MA menyambut baik kegiatan latihan Pramuka dan outbond ini karena bagian dari pembelajaran alam,” Kegiatan ini betujuan untuk meningkatkan kemampuan mental, moral dan keterampilan para siswa,” kata Nawir. Kepala SMP AL Ulum Terpadu Nur Rahimah, S SPdi menjelaskan kegiatan belajar out door training yang diiringi dengan kegiatan pramuka dan outbond merupakan penyempurnaan dari proses belajar mengajar di alam terbuka. “Dalam kegiatan ini siswa diajak untuk mengenal alam terbuka dengan tujuan dapat menambah wawasan dan kecerdasan intelegensi, emosional, dan spiritual,” jelasnya sembari mengatakan kegiatan ini rutin dilakukan setiap tahunnya. Ditambahkannya, teknik penyampaian telah dikemas dalam berbagai bentuk materi dan telah dikombinasikan dalam permainan sehingga siswa santai dalam menjalaninya. “Ditambah lagi dengan arena kegiatan yang bisa dijadikan tempat rekreasi tentunya sangat membantu siswa untuk memacu semangatnya ketika kembali mengikuti proses belajar di dalam ruangan,” kata Nur. (cat)

Muzakarah Internasional Hukum Keluarga Dan Perwakafan MEDAN (Waspada): Muzakarah/Seminar Internasional Hukum Keluarga dan Intensifikasi Wakaf yang diselenggarakan kerjasama Pemprovsu, MUI-SU, PTA SU, Kemenagsu, IAIN-SU, UMSU, BWI-SU, dan HISSI-SU dirangkaikan dengan Rakerda PTA-PA se Sumut dibuka Wakil Ketua Mahkamah Agung Non Yudisial diwakili Ketua Muda Urusan Lingkungan Peradilan Agama MARI. Dr.H.Andi Syamsu Alam, SH,MH di Gedung Gelora Hotel Madani Medan, Selasa (19/2). Muzakarah Hukum Keluarga menghadirkan pemakalah dalam negeri dan luar negeri terdiri dari Ketua MUI Sumut Prof.Dr. Abdullah Syah, MA, Kolej Pengajian Islam Johor Malaysia Prof. Dr .M.S. Sujimon, Ketua Mahkamah Syariah Pulau Pinang dan Direktur Pascasarjana IAIN Ar-Raniri Aceh Prof.Dr.Rusdi Ali, SH. Sedangkan mengenai hukum wakaf pemakalah terdiri dari Prof.Dr M.Yasir Nasution MA (Badan Wakaf Indonesia Sumut), Tuan Haji Amir bin Danuri, Dr.H.Suhrawardi K Lubis, SH,Sp.N, dan Khairul Busra bin Mhd. Isa. Ketua Muda Mahkamah Agung Urusan Lingkungan Peradilan Agama Dr.H.Andi Syamsu Alam, SH, MH. selaku Keynote Speaker mengatakan permasalahan hukum keluarga meningkat dari tahun ketahun hal ini disebabkan banyaknya kekerasan dalam rumah tangga (KDRT), kurangnya pembinaan terhadap masyarakat dan maraknya perkawinan sirri dan kawin dibawah umur yang menyebabkan rawan perceraian serta meningkatnya kerisis moral seperti perselingkuhan dan lain sebagainya.(m05)

MEDAN (Waspada): Teman Perjuangan Amri Tambunan (TEPAT) kawasan Medan Utara bertekad memenangkan pasangan Drs H Amri TambunanDr RE Nainggolan MM (Amri RE) pada Pemilihan Gubernur Sumatera Utara (Pilgubsu) 7 Maret mendatang. “Seluruh tim TEPAT sekawasan Medan Utara (Kecamatan Medan Deli, Medan Labuhan, Medan Marelan dan Medan Belawan) telah sepakat berjuang memenangkan pasangan Amri-RE satu putaran,” ujar Harapan Siregar, Koordinator Kecamatan (Korcam) TEPAT Medan Deli, saat konsolidasi dan pemantapan tim TEPAT sekawasan Medan Utara di Jalan Kawat VI, Kelurahan Tanjung Mulia Hilir, Kecamatan Medan Deli,

kemarin. Hadir dalam konsolidasi itu, Korcam TEPAT Medan Labuhan Abdul Latif Rambe, Korcam Medan Marelan Hasmar L Nasution, Korcam Medan Belawan B Alkhalidi, Kasmiati (Belawan) dan 46 orang utusan warga dari 23 kelurahan di Medan Utara. Juga hadir Wakil Ketua TEPAT Kota Medan Drs Edi Sumarno, Sekretaris Budi Har-yanto S Phil, anggota Drs M Siregar, dan pengurus TEPAT Sumut Drs CH Din Hutasuhut. Tim TEPAT se-Medan Utara optimis, target memenangkan Amri-RE satu putara akan tercapai. Ini mengingat pasangan yang diusung oleh Partai Demokrat ini adalah dua figur yang sudah teruji kepemimpinannya. Menurut Korcam TEPAT

Truk Barang Dengan Biaya Operasional Rendah MEDAN (Waspada): Usaha jasa angkutan barang melalui jalur darat akan semakin bergairah atas kehadiran truk barang dengan biaya operasional rendah dari generasi terbaru Hino Ranger FM 285 JD, yang peluncurannya dilakukan di Hotel Santika Medan, Jumat (22/2). Hino ranger terbaru ini, menurut Direktur Promosi dan Pemasaran PT.Hino Motors Sales Indonesia Santiko Wardoyo, merupakan pengembangan dari FM 260 JD. Malah Ranger terbaru ini, katanya, unggul dengan mesin generasi terbaru common rail yang punya kemampuan kuat, tangguh dan handal. “Selain punya tiga filter (saringan minyak) tetapi juga bahan bakar diatur komputer sehingga output dan input

seimbang,” katanya. Sebagai truk beroda 10 yang irit bahan bakar dan murah biaya operasional, Wardoyo menyebutkan Hino FM 285 JD berkapasitas angkut barang 26 ton sehingga dijuluki truk yang cukup jago cari duit . Sementara Chief Executive Officer IPN Medan Tan Kim Pauw mengaku, walau pemasarannya baru dimulai namun sejak beberapa hari lalu sedikitnya sudah ada 10 pemesan di Medan. Sumut, katanya memiliki pasar yang cukup bagus, selama tahun 2012 saja truk kategori 3 (Ranger) terjual 58 persen, dan kategori 2 (Dutro) 14,2 persen. Dan khusus untuk tahun 2013 ditargetkan dari semua kategori termasuk Ranger FM 285 JD sebesar 709 unit. (m22)


SANTIKO Wardoyo bersama Tan Kim Piauw serta staf lainnya dari pihak Hino ketika mengadakan temu ramah di Medan Jumat (22/2).

Medan Labuhan, Abdul Latif Rambe, profil dan track record Amri sudah sangat dikenal di kawasan terebut. Sebab, program Amri Tambunan selama menjabat bupati Deli Serdang dua periode, benar-benar nyata. “Dalam berbagai sosialisasi yang kita lakukan ke tengahtengah masyarakat, kesuksesan Amri memimpin Deli Serdang perlu dikembangkan di 33 kabupaten/kota se Sumut. Karya

nyata Amri Tambunan seperti konsep “Cerdas”, bedah rumah, Gerakan Deli Serdang Membangun (GDSM), dan program nyata lainnya sangat ditunggu masyarakat demi terwujudnya provinsi yang lebih maju,” kata Latif. “Kita pilih pemimpin yang mampu memimpin, mampu bekerja nyata bukan hanya katakata, tapi fakta,” tambah Kasmiati, warga Belawan. (m13) Waspada/Anum Saskia

AL USTAD Muhammad Nur Wahabi saat menyampaikan ceramahnya dihadapan kepala sekolah, guru dan ratusan siswa SMPN 11 Medan.

Generasi Muda Islam Harus Idolakan Nabi Muhammad SAW Waspada/Rudi Arman

KETUA PMLSU dan penasehat foto bersama usai kegiatan ramah tama Imlek 2564 di secretariat Jalan Burjamhal, Minggu (17/2).

Marga LIE Temu Ramah Imlek MEDAN (Waspada): Ratusan marga LIE se Sumut yang tergabung di Perhimpunan Marga LIE Sumatera Utara (PMLSU) mengadakan temu ramah Imlek 2564 di sekretariat Jalan Burjamhal, kemarin. Ketua PMLSU dr. Sukirman didampingi sekretaris Drs. Andriasan S mengatakan, perayaan Imlek 2564 dapat dimanfaatkan sebagai upaya meningkatkan rasa kekeluargaan. Apalagi jika sudah lama tak saling bertemu karena berdiam di daerah berbeda. “Selain itu, tentu bisa digunakan sebagai media berbagi informasi, bahkan tidak tertutup kemungkinan saling bantu sesama,” ujar dr Sukirman. Didampingi pelaksana kegiatan Hendra Hartono, Edy Syahputra,William Haslie, dr Juli Jamnasi serta penasehat Irwanto Lie, Sadikin Lie, Herry Chandra, Lie Fuk Yong, Lie Chen Ho, Lie Min Ak serta Humas Anton Lieswanto dan Drs Hendra Prawira menambahkan, kegiatan

yang dihadiri ratusan marga LIE dari seluruh Sumut ini juga berpotensi menumbuhkembangkan sektor bisnis. Sebab tidak tertutup kemungkinan bakal ada kerjasama di sektor itu. “Ini merupakan agenda tahunan dan ke depan diharap semakin banyak yang bergabung di PMLSU,” sebutnya. Sementara Sadikin Lie bercerita tentang berdirinya marga LIE di Sumut yang diprakarsai Hendry Wijaya (Lie Yak Heng) pada 2005 lalu. “Tujuan awalnya sangat mulia, untuk menyatukan keluarga besar sehingga bisa saling memberi masukan,” katanya. Disebutkan, pihaknya terus melakukan berbagai kegiatan sosial, serta ikut pertemuan marga LIE di seluruh dunia yang dilaksanakan setiap tahun sekali di berbagai negara. Acara juga dirangkai makan siang bersama dan dimeriahkan hiburan barongsai serta taritarian. (m39)

MEDAN (Waspada) : Generasi muda Islam diingatkan untuk mengidolakan Nabi Muhammad SAW dalam kehidupan seharihari. Demikian disampaikan Al Ustad Muhammad Nur Wahabi SPdi dalam kegiatan perayaan Maulid Nabi Muhammad SAW di SMPN 11 Medan, Sabtu (23/2) yang dihadiri Kepala Sekolah Khairani MPd, para guru, orang tua siswa serta undangan lainnya. Menurut Al Ustad Muhammad Nur Wahabi, menjadikan Nabi Muhammad Rasulullah SAW sebagai idola begitu penting, dalam rangka meningkatkan mutu keimanan dan ketakwaan serta peningkatan prilaku yang baik dikalangan pelajar. “Kita sangat prihatin dengan pelajar yang tidak pernah mengidolakan Nabi Muhammad SAW, setiap ditanya, siapa tokoh yang mereka kenal dan bisa diidolakan, sangat jarang yang menyebutkan Nabi Muhammad,” katanya. Padahal lanjutnya, dengan menjadikannya idola, generasi bangsa ini akan tumbuh menjadi sosok yang cerdas, sebab Rasulullah saat mudanya langsung bisa membaca tanpa belajar huruf demi huruf. Kemudian cerdas dalam mengatur strategi terutama penyebaran ajaran Islam dan cerdas menyelesaikan berbagai masalah yang timbul. Ia juga sosok yang santun dan lemah lembut sehingga diberi gelar Al Alamin,dengan sifatnya yang siddik, amanah, tabligh dan fatonah. Hal lain yang dia ingatkan, agar generasi muda Islam mengenal dan mengetahui penanggalan hijriyah. “Umat Islam banyak yang tidak hafal penanggalan hijriyah, padahal Islam mempunyai penanggalan sendiri yang seharusnya menjadi penanggalan hari yang harus diingat,” jelasnya. Kenyataannya, saat kita bertanya pada setiap anak, jawaban mereka langsung pada penanggalan Masehi. Ini perlu dihidupkan kembali, pihak sekolah perlu mengingatkan dan membiasakannya. Sebelumnya, Kepala SMPN 11, Khairani MPd menyebutkan kegiatan yang dilaksanakan setiap tahun ini menjadi sarana penambahan pengetahuan keagamaan bagi siswa. Selain itu, guru yang membidangai ekstrakurikuler, memberi kesempatan kepada siswa yang berbakat untuk ikut berbagai perlombaan keagamaan. “Alhamdulillah semua kegiatan berjalan lancar dan siswa yang menang lomba diharapkan lebih mengasah kemampuannya untuk persiapan lomba pada event antar sekolah,” kata Khairani. (m37)


Laporan Khusus

WASPADA Minggu 24 Februari 2013

Waspada/HM Husni Siregar

PASANGAN Cagubsu nomor urut 4 Drs Haji Amri Tambunan terlihat ramah dengan menyalami massa pendukungnya saat berkampanye di Kota Siprirok yang di pusatkan di Lapangan Tanah Merah, Kel. Sipirok, Sabtu (23/2) sore.

Haji Amri Tambunan Bersama Masyarakat Membangun Sumut

Waspada/HM Husni Siregar

HARI keempat kampanye pasangan Cagubsu/ Cawagubsu nomor urut 4 Drs Haji Amri TambunanDr Rustam Efendy Nainggolan MM dilaksanakan dalam bentuk temu ramah (kampanye terbatas) di Kota Siprirok yang di pusatkan di Lapangan Tanah Merah, Kel. Sipirok, berlangsung sukses dan meriah, Sabtu (23/2) sore. Ribuan massa yang terdiri dari tokoh agama, para pimpinan Pondok Pesantren se- Tapanuli Bagian Selatan (Tabagsel) meliputi Padang Sidempuan, Padang Lawas Utara, Padang Lawas dan Madina,tokoh masyarakat serta berbagai organisasi seperti PC NU, Muslimat NU, GP Ansor serta pengajian kaum ibu terlihat antusias menyambut kehadiran Cagubsu Drs Haji Amri Tambunan yang diusung Partai Demokrat dan pernah bersekolah di Sipirok itu. Saat Cagubsu Drs Haji Amri Tambunan didampingi istri Ny Ir Hj Anita Amri Tambunan Br Lubis, Ketua PW NU Sumut H Ashari Tambunan tiba di lokasi kampanye, Salawat Badar yang dikumandangkan Muslimat Nahdlatul Ulama Tabagsel menggema menyambut calon pemimpin Sumut yang diharapkan masyarakat Sipirok dan wilayah Tabagsel akan mampu membawa perubahan bagi Sumut ke arah yang lebih baik 5 tahun ke depan. Di hadapan massa yang begitu antusias untuk menghantarkan Mustasyar Pimpinan Wilayah Nahdlatul Ulama (PW NU) Sumut yang berpasangan dengan Dr RE Nainggolan MM nomor urut 4 berhasil memenangkan Pemilu Gubsu 7 Maret 2013, Drs Haji Amri Tambunan mengajak seluruh warga Tabagsel untuk tetap memelihara kebersamaan membangun bangsa dan Sumut yang kita cintai. Kebersamaan indah yang kita perlihatkan ini harus tetap kita pupuk dan pelihara untuk membangun Sumut. Dulu Sumut masih bisa mempertahankan prestasi sebagai provinsi terbaik di luar Pulau Jawa. Namun di era lima tahun terakhir ini Sumut berada di posisi ke 19 dari 33 provinsi yang ada di Indonesia. Ketika saya masih menjabat Humas di Pemprovsu dan sering berkunjung ke daerah ini bersama Gubsu ketika itu H Raja Inal Siregar, jalan-jalan terawat dengan baik dan kondisinya mulus. Namun saat ini kondisi jalan cukup memprihatinkan. Begitu juga kondisi irigasi yang untuk Sumut sekira 30 persen kondisinya sangat mengganggu bagi petani, jelas Amri. Karenanya, untuk perbaikan ke arah yang lebih baik mari kita bersama-sama membangun Sumut dengan menetapkan pilihan pada

Waspada/HM Husni Siregar

MASSA dari usia remaja dan orangtua pendukung kadidat gubernur Sumut Amri Tambunan foto bersama saat kampanye di Kota Siprirok yang dipusatkan di Lapangan Tanah Merah, Kel. Sipirok, Sabtu (23/2) sore.

Pilgubsu 7 Maret 2013 untuk kemenangan nomor urut 4 agar kita bisa membangun pendidikan serta berbagai infrastruktur seperti jalan, irigasi dan lainnya, kata Amri Tambunan yang pernah mengecap pendidikan di SMAN Sipirok. H Sutor Siregar selaku panitia rapat terbatas kampanye Pilgubsu nomor urut 4 yang juga Ketua DPC Partai Demokrat Tapanuli Selatan dalam pertemuan itu mengatakan kalau kita ingin menang mari kita mulai dengan niat yang tulus dan ikhlas. Mari kita menangkan pasangan Cagubsu/Cawagubsu Drs Haji Amri Tambunan-Dr Rustam Efendy Nainggoalan MM pada pesta demokrasi rakyat Sumut 7 Maret 2013. Sementara itu tokoh ulama Tabagsel H Miswar Nasution mengajak seluruh ulama di Tabagsel untuk memenangkan pasangan Amri-RE sehingga kedua kandidat yang sudah cukup teruji dan berpengalaman dalam mengelola pemerintahan, pembangunan dan pembinaan kemasyarakatan dapat mempercepat pembangunan Sumut yang kita cintai ini. Kami para ulama di daerah Tabagsel siap mendukung dan memenangkan Amri-RE pada Pilgubsu,7 Maret 2013, ujar H Miswar. Sedangkan tokoh masyarakat Adat Sipirok H Rasyid Siregar dari keluarga besar “Bagas Godang” dalam sambutannya mengajak seluruh warga untuk memenangkan Amri-RE. Kami masyarakat Sipirok dan umumnya wilayah Tabagsel siap mendukung dan memenangkan Drs Haji Amri Tambunan menjadi Gubsu melalui Pilgubsu 7 Maret 2013. Pada kesempatan itu, Amri Tambunan mengimbau massa yang hadir untuk mengajak seluruh keluarga, tetangga, kerabat dan handai tolan untuk memenangkan nomor urut 4 pada Pilgubsu 7 Maret 2013 agar kita secara bersama-sama dapat menentukan arah pembangunan Sumut 5 tahun ke depan. Kita harus mampu mengembalikan ke jayaan Sumut paling tidak menjadikan Sumut sebagai provinsi terbaik di luar Pulau Jawa, ujar Amri yang disambut yel..yel...”Hidup Amri” Nomor 4 … Menang. Duduk Ditikar Membeludak massa yang datang khususnya para kaum ibu untuk bertatap muka langsung dengan Cagubsu Drs Haji Amri Tambunan, membuat Panitia sedikit kewalahan karena persediaan kursi penuh.Akibatnya seratusan kaum ibu dengan rela dan penuh rasa tulus “duduk ditikar” untuk mendengarkan arahan dari Cagubsu Drs Haji Amri Tambunan. Bahkan cuaca sore hari itu yang agak sedikit terik, tidak membuat para kaum ibu berpakaian “Hijau-hijau” yang merupakan warga Muslimat NU se Tabagsel beranjak dari tempat duduknya.(a06).-

Waspada/HM Husni Siregar

RATUSAN kaum ibu dengan rela duduk di tikar untuk mendengarkan arahan dari Cagubsu Drs Haji Amri Tambunan saat kampanye di Kota Siprirok yang di pusatkan di Lapangan Tanah Merah, Kel. Sipirok, Sabtu (23/2) sore.



24 Februari 2013


Menpora Perjuangkan Sirkuit IMI MEDAN (Waspadas): Menteri Pemuda dan Olahraga (Menpora), Roy Suryo, akan memperjuangkan keberadaan Sirkuit Multi Fungsi IMI Sumut di Jl Pancing Medan yang kini terancam digusur oleh pengembang. “Kita akan menyelesaikan masalah ini secepatnya. Semoga perjuangan kita nantinya bisa membuahkan hasil yang memuaskan,” ujar Roy Suryo ketika meninjau sirkuit tersebut, Sabtu (23/2) pagi. Saat meninjai Sirkuit IMI, Roy

langsung masuk ke kantor sirkuit danmendengarkronologiskisruh lahan sirkuit dari Ketua Harian Pengprov IMI Sumut, Jhon IsmadiLubis. Setelahmendengarpenjelasan, Roy Suryo melihat keadaan sirkuit dari lantai dua kantor itu.

Namun karena kurang puas, Menpora akhirnya turun dan mengelilingi sirkuit didampingi Jhon Lubis. Juga hadir Anggota DPR RI NurdinTampubolon dan Ramadhan Pohan beserta Kadispora Sumut Khairul Anwar. Menurut Roy, sirkuit itu merupakan sarana olahraga yang harus dipertahankan dalam melahirkan bibit-bibit pebalap nasional.“Atlet itu bisa berprestasi bila kita memberikan tempat latihan kepada mereka seperti sirkuit ini,” katanya. “Kami akan mengundang

Waspada/Dedi Riono

TIM futsal SMPN 6 Medan diabadikan bersama sesuai menjuarai turnamen Multi Karya Cup II/2013 di Lapangan De Futsal Medan, Sabtu (23/2).

SMPN 6 Juara Multi Karya Cup MEDAN (Waspada): SMPN 6 Medan menjuarai turnamen futsal Multi Karya Cup II/2013, setelah di partai puncak menaklukkanSMPN15Medan3-2diLapangan De Futsal, Jl Suka Aman/ STM Medan, Sabtu (23/2). Kemenangan SMPN 6 diraih lewat adu tendangan penalti setelah dalam pertandingan waktu normal kedua tim bermain sama kuat 1-1. SMPN 6 mencetak gol lebih dulu disumbangkan M Rois di paruh waktu babak pertama. Sedangkan gol balasan SMPN 15

tercipta di penghujung babak kedualewateksekusibolamatiAndo Jesaya. SMPN 15 kalah dalam adu tendangan penalti akibat dua dari tiga eksekutornya, yakni Ando Jesaya dan Dede Arfan gagal membobolgawanglawan.Praktis hanya Fajar Habib yang sukses menjalankantugasnya.Sedangkan dua eksekutor penalti SMPN 6, yakni M Gunawan dan M Rois tanpa kesulitan mampu membuat gol, sehingga eksekutor terakhir mereka tidak perlu menja-

Duo Albatros Final Mencirim Cup BINJAI (Waspada): Tim old crack dan tim junior Albatros FC sama-sama akan tampil dalam babak final turnamen sepakbola Mencirim Cup 2013 di Lapangan Mencirim, Minggu (24/2) ini. Sebelumnya, tim old crack Albatros melaju ke final setelah menaklukkan Bank Sumut 2-0, Jumat (22/2). Di partai puncak, Albatros menghadapi Tasbi Medan. Sedangkan tim junior Albatros di final menantang tuan rumah Mencirim FC. Ketua Albatros FC, Alexander Gho, Sabtu ( 23/2), mengatakan kedua tim ditargetkan meraih gelar juara. Para pemain pun sudah diberimotivasiuntuktampilmaksimal guna mewujudkan target tersebut. Dikatakan, tim old crack Albatros akan mewaspadai para pemainTasbisepertiCollyMisrun

dan dua pemain asing Raymond serta Junior, ditambah pemain lainnya seperti Iskandar Jalil dan penjaga gawang Mardianto. Albatros sendiri akan turun dengan diperkuat Alexander Gho, Iwan Karo-Karo, Petrus Barus, Junaidi Koto, Indra Jaya, Amran, Asriadi dan lainnya. Sedangkan tim junior Albatros kelahiran 1994 yang dibesut pelatih Amran dan Azwan Lubis juga sudah mempersiapkan strategi khusus menghadapi tuan rumah Mencirim FC.“Anak-anak harus kuat mental karena itu modal utama,” timpal Amran. Alexander Gho mengemukakan, khusus pemain old crack, pertandinganfinalmelawanTasbi menjadi ajang pemanasan jelang mengikuti turnamen di Pulau Penang, di mana Albatros merupakan tim juara bertahan. (a04)

21 Tim Bersaing Di Babalan P BRANDAN (Waspada): Sejumlah 21 tim dalam turnamen futsal pelajar yang digelar Singapore Community di Lapangan Singapore Futsal, Jl Singapore, Kec Babalan, Kabupaten Langkat, mulai Sabtu (23/2). KetuaPanitia,Albajar,mengatakan21timyangbersaing,semuanya berasal dari Langkat. Event ini juga sebagai ajang mempererat tali silaturahim sesama pelajar. “Tim yang ikut bersaing datang dari sejumlah kecamatan seperti Pangkalanberandan, Pangkalansusu, Besitang, Tanjungpura, dan Gebang. Kompetisi ini memakai sistem gugur dan akan berakhir Minggu (24/2) ini,” katanya. (c01)

Problem Catur

lankan tugas. Sebelumnya, posisi ketiga diduduki SMP Assyafi’i Medan sesuai menundukkan SMPN 36 Medan dengan skor 9-5. Gelar top skor diraih Ando Jesaya (SMPN 15 Medan) dengan mengemas23goldanpemainterbaik disandang M Rois (SMPN 6 Medan).Turnamen tersebut ditutup resmi Kelapa SMK Multi Karya, Ir Zainuddin. “Selainmendapattrofibergilir dan tetap serta dana pembinaan, tim yang menduduki peringkat pertama hingga keempat juga berhak menerima beasiswa pendidikan di SMK Multi Karya. Selamat kepada tim juara,” ujar Zainuddin didampingi Koordinator Turnamen, Lyly Rismaidi. Ketua Panitia, Rudi Sanjaya, didampingiKetuaBidangPertandingan Drs Irwan Herianto Siregar, melaporkan turnamen yang berlangsung sejak 18 Februari itu total diikuti 50 tim pelajar SLTP Kota Medan sekitarnya. (m42)

pihak-pihak yang terkait untuk segera menyelesaikan masalah sirkuit ini. Saya akan lihat semua yang ada. Saya punya staf ahli yang dulu mantan Kadispora Sumut,jaditahupersissejarahnya. Nanti akan ada tindakan yang kami lakukan.Yang jelas, saya kumpulkandatasebanyak-banyaknya dulu,” ungkap Roy. Dalam kesempatan itu, Roy meminta Staf Ahlinya Sakhyan Asmara yang ikut mendampingi peninjauan sikuit untuk segera menyelidikikasuspenjualanlahan sirkuit tersebut. “Saya menyimpulkanadakeselahandiPemprovsu dalam menjual lahan ini,” tambahnya. Diakuinya, selama ini dirinya hanya sebatas menerima laporan persoalan penjualan sirkuit IMI tersebut. Dari laporan itu menyebutkan, jika lahan seluas 15 hektar ini yang tergerus oleh pembangunan kepada pengembang sekira 20 sampai 30 persen. “Saya lihat langsung ternyata bukan 20 sampai 30 persen, tetapi berkurang lebih dari separuh,” jelasnya. Dirinya menyesalkan persoalaninisetelahsekianlamaproses pembangunan, hingga IMI Sumut ditunjuk untuk mengelola sirkuit. Dilepasnya aset Pemprovsu inipun sangat disesalkannya. Sebab, anggaran di Kemenpora yang masih terbatas. “Makanyasaranayangsudah ada jangan dihilangkan. Saya kira halsemacaminitidakbolehterjadi di dunia olahraga Indonesia. Saya belum berjanji apa-apa, tetapi semuakasusbisadiselesaikandan penyelesaiannyatidakmerugikan dunia olahraga,” imbuhnya. Sebagai bentuk komitmen mendukung keberadaan sirkuit itu, Menpora membubuhkan

tandatangan di spanduk yang jugatelahditandatanganiparabiker pekan lalu. Ketua Harian IMI Sumut, Jhon Ismadi Lubis mengapresiasi kedatangan Menpora yang melihatlangsungkondisisirkuit.“Kita sampaikan kronologis sirkuit. Bahwa kita hanya menerima amanah dari Pemprovsu untuk mengelolanya.Apapunnamanya kitatergantungPemprovsu.Kalau izin pengelolaan kita dicabut, selesai kita. Sedangkan persoalan hukum, kita tidak turut ikut campur, itu antara pemerintah dan pengembang,” ujarnya didampingiSekretarisKONISumutChairul Azmi dan Ketua KONI Medan Zulhifzi Lubis. NamunJhonsangatberha-rap sirkuittersebutdipertahankantanpa adanya pembangunan yang dilakukan pengembang. Sebab, jika relokasi yang dilakukan tidak memenuhistandar,sirkuittidakakan bisa digunakan dan menjadi bomerang bagi IMI Sumut. “Masalahtimbulkalaurelokasi tidak memenuhi standar, itu harus dipikirkan. Harapan kita, sirkuit tetap bertahan. Tidak mungkin relokasi karena tidak memenuhi standar. Ini yang kita harapkandaripemerintahpusat,karena ini kepentingan anak bangsa,” tegasnya. Sebelumnya, Sekretaris AliansiMasyarakatPecintaOtomotif (AMPO), Indra Gunawan, menyerahkan buku berisikan fotocopi dokumen-dokumen tentang lahan, kronologis sirkuit dan pernyataan sikap dari para biker di Sumut kepada Menpora. “Kita berharap agar Menpora bisa menyelesaikan masalah ini tanpa menggusur sirkuit,” ujar Indra. (m47)

500 Atlet Taput Ikut Kejuaraan Naga Sakti TARUTUNG (Waspada): Sejumlah 500 atlet Kungfu Naga Sakti Cabang Tapanuli Utara (Taput) mengikuti kejuaraan piala Guru Besar Perguruan Kungfu Naga Sakti di Kabupaten Toba Samosir, 23-24 Februari ini. Para atlet didampingi sekira 100 pendampingi, terdiri atas dewan guru, pelatih, asisten pelatih, dan pengurus, dilepas resmi Ketua KONI Taput di halaman Gedung Sopo Partungkoan, Jl Sisingamangaraja, Tarutung, Sabtu (23/2). Ketua KONI Taput, Saur Lumbantobing SE, mengatakan para atlet harus senantiasa disiplin dan patuh terhadap pelatih. Dia berharap atletTaput meraih prestasi membanggakan dalam event tersebut. “KONI Taput mendukung penuh atlet daerah ini mengikuti berbagai kejuaraan. Kami juga bangga dengan kepengurusan Perguruan Naga Sakti Taput yang begitu kompak dan bersinergi membangunan mental generasi muda melalui kegiatan olahraga,” ujar Saur. Ketua Perguruan Kungfu Naga Sakti CabangTaput, Saut Silaban, menjelaskan 500 atlet yang diturunkan adalah mereka yang datang dari dusun dan desa asal 13 kecamatan se Taput atau minus Kecamatan Simangumban dan Purbatua. “Kita menargetkan atlet Taput mampu meraih gelar juara umum pada kejuaraan itu. Untuk mencapai target tersebut, kita telah mempersiapkan atlet secara matang, baik dari segi kesehatan, fisik, pukulan jurus dan ketangkasan,” ucapnya. (a21)

Waspada/Armansyah Th

MENPORA Roy Suryo (tiga kanan) mendengar penjelasan Ketua Harian Pengprov IMI Sumut, Jhon Ismadi Lubis saat meninjau Sirkuit IMI Sumut, Sabtu (23/2).

