Page 1

Harga Eceran Rp2.500,-

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

KAMIS, Kliwon, 8 Desember 2011/12 Muharram 1433 H


RAZIA SENJATA API: Aparat keamanan memeriksa penumpang bus angkutan antar provinsi Banda Aceh-Medan di jalur transit Kota Lhokseumawe, Provinsi Aceh. Selasa (6/12). Polisi dibantu TNI AD terus mengintensifkan razia senjata api pasca maraknya kasus penembakan di Aceh.

No: 23707 Tahun Ke-65

Terbit 24 Halaman Waspada/Marolop Panggabean

Bakar Diri Di Depan Istana Negara

MOBIL Toyota Avanza yang dipergunakan kawanan perampok diamankan di Polres Taput.

Perampok Dan Polisi Baku Tembak Di Taput

Terkait Pemberondongan Buruh PT SA

Operasi Senjata Api Ilegal GEUREUDONG PASE (Waspada): Danrem 011/LW Kolonel A Rachim Siregar mengatakan, pihaknya akan melakukan operasi senjata ilegal demi menjaga perdamaian di Bumi Iskandar Muda. Hal itu dikatakan A Rachim Siregar di Tempat Kejadian Perkara (TKP) Rabu (7/12) siang, terkait kasus penembakan oleh orang tak dikenal terhadap buruh perkebunan PT Satiya Agung di Aceh Utara, yang menewaskan tiga orang. “Ya, kalau pemilik senjata ilegal tidak mau menyerahkan senjatanya, akan kita gelar operasi senjata api ilegal. Kita mengimbau kepada pemilik senjata, jangan menyimpan senjata api karena melanggar undang-undang dan perjanjian MoU,” sebut Kolonel A Rachim Siregar. Danrem mengharapkan masya-rakat tidak perlu takut denganperistiwapemberondonganitu.PihakPTSAdiharapkan untuk memberikan sugesti kepada para buruh agar merasa tenang dan dapat kembali bekerja seperti biasa. Apa lagi, para buruh di perkebunan itu hanya mencari sesuap nasi. TNI sepenuhnya mendukung pihak kepolisian dalam melakukan pengembangan untuk mendeteksi pelaku pemberondongan. Usaha untuk mencari tahu siapa dibalik kasus ini sudah mendekati sasaran. Danrem mengajak para buruh untuk kembali bekerja sebagaimana mestinya. TNI dan Polri akan terus memberikan pengamanan kepada para buruh hingga kondisinya benarbenar normal. Kapolres Lhokseumawe AKBP Kukuh Santoso di lokasi kejadian, mengaku sampai kini belum berhasil mengidentifikasi siapa pelaku pemberondongan. Kapolres mengimbau kepada masyarakat agar dapat membantu polisi untuk mengungkap kasus itu. (b18/b11)


JAKARTA (Waspada): Seorang pria yang belum diketahui identitasnya melakukan aksi bakar diri di depan Istana Negara saat unjuk rasa, Rabu (7/12) (foto). Pria nekad itu berusia sekitar 40 tahun dan mengalami luka bakar hingga 90 persen dirawat di RS Cipto Mangunkusumo. Menurut salah satu petugas kepolisian Jakarta Pusat yang enggan disebut namanya, korban luka bakar itu hingga kini belum diketahui identitasnya.

“Saat ini tengah dilakukan operasi oleh dokter. Sudah sekitar 30 menit lalu, belum tahu selesainya kapan,” kata polisi tersebut di RS Cipto Mangunkusumo, Jakarta Pusat. Menurut dia, korban diduga mengikuti aksi Kepala Desa di depan Istana Negara. Saat itu petugas kepolisian mengira api yang membumbung berasal dari kendaraan yang dibakar. “Ternyata saat petugas kami ke arah sana, yang terbakar adalah manusia,” tuturnya. Lanjut ke hal A2 kol. 5

TARUTUNG (Waspada): Baku tembak antara enam orang perampok dengan anggota Serse Polres Taput, Selasa (6/12) pagi, terjadi di jalan umum Sibolga-Tarutung Km 19, tepatnya di Desa Dolok Nauli, Dusun Lobu Pining, Kec. Adiankoting (Taput). Baku tembak terjadi setelah korban Faisal, 31, warga Pematangsiantar, sehari-hari berdagang telur sekaligus sopir, bersama kernetnya Rian Andika melapor dirampok enam orang bersenjata api (Senpi), ke Polsek Adiankoting Perampokan berhasil menyikat Rp25 juta, setelah mengikat kedua tangan korban. Petugas Polsek Adiankoting yang menerima laporan berkordinasi dengan PolresTaput, langsung merazia kendaraan yang menuju Kec. Adiankoting. Di Dusun Pearaja, Kec. Tarutung, tim Polres Taput yang mengendarai mobil patroli dari arah Tarutung, berpapasan dengan mobil Toyota Avanza yang meluncur dari arah berlawanan Sibolga. Tiba-tiba mobil Avanza tersebut berbalik arah dan kabur. Aparat yang curiga langsung melakukan pengejaran. Kawanan pelaku berusaha kabur ke arah Desa Banua Aji, Kec. Adiankoting, sehingga terjadi kontak tembak. Kawanan tersebutberhenti dan meninggalkan mobil karena ban belakang pecah ditembak polisi. Mereka kabur ke hutan sekitar Desa Banua Aji (berbatasan Tapteng). Menurut Kapolres Taput, AKBP IKG Widjatmika, S.Ik, Rabu (7/12), melalui kerja keras, tim Serse Polres melumpuhkan satu dari enam kawanan pelaku, dengan tembakan di punggung. Sedangkan yang lainnya melarikan diri ke hutan Banua Aji dan menjadi target pengejaran Serse Polres Taput. Tersangka yang dilumpuhkan, yakni BM, 47, warga Launa Bulu II Kec. Buttu Raja, Kab. Dairi. Tersangka masih berada di RSU Tarutung untuk menjalani operasi mengeluarkan peluru dari punggungnya. Lanjut ke hal A2 kol. 2

12 Ribu Pelanggar Lalin Disidang MEDAN (Waspada) :Sekitar 12.000 pelanggar lalulintas disidangkan di Pengadilan Negeri Medan, setelah Polresta Medan memberlakukan UU No. 2 Tahun 2009 di Kota Medan sejak 21 November 2011.

Angka tersebut terus meningkat dengan prediksi angka tambahan pada Jumat (9/12) depan sekitar 7000 berkas yang akan disidangkan di Pengadilan Negeri Medan. Sehingga total pelanggar lalulintas mencapai

19.000. “Sekitar 90 persen pelanggar lalulintas tersebut tidak menghidupkan lampu pada siang hari, sedangkan 10 persennya adalah STNK kadaluarsa, tidak memiliki SIM, kaca spion tidak

dipasang, dan lainnya,” ujar Humas PN Medan, Ahmad Guntur didampingi Muhammad Syahrif F Harahap, di kantornya, PN Medan, Rabu (7/12). Hasil dari denda penilangan tersebut, lanjutnya, sekitar

Rp242.048.000 dimana pada tanggal 25 November sekitar 5.057 pelanggar yang disidang dengan kehadiran pelanggar 3.456 orang berkisar Rp79.339.500. “Adapun yang tidak hadir

sekitar 1.601 pelanggar dan ini akan membayar dendanya di Kejaksaan Negeri Medan sesuai dengan angka yang tertera,” ujarnya. Sedangkan hasil sidang pada 2 Desember lalu sekitar

4.535 pelanggar yang disidang dengan kehadiran sekitar 2.988 pelanggar yang hadir sedangkan selebihnya tidak datang. Sehingga dana yang terkumpul sekitar Rp70.545.000. Lanjut ke hal A2 kol. 6

Bus Trans Medan Mulai Beroperasi Tahun Depan Organda Menolak MEDAN (Waspada): Angkutan massal atau Trans Medan direncanakan beroperasi di Kota Medan tahun depan. Saat ini, Pemko sedang menunggu pengiriman bus dari Kementerian Perhubungan (Kemenhub). Namun, Organda menolak kehadiran bus tersebut. Kepala BidangTeknis Sarana dan Prasarana Dishub Medan Iswar mengatakan, pada tahun 2010, sudah dilakukan studi kelayakan dengan anggaran Waspada/Istimewa

WALI Kota Medan Rahudman Harahap menerima Piala ICT PURA tahun 2011 kategori utama dari Menteri Kominfo RI Tifatul Sembiring di Empire Palace Hotel Surabaya, kemarin.

Kota Medan Dapat Dua Penghargaan Dari Dua Menteri MEDAN (Waspada): Wali Kota Medan Drs H Rahudman Harahap, MM mendedikasikan dua penghargaan yang baru diraihnya yakni Penilaian Kinerja Pemerintah Daerah (PKPD) Bidang Pekerjaan Umum 2011 kategori Kota Metropolitan dari Kementerian Pekerjaan Umum dan piagam Information Communication dan Technology (ITC) Pura dari Kementerian Komunikasi dan Informatika Republik Indonesia kepada

seluruh warga Kota Medan. Untuk ituWali Kota mengucapkan rasa terima kasih sebesar-besarnya atas kinerja dan dedikasi Satuan Kerja Perangkat Daerah (SKPD) yang telah bekerja sungguh-sungguh untuk masyarakat. “Hal ini menunjukkan kita mampu memberikan yang terbaik dengan meraih dua penghargaan dalam waktu yang hampir bersamaan,” kata Rahudman ketika menghadiri

Al Bayan

Makanan Halal Oleh Tgk H Ameer Hamzah Hai manusia! Makanlah dari apa yang ada di bumi ini yang halal lagi baik, dan janganlah kamu mengikuti langkah-langkah setan karena sesungguhnya setan itu musuh yang terang-terangan bagi kamu. (QS.2:168)

sebesar Rp300 juta. Setelah pengkajian, pihaknya tinggal melakukan persiapan penyediaan sarana dan prasarana. Terutama koridor sebagai tempat menaikkan dan menurunkan penumpang. ‘’ Seluruhnya akan disiapkan sambil menunggu pengiriman bus dari Jakarta,” katanya pada acara sosialisasi angkutan massal Kota Medan (Trans Medan) di Hotel Madani Medan, Rabu (7/12). Lanjut ke hal A2 kol. 1

Kakek Selundupkan Sabu Rp500 Juta Dari Malaysia

malam syukuran penerimaan penghargaan PKPD kategori Kota Metropolitan dan piagam ICT Pura di arena Medan Mega Fair, Selasa (6/12) malam. Dijelaskannya, keberhasilan menerima penghargaan di bidang Pekerjaan Umum tidak terlepas dari sejak awal memimpin kota ini, pembangunan infrastruktur kota menjadi salah satu prioritas utama yang harus

TANJUNGBALAI (Waspada) : Seorang kakek berinisial IY, 61, warga Bireuen, Aceh, ditangkap petugas Bea Cukai Teluknibung dalam kasus dugaan membawa sabu senilai Rp 505 juta di saku jaket bagian dalam Rabu (7/12) malam.Sabu yang dibawa IY dikemas dalam dua bungkusan plastik dimasukkan ke dalam 2 amplop. IY, ditangkap ketika melewati ruang pemeriksaan petugas Custom Narcotica Teams Bea Cukai Teluknibung, kata Kepala

Lanjut ke hal A2 kol. 2

Lanjut ke hal A2 kol. 3

Plt Gubsu: Perkuat Kerjasama IMT-GT Undang Delegasi Hadiri Pesta Danau Toba

Waspada/Rasudin Sihotang

TERSANGKA IY dan barang bukti sabu.

Dakwah Waspada Di Rantauprapat:

Muharram Momentum Hijriyah Akhlak Ke Arah Yang Lebih Baik RANTAUPRAPAT (Waspada): Ustadz DR Achyar Zein MA mengajak umat Islam menjadikan bulan Muharram 1433 Hijriyah sebagai momentum hijriyah (perubahan)

Waspada/Surya Efendi

Plt Gubsu Gatot Pujo Nugroho (tengah) bersama Wakil Gubernur Propinsi Narathiwat Thailand U-Tarn Pichayaporn (kanan) dan Ketua Menteri Malaka Malaysia Datuk Seri Mohd Ali Rustam (kiri) berbicara pada pertemuan Forum Ketua Menteri dan Gubernur ke-8 (Chief Minister and Governors Forum/CMGF) di Hotel JW Marriott Medan, Rabu (7/12).

akhlak ke arah yang lebih baik untuk memperbanyak investasi di akhirat.

Lanjut ke hal A2 kol. 6

TOKOH Sufi Wanita, Rabi’ah al-Adawiyah waktu itu baru berusia enam tahun. Ia rajin membaca ayat Alquran. Suatu malam ia membaca surat al-Baqarah ayat 168 seperti yang kita kutip di atas. Lalu ia mengamalkannya sepenuh hati. “Ya Allah, aku akan menjaga perutku sebaik-baiknya. Jangan sampai masuk makanan haram.Wahai mulut, engkau hanya aku izinkan memakan makanan yang halal saja,” ujar Rabi’ah. Lanjut ke hal A2 kol. 2

Waspada/Armansyah Abdi

USTADZ DR Achyar Zein, MA menggugah jamaah Tabligh Akbar Road to Dakwah Waspada di Masjid Agung Rantauprapat, Rabu (7/12).

MEDAN (Waspada): Plt Gubernur Sumatera Utara (Gubsu) H Gatot Pujo Nugroho mengatakan, kerjasama antar pemerintah tiga negara IMT-GT harus diperkuat untuk mewujudkan pembangunan menuju masyarakat ekonomi Asean di tahun 2015. ”Forum ketua menteri dan gubernur telah diminta untuk meningkatkan peranannya dalam mengidentifikasi, men-

dukung dan melaksanakan proyek prioritas dalam sub regional ini. Ini sebagai arahan dari pertemuan pemimpin tiga negara pada tahun lalu di Hanoi, Vietnam,” kata Gatot, saat membuka forum pertemuan IMT GT ke-8, di Hotel JW Marriot, Medan, Rabu (7/12). Gatot berharap forum tersebut mendorong kerjasama dengan memberikan dukungan penuh kepada sektor swasta

China Tangkap Mafia Penyelundup Anak BEIJING (Waspada): Kepolisian China menangkap 608 orang terlibat perdagangan anak, dalam dua operasi berbeda. Pihak berwenang mengatakan, Rabu (7/12), sekira 178 anakanak berhasil diselamatkan dalam operasi ini. Kementerian Keamanan Umum mengatakan, jaksa penuntut tengah dipersiapkan untuk menangani kasus ini,

Lanjut ke hal A2 kol. 3

dalam rangka upaya mewujudkan kegiatan prioritas dalam kerjasama ini. ”Dalam menghadapi ketidakpastian yang diciptakan internasional dan kemungkinan memburuknya situasi ekonomi, kita tidak punya pilihan yang banyak kecuali memperkuat kerjasama regional dan subregional,” lanjutnya.

Lanjut ke hal A2 kol. 3

Ada-ada Saja Todong Ahli Bela Diri, Perampok Bonyok Dikarate PERNAH dengan cerita orang jahat ‘mengerjai’ nenek tua, dan anda berpikir: “Coba pilih lawan yang seimbang?” Nah, ini adalah cerita yang cocok bagi anda. Seorang penodong asal kota Chicago, AS, kena batunya pada akhir pekan lalu setelah menjadikan seorang pria bela

Lanjut ke hal A2 kol. 1

Serampang - Siapa bilang Medan lapok...? - He...he...he...

Ulama Minta Jangan Bikin Rusuh Aceh LHOKSEUMAWE (Waspada): Majelis Pemusyawaratan Ulama (MPU) Aceh Utarameminta siapa saja agar tidak menciptakan lagi kerusuhan di Aceh di tengah situasi damai seperti ini. Hal itu dikatakan Ketua Majelis Pemusyawaratan Ulama (MPU) Aceh Utara, H Mustafa Achmad, Rabu (7/12) , berkaitan kasus penembakan di lokasi perkebunan PT Satiya Agung yang merenggut delapan korban, tiga di antaranya meninggal dunia.

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) KAMIS, Kliwon, 8 Desember 2011/12 Muharram 1433 H  z No: 23707 Tahun Ke-65

Terbit 24 Halaman

Lanjut ke hal A2 kol 6


RAZIA SENJATA API. Aparat keamanan memeriksa penumpang bus angkutan antar provinsi Banda Aceh-Medan di jalur transit Kota Lhokseumawe, Provinsi Aceh. Selasa (6/12). Polisi dibantu TNI AD terus mengintensifkan razia senjata api pasca maraknya kasus penembakan di wilayah tersebut.

Waspada/Marolop Panggabean

KAPOLRES Taput IKG Widjatmika, S.Ik memimpin penyisiran di hutan Banua Aji, Kec. Adiankoting, Taput, Rabu (7/12). Foto atas: Tersangka BM di RSUD Tarutung, sebelum menjalani operasi untuk mengeluarkan peluru dari punggungnya.

Perampok-Polisi Baku Tembak

BBM Mulai Langka, SPBU Kehabisan Stok MEDAN (Waspada): Sejumlah Stasiun Penyaluran Bahan Bakar Umum (SPBU) di Medan, kini selalu mengalami kehabisan stok BBM, sehingga masyarakat pemilik kenderaan roda dua dan empat kecewa. Pantauan Waspada, Rabu (7/12) SPBU yang selalu mengalami kelangkaan BBM yaitu SPBU Jalan SM Raja di samping

Ramayana, SPBU di Jalan Bakti Sukaramai, SPBU di Jalan MT Haryono, Jalan Denai dan beberapa SPBU di sepanjang Jalan Veteran hingga Jalan Marelan Raya dan di Jalan Medan Belawan. Pemilik SPBU yang tidak ingin disebut Lanjut ke hal A2 kol 2

Pertemuan IMT-GT

1 Dari 6 Pelaku Dibekuk TARUTUNG (Waspada): Baku tembak antara enam orang perampok bersenpi dengan anggota Serse Polres Taput, Selasa (6/12) pagi, terjadi di jalan umum SibolgaTarutung Km 19, tepatnya di Desa Dolok Nauli, Dusun Lobu Pining, Kec. Adiankoting (Taput). Baku tembak terjadi setelah korban Faisal, 31, warga Pematangsiantar, sehari-hari berdagang telur sekaligus sopir, bersama kernetnya Rian Andika melapor dirampok enam orang bersenjata api (Senpi), ke Polsek Adiankoting Dalam perampokan itu kawanan tersebut membawa kabur uang Rp25 juta, setelah mengikat kedua tangan korban. Petugas Polsek Adiankoting yang menerima laporan berkordinasi dengan Polres Taput, langsung merazia kendaraan yang menuju Kec. Adiankoting.

Di Dusun Pearaja, Kec. Tarutung, tim Polres Taput yang mengendarai mobil patroli dari arah Tarutung, berpapasan dengan mobil Toyota Avanza yang meluncur dari arah berlawanan Sibolga. Tiba-tiba mobil Avanza tersebut berbalik arah dan kabur. Aparat yang curiga langsung melakukan pengejaran. Kawanan pelaku berusaha kabur ke arah Desa Banua Aji, Kec. Adiankoting, sehingga terjadi kontak tembak. Kawanan tersebutberhenti

Korem 011/LW Akan Operasi Senjata Ilegal GEUREUDONG PASE ( Waspada): Danrem 011/LW Kolonel A Rachim Siregar mengatakan, pihaknya akan melakukan operasi senjata ilegal demi menjaga perdamaian di Bumi Iskandar Muda. Hal itu dikatakan A Rachim Siregar di Tempat Kejadian Perkara ( TKP) Rabu (7/12) siang, terkait kasus penembakan oleh

orang tak dikenal terhadap buruh perkebunan PT Satiya Agung di Aceh Utara, yang menewaskan tiga orang. “Ya, kalau pemilik senjata ilegal tidak mau menyerahkan senjatanya, akan kita gelar operasi senjata api ilegal. Kita Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 7

DPRDSU ‘Gerah’ BPK Audit Anggaran Reses Waspada/Surya Efendi

Plt Gubsu Gatot Pujo Nugroho (tengah) bersama Wakil Gubernur Propinsi Narathiwat Thailand U-Tarn Pichayaporn (kanan) dan Ketua Menteri Malaka Malaysia Datuk Seri Mohd Ali Rustam (kiri) berbicara pada pertemuan Forum Ketua Menteri dan Gubernur ke-8 (Chief Minister and Governors Forum/CMGF) di Hotel JW Marriott Medan, Rabu (7/12). Kegiatan IMT-GT melibatkan Indonesia, Malaysia dan Thailand itu dalam rangka memperkuat kerjasama regional dan sub-regional untuk menghadapi ketidakpastian dan tekanan ekonomi internasional pasca krisis ekonomi di AS dan Eropa.

TNI: Kekerasan Di Aceh, Papua Gunakan Senjata Sisa Konflik JAKARTA (Antara): Markas Besar TNI menyatakan tingkat penyelundupan senjata terutama ke daerah-daerah konflik seperti Aceh dan Papua relatif menurun. Juru bicara TNI Laksamana Muda TNI Iskandar Sitom-

pul ketika dikonfirmasi di Jakarta, Rabu (7/12) mengatakan, dibandingkan saat konflik berkecamuk di wilayah-wilayah tersebut, tingkat penyelundupan senjata baik melalui darat maupun laut relatif menurun secara signifikan.

“Dulu memang sempat marak, misalnya saat terjadi konflik di Aceh dalam status darurat militer dan di Ambon dimana banyak senjata diselundupkan lewat laut,” katanya. Lanjut ke hal A2 kol 1

MEDAN (Waspada): Dialog hangat terjadi antara Badan Pemeriksa Keuangan (BPK) RI Perwakilan Sumut dengan anggota DPRD Sumut pada acara rapat kerja (Raker) dewan membahas program kerja 2012, di Berastagi. Anggota dewan merasa ‘gerah’ dengan tindakan BPK yang mengaudit anggaran reses mereka. Berbagai hal (mulai dari pernyataan, pertanyaan sampai nada mengancam) disampaikan sejumlah anggota dewan. Selasa (6/12) sore, kegiatan Raker DPRD Sumut diisi kegiatan paparan oleh BPK. Pembicara adalah Kepala Sub Auditoriat BPK RI Perwakilan Sumut Aryo Seto. Awalnya, anggota dewan terlihat

tenang-tenang mendengarkan paparan yang disampaikan Aryo. Diskusi mulai hangat saat sesi tanya jawab dibuka. Wakil Ketua DPRD Chaidir Ritonga, yang menjadi moderator sampai kewalahan membatasi anggota dewan yang bersemangat bertanya. Persoalan dana reses langsung menjadi topik saat anggota dewan dari Fraksi PAN Irwansyah Damanik, diberi kesempatan pertama bertanya. Disusul Tahan Manahan Panggabean, Mustofawiyah Sitompul, Isma Fadly Pulungan. Kemudian berlanjut lagi oleh anggota dewan lainnya Marasal Hutasoit, Budiman Nadapdap, Bustami HS, Arifin Lanjut ke hal A2 kol 1

Waspada/Bustami Saleh

DANREM 011/LW, Dandim 0103 Aceh Utara, Tgk M. Isa (pakai baju putih) Direktur PT Cimita Rata dan Pang Ben, Ketua KPA Sagoe Mujahidin (pakai baju hitam) sedang berbincang-bincang tentang kejadian pemberondongan buruh PT. SA di TKP, Rabu (7/12) siang.

KPA Wilayah Sago Mujahidin:

Pemberondong Buruh PT SA Biadab GEUREUDONG PASE ( Waspada): Ketua Komite Peralihan Aceh (KPA) Wilayah Sagoe Mujahidin, Pang Ben Rabu (7/12) kepada Waspada mengatakan, pihaknya mengutuk keras pelaku pemberondongan buruh di perkebunan PT Satiya Agung pada Minggu (4/12) pukul 23:30. Dia

menilai pelaku cukup biadab dan tidak manusiawi. “Itu merupakan perbuatan orang yang tidak beragama,” ucap Pang Ben di TKP pemberondongan buruh PT. SA kemarin siang. Hal tersebut diungkapkan saat kunjungan Danrem 011/LW, Dandim 0103 Aceh Utara dan Pj Bupati Aceh

Ada-ada Saja

Al Bayan Oleh: H. Ameer Hamzah Hai manusia! Makanlah dari apa yang ada di bumi ini yang halal lagi baik, dan janganlah kamu mengikuti langkah-langkah setan karena sesungguhnya setan itu musuh yang terang-terangan bagi kamu. (QS.2:168) TOKOH Sufi Wanita, Rabi’ah al-Adawiyah waktu itu baru berusia enam tahun. Ia rajin membaca ayat Alquran. Suatu malam ia membaca surat al-Baqarah ayat 168 seperti yang kita kutip di atas. Lalu ia mengamalkannya sepenuh hati. “Ya Allah, aku akan menjaga perutku sebaikbaiknya. Jangan sampai masuk makanan haram. Wahai mulut, engkau hanya aku izinkan memakan makanan

Lanjut ke hal A2 kol 2

JAKARTA ( Waspada): Seorang pria yang belum diketahui identitasnya melakukan aksi bakar diri di depan Istana Negara saat unjuk rasa, Rabu (7/12). Pria nekad itu berusia sekitar 40 tahun dan mengalami

PERNAH dengan cerita orang jahat ‘mengerjai’ nenek tua, dan anda berpikir: “Coba pilih lawan yang seimbang?” Nah, ini adalah cerita yang cocok bagi anda. Seorang perampok asal kota Chicago, AS, kena batunya pada akhir pekan lalu setelah menodong seorang pria yang ternyata pakar seni bela diri. Polisi mengatakan tersangka Anthony Miranda, 24, menodongkan pistolnya ke arah korbannya yang sedang duduk di dalam mobil saat parkir. Seperti dilansir MSNBC, Rabu (7/12), tersangka kemudian mendekati pria itu pada Jumat siang lalu, dan meminta barang-barang berharga milik pria itu. Di bawah todongan pistol pria tadi menuruti permintaan tersangka. Namun

BAGI anak usia 3,5 tahun dan 7 tahun, merupakan usia ceria atau sedang lucunya menjalani hidup. Namun, hal seperti itu tidak didapatkan Putri Nesya, bocah berusia

Lanjut ke hal A2 kol 4

Lanjut ke hal A2 kol 4

Lanjut ke hal A2 kol 5


PETUGAS di bantu warga membawa korban bakar diri di depan Istana, Jakarta (7/12). Lelaki setengah baya yang belum diketahui identitas dan motifnya itu menderita luka bakar parah dan mendapat perawatan di RSCM.

Seorang Pria Bakar Diri Di Depan Istana Negara

Lanjut ke hal A2 kol

Nazaruddin Protes Dakwaan

Todong Ahli Bela Diri, Perampok Bonyok Dikarate

Makanan Halal

Utara, serta Direktur PT Cimita Rata, Tgk M. Isa, dan staf PT SA ke lokasi kejadian. KPA Sagoe Mujahidin bersedia bekerjasama dengan TNI dan Polri untuk memburu pelaku.Pihaknya menganggap pelaku merupakan musuh

Waspada/Abdul Mukthi Hasan

PUTRY NESYA dan M Azmi yang menderita sakit bocor jantung dan kelainan kaki kiri terlihat ceria saat berada di sisi ibunya Nursalwa, belum lama ini.

Bocah Penderita Bocor Jantung Dan Lumpuh Layu Asal Peusangan Berharap Bantuan

JAKARTA (Antara): Terdakwa kasus dugaan suap proyek wisma atlet Jakabaring, Muhammad Nazaruddin, memprotes dakwaan yang dibacakan jaksa penuntut umum karena menurut dia sama sekali berbeda dengan Berita Acara Pemeriksaan. “Saya protes keras atas dakwaan yang saya tidak mengerti. Karena uraian jaksa dalam dakwaan tidak masuk akal dan tidak sesuai fakta,” tegas Nazaruddin dalam nota keberatan yang dibacakan dalam sidang di Pengadilan Lanjut ke hal A2 kol 6

Serampang - Seperti hidup di Texas - He.... he....he....

Berita Utama

A2 TNI: Kekerasan ....

Iskandar mengatakan pihaknya bersama instansi terkait telah mengintensifkan pengawasan di perbatasan darat dan laut terhadap segala bentuk kegiatan ilegal seperti penyelundupan senjata. “Setiap modus penyelundupan senjata, termasuk yang diselundupkan melalui kapalkapal nelayan tradisional, telah kami deteksi dengan lebih baik dan intensif sehingga jumlah kegiatan penyelundupan pun menurun,” ujarnya menegaskan. Iskandar menekankan, maraknya aksi kekerasan bersenjata di Papua dan beberapa kali di Aceh belakangan ini, sebagian besar menggunakan senjata sisa konflik atau hasil rampasan dari para aparat yang diserang. “Jadi, hingga kini belum

Korem 011/LW ....

mengimbau kepada pemilik senjata, jangan menyimpan senjata api karena melanggar undang-undang dan perjanjian MoU,” sebut Kolonel A Rachim Siregar. Pada kesempatan itu, Danrem mengharapkan masyarakat tidak perlu takut dengan peristiwa pemberondongan itu. Pihak PT SA diharapkan untuk memberikan sugesti kepada para buruh agar merasa tenang dan dapat kembali bekerja seperti biasa. Apa lagi, para buruh di perkebunan itu hanya mencari sesuap nasi. TNI sepenuhnya mendukung pihak kepolisian dalam melakukan pengembangan untuk mendeteksi pelaku pemberondongan. Usaha untuk mencari tahu siapa dibalik

DPRD SU ....

Nainggolan dan sejumlah anggota dewan lainnya. Berbagai statemen diungkapkan anggota DPRD Sumut pada diskusi itu. Mulai dari membujuk BPK untuk menjaga hubungan baik, sampai pernyataan yang mengancam, bahwa DPRD juga mempunyai wewenang pengawasan. Ketua Fraksi Partai Demokrat (FPD) Tahan Panggabean, mengatakan sudah tiga kali DPRD Sumut diharuskan mengembalikan uang reses. Padahal, katanya, hampir tidak ada anggota dewan yang tidak melakukan reses. Malah uang reses yang mereka terima Rp35 juta kurang. Dalam hal ini, dia merasa dewan tidak diperlakukan dengan baik. ‘’Mungkin saja suatu saat dewan juga akan menjalankan fungsinya. Yakni mengawasi BPK,’’ kata Tahan Panggabean. Disebutkan Aryo Seto, BPK tidak mengenal kata pencitraan dalam menjalankan tugasnya. Sebelum melakukan pemeriksaan, BPK terlebih dahulu memperhatikan datadata pendukung dari objek yang akan diperiksa. Salah satu diantara yang menjadi sasaran pemeriksaan BPK adalah halhal yang menjadi sorotan masyarakat. Kata Aryo Seto, sesuai tugasnya, BPK melakukan pemeriksaan terhadap anggaran yang sudah digunakan. Kalau audit terhadap anggaran sedang berjalan, merupakan Jawaban Problem Catur,

TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Kf2+. 2. MxK, MxM. 3. Kg3 atau Ke3, e1(B)+. 4. Kf1, MxK+mat. (Jika 2. Rg1, Kh3+. 3. Rh1, Mg1+mat).

Jawaban TTS: TTS Topik





Jawaban Sudoku: 8 1 6 9 3 7 2 4 5

5 9 2 6 8 4 7 3 1

7 4 3 1 5 2 9 8 6

9 2 8 7 1 3 6 5 4

4 3 1 5 6 9 8 2 7

6 7 5 2 4 8 1 9 3

3 8 7 4 9 6 5 1 2

1 6 4 8 2 5 3 7 9

2 5 9 3 7 1 4 6 8

ada indikasi kembali terjadi penyelundupan senjata ke beberapa daerah konflik seperti Aceh dan Papua. Meski demikian, operasi pengamanan perbatasan yang digelar di darat dan laut akan terus diintensifkan untuk mengantisipasi segala bentuk kegiatan ilegal termasuk penyelundupan senjata,” tuturnya. Aksi kekerasan bersenjata kembali terjadi beberapa hari ini di Aceh. Polri menduga salah satu penyebab kekerasan bersenjata tersebut karena masih banyaknya peredaran senjata sisa konflik Aceh di masyarakat. ‘“Jadi ini juga memerlukan penyelidikan lebih lanjut lagi. Bisa saja ini terkait dengan ketika dulu di Aceh banyak beredar senjata-senjata. Kita harapkan upaya-upaya untuk meminimalisir senjata-senjata

ilegal itu juga terus dilakukan Polda Aceh,” ujar Kabid Penum Div Humas Polri Kombespol Boy Rafli Amar. Seperti diketahui Minggu (4/12) malam, penembakan terjadi terhadap sejumlah pekerja perkebunan di Krueng Jawa, Kecamatan Geureudong Pase, Aceh Utara. Tiga pekerja perkebunan tewas, sementara lima lainya dilarikan ke rumah sakit. Para pelaku kemudian kabur meninggalkan selongsong peluru bekas tembakan yang diduga berasal dari senjata api laras panjang jenis AK-47. Penembakan ini seolah menyambung peristiwa pelemparan granat di sekitar Wisma Lampriek, di Jalan Teuku Daud Bereueh Banda Aceh, Kamis (1/12). Saat itu tiga warga luka terkena serpihan granat yakni kakak beradik, Ina ,23, TLia ,22, dan Ardeman ,20.

kasus ini sudah mendekati sasaran. Untuk memburu pelaku, TNI siap mendukung polisi dan tidak ada penambahan kekuatan, dari TNI hanya mensiagakan kekuatan yang ada di Kodim dan Koramil. Danrem mengajak para buruh untuk kembali bekerja sebagaimana mestinya. TNI dan Polri akan terus memberikan pengamanan kepada para buruh hingga kondisinya benar-benar normal. Kapolres Lhokseumawe AKBP Kukuh Santoso di lokasi kejadian, mengaku sampai kini belum berhasil mengidentifikasi siapa pelaku pemberondongan. Kapolres mengimbau kepada masyarakat agar dapat membantu polisi untuk mengungkap kasus itu.

Pada kesempatan itu, Pj Bupati Aceh Utara HM Alibasyah mengaku datang ke TKP untuk melihat langsung lokasi kejadian. Informasi yang berhasil didapatnya di lapangan bahwa kejadian sama sekali tidak ada kaitannya dengan Pilkada Aceh dan kejadian ini hanya sebuah perbuatan kriminal. Mandalaris Silaban, Sate Menager Perkebunan PT Satiya Agung pada kesempatan yang sama mengungkapkan,meskipun masih dalam kondisi duka, pada hari ke tiga paska kejadian, aktivitas buruh kembali normal, kecuali di barak Krueng Jawa. Sampai saat ini, belum ada kegiatan. Kata dia, jumlah pekerja di PT SA total mencapai 486 orang. (b18/b11)

wewenang inspektorat. Khusus menyangkut dana reses, menurut Aryo Seto, BPK melakukan pengujian eksistensi. Misalnya untuk biaya sewa menyewa, BPK melakukan konfirmasi kepada pihak penyewa. Hasilnya didapati pengakuan tidak pernah ada sewa menyewa itu. ‘’Konsekwensinya BPK membuat rekomendasi, dana tersebut dikembalikan ke kas daerah,’’ kata Aryo. Buat pusing Diungkapkan sejumlah anggota DPRD Sumut pada acara itu, dana reses membuat mereka pusing. Padahal saat pelaksanaan reses, anggota dewan tidak dibenarkan memegang uang kontan. Seluruh kebutuhan reses disediakan oleh staf DPRD, termasuk laporan keuangannya. Item yang dapat dibayarkan dari dana reses juga sangat terbatas. Hanya boleh untuk biaya sewa teratak, kursi, sound system dan biaya makan. Pada-

hal masih ada biaya-biaya lain yang harus dikeluarkan dewan. Termasuk biaya transport masyarakat yang menghadiri kegiatan reses dewan. Menurut Ketua Fraksi PDIP Budiman Nadapdap, anggota dewan sudah melak-sanakan reses dengan sangat transparan. Pengeluaran reses seluruhnya dicatat staf dengan sangat jelas. Sikap terus terang disampaikan anggota FPD Arifin Nainggolan. Katanya, inti dari masalah ini adalah persahabatan. Dia memberikan contoh DPRD DKI Jakarta. Katanya, BPK sulit menjumpai temuan di DPRD itu. Karena DPRD dan BPK nya bersahabat. Di Sumut, Arifin Nainggolan, berharap seperti itu, karena dewan dan BPK samasama mempunyai fungsi pengawasan. Katanya, jangan sampai jeruk makan jeruk. ‘’Kalau ada masalah di dewan tidak usahlah dipermasalahkan,’’ katanya. (m12)

BBM Mulai Langka ....