Awal Bagus SMA Nusantara Voli Dharmawangsa Cup XIX MEDAN (Waspada):Tim putri SMA Nusantara Lubukpakam yang bersaing di Grup X, meraih kemenangan pertama atas SMK YPK Medan 20 dalamlanjutanturnamenbolavoliDharmawangsa Cup XIX/2013, Sabtu (24/2). Bertanding di Lapangan Taman Rekreasi dan Olahraga, Jl Gajah Mada Medan, laga kedua tim berlangsung berat sebelah. Anak-anak YPK tidak berdaya menghadapi permainan cepat dan cerdik lawan. Tanda-tanda kekalahanYPK sudah terlihat sejak set pertama. Putri, Lilis, dan kawan-kawan tampak kehilangan motivasi dan harus kalah telak 7-25. Sebaliknya, SMA Nusantara terus menunjukkan dominasinya di set kedua. Smes-smes tajam Anum dan Dina membuat permainanYPK sulit berkembang. Mereka tampak

IMI Aceh, YRFI Bakti Sosial BANDA ACEH (Waspada): Pengprov IMI Aceh bersama PengurusYamaha Riders Federation Indonesia (YRFI) mengadakan bakti sosial (Baksos) dengan menyerahkan bantuan untuk Panti AsuhanYayasan Penyantun Islam Seutui, Banda Aceh, Sabtu (23/2). Bantuan berupa bahan sembako, peralatan olahraga, kasur, dan bibit mangga diserahkan Ketua Pengprov IMI Aceh Ibnu Rusdi SE dan Ketua YRFI Pusat Moh Rahmat. Dalam kesempatan itu, Ibnu Rusdi mengatakan penyerahan bantuan merupakan rangkaian dari kegiatan IMI dan YRFI dalam rangka sosialisasiYRFI di Aceh. “Jadi untuk diketahui, IMI dan klub-klub otomotif tidak hanya melakukan kegiatan ba-

Menpora Apresiasi Tako Indonesia HUT Emas Moment Kebangkitan MEDAN (Waspada): Menteri Pemuda dan Olahraga (Menpora) Roy Suryo memberikan apresiasi kepada Perguruan KarateDo Tako Indonesia yang memperingati HUT ke-50 atau HUT emas dan sekaligus pelantikan Pengda Perguruan Karate-DoTako Indonesia yang dipimpin Dr Ir Nurdin Tampubolon. Acara yang dihelat di Ball Room Hotel Grand Angkasa, Sabtu (23/2), Roy Suryo didampingi istri mengharapkan kepengurusan PB Tako Indonesia periode 2012-2016dapatmenjadikanacara ini sebagai momentum kebangkitanprestasiTakoIndonesia. Karena,Tako Indonesia sebelumnya sudah memberikan prestasi menggembirakan baik di kancah nasional dan internasional. Ahli telematika yang dipercayakan sebagai Menpora ini mengakuiakanmembenahidanmeningkatkan prestasi olahraga di tingkat internasional. Tentunya, Menpora berharapTako Indone-

sia dapat menyumbangkan atlet sebanyak-banyaknya untuk memperkuat kontingen Indonesia di berbagai kejuaraan internasional, baik SEA Games, Asian Games dan lainnya. Ketua Umum PB Tako Indonesia Dr Ir Nurdin Tampubolon mengakui selama kurun waktu 10 tahun terakhir, prestasi karate Tako Indonesia menurun. Selain perayaanHUTEmasdankegiatan pelantikan PB Tako Indonesia masa bakti 2012-2016, juga dilaksanakan Kejuaraan Daerah (Kejurda) Tako se Sumatera Utara diGelanggangRemaja,21-23Februari dengan diikuti 450 karateka. Nurdin yang juga anggota DPR I meyakini bahwa dia dan insanTakoIndonesiaoptimismengembalikankejayaantakoseperti dahulu. “HUT Emas ini akan kita jadikan sebagai moment untuk membangkitkankembaliprestasi Tako Indonesia seperti masa jayanya dulu,” kata Nurdin. KetuaPanpel,SamsulSianturi

SH,mengakupuasacaraHUTEmas dan pelantikan kepengurusan PB Tako berjalan lancar dan diikuti ratusaninsanTakoIndonesiaserta berbagaiundanganbaikdariSumut dan di luar Sumut. “Kita sadari, untuk berkembangpengurusharuspunyaakses ke tokoh-tokoh pemerintahan dantokohpolitik.Kebetulanketua umum kita juga anggota DPR RI, sehingga beliau juga menjalin komunikasi dengan pejabat pemerintah dan rekan sejawatnya agar sama-sama ikut membantu perkembangan Tako,” kata Samsul. SamsulSianturiyangjugaKetuaTakoSumutmenimpali,penurunan prestasi sebenarnya bukan hanya dialami Perguruan Tako, tapi hampir seluruh cabang olahraga. Khusus untuk Tako Sumut, dia menyebutkan, kurangnya dukungan pemerintah daerah sehingga pengurus yang harus habis-habisan sendiri untuk melakukan pembinaan terhadap atlet.

Putih melangkah, mematikan lawannya enam langkah. Jawaban di halaman A2.

Waspada/Setia Budi Siregar

MENPORA RI Roy Suryo bersama Ketua Umum PB Tako Dr Ir Nurdin Tampubolon, Sekjen PB Tako Edison Manurung SH didampingi Ketua Pengda Tako Sumut Samsul Sianturi SH menandatangani fakta integritas di sela-sela pelantikan PB Tako Indonesia, Sabtu (23/2), di Ball Room Grand Angkasa Hotel.

kelilangan pola permainan sehingga kesalahan demi kesalahan kerap dilakukan. Keadaan ini dimanfaatkan Nusantara untuk kembali memenangi set kedua juga dengan skor 25-7. “Anak-anaksudahtampilbagus,namunmereka belum teruji karena lawan yang kita hadapi kemampuannya memang masih di bawah. Makanya anak-anaktidakbolehcepatberpuasdiri,mengingat perjuang masih panjang dan lawan-lawan tangguh sudah menunggu di laga berikutnya,” ujar pelatih SMA Nusantara, Rizal. Pertandingan lainnya di Grup X, putri SMA Bayu Pertiwi meraih kemenangan mudah atas SMAN 3 Medan 2-0 (25-11, 25-12). Persaingan di Grup C, tim putra SMA Yaspi menundukkan SMA Prayatna Medan 2-1 (25-14, 22-25, 17-15). (m42)

“Selama ini juga kurang adanya harmonisasi antar pengurus untuk menggenjot pembinaan. Ditambah finansial yang kurang, makanya prestasi kita juga agak terpuruk,” sambungnya. Samsul menyatakan27pengcabTakoyang ada di Sumut saat ini dengan dukungan 387 dojo siap kembali menunjukkankemampuanuntuk bersaing dengan perguruanperguruan lain. Untukitulahdalamrangkaian perayaan HUT Emas, PengdaTako Sumut juga melakukan kegiatan pembinaan berupa Kejurda se-Sumut yang diharapkan bisa memunculkan bibit karateka Tako,sertamendapatkankarateka terbaik yang akan ditampilkan pada event-event nasional. Kepengurusan PB Tako IndonesiadilantikKetuaDewanGuruTako Indonesia Ir Effendi Sirait didampingi Ketua Umum PB Forki Hendarji. Acara juga dirangkaikandenganpenyematansabuk hitam dan sejumlah atraksi karatekaTako Indonesia. Turut hadir, Ketua Forki Sumut DR H Rahmat Shah, Anggota Dewan GuruTako Indonesia Ir Lintong Siagian, Ny Ratna Lubis Sahrun Isa yang merupakan istri almarhum Sahrun Isa pendiri Perguruan Tako dan Dra Rupina Aruan Jamin Purba, istrialmarhummantanKetuaDewan Guru Tako, murid pertama SahrunIsadanundanganlainnya. Kepengurusan PBTako Indonesia: Ketua Umum DR. Ir. Nurdin Tampubolon, Ketua I Drs Efendi Silalahi, Ketua II Pujatmoko, Ketua III Drs. H. Dheni Kurnia, LP, MA, Ketua IV Palti Hutapea. Sekretaris Umum Drs EdisonManurungSHMM,Sekretaris I Aman Situngkir SE, Sekretaris II Nerwan SH, Sekretaris III Mekida Marbun dan Sekretaris IV Tobal Kasmuri. Bendahara Umum Achmad Solahudin SE, Bendahara I Rita Sudjiharto SE, Bendahara IIWJM Sucipto, Bendahara III Martin Manurung, Bendahara IV Fery Batin. Kepengurusan dilengkapi dengan berbagai bidang. (m18)

lap-balap saja, tapi juga melakukan kegiatan sosial sebagai ibadah untuk bekal di kemudian hari,” sebut Didi, begitu dia akrab disapa. Karena itu, Didi mengharapkan bantuan yang diberikan bermanfaatbagianak-anakpanti. “Hanya inilah yang dapat kami berikan dan mudah-mudahan ke depan kami dapat melakukan kegiatanserupadisini,”ujarpolitisi Partai Demokrat ini. Ustadz Saifuddin atas nama

pengurus yayasan menyampaikan terima kasih kepada IMI dan YRFI atas kepedulian ini. “Saya pastikanbantuaniniakanmemiliki banyak manfaat bagi penghuni panti,” katanya. Pengurus Pusat YRFI, Moh Rahmat, menyebut kedatangan mereka ke Aceh merupakan bagian sosialisasiYRFI sebagai wadah klub Yamaha se-Indonesia yang dilakukan di 12 kota di Indonesia.“Sosialisasiinijugadirangkai bakti sosial,” sebutnya. (b04)

10 Tim Ikut Piala GanTeng MEDAN (Waspada): Sejumlah 10 tim akan bersaing dalam turnamen sepakbola Piala GanTeng Desa Lau Dendang 2013, di Lapangan Laden, Jl Pengabdian, Simpang Beo, Lau Dendang, Percut Sei Tuan, Minggu (24/2) siang ini. Ketua Panitia Irmanto didampingi Sekretaris Abyadi Siregar, mengatakan turnamen tersebut akan dibuka resmi Gubernur Sumut, Gatot Pujo Nugroho. Pembukaan turnamen akan ditandai dengan tendangan bola perdana oleh Gubsu. “Ke-10 tim yang bersaing berasal dari sembilan dusun di Desa Lau Dendang. Turnamen ini juga menyediakan hadiah total jutaan rupiah. Namun yang paling penting ingin dicapai dari turnamen ini adalah mempererat tali silaturahim sesama warga,” katanya. Tokoh Masyarakat Lau Dendang, Mujimin, berharap semua peserta dapat bertanding dengan sportif, sehingga tidak mengganggu ketentraman warga sekitar.“Maki kita sama-sama menjaga kesatuan dan persatuan,” himbaunya. (m42)

Ribuan Warga Jalan Santai Di Simalungun PAMATANGRAYA (Waspada): Bupati Simalungun, JR Saragih, bersama unsur pimpinan daerah, KPU, dan Panwaslu Simalungun melakukan jalan santai bersama ribuan warga dan pelajar, Sabtu (23/2). Kegiatan itu sekaligus dalam rangka sosialisasi pelaksanaan Pemilihan Gubernur Sumut (Pilgubsu) yang akan digelar 7 Maret 2013. Para peserta dilepas resmi JR Saragih di titik start Lapangan SMK Efarina Pamatang Raya. Sedikitnya 6.000 massa terdiri atas Muspida, KPU, PNS, masyarakat dan pelajar tampak bersemangat mengikuti kegiatan yang menempuh jarak sekira 3 Km dengan finish di balai pertemuan Pdt J Wismar Saragih Pamatang Raya. “Saya bangga dengan para peserta gerak jalan santai ini yang begitu semangat dan sangat antusias,” ujar JR Saragih. Kepala Divisi Humas dan Hubungan Antar Lembaga KPU Simalungun, Ramadin Turnip SH, mengambil waktu sesaat untuk menyosialisasikan tata cara pemilihan Gubernur danWakil Gubernur Sumut. Dia menyampaikan bahwa dalam pemilihan nantinya ada lima pasang calon Gubsu dan Wagubsu, cara memilihnya adalah dengan pencoblosan di Tempat Pemungutan Suara (TPS) dan hanya satu kali pencoblosan dari salah satu calon yang dipilih. Yang melakukan pemilihan adalah mereka yang terdaftar di Daftar Pemilih Tetap (DPT). (a29)



WASPADA Minggu 24 Februari 2013

Sociedad Ungguli Bilbao 3-1 MADRID, Spanyol (Waspada): Real Sociedad membuat lompatan besar melewati Valencia untuk menempati posisi kelima dalam klasemen sementara Liga Utama Spanyol (La Liga) setelah menyusul ketertinggalan mereka untuk memetik kemenangan 3-1 atas tuan rumah Athletic Bilbao pada derbi Basque, Jumat waktu setempat atau Sabtu (23/2) dinihari WIB. Ibai Gomez membuat tim

tuan rumah unggul terlebih dahulu lewat tembakannya melalui tendangan voli yang menakjubkan pada menit ke30 sebelum Antoine Griezmann menandukkan gol penyama kedudukan bagi Sociedad empat menit kemudian. Suatu kesalahan besar dari kiper Bilbao Raul memberi peluang kepada Imanol Agirretxe untuk mencetak gol di menit ke-67 dan pemain lain Sociedad, pemain depan Carlos Vela asal

PEMAIN Real Sociedad melakukan selebrasi.

Meksiko, melepaskan tembakan melengkung bagi gol ketiga Sociedad pada sisa waktu 14 menit untuk memastikan kemenangan pertama mereka atas klub San Mames itu dalam kurun waktu lebih dari satu dasawarsa. “Ini sudah lama sekali sejak kami dulu menang di Bilbao tetapi kami tahu itu bisa saja terjadi dan kami merasa sangat senang,” ujar kapten Sociedad Xabi Prieto kepada Marca TV. “Kami tidak berharap akan berada di posisi ini terus dalam klasemen tetapi kami ingin mempertahankannya sekarang dan melanjutkan sepak terjang yang sangat positif ini serta sambil melihat apakah kami bisa masuk kualifikasi ke liga Europe.” Sociedad, satu-satunya klub yang bisa mengalahkan sang pemimpin Barcelona pada musim ini, kini mengantungi 40 poin dari 25 pertandingan. Kekalahan pada pertandingan Jumat itu bagi Bilbao, yang berhasil mencapai final Liga Europa dan Piala Raja pada musim lalu, membuat mereka merosot ke posisi 15 dengan 26 poin dan pelatih Marcelo Bielsa benar-benar dalam bahaya. (m18/ant/rtr)

Nishikori Ke Semifinal Memphis Terbuka MEMPHIS ( Waspada): Unggulan kelima Kei Nishikori dari Jepang mengalahkan unggulan utama Marin Cilic 6-4 dan 6-2 dan maju ke babak semifinal turnamen tenis National Indoor Tennis Championships Amerika yang berlangsung di Memphis, Jumat waktu setempat atau Sabtu (23/2) pagi WIB. Cilic yang berasal dari Kroasia mengamankan tiga match points pada pertandingan sebelumnya melawan Igor Sijsling, tetapi ia tidak berhasil membendung serangan Nishikori, yang hanya memiliki empat ace, dibanding dengan belasan yang didapatkan Cilic, tetapi ia unggulan 69 persen raihan poin melalui servisnya. “Saya mendominasi permainan melalui servis saya,” kata Nishikori yang berusia 23 tahun, yang juga maju ke semi final di Brisbane pada Januari lalu, tetapi mundur ketika akan melawan Andy Murray, karena mengalami cedera kaki. Sejak itu, dia maju ke putaran keempat turnamen Australia Terbuka. “Saya merasa sudah semakin baik...dari waktu ke waktu,” kata Nishikori setelah usai bertanding. Dia selanjutnya akan bertemu dengan petenis dari Australia Marinko Matosevic, yang menang 6-7 (6/8), 6-2, 6-4 atas unggulan ketujuh dari Ukraina, Alexandr Dolgopolov. Nishikori memenangi pertandingan pada satu-satunya pertemuan mereka sebelum ini, di Brisbane, awal tahun 2013.

Pada kategori putri, di turnamen yang merupakan kombinasi Tur ATP dan WTA itu, pemain yang dikenal memiliki pukulan keras, Sabine Lisicki dari Jerman, mempersiapkan pertemuannya den gan Marina Erakovic. Lisicki, unggulan ketiga, kandas pada tiap awal set, tapi akhirnya unggul 7-5, 7-5 atas unggulan ketujuh Magdalena Rybarikova. Dia sedang mengincar gelar WTA keempat dalam karirnya. Pemain dari Selandia Baru Erakovic mengalahkan Stefanie Voegele dari Swiss dengan angka 6-2, 6-4 dalam usahanya mengincar gelar pertama turnamen WTA. Marseille Terbuka Petenis nomor delapan dunia Jo-Wilfried Tsonga mengamankan lima match point pada laga tiebreak set ketiga ketika mengalahkan pemain dari Australia Bernard Tomic sehingga lolos ke babak semi final turnamen tenis Marseille Terbuka, Sabtu (23/2) WIB. Unggulan ketiga dari Prancis itu, yang kalah pada set pertama, berhasil membuat angka tie-break 12-10 untuk menutup dengan angka kemenangan 46 6-3 7-6, pada laga yang berlangsung dua jam lima menit. Tsonga, yang menang pada pertemuan pertama sebelumnya melawan Tomic, peringkat 46 dunia, memanfaatkan keberuntungannya ketika mengalahkan pemain berusia 21 tahun dari Australia itu, salah satu petenis muda paling

menakjubkan dalam kancah tenis dunia. “Saya berhasil menemukan dan mempertahankan bentuk permainan saya dan rasanya itu semua terjadi karena faktor keajaiban.Tapi ia akan mengakui bahwa saya juga bermain baik dalam pertandingan tadi,” kata Tsonga kepada wartawan. “Pada momen seperti ini, kita harus bermain dengan berani untuk mengatasi kekhawatiran dan saya akui bahwa saya bermain amat agresif,” katanya. Tsonga selanjutnya akan bertemu dengan Gilles Simon pada laga semifinal, setelah rekan senegaranya itu mengalahkan penyandang gelar Juan Martin Del Potro 6-4 6-3. Simon tidak melakukan kesalahan dalam melancarkan servisnya sejak awal dan ia amat awas ketika menghadapi lawannya menantang juara AS Terbuka, yang amat efektif bila melakukan pukulan backhand. Setelah menyelesaikan permainan set pertama dalam waktu 36 menit, peringkat ke-14 Simon dengan cepat memimpin 4-1 pada laga set kedua dan tidak memberi kesempatan bagi lawannya untuk melaku-kan tekanan. Unggulan utama Tomas Berdych harus bekerja keras ketika mengalahkan unggulan ketujuh Jerzy Janowicz, yang namanya dikenal ketika maju ke babak final Paris Masters November lalu, padahal ia masuk ke daftar undian melalui babak kualifikasi. (m18/ant/rtr/afp)


PETENNIS asal Jepang Kei Nishikori (kiri) berjabat tangan dengan Marin Cilic (Kroasia) seusai pertandingan perempatfinal US National Indoor Championships di Memphis, Sabtu (23/2) WIB. Nishikori mengalahkan Cilic 6-4 dan 6-2 dan melaju ke semifinal.

Warriors Bekap Spurs 107-101 SAN ANTONIO (Waspada): Golden State Warriors berhasil membekap San Antonio Spurs 107-101 dalam lanjutan NBA, Sabtu (23/2) siang WIB. Tampil dengan jersey berlengan pendek Warriors memaksa Spurs bertarung sampai overtime. Kemenangan beruntun Spurs pun berhenti di angka lima. Sebelumnya, Tim Duncan dkk. berturut-turut menundukkan Brooklyn Nets, Chicago Bulls, Cleveland Cavaliers, Sacramento Kings, dan LA Clippers. Pertandingan berlangsung ketat di kuarter pertama, di mana kedua tim sama-sama mencetak 25 poin. Spurs kemudian unggul tipis di akhir kuarter kedua setelah mencetak 14 poin tambahan, sementara Warriors hanya 13. Tim Duncan dan Danny

Green tampil apik untuk Spurs. Duncan mencetak 19 poin, 13 reboung, dan 3 assist, membuatnya menjadi penampil terbaik dari kubu Spurs. Sementara Green mencetak 20 poin dan empat rebound. Spurs tampak mendominasi di kuarter ketiga, namun Stephen Curry membawa Warriors mengejar, di mana akhirnya

Curry mencetak 19 poin dan 6 assist di akhir pertandingan. David Lee sempat membawa Warriors unggul 90-89, tapi tak lama kemudian kuarter keempat berakhir dengan skor sama kuat. Di babak overtime, Warriorsmenambah14poindanSpurs hanya mencetak 8. Spurs pun akhirnya kandas. (m18/euro)

Hasil Pertandingan Lainnya LA Lakers vs Portland 107-111 Boston Celtics vs Phoenix 113-88 Minnesota vs Oklahoma 111-127 Mavericks vs Hornets 104-100 Orlando vs Memphis 82-88 Sacramento vs Atlanta 108-122 Houston vs Brooklyn 106-96 Denver vs Washington 113-119 Chicago Bulls vs Charlotte 105-75 Detroit vs Indiana 82-114 New York Knicks vs Toronto 98-100


DUA pemain AC Milan Mario Balotelli dan El Shaarawy

Khawatirkan Euforia Milan Inter Vs Milan Dinihari Nanti MILAN, Italia (Waspada): Bek AC Milan, Philippe Mexes mendesak rekan-rekan setimnya untuk tetap menginjakkan kaki mereka di tanah menyusul kemenangan sensasional Rossoneri atas Barcelona pada Kamis lalu. Dan berkonsentrasi saat menghadapi Derby della Madonnina, Senin (25/2) dini hari WIB pukul 02:45 WIB (live TVRI). Milan menang 2-0 atas Blaugrana pada pertandingan leg pertama babak 16 besar Liga Champions yang digelar di Stadion San Siro. Moral para punggawa anak-anak asuhan Massimiliano Allegri diyakini tengah tinggi-tingginya, tapi Mexes ingin Milan lebih kalem dan tidak terbuai euforia kemenangan itu. “Itu memuaskan untuk bisa mengalahkan Barcelona, tapi kami masih belum menyelesaikan dan mendapatkan apaapa,” kata Mexes, seperti diwartakan Milan Channel, Sabtu (23/2). “Yang paling sulit saat ini adalah untuk mengatasi euforia menjelang pertandingan melawan Inter, pertandingan yang ingin kami menangkan

setelah apa yang terjadi pada pertemuan pertama musim ini,” papar pemain internasional Prancis ini. Milan menyerah 0-1 saat pertemuan pertemuan pertama mereka dengan Nerazzurri musim ini. Mexes pun mewaspadai para pemain Inter, yang dinilainya bisa menyulitkan Rossoneri untuk meraup tiga poin. Namun, mantan pemain AS Roma ini juga senang, karena di timnya ada Mario Balotelli yang siap mengancam gawang tim asuhan Andrea Stramaccioni. “Rodrigo Palacio dan Antonio Cassano adalah pemain bagus yang membuat kami harus waspada,” ucap Mexes. “Siapa pun yang membuat kesalahan paling sedikit, itulah yang akan menang,” sambungnya. “Mantan striker Inter Mario Balotelli? Dia sekarang di Milan dan dia akan menjadi ancaman berbahaya untuk Nerazzurri,” katanya. Gelandang serang Inter Milan, Ricky Alvarez, mengakui bahwa laga Derby della Madonnina adalah sebuah pertandingan yang unik. Derby della Madonnina merupakan sebutan dari laga dua klub kota Milan yang mempertemukan AC

Milan kontra Inter Milan. Meski memiliki kandang yang sama, namun Nerazzurri akan bertindak sebagai tuan rumah saat berhadapan dengan Rossoneri dalam pertandingan lanjutan kompetisi Serie A giornata ke-26. “Itu adalah sebuah pertandingan yang luar biasa, unik,” ujar Alvarez, seperti diwartakan Inter Channel, kemarin. “Bermain di pertandingan derby adalah perasaan terbaik yang pernah saya rasakan,” sambungnya. “Dengan stadion yang dipenuhi oleh fans, atmosfer pertandingan, itu akan menjadi peristiwa yang hebat. Kami benar-benar berharap untuk memenangkan pertandingan, dan memberikan sukacita untuk para suporter,” jelasnya. Alvarez juga menegaskan, performa Inter yang belakangan kurang cemerlang di kompetisi Serie A tidak akan berpengaruh saat Derby della Madonnina. Pemain asal Argentina ini ingin La Beneamata menaklukkan Milan untuk merebut posisi ketiga di klasemen. “Mungkin kami tidak bermain dengan baik di liga, itu tidak seperti yang kami inginkan, tapi saya percaya diri pada tim

ini dan saya yakin kami akan memenangkan pertandingan nanti,” tandas pemain berusia 24 tahun ini. Tidak Berbau Rasial Ultras Inter Milan merilis pernyataan, poster dan selembaran untuk menyampaikan kepada anggota mereka agar tidak menghina Mario Balotelli dengan hal yang berbau rasial selama pertandingan Pada pertemuan antara Inter kontra Milan diyakini bakal ada tensi tinggi, dan kemungkinan besar Inter bisa terkena sanksi jika fans mereka tidak bisa mengendalikan diri untuk meneriakkan hinaan berbau rasial kepada Balotelli, yang notabenenya pernah berkostum Nerazzurri. Balotelli memang menjadi daya tarik tersendiri dalam Derby della Madonnina kali ini, dan organisasi ultras Curva Nord diharapkan bisa mengendalikan anggotanya untuk memastikan segalanya berjalan lancar. “Semua orang akan duduk di sana mengharapkan perilaku premanisme kami,” kata sebuah pernyataan dari Curva Nord, seperti dilansir FootballItalia, kemarin. “Kami tidak akan mem-

berikan apa yang orang-orang itu tunggu dari kami pada setiap kesempatan untuk mem-buka mulut mereka. Mereka (Milan), maupun Presiden mereka sendiri akan mendapatkan publisitas yang baik setelah mereka meninggalkan pertandingan,” jelasnya. “Tak ada masalah dengan mengejek dia (Balotelli), bersiul dan merasa bebas untuk mengekspresikan perbedaan pendapat Anda, tapi hindari suara monyet dan ekspresi yang mereferensikan warna kulitnya,” tegas pernyataan tersebut. Ultras Inter juga mengatakan akan ada poster dan selebaran yang bakal dibagikan di pintu masuk Stadion San Siro pada hari Minggu, demi mengantisipasi fans untuk melakukan tindakan rasial kepada para pemain yang dianggap menjadi target. “Kami harus menghindari menciptakan sebuah situasi di mana kami mendapatkan cap buruk pekan ini. Setiap ultras yang kedapatan dihukum karena Mario Balotelli adalah pelaku kejahatan dan seperti meludahi dirinya sendiri di wajah. Kami mengandalkan kedewasaan Anda,” tutup pernyataan itu. (m18/ok)

PSMS Tak Gentar Hadapi PSAP Di Stadion Kuta Asan Sore Ini MEDAN (Waspada): PSMS Medan tidak gentar menghadapi laga away perdana melawan PSAP Sigli dalam lanjutan Kompetisi Divisi Utama PT Liga Indonesia di Stadion Kuta Asan, Minggu (24/2) sore ini. Tim Ayam Kinantan yang kini terseok-seok dalam pendanaan juga penuh dengan harapan bisa mencuri poin. Apalagi telah kehilangan tiga poin saat dikalahkan PS Bangka (14/2) beberapa waktu lalu di Stadion Baharoeddin Siregar menjadi catatan buruk yang harus dihilangkan. Bertandang ke Sigli, punggawa Ayam Kinantan pun berharap mencuri poin. “Misinya tetap berusaha mendapatkan poin. Kami akui ini misi sulit, tapi mau tak mau harus kami lakoni untuk mendapatkan tambahan poin,” jawab Suharto asisten pelatih PSMS, Sabtu (23/2). Secara teknis, tim tamu tak mengetahui pasti seperti apa karakter permainan dari anakanak PSAP. Namun soal spirit bermain dipastikan tak jauh berbeda dengan M Affan Lubis dkk jika tampil di hadapan pendukungnya. “Yang kami ketahui PSAP tidak banyak melakukan perubahan pemain, ada beberapa nama lama se-perti Sayuti, M Ali yang menjadi pilar disana. Sekali lagi ini laga away yang berat yang harus bisa dilalui dengan mencuri poin,” kata Suharto. Menghadapi PSAP, Suharto mengaku belum ada perubahan dari komposisi pemain yang bakal diturunkan. Duet Alamsyah Nasution di lini tengah tetap menjadi andalan. Termasuk dengan defender Moise asal Paraguay yang diharapkan mampu membendung gempuran tuan rumah dalam kondisi yang fit. Berkaca dari catatan pertemuan, PSAP dengan PSMS lebih sering berbagi kemenangan. Biasanya siapa yang menjadi tuan rumah, dialah yang mendapatkan tiga poin dan berpesta kemenangan. Pertandingan PSAP menjamu PSMS Medan dipastikan berlangsung dengan sengit. Pasalnya kedua tim sama-sama membutuhkan kemenangan untuk memperbaiki posisi di klasemen sementara grup I Divisi Utama PT Liga Indonesia. PSMS sudah mengatongi 3 poin dari dua laga, yang sebelumnya mengalahkan PS Bengkulu dan kalah atas PS Bangka.