distribusi. “Posisi stok BBM di Sumut tetap aman hingga akhir tahun, kita tidak ada masalah di supply dan distribusi. Stok premium masih ada 36.000 kilo liter (KL), sedangkan solar 40.000 KL,” kata External Relations PT Pertamina UPms Regional Sumbagut Sonny Mirath kepada Waspada, Selasa (29/11). Sonny menyebutkan, untuk persediaan BBM pada Natal dan Tahun Baru, Pertamina akan menyiapkan langkah-langkah perencanaan seperti pembentukan tim satuan tugas (satgas) dalam memenuhi permintaan masyarakat pada hari besar tersebut. “Untuk penambahan stok khusus Natal dan tahun baru, beberapa tahun terakhir kenaikan permintaan tidak terlalu signifikan,” ujarnya. Mengenai kebutuhan BBM bersubsidi pada tahun 2012, Sonny mengatakan, pihaknya belum mendapatkan penugasan dari pusat, karena volumenya akan ditentukan dari UU APBN tahun 2012. “Kami belum dapat penugasan, karena biasanya BPH Migas yang akan mengumumkan perusahaan mana saja yang mendistribusikan BBM subsidi, seperti Pertamina dan beberapa perusahaan lainnya,” ujar Sonny. (m35)

namanya mengaku habisnya stok karena keterlambatan pendistribusian BBM ke stasiun mereka oleh Pertamina, sehingga omset penjualan menjadi berkurang dan konsumen kecewa. Namun, walau BBM habis di SPBU, ternyata penjualan BBM di tingkat eceran masih banyak diperdagangkan secara bebas. Padahal sesuai peraturan pembelian BBM melalui jerigen tidak dibenarkan. Jenis BBM yang paling banyak di jual para pedagang pengecer ini jenis Premium yang merupakan BBM paling banyak dibutuhkan bagi kenderaan masyarakat umum. Sedangkan tarif penjualan per liternya lebih tinggi dari harga eceran di SPBU yakni paling rendah Rp5.000 per liter, sedangkan di SPBU hanya Rp4.500 per liter. Stok BBM Masih Aman Kelangkaan BBM sehingga membuat banyak SPBU mengalami kehabisan penjualannya dibantah Pertamina. BUMN pengendali BBM ini menjelaskan, menjelang dan hingga akhir tahun 2011, stok bahan bakar minyak (BBM) untuk wilayah Sumatera Utara masih dalam kondisi aman dan tidak ada mengalami kendala baik dalam masalah supply maupun

Al Bayan ....

yang halal saja,” ujar Rabi’ah. Ketika ayahnya pulang dari pasar membawa makanan lezat, dan meminta putri kesayangannya memncicipinya, sang anak bertanya: Ayah, saya tidak mau makan sebelum ayah terangkan, dari mana engkau memperoleh uang ini. Jika dari sumber yang halal saya mau memakannya, tetapi jika sumbernya haram saya tidak memakannya.” Sang ayah berkata mengguruinya. “Kalau makanan itu haram dan tidak ada lagi yang bisa dimakan, apakah itu tidak dibenarkan?” Rabi’ah kecil menjawab tegas: “Wahai ayah! aku tetap bersabar menghadapi lapar di dunia dari pada aku harus bersabar menghadapi siksa api neraka di hari kiamat kelak”.

Itulah gadis kecil Rabi’ah al-Adawiyah, sejak usia enam tahun sudah memelihara diri dari makanan yang haram. Hikmah memelihara diri dari makanan yang haram, Rabi’ah kelak menjadi seorang ulama wanita besar yang paling cinta kepada Allah. Hatinya terang, otaknya cerdas, terbuka hijab, dan doanya dikabulkan Allah. Di zaman sekarang, sangat sedikit—barangkali tidak ada sama sekali—gadis yang seteguh iman Rabi’ah alAdawiyah. Jikapun ada, mungkin satu di antara sejuta manusia. Kebanyakan gadis sekarang, tidak peduli terhadap sumber makanan yang dimakannya. Apakah ayahnya seorang koruptor atau bukan? Apakah ayahnya seorang yang mendapat kursi karena KKN atau bukan? Pokoknya ayah-

WASPADA Kamis 8 Desember 2011

12.000 Pelanggar Lalulintas Disidangkan Di PN Medan MEDAN (Waspada): Sekitar 12.000 pelanggar lalulintas disidangkan di Pengadilan Negeri Medan, setelah Polresta Medan memberlakukan UU No. 2 Tahun 2009 di Kota Medan sejak 21 November 2011. Angka tersebut terus meningkat dengan prediksi angka tambahan pada Jumat (9/12) depan sekitar 7000 berkas yang akan disidangkan di Pengadilan Negeri Medan. Sehingga total pelanggar lalulintas mencapai 19.000.

“Sekitar 90 persen pelanggar lalulintas tersebut tidak menghidupkan lampu pada siang hari, sedangkan 10 persennya adalah STNK kadaluarsa, tidak memiliki SIM, kaca spion tidak dipasang, dan lainnya,” ujar Humas PN Medan, Ahmad Guntur didampingi Muhammad Syahrif F Harahap, di kantornya, PN Medan, Rabu (7/12). Hasil dari denda penilangan tersebut, lanjutnya, sekitar Rp242.048.000 dimana pada tanggal 25 November

Waspada/M Jakfar Achmad

SAHMIL atau Samin, 32, warga Afdeling IVPengkling Pulo Lhei, Aceh Tamiang, korban tembak ketika dijenguk Pj Bupati Aceh Utara H M Alibasyah didam-pingi Direktur RSUD CM Lhokseumawe drg Anita Syafrida, Selasa (6/12)

Pemberondong ....

memperket pengamanan untuk menjaga perdamaian yang telah berhasil dirajut di Helsinki. KPA Sagoe Mujahidin siap mendukung apara keamanan untuk mengusut siapa pelaku di balik kasus tersebut, “ kata Pang Ben. (b18/b11)

Seorang Pria ....

sakan celana dalam dan sepatu korban. Sedangkan identitas diri sudah terbakar habis. Saat ini tim Polres Jakarta Pusat masih menyelidiki penyebabnya. Sambil menunggu proses operasi selesai. (vn)

bersama. Dalam peristiwa ini diingatkan untuk tidak saling tuding menuding. Atas peristiwa ini kata Pang Ben, a d a h i k m a h n y a , k a re n a dengan peristiwa bisa bersatu antara KPA, TNI dan Polri. “KPA, TNI dan Polri siap luka bakar hingga 90 persen dirawat di RS Cipto Mangunkusumo. Menurut salah satu petugas kepolisian Jakarta Pusat yang enggan disebut namanya, korban luka bakar itu hingga kini belum diketahui identitasnya. “Saat ini tengah dilakukan operasi oleh dokter. Sudah sekitar 30 menit lalu, belum tahu selesainya kapan,” kata polisi tersebut di RS Cipto Mangunkusumo, Jakarta Pusat. Menurut dia, korban diduga mengikuti aksi Kepala Desa di depan Istana Negara. Saat itu petugas kepolisian mengira api yang membumbung berasal dari kendaraan yang dibakar. “Ternyata saat petugas kami ke arah sana, yang terbakar adalah manusia,” tuturnya. Polisi tersebut mengatakan hingga kini belum diketahui motif perbuatannya. “Agak aneh, karena kalau memang sengaja jadi bagian aksi itu, pasti dia ingin disorot media massa. Tapi ini sepert i n y a t i d a k d i s e n g a j a ,” jelasnya. Luka bakar yang dialami pria ini sangat parah, mengingat seluruh pakaian korban terbakar habis, hanya menyi-

Ada-ada Saja ....

tersangka melakukan kesalahan besar dengan menyuruh korbannya keluar dari mobil. Pria tadi kemudian dengan cepat meraih pistol tersangka. Di saat bersamaan tersangka sempat menarik pelatuk pistol namun mengenai kakinya sendiri. Kepada polisi, pria yang menjadi korban tersebut berusia 33 tahun, mengatakan bahwa ia sering mengikuti pertarungan ‘Ultimate Fighting’ dan kompetisi seni bela diri lainnya. Polisi memperkirakan korban termasuk ahli bela diri yang hebat karena tersangka perampok mengalami luka bonyok cukup parah di bagian tubuh dan wajah akibat ‘dikarate’. Te r s a n g k a d i t a n g k a p dengan membayar uang jaminan sebesar US$350.000 atau sekira Rp 3,1 miliar. (msnbc/rzl) nya pejabat atau orang berduit habis perkara. Malah kebanyakan gadis-gadis zaman sekarang menggoda ayahnya supaya dibeli mobil mewah, sekolah ke luar negeri atau menambah tabungannya di bank riba. Pada gilirannya, bukan bahagia yang ia dapatkan, malah kecelakaan semua keluarga. Ayahnya dihina rakyat karena korupsi, ibunya dimaki karena tampil glamour. Ia sendiri tak siap menerima cerca. Akhirnya, ia tak mungkin tampil di tengah-tengah masyarakat sebagai generasi yang berkualitas. Malah namanya tenggelam dari daftar nama pemudi pelopor. Ia hanya dikenal oleh kalangan hidung belang, karena telah menyulap dirinya sebagai kupu-kupu malam.

Bocah Penderita ....

7 tahun serta adiknya M Azmi anak dari pasangan Ismail, 60, peda ga n g a ya m kel il in g dengan Nursalwa, 38, seorang ibu rumah tangga warga Gampong Raya Dagang, Peusangan, Bireuen. Kedua anaknya harus bergelut dengan penyakit yang menggerogoti sejak kecil. Putri Nesya sesuai hasil medis mengalami bocor jantung, adiknya M Azmi, kata orang tuanya, berdasarkan hasil pemeriksaan medis menderita lumpuh layu yaitu kaki kirinya sulit digerakkan, walaupun tubuhnya terlihat normal. “Saya ketahui penyakit Putry Nesya setelah saya bawa ke RSUZ Banda Aceh pada 17 November 2011. Saat di Banda Aceh, dokter mengatakan, Putry Nesya mengalami bocor jantung dan harus dibawa ke Jakarta, karena di Banda Aceh

sekitar 5.057 pelanggar yang disidang dengan kehadiran pelanggar 3.456 orang berkisar Rp79.339.500. (m38)

Ulama Minta ....

Mustafa meminta agar kedamaian yang telah tercipta selama ini dijaga, dan tidak mudah terpengaruh dengan segala tindakan anarkis yang tidak benar, apalagi perbuatan membunuh dan membuat rusuh keadaan. “Jangan adalagi pertumpahan darah. Apa yang telah terjadi, jangan sampai terulang lagi,” ujarnya. Menurutnya, saat ini Aceh sedang menghadapi situasi genting, banyak hal dari kebijakan politik yang tidak memuaskan, tetapi beginilah kenyataan politik di Aceh. Abu Paloh Gadeng, demikian dia disapa amat tidak setuju dengan setiap kekerasan, karena apapun alasannya, agama tidak membenarkan akan hal itu. Sementara itu, korban tembakan komplotan pria bersenjata api, kini kondisinya kian membaik. Dari lima korban luka tembak yang masih hidup, empat di antaranya dirawat di Rumah Sakit Umum Daerah Cut Meutia (RSUD CM) Lhokseumawe. (b14/b13)

Waspada/Marolop Panggabean

MOBIL kijang Avanza yang dipergunakan kawanan perampok diamankan di Polres Taput.

Perampok-Polisi ....

dan meninggalkan mobil karena ban belakang pecah ditembak polisi. Mereka kabur ke hutan sekitar Desa Banua Aji (berbatasan Tapteng). Menurut Kapolres Taput, AKBP IKG Widjatmika, S.Ik, Rabu (7/12), melalui kerja keras, tim Serse Polres melumpuhkan satu dari enam kawanan pelaku, dengan tembakan di punggung. Sedangkan yang lainnya melarikan diri ke hutan Banua Aji dan menjadi target pengejaran Serse Polres Taput. Tersangka yang dilumpuhkan, yakni BM, 47, warga Launa Bulu II Kec. Buttu Raja, Kab. Dairi. Tersangka masih berada di RSU Tarutung untuk menjalani operasi mengeluarkan

peluru dari punggungnya. Mobil Toyota Avanza milik kawanan itu dan pick up L300 milik korban, diamankan di Polres Taput sebagai barang bukti. Dalam penyisiran di tengah hutan, tim Polres menemukan buku speksi mobil milik korban yang dibuang, bersama pakaian tersangka. Sementara BM mengatakan, kawan-kawanya berasal dari Medan dan melarikan diri ke gunung. Kata Kapolres, untuk mengantisipasi hal-hal lain, pihak TNI-AD dari Kesatuan 123 Lapo Gambiri sudah diminta untuk membantu, karena lokasi yang disisir sudah mendekati lapangan tembak mereka. (c12)

Nazaruddin Protes ....

Khusus Tindak Pidana Korupsi Jakarta, Rabu (7/12). Nazar mencontohkan hal yang tidak masuk akal dan tidak sesuai fakta, yakni disebutkan dirinya dan istri tercantum sebagai pemegang saham Grup Permai. “Harusnya konfirmasi dulu penyidik ke saya atas semua kesaksian tersebut. Tapi saya tidak pernah dikonfirmasi,” Karena alasan itu pula, mantan Bendahara Umum DPP Partai Demokrat ini mengatakan bahwa pengadilan yang sedang ia jalani ha-

nyalah rekayasa. Hal tersebut tertuang dalam nota keberatan sebanyak 20 lembar yang dibuat dan dibacakan oleh terdakwa dalam persidangan. “Pengadilan ini hanya direkayasa, dan saya ditipu untuk pergi ke Singapura, ternyata saya direkayasa seperti ini. Saya tidak pernah di BAP sejak 25 Agustus 2011, faktanya saat saya dipanggil terkait Wafid (Muharam, mantan sekretaris Menpora, red) , saya malah ditolak penyidik untuk memberikan tambahan keterangan tentang semuanya,” ujar Nazaruddin.

Mantan anggota Komisi III DPR ini, meminta Majelis Hakim Tipikor untuk membatalkan dakwaan JPU dari KPK terhadap dirinya. Nazaruddin didakwa menerima lima lembar cek senilai Rp4,6 miliar dari Mohammad El Idris terkait proyek wisma atlet Palembang, dari manager marketing PT Duta Graha Indah Tbk. Jaksa dengan dakwaan alternatif yaitu pasal 12 huruf b dan atau pasal 5 ayat 2 jo Pasal 5 ayat 1 huruf b dan atau Pasal UndangUndang (UU) Pemberantasan Tindak Pidana Korupsi.

tidak ada alat untuk mengobatinya, Azmi mengalami kelainan di kaki kirinya,” kata Ismail, orang tua dua bocah malang tersebut kepada wartawan belum lama ini. Mendengar kata dokter, Putri Nesya harus dibawa ke Jakarta, Ismail lemas karena memikirkan kondisi ekonominya yang tidak mungkin membawa buah hatinya itu ke Jakarta. Namun, dia terus berpikir. Sebagai orang tua harus bisa membawa anaknya ke Jakarta walapun kondisinya serba kekurangan. “Saat itu saya berpikir, jangankan untuk membawa anak saya ke Jakarta, untuk menutupi kebutuhan sehari-hari saja sangat sulit. Saya hanya muge ayam yang masuk gampong keluar gampong dengan pendapatan pas-pasan,” ucapnya. Ismail menceritakan, Putry Nesya sempat masuk TK,

namun menjelang masuk sekolah MIN, ia batuk-batuk, lalu demam dan mengeluh sakit kepala serta perut. “Kendati kondisinya saat itu demikian, tapi ia tetap ingin pergi ke sekolah, sehingga saya berinisiatif mengantarnya hingga ke dalam lokal sekolah saban hari, namun setiap pulang sekolah, ia sering terduduk dan tak sanggunp bergerak, mengeluh sakit di bagian jantungnya,” kenang Ismail. Karena melihat anak kesayangannya mengalami seperti i t u , Is m a i l m e m u t u s k a n membawa ke RSUD. Pertama kali, dokter memvonis anaknya menderita gizi buruk, kali kedua penyakit anaknya tersebut berdasarkan hasil rotgen yang dilakukan 20 Oktober menderita pembekakan jantung. Karena bingung, Ismail memutuskan membawa anaknya ke RSUZ Banda Aceh.

Saat itulah baru diketahui penyakit anaknya yang sebenarnya yaitu bocor jantung. Belum selesai memikirkan penyakit anak perempuannya itu, kini Ismail kembali dicoba yang Maha Kuasa. Anak laki-laki bungsunya M Azmi menderita kelainan di bagian kaki kiri, sehingga tidak bisa berjalan normal. Rasanya lengkap sudah derita yang dialami Ismail. Namun, katanya, ia berinisiatif membawa M Azmi ke tempat terapi. Hasilnya, kakinya mulai berubah dan sudah bisa digerak-gerakkan serta mampu berdiri dengan menyangga. Ismail dan Nursalwa berharap ada yang donator atau dermawan terketuk untuk membantu dua anak manusia ini yang sedang menanti dan mengharapkan belas kasihan ini. * Abdul Mukthi Hasan

Berita Utama

A2 Sejumlah SPBU Selalu Kehabisan Stok MEDAN (Waspada): Sejumlah Stasiun Penyaluran Bahan Bakar Umum (SPBU) di Medan, kini selalu mengalami kehabisan stok BBM, sehingga masyarakat pemilik kenderaan roda dua dan empat kecewa. Pantauan Waspada, Rabu (7/12) SPBU yang selalu mengalami kelangkaan BBM yaitu SPBU Jalan SM Raja di samping Ramayana, SPBU di Jalan Bakti Sukaramai, SPBU di Jalan MT Haryono, Jalan Denai dan beberapa SPBU di sepanjang Jalan Veteran hingga Jalan Marelan Raya dan di Jalan Medan Belawan. Pemilik SPBU yang tidak ingin disebut namanya mengaku habisnya stok karena keterlambatan pendistribusian BBM ke stasiun mereka oleh Pertamina, sehingga omset penjualan menjadi berkurang dan konsumen kecewa. Namun, walau BBM habis di SPBU, ternyata penjualan BBM di tingkat eceran masih banyak diperdagangkan secara bebas. Padahal sesuai peraturan pembelian BBM melalui jerigen tidak dibenarkan. Jenis BBM yang paling banyak di jual para pedagang pengecer ini jenis Premium yang merupakan BBM paling banyak dibutuhkan bagi kenderaan masyarakat umum. Sedangkan tarif penjualan per liternya lebih tinggi dari harga eceran di SPBU yakni paling rendah Rp5.000 per liter, sedangkan di SPBU hanya Rp4.500 per liter. Stok BBM Masih Aman Kelangkaan BBM sehingga membuat banyak SPBU mengalami kehabisan penjualannya dibantah Pertamina. BUMN pengendali BBM ini menjelaskan, menjelang dan hingga akhir tahun 2011, stok bahan bakar minyak (BBM) untuk wilayah Sumatera Utara masih dalam kondisi aman dan tidak ada mengalamikendalabaikdalammasalahsupplymaupundistribusi. “Posisi stok BBM di Sumut tetap aman hingga akhir tahun, kita tidak ada masalah di supply dan distribusi. Stok premium masih ada 36.000 kilo liter (KL), sedangkan solar 40.000 KL,” kata External Relations PT Pertamina UPms Regional Sumbagut Sonny Mirath kepada Waspada, Selasa (29/11). Sonny menyebutkan, untuk persediaan BBM pada Natal dan Tahun Baru, Pertamina akan menyiapkan langkah-langkah perencanaan seperti pembentukan tim satuan tugas (satgas) dalam memenuhi permintaan masyarakat pada hari besar tersebut. “Untuk penambahan stok khusus Natal dan tahun baru, beberapa tahun terakhir kenaikan permintaan tidak terlalu signifikan,” ujarnya. (m35)

Bus Trans Medan ... Menurutnya, kota ini membutuhkan angkutan massal karena tingkat kemacatan di Medan semakin parah sekaligus untuk memberikan kenyamanan. Jadi keberadaan angkutan massal ini diharapkan bisa mengurangikemacatanhingga40persen. Data Badan Pusat Statistik (BPS) Sumut, penduduk Kota Medan tercatat sebanyak 2.121.953 jiwa. Namun, pada waktu-

Ada-ada Saja ... diri sebagai targetnya. Polisi mengatakan tersangka Anthony Miranda,24,menodongkanpistolnya ke arah korbannya yang sedang duduk di dalam mobil saat parkir. Seperti dilansir MSNBC, Rabu (7/12), tersangka kemudian mendekati pria itu pada Jumat siang lalu, dan meminta barangbarang berharga milik pria itu. Di bawah todongan pistol pria tadi menuruti permintaan tersangka. Namun tersangka melakukan kesalahan besar dengan menyuruh korbannya keluar dari mobil. Pria tadi kemudian dengan cepat meraih pistol tersangka. Di saat bersamaan tersangka sempat menarik pelatuk pistol namun mengenai kakinya sendiri. Kepada polisi, pria yang menjadi korban tersebut berusia 33 tahun, mengatakan bahwa ia sering mengikuti pertarungan ‘Ultimate Fighting’ dan kompetisi seni bela diri lainnya. Polisi memperkirakan korban termasuk ahli bela diri yang hebat karena tersangka mengalami luka bonyok cukup parah di bagian tubuh dan wajah akibat ‘dikarate’. Tersangka ditangkap dengan membayar uang jaminan US$350.000 atau sekira Rp 3,1 miliar. (msnbc/rzl)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Kf2+.

waktu tertentu, penduduk Medan bertambah ratusan ribu jiwa yang disebut commuters. Dalam rencana, Trans Medan ini akan berjalan bersamaan dengan kendaraan lain baik pribadi maupun angkutan kota (angkot) di jalan umum sekarang ini. Tidak ada jalur khusus untuk bus Trans Medan. Operasionalnya juga akan tepat waktu sehingga penumpang memiliki kepastian ketika naik bus ini. Sementara, Ketua Organisasi Angkutan Darat (Organda) Medan Mont Gomery Munthe menolak rencana ini. Pihaknya menilai rencana Pemko ini justru menimbulkan masalah baru karena akan menyebabkan pengangguran.“Total ada 12.000 angkot yang tergabung dalam Organda dengan jumlah sopir mencapai 24.000 orang. Kalau rencana Pemko tersebut direalisasikan, seluruhnya terancam tidak memiliki penghasilan lagi,” katanya. (m50)

Waspada/M Panggabean


Perampok Dan Polisi ... Mobil Toyota Avanza milik kawananitudanpickupL300milik korban, diamankan di Polres Taput sebagai barang bukti. Dalam penyisiran di tengah hutan, tim Polres menemukan buku speksi mobil milik korban yang dibuang, bersama pakaian tersangka. Sementara BM mengatakan, kawan-kawanya berasal dari Medan dan melarikan diri ke gunung. Kata Kapolres, untuk mengantisipasi hal-hal lain, pihak TNI-AD dari Kesatuan 123 Lapo Gambiri sudah diminta untuk membantu, karena lokasi yang disisir sudah mendekati lapangan tembak mereka. (c12)

2. MxK, MxM.

Kota Medan ...

3. Kg3 atau Ke3, e1(B)+.

dibenahi. Sebab, jika ingin perekonomian maju maka infrastruktur yang menjadi urat nadi harus ditangani dengan baik. Salah satunya dengan membentuk patroli yang memantau dan memperbaiki kondisi jalan kurang baik serta merehabilitasi hampir seluruh ruas jalan. Kemudian, lanjutnya, melakukan penataan drainase, mengembangkan gotong royong di tingkat lingkungan yang terkesan sederhana namun memiliki manfaat nyata di tengah-tengah masyarakat. Hal itu dilakukan karena hampir seluruh aktivitas social ekonomi masyarakat membutuhkan infrastruktur yang baik sehingga dapat menciptakan kondisi aman dan nya-

4. Kf1, MxK+mat. (Jika 2. Rg1, Kh3+. 3. Rh1, Mg1+mat).

Jawaban TTS: TTS Topik





Jawaban Sudoku: 8 1 6 9 3 7 2 4 5

5 9 2 6 8 4 7 3 1

7 4 3 1 5 2 9 8 6

9 2 8 7 1 3 6 5 4

4 3 1 5 6 9 8 2 7

6 7 5 2 4 8 1 9 3

3 8 7 4 9 6 5 1 2

1 6 4 8 2 5 3 7 9

2 5 9 3 7 1 4 6 8

DPRDSU ‘Gerah’ BPK Audit Anggaran Reses MEDAN (Waspada): Dialog hangat terjadi antara Badan Pemeriksa Keuangan (BPK) RI Perwakilan Sumut dengan anggota DPRD Sumut pada acara rapat kerja (Raker) dewan membahas program kerja 2012, di Berastagi. Anggota dewan merasa ‘gerah’ dengan tindakan BPK yang mengaudit anggaran reses mereka. Berbagai hal (mulai dari pernyataan, pertanyaan sampainadamengancam)disampaikan sejumlah anggota dewan. Selasa (6/12) sore, kegiatan Raker DPRD Sumut diisi kegiatan paparan oleh BPK. Pembicara adalah Kepala Sub Auditoriat BPK RI Perwakilan Sumut Aryo Seto. Awalnya, anggota dewan terlihat tenang-tenang mendengarkan paparan yang disampaikan Aryo. Diskusi mulai hangat saat sesi tanya jawab dibuka. Wakil Ketua DPRD Chaidir Ritonga, yang menjadi moderator sampai kewalahan membatasi anggota dewan yang bersemangat bertanya. Persoalan dana reses langsung menjadi topik saat anggota dewan dari Fraksi PAN Irwansyah Damanik, diberi kesem-

patan pertama bertanya. Disusul Tahan Manahan Panggabean, Mustofawiyah Sitompul, Isma Fadly Pulungan. Kemudian berlanjut lagi oleh anggota dewan lainnya Marasal Hutasoit, Budiman Nadapdap, Bustami HS, Arifin Nainggolan dan sejumlah anggota dewan lainnya. Berbagai statemen diungkapkan anggota DPRD Sumut pada diskusi itu. Mulai dari membujuk BPK untuk menjaga hubungan baik, sampai pernyataan yang mengancam, bahwa DPRD juga mempunyai wewenang pengawasan. Ketua Fraksi Partai Demokrat (FPD) Tahan Panggabean, mengatakan sudah tiga kali DPRD Sumut diharuskan mengembalikan uang reses. Padahal, katanya, hampir tidak ada anggota dewan yang tidak melakukan reses. Malah uang reses yang mereka terima Rp35 juta kurang. Dalam hal ini, dia merasa dewan tidak diperlakukan dengan baik. ‘’Mungkin saja suatu saat dewan juga akan menjalankan fungsinya. Yakni mengawasi BPK,’’ kata Tahan Panggabean.

Kakek Selundupkan ...

lui mesin X-Ray. Berdasarkan data pada Passenger Analysis Unit (PAU), petugas menetapkan target operasi terhadap seorang penumpang memegang paspor nomor U273850. “ Hasil pemindaian dengan menggunakan mesin X-Ray, tidak terdapat image yang mencurigakan pada barang bawaannya,” jelas Parinding, didampingi anggota Custom Narcotic Teams Hery Supomo dan Kapol Sub Sektor KPPPTeluknibung Ipda P Sihombing.Ketika dilakukan pemeriksaan badan, petugas menemukan sabu disembunyikan di kantong jaket bagian dalam. Hasil identifikasi menggunakan narcotest, kata Parinding, serbuk kristal putih itu positif Methamphetamineatausabudengan rincian masing-masing amplop seberat 101 gram atau totalnya 202 gram senilai Rp 505 juta. Kepada Waspada, IY mengatakan, sabu itu dibawanya dari Malaysiaatasperintahpriaberinisial Az, warga Aceh dengan upah Rp 10 juta. “ Aku ke Malaysia chek up karena menderita Diabetes Melitus. Dan, ketika Az menawari upah Rp 10 juta,langsung kuterima, kan bisa membantu biaya perobatan,” kata IY petani cabai di Bireuen. (a14/a32)

Kantor KPPBC Teluknibung Rahmady Effendi Hutahaean melalui Kasi P2 Triyanta Gala Parinding. Didampingi Kasi PabeanYusep Sasmita dan bagian Humas AgusYudha. Parinding menjelaskan, IY penumpang Fery MV. Ocean Star ditangkap setelah petugas memindai seluruh barang bawaan penumpang mela-

China Tangkap ... meski belum ada dakwaan resmi terhadap para tersangka. Dalam pernyataannya melalui situs online, Kementrian Keamanan Umum mengatakan sekira 5.000 polisidari10provinsibekerjasama dalam enam bulan terakhir dan berhasil menciduk para tersangka pada akhir pekan lalu. Anak perempuan dan wanita dewasa juga mengalami penculikan dan diperkejakan sebagai buruh atau sebagai pengantin untuk anak yang tak dinikahi. Puluhan ribu anak dilaporkan hilang setiap tahunnya, meski jumlah pasti dari para korban sulit untuk diketahui. Anak-anak yang diselamatkan rencananya akan di titipkan di panti asuhan. (ap/rzl)

Pada kesempatan tersebut Gatot mengundang kehadiran seluruh delegasi untuk menyaksikan Pesta Danau Toba yang akan dilaksanakan di Parapat 27-30 Desember 2011. Pada kesempatan tersebut Gatot mempromosikan sejumlah proyek prioritas dalam mendukung Master Plan Percepatan Perluasan Pembangunan Ekonomi Indonesia (MP3I) koridor Sumatera. Di antaranya proyek pembangunan kluster industri kelapa sawit Sei Mangkei, pembangunan ruas tol Medan-Kualanamu-Tebingtinggi sepanjang 60 kilometer. Kemudian ruas tol Medan-Binjai sepanjang 15,8 kilometer dan bendungan Simeme di Kec.Biru-biru Deliserdang. Menurut Gatot, tahun 2017, interkoneksi listrik antara Malaysia (Malaka) dengan Pulau Sumatera (Pekan Baru) selesai dibangun sehingga diharapkan dapat mengatasi persoalan defisit listrik di Pulau Sumatera. Mega proyek interkoneksi daya Malaka-Riauinimerupakansalah satu bentuk realisasi dari Forum IMT-GT (Indonesia-MalaysiaThailand-Growth Triangle). Erick Sidgwick dari Asian De-

velopment Bank (ADB) dalam Forum Gubernur IMTG menjelaskan, PLN dan TNB (Tenaga Nasional Berhard) sepakat membentuk tim untuk bekerja dalam proyek. Pada tahun 2013 diharapkan pembangunan konstruksi interkoneksi ini dapat dimulai.Diharapkan proyek tersebut memperoleh dukungan pembiayaan Asian Development Bank (ADB). Dalam Forum Gubernur hadir Gubernur Sumatera Barat DR Irwan Prayitno, Ketua Joint Business Council (JBC) IMT-GT Thailand Bonchuay ChansiliwathanaThamrong, Ketua JBC IMTGT Indonesia, Irfan Mutyara, KetuaJBCIMT-GTMalaysia,Dato’ Haji Faudzi Naim Bin Haji Noh, Wakil Ketua BKPM Indonesia Ahmad Kurniadi dan para delegasi ke tiga negara. Forum gubernur ini adalah rangkaian pertemuan IMT-GT yang berlangsung sejak tanggal 5-7 Desember 2011 di JW Mariott Hotel Medan. Seperti diketahui Indonesia-Malaysia-Thailand Growth Triangle (IMT-GT) adalah sebuah inisiatif kerjasama subregionalyangdibentukpadatahun1993 oleh pemerintah Indonesia, Malaysia dan Thailand. (m28)

man bagi masyarakat. Itu sebabnya Rahudman menegaskan pihaknya akan terus bekerja keras untuk untuk meningkatkan kualitas infrastruktur, tentunya dengan dukungan alokasi APBD maupun dukungan sumber pembiayaan lainnya. Seperti contoh pembangunan fly over Simpang Pos melalui pendanaan dari APBN. Pembangunan ini diharapkan mampu mengatasi kerugian masyarakat yang diakibatkan kepadatan lalulintas. Sedangkan penerimaan penghargaan piagam ICT Pura, jelasnya, lantaran Kota Medan dinilai mampu menerapkan teknologi informasi dan komunikasi guna mendukung penyelenggaraan pelayanan publik. Dalam watu dekat ini, Medan

akan memiliki sistem informasi geospasial yang akurat dan handal, pemanfaatannya sangat luas di berbagai sektor pembangunan. “Jadi sekali lagi saya sampaikan, dua penghargaan yang kita raih ini didedikasikan untuk seluruh warga Kota Medan,” ungkapnya. Malam syukuran ini turut dihadiri Sekda Kota Medan Ir Syaiful Bahri, Forum Komunikasi Pimpinan Daerah Kota Medan, anggota DPRD Medan, tokoh agama dan pemuda, Ketua TP PKK Kota Medan Hj Yusra Rahudman Harahap MM, seluruh pimpinan Satuan Kerja Perangkat Daerah (SKPD), Camat dan Lurah di lingkungan Pemko Medan serta undangan lainnya. (m50)

Plt Gubsu: Perkuat ...

Al Bayan ... Ketika ayahnya pulang dari pasar membawa makanan lezat, dan meminta putri kesayangannya memncicipinya, sang anak bertanya: Ayah, saya tidak mau makan sebelum ayah terangkan, dari mana engkau memperoleh uang ini. Jika dari sumber yang halal saya mau memakannya, tetapi jika sumbernya haram saya tidak memakannya.” Sang ayah berkata mengguruinya. “Kalau makanan itu haram dan tidak ada lagi yang bisa dimakan, apakah itu tidak dibenarkan?” Rabi’ah kecil menjawab tegas: “Wahai ayah! aku tetap bersabar menghadapi lapar di dunia dari pada aku harus bersabar menghadapi siksa api neraka di hari kiamat kelak”. Itulah gadis kecil Rabi’ah al-Adawiyah, sejak usia enam tahun sudah memelihara diri dari makanan yang haram. Hikmah memelihara diri dari makanan yang haram, Rabi’ah kelak menjadi seorang ulama wanita besar yang paling cinta kepada Allah. Hatinya terang, otaknya cerdas, terbuka hijab, dan doanya dikabulkan Allah.

Di zaman sekarang, sangat sedikit—barangkali tidak ada sama sekali—gadis yang seteguh iman Rabi’ah al-Adawiyah. Jikapun ada, mungkin satu di antara sejuta manusia. Kebanyakan gadis sekarang, tidak peduli terhadap sumber makanan yang dimakannya. Apakah ayahnya seorang koruptor atau bukan? Apakah ayahnya seorang yang mendapat kursi karena KKN atau bukan? Pokoknya ayahnya pejabat atau orang berduit habis perkara. Malah kebanyakan gadis-gadis zaman sekarang menggoda ayahnya supaya dibeli mobil mewah, sekolah ke luar negeri atau menambah tabungannya di bank riba. Pada gilirannya, bukan bahagia yang ia dapatkan, malah kecelakaan semua keluarga. Ayahnya dihina rakyat karena korupsi, ibunya dimaki karena tampil glamour. Ia sendiri tak siap menerima cerca. Akhirnya, ia tak mungkin tampil di tengah-tengah masyarakat sebagai generasi yang berkualitas. Malah namanya tenggelam dari daftar nama pemudi pelopor. Ia hanya dikenal oleh kalangan hidung belang, karena telah menyulap dirinya sebagai kupu-kupu malam.