ASISTEN pelatih PSMS Suharto menyaksikan para pemain melakukan latihan ringan di Stadion Kuta Asan,Sabtu(23/2). Bagi tuan rumah, tim besutan Rudi Saari masih mengantongi satu poin dari dua laga tandang sebelumnya ke Persisko Bungo dan Persih Tembilahan. Makanya di dalam laga home perdananya, target kemenangan pun diwajibkan kepada M Ali dkk. “Sebagai tuan rumah sudah pasti target tiga poin harus diwujudkan. Ini laga home per-

tama kami yang sangat penting. Tiga poin akan membawa kami ke posisi yang lebih baik lagi di klasemen sementara,’ ujar Rudi Saari pelatih PSAP Sigli usai menggelar latihan pagi. Sekalipun menghadapi mantan tim yang pernah ditanganinya, Rudi Saari tetap harus bersikap profesional. Bahwa kini dirinya adalah sebagai allena-

tore tim dengan julukan Aneuk Nanggroe. “Saya rasa pelatih manapun mampu bersikap profesional dan akan berusaha membawa tim yang dita-nganinya untuk menang,” sambungnya. Menurut Rudi peluang untuk menang memang sedikit berpihak kepadanya. Sebagai tuan rumah dengan dukungan suporter akan mem-

bantu semangat bertanding pemainnya. Tak hanya itu, secara mental mantan pelatih PON Sumut ini berharap M Afffan dkk pasca kekalahan dari PS Bangka belum pulih. “PSMS tetap tim besar yang sulit dikalahkan.Tapi kami juga ingin menang di setiap laga kandang, ini merupakan moment menambah tiga poin,” pungkasnya. (m18)


WASPADA Minggu 24 Februari 2013


Batik Corak

Untuk Segala Usia BERGAYA dengan busana batik untuk berbagai usia, kini semakin trend dan diminati. Batik, bukan lagi sekadar gaun resmi atau upacara khusus saja.

Karena itu pengelolanya sudah menyiapkan berbagai keperluan busana yang tetap trendy dengan mengenakan batik. Batik bercorak dengan motif pilihan kini sangat banyak ditemukan. Salah satunya di Keraton Batik di Jalan Dr Mansur No 27 Medan. Pengusahanya, Irsyadanur atau akrab disapa Irsan Selasa lalu menyebutkan, pangsa pasar batik di Medan saat ini sangat menggembirakan. Apalagi batik yang ada di tokonya ini langsung dari Malang, Solo dan Jogja. Tak heran, jika perpaduan motif dalam rancangan busana batik tersebut nampak beragam. Ada yang berwarna terang, lembut, dan bercorak. “Semua batik yang ada di sini bisa digunakan berbagai usia termasuk koleksi untuk anak-anak. Batik sarimbit keluarga, hem batik, dress, gamis dan bolere/

cardigan. Semua batik di sini berbagai semi sutera dan katun serta berbahan serat . Batiknya ada yang tulis ada juga yang batik cap. Sedangkan untuk model yang ada, dari satu desain hanya ada lima saja dengan model yang berbeda. Jadi, tak perlu ragu atau khawatir busana yang dikenakan akan banyak di pasaran, karena mode yang disiapkan terbatas,” kata Irsan. Beragam koleksi busana batik kini semakin digemari bukan hanya model, corak dan bahan yang digunakan tetapi termasuk harga yang terjangkau. Jadi, tak salah jika berbatik ria, karena busana ini asli produk anak negeri.

Naskah dan foto Anum Saskia

Pilihan Tas Terbaru Chanel Bagi Anda pecinta high-end-brand asal Perancis, Chanel, tas dari koleksi Spring/ Summer 2013 ini tampaknya wajib Anda miliki. Tas-tas koleksi musim panas Chanel ini hadir dengan desain yang unik namun tetap terlihat mewah. Sebelum menambahkannya dalam koleksi tas Anda, simak dulu rangkaian tas terbaru Chanel berikut ini:

1. PLEXY GLASS CLUTCH Chanel yang biasanya hadir dengan ciri khas tas berantai, kini terlihat lebih moderen dengan clutch berbahan plastik ini. Hadir dalam beragam warna cerah yang begitu ‘summer’, clutch rancangan Karl Lagerfeld ini dapat Anda miliki dengan harga US$ 5.700 atau sekitar Rp 50 jutaan

4. RED QUILTED BAG Kesan mewah khas Chanel terpancar dari bahan mengkilat dalam Chanel Quilted Bag ini. Bentuknya yang kecil dan ringkas, sehingga praktis dibawa untuk acara pesta maupun jalanjalan. Tak sabar ingin memilikinya? Anda bisa membelinya seharga US$ 3.200 atau kurang lebih Rp 30 jutaan.

3. TOTE BAG 2. CHANEL MULTICOLOR SEQUIN Kesan musim panas dibawa Chanel dengan tas model klasik warna-warni ini. Selain terlihat kasual, tambahan material sequin membuat tas ini terlihat begitu elegan. Anda bia membawa pulang tas cantik ini dengan harga US$ 10.000 atau sekitar Rp 90 jutaan.

Bagi Anda yang gemar membawa banyak muatan dalam tas, tote bag dari chanel ini adalah pilihan yang tepat. Detail tas yang stylish ditambah pemilihan warna toska membuat tas seharga US$ 3000 atau sekitar Rp 29 jutaan ini begitu mengundang perhatian

Ladies Sunglasses Yang Memikat BRAND Nike seperti menjadi brand andalan berbagai item olahraga yang fashionable. Mulai dari sepatu, apparel, lengkap hingga assesoris. Salah satunya yang menunjang gaya hidup sporty sekaligus fashionable adalah vision, frame, dan sunglasses gaya dengan gabungan teknologi tinggi. Jika dulu sunglass Nike Vision terkenal karena kenyamanan dan inovasinya yang berguna untuk berolahraga, kini Nike Vision meluncurkan NSW Collection, koleksi yang menunjang gaya hidup urban dengan mengikuti tren yang sedang berlaku. Untuk tahun ini NSW Collection

hadir dengan mengambil unsur klasik dan vintage, yang diberi sentuhan modern melalui warna-warni neon; termasuk di antaranya yang menjadi unggulan, sunglass model aviator dan navigator yang stylish. Namun jika anda temui dengan harga tinggi bisa dialihkan sedikit ke brand lainnya seperti IFA, walau brand satu ini tidak ternama namun bisa menjadi perhatian kita karena disamping kualitas apik, fashion tentunya tidak ketinggalan. Beberapa andalannya adalah the New Special Sunglasses. Seperti jenis Guevara mulai gradation red, purple, black, transparent brown tea, silver, grey dan lainnya terbuat dari bahan

acrylic ini sangat nyaman digunakan. “Untuk jenis ini sepertinya sangat nyaman dikenakan oleh para wanita, namun ada beberapa yang menarik dan tidak ketinggalan fashion adalah jenis Grissa, Valesca, Amando, dan lainnya tentunya hal ini memberikan pilihan bagi pecinta mode khususnya wanita,” ujar Distributor IFA Ningsih. Nah siapa berani coba mau harga mahal atau terjangkau. (H)

5. HULA HOOP BAG Tas unik ini menjadi bahan perbincangan setelah muncul dalam show Chanel Spring 2013. Tas Chanel yang juga dirancang Karle Lagerfeld ini terlihat playful dan hadir dalam ukuran mini dan besar. Tas yang terinspirasi dari hula hoop ini dibandrol dengan harga US$ 1.500 atau sekitar Rp 14 jutaan untuk ukuran kecilnya.m31/WLP



WASPADA Minggu 24 Februari 2013

Lianna Gunawan

Dari Hobi, Menjadi Pengusaha Sukses baik dari desain, model, ukuran dan juga warnanya. “Dan ini tidak berjalan lama, karena ada jenuhnya. Saat itu saya merasa pasar sepatu ada, tapi saya harus berpikir untuk membuat kreasi sendiri,” kata dia. Untuk memproduksi secara profesional, Lianna yang mengaku tidak suka menduplikasi karya orang lain dan suka yang unik-unik ini membuat desain sepatu bermotif batik. “Saya selalu membuat yang berbeda, pada akhir 2010 memproduksi sepatu batik,” ujarnya. Ide muncul karena saat itu sedang heboh klaim Malaysia terhadap batik. “Dengan menggunakan bahan batik orang sudah tahu jika itu sepatu buatan Indonesia. Itu lah yang membuat gagasan timbul,” katanya. Dalam perjalannya, Lianna mengaku awalnya sempat takut atas respon negatif yang dilontarkan teman-temannya. Termasuk menggunakan batik dinilai sebagai salah satu yang kuno. Namun meski respon yang diterimanya negatif, Lianna mengabaikannya. Dia mengaku suka batik karena dibesarkan di lingkungan jawa yang menyukai batik. “Saya cinta batik, biarin deh orang mau ngomong apa. Karena memang saya sukai, saya kerjakan,” kata dia. Ketika pemasaran perdana produksinya yang mencapai ratusan pasang, dia mengaku sempat was-was atas penerimaan pasar, mengingat motifnya yang baru dan tidak lazim. “Untungnya pada hari pertama tanggapan luar biasa, dan pada hari ketiga produk tersebut sudah habis.” Untuk tahap awal dia masih memproduksi 10 hingga 20 pasang perbulan. Namun kini mencapai 500 sampai 600 pasang per bulan yang dipasarkan secara online, disamping reseller, retail di Jakarta dan juga ekspor ke Jepang dan Namibia di Afrika Selatan. Anum Saskia

Waspada/ Anum Saskia

DARI hobi membeli sepatu, akhirnya perempuan ini menjadi pengusaha sepatu terkenal dan sukses. Liana Gunawan, tercatat sebagai perempuan yang sukses berwirausaha dengan berbagai penghargaan, baik penghargaan lokal maupun internasional. Sementara brand sepatunya La Spina Shoes, yang berkantor pusat di Jln. Gunung Sahari 11 Jakarta Pusat semakin berkibar. Bahkan kreasinya sudah dipasarkan hingga Jepang dan Afrika Selatan. Bertemu dengannya pada seminarWanitaWirausaha MandiriFemina di Grand Ballroom Hotel Aryaduta, Medan, dia tampak semangat memberikan dukungan pada pengusaha perempuan yang hadir. Jangan pernah takut mencoba dan berinovasi,” kata Lianna. Diamengakusuksesnyabukansajakarenakegigihandalamberinovasi, tetapi juga karena dukungan berbagai pihak, terutama keluarga. Awalnya, kata Lianna, ia sangat menyukai sepatu. Bahkan setiap bulannya disaat pulang kerja dia selalu menyempatkan diri membeli sepatu. Seiring kemajuan teknologi, dia kemudian berbelanja sepatu

via online. “Saya suka sepatu, bahkan sudah terkoleksi hingga ratusan pasang. Namun suatu hari saat belanja via online sepatu pesanan saya tidak sesuai keinginan, saya kecewa,” kata Direktur La Spina itu. Darirasakecewaternyatamemberikaninspirasiuntuknya.Diapun mencoba mencari pembuat sepatu lainnya. Setelah ketemu dan memberikan desainnya sendiri, terasa sangat cocok dan nyaman. Setelah itu banyak teman sekerja yang memuji desainnya. “Akhirnya saya merasa perlu membuat sepatu sendiri, bisa dipakai dan dijual ke teman-teman dengan bayaran seadanya saja alias tidak pulang modal,” katanya. Setelah menjual lima pasang sepatu, Lianna mengaku tidak mendapatkan untung. Justru bahan bakunya makin menipis. Hingga akhirnya dia berfikir untuk memasarkan dan harus mendapatkan untung. “Jadi saat teman mau order, saya bilang oke, dan harganya saya tetapkan,” sebutnya. Untuk tahap awal dia hanya menawarkan jasa layaknya makelar. Karena dia melayani pesanan sepatu sesuai permintaan konsumen

Ibu Rumah Tangga Penjual Yang Hebat


bu-ibu rumah tangga sebenarnya wanita yang tangguh dan punya potensi dalam bidang ekonomi. Dengan sentuhan motivasi yang kuat, para ibu dapat mengembangkan kepiawaiannya mengatur keuangan rumah tangga, menjadi keahlian tersendiri dalam mengatur bisnis rumahan. Salah satu bisnis yang populer di kalangan ibu rumah tangga saat ini adalah menjual langsung suatu produk atau biasa disebut multi level marketing (MLM). Dalam istilah sehari-hari disebut mulut ke mulut atau Gethok Tular untuk versi Jawa. Mengapa populer? Tentu saja alasan terkuatnya adalah minimnya modal. Penjualan langsung tidak membutuhkan modal besar,

Rubrik Konsultasi Perkawinan & Hukum Kewarisan Masalah perkawinan semakin rumit sehingga angka perceraian meningkat namun hal itu merupakan perbuatan halal yang sangat dibenci Allah Swt. Rubrik ini berupaya membantu mencari solusi agar perceraian dapat dihindari. Demikian pula masalah Waris, sangat penting dipahami penyelesaiannya secara Faraidh untuk menghindari sengketa melalui pengadilan yang seringkali berkepanjangan.(Red)

Z Pengasuh: Hj. Beby Nazlia Hasibuan, SH, MH. (Mediator) foto beby Z Penanggungjawab: Dra. Hj. Erma Sujianti Tarigan, SH, MH. (Mediator) Z Pertanyaan tentang waris sms ke 081370031597 Z Pertanyaan tentang Perkawinan ke Email Litbang Waspada 08126030294.

Rumah Tangga Dipenuhi Pertengkaran Tanya: Aswrwb.Sayabelakanganinisedangmengalamimasalahrumah tangga yang sangat kacau. Hampir setiap hari saya bertengkar dengan suami saya padahal saat itu saya sedang hamil besar. Mulai dengan SMS di HP-nya dengan wanita lain bahkan terkadang tidak pulang. Bahkan saat saya bersalin dia tidak datang menemani saya. Saya sangat kesal dan malu sekali sehingga saya berucap dan bahkan di hadapan orang tua saya, saya akan pisah. Hanya saja pengetahuan saya terhadap hak asuh anak belum banyak sehinggasayainginbertanya,”Jikaterjadidikemudianhariperpisahan pernikahan kami, bagaimana hak asuh anak, apakah jatuh ke saya atau ke suami saya. Anak saya 2 (dua), yang pertama usia 1 tahun 5 bulan, yang kedua baru lahir. Kira-kira jatuh ke tangan saya? Bagaimana kemudian jika mantan suami saya menggugat dengan caranyauntukmerebutanaksaya,bagaimanabesarnyakemungkinan jika hal itu terjadi karena saya tidak mau anak saya kea rah yang salah karena hampir semua kesalahan suami saya itu dia tidak menerima dan tidak merasa bersalah dengan apa yang dia buat terhadap saya bahkan dia tidak mengucapkan maaf terhadap saya. Terima kasih atas jawabannya ya bu…. Dari 081375818xxx Jawab: Waalaikumsalam Wrwb. Secara hukum pertengkaran/ perselisihan suami istri yang berlangsung terus menerus dan tidak ada harapan akan hidup rukun lagi dalam rumah tangga Pasal 116 huruf (f) Kompilasi Hukum Islam (KHI) , sudah dapat

menjadi alasan bagi istri untuk mengajukan gugat cerai di pengadilan agama. Akan tetapi jika Anda masih ingin mempertahankan rumah tangga, itu pun sangat baik. Artinya, Anda dengan dibantu anggota keluarga lain atau bahkan dibantu Mediator, dapat memberi nasehat kepada suami Anda tentang mengelola rumah tangga yang baik, rumah tangga samara ( sakinah, mawaddah warahmah), bagaimana tanggungjawab suami terhadap istri dan anak, baik dari sisi agama maupun dari sisi hukum negara. Sedangkan tentang hak asuh atau pemeliharaan anak yang Anda pertanyakan, bahwa menurut hukum sebagaimana di dalam Kompilasi Hukum Islam (KHI) bahwa anak yang masih berusia di bawah 12 tahun (belum mummayyiiz) maka hak asuh/pemeliharaan anak jatuh pada ibunya, sedangkan pembiayaan atau nafkahanakmenjaditanggungjawabayahnyahinggasianakmampu berdiri sendiri atau dewasa, yakni usia 21 tahun (Pasal 105 huruf (a dan c) KHI. Jika suami merebut anak kalian berdua, itu sama saja dengan menyakiti si anak, sebab anak bukan benda yang bisa direbut-rebut, apabila anak Anda berada di tangan Anda dan suami ingin melihatnya maka persilakan saja, jangan dihalang-halangi sebab perceraian antara suami dan istri tidak dapat memutus hubungan darah antara anak dengan orang tuanya. Berdasarpengalamansayasidangdipengadilanagama,terhadap anak di bawah usia 12 tahun hak asuh/pemeliharaan anak jatuh ada ibunya, si ayah punya kewajiban menafkahi anak, dan kapanpun si ayah ingin melihat anaknya, diperbolehkan. Terkecuali si ibu cacat moral, misal pecandu narkoba maka hak asuh anak diserahkan pada si ayah. Semoga jawaban saya berkenan di hati Anda. Salam.

Suami Sudah Dianggap Orang Lain Tanya: Aswrwb. Saya seorang suami yang sudah dua kali cerai dengan istri, dan sudah rujuk kembali. Saya sudah minta maaf atas semua kesalahan saya, tapi akhir-akhir ini istri saya tidak mau memaafkan saya. Saya ikut mengurus rumah tangga dan anak, tapi istri tidak mau lagi mengurus saya, jika pulang kampung dan nginap dia tidak pernah permisi lagi pada saya, bahkan tidur dengan saya pun dia tidak mau lagi . Saya diperlakukan seperti orang lain, setelah kejadian ini apakah saya boleh kawin lagi? Dari 085760293xxx Jawab: Waalaikumsalam Wrwb. Melihat situasi seperti itu langkah

yangdapatAndalakukanadalahbertanyalangsungpadanya,ataupun disertai dengan anggota keluarga lain, jika Anda etnis Batak maka Anda dapat mengutus Anak Boru untuk mempertanyakan permasalahannya sekaligus mencari solusinya, misal berdamai mengingat anak, lagipula Anda sudah minta maaf. Akan tetapi apabila upaya secara kekeluargaan tidak berhasil, maka majukan dulu permohonan cerai (cerai talak) di pengadilan agama, apabila sudah diputus dan sudah berkekuatan hukum tetap, sudah lewat masa iddah istri maka barulah Anda menikah lagi dengan wanita lain. Jadi selesaikan dulu persoalan satu per satu barulah mengambil langkah berikutnya. Hukum agama dan hukum negara seharusnya dijalani bersama-sama agar tertib administrasi, dan menghindari hal buruk di belakang hari. Salam.


Warisan Orang Tua Tanya: Asswrwb Ibu Mediator Yth.. Kami 5 bersaudara, 4 org laki2 dan 1 perempuan, Ayah kami telah meninggal dunia disusul saudara laki-laki, kemudian Ibu. Adapun saudara laki-laki kami tersebut meninggalkan seorang istri dan 3 orang anak perempuan. Sekarang janda saudara kami tsb telah menikah lagi dengan laki-laki lain. Bagaimana pembagian warisan yg ditinggalkan oleh orang tua kami ? Terima kasih. Dari 08139721xxxx Jawab : Waalaikum salam …. Ketika Ayah anda meninggal

dunia, maka yang menjadi ahli warisnya adalah Ibu bersama dengan kelima orang anaknya yang terdiri dari 4 orang anak laki-laki dan 1 orang anak perempuan. Oleh karena warisan baru dibagi setelah Ibu meninggal dunia, maka pembahagian warisan tersebut dapat dibagi dengan ketentuan dua berbanding satu artinya dua bahagian untuk anak laki-laki dan satu bahagian untuk anak perempuan (Pasal 176 Kompilasi Hukum Islam).Terhadap salah seorang saudara laki-laki yang telah meninggal dunia lebih dahulu, maka bahagiannya dapat digantikan oleh ahli waris penggantinya yaitu ketiga orang anakperempuannya.Dimanabahagianahliwarispenggantitersebut tidak boleh melebihi dari bahagian ahli waris yang sederajat dengan yang diganti (Pasal 185 ayat 2 Kompilasi Hukum Islam). Salam.

Presiden Direktur PT Wellys Multi Indonesia dan Ketua Umum Ikatan Wanita Pengusaha Indonesia (IWAPI), Nita Yudi, usai menandatangani kerjasama pemberdayaan perempuan di bidang ekonomi, belum lama ini. (dian)

Waspada/Anum Saskia

Lianna Gunawan (tengah) saat menerima penghargaan bersama pengusaha perempuan sukses digelar Femina-Mandiri belum lama ini di Aryadutha Hotel Medan.

kecuali kegigihan, keuletan dan kerja keras. Sedikit banyak, hasilnya mampu meningkatkan perekonomian keluarga. “Ibu rumah tangga adalah penjual yang hebat. Mereka piawai mengatur keuangan, displin dan pantang menyerah,” kata Direktur PT Wellys Multi Indonesia, Sarhasi Pamungkas, saat bincangbincang dengan sejumlah wartawan di Jakarta, akhir pekan lalu. Kenyataan itu dibuktikan Wellys, perusahaan nasional yang bergerak di bidang kosmetika dan fashion dengan menggandeng ibu rumah tangga sebagai agen di seluruh area pemasaran. Dari 19 ribu lebih agen penjualan yang ada saat ini, hampir seluruhnya perempuan dengan status ibu rumah tangga. “Di Sumatera Utara, misalnya, hampir 50 persen agen kami ada di sana. Hampir semuanya kaum wanita, khususnya ibuibu rumah tangga. Demikian juga di kawasan Bandung dan Surabaya,” kata Sarhasi, yang sudah 15 tahun berkecimpung di dunia bisnis kecantikan dan fesyen. Keinginan untuk memberdayakan kaum perempuan, ternyata mendapat tanggapan yang positip dari Ikatan Wanita Pengusaha Indonesia (IWAPI) yang mempunyai visi dan misi yang sama. Ketua Umum Iwapi, Nita Yudi dalam satu kesempatan mengatakan, perempuan Indonesia harus terus diberdayakan untuk membangun kemandirian ekonomi di Indonesia. Iwapi, imbuh Nita, berkeinginan untuk mengembangkan potensi perempuan Indonesia menjadi seorang enterpreneur. Dengan perannya itu, perempuan dapat membantu meningkatkan ekonomi rumah tangganya. “Jadi perempuan itu harus bisa bersikap profesional dan proposional agar bisa membagi perannya, baik saat menjadi istri, ibu serta pebisnis,” ujar Nita. Kerjasama dengan pihak pengusaha seperti yang dilakukan antara Wellys dengan IWAPI diwujudkan dalam bentuk nyata. Saat Iwapi berkeliling Indonesia guna memberikan pelatihan, saat ituWellys ikut bergabung di dalamnya, memberikan pelatihan bagi kaum perempuan di bidang kosmetik serta fesyen. “Kerjasama ini sangat menguntukan bagi para ibu yang menjadi pengusaha MLM. Mereka tambah yakin bahwa langkah mereka meningkatkan perekonomian keluarga, didukung banyak pihak,” tandas Sarhasi. (dianw)

Bisnis Busana Perlu Kreativitas Usia muda bukan halangan untuk terjun ke dunia bisnis. Apalagi bisnis yang memang berasal dari bakat dan potensi diri, tentunya sangat menguntungkan lahir dan bathin. Hati senang, uang pun mengalir. Seperti itulah yang terjadi pada Jessica Febiani. Perempuan muda kelahiran Denpasar 20 Februari 1989 ini, sejak usia 16 tahun sudah menekuni bisnis pakaian. “Awalnya saya senang menggambar, khususunya disain sepatu dan baju. Lama-lama malah keterusan terjun bisnis pakaian. Kecilkecilan dulu, “ kata Jessica, saat ditemui di standnya di area busana cocktail & party zone Indonesia Fashion Week (IFW) di ruangan Assembly Hall Jakarta Convention Center, akhir pekan lalu. Kini, mengusung label moretosee, Jessi, demikian sapaan akrab gadis ramah itu, sudah mulai mengenyam manisnya bisnis busana dan assesorisnya. Omsetnya lumayan dengan ekspansi pasar yang semakin luas. “Sebulan saya dan 13 pegawai saya dapat memproduksi 500 potong baju dengan bahan katun, songket, sutra, batik dan tenunan. Itu belum termasuk tas, sepatu atau perhiasan rancangan saya sendiri,” kata Jessica yang juga sarjana double degree di salah satuperguruantinggiternamadiJakarta.Duajurusanyangditekuninya

sampai lulus adalah Teknologi Informatika dan Bisnis Manajemen. Saat ini Jessica mengaku sudah punya toko atau butik sendiri di beberapa kota besar seperti Jakarta dan Bali. Dia tidak mematok harga terlalu tinggi bagi seluruh produknya, yakni antara Rp 200 ribu sampai Rp 1 juta. “Saya ingin baju, sepatu, tas dan perhiasan yang saya hasilkan dapat dimiliki semua orang. Karena itu, harganya bersaing tapi kualitas tetap terjaga,” ujar dia. Terkait perluasan pemasaran, dia mengatakan tidak menutup kemungkinan akan melebarkan sayap sampai ke Sumatera. Selain dalam negeri, pameran busana di luar negeri juga pernah diikuti Jessica. Tujuannya supaya lebih dikenal di dunia mode internasional.Dia merasa sangat menikmati profesinya sebagai perancang busana untuk remaja dan dan dewasa, karenanya tidak gentar bersaing dengan perancang-perancang yang lebih senior ataupun perancang luar negeri. “Bagi saya, setiap rancangan itu unik dan punya karakter sendirisendiri. Saya senantiasa berpikir kreatif, supaya rancangan saya selalu baru. Kalau ada yang meniru, kita harus siap bikin yang baru lagi,” katanya, seraya tertawa renyah. Menurutnya, bisnis busana dan assesoris tidak harus dengan modal uang yang besar. Asalkan niatnya mantap ditambah kreatif danulet,makabisnisakanberjalan lancar. “Yang penting berpikir lain daripada yang lain. Artinya orisinalitas harus terus terjaga. Janganlupa,perkembangantrend pasar harus senantiasa disimak,” kata Jessica, tentang kiat-kiatnya. Sesuai perjalanan waktu dan bertambahnya usia, Jessi mulai menemukan jati dirinya yang asli. Sejak dua tahun terkahir dia lebih fokusmembuatbusanabernuansa etnik dan muda. Misalnya, Jessica membuat gaun malam dan blus dari bahan tenun Lombok yang dipadukan dengan sutera. “Saya ingin mengangkat bahan asli Indonesia, seperti tenun, batik, tenun ikat, dan songket, dan bahan sutera. Begitu pula dengan blus warna-warni dibuat dari bahan katun,” ungkap Jessica di sela-sela melayani tamunya. (dianw)


WASPADA Minggu 24 Februari 2013


Teater Gerak Dan Simbolisasi Waktu

Catatan Budaya

Milih Gubernur Oleh: S. Satya Dharma TAK sampai dua minggu lagi, Pemilihan Umum Kepala Daerah (Pemilukada) Sumatera Utara berlangsung. Janji-janji pun sudah diobral oleh lima pasangan Cagub/Cagubsu yang akan bertarung. Semuanya manis dan muluk-muluk. Bahkan tak ada satupun calon yang mencoba bicara apa adanya. Pokoknya, bak pedagang kecap, semua calon adalah nomor satu. Top markotop.