Disebutkan Aryo Seto, BPK tidak mengenal kata pencitraan dalam menjalankan tugasnya. Sebelum melakukan pemeriksaan, BPK terlebih dahulu memperhatikan data-data pendukung dari objek yang akan diperiksa. Salah satu diantara yang menjadi sasaran pemeriksaan BPK adalah hal-hal yang menjadi sorotan masyarakat. Kata Aryo Seto, sesuai tugasnya, BPK melakukan pemeriksaan terhadap anggaran yang sudah digunakan. Kalau audit terhadap anggaran sedang berjalan, merupakan wewenang inspektorat. Khusus menyangkut dana reses, menurut Aryo Seto, BPK melakukan pengujian eksistensi. Misalnya untuk biaya sewa menyewa, BPK melakukan konfirmasi kepada pihak penyewa. Hasilnya didapati pengakuan tidak pernah ada sewa menyewa itu. ‘’Konsekwensinya BPK membuat rekomendasi, dana tersebut dikembalikan ke kas daerah,’’ kata Aryo. Buat pusing Diungkapkan sejumlah anggotaDPRDSumutpadaacara itu, dana reses membuat mereka pusing. Padahal saat pelaksanaan reses, anggota dewan tidak dibenarkan memegang uang kontan. Seluruh kebutuhan reses disediakan oleh staf DPRD, termasuk laporan keuangannya. Item yang dapat dibayarkan dari dana reses juga sangat terbatas. Hanya boleh untuk biaya sewa teratak, kursi, sound system dan biaya makan. Padahal masih ada biaya-biaya lain yang harus dikeluarkan dewan. Termasuk biaya transport masyarakat yang menghadiri kegiatan reses dewan. Menurut Ketua Fraksi PDIP Budiman Nadapdap, anggota dewan sudah melaksanakan reses dengan sangat transparan. Pengeluaran reses seluruhnya dicatat staf dengan sangat jelas. Sikap terus terang disampaikan anggota FPD Arifin Nainggolan. Katanya, inti dari masalah ini adalah persahabatan. Dia memberikan contoh DPRD DKI Jakarta. Katanya, BPK sulit menjumpai temuan di DPRD itu. Karena DPRD dan BPK nya bersahabat. Di Sumut, Arifin Nainggolan, berharap seperti itu, karena dewan dan BPK sama-sama mempunyai fungsi pengawasan. Katanya, jangan sampai jeruk makan jeruk. ‘’Kalau ada masalah di dewan tidak usahlah dipermasalahkan,’’ katanya. (m12)

Bakar Diri Di Depan ... Polisi tersebut mengatakan hingga kini belum diketahui motif perbuatannya. “Agak aneh, karena kalau memang sengaja jadi bagian aksi itu, pasti dia ingin disorot media massa. Tapi ini sepertinya tidak disengaja,” jelasnya. Luka bakar yang dialami pria ini sangat parah, mengingat seluruh pakaian korban terbakar habis, hanya menyisakan celana dalam dan sepatu korban. Sedangkan identitas diri sudah terbakar habis. Saat ini tim Polres Jakarta Pusat masih menyelidiki penyebabnya. Sambil menunggu proses operasi selesai. (vvn)

WASPADA Kamis 8 Desember 2011

Muharram Momentum ... Demikian ditekankan ustadz DR Achyar Zein, MA pada acara Tabligh Akbar Road to Dakwah Waspada di Masjid Agung Rantauprapat, Rabu (7/12) sore. Achyar Zein mengatakan, perubahan akhlak adalah upaya yang harus dilakukan secara terus menerus oleh umat Islam dimana pun dan kapan pun khususnya oleh umat Islam yang ada di Labuhanbatu khususnya jamaah tabligh akbar Road to Dakwah Waspada dan termasuk juru dakwah seperti dirinya sendiri. Hijrah ke arah yang lebih baik itu dimulai dari diri sendiri, di dalam keluarga, masyarakat, bangsa dan negara. Mungkin hijrah yang dilakukan oleh Nabi Muhammad SAW beserta sahabat tidak bisa kita tiru sepenuhnya, tetapi paling tidak perubahan ke arah yang lebih baik itu sedikit demi sedikit tercermin dalam perilaku hidup sehari-hari. Mari tunjukkan, mulai Muharram 1433 Hijriyah ini tercermin perubahan akhlak yang lebih baik dari cara suami menyayangi istri, cara istri menghormati suami, cara orang tua mengasuh anak, cara anak menghormati orang tuanya. ‘’ Lanjutkan pula perubahan yang lebih baik itu dalam pekerjaan kita sehari-hari, dalam menjalankan prosedur, administrasi dan mekanisme di kantor, baik pemerintahan maupun swasta, dalam mengelola dan menata manajemen kantor, pola atasan menghadapi bawahan dan pola bahwahan bersikap terhadap atasan,’’ katanya. Putra Kec. Kualuh Leidong, Kab. Labuhanbatu Utara itu

12 Ribu Pelanggar ... “Sebelumnya Pengadilan Negeri Medan juga telah melaksanakan sidang tilang tersebut dengan dana tilang yang diserahkan oleh pelanggar sekitar Rp90.939.500. Sehingga totalnya hingga saat ini mencapai Rp242.048.000 dan dana tersebut diserahkan di Kejari Medan,” ujarnya. Ahmad Guntur menambahkan jika kemungkinan pada Jumat (9/12), berkas tersebut lebih dari 6000 berkas , ada penambahan hakim untuk menanganinya. “Ya apalagi kita mendengar ada sekitar 7000 berkas yang akan disidangkan, dan ini harus dipersiapkan lebih awal untuk menangani sidang tersebut,” lanjutnya. Sementara Muhammad Syarif menyatakan adapun denda tilang yang dikenakan kepada warga yang melanggar lalulintas bervariasi. “Namun biasanya yang hadir di persidangan dendanya tidak diberatkan oleh hakim berkisar Rp20.000 s/d Rp30.000 untuk menembusnya,” ujarnya. Tentu, lanjut Guntur, sesampainya pengambilan SIM, ataupun STNK, kita menerapkan apa yang sesuai dijatuhi majelis hakim tidak ada penambahan ataupun pengurangan didalam pengambilan tersebut. “Bagi yang tidak datang didalam persidangan, maka pelanggar akan langsung mengambil SIM ataupun STNK nya di Kejari Medan. Karena setelah sidang selesai maka dana maupun berkas yang belum diambil diserahkan di Kejari Medan,” lanjutnya kembali. (m38)

Waspada/Armansyah Abdi

WAKIL Bupati L.Batu Suhari Pane SIP didampingi Camat Rantau Utara Harris Topan SH menyerahkan bantuan dari Harian Waspada untuk lima masjid di Rantauprapat. menambahkan, pada bulan Muharram 1433 Hijriyah ini, Harian Waspada ikut mengambil peran dan berpartisipasi dalam mengemban misi syiar Islam melalui dakwah secara langsung kepada umat selain menjalankan peran tradisional-nya selama ini yakni, dakwah secara tulisan (bilqalam) yang terbit setiap hari Jumat-nya. Selain itu, Harian Waspada melaksanakan tanggungjawabnya terhadap pemeliharaan dan penyelamatan anak-anak yatim dan piatu, fakir miskin dan jompo terlantar secara tidak langsung melalui lembaga Lajnah Waspada yang terus eksis hingga saat ini. “Kita doakan peran mulia tersebut terus digelorakan Waspada sampai kapan pun,” ujarnya. Peran syiar Islam (bilqalam) itu sampai menjelang usianya yang ke-65 tahun masih tetap eksis dan dengan demikian Harian Waspada telah berperan serta mengarahkan umat Islam untuk selalu iqra’ (membaca) dan memahami secara komprehensif ayat-ayat qauliyah dan ayat-ayat kauniyah guna bekal penyelamatan hidup untuk dunia dan akhirat. Pemimpin Umum Harian Waspada diwakili Redaktur Pelaksana Drs Dedi Syahputra, MA, dalam kesempatan itu menyampaikan, sebagai surat kabar bercirikan nasionalis religius, Harian Waspada membuat dirinya turut bertanggungjawab dan berbagi beban memberikan pencerahan kepada umat Islam lewat dakwah bil qalam dan dakwah secara langsung sesuai dengan misinya, yakni membelakebenarandankeadilan. Di tengah perkembangan zaman yang semakin kompleks dan dinamis ini, Harian Waspada terus melakukan inovasi dalam metode peran syiar Islam-nya. Dengan inovasi dalam metode pencerahan umat ini, Harian Waspada mengharapkan tumbuhnya pola fikir, sikap dan tindakan umat Islam yang rasional, islamis dan berperadaban tinggi. Sementara Wakil Bupati L.Batu Suhari Pane SIP dalam sambutannya menyatakan kekagumannya dengan metode dakwah yang dilakukan Harian Waspada. Katanya, peran Pemerintah Labuhanbatu sebagaimana tercantum dalam misi meraih kemajuan-kemajuan pada dimensi mental-spritual (berahklakul karimah), keagamaan, dan meningkatkan kecerdasan dan kualitas SDM yang beriman dan bertakwa kepada Tuhan Yang Maha Esa guna mencapai Visi Labuhanbatu Mandiri 2015, sebagian telah ditanggungjawabi

oleh Harian Waspada dengan syiar Islam-nya melalui tulisan dan semakin dinamis lagi dengan cara dakwah secara langsung menjumpai pembacanya. Karena itu, tambahnya, Pemkab L.Batu menyatakan terima kasihnya kepada Harian Waspada atas peranannya memelihara dan membantu perubahan akhlak umat ke arah yang lebih baik. Jika akhlak sudah semakin baik karena peran syiar Islam Waspada, peran Pemkab L.Batu untuk mewujudkan Visi Labuhanbatu Mandiri, insya Allah akan tercapai. Dan kami mintakan kemitraan strategis Pemkab L.Batu dan Waspada tidak berhenti sampai disini,” sebut Suhari Pane seraya menandaskan, Waspada yang dibidani Mohammad Said (alm) dan merupakan putra L.Batu (Labuhan Bilik) itu turut berkontribusi menjadikan dirinya seperti sekarang ini. Tabligh akbar dihadiri lebih kurang 700 orang, terdiri dari jemaah Wirid Yasin Akbar Kec. Rantau Utara dan Rantau Selatan, unsur Muspida Plus, unsur SKPD, Ketua DP MUI dan unsur Kantor Kemenag L.Batu, Camat Rantau Utara Harris Topan SH dan Camat Rantau Selatan Herry AP dan para lurah. Turut hadir unsur PD IPHI, DPD BKPRMI, PD AlWashliyah, PD Muhammadiyah, BKMT dan dari berbagai lembaga keagamaan Islam lainnya. Harian Waspada melalui Redpel Dedi Syahputra beserta Bagian Litbang Akmal AZ dan Humas Drs Erwan Effendi Batubara MA memberikan santunan kepadaanak-anakpenghuniPanti Asuhan Al Arif Alwashliyah dan menyerahkan bantuan ambal, Alquran dan mukena kepada lima masjid/musholla yang ada di Rantauprapat. (a18/a17/c07)

Bom Meledak Di Afghanistan, 19 Tewas KANDAHAR, Afghanistan (Waspada): Pengeboman masih berlanjut di Afghanistan. Rabu (7/12) satu bom jalanan meledak di Provinsi Helmand, Afghanistan Selatan, menewaskan 19 orang, 12 di antaranya wanita dan anak-anak, demikian menurut pejabat lokal. Satu minibus melindas satu bom pada saat meluncur di selatan Afghanistan, yang memicu ledakan, kata mereka. Kendaraan itu berjalan di satu jalanan di distrik rawan Sangin — satu kubu Taliban — di Provinsi Helmand ketika tergilas bom, kata Daoud Ahmadi, seorang jurubicara pemerintah Helmand. (ap/m10)

WASPADA Kamis 8 Desember 2011

Pasukan Ditarik Dari Moskow Digantikan Oleh Helikopter MOSKOW, Rusia (AP): Ribuan pasukan keamanan ditarik keluar dariMoskow,namunhelikoptermenderu-deruterbangdiatasibukota Rusia itu Rabu (7/12), yang menunjukkan adanya unjuk kekuatan menyusul pemilu yang diwarnai skandal. Pemilu itu menunjukkan partaiPMVladimirPutinberjuangkerasuntuktetapmenjadimayoritas. PutinsecararesmimendaftarkandiriRabuuntukikutdalampemilihan presiden yang akan dilakukan Maret depan namun protes luar biasa berkelanjutan dua hari terakhir menunjukkan amarah oposisi Rusia yang menunjukkan dia berusaha merebut kembali jabatan lamanya. Ribuan warga Rusia yang melakukan rapat umum di Moskow dan St. Petersburg yang berhadapan langsung dengan polisi dan pasukan Kementerian Dalam Negeri, yang berhasil menahan ratusan pemrotes, termasuk para jurnalis. Serikat Jurnalis Rusia Rabu mengutuk “kekerasan polisi dan menyerukanagardilakukanpenyelidikanterhadappuluhanserangan danmenangkapsejumlahjurnalis,yangmenganggapmerekasebagai ‘satu usaha untuk mengintimidasi masyarakat.” Rapat umum diperkirakan akan berlanjut Rabu, bersamaan dengan rapat umum pro-Putin yang berkumpul di Moskow yang dihadiri beberapa ratus orang. Kecaman AS tak dapat diterima Sementara itu, Rusia menyatakan tidak dapat menerima komentar Menlu AS Hillary Clinton mengenai pemilihan parlemen Rusia tidak bisa diterima, kata Kementerian Luar Negeri Rusia. Hillary mengatakan, bahwa pemilu anggota Duma Rusia yang diselenggarakan pada Minggu “tidak bebas dan adil”. Beberapa pejabat Gedung Putih lainnya juga mengatakan Washington prihatin serius terhadap pemilihan umum di Rusia. Kementerian Luar Negeri Rusia mengatakan, Rusia mengharapkan pihak AS untuk menahan diri dari pernyataan tidak ramah yang bertentangan dengan arah positif umum hubungan bilateral. Presiden Rusia Dmitry Medvedev Selasa juga memangkas kritik Washington mengenai pemilihan Duma, mengatakan bahwa sistem politik adalah urusan internal Rusia. “Jika mereka mengamati pemilu dan menemukan pelanggaran, itu adalah satu hal. Tetapi masalah sistem politik Rusia bukanlah urusan mereka,”katanya. (m10)

AS Didesak Ubah Siasat Dalam Hadapi Pakistan WASHINGTON, AS (Antara/AFP): Amerika Serikat harus mengubah siasat hubungan dengan Pakistan sambil menangani dampak terburuk tentaranya, kata pakar, yang membantu mengembangkan pendekatan negara adidaya itu dengan Islamabad. Setelah berkuasa pada Januari 2009, Presiden Barack Obama menugaskanBruceRiedel,mantanagenbadansandiCIA,memimpin kajiankebijakanantarlembagadenganAfghanistandanPakistanuntuk Gedung Putih. Hasilnya mendesak pembicaraan erat dengan Pakistandanpeningkatanseranganpesawattanpaawakterhadapgerilyawan garis keras di perbatasan suku tanpa hukum di Pakistan Baratlaut. “Siasat tersebut masuk akal pada saat itu, tapi dalam perkembangan sekarang, ini saat untuk beralih ke kebijakan keterlibatan dan pembendungan,” kata Riedel, sekarang anggota terkemuka kelompok pemikir The Brookings Institution Selasa (6/12). Saat berbicara pada diskusi panel, dia mengatakan bahwa untuk saat ini,Washington tidak melakukan cukup pada bagian pembendungan, tapi tergelincir dan meluncur ke dalamnya tanpa kerangka terpadu. Pejabat AS, yang berbicara dengan syarat tak dikenali, menyatakan pemerintah Obama tidak berencana menerapkan kebijakan seperti itu pada saat ini. HubunganWashington dengan Islamabad memburuk sesudah gerakankhususASmenewaskanpemimpinalQaidaOsamabinLadin di kota tenang Pakistan, Abbottabad, pada Mei. Hubungan merosot ke titik terendah baru bulan lalu sesudah serangan udara persekutuan pertahanan Atlantik Utara (NATO) menewaskan 24 tentara Pakistan diperbatasanAfghanistan,yangmemicuPakistanmemboikotmuktamar Bonn mengenai masa depan Afghanistan.

Luar Negeri

Filipina Dan MILF Capai Persetujuan Perpanjang Mandat Pemantau Gencatan Senjata MANILA, Filipina (AP): Pemerintah Filipina dan kelompok pemberontak Muslim terbesar di negara tersebut Rabu (7/12) mencapai persetujuan perpanjangan mandat pemantau gencatan senjata internasional sampai 2013 meski terjadi serangkaian bentrokan akhir-akhir ini yang menewaskan sejumlah tentara dan pejuang Muslim. Pemerintah dan pejuang Front Pembebasan Islam Moro (MILF) juga mengatakan bahwa mereka akan melanjutkan pertemuan bulan depan untuk melakukan perundingan jalur-cepat mengenai perjanjian otonomi untuk masyarakat minoritas Muslimyangtelahberjuanguntuk mendapatkan pemerintahan

sendiri selama beberapa dasawarsa di negara yang didominasi Kristen itu. Rangkaian terakhir perundingan dilakukan di Malaysia, yang juga memimpin satu tim pemantau gencatan senjata. Kirakira 60 pemantau, yang berpangkalandidaerahselatanMindanao sejak 2004, juga beranggota Libya, Brunei, Norwegia, Jepang dan Uni Eropa. Rangkaianperundingantelah mengundang teka-teki sejak pemerintah menuduh pemberontak membunuh 19 pasukan pemerintah dalam satu penghadanganOktoberlalu.NamunPresidenBenignoAquinoIIImenolak seruan agar dilakukannya ofensif besar-besaran untuk menghapus pemberontak yang berkekuatan 11.000 pejuang dan menolak untuk menghentikan perundingan damai itu. Dalam pidato pembukaan perundingan itu di Kuala Lumpur Selasa, kepala perunding pemerintah Marvic Leonen menyerukan agar dicapainya penyelesaian

politik pada kuartal pertama tahun depan dan menegaskan kepuasannya dengan syarat-syarat yang diajukan. Pejuang MILF tidak berkomentar mengenai pernyataan bersama yang dikeluarkan dalam pertemuan itu. “Mari kita buktikan bahwa mekanisme gencatan senjata kita bukan surga bagi para penculik, pembunuh dan teroris, kata kepala perunding pemerintah itu. MILF membantah menampung unsur-unsur yang disebutkan itu. Abu Syayaf dituduh menculik Sementara itu, pasukan keamananFilipinaRabu menyalahkan semua kelompok Abu Sayyaf yang berkaitan dengan Al Qaida berada di balik penculikan seorang warga Australia di Filipina selatan yang bergolak. Ruben Cariaga,komandanpolisiProvinsi Zamboanga Sibugay, mengatakan ada indikasi dari model yang samadalampenculikansebelumnya sebagaimanaWarren Roduel dibawa oleh para penculiknya

pada Senin malam di kota Ipil. Roduel, 56 tahun, diculik dari rumahnya di Desa Meadows Subbagian Hijau, Pangi Atas di Kota Ipil pada sekitar pukul 18.00 waktu setempat. Pemerintah Australia telah memperingatkan warga negara mereka dari bepergian ke Filipina selatan karena penculikan. Pada saat yang sama, pemerintah Australia telah membentuk satuan tugas yang melibatkan perunding sandera yang terlatih untuk mengamati insiden tersebut. Cariaga mengatakan polisi dan militer sekarang melakukan operasi perburuan untuk kemungkinan penyelamatan korban yang diyakini terluka. Abu Sayyafdidirikanpadatahun1990andantelahmelakukansejumlah serangan kelas tinggi, termasuk penculikan, pemboman dan pemenggalan.MiliterFilipinamemperkirakan kelompok, yang memiliki hubungan dengan organisasi teroris eksternal seperti al Qaidaitu,saatinimemilikikurang dari 400 anggota.(m10)

Persaudaraan Muslim Nyatakan Menangi Pemilihan Kedua Mesir KAIRO, Mesir (AP): Partai politik Persaudaraan Muslim mengatakan Rabu (7/12) bahwa pihaknya telah memenangkan mayoritas kursi dalam pemilihan tahap kedua di Mesir, yang akan memberikannya sekurang-kurangnya40persenkursiparlemen yang telah diputuskan sejauh ini. Partai Kebebasan dan Keadilan mengatakan dalam satu pernyataan bahwa pihaknya telah memenangkan 36 dari 56 kursi yang khusus memilih para calon independen dalam pemungutan suara yang berakhir Selasa. Kelompok Islamis sebelum-

nya telah memenangkan hampir 37persensuaradalampemungutan suara pertama, yang perolehan kursi menurut daftar partai. Bagian politik dari Persaudaraan Muslim dan blok Islamis lainnya sejauh ini telah mendominasi pemilihan pertama setelah penggulingan Hosni Mubarak Februari lalu, dengan partai-partai liberal berada di belakangnya. Partai ultra-konservatif AlNour berada di urutan kedua setelahPersaudaraanMuslim,yang memenangkanhampirseperempat surat suara yang masuk pada pemungutansuaraakhirNovember

lalu. Al-Nour, yang terdiri dari para pengikut kecendrungan Islam Salafi, yang menganut hukum agama atau Syariah yang keras dan akan menjadikannya sebagai dasar negara. Jurubicara Partai Al-Nour Yousseri Hamed mengatakan kepada The Associated Press Rabu bahwa kelompoknya memenangkan sekurang-kurangnya lima kursi lagi dalam pemilihan tahap kedua Selasa. Surat suara dalam pemilihan terakhir itu masih terus dihitung.

Namun, beberapa tokoh Islamis,menghadapisatuperjuangan berat di Kairo. Calon Mostafa alNaggardariPartaiKeadilanberaliran liberal dan baru dibentuk untuk ikut pemilu mengatakan dia menangmelawancalonPersaudaraan Muslim dalam pemilihan kedua. Sementaraitui,Persaudaraan Muslimmengatakansalahseorang calonnya telah dikalahkan secara kontroversial oleh calon Al-Nour, Abdel-Monemel-Shahat,diIskandariyah,kotadipantaiutara.(m10)

AS Sambut Penandatanganan CTBT Oleh Indonesia JAKARTA (Waspada): Amerika Serikat menyambut baik ratifikasi Traktat Pelarangan Uji Coba Nuklir (CTBT) yang dilakukan Indonesia. “CTBT merupakan bagian penting dari upaya internasional untuk mencegah proliferasi senjata nuklir. Saya juga mendesak semua negara agar menandatanganinya dan meratifikasi perjanjian tersebut agar dapat diberlakukan secepat mungkin,” kata Presiden AS Barack Obama yang disampaikan Kedutaanbesar AS melalui siaran persnya ke Waspada Rabu (7/12). Menurut AS, ratifikasi itu merupakan contoh bagus tentang peran kepemimpinan yang positif, yang dapat Indonesia mainkan dalam upaya global demi mencegah penyebaran senjata nuklir. AS menegaskan, negaranya terus membahas pentingnya traktat tersebut terhadap keamanan AS dengan para anggota Senat. AS juga harus memimpin upaya global untuk mencegah proliferasi. Adopsi dan pemberlakuan segera CTBT juga akan menjadi bagian penting dari upaya tersebut. Menteri Luar Negeri Indonesia Marty Natalegawa juga mengatakan jaminan yang paling efektif terhadap ancaman dan penggunaan senjata nuklir adalah penghapusan senjata nuklir yang harus dilakukan tanpa syarat, mengikat secara hukum, non-diskriminatif dan tanpa menggunakan standar ganda yang berlaku bagi semua negara tanpa terkecuali. MenurutASpenandatangananCTBTitumerupakancontoh bagustentangperankepemim-inanyangpositifyangdapatdimainkan Indonesia dalam upaya global untuk mencegah penyebaran senjata nuklir. ComprehensiveTest BanTreaty merupakan bagian penting dari upaya internasional untuk mencegah proliferasi senjata nuklir. AS tetap berkomitmen penuh untuk menuju ratifikasi Test Ban Treaty tersebut dan akan terus membahas pentingnya traktat itu bagi keamanan AS dengan para anggota Senat. AS harus memimpin upaya global untuk mencegah proliferasi. Adopsi dan pemberlakuan segera CTBT merupakan bagian penting dari upaya tersebut.(m10)

A3 Mantan Presiden Israel Terlihat Tidak Menyesal Atas Kejahatannya JERUSALEM (AP): Mantan Presiden Israel Moshe Katsav dibawa ke penjara di kawasan pusat Israel Rabu (7/12) untuk menjalani hukuman tujuh tahun penjara karena melakukan pemerkosaan. Namun, dia mengatakan dirinya tidak bersalah dan menuduh Israel ‘menghukum’ dan ‘menguburnya hidup-hidup’. Televisi Israel memperlihatkan Katsav meninggalkan rumahnya di kota Kiryat Malachi dan masuk ke mobilnya untuk menempuh perjalanan selama satu jam menuju penjara Maasiyahu, di mana dia akan menjalani hukuman. Katsav dinyatakan bersalah Desember lalu dalam kasus memperkosa mantan karyawan perempuan ketika dia masih menjabat sebagai menteri cabinet dan telah melakukan perbuatan cabul terhadap dua perempuan lainnya ketika menjabat sebagai presiden pada tahun 2000 sampai 2007. Mahkamah Agung Israel menolak permohonan bandingnya atas hukuman tersebut. (m23)

Rusia Tolak Larangan Impor Minyak Iran MOSKOW, Rusia (Reuters): Larangan penjualan minyak Iran akan menjadi tindakan politik dan Rusia tidak yakin pasokan energi dijadikan alat untuk menekan, kata Menteri Energi Rusia Rabu (7/12). Komisaris Energi Eropa Guenther Oettinger mengatakan, dicapai konsensus di antara beberapa negara Uni Eropa (UE) untuk melarang impor minyak Iran dan Eropa berharap bisa mengajak Rusia untuk memberlakukan larangan global. Rusia, sebagai negara penghasil minyak mentah terbesar dunia, yang tidak mengimpor minyak Iran, tidak mendukung rencana yang ditujukan untuk menumpuk tekanan terhadap Iran agar menghentikan program nuklirnya. “Jelas sekali keputusan tersebut bermotifkan politik..dalam situasi ini kami mencoba bersikap netral,” kata Sergei Shmatku kepada wartawan di sela-sela Kongres Minyak Dunia. “Sadarkah Anda apa dampak dari keputusan ini jika diberlakukan?” tanyanya, tanpa menjelaskan lebih jauh.Sejumlah negara-negara UE khawatir larangan atas impor minyak Irak akan mengacaukan perekonomian mereka yang sudah rapuh dibanding Iran. Shmatko mengatakan, daripada melarang penjualan minyak, negara-negara yang khawatir soal rencana nuklir Teheran, yang banyakpihakcurigaiditujukanuntukmenciptakansenjata,sebaiknya mengupayakan resolusi diplomatik atas konflik itu. “Selama yang menjadi permasalahan adalah program nuklir Iran, kita sebaiknya mencoba membicarakan masalah ini pada forum lain, misalnya di DK PBB,” katanya.(m23)

Presiden Bashar Tolak Bertanggung Jawab Atas Pembunuhan Pemrotes WASHINGTON, AS (Antara/AFP): Presiden Syria Bashar alAssad menolak bertanggung jawab atas pembunuhan ribuan pemrotes, mengemukakan kepada seorang wartawan Amerika Serikat dia tidak memimpin pasukan yang melakukan tindakan itu, kata jaringan televisi. Dalam satu wawancara yang jarang dilakukannya, Bashar mengemukakan kepada wartawan kawakan Barbara Walters dari stasiun televis ABC News, Senin dalam usaha membela dirinya ditengah kecaman internasional terhadap tindakan keras sembilan bulan yang menurut PBB menewaskan 4.000 orang. ABC News berencana akan menyiarkan wawancara itu Rabu waktu setempat (Kamis 8/12WIB) tetapi seorang wartawan jaringan itu mengusahakan tanggapan AS dalam satu taklimat Departemen Luar Negeri, yang mengutip pernyataan Bashar yang mengatakan: “Saya presiden. Saya bukan memiliki sendiri negara jadi mereka bukan pasukan saya.” “Ada perbedaan antara memiliki kebijakan untuk menumpas dan beberapa kesalahan yang dilakukan sejumlah pejabat. Ada satu perbedaan besar,” kata Bashar yang dikutip wartawan itu. Menanggaapi pernyataan itu, jurubicara Departemen Luar Negeri AS Mark Toner mengeritik Bashar dan mengatakan dia memiliki banyak kesempatan untuk menghentikan aksi kekerasan itu. “Saya melihatnya lucu bahwa dia berusaha untuk bersembunyi agaknya di belakang permainan judi dan mengaku dia tidak melaksanakan kekuasaan sendiri di negaranya,” kata Toner dalam taklimat itu. “Tidak ada indikasi bahwa dia melakukan usaha selain menindak tegas gerakan oposisi yang damai itu,” kata Toner. Keluarga Bashar menguasai Syria dengan tangan besi selama empat dasa warsa. Abang Bashar, Letkol Maher al-Assad, memimpin Divisi IV Angkatan Darat yang mengawasi ibukota Damaskus serta pasukan elit Pengawal Republik.Syria berada dalam tekanan yang meningkat dari AS, Uni Eropa, Liga Arab dan Turki yang non-Arab untuk menghentikan tindakan keras itu.

China Tangkap 608 Orang Pelaku Penjual Anak BEIJING,China(Antara/Reuters):PolisidiChinatelahmenangkap 608 orang diduga menjual anak-anak dan membebaskan 178 anak, termasuk beberapa bayi, dalam tindakan keras yang mencakup 10 provinsi mengenai perdagangan anak, kata para pejabat Rabu (7/ 12). Polisimenangkaptersangkapada30November,kataDepartemen Keamanan Publik dalam satu pernyataan, dan menyebutkan bahwa tindakankerasitu“satudarikemenanganterbesaruntukanti-perdagangan manusia”.PolisidiprovinsibaratdayaSichuanpadaMeitelahmenemukan satukelompokyangdipimpinolehseorangpriabernamaCaiLianchao menjual 26 anak ke daerah lain, kata kementerian tersebut. Dia menambahkan bahwa dalam kasus lain, polisi di bagian timur Fujian Agustus lalu mempelajari bahwa anak-anak yang dijualkepadawargaolehwanitabernamaChenXiumeidantersangka lain dari satu geng perdagangan anak.



WASPADA Kamis 8 Desember 2011

Pemilik Sekolah Internasional Akan Mengadu Ke Mendiknas MEDAN (Waspada): Pengelola Yayasan Pendidikan Nanyang yang mengelola lembaga pendidikan Nanyang Zhi Hiu Modern School akan mengadukan warga Jalan Sriwijaya/Jalan Abdullah Lubis Kelurahan Darat Kecamatan Medan Baru ke Mendiknas RI, Kapolri dan Kapolda Sumut. Pengaduan disampaikan karena perbuatan warga telah mengganggu proses belajar mengajar siswa Nanyang dan menyebabkan para siswa trauma. Demikian disampaikan Ketua Medan Lawyers Club Syafaruddin, SH, M.Hum selaku penasehat hukumYayasan Pendidikan Nanyang kepada pers, Rabu (7/12). Tindakan warga mengintimidasi siswa Nanyang, sekolah yang menggunakan bahasa Inggris sebagai bahasa pengantar ini melalui suara musik hingar bingar dengan mengarahkan toa (pengeras keras) dari rumah warga ke kelas-kelas bisa dikenakan ancaman pidana sebab telah mengganggu proses belajar mengajar. Siswa sesuai UU Sisdiknas berhak mendapatkan pengajaran yang nyaman, aman dan tentram dan kondisi ini tidak perlu dirusak oleh kepentingan segelintir orang. Jika ada keberatan warga terhadap pihak Nanyang bisa menyampaikan aspirasinya. Ratusan pelajar tingkat TK, SD dan SMP Nanyang Zhi Hiu Modern Indonesia School trauma dan ketakutan serta merasa tidak nyaman belajar di kelas akibat suara hingar bingar musik yang berasal dari rumah warga yang bertetangga dengan sekolah Nanyang tersebut. Ratusan pelajar yang ditemani para guru dan koordinator guru Wilyo Yus Suprapto, SPd, menyebutkan suara hingar bingar musik tersebut berasal dari empat rumah warga tetangga Nanyang School yang didengungkan melalui toa. Suara musik dimulai pukul 8.00 (pagi hari) hingga pukul 15.00 (menjelang sore hari) dan baru mati pada saat anak-anak pulang dari sekolah. Lagu-lagu yang diputar dari keempat rumah warga tersebut terdengar sangat berisik dan lagu-lagunya kurang pas untuk didengar anakanak yang sedang mengikuti proses belajar mengajar. Menurut Suprapto, suara musik yang keras itu telah mengganggu anak-anak belajar apalagi saat sekarang anak-anak SD dan SMP sedang mengikuti ujian semester ganjil. Suara musik itu sendiri sudah berlangsung selama beberapa

minggu lalu sejak sekolah Nanyang melaksanakan pembangunan penambahan ruang belajar (lokal) baru, ruang serba guna dan laboratorium. Suprapto tidak memahami mengapa keberatan warga ditujukan dengan aksi mengintimidasi dan menakut-takuti siswa-siswa di sekolah ini. Padahal pembangunan gedung lima lantai yang sedang berjalan saat ini merupakan kebutuhan sekolah untuk menampung pertambahan jumlah murid yang setiap tahun naik secara signifikan. Nanyang school mengelola pendidikan TK, SD dan SMP dan setiap tahun mengalami kenaikan jumlah murid, sehingga pihak yayasan pendidikan Nanyang berinisiatif membangun penambahan lokal baru serta area parkir, kata Suprapto yang mewakili juru bicara Yayasan Pendidikan Nanyang. Suprapto menjelaskan lebih lanjut dari informasi yang diterimanya dari pihak Yayasan Pendidikan Nanyang, pembangunan gedung berlantai lima tersebut telah mendapat izin dari Dinas Pendidikan Kota Medan dan IMB juga sudah dikeluarkan Dinas TRTB Kota Medan dan kontraktor yang membangun gedung berlantai lima Nanyang school juga melaksanakan pembangunan sesuai prosedur. Kontraktor Fatruddin Kurniawan saat ditemui menjelaskan pihaknya dipercaya Nanyang school untuk membangun gedung berlantai lima dimana lantai 1 digunakan sebagai area parkir, lantai dua dimanfaatkan sebagai ruang serba guna, lantai tiga dan lantai empat untuk ruang kelas dan laboratorium, ruang musik, ruang ekstrakurikuler dan ruang multi media. Menurut Syafaruddin jika ada keberatan warga terhadap pembangunan gedung baru berlantai 5 bisa menyampaikan aspirasinya kepada kepala lingkungan, lurah maupun camat. “Sebaiknya warga, pihak lingkungan, kelurahan maupun kecamatan duduk satu meja bersamaYayasan Pendidikan Nanyang dan sampaikan apa yang menjadi keberatan warga, sehingga bisa diakomodir oleh pihak sekolah,” tegas Syafaruddin yang menyebutkan tidak bisa menyalahkan pihak Nanyang karena apa yang dilakukan pihak sekolah adalah untuk kepentingan siswa dan sebagai sarana dan prasarana belajar yang harus dipenuhi pihak sekolah sesuai ketentuan dari Dinas Pendidikan Kota Medan. (m08)

Polisi Ungkap Penusukan Juara Olimpiade Matematika JAKARTA (Waspada): Polisi mengungkap kasus penusukan yang menewaskan juara Oliampide Matematika Christopher Melky Tanujaya, 16, dengan memeriksa dua saksi dan rekaman CCTV. Christopher ditemukan tewas di depan Rumah Makan (RM) Garuda, tepat di dekat SDN 01 Pagi Pluit, Jalan Pluit Selatan, Penjaringan, Jakarta Utara. Kasat Reskrim Polres Metro Jakarta Utara AKBP Irwan Anwar kepada wartawan Rabu (7/12), mengatakan, korban tewas dengan luka tusukan di bagian leher kanan, dada, dan punggung. “Saat ini kami sedang memeriksa rekaman CCTV salah satu kantor dekat lokasi kejadian perkara,” kata Irwan. Sejauh ini polisi belum mengetahui motif penusukan yang menewaskan warga Perumahan Taman Grisenda CC2, No.813, Kelurahan Kapukmuara, Penjaringan, Jakarta Utara. Korban Christoper tewas Senin (5/12) sore, ditusuk setelah turun dari bus Trans Jakarta di halte busway Pluit Junction, Jakarta Utara. Korban saat itu, baru saja pulang bermain futsal di Mal Puri Indah Jakarta Barat menuju rumah-

nya seorang diri. “Saat itu berdasarkan keterangan saksi mata, korban naik busway. Setelah turun, di dekat SDN 01 Pagi Pluit dia ditusuk orang dengan ciri-ciri rambut ikal,” terang Irwan. Christopher siswa SMA Saint Joseph Institute di Singapura yang ditusuk pisau tersebut mengalami pendarahan hebat. Christopher bersekolah di salah satu SMA di Singapura setelah mendapat juara lomba olimpiade matematika. Semasa duduk di bangku SMP IPK Pluit, Christopher pernah meraih medali emas di Olimpiade Sains Nasional untuk kategori matematika. Christopher yang baru tiba di Jakarta pada 11 November 2011 lalu untuk liburan di Jakarta. Penusukan korban pertama kali diketahui Setiohadi Wiratmoko,30, warga Petamburan, Tanah Abang, Jakarta Pusat. Saat itu Setiohadi sedang melintas di jalan, melihat korban berteriak minta tolong. Melihat korban, Setiohadi membawanya ke RS Atmajaya, dengan menggunakan sepeda motor. “Korban sempat ditangani di UGD selama setengah jam sebelum meninggal,” terangnya. (j02)

Jamsostek Masih Dipercaya JAKARTA (Waspada): PT Jamsostek mengucapkan terimakasih pada perusahaan dan pekerja yang menjadi peserta yang menjadikan BUMN tersebut masih dipercaya menjadi pelaksana program jaminan sosial hingga 34 tahun ini. “Kami memperoleh sejumlah penghargaan, termasuk yang terakhir berupa peringkat pertama survei Integritas Pelayanan Publik KPK Tahun 2011 untuk kategori BUMN,” kata Karo Humas PT Jamsostek Sarjan Lubis di Jakarta, Rabu (7/12). Terkait dengan peringatan hari jadi BUMN itu yang ke-34 pada 5 Desember 2011 lalu, Dewan Direksi dan Komisaris mengucapkan terimakasih kepada lebih 10 juta tenaga kerja dari sekitar 150 ribu perusahaan yang sudah menjadi peserta aktif selama ini.