Oleh: Yulhasni


RTISTIK yang minimalis dengan dua rentang kain merah putih menggantungkan simbol jam bandul, lelaki bernama Nizam itu mulai memperbincangkan waktu. Matanya tajam mengarah simbol waktu sambil sesekali membolak-balik buku. Panggung itu sangat minimalis tapi memiliki makna yang setiap orang boleh menginterpretasikannya. Sangat absurd dan mungkin perlu jembatan lain memahami pentas Insaid Teater Sisi UMSU karya/sutradara Arief Sinaga yang dimainkan di Gedung Utama TBSU, Selasa (19/2) malam. Istilahnya dalam garapan ini semua aliran dalam teater seperti surealis, ekspresionisme, religiusme, dan trasendentalisme menyatu padu. Merujuk pada aspek model pertunjukandrama,kitamengenal konsep absurdisme. Absurdisme adalah istilah filosofis mengenai suatu genre drama modern yang merombak sistematis drama tradisional. Drama absurd adalah drama yang sarat akan kemustahilan, keanehan, kesedihan, kepedihan, kelamnya kehidupan, kekosongan atas aktor yang memainkan perannya, serta kehampaan makna akan panggungnya. Semuadapatdikonsepuntuk menggambarkantentangkejahatandankekerasan,dominasi,matrealisme, bahasa, kegagalan dalam berkomunikasi, kenihilan dalam hidup, kegagalan dan ketidakpedulian, kesepian dan isolasi dan ketidakberadaan Tuhan. Hal yang janggal misalnya jika naskah realis kemudian digarap dalam model absurd. Alur dalamdramaabsurdpadaumumnya tidak beraturan. Dalam drama absurd ini, alurnya dapat dianalisis sesuai aturannya baik di awal, tengah, dan akhir. Meskipun tetap menggunakan pakem drama absurd di mana tak beralur. Naskah Insaid tidak bermaksudmengguruipenontontentang hakekat hidup dalam putaran

waktu. Meski pertunjukan berdurasi hampir 50 menit tersebut minim dialog, akan tetapi kualitas estetika panggung dalam gerak memiliki nilai dasar penting bagi penonton untuk sampai pada sebuah kesimpulan tentang arti pertunjukan. Ada tiga tokoh dalam cerita Insaid dan mereka mampu memposisikan diri sebagai bagian penting dari pertunjukan. Di sini patut diapresiasi bagaimana Arief Sinaga terus menjaga ritme pertunjukan dalampetikan-petikanteksdrama dengan kata-kata yang filosofis. Sub teks dalam drama adalah narasi yang berfungsi memberi ruang kepada aktor berkreasi dalamgerak.SutradaraInsaidmemberi arahan panggung untuk memudahkan pemain dalam memahami situasi dan dialog dalam naskah. Sehingga karakter yang di bawakan dapat dimainkan dengan arahan panggung yang benar serta dialog yang benar. Kekuatan pentas Insaid bukan pada pemaknaan teks, tetapi bagaimana teks tersebut diwujudkan dalam gerak. Aspek gerak pada Insaid adalah simbol dan tanda. Teater sebagai sebuah seni pertunjukan tidak terlepas dari aspek tanda dan simbol kehidupan manusia. Kehidupan manusia yang merupakan bahan penciptaan bagi penulis maupun pekerja seni teater lainnya akan membangun karya seni pertunjukan penuh dengan tanda dan simbol-simbol kehidupan. Tanda dan simbol yang sifatnya universal tersebut diyakini sebagai dasar dari komunikasi teater. Pada batas ini,


TEATER Sisi UMSU menggelar pentas teater Insaid naskah/sutradara Arief Sinaga di Gedung Utama TBSU, Selasa (19/2) malam. barangkali perlu menjadi catatan bagi pekerj teater Sisi UMSU agar simbol dan tanda tidak hanya menjadi aksesoris yang dibantu kekuatan lampu panggung. Simbol dan tanda tetap dimaknai sebagaipesanyangharusmampu dipahami penonton. Saya kira kelemahan penggarapan teater absurd terletak pada aspek penyampaian pesan tersebut. Interpretasi simbol pada Insaid mampu dimainkan dengan baikoleh ZuhaidiSafwan(Nizam) Bani Adam (Jarot), dan Ayu Nadira (PerempuanTua). Sayang memang kekuatan vokal hanya berhenti pada titik-titik kecil di atas panggung. Aktor nyaris berpola dalam maenstram bahwa level dan dua petak areal depan di atas panggung menjadi area berkreasi. Padahal panggung sebenarnya ruang kreasi yang lebih

besar dan setiap pemain harus mampu memanfaatkannya. Patut dicatat pada pentas Insaid, sutradara memberi satu tempat pada gerak dalam setiap adegan, baik sebelum maupun setelahdialogantartokoh.Konsep teater gerak sebenarnya bermaksud memberi kesempatan kreasi pada setiap pemain.Teater gerak adalah sebuah bentuk penyajian teateryangmengutamakangerak sebagai bahasa dengan lebih banyak membutuhkan ekspresi gerak tubuh dan mimik muka daripada wicara. Pesanyangtidakdisampaikan secara verbal membutuhkan keahlian tersendiri untuk mengelolanya. Kekuatan inilah yang dimiliki para pemain pendukung Insaid. Mereka mampu mengeksplorasi dan menciptakan gerak. Simbol dan makna yang

disampaikan melalui gerak dikerjakan dengan sangat teliti. Selain itu komposisi dan koreografi berwujud pesan menjadi daya tarik sendiri pertunjukan Insaid yang telah tampil sebelumnya di Tebing Tinggi, Siantar dan Binjai. AriefSinagasebagaisutradara memahami betul bahwa bekerja dengan gerak, maka teori komposisidankoreografidasaradalah hal yang wajib dimiliki oleh sutradara. Penataan gerak tidak bisa dikerjakandenganserampangan, harus mempertimbangkan makna pesan, suasana, dan terutama musik ilustrasinya. Dalam komposisi gerak, jika pemain dalam jumlahbanyak,makapengaturan blocking harus lebih teliti. Jumlah pemain yang banyak menimbulkanpersoalantersendiri,terutama menyangkutkomposisi.Jikatidak

pintar mengelola, maka banyaknya jumlah pemain justru akan memenuhi panggung dan membuat suasana menjadi sesak. Untuk komposisi musik, kita patut memberi apresiasi pada anak-anak Sisi UMSU. Dalam konteksilustrasimusik,meskipun tidak bisa memainkan musik, sutradara teater gerak harus mengerti kaidah musik ilustrasi. Kapan musik mengikuti gerak pemain, kapan pemain harus menyesuaikan dengan alunan musik,kapanmusikhadirsebagai latar suasana, dan perbedaannya harus dimengerti oleh sutradara. Kesadaran kolektif ini yang disuguhkan kepada penonton yangmenyaksikananak-anakSisi UMSU bermain. *Penulis Dosen Kajian Drama FKIP UMSU dan Bergiat di Komunitas Diskusi Sastra FOKUS UMSU

Mengapa ‘Melainkan’? Oleh: Hasan Al Banna BANYAK hal menarik dari diskusi di Anjung Seni Idrus Tintin Pekanbaru, Riau, selepas konser musikalisasi puisi “Melainkan” pada 9 Februari 2013. Saya selaku pimpinan produksi, perlu mengabarkan beberapa hal yang terluput dalam diskusi terkait konser dimaksud. Begini, satu-dua peserta sempat berpikir, konser tersebut dihadirkan sebagai kontra musikalisasi puisi. Mungkin, label “Melainkan” menjadi penyebab. Namun, sesungguhnya, istilah musikalisasi puisi yang melekat pada konser sudah terangbenderang memberi informasi kepada khalayak soal bentuk pertunjukan. Tentu,siapapunbebas‘menghidupkan’tekspuisidalambentuk lainuntukmembukapeluangbagi penafsiran puisi itu sendiri. Kreator-kreator terdahulu telah menciptakan deklamasi, baca puisi,visualisasipuisi/dramatisasi puisi dan yang teranyar, musikalisasi puisi. Boleh jadi, di masa

datang, tercipta pula genre lain dalam hal ‘menghidupkan’ teks puisi.Namun,apakahpenciptaan sesuatu yang baru menjadi maksimal tanpa terlebih dahulu melewati keuletan proses? Patut direnungkan, bahwa tidak serta-merta sesuatu yang baru muncul karena anti dengan yang sebelumnya. Istilah baca puisi tidak anti terhadap deklamasi. Musikalisasi puisi muncul bukan karena anti visualisasi/ dramatisasi puisi. Begitupun, kelak,kemunculangenrelaintidak harus bersebab anti musikalisasi puisi. Sangat terbuka kemungkinan, hal baru hadir karena selalu dilangsungkannya pengembangan; percobaan terus-menerus

terhadap bentuk yang tersedia. Intinya, saya dan kawankawan masih sepakat untuk setia berkutat dalam bilik musikalisasi puisi, sambil terus mencoba melakukan ‘penyerempetan’ kecilkecilan. Tentu, ‘penyerempetan’ akan terjadi kalau objek yang akan‘diserempet’ sudah dikenali. Makindikenaliobjekyangdimaksud, makin besar peluang untuk melakukan ‘penyerempetan’. Andai dari ‘penyerempetan’ tersebut muncul hal yang baru, itu persoalan lain. Begitulah, bagi saya dan kawan-kawan, “Melainkan” itu semacam kata kunci! Ia berfaedah sebagai sugesti, agar kami fokus mencari kemungkinankemungkinan tak terduga kala menggarap produk musikalisasi puisi. Tidak, seperti yang diutarakan di atas tadi, kami tidak sedang (atau mungkin belum) ingin melahirkan tandingan musikalisasi puisi. Kami tetap konsentrasi pada wilayah penciptaan musikalisasipuisidengansegenap rambunya; bertolak dari keutuhan teks puisi, tidak melakukan pengulangan lirik yang terdapat

pada teks puisi, dan menciptakan musikyangoriginalbagitekspuisi. Selain itu, tiga konsep yang tersedia dalam penggarapan musikalisaipuisitetapkamipatuhi, yaitu (1) seluruh teks puisi dapat dibacakansembaridiiringimusik; (2) sebagian teks dapat dinyanyikan dan sebagian lagi dibaca; atau (3) seluruh teks puisi dinyanyikan. Lantas,“Melainkan” diusung untukapa?Saatini,taklebihuntuk menerabas anggapan keliru, bahwa musikalisasi puisi yang baik adalah yang cuma dikemas dengan genre musik tertentu saja. Sebenarnya, anggapan tersebut juga tidak jelas dari mana sumbernya. Namun, faktanya, menurut kami, musikalisasi puisi seringterjebakpadakeseragaman genre musik. Makanya kerap dicap monoton! Padahal bagi kami, genre musik apa pun tak soal tatkala dijodohkan dengan teks puisi. Persoalannya, bagaimana ia mampu secara utuh menopang keberhasilan produk musikalisasi puisi yang bertanggung jawab. Begitu pula alat musik, apapun

ia, punya hak yang sama untuk disertakan ke dalam produk musikalisasi puisi. Begitulah, Sanggar Rumput Hijau (SRH) asal SMAN 2 Model Binjai yang tekun menggiati musikalisasipuisidanpernahmenjadi jawara festival musikalisasi puisi tingkatSumaterasekaligustingkat nasionalpadatahun2011menyadari keterjebakan tersebut. Kegelisahanyangserupalebih dahulu dialami kelompok musik 7 Keliling. Klop! Dua kelompok ini sepakat untuk bergiat di ruang proses yang sama, proses kami. Enam materi puisi milik SRH, yaitu “Ceracau Sebongkah Kota” (Hasan Al Banna), “Torsa Ni Namora Pande Bosi” (M Raudah Jambak), “Cintaku Jauh di Pulau (Chairil Anwar), “Sepisaupi” (Sutardji Calzoum Bachri), “Hotel Siantar” (Damiri Mahmud) dan “Akulah Medan” (Teja Purnama) masuk ke mesin‘daur ulang’.Tentu, proses ‘daur ulang’ tak sekalidua kali menghadapi kebuntuan. Namun, bukankah kebuntuan juga dibutuhkan sebagai celah untuk mengintai tawaran-tawaran yang lebih segar?

Demikianlah, plus puisi “Rindu 1” (Hasan Al Banna) hasil aransemen 7 Keliling, keenam materi tersebut kami angkut ke ataspanggungkonsermusikalisasi puisi bertajuk “Melainkan” yang sempat digelar di tiga kota; Medan, Binjai, dan Pekanbaru. Cerita punya cerita, materi konser tersebut sudah kami boyong ke studio rekaman. Saat ini, album “Melainkan”sedangdalamproses perampungan mixing. Syahdan, dari kolaborasi ini, berkeliaranlahanekagenremusik. Mulaidarirockprogressive,reggae, sampai ethnic alternative. Kolaborasi musik modern dengan tradisi juga berlangsung dalam peleburan proses ini, agar kekayaan musik tradisi Sumatera Utara dapat difaedahkan, antara lain Melayu Deli, Batak Toba, Karo, dan Simalungun. Pada akhirnya, proses peleburan ini digiring menuju world music. Namun, yang paling penting harus kami sadari, bahwa kami tetap tak sudi ruh puisi hambus dibikin proses ‘daur ulang’ ini.

Namun janji kelewat manis dan aktivitas pencitraan yang serba “hebat” dari para kandidat itu, justru mermbuat kita jadi mual, muak dan mau muntah. Ada begitu banyak fakta sejarah yang menunjukkan betapa janji-janji manis di masa kampanye itu tak lebih dari omong kosong belaka begitu salah satu calon terpilih.Sudahmenjadirahasiaumum,begituPemiluatauPemilukada usai, janji-janji itupun menguap bersama lalunya waktu. Masih segar dalam ingatan bagaimana dulu para kandidat gubernur Sumut pada Pemilukada 2009 berjanji akan memberantas kemiskinan, menggratiskan uang sekolah, dan menghapus pengangguran. Faktanya, hingga kini persoalan itu tetap saja ada dan tak terselesaikan. Lihatlah bagaimana Syamsul Arifin. Begitu dilantik sebagai Gubsu pada 16 Juni 2008 bersama pasangannya Gatot Pudjonugroho,justrubukanprestasikerjayangdiperlihatkannya, tapi malah tangan KPK yang mencokoknya. Ironisnya, SBY selaku presiden RI terlalu lama mengangkat Gatot sang wakil menjadi gubernur yang difinitif, sehingga ia dalam kapasitasnya sebagai pelaksana tugas, hanya mampu melanjutkan apa yang sudah ada dan sudah terprogram. Tanpa mampu berkreasi. Tanpa bisa mengeksplorasi diri. Maka, mereview kembali janji gubernur terpilih di masa lalu menjadi penting ketika kita akan melaksanakan pemilihan gubernur yang baru. Memang UU 32/2004 memberi hak otonom kepada pemerintah kabupaten/kota untuk melaksanakan pembangunan di daerah. Namun perhatian dan peranan gubernur tidak bisa diabaikan. Terutama karena pemerintah provinsi merupakan jembatan penghubung antara pemerintah daerah dan pemerintah pusat. Ironisnya, dalam banyak kasus peran sebagai jembatan ini seringkali dilalaikan. Jangankan ikut mengatasi problem kehidupan masyarakat yang jauh dari jangkauan, bahkan terhadap apa yang terjadi di depan mata pun gubernur seringkali terlambat atau bahkan tak pernah bereaksi sama sekali.

Pemilukada Sumut harus mampu menumbuhkan semangat kepedulian para calon dan juga seluruh masyarakat dalam kehidupan kesehariannya.

Oleh karena itu, setidaknya ada lima pelaku pembangunan yang seharusnya mendapat apresiasi dari seorang gubernur dalam konteks pembangunan daerah ini. Kelima pelaku itu adalah bupati/wali kota sebagai kepala pemerintahan daerah di bawahnya, kalangan swasta sebagai pelaku dunia usaha, warga masyarakat, kaum professional dan kalangan intelektual. Kelima pelaku pembangunan itu adalah stakeholder yang seharusnya terlibat dan ikut bertanggungjawab terhadap maju mundurnya suatu daerah. Pertanyaannya sekarang adalah; Apakah keterlibatan para stakeholder itu sudah dimaksimalkan atau malah diabaikannya? Ataskeadaanitulahmunculpertanyaaan,dalampemilukada Sumutnanti,siapacalongubernurSumutyangakandipilihrakyat? Terutama karena para calon itu, tanpa malu-malu, tidak hanya sekadarmemintarestudarimasyarakat,tapijugamengakudialah yang paling siap dan paling mampu memimpin daerah ini. Namun, apapun itu, yang jelas keberhasilan Pemilukada Sumut nanti tidak bisa lagi diukur secara kuantitatif dari banyaknya calon yang siap maju atau hanya dari besar kecilnya partisipasimasyarakat.YangutamaadalahbagaimanaPemilukada Sumut itu dapat menjadi barometer mengukur kedewasaan berpolitik masyarakat Sumut, sekaligus etalase dalam melihat kemajuan berdemokrasi di daerah ini. Dalam konteks inilah pemilukada Sumut harus mampu menumbuhkan semangat kepedulian para calon dan juga seluruh masyarakat dalam kehidupan kesehariannya. Tanpa semangat kepedulian itu, maka sekalipun pemilukada Sumut nanti berjalan aman, tertib, lancar dan luber, Sumut tidak akan mampu ke luar dari berbagai permasalahan sosial, politik dan kulturalnya seperti yang terjadi selama ini. Oleh karena itu, suksesnya pemilukada Sumut nanti tidak boleh hanya diukur dalam pengertian politik dan demokrasi, tapi harus juga dalam pengertian sosio kultural. Untuk yang terakhir ini, sekali lagi, Pemilukada hanya bisa dinyatakan sukses apabila hajatan tersebut mampu melahirkan semangat kepedulian tidak hanya dalam kehidupan semua warganya, tapi juga dalam diri sang gubernur terpilih. Dengan tumbuhnya semangat kepedulian itu barulah Pemilukada Sumut bisa diharapkan menghasilkan pembangunan Provinsi Sumut yang baru, tidak hanya pada tataran konsepsi, tapi juga pada tataran sistem dan tataran praktis. Satu pembangunan yang mendorong terjadinya proses penyejahteraan masyarakat secara menyeluruh. Begitulah! *Penulis adalah Koordinator Gerakan Relawan Medan Hijau (Gerilya-MU)

*P enyair, prosai, esais, dan penikmat seni pertunjukan.

Mereka Bukan ‘Sampah Masyarakat’ Potret Kehidupan Anak Jalanan Kota Metropolitan

ANAK jalanan, sosok yang sudah tidak asing lagi di telinga masyarakat saat ini. Jika berada di persimpangan lampu merah, terminal, sela-sela pertokoan, perkantoran, bahkan restoran, kerap kali mereka kita jumpai. Ketikakitaberhentidipersimpangan lampu merah, sering kita temui wajah-jawah lugu tak terurus itu. Sambil tersenyum, si bocah melangkah mantap mendekati pengendara sepeda motor atau mobil. Tangannya yang mungil mulai memainkan senar gitar diiringi lantunan lagu bernada sumbang. Sungguhprihatinbercampur gemas melihat mereka bernyanyi begitu lugunya. Matanya seolah berkata kepada semua orang untuk memberi uang recehan sebagai imbalan atas usaha kecilnya.Ketikadiberisedikitrupiah, bibir mungil mereka pun tersenyum diiringi ucapan terima kasih.

Di persimpangan jalan lainnya, seorang bocah berbadan kurus, baju kumal dan mata yang sayu justru memanfaatkan keadaannya itu dengan menyodorkankotakkecilkesetiappengguna jalandipersimpangan.Terkadang tangan kotornya saja ditengadahkan dengan menjual raut wajah iba mengharap pemberian. Takjauhdaritempatsebelumnya, anak-anak di pinggir jalan bergerombol memperebutkan sebuahkalengyangbarusajadibeli dari hasil meminta-minta atau mengamen. Kaleng berwarna oranye itu dihirup bergantian, lantastaklamakemudianmereka menikmati imajinasinya akibat menghirup kaleng tersebut yang

berdampak merusak otak dan masa depannya. Miris memang menyaksikan ketiga pemandangan tersebut yang terjadi justru di sebuah Kota Metropolitan.Sebuahpertanyaan besar, mengapa mereka hadir di sudut-sudut Kota Metropolitan itu? Bukankah Kota Metropolitan berarti suatu kawasan perkotaan yang relatif besar, baik dari ukuran luas wilayah, jumlah penduduk, maupun skala aktivitas ekonomi dan sosial sehingga timbul anggapan jika masyarakatnya mayoritas menengah ke atas? Ya, mungkin hal itu pulah menjadi daya tarik bagi masyarakat yang hidup di bawah garis kemiskinan melakukan eksodus besar-besaran dari kampung mereka ke kota metropolitan. Mereka menganggap akan lebih mudah mengais rezeki di sana meski tanpa membekali diri

dengan skill apapun. Sekarang ini kita mengenal ada delapan kawasan kota metropolitan di Indonesia. Berdasarkan data Direktorat Jenderal PenataanRuangtahun2006,Kota Medan menjadi salah satu di dalamnya. Medan merupakan kota ketigaterbesardiIndonesiasetelah Jakarta dan Surabaya. Namun, pola tata kehidupan masyarakat Kota Medan masih belum memenuhi syarat sebagai kota metropolitan. Kenapa? Coba kita pikir dengan seksama, apa pantas kota dengan sebutan metropolitan ‘dijamuri’ anak jalanan? Tidak bisa dipungkiri, anak jalanan seakan telah menjadi bagian dari kehidupan Kota Medan dan jika kita telusuri lebih lanjut, anak jalanan telah membudaya serta merupakan sub kultur di Ibu Kota Sumut ini. Data Dinas Sosial danTenaga

Kerja Kota Medan menunjukkan memang sudah terjadi penurunanjumlahanakjalanandiMedan. Jika tahun 2011 berjumlah 291 orang, maka untuk tahun 2012 berkurang menjadi 191 orang. Penurunan itu diklaim merupakan hasil razia anak jalanan yang digelar sebanyak 24 kali dalam setahun. Anak jalanan tidak hanya berasal dari Kota Medan saja, melainkan kabupaten/kota lainnya di Sumut seperti Binjai, Deliserdang,Langkat,danlainnya. Mereka hidup beralaskan bumi beratapkan langit. Sangat ironis memang, sebagai generasi muda bangsa yang harusnya digadang-gadang menjadi calon pemimpin di negeri ini, justru sejak kecil sudah harus merasakan kerasnya kehidupan. Bahkan tidak jarang anak jalanan menjadi korban dan targettindakkekerasandariorang

yang tidak bertanggung jawab. Faktanya memang sebagian anak jalanan berasal dari keluarga kurang mampu. Banyak di antara mereka yang dipaksa mencari uang untuk mengisi kekurangan ekonomi.Bahkanseringkalibukan kasih sayang yang mereka peroleh ketika kembali dari jalanan, melainkan tinju dan tendangan dari orangtua atau oknum tertentu, apalagi jika kembali ke rumah tanpa pendapatan. Banyakpuladiantaramereka berasal dari keluarga tidak harmonis (broken home). Mereka memilih hidup di jalanan bukan semata ingin mengais rezeki layaknya anak-anak dari keluarga miskin, tetapi sekadar mencari kebebasan atau bentuk dari sebuahpemberontakanterhadap keluarga yang dinilai tak peduli. Kenyataannya memang kadang kondisi di keluarga turut

menjadi pendorong anak untuk memutuskan hubungan dengan keluarga hingga mengambil keputusanuntukhidupdijalanan. Meskipun Undang-Undang Dasar 1945 pasal 34 secara tegas menyatakan bahwa fakir miskin dan anak terlantar dipelihara oleh negara, begitu juga dengan Undang-UndangNo4tahun1979 tentang Kesejahteraan Anak serta penandatanganan Konvensi Hak-Hak Anak pada September 1990, anak jalanan masih saja menjadimasalahkrusial.Terbukti jumlahanakjalanansemakinhari semakin meningkat saja. Hingga saat ini, bentuk penanggulangan anak jalanan yang dilakukan pemerintah masih sekadar penanganan panti. Menyerahkan mereka ke panti asuhan tanpa memberi bekal pembinaan berupa skill atau pendidikan yang layak. Alhasil,

anak jalanan yang dititipkan di pantiasuhanmemilih‘larimalam’ dan kembali ke jalanan. Penanganan panti memang dinilai bukan solusi tepat. Makanya, pemerintah perlu mencari jalankeluarnyauntukmenangani anak jalanan yang sering kali diperlakukantidakmanusiawidari oknum tak bertanggung jawab. SemogasajaPemerintahKota Medan bersama stakeholder bisa mencari solusi tepat menangani masalah anak jalanan. Apalagi mereka (anak jalanan) sejatinya bukan‘sampahmasyarakat’,tetapi adalahbagiandarikehidupankita dan diharapkan suatu saat nanti punya masa depan cerah. Semoga! *Penulis Arianda Tanjung SIKom,Wartawan Waspada Medan. Tulisan ini dilombakan dalam karya tulis LSM Madya Insani dengan tema “Anak Jalanan Di Kota Metropolitan”.



40% Radang Selaput Otak Disebabkan Bakteri P

enyakit radang selaput otak (meningitis) yang menyerang penyanyi cantik Ashanty memang cukup mengejutkan. Anda tentu menjadi lebih waspada untuk mengetahui apa saja penyebab dan gejala penyakit ini agar dapat melakukan penanganan segera.