Dengan total dana senilai Rp110 triliun, BUMN ini menyatakan akan terus meningkatkan kualitas pelayanan dan kuantitas peserta. “Kami ingin menjadi pelaksana jaminan sosial yang terpercaya menyusul ditunjuknya sebagai Badan Penyelenggara Jaminan Sosial Ketenagakerjaan,” kata Sarjan. Penghargaan publik yang diwujudkan dalam skoring tertinggi dalam survei Integritas Pelayanan Publik KPK Tahun 2011 untuk kategori BUMN, kata Sarjan, merupakan kepercayaan yang tak ternilai. “Hasil survei tersebut diharapkan dapat mengikis suara miring tentang tuduhan dugaan praktik korupsi yang tidak berdasar,” kata Sarjan. Sebelumnya KPK merilis hasil survei yang dilakukan pada 89 instansi yaitu 22 instansi

pusat, tujuh instansi vertikal dan 69 instansi pemerintah daerah. Sumber menyebutkan survei integritas 2011 ini bertujuan untuk mengetahui nilai integritas, indikator dan subindikator integritas dalam layanan publik. Badan Koordinasi Penanaman Modal (BKPM) memiliki nilai tertinggi mencapai 7,80, posisi selanjutnya Kementerian Kesehatan dengan nilai 7,52, PT Jamsostek 7,52, Kementerian Perindustrian 7,51, PT Pelindo II Cabang Tanjung Priok 7,50, Kementerian Perhubungan mendapat skor 7,47, dan Kementerian Kelautan dan Perikanan dengan nilai 7,46. Selanjutnya, Kementerian Pertanian 7,45, Kementerian Komunikasi dan Informatika 7,43, dan Kementerian Pendidikan Nasional dengan nilai 7,41. (j04)


ANTRIAN e-KTP: Seorang warga menunjukkan surat undangan resmi dari kecamatan untuk pengurusan e-KTP di Kec. Medan Polonia beberapa waktu lalu.

Sembilan Juta Orang Punya KTP Ganda JAYAPURA (Antara): Menteri Dalam Negeri Gamawan Fauzi mengungkapkan bahwa sekitar sembilan juta warga Indonesia mempunyai kartu tanda penduduk (KTP) ganda. “Sebanyak sembilan juta orang di Indonesia miliki KTP ganda karena kepengurusan dokumen-dokumen pribadi,” katanya dalam peninjauan pelaksanaan e-KTP di Distrik Abepura, Kota Jayapura, Papua,

Rabu (7/12). Gamawan mengatakan, banyaknya warga Indonesia yang memiliki KTP ganda tersebut karena kepengurusan dokumen-dokumen berharga di tiap daerah yang mengharuskan menggunakan KTP setempat sehingga ditemukan sedikitnya sembilan juta orang yang mempunyai KTP ganda. Mendagri mengatakan, melalui e-KTP yang berlaku secara nasional diharapkan kepe-


yang berisi data pribadi pemilik e-KTP. Di dalamnya selain terdapat data diri berupa foto ada juga sidik jari, iris mata, juga nomor induk kependudukan yang berlaku di seluruh Indonesia. “e-KTP punya keamanan tingkat tinggi dan dipastikan tidak bisa dimanipulasi oleh orang yang tidak bertanggung jawab,” katanya. Gamawan juga mengatakan, pembuatan e-KTP ini me-

rupakan suatu pekerjaan besar yang belum semua negara melakukannya dan baru tahun ini Indonesia melakukannya secara bersama-sama dengan Jerman. “Tidak semua negara mempunyai program e-KTP dan pada tahun ini kami melakukannya bersama dengan Jerman,” katanya. Dia juga mengungkapkan, untuk e-KTP di beberapa negara lain tidak selengkap dengan yang dilakukan oleh Indonesia.

Anas Putuskan Pemenang Proyek Hambalang JAK ARTA ( Waspada): Mengaku tidak dilibatkan dan tidak mengetahui proyek pembangunan wisma atlet Sea Games Palembang, Sumatera Selatan, terdakwa Muhammad Nazaruddin justru mengungkap pembangunan proyek atlet di Hambalang, Bogor, Jawa Barat yang terkait langsung dengan Ketua Umum DPP Partai Demokrat Anas Urbaningrum. Hal tersebut diungkapkan mantan bendahara umum DPP PD itu dalam sidang kedua dengan agenda pembacaan eksepsi (nota keberatan) Nazaruddin atas dakwaan Jaksa Penuntut Umum (JPU) Komisi Pemberantasan Korupsi (KPK), di Pengadilan Tipikor, Jakarta, Rabu (7/12). Dalam eksepsinya Nazaruddin membantah PT Duta Graha Indah (DGI) pemenang proyek Hambalang, tapi justru PT Adhi Karya yang menang karena permintaan Anas. “Pada April 2010, Anas memutuskan pemenang pengerjaan proyek Hambalang adalah PT Adhi Karya dan bukan PT DGI. Keputusan tesbut dengan alasan menurut laporan Rosa, PT DGI Tbk tidak dapat membiayai biaya kongres Demokrat sebesar Rp100 miliar. Akan tetapi, pemenangnya adalah PT Adhi Karya,” kata Nazaruddin. Dikatakannya, PT Adhi Karya

diperkenalkan oleh Mahfud Suroso yang merupakan teman baik Anas, dimana PT Adhi Karya sanggup menggelontorkan dana Rp100 miliar untuk membiayai kongres dan menjadikan Anas sebagai Ketum DPP PD. “Dan saya hanya mendegar perintah Anas kepada bapak Mahfud agar Adhi Karya menyerahkan uang kepadaYulianis untuk dibawa ke Bandung dalam kongres Demokrat,” kata Nazaruddin. Pada kesempatan tersebut Nazaruddin membantah keterlibatannya dalam proyek tersebut, justru dia mengetahuinya dari media massa. “Tanggal 10 Mei 2011 saya mengikuti proyek wisma atlet dari media,” lanjutnya. Sebelumnya pria yang ditangkap di Bogota, Kolombia itu mengatakan, dirinya bertemu dengan Direktur Utama PT Duta Graha Indah, Dudung Purwadi di kantor Anugrah Nuantara di kawasan Casablanca, Jakarta, pada Mei 2009. Saat itu, Dudung bersama Manager Marketing PT Duta Graha Indah, Mohammad El Idris ingin bertemu dengan Anas Urbaningrum. “Pada Mei 2009 terakhir kali saya ketemu Dudung pada waktu itu mau bertemu Anas. Yang datang adalah Anas, Dudung, Idris dan saya. Pertemuan itu untuk bicarakan proyek Hambalang tidak yang lain,” terang Nazaruddin.

Ketua DPR Tak Setuju Masa Tugas Timwas Centruy Diperpanjang

MENANGISI SUAMI: Lisdiyanti, 40, (kerudung biru) menangis seusai melihat jenazah suaminya Rakhmat Santoso, 43, korban perampokan di kantor POS cabang Cipondoh, Tangerang, Banten, Selasa (6/12). Korban di tusuk dibagian kepala pada Senin malam, selain itu juga raib uang kantor POS senilai Rp173 juta yang diduga dibawa kabur kawanan perampok.

milikan identitas diri tidak lagi ganda atau disalahgunakan oleh orang lain yang tidak bertanggung jawab. “e-KTP ini sangat berguna dan diharapkan bisa digunakan dalam kepengurusan apa saja termasuk pembelian tanah, urus paspor atau lainnya,” katanya. Dia mengatakan, e-KTP mempunyai banyak kelebihan dan keamanan yang tinggi, seperti tidak mudah patah dan mempunyai ‘chip‘ di dalamnya

JAKARTA (Waspada): Ketua DPR Marzuki Alie berpendapat masa tugas Tim Pengawas (Timwas) Kasus Century DPR yang akan segera berakhir pada 16 Desember 2011 mendatang tidak perlu diperpanjang , sebab, rekomendasi dari hak angket DPR dalam kasus ini sebagian telah dilaksanakan. ”Kan, rekomendasi sebelumnya sudah dilaksanakan oleh aparat penegak hukum, dengan menyelidiki kasus ini dan telah ada tersangkanya. Jadi apa lagi yang akan ditangani,” tegas Marzuki di Gedung DPR RI Jakarta, Rabu (7/12). Sebelumnya, pengamat Politik dari Universitas Muhammadiyah Jakarta Cecep Effendy mengatakan isu kasus Bank Century terus digulirkan untuk mengalihkan isu atas berbagai hak-hak rakyat yang menjadi kewajiban negara yang sampai hari ini belum dirasakan oleh

rakyat seperti pendidikan, kesehatan, kemiskinan, dan penegakan hukum keadilan . Isu ini menurut Cecep seperti sengaja terus digulirkan walau para pengusung isu ini sadar bahwa kasus ini tidak akan ke manamana. ”Saya melihat ada keanehan, kok terus-terusan kasus Century ini digulirkan. Memangnya mau dibawa ke mana kasus ini? DPR maupun partai tidak ada yang berani mengambil tindakan lebih jauh untuk membawa perkara ini ke Mahkamah Konstitusi (MK),” ujar Cecep kepada wartawan. Sebelumnya, Wakil Ketua DPR Priyo Budi Santoso mengatakan, kemungkinan DPR akan memperpanjang masa tugas Timwas Century DPR. Mengingat hanyak hal yang belum ditindaklanjuti oleh aparat penegak hukum untuk menuntaskan kasus ini. (aya)

Lebih lanjut dikatakan Nazaruddin, dirinya tidak berhubungan dengan Dudung maupun Anas sejak dirinya keluar dari PT Anak Negeri. Kemudian, pada Desember 2009 dia dalam kapasitasnya sebagai bendahara bersama Angelina sebagai koordinator Badan Anggaran DPR. Anas, kata Nazaruddin, memintanya untuk menemui Menpora Andi Mallarangeng guna membicarakan proyek Hambalang. “Maka terjadi pertemuan dengan yang bersangkutan di kantor Menpora. Ada Menteri Andi, Mahyuddin Ketua Komisi X, Angelina dan saya. Dalam pembicaraan itu Menpora memanggil Wafid. Kemudian disepakati, Menpora dan Angelina, Banggar, akan buat anggaran khusus untuk proyek Hambalang. Teknisnya, akan dibahas detail antaraWafid dan Angelina,” kata Nazaruddin. Kemudian Anas, kata Nazar, meminta mempertemukan Angelina dengan Rosa untuk mendukung rencana pengerjaan proyek Hambalang pada 2010. “Setelah itu Angie dan Rosa berkomunikasi langsung tanpa saya ketahui, karena Rosa wajib

lapor lang-sung ke Anas. Tugas saya hanya mengenalkan saja,” ujar pria kelahiran Pematang Siantar ini. Anas, lanjut Nazaruddin, memerintahkannya untuk memanggil Ignatius Mulyono dan mengundang Kepala BPN Joyo Winoto untuk keperluan mengurus proyek tersebut. Pertemuan itu menyepakati bahwa Joyo akan membantu Anas dalam mengurus sertifikat tanah Hambalang yang sudah dua tahun terbelit sengketa. “Pertemuan yang dihadiri Anas, Mulyono, Joyo dan saya Disepakati Joyo akan membantu Anas dalam sertifikat tanah Hambalang yang sudah dua tahun enggak selesai,” tambahnya. Selanjutnya, pertemuan berlanjut antara Nazar dengan Andi Mallarangeng di restoran Arcadia. Di restoran itu Nazar bertemu Andi, Mindo dan Sesmenpora Wafid Muharam. Pertemuan mereka membicarakan agar proyek Hambalang dimenangkan PT DGI. “Ternyata di sebelah restoran Jepang sudah ada Mindo danWafid. Setelah itu saya diajak duduk bareng membicarakan proyek Hambalang bukan wis-

ma atlet. Agar Hambalang dimenangkan PT DGI. Tapi PT DGI harus mengikuti aturan dan mekanisme yang berlaku,” katanya. Kemudian, pertemuan antara Nazar dengan Angie, Andi, danWafid hanya membicarakan proyek Hambalang. Anggie, kata Nazar, akan mengatur secara teknis di Banggar DPR. “Kemudian setelah pukul 10.00 pertemuan antara saya, Andi, Angie, Mahyudin, Wafid hanya membicarakan proyek Hambalang. Teknisnya Angie akan mengatur dengan teman-teman di Banggar Komisi X yang kemudian hasilnya sesuai dengan ya n g d i p u tu s k a n Ana s ,” terangnya. Pada sidang sebelumnya, Nazaruddin didakwa dengan pasal 12 huruf B UU Tipokor no 31/1999 tentang pembarantasan tipikor yang diubah UU 20/2001. Ancaman dengan pasal berlapis yakni, Pasal 12 huruf b UU Pemberantasan Korupsi, Pasal 5 Ayat (2) jo. Pasal 5 Ayat (1) huruf b UU Pemberantasan Korupsi, Pasal 11 UU Pemberantasan Korupsi, Nazaruddin terancam hukuman 20 tahun penjara. (j02)

Baru 22 Provinsi Tetapkan UMP 2012 JAKARTA (Waspada): Sampai 2 Desember 2011 baru 22 dari 33 provinsi menetapkan Upah Minimum Provinsi (UMP) 2012. 11 Provinsi lainnya masih belum menetapkan besaran UMP yang berlaku di wilayahnya. 22 Provinsi yang telah menetapkan UMP tahun 2012, yaitu Sumatera Utara, Sumatera Barat, Riau, Jambi, Sumatera Selatan, Bangka Belitung, Bengkulu, Banten, DKI Jakarta, Jawa Barat, Jawa Tengah, Jawa Timur, Nusa Tenggara Timur, Kalimantan Selatan, Kalimantan Tengah, Maluku, Gorontalo, Sulawesi Tenggara, Sulawesi tengah, Sulawesi Selatan, dan Papua Barat. Jawa Barat, Jawa Tengah dan Jawa Timur tidak menetapkan UM. “Memang masih terdapat beberapa daerah yang sampai kini karena berbagai hal, masih belum dapat menetapkan upah minimum. Rata-rata masih dalam pembahasan dewan pengupahan atau menunggu penetapan gubernur. Namun kita tetap mendorong percepatan penetapan agar dapat segera disosialisasikan dan diterapkan,” ujar Kepala Pusat Humas Ke-

menakertrans Suhartono di Kantor Kemenakertrans, Rabu (7/12). Suhartono mengatakan dalam penerapan kebijakan untuk menentukan besaran upah minimum memang harus sangat hati-hati dan mempertimbangkan kepentingan pihak terkait yang berhubungan dengan masalah pengupa-han. “Patut dipahami semua pihak, bahwa konsep dan kebijakan upah minimun itu merupakan upah terendah yang diperuntukkan bagi pekerja lajang dengan masa kerja kurang dari satu tahun. Upah minimum hanya sekadar jaring pengaman sosial,” kata Suhartono. Suhartono menjelaskan upah minimum merupakan jaring pengaman (safety net) yang ditetapkan dengan mempertimbangkan Kebutuhan Hidup Layak (KHL), produktivitas makro, pertumbuhan ekonomi, kondisi pasar kerja dan usaha yang paling tidak mampu (marginal). “Nilai KHLmerupakan salah satu faktor pertimbangan dalam penetapan UMP. Nilai KHL diperoleh melalui survei

yang dilakukan unsur tripartit dalam dewan pengupahan sehingga nilai besarannya merupakan hasil bersama antara pengusaha, pekerja/buruh dan pemerintah,” kata Suhartono. Dalam menetapkan UMP, katanya, memang diperlukan kehati-hatian karena harus mempertimbangkan berbagai kondisi tertentu. Namun dengan mempertimbangkan kepentingan bersama, penetapan UMP ini diharapkan dapat berjalan efektif dan dipatuhi semua pihak, terutama pengusaha, pekerja/buruh dan pemerintah di masing-masing daerah. Suhartono menjelaskan berdasarkan pe-mantauan penetapan UMP tahun 2012, provinsi yang menetapkan kenaikan upah tertinggi adalah DKI Jakarta sebesar 18,52 % sedangkan yang kenaikan upah terendah adalah Papua barat sebesar 3,35 %. Sedangkan perbandingan antara UMP dengan KHL yang paling tinggi adalah Provinsi Sumatera Utara. Upah yang diterapkan 115.94 % sedangkan yang terendah adalah Maluku sebesar 56,07%. (j04)


WASPADA Kamis 8 Desember 2011

07.00 Si Doel Anak Sekolah 07.45 DAHSYAT 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12.30 Sinema Siang 14.30 Kabar Kabari 15.30 OB 16.15 Top 5 17.00 Seputar Indonesia 17.30 Silet 18.00 Dewa 21.00 Mega Sinetron : Anugerah 22.30 Box Office Movie Storm Warriors 00.30 Seputar Indonesia Malam


07:00 Inbox 09.05 Halo Selebriti 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14.30 Status Selebriti 15.00 Uya Emang Kuya 16.00 Liputan 6 Petang 16.03 Jebakan Betmen 17.00 Liputan 6 Petang 17.30 Parade FT V Istimewa 19.30 Bukan Islam KTP 20.00 Liputan 6 Terkini 20.03 Bukan Islam KTP 21.00 SCTV Sinetron : Janji Cinta Aisyah 22.30 Liputan 6 Terkini 22.33 SCTV SInemaWajah Indonesia Pahala Terindah

07:00 Disney Club 08:00 Disney Club 09:00 Cerita Pagi 10:30 Diantara Kita 11:00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 15:30 Lintas Petang 16.00 Aksi Juara 16:30 Zona Juara 17.30 Oscar Oasis 18:00 Animasi Spesial : Shaun The Sheep 19:00 Sampeyan Muslim 20.00 Senggol Senggol Asmara 21.00 Bulan Di Atas MEntari 00.00 Musik Pilihan

07:30 Wooow…! 08:00 Friends 09:00 Resep Warisan 09:30 Segeeerr Beneerrr 10:30 Catatan Sang Dai 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Sinema Siang : Mr. Vampire II 15:00 Mantap (Live) 16:00 Topik Petang (Live) 16:30 Fenomania 17:00 Warkop Series : Anak Jin 18:00 Pesbukers (Live) 1 9 : 0 0 Ta w a S u t r a Coooyyy… 20:00 Klik! Award (Live) 23:00 Most Incredible Moments 00:00 XYZ 00:30 Topik Malam (Live