Radang selaput otak umumnya disebabkan oleh adanya infeksi. Namun, ada juga kasus dimana penyakit ini disebabkan penyakit lain seperti kanker atau penggunaan obat tertentu. Ada dua jenis penyebab radang selaput otak, yang infeksi dan non-infeksi. Untuk yang infeksi biasanya diakibatkan bakteri, kuman, virus atau jamur. Radang non infeksi bisa disebabkan oleh kanker, gangguan auto imun atau penggunaan obat tertentu. Penyakit yang bisa menyerang segala usia ini memang cukup mematikan, karena menyerang bagian vital dari tubuh yaitu otak. Pada beberapa kasus, tidak hanya orang dewasa yang dapat menderita penyakit ini, tetapi juga bisa menyerang anak-anak

dan bayi atau Balita. Pada orang dewasa maupun anak-anak, gejalanya hampir sama, yaitu berupa nyeri di kepala, sakit kepala hebat yang tak kunjung sembuh hingga menyebabkan muntah-muntah, tegang di leher dan disertai demam tinggi atau rendah, bisa sekitar 37 atau 37,5 derajat celcius. Gejala yang perlu diperhatikan pada anak-anak jika anak menjadi rewel, cenderung lemas, mendadak tidak aktif, demam apalagi hingga kejang. Hal ini patut dicurigai, karena ini merupakan gejala radang selaput otak. Untuk mengetahui lebih lanjut tentang meningitis adalah suatu peradangan dari selaputselaput otak (meningen). Meningitis yang disebabkan virus biasanya tidak berbahaya dan

akan pulih dengan sendirinya. Sedangkan meningitis yang disebabkan bakteri atau disebut meningitis bakterialis lebih berbahaya karena dapat mengakibatkan kematian pada 50% anak yang terkena serta menunjukkan gejala sisa lainnya seperti kelumpuhan, tuli ataupun kurangnya kemampuan belajar apabila anak berhasil sembuh. Radang selaput otak ini merupakan infeksi dan peradangan dari selaput yang membungkus otak. Penyakit ini sering menyerang bayi berumur kurang dari 1 tahun. Penelitian di seluruh dunia termasuk Indonesia menunjukkan 40% meningitis disebabkan bakteri Haemophilus Influenzae tipe b (Hib). Meningitis mempunyai gejala sebagai berikut demam tinggi yang terjadi secara tibatiba, sakit kepala yang sangat menyiksa dan terjadi secara terus-menerus, kaku atau kejang pada leher sehingga menimbulkan rasa sakit ketika hendak menundukkan kepala,

mual dan muntah, kadang disertai dengan diare, bingung dan kehilangan orientasi bahkan terlihat linglung, mengantuk dan sering loyo, sakit mata atau terasa sensitif pada cahaya terang, otot atau sendi terasa lemah dan ngilu. Bila menemukan gejala di atas, secepatnya dibawa ke rumah sakit. Tim dokter akan melakukan pemeriksaan fisik, laboratorium yang meliputi tes darah dan X-Ray guna mendiagnosa penyakit. Bila mengarah pada meningitis, maka akan dilakukan pemeriksaan lumbar puncture (pemeriksaan cairan selaput otak). Meningitis mudah menular. Jika tak ditangani secepatnya dengan baik bisa mengakibatkan kondisi sangat serius, di antaranya tuna ganda, seperti lumpuh dan gangguan mental. Penularan meningitis yaitu melalui cairan ludah atau ingus ketika anak bersin, bicara, tertawa maupun batuk dan terhirup orang lain ketika mereka bernapas. Penularan juga dapat terjadi

jika Balita makan atau minum bersama penderita dari piring dan gelas yang sama. Bahkan, memakai handuk, memegang bekas tisu yang baru dipakai membersihkan hidung juga bisa menjadi media penularan. Penderita meningitis masih akan menularkan penyakitnya selama mereka masih menunjukkan gejala penyakit tersebut. Bahkan, penderita menagitis yang penyebabnya bakteri masih dapat menularkan penyakitnya sekitar 24 jam setelah mereka diberi antibiotik. Selain bakteri dan virus, kadang-kadang pula meningitis disebabkan jamur, protozoa maupun parasit. Dibandingkan dengan yang disebabkan oleh virus, meningitis yang disebabkan bakteri agak jarang terjadi. Pada bayi, anak dan Balita, gejala yang muncul beberapa hari setelah menderita batuk pilek, diare dan muntah-muntah, yang merupakan tandatanda infeksi bakteri atau virus, antara lain demam (sekitar 39º C), lesu, lemah dan rewel, sakit kepala dan mata sensitif terha-

dap cahaya, kaku kuduk, kadangkadang ruam kulit dan kulitnya berwarna kuning serta kejang, tidak mau makan atau minum susu, kedinginan, menangis menjerit-jerik seperti kesakitan, ubun-ubun bayi yang masih terbuka mungkin tampak menonjol dan keras. Pada bayi gejala-gejala klasik bisa terlihat malas menyusu, serta tampak lesu dan lemah sekali. Masa inkubasi 2-14 hari. Balita yang terdiagnosa menderita meningitis, dia perlu dirawat di rumah sakit. Dengan penanganan maksimal, meningitis yang disebabkan bakteri dapat sembuh sekitar 3 minggu. Usahakan Balita banyak mengonsumsi cairan dan istrirahat. Untuk pencegahan lakukan imunisasi HiB/pneumokokus, jaga kebersihan dengan mencuci tangan yang bersih, terutama sebelum makan. Hindari kontak dengan seseorang yang sedang tampak sakit. Hindari berbagai makanan atau minuman dari piring atau gelas yang sama. *dr Lily

PerubahanTarif Layanan RSU Pirngadi Medan Batal


Tips: Cara Merawat Gigi Balita Usia 0–24 Bulan Tidak perlu menunggu waktu yang tepat sampai anak mau ke dokter gigi atau cukup umur untuk memulai perawatan pada giginya. Umumnya penyakit dan kelainan gigi pada anak merupakan salah satu gangguan dalam proses pertumbuhan dan perkembangan anak. Sejak gigi susu mulai tumbuh, orangtua harus bertanggungjawab membersihkan gigi bayi mereka. Walaupun gigi anak hanya merupakan gigi susu yang keberadaannya hanya sementara, namun kesehatan gigi susu berpengaruh terhadap kesehatan gigi anak di kemudian hari. Karena itu, sebagai orangtua perlu mengetahui bagaimana merawat gigi anak sejak bayi dengan cara yang benar, agar kesehatan gigi dan mulut anak teratasi. Cara merawat mulut bayi pada saat usia 0 – 6 bulan: Bersihkan gusi bayi anda dengan kain lembab, setidaknya dua kali sehari. Jangan biarkan bayi anda tidur sambil minum susu dengan menggunakan botol susunya. Selesai menyusui, ingatlah untuk membersihkan mulut bayi dengan kain lembab. Jangan menambah rasa manis pada botol susu dengan madu atau sesuatu yang manis. Cara merawat mulut dan gigi bayi pada usia 7-12 bulan: Tanyakan dokter anak atau dokter gigi apakah bayi mendapat cukup fluor. Ingatlah untuk membersihkan mulut bayi dengan kain lembab ( tidak basah sekali), sehabis menyusui. Jangan biarkan bayi tidur dengan botol susunya (sambil minum susu dari botol) kecuali air putih. Berikan air putih bila bayi ingin minum diluar jadwal minum susu. Mulailah membersihkannya dengan menggunakan kain lembab. Bersihkan setiap permukaan gigi dan batas antara gigi dengan gusi secara seksama, karena makanan seringkali tertinggal di permukaan itu. Saat gigi geraham bayi mulai tumbuh, mulai gunakan sikat gigi yang kecil dengan permukaan lembut dan dari bahan nilon. Jangan gunakan pasta gigi dan ingat untuk selalu membasahi sikat gigi dengan air. Periksakan gigi anak ke dokter gigi, setelah 6 bulan sejak gigi pertama tumbuh atau saat usia anak setahun. Cara merawat mulut dan gigi bayi pada usia 13-24 bulan: Mulailah perkenalkan pasta gigi berfluoride. Jangan biarkan anak tidur dengan botol susu (sambil minum susu dari botol), kecuali air putih. Pergunakan pasta gigi seukuran sebutir kacang hijau. Sikat gigi anak setidaknya dua kali sehari (sehabis sarapan dan sebelum tidur di malam hari). Gunakan sikat gigi yang lembut dari bahan nilon. Ganti sikat gigi tiap tiga bulan atau bila bulu-bulu sikat sudah rusak. Jadilah teladan dengan mempraktekkan kebiasaan menjaga kesehatan mulut dan lakukan pemeriksaan rutin ke dokter gigi setiap 6 bulan sekali. Biasakan anak untuk memakan makanan ringan yang sehat, seperti buah segar dan sayuran segar. Hindari makanan ringan yang mengandung gula.*drg Linda

PeraturanWalikota (Perwal) Kota Medan No 5 tahun 2012 tentang Pengelolaan Keuangan Badan Layanan Umum Daerah (BLUD) Rumah Sakit Umum Pirngadi Medan (RSUPM) yang melakukan perubahan tarif layanan di rumah sakit tersebut harus dibatalkan demi hukum karena dalam mekanisme penetapannya tidak merujuk kepada Undang-Undang No 25 tahun 2009 tentang pelayanan publik pasal 31 ayat 4 dimana kenaikan tarif harus berdasarkan persetujuan DPRD. Pernyataan ini disampaikan anggota DPRD Medan HT Bahrumsyah dalam rapat dengar pendapat dengan Rumah Sakit Umum Pirngadi Medan dan Bagian Hukum Pemko Medan di gedung sementara DPRD Medan. “Dalam pasal 31 ayat 4 berbunyi penentuan biaya/tarif pelayanan publik sebagaimana dimaksud pada ayat (2) dan ayat (3) ditetapkan dengan persetujuan DPR, DPRD provinsi, DPRD kabupaten/kota dan berdasarkan peraturan perundang-undang,” ungkapnya dalam rapat yang juga dihadiri Dirut RSU Pirngadi Medan Dr

Amran Lubis dan Kepala Bagin Hukum Pemko Medan Soritua Harahap SH. Dikatakan Bahrum, seperti tertuang dalam undang-undang Pelayanan Publik pasal 5 ayat dua disebutkan ruang lingkup sebagaimana dimaksud pada ayat (1) meliputi pendidikan, pengajaran, pekerjaan dan usaha, tempat tinggal, komunikasi dan informasi, lingkungan hidup, kesehatan, jaminan sosial, energi, perbankan, perhubungan, sumber daya alam, pariwisata, dan sektor strategis lainnya. “Jadi sudah jelas ini harus menjadi pedoman dimana pengaturan tentang kesehatan yakni tarif rumah sakit masuk kedalam ruang lingkup UU pelayanan publik,” ungkapnya. Terkait permasalahan ini Bahrum menyarankan agar Pemko Medan dalam hal ini RSU Pirngadi Medan dan bagian hukum segera menyampaikan Ranperda ke DPRD Medan dimana nantinya bisa dibahas secepatnya. “Untuk itu kita mendesak Pemko Medan agar segera menyampaikan Ranperdanya ke DPRD untuk dibahas, karena

mekanisme yang ditempuh dalam kenaikan tarif ini jelas tidak sesuai dengan ketentuan,” ungkapnya. Tidak hanya UU pelayanan publik, Bahrum juga mengatakan dalam penentuan tarif sesuai dengan UU Rumah Sakit No 44 tahun 2009 pasal 50 ayat 2 tentang besaran tarif kelas III rumah sakit yang dikelola pemerintah daerah ditetapkan melalui peraturan daerah. “Jadi dalam UU Rumah Sakit ini juga sudah jelas besaran tarif ditetapkan melalui Perda dan pengajuan Perda sendiri berarti harus ada persetujuan DPRD,” ungkapnya. Dalam kesempatan yang sama, anggota DPRD Medan H Surianda Lubis SAg mengungkapkan Perwal terkait kenaikan tarif RSU Pirngadi ini harus batal demi hukum. “Jadi karena tidak merujuk kepada UU dimana mekanisme dalam penempuhannya ada yang diabaikan maka kenaikan tarif ini batal demi hukum,” tegasnya. Tidak Paham Dalam rapat dengar pendapat yang dihadiri sejumlah

anggota DPRD Medan dari Komisi B di antaranya HT Bahrumsyah SH, Surianda Lubis SH, Ir Yahya Payungan Lubis, Roma P Simare-mare dan Janlie, Dirut RSU Pirngadi menyampaikan permintaan maaf karena dalam menempuh kenaikan tarif ini pihaknya tidak melakukan komunikasi terlebih dahulu. “Saya selaku Direktur RSU Pirngadi Medan menyampaikan permohonan maaf dan ke depan jika ada permasalahan terkait RSU Pirngadi, kami akan mengkomunikasikannya dahulu dengan Komisi B sebagai pihak yang terkait dengan Pirngadi. Kita menyadari tidak ada komunikasi terlebih dahulu perihal kenaikan tarif ini,” ungkapnya. Berbeda dengan Kabag Hukum Pemko Medan Soritua Harahap yang sepertinya tidak paham dengan proses menempuh PeraturanWalikota (Perwal) yang menurutnya bisa ditempuh sesuai dengan Peraturan Dalam Negeri (Permendagri). Soritua mengatakan tidak ada pembatalan tarif. “Tidak ada pembatalan tarif,” ungkapnya sambil berlalu. (m30)

Lidah Buaya Sebagai Penurun Kadar Gula Darah Berbicara mengenai tanaman yang satu ini memang sudah sangat terbukti khasiatnya di dunia medis. Tanaman lidah buaya dikenal dengan nama Aloenet vera sangat bermanfaat bagi kesehatan rambut. Tapi tahukah kamu khasiat tanaman aloevera yang lainnya ? Ada beberapa manfaat tanaman lidah buaya bagi kesehatan tubuh manusia yakni mendinginkan kulit yang terbakar sinar matahari, terutama bagi mereka yang kerap bekerja di luar ruangan. Mengatasi masalah kulit yang disebabkan cuaca, seperti kulit kering, kemerahan, mengelupas dan iritasi ringan atau ruam. Memudarkan warna kemerahan pada memar di tubuh. Mengatasi rasa tidak nyaman yang disebabkan alat cukur. Mengatasi luka bakar ringan. Meredakan kulit yang melepuh. Dapat digunakan sebagai krim anti penuaan dini atau untuk mengatasi keriput. Mengobati ruam akibat terkena getah tanaman. Mengatasi rasa gatal akibat gigitan serangga. Gunakan setiap hari untuk memudarkan bekas luka dan strecth mark, garis-garis putih atau merah akibat kehamilan. Merawat luka kecil akibat teriris pisau atau tergores. Memudarkan bintik bintik kehitaman pada kulit. Dapat berguna sebagai pengganti kondisioner dan jelly untuk rambut. Bisa digunakan untuk mengurangi jerawat. Digunakan untuk mempercepat penyembuhan sariawan. Dapat digunakan sebagai body lotion alami. Untuk meredakan otot yang keram atau menegang. Digunakan untuk mengurangi keluhan pada masalah gusi. Mengurangi ketombe pada kepala. Mengatasi kutu air. *Fahmi Isya/sumber: seri tanaman obat tradisional

Cara Membuat Ramuan Dari Tanaman Lidah Buaya Radang tenggorokan Cara meramu: 1 daun lidah buaya dicuci dan dikupas. Isinya dipotong-potong atau diblender. Tambahkan 1 sendok makan madu murni. Minum 3 kali sehari. Ambeien Cara meramu: Setengah (1/2) batang daun lidah buaya dibuang durinya, dicuci, lalu diparut. Beri setengah (1/2) gelas air panas, kemudian peras. Tambahkan 2 sendok makan madu. Dalam keadaan hangat, minum 3 kali sehari. Sembelit Cara meramu: Setengah (1/2) batang daun lidah buaya dicuci dan dikupas. Isinya dipotong kecil-kecil. Seduh dengan setengah (1/2) gelas air. Beri 1 sendok makan madu. Hangat-hangat dimakan 2 kali sehari. Diabetes Melitus Cara meramu: 2 batang daun lidah buaya, dicuci, dibuang durinya, dipotongpotong. Rebus dengan 3 gelas air, lalu saring. Minum 3 kali sehari sesudah makan, masing-masing setengah gelas. Penurun kadar gula darah Cara meramu: 1 pelepah lidah buaya ukuran besar (kira-kira seukuran telapak tangan) dibersihkan dengan mengupas kulit dan durinya. Rendam sekitar 30 menit dalam air garam. Remas sebentar lalu bilas di bawah air yang mengalir (air kran). Rebus dengan 3 gelas air hingga mendidih. Dinginkan. Minum sebanyak 1/2 gelas, 2 sampai 3 kali sehari. Penyubur rambut Cara meramu: 2 pelepah lidah buaya dicuci lalu kupas. Isinya digosokkan pada kulit kepala yang telah dikeramas pada sore hari. Bungkus dengan kain. Keesokan harinya rambut dibilas. Lakukan setiap hari selama 3 bulan. Batuk (yang membandel) Cara meramu: 20 g daun lidah buaya dicuci, dikupas, dipotong-potong. Beri 2 sendok makan madu murni. Minum 2 kali sehari. Ulangi selama 10 hari.

WASPADA Minggu 24 Februari 2013



Ragam Diet

Bolehkah Mengganti Beras dengan Kentang ? Kentang dan nasi sama-sama masuk dalam kategori karbohidrat karena kandungan tepung dan gula yang tinggi. Kentang sedikit lebih tinggi kandungan gizinya dibandingkan nasi, dengan kandungan protein dan mineral lebih lengkap. Kentang apabila dikonsumsi dengan kulitnya (dibersihkan dengan benar) masuk dalam kategori karbohidrat kompleks. Per 100 gr kentang, energi 93 Kcal, karbohidrat 21 g, vitamin C 9,6 mg, folat 28 mcg, kalsium 15 mg, zat besi 1,1 mg. Sedangkan nasi energi 130 Kcal, karbohidrat 28,6 g, vitamin C 0 mg, folat 58 mcg, kalsium 3 mg, zat besi 1,5 mg. Banyak wanita melakukan program penurunan berat badan (BB) untuk mencapai bobot tubuh ideal. Salah satu trik diet dengan kentang agar BB menyusut. Tak sedikit wanita yang menghindari konsumsi nasi dan menggantinya dengan kentang. Namun benarkah konsumsi kentang bisa efektif menurunkan berat badan? Tidak ada penelitian sebelumnya yang membuktikan kentang bermanfaat untuk menurunkan BB. Namun, dari hasil uji coba terhadap pria dan wanita yang menjadikan kentang sebagai bagian dari program penurunan BB terbukti berhasil mengurangi bobot tubuh berlebih. Ketika mengalami keluhan BB, hal yang perlu dilakukan bukanlah menghindari makanan atau kelompok makanan tertentu. Tapi, penting untuk mengurangi jumlah kalori dari makanan harian. Para peneliti mempelajari pola hidup 86 pria dan wanita dengan kelebihan BB selama 12 minggu. Peneliti mengukur efek dari diet modifikasi indeks glikemik mengurangi kalori dengan menambahkan kentang dalam menu diet harian responden. Indeks Glikemik atau GI seperti diketahui adalah ukuran dampak karbohidrat pada tingkat gula darah. Tiga kelompok dengan orang yang dipilih secara acak, diamati masing-masing memiliki diet yang mengonsumsi 5-7 porsi kentang per minggu. Hasilnya, ketiga kelompok mengalami kehilangan BB. Satu buah kentang ukuran sedang mengandung 110 kalori per porsi, mengandung kalium lebih (620 gram) dari pisang dan menyediakan hampir setengah dari nilai harian vitamin C (45 persen) dan tidak mengandung sodium, lemak atau kolesterol, sehingga baik untuk kesehatan dan penting untuk menjadikannya makanan diet harian. Jika ingin menurunkan berat badan dengan kentang sebaiknya konsumi kentang yang dikukus atau direbus. Hindari kentang digoreng, karena kandungan lemak yang ada dalam kentang goreng cukup tinggi dan bisa merusak program diet. Manfaat Kentang Kentang bermanfaat sebagai penawar racun alami asam yang berlebihan atau asidosis. Kentang penting membantu pertumbuhan bakteri dalam saluran pencernaan tubuh. Kandungan garam alkali menjadikan kentang sebagai salah satu makanan basa yang paling kuat, karena itu kentang sangat berguna untuk menjaga cadangan alkali tubuh. Kentang mempunyai banyak khasiat. Di antaranya potassium, vitamin C (sumber kedua selepas oren), membekalkan karbohidrat kompleks dan fiber atau gentian kepada gula darah (blood sugar) dan pengawalan tekanan darah. Kentang juga mengandungi vitamin B1, B2 dan B3 serta sedikit kandungan protein dan zat besi. Kandungan potasium kentang, dua kali lipat dari kandungan potassium dalam pisang dan fiber. Jumlah lemaknya di bawah paras 25%, sehinga dapat menghalang endapan kolesterol di dalam lapisan saluran darah. Kentang cocok bagi yang me-ngalami kekurangan gula dalam darah. Kentang merupakan sumber terbaik dalam pembentukan zat besi dalam darah. Menjamin sistem ketahanan badan, karena kandungan vitamin serta kalsium yang tinggi. Kentang juga bisa memutihkan dan melembutkan tangan. Ini menunjukkan kentang bukan saja bermanfaat untuk tujuan pengobatan. Kandungan potassium danVitamin C pada kentang sangatcocokuntukuntukperawatankulit,sepertiwajahberminyak dan berjerawat. Bagi kulit berminyak, dua buah kentang dikupas dan diparut. Lalu dioleskan pada wajah hingga rata, biarkan selama 1/2 jam. Bersihkan dengan air dingin bersih. Sementara untuk jerawat, sebuah kentang diiris tipistipis, tempelkan ke seluruh wajah. Biarkan sampai kentang menjadi kering dan berwarna keabuan. Bersihkan dengan air bersih dingin. Kentang sangat cocok bagi penderita penyakit maag atau sering mangalami sakit karena kelebihan asam lambung. Sebab dalam kentang terkandung atropine yang dapat memebantu mengurangi asam lambung dan mengurangi sakit pada lambung. Biasanya zat lysine tidak terdapat pada nabati, tetapi di dalam kentang terdapat lysine yang sangat penting dalam pertumbuhan badan dan otak. Dengan kentang kita dapat mengkonsumsivitaminCsecaramudah.KarenavitaminCdidalam kentang tidak hilang setelah masak karena dikelilingi oleh sari pati. Walaupun kalorinya cukup rendah, kentang dapat menyebabkan kegemukan karena adanya Glycemic Index. Kentang mempunyai khasiat membuat mata yang lelah kembali bersinar serta dapat menghilangkan bengkak pada mata. Parutlah kentang lalu masukkan ke dalam kain tipis yang bersih (kain kasa atau kain mori) dan kompreskan ke kelopak mata. *Siti Aisyah Ritonga, ahli gizi di salah satu rumah sakit swasta

Pro Dan Kontra Fitoestrogen Bagi Kesehatan INFO kesehatan sering sekali disampaikan secara salah kaprah tanpa penjelasan, terutama bagi media cetak, elektronik hingga visual bahkan film yang tak memiliki filter untuk menyaring informasi dan lebih senang dengan pemberitaan bombastis. Di era kemudahan mengakses informasi seperti sekarang, pengetahuan tentang kesehatan bagi masyarakat awam jadi semakin berantakan. Salah satu yang mencuat belakangan ini masalah fitoestrogen diidentikkan dengan bahan makanan alami berasal dari kedelai. Di satu sisi dari dulu dianggap banyak sekali memiliki manfaat kesehatan, kini cukup banyak artikel yang memberitakan dampak negatifnya. Atas kandungan fitoestrogen yang banyak terkandung dalam kedelai itu, ada banyak yang sering sekali disebutkan. Antara lain memberi kecenderungan sifat kewanitaan pada pria, hingga penyakit keganasan seperti kanker payudara pada wanita. Padahal ada batasan tertentu sebagaimana juga bahan makanan atau obat-obatan lain dalam jumlah yang dikonsumsi hingga bisa dianggap aman atau tidak, termasuk juga cara pengolahannya. Sekilas Tentang Fitoestrogen Fitoestrogen merupakan komposisi alami ditemukan pada tumbuhan, yang memiliki banyak kesamaan dengan estradiol, bentuk alami hormon estrogen yang paling poten. Namun fitoestrogen yang ditemukan pada bahan-bahan alami ini memiliki keamanan lebih tinggi ketimbang hormonnya secara langsung. Sifatnya sama, namun ia bekerja lebih lemah

dari hormon. Kelompok utama fitoestrogen adalah flavon, lignan, coumestans dan isoflavon.Yang terakhir inilah dianggap paling bermanfaat dalam menjaga keseimbangan hormon estrogen dalam tubuh, bersifat sebagai antioksidan sekaligus memiliki fungsi proteksi terhadap organ-organ kewanitaan termasuk payudara dan rahim, juga menjaga penuaan lewat proses penjagaan kekenyalan kulit dengan berbagai zat alami yang dibutuhkan termasuk kolagen, mencegah osteoporosis dan menjaga kadar lemak. Namun beberapa penelitian memang mengatakan kandungan isoflavon paling baik terdapat pada produk fitoestrogen yang terfermentasi seperti tempe dan kecambah kedelai, sementara yang tidak terfermentasi seperti beberapa jenis tahu atau susu kedelai dari banyak berita itu dianggap tak sebaik itu, namun bukan berarti selalu beresiko. Selain pada kedelai, fitoestrogen ditemukan cukup banyak pada sereal, gandum, biji bunga matahari, teh hijau, beberapa jenis buah-buahan dan sebagainya. Kanker dan Hormon Estrogen Kanker dengan resiko paling umum dihadapi wanita, kanker payudara memang sangat erat berhubungan dengan kesehatan wanita, terlebih di usia menjelang atau pasca menopause, dimana salah satu faktor pemicu terbesarnya hormon estrogen. Yang juga berperan dalam kasus kanker lain yang tak kalah pentingnya kanker rahim, dianggap ikut mempengaruhi berbagai kasus yang ada.

Namun ada juga faktor riwayat keluarga yang belakangan ini disorot banyak ahli sebagai peningkat resiko faktor utamanya. Ada banyak cara pencegahan selama ini kita dapati dari berbagai media pengetahuan termasuk faktor gaya hidup seperti konsumsi alkohol, menjaga diet agar tubuh tetap proporsional dan terhindar dari obesitas yang juga banyak disebut termasuk dalam faktor pemicu, makan makanan sehat seperti sayuran dan buah-buahan sampai berolahraga secara teratur. Kembali pada masalah hormon, rata-rata riset memang benar menunjukkan kadar estrogen tinggi mengambil peranan besar dalam banyak kasus yang dijumpai. Sementara kontradiksinya, kadar estrogen menurun drastis menuju peristiwa menopause juga berada sebagai latarbelakang banyak gangguan pasca menopause termasuk penuaan kulit serta organ tubuh lain, stress, osteoporosis hingga resiko penyakit jantung. Konsumsi Seimbang Yang menjadi masalah terkait penjelasan diatas bila kadar isoflavon meningkat terlalu tinggi lewat makanan yang dikonsumsi dan kecenderungannya lebih besar pada produk yang tidak terfermentasi. Kemudian juga cara pengolahan yang salah seperti cara menggoreng lebih tak dianjurkan ketimbang rebusan atau fermentasi, kemudian olahan kedelai yang disimpan terlalu lama sehingga bisa meningkatkan aktifitas jamur dengan zat aflatoksinnya yang berbahaya dan mekanisme berbeda ikut memicu gangguan

lain pada tubuh. Selain itu, masih banyak faktor berperan dalam menentukan ketentuan kadar kebutuhan yang sangat bervariasi bergantung individunya, termasuk juga memiliki bakat kanker secara genetik, belum lagi menyebut kontaminasi pestisida pada produk nabati atau olahan daging yang terkadang banyak mengandung pengawet dan perasa berbahaya secara berlebihan. Dalam banyak riset, para ahli sudah mengingatkan cara pengolahan yang tidak benar akan turut beresiko meningkatkan fitoestrogen ke angka sangat tinggi sehingga memicu ketidakseimbangan hormon dalam kaitannya ke kasus-kasus keganasan. Begitu juga, dalam kasus kecenderungan sifat wanita pada pria hingga homoseksualitas yang kerap disinggung-singgung, ada batasan jumlah konsumsi yang harus dijaga agar tak terlalu banyak. Dan ini semua berhubungan lagi dengan kadar fitoestrogen yang dikandung oleh satu jenis bahan makanan alami. Ada juga beberapa senyawa yang bisa beresiko di dalamnya, bahkan sebagian penelitian digolongkan sebagai kontraindikasi terhadap beberapa kasus termasuk wanita hamil atau ibu menyusui, serta penderita gangguan hormonal serta kanker . Jadi sebaiknya tak perlu terlalu cepat menilai kebenaran publikasi berita ilmiah dari media bebas, namun pahami dulu banyak aspek yang ada di dalamnya. Di luar beberapa resiko yang timbul dari banyak hal tadi, fitoestrogen tetap bermanfaat dalam penjagaan kesehatan, sejauh konsumsinya dilakukan dengan seimbang dan tak berlebihan. (dr. Daniel Irawan)


WASPADA Minggu 24 Februari 2013


Pedas Atau Enggak Sama Enaknya KETOPRAK, makanan khas asal Jakarta dan secara khusus dari Cirebon ini, mulai mendapat tempat dihati warga Medan. Mengaandalkan bahan seperti bihun jagung, tahu, tauge disiram dengan kacang tanah tumbuk ini, dan tebaran kerupuk, makanan ini kini bisa didapatkan di JL Sei Serayu Medan. Ketoprak Kuno, begitu nama makanan ini. Mengandalkan Warung sederhana dan sedang menyiapkan tempat yang lumayan luas, warung yang belum lama dibuka ini mulai ramai saat siang dan malam hari


Kendi tempat aneka bumbu di Kuno Ketoprak

Apa yang membuat pengelolanya Darma dan pendukungnya Diky dan Nanda menamakan warung ini Kuno, adalah hal yang benar. Pasalnya, perlengkapan di warung ini menggunakan barang lama atau kuno. Seperti kendi kecil tempat kacang tumbuk, tempat garam dan piring kaleng lurik-lurik. Cangkir untuk minuman birpleto’ dengan es. Nanda menyebutkan, selain konsep. peralatan kuno dan barang pendukung lainnya memang terkesan kuno. Tetapi yang penting kata Nanda, makanan ini digemari masyarakat. Pihaknyapun merasakan bahwa anomi masyarakat terhadap makanan tradisional tidak diragukan. “ Ini tahap awal, kedepan kami juga ingin menyiapkan makanan daerah lainnya, agar tidak hilang dari peredaran begitu saja, karena banyaknya makanan dari luar negeri dengan beragam jenis. Misalkan tiwul, getuk,lupis dan yang tradisional lainnya,” kata Nanda. Sajian ketoprak yang langsung mengulek cabai rawit dan seiris bawang putih di


pinggan, menyiram kacang tumbuk dengan air dari botol yang sudah dicampur jeruk kesturi, dan diulek lagi hingga terlihat kental. Lalu, tahu yang sudah digoreng dibelah dua dan dimasukkan dalam pinggan. Begitu juga dengan bihun, toge dan telur. Lalu disempurnakan dengan tebaran bawang goreng dan kerupuk. “ Kalau suka pedas, cabai rawitnya lebih dari 3 buah, kalau enggak suka pedas ya satu saja atau tidak pakai cabai sama sekali. Pakai atau enggak rasanya tetap enak,” kata Diky yang membuat ketoprak. Ingin coba minuman khas di warung ini? Pesan saja, birpleto’ minuman yang disajikan hangat dan dingin. Rasanya sedikit pedas seperti wedang jahe dan bandrek. Hanya saja warnanya sangat beda dari. Wedang jahe, meskipun rasanya hampir sama. Naskah dan foto : Anum saskia


Minuman Tradisional Ala Jepang

Teh tradisional Jepang dapat dinikmati berbagai kalangan.

Waspada / ist

Tips: Agar Bumbu Spaghetti Lebih Meresap dan Enak SPAGHETTI adalah hidangan pasta yang disukai warga Indonesia. Hidangan dari Italia ini memang nikmat, sayangnya, jika membuat sendiri, bumbu spaghetti kurang bisa meresap ke dalam pasta walau sudah diaduk rata. Untuk mengatasi hal ini, Anda bisa melakukan tips sebagai berikut: Tambahkan sedikit garam pada air rebusan spaghetti. Hal ini bertujuan agar pasta memiliki sedikit rasa yang merata. Sehingga tidak terlalu hambar jika tidak terkena bagian bumbu. Tambahkan juga minyak zaitun saat merebus pasta, selain mencegah pasta saling menempel, minyak akan melembutkan pasta dan memudahkan saus spaghetti tercampur rata. Pastikan pasta matang sempurna, tidak terlalu keras, tidak terlalu lunak. Pasta yang terlalu keras membuat bumbu lebih sulit meresap.

MIRAI OCHA, Minuman “Ocha” dalam kemasan botol pertama di Indonesia mengandalkan teh tradisional Jepang, kini dapat dinikmati dalam kemasan botol yang praktis, mudah dibawa kemana saja dan kapan saja. Jumat lalu, Suntory Garuda Beverage meluncurkan sebuah produk baru Mirai Ocha sebuah inovasi minuman Ocha dalam botol pertama di Indonesia. Minuman diperuntukkan bagi yang suka aktif, dinamis dan menyukai terobosan baru. Rasa madu, termasuk minuman yang digemari. Aroma madu berbaur dengan teh, memberi nuansa tersendiri bagi yang menikmati. Rasa lainnya sakura dan original. “Mirai Ocha diharapkan dapat menjadi pilihan baru yang berbeda untuk minuman siap minum dalam kemasan botol, yang dapat menarik konsumen ke kategori Ocha ini. Kami meluncurkan produk yang menyenangkan dan menyegarkan bagi orang-orang muda yang gemar menikmati minuman dalam kemasan botol untuk kehidupan sehari-hari serta menyukai hal-hal praktis karena mereka bergerak dengan aktif dan dinamis. Kami percaya, inovasi produk penting bagi konsumen minuman siap minum dalam kemasan botol di


Ayam Kodok

Bahan: - 1 ekor ayam berat 1 kg - 500 gram daging ayam cincang dari ayam yang dilepaskan kulit dan tulangnya - 4 butir telurrebus, kupas kulitnya - 300 gram daging sapi cincang - 6 lembar roti tawar - 200 ml susu cair - 2 butir telur, kocok lepas Bumbu, dihaluskan: - 1 1/2 sendok teh merica bubuk - 1/2 butir pala -7 butir bawang putih -7 butir bawang merah

Hidangkan spaghetti dalam kondisi hangat. Pastikan Anda mengaduknya saat saus dan pasta masih hangat. Hal ini bertujuan agar bumbu lebih meresap, jika pasta sudah dingin, maka bumbu akan lebih sulit meresap dan tercampur rata. Jangan pelit memberi saus spaghetti. Pasta yang tidak terkena saus akan menghilangkan kenikmatan menyantap spaghetti.**

Indonesia yang memang selalu mencari hal baru untuk dicoba,” ucap Erwin Panigoro, Marketing Manager Suntory Garuda Beverage sembari menambahkan Titi Rajo Bintang merupakan sosok yang sesuai dengan brand Mirai Ocha ini, karena esensi dari Mirai Ocha adalah kesegaran dan semangat yang tidak pernah padam, serta tanggap terhadap hal-hal baru yang terjadi di kehidupan sehari-hari. Titi Rajo Bintang memiliki semua elemen tersebut, dia selalu bersemangat dan selalu terbuka dengan inovasi serta menyukai hal baru. Dia juga memancarkan semangat Ganbatte. “Mirai Ocha ini sangat menarik buat saya. Pertama saya memang penggemar Ocha, dan menyukai hal-hal yang berbau Jepang. Dengan adanya Ocha di dalam botol, membuat segala sesuatu menjadi lebih praktis bagi saya. Saya merasa sangat tersanjung untuk menjadi duta brand ini, dan berharap dapat ‘menghidupkan’ semangat yang tersirat di dalam brand Mirai Ocha,” ujar Titi Rajo Bintang, duta brand Mirai Ocha. Sajian minuman botol ini telah disebar di berbagai kota besar di Indonesia dengan berbagai program. Di Medan sendiri kegiatan berlangsung sejak Jumat hingga Minggu hari ini, di Lapangan Merdeka Medan sekaligus memberi kesempatan pada pengunjung mendapatkan berbagai hadiah. **Anum Saskia

Bumbu lainnya: - 2 sendok makan kecap asin - 1 sendok makan saus tiram - 1 1/2 sendok teh kaldu bubuk - 1/2 sendok teh garam Saus untuk mengoles ayam saat dipanggang, aduk jadi satu: - 2 sendok makan kecap manis - 1 sendok makan kecap asin - 1 sendok makan minyak sayur atau margarine cair

Saus coklat: - 1 sendok makan margarine - 1 butir bawang bombay, cincang halus - 5 siung bawang putih, cincang halus - 1 1/2 sendok teh merica hitam butiran, tumbuk kasar - 1/2 butir pala, haluskan - 1/4 sendok teh merica bubuk - 2 sendok teh saus tiram - 3 sendok makan kecap manis - 1 1/2 sendok makan kecap asin - 1/2 sendok teh kaldu bubuk - 500 ml air kaldu - 2 sendok makan maizena, cairkan dengan 2 sendok makan air. Sajikan dengan wortel, Timun, Kentang, Buncis Naskah dan foto: Sri Gustina



Konsultasi Teknologi Informasi Diasuh oleh Codealgo

ke email kami di Semoga dapat membantu, terima kasih. Dari : 0857605xxxxx Assalamualaikum wr.wb, aku mau nanya, gimana ya cara menginstal ulang windows 7, soalnya banyak datadata di komputerku hilang, seperti bagian-bagian dari photoshop sehingga tidak dapat dibuka karena di scan oleh AVG. Mohon bantuannya. Terima kasih. Jawab : Waalaikumsalam wr.wb, cara menginstall ulang windows 7 sangat mudah, pertama, set terlebih dahulu komputer kamu agar first boot dilakukan dari CD/ DVD (apabila installer windows 7 kamu berupa bentuk keping CD/DVD) atau flashdisk (bila installer windows 7 terletak di flashdisk), sesuaikan first boot dengan sumber installer windows 7 kamu. Lalu, masukkan installer kamu ke komputer, dan reboot komputer kamu. Oh ya, sebelumnya kami sangat menyarankan agar membackup data-data kamu terutama yang penting karena bisa saja data tersebut hilang saat instalasi dilakukan. Selain itu, pastikan driver hardware kamu juga tersedia karena bisa saja windows 7 tidak support driver hardware kamu. Setelah reboot dilakukan, tekan tombol ENTER di keyboard saat dilayar muncul tulisan “press any key to boot from

CD/DVD”, setelah ini akan muncul konfigurasi pertama dimana kita harus memasukkan bahasa sistem operasi, format waktu, dan keyboard, pilih sesuai keinginan kamu lalu pilih NEXT. Pada langkah selanjutnya, klik “INSTALL”, ceklist service agreement dan pilih next, lalu tentukan drive dan partisi mana yang hendak kamu install dan klik next, lalu tunggu sampai instalasi selesai dilakukan. Setelah instalasi selesai, komputer akan reboot kembali dan saat kembali hidup, kamu akan diminta untuk mengatur konfigurasi komputer seperti nama komputer, password, dsb. Setelah konfigurasi selesai, komputer dengan windows 7 sudah dapat digunakan, semoga dapat membantu, terima kasih. Dari : 0857611xxxxx Hai codealgo..hp k-touch H711 ku kenapa selalu putus internetnya saat buka FB..tapi saat buka situs yang lain gak masalah..mohon solusinya ya codealgo.. Jawab : Setahu kami, hp ktouch H711 sudah menyediakan akses langsung ke situs-situs terkenal terutama situs social media kaya facebook, twitter, dll. Apabila saat mengakses salah satu situs tersebut internet terputus, coba pastikan pertama kali bahwa memori kamu tidak sedang dalam keadaan full. Memori full merupakan salah satu penyakit yang ada pada hp ini dan bisa mengakibatkan internet kamu terputus. Apabila memori tidak full dan akses ke facebook tidak bisa sedangkan situs lain bisa, mungkin saja ada kerusakan aplikasi pada hp kamu sehingga koneksi ke facebook via hp tidak bisa dilakukan. Apabila ini yang menjadi penyebabnya kami

sarankan kamu membawa hp kamu ke service center. Semoga dapat membantu, terima kasih. Dari : 0858339xxxxx Hai codealgo, saya Fazri di labuhan, saya mau nanya ni, saya kan punya hp nokia 1200, terus entah diapain ama temen saya tiba2x tombolnya terkunci dengan menggunakan password, sedangkan teman saya ini tidak tau passwordnya, jadi gimana ya agar bisa terbuka lagi. Terima kasih codealgo. Jawab : Hai Fazri di Labuhan, apabila kamu lupa password, cara paling mudah adalah dengan melakukan hardreset terhadap hp kamu, hal ini bisa dilakukan dengan cara menekan tombol * + 3 + call + power on. Apabila diminta lock code, coba gunakan 12345. Semoga dapat membantu, terima kasih. Dari : 0877636xxxxx Hai codealgo..salam kenal ya..saya Putri ingin minta bantuan sama codealgo..bagaimana caranya melihat pertemanan di suatu facebook, tapi pertemanan itu sudah di blokir sama teman yang bersangkutan..wassalam. Jawab : Hai Putri, sayang sekali kamu tidak bisa melihat pertemanan apabila kamu sudah di blok oleh orang lain. Ada cara yang bisa kamu lakukan untuk melihat orang tersebut di fb, caranya dengan logout dari fb, dan search nama kawan kamu tersebut tanpa login, apabila profil kawan kamu disetel untuk public dan bukan private, kamu akan dapat melihat profil kawan kamu tersebut. Semoga dapat membantu, terima kasih.

Konsultasi Sumber Daya Manusia Diasuh oleh Thoga Sitorus

Selamat pagi, Pak Thoga. Nama saya Suwarno, bekerja di sebuah perusahaan swasta di Kabupaten Langkat, mau menanyakan kepada Bapak tentang perbedaan pekerjaan harian dan pekerjaan bulanan. Apakah saya sebagai pekerja harian ada batas waktu bekerjanya dan bagaimana kalau perusahaan mempekerjakan pekerja harian melewati batas waktu yang ditentukan. Mohon penjelasan Bapak agar saya mengerti status saya sebagai pekerja harian. Jawab : Selamat pagi, Sdr Suwarno. Mengenai pertanyaan Sdr tentang pekerjaan harian lepas maka acuan kita adalah keputusan Menteri Tenaga Kerja dan Transmigrasi Nomor Kep-100/MEN/ VI/2004 tentang ketentuan pelaksanaan perjanjian kerja waktu tertentu. Dalam Kepmen 100/2004 ini disebutkan bahwa untuk dapat dikategorikan sebagai pekerja/buruh harian lepas harus mengikuti beberapa ketentuan, di antaranya lama bekerja dalam 1(satu) bulan tidak boleh melebihi dari 21 (dua puluh satu) hari kerja. Di samping itu pengusaha/perusahaan yang mempekerjakan perkerja/ buruh harian lepas wajib membuat perjanjian kerja harian lepas secara tertulis.

Bantuin Aku, Dong?!

No 082364766027, Jawaban akan dibalas melalui Harian Waspada, jadi dimohon sabar menunggu.

PEMBERITAHUAN : NB : Kirimkan pertanyaan kamu ke codealgo melalui nomor 081370311355 atau ke email Setiap pertanyaan yang masuk akan kami jawab menggunakan metode FIFO (First In First Out). Codealgo hanya akan menjawab pertanyaan konsultasi melalui rubrik konsultasi Waspada. Kunjungi website kami untuk mengetahui produk dan jasa yang kami tawarkan di yang akan segera dilaunching dalam waktu dekat.

Batas Waktu Pekerja Harian

Minggu 24 Februari 2013

BUAT yang punya problem, khusus remaja atau pelajar tapi susah buat dipecahkan, seperti masalah sekolah, pacar, ortu yang suka ngomel atau teman yang nyebelin, jangan bingung dulu. Tim Remaja Waspada dan Mbak Fifi yang nama lengkapnya Fidia Rizki, S.Psi, psikolog lulusan Universitas Medan Area akan mencoba membantu kamu mencari jalan solusinya. Silahkan kirim pertanyaan melalui SMS ke

Dari : 0853612xxxxx Selamat siang codealgo, mau nanya..ketika aku pasang game ke komputerku, dari flashdisk, ketika mau ku buka gamenya, muncul tulisan begini, “the game has stop working”. Kemudian tidak bisa dibuka..apa masalahnya ni? Mohon bantuannya ya, terima kasih. Jawab : Selamat siang, sayang sekali kamu tidak menyertakan game apa yang sedang kamu mainkan dan spesifikasi sistem operasi yang kamu gunakan. Ada beberapa cara untuk memperbaiki hal ini, cara pertama adalah dengan memeriksa memori kamu, biasanya aplikasi yang tiba-tiba berhenti saat sedang dijalankan disebabkan karena memori yang bermasalah. Untuk menjalankan pengecekan memori, buka start menu, klik control panel, pada search box, ketik “memory” lalu pilih menu “diagnose your computer memory problem”. Cara lainnya adalah dengan mengecek apakah komputer kamu sedang ada masalah dengan virus atau tidak, virus juga dapat menjadi salah satu penyebab komputer kamu tiba-tiba menghentikan aktifitas aplikasi game kamu, maka cobalah scan komputer kamu dengan antivirus yang telah terupdate databasenya. Cara lainnya adalah dengan membuang game tersebut lalu coba install kembali, bisa saja kan saat kamu install atau copy game tersebut dari flashdisk ada file yang tidak terikut dan menyebabkan game menjadi hang. Cara terakhir yang agak susah adalah dengan memainkan games tersebut dengan mode clean boot state. Cara yang terakhir ini bisa dilakukan tapi kamu membutuhkan pengetahuan yang agak dalam tentang sistem operasi karena salahsalah komputer kamu yang bisa rusak, dan agak panjang menjelaskan hal tersebut pada rubrik konsultasi ini, apabila kamu ingin tau lebih lanjut tentang metode clean boot state, silahkan kirimkan pertanyaan kamu kembali


Bentuk perjanjiannya dapat dibuat berupa daftar pekerja/buruh yang melakukan pekerjaan tersebut, dan sekurang-kurangnya memuat : a. nama/alamat perusahaan atau pemberi kerja ; b. nama/alamat pekerja/buruh ; c. jenis pekerjaan yang dilakukan ; d. besarnya upah dan/atau imbalan lainnya. Daftar pekerja/buruh tersebut disampaikan kepada instansi yang bertanggung jawab di bidang ketenagakerjaan setempat selambat-lambatnya 7 (tujuh) hari kerja sejak mempekerjakan pekerja/buruh harian lepas. Pelanggaran dari ketentuan di atas dapat mengakibatkan berubahnya status pekerja/buruh dari pekerja/ buruh harian lepas (pekerja kontrak) menjadi pekerja/ buruh tetap. Untuk pekerja/buruh bulanan dapat kita bagi menjadi dua, yaitu pekerja/ buruh bulanan yang berdasarkan perjanjian kerja kontrak dan pekerja/buruh bulanan yang berdasarkan perjanjian kerja tetap. Ketentuan yang mengatur pekerja/buruh bulanan yang kontrak mengacu pada Kepmen 100/2004 (BAB V) sedangkan untuk pekerja/ buruh bulanan tetap mengacu pada ketentuan umum yang diatur dalam Undang-Undang No.13 Tahun 2003 tentang Ketenagakerjaan Ps.59.

Memperpanjang Kontrak Kerja Selamat pagi, Pak Thoga. Saya MS, staf bagian umum sebuah perusahaan swasta

di Kabupaten Deli Serdang, ingin menanyakan tentang lamanya waktu/waktu yang dapat diperjanjikan dalam perjanjian kontrak kerja atau Perjanjian Kerja Waktu Tertentu (PKWT) dan apabila telah habis jangka waktu yang diperjanjikan tetapi pekerjaan belum selesai, apakah perjanjian kerja dapat langsung diperpanjang atau kegiatan pekerjaan diberhentikan lebih dulu menunggu waktu tenggang 30 hari sesuai ketentuan, padahal waktu penyelesaian pekerjaan tinggal beberapa bulan saja. Jawab: Selamat pagi, Sdr MS. Ketentuan tentang PKWT diatur dalam UU No. 13 Tahun 2003 tentang Ketenagakerjaan (UUK) Pasal 59 antara lain disebutkan, bahwa PKWT dapat diperpanjang atau diperbaharui (Pasal 3). Kemudian Pasal 4, Perjanjian kerja waktu tertentu yang didasarkan atas jangka waktu tertentu dapat diadakan untuk paling lama 2 (dua) tahun dan hanya boleh diperpanjang 1 (satu) kali untuk jangka waktu paling lama 1 (satu) tahun. Pasal 5, Pengusaha yang bermaksud memperpanjang perjanjian kerja waktu tertentu tersebut, paling lama 7 (tujuh) hari sebelum perjanjian kerja waktu tertentu berakhir telah memberitahukan maksudnya secara tertulis kepada pekerja/buruh yang bersangkutan. Pasal 6, Pembaruan perjanjian kerja waktu tertentu hanya dapat diadakan setelah melebihi

masa tenggang waktu 30 (tiga puluh) hari berakhirnya perjanjian kerja waktu tertentu yang lama, pembaruan perjanjian kerja waktu tertentu ini hanya boleh dilakukan 1 (satu) kali dan paling lama 2 (dua) tahun. Pasal 7, Perjanjian kerja untuk waktu tertentu yang tidak memenuhi ketentuan sebagaimana dimaksud pada ayat tersebut di atas, maka demi hukum menjadi perjanjian waktu tidak tertentu. Mengenai pertanyaan Sdr tentang perpanjangan waktu setelah habis jangka waktu yang diperjanjikan dan waktu penyelesaian pekerjaan masih tersisa beberapa bulan lagi, apakah penyelesaian sisa waktu tersebut harus menunggu tenggang waktu 30 hari. Tentu pertanyaan Sdr ini benar karena hanya menunggu penyelesaian pekerjaan yang tinggal beberapa bulan lagi sesuai ketentuan harus menunggu waktu 30 hari, tidaklah efisien dan efektif. Maka untuk mengatasi hal tersebut, agar tidak membuang-buang waktu/ menunggu waktu 30 hari, selanjutnya diatur dalam Kepmenakertrans No. 100 Tahun 2004 tentang Ketentuan Pelaksanaan PKWT, Pasal 3 ayat (5), Dalam hal PKWT dibuat berdasarkan selesainya pekerjaan tertentu namun karena kondisi tertentu pekerjaan tersebut belum dapat diselesaikan, dapat dilakukan pembaharuan PKWT. Ayat (6), Pembaharuan sebagaimana

Tanya: Rudi – Hp 6287869692xxx Assalamualaikum...., Salam kenal buat Mbak. Saya Rudi seorang Mahasiswa. Rudi orangnya sulit/malu untuk menampakkan rasa sayang secara terang-terangan kepada seseorang baik ORTU, ADIK, TEMEN, SAUDARA atau yang lainnya. Baik dalam bentuk perkataan atau pun tindakan. Terkadang ingin terang-terangan tetapi tidak bisa dan ada penyesalan sesudahnya. Mohon solusi terbaik untuk saya. Terima kasih sebelumnya Jawab: Waalaikumsalam, Helo Rudi Mbak paham apa yang kamu utarakan. Ada orang yang Ekstrovert, ciri-cirinya orangnya open minded , terbuka dan blak-blakan, namun sebahagian orang, ada yang sulit bersikap terbuka buat menampilkan perasaannya (Introvert), atau kesulitan mengungkapkan apa yang ada di fikirannya ke orang lain, nah adik masuk tipe ke-dua. Biasanya mereka cenderung menahan diri dan ragu-ragu mengekspresikan dirinya. Supaya adik engga ragu dan malu.. kudu meningkatkan rasa percaya dirimu. Percaya deh, karena PeDe mu itu bisa ditingkatkan, karena setiap orang bisa punya kadar PeDe yang oke. Kuncinya kamu harus nyaman dengan dirimu sendiri. Nah biar bisa nyaman dengan diri sendiri kurangi mengkritik dirimu secara berlebihan,dan melihat kekurangan yang ada. Tapi sebaliknya mulai melihat kelebihan dan potensi yang kamu miliki. Karena dengan ragu-ragu bisa menghambat kita untuk lebih exist. Agar kamu bisa lebih terbuka mulai biasakan diri untuk berani mengemukakan pendapat… menyatakan apa yang kamu suka dan tidak.. begitu juga dengan mengekspresikan apa yang kamu rasakan, missal rasa sayang dsb. Diawal mungkin sulit karena terganjal rasa malu, tapi yakin deh.. belum tentu apa yang kamu khawatirkan sama dengan apa yang ada di fikiran orang lain. Engga ada salahnya mencoba. Semoga berhasil… Tanya: Miera – Hp 6287867688xxx Mbak Fifi saya sedang kesal dengan saudara yang tinggal di rumahku. Masalahnya dia suka ikut-ikutan urusan orang lain. Misal kalau ortuku marah dia ikutan. Nyebelin.. gimana ya mbak menghadapinya? Jawab: Dear Miera Memang ngeselin saat kita sedang dimarahin ada orang lain ikut menimpali, rasanya seperti dimarahin rame-rame. Bagaimana dengan saudaramu.. orang yang suka ikut campur umumnya karena dia punya masalah dengan dirinya sendiri. Nah menghadapinya, kamu ngomong langsung ke dia apa yang membuatnya selalu ikut campur waktu ortu memarahimu.. sebisa mungkin menanyakannya engga pakai emosi tapi dengan kata-kata yang tegas. Karena siapa tahu dia sebenarnya ingin mencari perhatian dari orang tuamu.. atau jealous dengan keadaanmu yang mungkin lebih beruntung darinya. Apapun alasannya hanya dia yang tahu. Buatmu.. tunjukkan bahwa sebenarnya kamu cukup peduli dengannya.. sesekali ajak dia ngobrol tapi jangan memusuhinya. Tapi bila kamu sudah bersikap baik namun dia tetap ikut campur urusanmu.. abaikan saja dia. Anggap saja dia tidak ada.. lamalama dia bosan sendiri.. tapi jadikan ini jalan terakhir, Dan jalin komunikasi yang baik dengan orang tua agar beliau tidak sering memarahimu. Tanya: Anto – Hp 6287866687xxx Dear mbak Fifi, salam kenal.. gimana caranya dapat pacar yang baik hatinya dan gak matre… mkasih atas solusinya Tanya: Bambang – Hp 628567324xxx Assalamualaikum, salam kenal buat mbak Fifi yang manis. Mbak saya mau tanya nee, gimana caranya mengetahui kepribadian cewe yang baik dan menyayangi kita dengan tulus.. soalnya pengalamanku.. sering dimanfaatin mantan-mantan. Makasih atas jawabannya. Jawab: Waalaikumsalam, Hello Anto n Bambang, salam kenal kembali Pacar yang baik tentu yang memperlakukan orang lain dengan baik pula. Artinya dia tidak memanfaatkan orang buat kepentingan dirinya sendiri. Jadi bisa kelihatan dari keseharian dia bertingkah laku. Tapi yang namanya pacaran memang butuh biaya dik.. maksudnya modal buat menyenangkan orang yang disayangi, sesekali menraktir makan atau nonton n jalan-jalan. Kalau masih pelajar dan dibiayai orang tua tentu memberatkan. Jadi seru juga bila gantian, namanya masih sekolah dan belum punya penghasilan. Kalau cewe matre… kelihatan dari sikapnya yang morotin dan senang memanfaatkan buat kepentingan sendiri tanpa melihat kemampuan sang pacar. Tapi don’t worry.. masih banyak koq cewe yang baik, yang mandiri dan engga nyusahin. Karena mencintai dengan tulus.. adalah berusaha menyenangkan dan memberi yang terbaik untuk orang yang dikasihi dan menjauhkannya dari kesulitan. Cari pacar engga perlu diuji-uji, kalau personalnya baik akan kelihatan dari kesehariannya koq.. salam

dimaksud dalam ayat (5) dilakukan setelah melebihi masa tenggang waktu 30 (tiga puluh) hari setelah berakhirnya perjanjian kerja. Ayat (7), Selama tenggang waktu 30 (tiga puluh) hari sebagaimana dimaksud

dalam ayat (6) tidak ada hubungan kerja antara pekerja/buruh dan

Konsultasi Remaja

Tanya: Raihana – Hp 6285275856xxx Assalamualaikum, Dear mbak Fifi salam kenal.. Saya mau curhat. Mbak, saya jadi cewek ke dua.. sakit rasanya melihat pacarku jalan sama ceweknya.. Saya berusaha untuk ngelupain dia.. karena merasa berdosa juga… gimana ya mbak.. Pliss Jawab: Waalaikumsalam, Dear Raihana, salam kenal kembali Waduuh posisimu engga enak banget ya, dijadikan sebagai kekasih gelap, maksudnya diumpetin dalam gelap. Saat dia meletakkan kamu dalam posisi itu, artinya dia tidak sungguhsungguh serius denganmu. Karena saat cowok benar-benar sayang, dia akan melakukan untuk mendapatkanmu dan meletakkanmu dalam posisi yang istimewa. Dia tidak ragu buat memperkenalkanmu pada keluarga dan temantemannya.. tetapi kenyataannya lain, dia hanya menjadikanmu bagian dari kesenangannya. Jadi fikir-fikir kembali.. apakah perasaanmu setimpal dengan perasaannya. Kamu tidak perlu melupakannya, karena dia masih ada di sekitarmu. Sebaiknya kamu segera keluar dari posisi yang tidak enak dari kehidupannya. Caranya.. batasi hubunganmu dengannya.. buka matamu buat melihat sekitarmu. Masih banyak cowok yang bersedia menjadikanmu orang nomor satu bukan ke-dua. Jalin hubungan dengan orang-orang buat mengisi kekosongan hatimu. Dijamin kamu bisa segera keluar dari posisi yang tidak mengenakkan itu. Percayalaa.. masih banyak cowok yang bersedia memperlakukanmu dengan istimewa.. salam Tanya: Intan – Hp 6285275361xxx Assalamualaikum, mbak Fifi.. aku Intan pendatang baru aku ingin curhat sama mbak. gimana ya mbak caranya aku sama pacar bisa baikan lagi… Tanya: Gina – Hp 6285762243xxx Hallo mbak.. saya pengen balikan lagi dengan mantan… menurut mbak gimana? Jawab: Waalaikumsalam, dear intan dan Gina Pengen balikan dengan mantan..kenapa engga? Asal masing-masing masih punya kedekatan emosi dan perasaan.. mbak yakin masih bisa. Perasaan sayang pada mantan kadang sukar dihilangkan tidak semudah saat kita bilang putus… karena terbentuknya juga butuh waktu dan proses. Jadi coba kamu jalin komunikasi yang baik dulu dengan mantan. Take it slow.. tidak perlu terburu-buru buat ngungkapin kamu ingin balikan. Seiring berjalannya waktu kamu dapat melihat waktu yang tepat apakah dia masih layak buat dijadikan pacar atau hanya sebatas teman. salam Tanya: Sarina – Hp 6285760059xxx Assalamualaikum .Salam kenal, mbak saya Sarina di Subulussalam .. Mbak Sarina mau curhat kenapa ya Sarina punya pacar ,tapi selama pacaran .dia tu gak pernah nelpon .dia bilang enggak hobbi-an nelpon .Sarina enggak tau dia jujur apa gimana .. :( Mbak kasih solusinya donk Jawab: Waalaikumsalam, Dear Sarina salam kenal kembali Meskipun udah jadian.. tampaknya kamu dan dia belum terlalu dekat ya? Karena masih belum saling terbuka buat ngeluarin unek-unek yang terganjal dihati. Coba deh ajak ketemuan dan ngobrol terbuka tentang keinginanmu, apakah sama dengan keinginanya. Menurut dia orang yang pacaran seperti apa.. sama engga dengan yang kamu harapkan. Bisa aja menurut dia.. pacaran engga usah sering teleponan, kalau sudah ketemuan dsbnya. Coba ngomong bahwa kamu pengen diperhatikan dan berbagi dengannya. Buang sedikit gengsi bila ingin salingterbuka.Bukanuntukmemintanyaberubahkepribadiannya karena pacaran bukan buat mengubah dirimu atau dia jadi orang yang berbeda. Yang penting bisa saling menyesuaikan diri dan saling sayang sebagai pasangan. Semoga sukses salam Tanya: Ciiuy – Hp 628566303xxx Assalamualaikum mbak Fifi.. Mau tanya nih.. gimana cara kita menghilangkan rasa ke-egoisan kita terhadap seseorang yang kita sayang..? Seperti yang kita tau. Sifat egois dominannya susah dirubah.. tolong masukkannya y mbak.. :) Wassalam.. Jawab: Waalaikumsalam, Dear Ciiuy Sifat egois masih bisa diubah asal ada kemauan yang kuat dalam dirimu. Caranya kamu buat criteria sifat positif dan negatifmu. Nah.. sifat negatifmu mulai dikurangi sedikit demi sedikit. Memang tidak bisa langsung berubah .. tapi kadar ke-egoisannya menjadi berkurang dibanding sebelumnya. Masa sih berubah kearah kebaikan tidak mendapat dukungan. Pasti orang-orang disekitar yang menyayangimu akan memberi tanggapan positif dan jadikan itu pemacu semangatmu. Banyak koq orang yang dulunya gampang marah, temperament bisa berubah menjadi lebih sabar dan pemaaf.. asal ada kemuan yang kuat dari dalam diri. Dicoba ya semoga sukses..

pengusaha. Ayat (8), Para pihak dapat mengatur lain dari ketentuan dalam ayat

Bagi para pembaca yang ingin menanyakan seputar tentang ketenagakerjaan dapat mengirimkan pertanyaan melalui, HP:0811632554

(5) dan ayat (6) yang dituangkan dalam perjanjian.

Kupon Konsultasi

WASPADA Minggu 24 Januari 2013


Aktifkan Daya Pikir Anak, Cita Luhur Konsepkan Joy Learning School UNTUK meningkatkan daya cipta dan memacu semangat belajar pada anak-anak, PG/TK Cita Luhur mengenalkan berbagai macam ilmu pengetahuan dengan pendekatan nilai budi bahasa, agama, sosial, emosional, fisik, motorik, kognitif, bahasa, seni, dan kemandirian. Hal itu diungkapkan Kasek Cita Luhur, Ms. Joelin Lim seraya menyatakan setiap kegiatan dirancang sebagai upaya mengembangkan daya pikir dan peranan anak dalam hidupnya dimana kegiatan belajar dikemas dalam model belajar sambil bermain. "Sekolah Taman Kanakkanak Cita Luhur Jl. Supeno Simpang Juanda No.6 Medan tidak hanya memberikan keleluasaan bermain dan belajar pada anak melainkanmemaksimalkandaya pikir anak," ujarnya. Ms.Joelin juga mengungkapkan memaksimalkan daya pikir anak tentunya dengan berbagai metode pengajaran agar tidak hanya dapat mengenal, dan mengerti tentang Agama, Budi bahasa, Berhitung, Membaca (mengenal aksara dan ejaan), melainkan dapat memahami, karena dalam setiap kegiatan proses belajar dan bermain PG/ TK Cita Luhur juga menyelipkan kegiatan-kegiatan Bernyanyi, Bersosialisasi dalam lingkungan keluarga dan teman-teman sepermainannya, dan berbagai macam keterampilan lainnya. Dia juga mengungkapkan pendidikan anak usia dini merupakan jenjang pendidikan sebelum pendidikan dasar sebagai upaya pembinaan sejak lahir sampai dengan usia enam tahun yang dilakukan melalui pemberian rangsangan pendidikan untuk membantu pertumbuhan dan perkembangan jasmani dan rohani agar anak memiliki kesiapan dalam memasuki pendidikan lebih lanjut, yang diselenggarakan pada jalur formal, nonformal, dan informal. "Pendidikan anak usia dini merupakan salah satu bentuk penyelenggaraanpendidikanyang menitikberatkan pada peletakan dasar ke arah pertumbuhan dan perkembangan fisik (koordinasi motorik halus dan kasar), kecerdasan(dayapikir, daya cipta, kecerdasan emosi, kecerdasan


CERIT A ADIK Adik-adik, berikut Redaksi memuat cerita-cerita berkaitan tentang malaikat. Malaikat adalah makhluk Allah yang taat dan setia kepada Nya. Semoga bisa menambah wawasan dan menambah keimanan kita pada kekuasaan Allah SWT.

Jenazah Yang Dimandikan Malaikat spiritual), sosio emosional (sikap dan perilaku serta agama) bahasa dan komunikasi, sesuai dengan keunikan dan tahap-tahap perkembangan yang dilalui oleh anak usia dini," terangnya. Untuk itu, lanjutnya, keberadaan PG/TK Cita Luhur adalah untuk membentuk anak Indonesia yang berkualitas, yaitu anak yang tumbuh dan berkembang sesuai dengan tingkat perkembangannya sehingga memiliki kesiapan yang optimal di dalam memasukipendidikandasarserta mengarungi kehidupan pada masa dewasa. "Kemudian tentunya untuk membantu menyiapkan anak mencapai kesiapan belajar (akademik) di sekolah nantinya," ujar Ms. Joelin kembali. Cita Luhur tentunya, lanjut Ms Joelin adalah memberikan buku yang spesifik dan berkarakteryangcocokuntukparaanak usia dini, praktek atif, permainan lego dimana permainan ini selain mengasahotakutnukberfikirjuga diselingi belajar bahasa dan berhitung. “Karena ini merupakan sekolah berkarakter nasional sehingga muatan berbahasa Indonesianya lebih tinggi dimana tiga hari khusus mengenakan bahasa Indonesia dan dua hari berikutnya bahasa Inggris,” ujarya seraya menyatakan saat ini pendidikan anakdidukungdenganlimaruang belajar, satu perpustakaan, satu klinik, ruang out door sebagai tempat bernyanyi. Dalam waktu dekat juga, lanjutnya,haliniakanditingkatkan

kembali hingga sampai jenjang sekolah menengah atas. Sementara Konsultan Cita Luhur Agus menyatakan pendidikan di sekolah tersebut lebih menekankan tentang analisa, kreatifitas, kepekaan dan nurani. “Dengan penekanana ini anak-anak dirangsang untuk berpikir mencari data, kemudian menuliskan, serta memahami,” ujarnya. “Tujuannya adalah menyeimbangkan analisa, kreatifitas, kepekaan, dan nurani atau yang disebut aktif learning atau joy learning karena setiap awal maupun penyelesaian tugas disertaidenganpembacaandoa,” lanjut Agus kembali. • Hamzah

KEMUDIAN Abu Amir menghadap ke arah mayat anaknya, dan dengan sedih dia berkata : “Buah hatiku sayang. Dari semula telah kuperingatkan engkau akan bahaya ini. Ah, anakku, andaikata engkau mendengar nasihat orang tuamu, tentu engkau berbahagia dalam hidup…. Tentu engkau sekarang masih hidup bersama-sama bangsawan kaummu. Sungguhpun demikian, sekarang ayah mengharap agar engkau berbahagia juga. Kalau Allah memberi kebahagiaan kepada pahlawan perkasa ini (Hamzah) atau pahlawan yang lain di antara pengikut Muhammad, semoga engkau mendapat yang demiikian ….” Setelah itu dia berteriak dengan suara yang lantang: “Wahai kaum Quraisy, janganlah mayat Handhalah dicincang luluh, sekalipun dia telah menentang aku, orangtuanya, dan melawan kau…” Handhalah telah berada di alam yang lain, dia menjadi penghuni dunia yang fana’ ini. Mayatnya yang berupa tubuh kasar boleh berada di bumi dan dibuat sesuka hati musuhnya, dicincang lumat atau tidak, bukan soalnya lagi. Dirinya kini telah berada di taman Firdaus. bersambung **m31/Darul Nu’man

Cocok Tanam Meriahkan HUT TK Bhayangkari Memeriahkan HUT Bhayangkari, seluruh pelajar Sekolah Dasar (SD) Yayasan Kemala Bhayangkari gelar cocok tanam. Acara penyemaian pembibitan diselenggarakan oleh Ketua Yayasan Kemala Bhayangkari Ny. Untung Sudarto dan Tim Pengajar Taman Kanak-kanak, Kepsek Santaria Spd berserta tim pengajar lainnya. Dalam kata sambutannya, Ny Untung Sudarto menyatakan pendidikan hak seluruh anak begitu pula sekolah ini bukan hanya untuk kalangan anak polisi melainkan seluruh lapisan masyarakat.



WASPADA Minggu 24 Februari 2013

Studi Tour Ke PT Dirgantara Tingkatkan Wawasan GUNA lebih meningkatkan wawasan dan pengetahuan para siswa, pihak yayasan SMK Tritech Informatika di Jalan Bhayangkara Medan, mengadakan studi tour ke PT Dirgantara Indonesia di Bandung, 4 s/d 7 Februari lalu.

Waspada/Anum Saskia

Siswa SMKN 1 yang berhasil merebut juara 1,2 dan 3 dalam LKS Akutansi digelar Perguruan Panca Budi Medan, berpose bersama kepala sekolah.

LKS Akuntansi Asah Kemampuan Siswa SMKN 1 Medan sukses meraih kemenangan dalam Lomba Kompetensi Siswa (LKS) Akutansi Gemilang Prestasi Perguruan Panca Budi. Tim dari SMKN 1 yang terdiri dari empat orang siswa itu berhasil meraih juara secara berurut yakni juara 1,2 dan 3. Tentu saja kemenangan ini membuat pihak sekolah merasa senang dan bangga. Apalagi lomba ini memberi kesempatan pada siswa di program keahlian akutansi untuk bersaing dengan teman sebayanya. Para juara dari sekolah ini, Suwardani juara 1, ErniYuliana juara 2 dan Indriyani juara 3 ditemui kemarin mengakui jika kemenangan mereka ini sebagai bukti bahwa pelajaran yang didapatkan dari guru dapat mereka serap dengan baik. Apalagi, kata tiga cewek ini, waktu pengerjaan soal yang diberikan oleh dewan juri selama tiga jam, membuat merekaleluasamengerjakantugasdanmenelaahnya hingga hasilnya benar. “Lomba program keahlian akutansi ini bermanfaat buat siswa SMK, karena mengasah kemampuan kami dan lebih memberi kesempatan menilai kemampuan diri dengan penilaian orang lain. Saat lomba ada dewan juri yang menentukan bagaimana pekerjaan kita sebagai akuntan. Waktu yang diberikan cukup memadai untuk mengerjakan tugas yang diberikan. Sehingga hasil yang dicapai dari pengerjaan tugas serasa lebih maksimal,” kata Suwardani yang terpilih sebagai peserta LKS tingkat nasional dalam waktu dekat. Erni Yuliana dan Indriyani menambahkan,

lomba seperti ini hendaknya lebih sering dilakukan. Hal ini memberi kesempatan pada siswa program akutansi untuk mempertajam pengetahuannya. Sebab, kata dua remaja ini, dengan kegiatan lomba, setiap siswa akan terpacu untuk meningkatkan kemampuannya dan lebih mengasah kecerdasannya. “Akutansiinimemangtidaksulit,tetapiketelitian, keakuratan data dan kecepatan pengerjaan serta kebenaran dalam pengerjaan tugas sangat diperlukan. Kalau sering ikut lomba, secara otomatis membangun semangat siswa untuk belajar mempertajam kemampuanya. Lagi pula dengan perlombaan, kita semakin tau kemampuan yang kita miliki dan teman sebaya di jurusan yang sama,”kata Indriyani. Kepala SMKN 1, Dra Asli Sembiring MPd menyebutkan, prestasi siswa di sekolah ini semakin meningkat. Dia memberikan dukungan penuh bagi siswa yang meraih kemenangan dan berharap siswa lainnya ikut ambil bagian dalam program lomba. “Lomba mengasah kemampuan diri sekaligus menjadi ajang persaingan sehat bagi siswa, karena itu saya dan guru di sekolah ini mendukung sepenuhnya jika mereka akan berlomba. Kedepan, akan ada prioritas khusus bagi siswa yang menang lomba dan siswa yang terdaftar ikut lomba dalam berbagai event,”kata Asli sembiring yang tetap mengingatkansiswaagartidaklalaidenganpelajaran sekolahnya. * Anum Saskia

Ketua Yayasan Zulkifli S.Sos, Kepala Sekolah Supriyanto MI bersama wakilnya Guskandar S.Kom menyebutkan kegiatan studi banding ini sekaligus memberikesempatanpadasiswa untuk melihat secara langsung perusahaan penerbangan. Menurut catatan, Dirgantara Indonesia tidak hanya memproduksi berbagai pesawat tetapi juga helikopter, senjata, menyediakan pelatihan dan jasa pemeliharaan (maintenance service) untuk mesin-mesin pesawat. Dirgantara Indonesia juga menjadi sub-kontraktor untuk industri-industri pesawat terbang besar di dunia seperti Boeing, Airbus, General Dynamic, Fokker

dan lain sebagainya. Dirgantara Indonesia pernah mempunyai karyawan sampai 16 ribu orang. Karena krisis ekonomi yang melanda Indonesia, Dirgantara Indonesia melakukan rasionalisasikaryawannyahinggamenjadi berjumlah sekitar 4000 orang “Kami ingin siswa di sekolah ini memiliki wawasan terhadap industri nasional kita yang merakit komponen pesawat terbang. Perusahaan yang berdiri tahun 1976 tersebut bisa memberi gambaran pada siswa bahwa Indonesia memiliki SDM yang handal. Merekapun harus mempersiapkan diri agar tidak tertinggal dengan anak Indonesia lainnya,”kata Guskandar selaku wakil kepala sekolah. Siswa Tritech, sambung Guskandar dengan jurusan multi media dan teknik jaringan komputer,memangdipersiapkan untuk terjuan ke dunia kerja. Tetapi, banyak pula yang berminat untuk melanjutkan pendidikannya. Karena itu, dengan kegiatan studi tour ini diharapkan para siswa memiliki wawasan yang luas serta mendapatkan beragam ide yang mendukung


Kepala Sekolah SMK Tritech Informatika Medan, Supriyanto saat memberikan arahan pada peserta studi tour saat berkunjung ke PT Dirgantara. cita-cita mereka. “Meskipun saat berada di sana, semua pengunjung tidak bisa memasuki area perakitan secara bebas, namun bisa memberikan pengalaman baru bagi siswa. Hal ini bisa kami ketahui dari tugas yang diberikan kepada siswa berupa laporan

perjalananyangdiselesaikansiswa sekembalinya dari sana,” ujar Guskandar. Dia menambahkan, sebelumnyasiswasekolahinijuga melaksakan kegiatan yang sama ke Batam, Singapura dan Kuala Lumpur. Antusias siswa untuk ambil bagian dalam studi tour

ini membuat pihak sekolah menyiapkandanakhusussebagai persiapan bagi peserta. Tahun ini rencananya siswa dan guru akan mengikuti program studi tour ke China sebagai negara industri yang kini semakin maju pesat. * Anum Saskia

Futsal SIM Cup III


Tim fusal SMP Muhammadiyah 3 yang berhasil meraih juara pertama pada turnamen futsal Iskandar Muda Cup III yang berlangsung di Total Futsal Jalan DR Mansyur Medan belum lama ini.

SISWA SMP Muhammadiyah 3 Medan ukir prestasi dengan menjuaraiturnamenfutsalSultan Iskandar Muda Cup III yang dilaksanakan di lapangan total futsal Jalan DR Mansyur Medan belum lama ini. SMP Muhammadiyah 3 berhasil keluar sebagai juara setelah dalam partai final berhasil mengalahkan SMP Brigjend Katamso dengan skor 4-1. Dimana gol untuk SMP Muhammadiyah 3 masingmasing dicetak Fikri Almaida Tasrip dua gol, Emir Akbar Pais satu gol dan Prayogi satu gol. Selain berhasil keluar sebagai juara SMP Muhammadiyah juga berhasil menempatkan Ahmad Yowanda sebagai pemain terbaik dalam turnamen tersebut.

“Kemenanganinimerupakan suatu prestasi yang sangat membanggakan siswa dan sekolah kami berharap siswa dapat mempertahankan prestasi ini bahkan kalau bisa lebih ditingkatkan lagi, ujar menejer futsalSMPMuhammadiyahMifta Fariz MA di sekolah itu kemarin. Mifta menjelaskan saat ini SMP Muhammadiyah 3 Medan sedang giat-giatnya mengembangkan bakat siswanya khususnya di bidang sepak bola, hal ini ditunjukan dengan telah dibukanya SSB Hizbul Wathan (HW) di sekolah itu sebagai ajang untuk mengembangkan bakat siswa di bidang olah raga sepak bola. “Di sini kami membina para pesepak bola usia dini dengan

mendatangkan pelatih yang berlisensi PSSI, dan khusus bagi siswa SMP Muhammadiyah 3 dibebaskan biaya pembinaan,” ungkapnya. Selain itu Mifta juga menjelaskan saat ini ada empat siswa SMP Muhammadiyah 3 Medan yang lolos pada seleksi pertama Tim Asosiasi Sekolah Sepak Bola Indonesia (ASSBI) Sumut. Keempat siswa yang lolos pada seleksi pertama adalah Fikri Almaida Tasrip, Arianto Ahmad Fauzi, Ahmad Yowanda. Dan keempatnya akan bergabung dangan tim ASSBI Sumutyangakandiikutkandalam festival dan kompetisi nasional ASSBI di Jakarta pada 7-11 Mei 2013. * Erzil Markos

WASPADA Minggu 24 Februari 2013

B9 Remaja Siswa Wajib Laksanakan Shalat Dhuha MEMASUKI lingkungan Perguruan AlAzhar Medan pagi menjelang siang hari atau tepatnya pada pukul 11:00 suasana terlihat beda. Saat itu banyak dijumpai siswa yang berlalu lalang dengan membawa mukena dan sajadah.

Waspada/Erzil Markos

Khairi Syafira

Sunnah Yang Jadi Kewajiban SHALAT Dhuha meski merupakan shalat sunnah, namun bagi Khairi Syafira sudah menjadi suatu kewajiban,” Seperti ada yangkurangkalausayabelumshalatDhuhasetiapharinya,”ungkap siswa kelas VIII SMP Al-Azhar Medan ini. Setelah belajar selama 3 jam atau dua mata pelajaran terasa cukup lelah, namun fikiran kembali tenang dan segar setelah melaksanakan shalat Dhuha. Sehingga seperti ada energi baru untuk memulai pelajaran berikutnya, ungkapnya. Syafira menjelaskan kebiasaan shalat Dhuha di sekolah sangat membantunya dalam meningkatkan amal ibadah dan mendekatkan diri kepada sang pencipta. Karena dengan adanya kegiatan ini apa yang selama ini jarang kita laksanakan, kini menjadi suatu kewajiban sehingga kita menjadi terbiasa untuk mengerjakannya. “Sesuatu yang sangat menyenangkan adalah shalat ini dilaksanakan pada saat kita menimba ilmu pengetahuan di sekolah sehingga menambah tenang fikiran dan membuat konsentrasi dalam belajar lebih meningkat lagi, walau kita harus membawa mukena dan sajadah setiap harinya ke sekolah,” ungkapnya. Erzil Markos

Ya....pada jam-jam tersebut tepatnya saat bel tanda istirahat berbunyi seluruh siswa tanpa dikomandoi berbondong-bondong menuju Masjid Ar-Rahmah yang berada di komplek sekolah itu untuk melaksanakan shalat Dhuha,sehinggasuasanalayaknya bak di pesantren. Pendidikan agama merupakan dasar untuk menciptakan moral dan sikap yang baik, untuk mewujudkansuasanabelajardan proses pembelajaran agar peserta didik mampu mengembangkan potensi dirinya untuk memiliki kekuatan spiritual keagamaan, pengendalian diri, kepribadian, kecerdasan, akhlak mulia, serta keterampilan yang diperlukan dirinya, masyarakat, bangsa dan negara. Halitulahyangsaatinisedang digalakkan di lingkungan Perguruan Al-Azhar Medan yang mengenalkan agama sejak dini sekaligus untuk mengamalkannya. Setiap hari saat jam istirahat seluruh siswa secara rutin melaksanakan shalat Dhuha dan membacasuratYasinyangdilaksanakan di masjid sekolah itu.

Selain para siswa, guru dan karyawanlainnyapunikutmelaksanakan shalat Dhuha tersebut. Kepala SMP Al-Azhar Medan Drs AgustonoMAmengatakan,shalat Dhuha ini rutin dilakukan setiap hari dengan harapan agar siswa terbiasa melaksanakan shalat sunnah. Di samping itu, siswa juga diharapkan mampu menanamkan nilai-nilai agama dalam kehidupan sehari-hari agar bisa berperilaku baik dan bermoral sesuai dengan visi misi perguruan AlAzhar Medan yaitu menciptakan intelektual muslim dan muslim yang intelektual. “ShalatDhuhadanmembaca surat Yasin ini dilakukan setiap hari, agar siswa terbiasa dan mengerticaramelaksanakannyabaik secara bersama-sama maupun sendiri-sendiridirumahmaupun di sekolah. Sistem pengerjaannya secara bergantian antara perempuan dengan laki-laki hal ini mengingat kapasitas masjid yang tidak memungkin untuk menampungseluruhsiswasekaligus, “ katanya. Menurut Agustono, untuk

Waspada/Erzil Markos

SISWA SMP Al-Azhar Medan melaksanakan shalat Dhuha di masjid di sekolah itu, kegiatan ini wajib dilaksanakan siswa setiap jam istirahat. menanamkan nilai-nilai agama dalam diri siswa, pihaknya memang mewajibkan siswa melaksanakan shalat berjamaah di sekolah setiap harinya, tidak hanya shalat Dhuha, namun juga shalat wajib seperti shalat Zuhur,

Atasi Kecanduan HP Dan Games MELAKUKAN hal yang kita sukai kadang memang bikin ketagihan. Tapi, jangan sampai kecanduan. Soalnya bukan berpotensi dijauhi teman saja, tapi juga bisa menganggu jiwa. Kecanduanadalahkeinginan akan keterlibatan terus menerus pada sesuatu atau seseorang yang enggak bisa dikontrol. Tapi, kalau udah mengetahui efek buruknya dan tetap enggak bisa berhenti melakukannya, berarti kita sudah kecanduan terhadap sesuatu. Kecanduan Social Media Setiap bangun tidur, hal pertama

yang kita lakukan adalah ngecek hape. Ketika enggak ada BBM atau balasan tweet dari teman, kita mendadak bête. Buat kita update status, foto, atau lokasi kita di berbagai jejaaring sosial itu wajib. EnggakCumadiTwitter, tapi juga di FB, Instagram dll. Dampak negatif : Terlalu sering dan detail saat mengupdate status atau lokasi keberadaan kita berpotensi jadi sasaran kejahatan. Misalnya, meng-update lokasi rumah dengan alamat yang super-lengkap. Bisa ajakan, alamat rumah tersebut disalahgunakan oleh orang lain dan

mengakibatkankerugianbuatkita dan keluarga. Cedera otot : Terlalu sering mengetik di smartphone atau gadget lainnya bisa membuat kita cedera pada urat otot ibu jari serta sendi tangan jadi kesemutan, nyeri, sampai mati rasa. Anti sosial : Saat lagi ngumpul bareng teman atau keluarga, kita malahasyikmenataplayargadget. Akibatnya kita malah jadi enggak akrab sama orang-orang di sekitar. Enggak pengin kan diprotes gara-gara sibuk sama aktivitas dunia maya?

Ashar dan shalat Jumat. Inidikarenashalatberjamaah mempunyainilai27kalidarishalat sendiri-sendiri, selain itu dalam enam bulan sekali siswa juga melaksanakanmalamibadahdan zikir bersama yang dirangkai

dengan shalat tahajjud. “Ini masuk ke dalam program pendidikan kegamaan di Perguruan Al-Azhar Medan dan kegiatan ini sepenuhnya mendapat dukungan pihak yayasan, maupun orangtua siswa, bagi

yang tidak melaksanakan shalat Dhuha kecuali dengan alasanalasan tertentu akan kita berikan sanksi.” ungkapya.

Cara mengatasi : Batasi update status. Kalau biasanya setiap lima menit kita update status, bikin jadwal buat diri sendiri. Matikan gadget. Kurangi penggunaannya. Coba mematikan gadget atau setidaknya jauhkan dari tangan kita saat berkumpul dengan keluarga atau teman. Ini juga membuat jari kita bisa beristirahat denan cukup. Kecanduan Games Enggak mau beranjak dari layar computer, TV, sampai lupa tidur, makan, dan ngerjain tugas. Apalagi interaksi sama orang lain. YangadadiotakkitaCumagimana caranya menamatkan level di games yang sedang dimainkan. Benar-benar pekerjaan sia-sia.

Dampaknegatif :Nilaisekolah menurun, sangkin asyiknya main game, fokus kita akan hal lain jadi menurun. Kita jadi enggak konsentrasi saat guru menjelaskan pelajaran. Tugas sekolah pun keteteran,saatulanganjadienggak tahu mau menjawab apa. Radiasi otak : Menatap layar TV, computer selama berjamjam bisa mengakibatkan radiasi yang merusak saraf mata dan mengurangi fungsi otak. Gangguan jiwa : Saking kecanduannya, kalau dilarang main games sama orangtua, kita enggak bisa mengontrol emosi. Kalau dibiarkan, jiwa kita terganggudanjadiagresifsamaorang sekitar sehingga memerlukan

perawatan khusus. Enggak realistis : Gara-gara sering berkutat dengan kehidupan fantasi di games, kita jadi membawa kebiasaan di sana ke hari-hari kita. Misalnya, kalau sering main games balap mobil, kita jadi hobi ngebut di jalanan karena merasa seperti di games. Cara mengatasi : Secara perlahan coba kurangi instensitas bermain games. Kalau biasanya kita menghabiskan waktu sampai lima jam, kurangijadiduajam.Carikegiatan baru seperti hobi baru lainnya yang bisa dilaukan di luar rumah atau bersama teman-teman baru. m31

*Erzil Markos



Puisi Puisi

Terluka Cerpen

Hanya Tuhanlah yang tahu pasti Apa gerangan yang bakal terjadi nanti Begitu buruk tlah kau perlakukan aku Ibu menangis lah demi anakmu Sementara aku tengah bangganya Mampu tetap setia meski banyak cobaan Begitu tulusnya kubuka tangan ku Langit mendung gelap malam untukku Ternyata mengagungkan cinta Harus ditebus dengan duka lara.... Tetapi akan tetap kuhayati hikmah sakit hati ini Sudah sempurnakah kekejamanmu Petir menyambar hujan pun turun Di tengah jalan sempat aku merenung... Masih adakah cinta yang disebutkan cinta Bila kasih sayang kehilangan makna LIANA merenungi makna lagu “Seberkas CintaYang Sirna” bait demi bait, sama seperti yang dirasakannya ketika Andre tidak mempedulikan hati itu lagi. Menangis, hanya itu yang mampu dilalukan Liana. Andre telah menghancurkan perasaan Liana. Hati itu telah “terluka”. Luka itu semakin menambah hati Liana tertutup rapat untuk ruang yang lain. Hari demi hari Liana coba untuk meyakinkan hatinya pada Andre, apakah ini cinta atau hanya untuk mengisi kekosongan hati saja. Yang sampai suatu hari Liana sempat merasakan rindu yang tak terbendung. Akhirnya Liana meyakinkan dirinya, apa yang dirasakannya terhadap Andre adalah “cinta”. Namun saat bersamaan Liana juga berusaha untuk tidak egois menurutkan kata hatinya. Dalam perjalanan hari demi hari itu pula hati Liana sempat begejolak, antara ingin melepas demi kebahagiaan Andre dan mempertahankan hubungan kasih mereka. Ternyata untuk melepas orang yang disayangi begitu sulit, apalagi hati ini belum siap, butuh pengorbanan

Karya: Adhiet’s Ritonga


Masih sanggup untuk kutahankan Meski telah kau lumatkan hati ini Kau sayat luka baru di atas luka lama Coba bayangkan betapa sakitnya

hati yang harus ditebus dengan airmata. Berkali-kali Liana sempat terpikir mempertimbangkan keputusannya untuk orang yang disayanginya itu. “Apakah aku harus melepasmu Andre? Semakin aku menyayangimu, semakin ku harus melepasmu dari hidup ku. Oh Tuhan... begitu beratnya situasi ini,” tangis Liana. Cinta dan sayang tidak harus memiliki, kata-kata itu terus tergiang di telinga Liana. “Rencana hanya milik kita, semua ketentuan kita serahkan kepada Allah. Namun aku akan menyayangimu sampai kapanpun Liana, meski kita tidak dapat bersatu, kamu bukan orang lain lagi bagiku,” kata Andre suatu hari. Berhari-hari Liana memikirkan kata-kata itu dan mencoba untuk berbesar hati. “Tidak mengapa Andre mungkin hanya impian ku yang terlalu besar untukmu, semestinya aku menyadari itu semua. Kebahagiaanmu jauh lebih penting dari pada keegoisanku menuruti kata hati ini, meski aku tahu untuk menghadapi situasi ini akan membutuhkan waktu yang tidak sebentar, namun demi kebahagiaanmu

WASPADA Minggu 24 Februari 2013

Seribu Kupu-kupu apapun itu, mungkin waktu yang terus bergulir akan menjawabnya. Biar lah hati ini begitu Andre, dan biarkanlah hati itu terus menangis hingga dia lelah,” tangis Liana lirih. Ingin rasanya aku mendengar kata-kata kebencian dari mulut Andre untukku tentang rasa ini untuknya dan inginnya aku agar Andre memaki ku hingga aku tersadar untuk bisa membencinya. Aku sempat terpukul, saat Widya mengaku mencintai Andre. “Aku mencintai Andre Liana,” katanya padaku jujur. Keterusterangan Widya itu membuat naluri ku sebagai wanita merasa terenyuh. Lama aku terdiam yang akhirnya aku harus berbohong pada Widya tentang perasaan ini pada Andre, meski hati ini sakit, namun dengan berat hati ku coba lagi untuk berbesar hati, karena aku telah memaknai apa artinya kehilangan. Aku juga sempat terpikir, mungkin inilah cara agar aku bisa membencinya. Namun, rasa sayang itu ternyata lebih besar dari pada harus membencinya. Benar kata orang bijak, bila kau menyayanginya, kau tidak akan sanggup membencinya sebab cinta itu adalah anugrah bagimu. “Ya Tuhan, kalau boleh aku jujur, aku tidak mau kehilangan dia, aku ingin tetap bersamanya meski cinta itu tak bisa bersatu. Meski satu sisi aku ingin membencinya, tapi kenapa hati ini tidak bisa melakukan itu,” keluh Liana. Kini hati Liana terasa kosong seperti yang pernah dirasakannya setelah kehilangan orangorang dicintainya. Dan saat ini hati itu kembali hampa. Tapi itu lah perjalanan hidup yang harus dilalui Liana. Liana pernah berharap Andrelah laki-laki yang diam-diam pernah dikaguminya bertahuntahun lalu meski tidak sempat terjalin kasih di antara mereka. Liana sempat berharap sosok laki-laki yang juga pernah diharapkan ibunya jadi calon mantunya ini akan menuntunnya

Kupu – kupu jingga Liar di taman Kupu – kupu hitam putih Menempel di dinding Kupu – kupu malam Lelah memberi kehangatan Kupu – kupu pelangi Indah di setiap kilaunya

Aprillia Momentum Cukup kubahagia Meski tak ada terompet ditiup Atau nyala lilin berkilauan Apa lagi kue tart berbalut coklat Kesukaanku Karya: M Luthfi Naufal


seperti pesona kepribadian yang pernah disukai ibunya, bahkan menyayangi Andre seperti anaknya sendiri. Kini telah melukai hati anaknya. Liana sejenak mengenang ibunya. “Kalau saja ibuku masih hidup pasti ibu akan memelukku erat-erat dengan kasihnya, dengan sabar mendengarkan semua apa yang menjadi kesedihanku. Dan aku akan berlindung di bawah ketiak ibu seperti yang dulu selalu kulakukan bila aku sedih atau melakukan kesalahan sebagai tanda maafku untuknya. Ibuuuuuu....., aku sudah kehilangan semua orang-orang kucintai, tangisku terisak ingin menghilangkan beban yang kurasakan begitu berat.” “Jangan bersedih kak,” ujar Maya, membangunkan dari lamunanku sambil mengusap airmata. “Kakak hanya mengenang ibu, May. Bila saja ibu masih ada, dia tidak akan membiarkan kakak seperti ini,” isak ku sambil menggenggam kuat kedua tanganku menahan gejolak itu. Maya tau, setelah pertemu-

an ku dengan Andre hari-hariku begitu ceria, senyum kebagiaan saat mengenang kebersamaan bersama Andre, saat Andre menelepon, saat Andre mengatakan sayang, saat Andre mempedulikan aku, bahagianya aku. Sampai pada akhirnya senyum itu kembali berubah menjadi mendung. “Kakak masih punya Maya sebagai adik yang siap mendengar semua apa yang menjadi beban yang kakak rasakan,” ungkap Maya mencoba menghiburku. Aku sedikit lega dengan ucapan Maya itu. “Aku tau dan memahami, kakak ingin mencoba bangkit dari kesedihan yang pernah kakak alami. Dan aku juga tau persis bila kakak menyayangi seseorang. Tapi berusahalah tegar dan sabar, karena aku yakin, Andre juga menyayangi kakak, mungkin hanya karena keadaan saja yang mengharuskan begitu,” ucap Maya. Kupandangi wajah Maya saat berucap itu padaku, ada ketulusan yang dalam dari sorot matanya.Yach.... Maya memang bukan orang lain bagiku, bah-

kan dia selalu membantuku di setiap masalah yang menyertaiku. Rumah Maya adalah rumah kedua bagiku setelah aku ditinggal orang-orang yang kucintai. Maya sudah seperti adik kandungku sendiri sejak 25 tahun yang lalu aku mengenalnya. Bahkan Maya adalah orang yang paling mengerti semua sisi kehidupanku. Aku tetap berharap hubungan kasih itu tetap menjadi bagian hidup ku, semua kukembalikan kepadaMu Ya Allah, Engkau yang Maha mengetahui perjalanan hidup setiap hambaMu. “Aku berserah diri kepadaMu, karena Engkaulah yang Maha Tahu apa yang kurasakan dari semua kesedihan ku. Aku tidak tau apa hikmah setelah Engkau mempertemukan kami kembali, yang sempat membuat aku punya impian indah. Aku mohon Engkau menuntun hati ini ke jalanMu, maafkan aku yang mungkin telah melalaikanMu karena aku telah lebih banyak menghabiskan waktu hanya untuk keegoisan hatiku. Maafkan aku ya Rahman......maafkan aku...”

Baca... baca... bacalah !!! Ini perintah! Bukan cuma sekedar imbauan Tapi perintah dari Yang Maha Mengetahui dan pemilik ilmu Bacalah...! Semua ilmu yang ada di seluruh alam semesta dan isinya Bacalah...! Ini perintah yang wajib dilaksanakan perintah kepada makhluk yang bernama manusia yang diciptakan dengan sebaik-baik bentuk dan memiliki akal pikiran maka... Bacalah dan pikirkanlah! Manusia akan menjadi tahu untuk apa dia diciptakan dan dihadirkan di muka bumi ini Karya: Jul Mara Pidona

Buku, Guru Terbaikku Lembaran demi lembaran ku buka lalu ku baca betapa banyak hal yang tidak ku ketahui betapa banyak hal yang menarik hati Buku... Kau guru terbaikku Kau paparkan semua wawasan yang tak pernah kami ketahui Kau terangkan semua agar kami tahu agar kami pintar dan jadi pelajar yang penuh dengan beribu wawasan

Pariwisata Rambutan Binjai Berjaya Di Mekarsari


Minggu 24 Februari 2013

RAMBUTAN Binjai asal Binjai, Sumatera Utara kembali Berjaya di Taman Wisata Mekarsari, Cilengsi, Bogor, Jawa Barat. Buktinya selama Februari, Mekarsari menggelar tur Rambutan Binjai dengan respon luar biasa dari masyarakat. Tur rambutan tersebut berlangsung sejak 24 Januari sampai dengan 28 Februari 2013. Dalam tur ini, pengunjung digiring ke dalam dunia rambutan dari awal memasuki Mekarsari hingga pulang. Nama programnya “Booking Pohon Rambutan” dengan tagline asyiknya memanen satu pohon rambutan, sensasi di kebun sendiri. Harga tur booking pohon rambutan terbagi dalam dua jenis, yakni Rp650.000/5 orang untuk pohon dengan buah yang lebat dan Rp450.000/5 orang dengan pohon berbuah sedang. Menurut Marketing Manager Mekarsari, Indra Dewi pada acara “Media Gathering” di TamanWisata Mekarsari, dalam paket tersebut pengunjung diberikan satu pohon rambutan Binjai (30-50 Kg), air mineral 600 Ml, souvenir, dan fruity world tour. Paket lainnya, paket memanen sekeranjang rambutan langsung dari pohonnya dengan harga tur Rp30.000 per orang sudah termasuk tiket kereta keliling, masuk wahana kebun rambutan, dan panen rambutan satu keranjang atau 1 Kg, dan air mineral.. Public Relations Manager Mekarsari, Putri Ayu Pratami menambahkan untuk program panen rambutan, Mekarsari menyediakan 200 pohon Rambutan Binjai. “Pohon Rambutan Binjai dipilih karena pohonnya tidak terlalu tinggi, sehingga pengunjung tidak perlu bersusah payah memanjatnya,” terangnya. Mekarsari kini memiliki sekitar 25 koleksi rambutan. Selain Rambutan Binjai juga ada Rambutan Aceh Kering Manis,

TUR Rambutan Binjai di Mekarsari.

TUR panen Rambutan Binjai.

Rambutan Mubin, Rambutan Aceh Lebak, Rambutan Narmada, Rambutan Aceh Lengkeng, Rambutan Sibatuk, Rambutan Sikoneng, Rambutan Kilitik, dan lainnya. “Kali ini rambutan yang dipanen, utamanya Rambutan Binjai. Tapi ada juga Rambutan Aceh Lebak dan Rambutan Simacan yang dapat dijadikan pilihan pengunjung untuk dipanen,” tuturnya. Pengunjung yang membeli paket tur rambutan ini sebelumnya melakukan reservasi melalui website Mekarsari atau datang langsung menuju area informasi Family Tour. Yang menarik dari paket tur ini, juga ada tambahan kejutan lainnya berupa Grebek rambutan, yakni sebuah kejutan untuk pengunjung yang sedang bersantai di areal danau setiap hari Minggu, dimana ada petugas Mekarsari yang berseragam petani menggunakan gerobak menjual paket rambutan Binjai dengan harga Rp2.000/Kg dan dengan waktu yang terbatas. Sementara harga normal Rambutan Binjai itu Rp20.000/Kg. Ada lagi Surprise Train, setiap Minggu pengunjung akan mendapatkan kejutan yang bisa ditemukan pada kursi yang diduduki di dalam kereta. Hadiah berupa buah rambutan dapat ditukarkan di stan Family Tour. Dan juga Clown Sabotage, dengan menaiki kereta keliling pengunjung yang beruntung akan merasakan sensasi “pembajakan” kereta oleh para karakter buah Mekarsari. Secara mendadak kereta akan diberhentikan di tengah jalan dan para clown akan memberikan tanda cintanya berupa seikat buah rambutan dan souvenir Mekarsari kepada seluruh pengunjung yang ada di dalam kereta. Sedangkan pada kegiatan special fruit show, Mekarsari menghadirkan program fun science bertema rambutan selama bulan Februari,


LOMBA mengupas Rambutan Binjai. seperti praktik kromatografi, yakni menguji klorofil pada daun dan kulit rambutan, menguji kandungan vitamin C pada buah rambutan, praktik pembuktian listrik pada buah rambutan, dan lain sebagainya. Jadwal Panen Buah Kalau Anda pecinta buah, wisata ke taman buah saat panen akan jadi kepuasan tersendiri. Mekarsari memiliki jadwal panen selama setahun. Mekarsari memiliki kebun buah tropis terlengkap di dunia.

Dalam area seluas 264 hektar, terdapat beragam buah yang siap dipanen pada bulan tertentu. Selama tahun 2013 ini, di Mekarsari nama bulan diganti menjadi nama buah, sesuai dengan yang sedang panen. Bulan Januari diganti menjadi bulan durian karena buah yang dipanen di bulan itu adalah durian. Sedangkan Februari adalah rambutan, Maret adalah jambu biji dan April adalah belimbing. Kemudian Mei adalah bulannya

jeruk. Bulan Juni akan panen jambu bol, Juli bulannya melon sedangkan Agustus penuh dengan nangka. Kalau Anda suka sawo, datang saja pada bulan September karena sedang panen besar. Kalau gemar buah lengkeng, datang di bulan Oktober. Sementara salak dipanen pada bukan November. Sedangkan Desember adalah bulan panennya aneka buah langka, seperti buah rambai. Naskah & foto: Adji K.

Berwisata Ke Kota Rambutan, Binjai MENCICIPI Rambutan Binjai memang bisa di mana saja. Pohon dan buahnya sudah menyebar ke sejumlah daerah dan kota di Jawa dan pulau lainnya. Tapi kalau menikmatinya di tempat asalnya yakni Binjai, Sumatera Utara. Hmmmm.., jelas menawarkan atmosfir lain. Kendati Rambutan Binjai sudah ada di kota lain tetap saja, julukan Kota Rambutan di Indonesia tetap disandang oleh Binjai. Pasalnya kota ini sebagai sentra penghasil Rambutan Binjai terbesar, melebihi kotakota lain yang ada di seluruh Indonesia. Produksi Rambutan Binjai dari kota ini mencapai sekitar 2.400 ton per tahun dari lahan seluas sekitar 425 hektare. Umumnya usaha perkebunan rambutannya dilakukan oleh penduduk secara tradisional. Kota Binjai berada di bagian Utara Sumut atau 22 Kilometer di sebelah Barat Kota Medan. Kota ini berbatasan langsung dengan Kabupaten Langkat di sebelah Barat dan Uutara, serta Kabupaten Deli Serdang di sebelah Timur dan Selatan. Konon, Kota Binjai berasal dari sebuah kampung kecil yang terletak di pinggir Sungai Bingai. Upacara adat dalam rangka pembukaan Kampung tersebut diadakan di bawah sebatang

POHON Rambutan Binjai.

SENSASI memetik Rambutan Binjai di kebunnya langsung. pohon Binjai yang besar dan rindang serta tumbuh di pinggir Sungai Bingai. Di sekitar pohon Binjai yang besar itulah kemudian dibangun beberapa rumah yang lama-kelamaan menjadi besar dan luas. Kawasan itu lalu berkembang menjadi bandar atau pelabuhan yang ramai di-

datangi oleh tongkang-tongkang dari Stabat, Tanjung Pura, dan Selat Malaka. Hingga akhirnya nama pohon Binjai tersebut melekat menjadi nama Kota Binjai. Kalau datang ke Kota Binjai saat musim rambutan tiba, Anda akan melihat pemandangan pedagang rambutan di

sepanjang jalan masuk kota. Para pedagang rambutan tersebut berjualan di tempattempat yang sudah dibangun oleh pemkot setempat sehingga memberi kenyamanan saat menyantap rambutan. Atau bisa juga membawa rambutannya sambil keliling kota melihat bangunan tua dan

Tugu Perjuangan 1945 yang menjadi perlambang pintu gerbang Kota Binjai menyambut kedatangan anda yang datang dari luar kota. Pilihan lain menikmati Rambutan Binjai di Pantai Indah SB yang ramai dikunjungi wargai Binjai dan sekitarnya terutama pada akhir pekan. SB merupakan singkatan dari nama orang, Suherman Bangun. Dialah yang mengelola lokasi ini. Dulunya Pantai Indah SB hanyalah sebuah sungai biasa, kini ia menjadi objek wisata menarik. Daya tarik utama Pantai Indah SB adalah lokasinya yang masih alami. Sungainya tersembunyi di balik perkebunan sawit. Air yang mengalir dari Sungai Begulda sangat sejuk dan bening. Banyak pengunjung yang berenenang menggunakan ban. Letaknya sekitar 6 Km dari pusat kota. Binjai merupakan salah satu tempat transit bagi wisatawan yang ingin menuju ke kawasan wisata Bukit lawang di kawasan Taman Nasional Gunung Leuser di Kabupaten Langkat yang berjarak 68 Km di Barat Laut Binjai. Bukit Lawang juga merupakan daerah konservasi mawas Sumatera atau orang utan merah. Naskah & foto: Adji K.

CIRI dan bentuk fisik Rambutan Binjai

Keunggulan Rambutan Binjai RAMBUTAN Binjai bukan saja berjaya di daerahnya. Di luar Sumut, permintaan rambutan ini terus menanjak. Soalnya, buah berambut ini memiliki banyak keunggulan ketimbang jenis lainnya. Kendati tak sesohor rambutan rapiah atau lebak, varietas ini memiliki banyak keunggulan dibandingkan jenis lainnya. Tohir Amir (50), petani Rambutan Binjai di Jakarta Selatan mengatakan, Rambutan Binjai memiliki daging buah yang tebal dan padat kenyal, buahnya juga gampang ngelotok dan rasanya manis. Secara fisik Rambutan Binjai memiliki rambut yang panjang dan kasar, tetapi tumbuh agak jarang di bagian kulitnya. Warna kulitnya yang merah legam. Menanam Rambutan Binjai juga terbilang mudah. Yang menggiurkan lagi, pekebun Rambutan Binjai dapat meraup omzet ratusan juta hingga miliaran rupiah setiap kali panen di lahan puluhan hektar. Dengan pelbagai kelebihannya itu, Rambutan Binjai pantas menjadi primadona baru pecinta buah yang masuk famili Sapindacaeae ini. Terlebih, walau memiliki banyak keunggulan, harga jual Rambutan Binjai tidak jauh berbeda dengan jenis lainnya. Menurut Tohor lagi, sekarang sudah banyak penyedia bibit Rambutan Binjai mengingat banyak pesanan bibit pohon itu yang ikut-ikutan meningkat. Bahkan ada penyedia bibit Rambutan Binjai yang menjual sampai 3.000 bibit Rambutan Binjai per bulannya. Harganya mulai dari Rp10.000 sampai Rp 100.000 per pot tergantung usia bibit. Alasan utama mengapa bibit pohon Rambutan Binjai digandrungi masyarakat karena cara menanamnya terbilang praktis dan sederhana. Sama dengan rambutan jenis lainnya. “Pohon Rambutan Binjai tumbuh dan berbuah baik di dataran rendah hingga ketinggian 500 di atas permukaan laut dengan tipe iklim basah,” jelasnya. Keunggulan lainnya varietas Binjai yang “cocok” ditanam dalam pot atau disebut tanaman buah dalam pot (tabulampot). Alasannya lebih cepat berbuah dibandingkan varietas lain. Apalagi jika bibitnya berasal dari okulasi yang bisa berbuah kurang dari setahun. Varietas Binjai juga memiliki keindahan tersendiri. Ia memiliki 4 – 5 cabang dan karena itu lebih rimbun. Tabulampot untuk Rambutan Binjai setinggi 60 – 75 cm dengan diameter pot sekitar 50 – 60 cm, pot dijaga agar pembuangan air penyiraman lancar. Kelemahannya, tabulampot sangat sensitif terhadap media tanam yang memadat, yang mengakibatkan daun cepat mengering lalu rontok. Solusinya, disarankan menggunakan media tanam berupa pupuk kandang seluruhnya. Lebih baik lagi jika pupuk kandang tadi diberi insektisida Furadan 3 G sebanyak 100 gram per pot. Ini untuk mencegah serangan hama. Naskah & Foto: Adji K.



WASPADA Minggu 24 Februari 2013

Sharapova Promosi Pulau Jawa PETENIS Maria Sharapova (foto) tampil sebagai model sampul majalah wisata Rusia dengan latar belakang matahari terbenam di Candi Borobudur. Sharapova tampil cantik di majalah Conde Nast Traveller edisi Maret 2013 dengan serangkaian foto dirinya dengan latar belakang tempat-tempat wisata di Indonesia. Gambar-gambar ini diambil pada November lalu saat peringkat ketiga WTA itu mengunjungi Pulau Moyo maupun Candi Borobudur di Jawa Tengah. Dalam akun Facebook miliknya, Sharapova pun menuliskan pesan bagi pembaca. “Saya tampil di sampul Conde Nast Rusia dengan gambar-gambar dari (Pulau) Jawa, Indonesia. Saya harap Anda dapat kesempatan berkunjung ke sana. Sebuah tempat istimewa dengan pengalaman spiritual dan budaya serta orang-orang yang ramah,” kata Masha, Rabu (20/2). “Ini merupakan gambar-gambar favorit saya dari Conde Nast. Saya senang dengan baju-bajunya dan akan saya kenakan dalam kehidupan sehari-hari,” lanjut mantan ratu tenis dunia itu. Sharapova baru saja kembali dari Qatar Terbuka, pekan lalu. Sayang, Sharapova hanya mampu bertahan sampai semifinal sebelum disingkirkan peringkat satu dunia asal Amerika Serikat (AS), Serena Williams. (m33/ms)

Cekal Berakhir Slank Konser Bareng Polisi DALAM kurun waktu 2008 - 2012, lebih 10 konser Slank dicekal oleh pihak kepolisian. Akibatnya, Slank mengalami rugi besar. Kemudian Slank mengajukan gugatan uji materi ke Mahkamah Konstitusi terhadap UU No. 2 Tahun 2002 tentang Kepolisian Negara Republik Indonesia, khususnya Pasal 15 UU Ayat (2A) tentang Izin Keramaian. Alasannya, mereka sering dilarang konser karena dianggap kerap berujung kericuhan. Namun setelah berdialog dengan pihak Mabes Polri, personel Slank sepakat mencabut gugatan uji materi tersebut. Menurut Bimbim, daripada meng-

habiskan waktu untuk melakukan sidang gugatan, lebih baik grupnya bekerjasama dengan kepolisian melakukan kegiatan bersama, seperti penyuluhan narkoba. "Insya Allah kami berencana mengadakan konser bersama dalam waktu dekat," kata Bimbim di Mabes Polri, Jumat (22/2). Vokalis Slank, Kaka, menyatakan, konser bersama itu untuk menunjukkan bahwa tidak ada lagi masalah antara grupnya dan pihak kepolisian. Dengan demikian pencekalan terhadap Slank telah berakhir. "Itu buat menjawab bahwa tidak ada masalah dengan pencekalan," ujar dia. Sementara gitaris Slank, Abdee mengaku khawatir dengan kondisi politik di Indonesia saat ini. Menurutnya, suhu politik sekarang memudahkan pihak-pihak tertentu meman-

faatkan keadaan dengan mendekati Slank. "Sekarang, suhu politik lagi panas. Banyak pihak yang memanfaatkan ini dengan mendekati Slank," kata Abdee. Sebenarnya, kata Abdee, pihak-pihak yang mendekati Slank bisa menjadi kekuatan tambahan untuk mereka. Namun Slank tak mau memanfaatkannya. "Kami tahu akan ada kekuatan yang besar kepada Slank. Kami memutuskan belum saatnya Slank ajukan judicial review," kata Abdee.

PERSONEL Slank (kiri ke kanan) Abdee, Bimbim, Ridho, Kaka, didampingi Kabag Penum Humas Mabes Polri Kombes Pol. Agus Rianto, Ivan dan Manajer Slank Bunda Iffet, usai memberi keterangan kepada wartawan mengenai pencabutan gugatan Uji Materi UU No. 2/2002 tentang Kepolisian Negara Republik Indonesia di Mabes Polri, Jakarta, Jumat (22/2).

Alasan keamanan Sebelumnya, Polda Metro Jaya beberapa kali tidak memberikan izin konser kepada Slank, di antaranya di kawasan Tangerang. Hal ini karena alasan keamanan. Meski demikian, polisi juga mengklaim pernah beberapa

kali memberikan izin konser band yang sudah berdiri 29 tahun itu. "Sebetulnya jika ada jaminan tidak akan rusuh dari masing-masing penyelenggara konser, yang terlibat dalam konser, ya silakan saja," ujar Kepala Bidang Humas Polda Metro

Dicky A. Siregar Tersingkir KONTESTAN bersuara unik, Dicky Adam Siregar, tersingkir dari X Factor Indonesia (XFI), Sabtu (23/ 2) dinihari. Kendati sudah berjuang maksimal di Gala Live Show plus babak tambahan Save Me Song (SMS), pemilik suara Countertenor atau Castrato yang mirip dengan suara perempuan ini, kalah bersaing dengan grup vokal Ilusia Girls . Dicky dari kategori Boys yang dimentori Anggun, sebenarnya tampil memukau dengan mengusung hits Nirvana, Smells Like Teen Spirit. Tak pelak pria berambut gondrong ini mendulang pujian dari empat juri. Bahkan, menyusul standing ovation dari Anggun – sang mentor, juri Bebi Romeo berkomentar, “Malam ini saya melihat penyanyi profesional, aransemen juga profesional. Kalaupun kalah, kamu jadi sesuatu buat musik Indonesia.” Sayangnya, dukungan polling SMS pemirsa RCTI yang dibuka sejak Senin (18/ 2) kurang memadai, Dicky harus bertarung head to head dengan Ilusia Girl di babak tambahan SMS. Lagu My Same yang kembali diusung Dicky tak

mampu mengangkatnya dari posisi terendah dan secara dramatis menjadi finalis pertama yang tersingkir. Sebaliknya, Ilusia Girls yang melantunkan tembang Set Fire to The Rain lolos ke babak 12 besar dan berhak tampil pada Gala Show, Jumat (29/2) malam. Selaku mentor, Anggun menyatakan sangat bangga terhadap Dicky. “Mungkin masyarakat Indonesia belum siap dengan keunikan vokal Dicky,” tandas Anggun. Trending Topic Gala Show perdana X Factor Indonesia yang diprediksi insan musik berpontensi menenggelamkan pamor Indonesian Idol, benar-benar mampu menyedot perhatian jutaan pemirsa RCTI, Youtube dan jejaring sosial. Terbukti, masyarakat tak henti-hentinya menggelontorkan pujian dan dukungan ke Timeline Twitter @XFactor_ID hingga mencapai Trending TopicWorldwide. Khususnya bagi tiga kontestan berdarah Batak – Alex Rudiart, Fatin Shidqia Lubis, Isa Raja plus grup vokal Nu Dimension, Shena Malsiana, Mikha Angelo, Diawali aksi memukau Novita Dewi Marpaung yang menyanyikan Love On Top dari Beyonce, dilanjutkan Gede Bagus membawakan Tak Bisa


Jaya, Komisaris Besar Rikwanto. Kepolisian tidak menginginkan hal-hal yang bisa menjadi pemicu timbulnya pergesekan saat pertunjukan konser musik apapun. Untuk mengantisipasi terjadinya pergesekan itu, maka kepolisian langsung mencegah dengan cara tidak

memberikan izin konser. Menurut Rikwanto, pada 2009 konser Slank di Yon Arhanud Tangerang Kabupaten, para Slanker merusak ruko-ruko. Tercatat banyak kaca ruko yang hancur di wilayah Tangerang Kabupaten dan Tangerang Kota. Pada bulan Ramadhan

'Slanker' yang belum bisa tertib dan cenderung membuat keributan serta pengrusakan," kata Rikwanto. Untuk konser Slank di wilayah Kabupaten Tengerang ini panitia tidak mengajukan izin ke Polda, melainkan ke Polres Tangerang Kabupaten.(t/v)

Fatin, Funny and Amazing Teen from INdonesia SETELAH penampilannya di Audisi X Factor Indonesia dengan suara yang begitu luar biasa, kini Fatin Shidqia Lubis mulai menunjukkan perkembangannya. Hingga Gala Show, Jumat (22/2) malam, penam-

pilan Fatin mendapat lebih banyak pujian dari penikmat musik di seluruh indonesia. Di kalangan pengguna Twitter, Fatin berhasil menempati Worldwide Trending Topic. Ini berarti penampilan

Fatin telah menjadi pembicaraan dunia. Fatin sendiri mendapat julukan dari salah seorang pengguna Twitter sebagai “Funny and Amazing Teen from INdonesia“. Hal tersebut memang

Dicky Adam Siregar ke Lain Hati dari Kla Project, Ilusia Girls membawakan Impossible dari Shontelle. Kemudian Fatin Shidqia Lubis yang membawakan lagu Rumor Has It dari Adele. Lalu, Dicky Adam Siregar dengan lagu Smells Like Teen Spirit dari Ni r vana, Nu Dimension menyanyikan Careless Whisper dari George Michael, Shena Malsiana yang memukau juri dengan lagu A Natural Woman dari Aretha Franklin, kemudian Mikha Angelo menyanyi sambil bermain gitar membawakan lagu Baby One More Time dari Britney Spears versi dirinya. Isa Raja membawakan Losing My Religion dari R.E.M. Diikuti Yohanna Febianti menyanyikan Sang Dewi milik Titi DJ. Panggung Gala Show ditutup dengan apik oleh Alex Rudiart membawakan lagu dari Bruno Mars yakni Locked Out of Heaven.(AgusT)

2012, Slank akan manggung lagi di lapangan Yon Arhanud, namun tidak diizinkan karena terkait Perda bulan Ramadhan di wilayah Tangerang Selatan. "Konser di BSD City Serpong pada November 2012, Polres Tangerang Kabupaten juga tidak memberikan izin karena

fatin fb

Fatin foto bersama para pendukungnya yang disebut FATINISTIC

sangat pantas, karena Fatin bukan hanya mampu menjadi Worldwide Tranding Topic Twitter, namun video penampilannya juga berhasil masuk dalam official site Bruno Mars, ketika menyanyikan lagu Grenade. Fatin, yang menurut Anggun memiliki identitas vokal, berhasil menarik perhatian jutaan penggemarnya. Dia mampu membawakan berbagai lagu dengan luar biasa. Setelah sukses membawakan lagu Grenade (Bruno Mars), Pumped up Kick (Foster The People) dan Diamon (Rihana) pada sesi sebelumnya, Fatin semakin menunjukkan kualitas vokalnya dengan menyanyikan Rumor Has It (Adele). Karena itu, memang sangat pantas jika dia mendapat julukan “Funny and Amazing Teen from INdonesia” (FATIN). Dengan penampilan yang apa adanya, ternyata memberi nilai tersendiri sehingga sosok Fatin begitu diidolakan. Bahkan, Ahmad Dhani memberikan saran agar Fatin tetap mempertahankan gayanya yang lucu dan aneh. Usai membawakan lagu Rumor Has It, Dhani menilai penampilan Fatin lebih bagus dibanding minggu sebelumnya. Menurutnya, Fatin lebih baik

fatin fb

menjadi dirinya sendiri dalam setiap aksi panggung. "Saran saya, kamu natural aja, be yourself. Jangan ubah kelucuan kamu. Karena kamu itu aneh, jadi bagus," kata Dhani. Pentolan grup band Dewa 19 ini juga menanyakan perasaan Fatin yang semakin banyak penggemarnya sejak sukses membawakan lagu Grenade milik Bruno Mars. "Fatin, bagaimana perasaannya punya banyak penggemar? Senang ya? Malam ini kamu kembali menunjukkan dirimu. Malam ini kamu bagus sekali," kata Dhani.(ks/k)

Waspada, Minggu 24 Februari 2013  

Waspada Daily

Read more
Read more
Similar to
Popular now
Just for you