07:00 - KISS Pagi 07:30 - FTV Pagi 09:30 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia (Korea) 13:30 - Drama Asia (Korea) 15:00 - KISS Sore 16:00 - Fokus 16:30 - Drama Asia (Korea) 18:00 - Drama Asia (Mandarin) 1 9 : 0 0 - Si n e t r o n Unggulan: Satria 20:00 - Tutur Tinular 22:00 - Mega Asia: The Detective

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.00 Headline News 10.05 Eleven Show 11.05 The Spring & Latern Festival 12.05 Metro Siang 13.05 Oasis 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Suara Anda 19.05 Suara Anda 19.30 The Beauty Of Harmony 20.30 Genta Demokrasi 21.05 Top Nine News 21.30 The Destroyed In Seconds 22.05 Provocative Proactive


07:30 Ranking 1 08:30 Derings 10:00 Ngulik 10:30 IBU 11:00 Insert 12:00 Reportase Siang 12:30 Jelang Siang 13:00 Bingkai Berita 13:30 Ceriwis 14:30 86 15:00 Keluarga Minus 15:30 Sketsa 16:00 Happy Family 17:00 Reportase Sore 17:30 Insert Sore 18:15 Jika Aku Menjadi 19:00 Comedy Project 20:00 The Hits 21:00 Bioskop TransTV 23:00 Kakek-Kakek Narsis 00:00 Bioskop TransTV 02:00 Reportase Malam

06.30 Apa KAbar INdonesia 09:30 Live New Kabar Pasar Pagi 10:00 Coffee Break 11:30 Mutumanikam 12:00 Live News Kabar Siang 13:30 Tokoh 14:30 Keliling Indonesia 15:00 Tahukah Anda 15:30 Imperium 16:30 Sport File 17:00 Live News Kabar Petang 19:30 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22.00 Live News Kabar Arena 23:00 Radio Show

08.00 Avatar 09.00 Super Hero Kocak 10.00 Obsesi 10.30 Abdel Dan Temon 11.00 Top Banget 11.30 Hot Spot 12.00 Awas Ada Sule 13.00 Main Kata 14.00 Steve Ewong S a n g Pemburu 14.30 Deny Manusia Ikan 15.00 Berita Global 15.30 Sea Games 2011 18.00 Spongebob 19.00 Awas Ada Sule 20.00 Big Movies 22.00 Big Movies

07:30 Selebrita Pagi 08:00 Jalan-Jalan Selebrit. 08:30 Hitam Putih 09:30 Ups Salah 10:00 Spotlite 11:00 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 14:00 Dunia Binatang 14:30 Jagomatika 15:00 Koki Cilik 15:30 Asal Usul Flora 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Si Gundul 17:30 Orang Pinggiran 18:00 Ups Salah Sambung 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 (Masih) Dunia Lain 00:30 Sport7 Malam **m31/G

Kim Kardashian Masuk Daftar Diawasi Imigrasi Australia Kim Kardashian masuk dalam daftar orang yang diawasi Departemen imigrasi Australia karena tiga kali melakukan pelanggaran aplikasi permohonan visa. Meskipun menjadi sosok sangat terkenal, Kardashian

tampaknya berpura-pura menjadi turis dalam kunjungan

Kedapatan Main Games, Alec Baldwin Diusir Dari Pesawat

Kristen Stewart dan Robert Pattinson/

Bintang-bintang Twilight Paling Tajir BAGI penggemar film, jutaan dolar dibayarkan kepada Kristen Stewart dan Robert Pattinson untuk membintangi beberapa film kelihatannya banyak sekali, tapi bagi produser franchise film Twilight, bayaran mereka itu tergolong murah. Jejaring finansial, Selasa (6/ 12), memposting peringkat bintang-bintang film Hollywood yang memberi studio keuntungan lebih besar dibandingkan dengan bayaran sang bintang. Barangkali hal biasa bagi aktor-aktor papan atas untuk membintangi film Hollywood yang mengantungi ratusan juta dolar AS di box office. Kristen Stewart, memerankan Bella Swan dalam Twilight mengisahkan Bella jatuh cinta pada vampir Edward Cullen, berada di peringkat Nomor 1 pada daftar Hollywood‘s Best Actors for the Buck, setelah cuma dibayar satu dolar AS untuk setiap 55,83 dolar AS yang dia hasilkan untuk produser filmnya. Pattison memerankan Cullen berada di pringkat 3 dengan menghasilkan 39,43 dolar AS untuk setiap satu dolar AS yang parkir ke kantongnya. Film terakhir pasangan tersebut, Twilight Saga: Breaking Dawn - Part 1 telah mengantungi 589 juta dolar AS di box office global sejak peluncurannya November yang baru lalu. Tapi jika pasangan itu dikeluarkan dari franchise blockbuster seperti Twilight, dan performa keuangan berubah dramatis. Itulah sebabnya rata-rata penghasilan Robert Pattinson lebih kecil dibandingkan dengan

penghasilan Kristen Stewart. Untuk memenuhi kualifikasi daftar tersebut, para aktor harus telah membintangi tiga film besar selama lima tahun terakhir, dan semua film diluncurkan setelah 1 Mei tahun ini tak dihitung, jadi Twilight yang paling akhir tak termasuk. Tapi semua film sebelumnya, yang sama berhasilnya, memang termasuk daftar itu. meneliti imbalan masingmasing bintang di tiga film terakhir mereka dan pendapatan operasional semua film itu, demikian laporan Reuters. Media finansial tersebut kemudian membagi jumlah pendapatan operasional dengan ganti rugi dan jumlah rata-rata bagi ketiga film itu. Robert Pattinson memiliki angka lebih rendah sebab sedemian sibuk, lapor Ia terlibat dalam penggarapan drama Water for Elephants dan Remember Me, namun tak satu pun dari kedua film itu berjaya di box office. Kristen Stewart baru saja tampil di film gemilang dalam box office, The Runways, di antara film paling laris Twilight. tak memasukkan film animasi. Yang berada di antara pasangan kekasih Twilight itu adalah aktris Anne Hathaway, memberi studio film 45,67 dolar AS untuk setiap satu dolar AS dibayarkan kepadanya dalam berbagai film termasuk Alice in Wonderland dan Bride Wars. Bintang Harry Potter- Daniel Radcliffe berada di urutan keempat, sementara bintang utama Transformer Shia LaBeouf menempati posisi nomor 5.(ant)

Aktor Alec Baldwin terlibat sengketa dengan awak maskapai American Airlines, Rabu, di mana dia diminta meninggalkan pesawat karena main game di ponsel pintarnya sebelum pesawat berangkat. “Alec diminta meninggalkan penerbangan karena main (game) Words with Friends. Dia memang sangat menyukai WWF sehingga meninggalkan pesawat pun tak masalah buatnya, dia lalu memesan penerbangan AA (American Airlines) yang lain,” kata juru bicara Baldwin, Matthew Hiltzik, dalam satu pernyataan. Baldwin lalu memposting sejumlah pesan menyangkut insiden ini ke Twitter, sekaligus memuji pesaing AA, United Airlines. “Pramugari American (Airlines) mengeluarkan saya k a re n a m a i n W O R D S W FRIENDS selagi kami berada di

gerbang (gate),” kata bintang“30 Rock” itu via Twitter seperti dikutip Reuters. Dia juga men-tweet, “Penerbangan terakhir bersama American di mana guru senam sekolah katolik di era 1950an beralih menjadi awak pesawat.” Tweet Baldwin dan pernyataan juru bicaranya disampaikan segera setelah seorang penumpang pesawat yang menggunakan penerbangan dari Bandara Internasional Los Angeles (LAX) menuju NewYork memposting pesan di Twitter, “Dalam penerbangan AA di LAX. Alec Baldwin diusir dari pesawat. Kami harus kembali ke gate. Payah, semua orang jadinya harus menunggu.” Seorang pejabat American Airlines menolak mengomentari hal ini dengan menegaskan demi privasi pelanggannya. (ant)

terbarunya ke Australia, seperti dikutip dari Foxnews. Ia pergi ke Australia untuk meluncurkan serangkaian produk tas tangan dan kemunculannya di toko sudah diiklankan secara luas. Sosoknya makin menyolok karena ia baru-baru ini bercerai dengan Kris Humpries. Peluncuran berlangsung di Sydney menjadi headline dan peliputan menarik di seluruh dunia dan ia tak sadar telah

diperingatkan departemen imigrasi. Sebuah Investigasi lanjutan menemukan bahwa dua kunjungan Kardashian sebelumnya dilakukan tahun 2007 dan tahun lalu juga untuk urusan bisnis. Departemen imigrasi menolak berkomentar secara langsung soal Kardashian kecuali mengatakan “jika orang datang untuk bekerja di Australia, Mereka harus memiliki visa yang sesuai dengan per-

syaratan.” “Ji k a p e r s y a ra t a n dilanggar, maka kami dapat merekomendasikan atau membatalkan visa orang tersebut ... dan pihak departemen akan mencatat pelanggaran serta keimigrasian mereka,” ujar surat pernyataan itu. “Rekam jejak itu akan jadi pertimbangan jika mereka mengajukan visa memasuki Australia.” (ant)

Kim Kardashian/

Pameran Foto Dan Talkshow Meriahkan Launching PDT

Alec Baldwin/

Pesta Danau Toba 2011 dilaksanakan 27 s/d 30 Desember 2011 di Parapat dimeriahkan berbagai kegiatan diantaranya Launching Kamis (8/12) di Atrium Plaza Medan Fair, pameran foto dan talkshow kopi. Foto menggambarkan kota Medan dan Sumatera Utara dimasa lampau dan sekarang bakal dipamerkan, kata Dimardi Abas selaku kurator mewakili 12 jurnalis dan photographer lainnya Palti Siregar, Sebastian Hutabarat, Tarmizi Harva, endrA, Ferdy Siregar, Tjang Kok Cheang, Mak Pak Kim, Said Harahap, Johny Siahaan, Peter Chandra dan Irsan Mulyadi. Sementara Talkshow Kopi mengingat Medan Bukan Cuma Bika Ambon, disamping minuman terfavourite dunia juga adalah komuditas paling diminati kedua setelah migas didunia.

Medan sebagai salah satu pusat perdagangan kopi perlu menseriusi minuman ini. Untuk itulah Pemko Medan bekerjasama dengan BPD AEKI SUMUT menyelenggarakan talkshow tentang kopi dengan menampilkan praktisi kopi Hendarto Setyobudi yang akan membahas bagaimana berwisata dari secangkir kopi dengan mengenal eksotisme kopi Sumatera dengan benar, mengenal seni meracik kopi sampai penyajiannya. Talkshow juga menampilkan kolumnis dan praktisi pariwisata Sumut Cahyo Pramono yang akan mengupas filosopi kopi dan hubungannya dengan pariwisata mulai jam 15.00. “Medan sebagai gerbang utama pariwisata di Indonesia bagian barat. Kita tetap commit untuk tetap menata, membina dan mendukung unsur-unsur pariwisata yang ada di Medan mau-

pun Sumatera Utara” demikian disampaikan Drs Busral Manan selaku Kepala Dinas Kebudayaan dan Pariwisata Kota Medan disela-sela persiapan kegiatan Medan Tourism Expo dan Launching Pesta Danau Toba 2011. Pesta Danau Toba adalah kegiatan tahunan masyarakat Sumatera Utara yang sangat menggambarkan keberagaman masyarakatnya namun tetap dalam satu kesatuan sangat membanggakan, lanjutnya lagi. Launching akan dihadiri Gubernur Sumatera Utara, Walikota Medan, Panitia Pesta DanauToba 2011, kepala-kepala daerah se Sumut, perwakilanperwakilan negara sahabat dan undangan lainnya juga dimeriahkan penampilan keseniankesenian Sumatera Utara dan pameran kuliner,produkproduk Medan/Sumut.(rel/ m19)

Sport A6 Villas-Boas Balas Pers

WASPADA Kamis 8 Desember 2011

Drogba Bawa Blues Juarai Grup E LONDON (Waspada): Didier Drogba menyumbang dua gol untuk membawa Chelsea menjuarai Grup E, Selasa (Rabu WIB), setelah mengalahkan Valencia 3-0 pada matchday 6 Liga Champions di Stamford Bridge, London. The Blues memastikan posisi puncak dengan 11 poin, unggul satu angka di atas Bayer Leverkusen yang pada partai lainnya ditahan Genk 1-1. Lompatan besar langsung dijadikan, Andre Villas-Boas, manajer Chelsea, sebagai balasan atas kritik pers terhadap timnya. “Kritikan untuk kami selalu j a d i

yang teratas. Jujur saja, dilihat d a r i

peliputan sepertinya hanya ada satu tim di negara (Inggris) ini, yakni Manchester City,” sindirnya. “Saya tidak akan mengkritik pilihan editorial kalian, tapi inilah kenyataannya. Banyak orang memiliki perspektif di luar batas, dengan mengkritik para pemain sampai pilihan strategi kami,” tambah pelatih asal Portugal berusia 34 tahun itu, seperti dilansir Goal, Rabu (7/12). Pasukan Villas-Boas paham benar, kekalahan atau hasil imbang dengan skor besar dapat membuat Valencia melaju ke babak berikutnya. Namun dua gol Drogba dan satu gol sumbangan

Didier Drogba

Ramires meloloskan London Blues ke babak 16 besar. Gol Drogba menit ketiga menghapus semua kegugupan Si Biru. Gol tambahan dari Ramires menit 22, membuat tim tuan rumah mantap memimpin 2-0 saat memasuki turun minum. Drogba kembali menambah sumbangan golnya menit 77 untuk menuntaskan perlawanan Los Ches. Sukses ganda pun diraih, karena Genk mampu menahan imbang Bayer Leverkusen. Sebagai juara Grup E, Chel-


sea berarti akan terhindar dari pertemuan dengan tim-tim favorit juara pada babak 16 besar, di antaranya Barcelona, Real Madrid, Bayern Munich, dan Inter Milan. “Kami sempat tertinggal di grup, namun kami telah melakukan pekerjaan malam ini dengan baik. Pria besar (Drogba) tampil fantastis malam ini, dia bermain cemerlang buat kami,” ucap kapten Chelsea John Terry dalam Sky Sports. “Semuanya sempat berjalan sangat sulit, maka kami membutuhkan gol dan pria besar (Drogba) itu mencetak gol dan membuat kami bangkit. Kami mencetak gol cepat lewat Drogba dan itu jelas membantu kami mempertahankan skor,” tambah Terry. Los Ches dengan demikian terpaksa turun kelas, mentas di babak 32 besar Liga Europa bersama tim peringkat tiga lainnya; Olympiakos Piraeus (Grup F), FC Porto (Grup G), dan Viktoria Plzen (Grup H). “Tujuan saya sekarang adalah memenangkan Liga Europa. Saya tak memiliki hal untuk disalahkan,” tutur entrenador Unai Emery. “Pemain tak bisa disalahkan, Bayer Leverkusen dan Chelsea memang sepatutnya lolos. Sekarang kami harus berpikir ke depan,” katanya menambahkan. (m15/goal/sky/espn)

Allegri Marah Gagal Menang Milan Menjauh Dari Barca Di Grup H PRAHA (Waspada): Allenatorre AC Milan Massimiliano Allegri (foto), marah skuadnya gagal menang saat dijamu Viktoria Plzen pada laga pamungkas Liga Champions Grup H. Berlaga di hadapan ribuan pendukung klub Ceko itu di Synop Tip Arena, Selasa (Rabu WIB), I Rossoneri sempat unggul 2-0 melalui gol Alexandre Pato menit 47 dan Robinho menit 48. Tapi di penghujung laga, tim tuan rumah bangkit mencuri dua gol lewat David Bystron menit 89 dan Michal Duris menit ketiga injury time, sehingga memaksakan hasil 2-2. “Ada amarah dibanding ke-

pahitan atas hasil ini. Kami punya kesempatan menambah gol ketiga, tapi kami malah harus membayar kebingungan di akhir laga,” sesal Allegri melalui Sky Sports, Rabu (7/12). “Kami sudah unggul 2-0, namun para pemain kami tidak cukup fokus menuntaskan laga, sehingga membuka jalan Plzen untuk bangkit. Itu yang membuat saya sangat marah,” ujarnya lagi. Il Diavolo tetap lolos babak 16 besar sebagai runner-up Grup H dengan nilai sembilan. Koleksi poin Milan itu jauh di bawah juara grup Barcelona (nilai 16), yang pada laga lainnya menggunduli BATE Borisov


4-0 di Camp Nou. Turun dengan pemain lapis kedua, El Barca tetap masih di atas kelas BATE. Sergi Rober-

to membuka pesta tuan rumah menit 35. Pemain berusia 19 tahun itu dengan tenang melesakkan tendangan lewat kaki kanannya, yang tidak mampu dijangkau kiper tamu. Pada paruh kedua, pasukan Pep Guardiola menambah tiga gol lagi. Satu dari Martin Montoya menit 60, dua gol lagi dicetak Pedro Rodriguez menit 63 dan penalti menit 88. “Dalam sepakbola, Anda harus siap bermain sampai 95 menit karena lawan bisa menyerang balik kapan saja. Pastinya, kami tidak akan mengulangi kesalahan ini pada kesempatan berikutnya,” tekad Allegri. (m15/vvn/sky)

Honda Pelopori Sistem Injeksi PGM-FI MEDAN (Waspada): Keraguan dan kekaguman muncul terkait dihilangkannya karburator pada sistem kerja motor untuk digantikan dengan sistem injeksi dengan tanpa kehilangan kekuatan dan kecepatan, yang sedang dipelopori Honda. Setelah lebih 20 tahun, perubahan teknologi secara radikal kembali akan terjadi di industri sepeda motor. Secara bertahap, Honda akan mempelopori teknologi terbaru dengan menghadirkan teknologi injeksi berlabel PGM-FI (Programmed Fuel Injection). Leo Wijaya, Marketing Manager CV Indako Trading Co selaku main dealer Honda di Sumatera Utara, menjelaskan teknologi ramah lingkungan PGM-FI pertama kali digunakan tahun 1981 yang disematkan pada motor besar Honda CX500 Turbo. Teknologi ini menurut Leo di Medan, Rabu (7/12), berevolusi dan mulai diterapkan pada 2003. Di Indonesia, teknologi ini dikenal sebagai pelopor teknologi injeksi industri kendaraan roda dua yang diperkenalkan pertama kali melalui Honda Supra X 125 PGM-FI tahun 2005. “Kami yakin kepeloporan teknologi ini akan memberikan banyak manfaat, bukan hanya untuk konsumen namun juga untuk lingkungan sekitarnya,” ungkap Leo. “Selain manfaat PGM-FI yang mampu menyumbangkan emisi bersih dan konsumsi BBM lebih hemat, mesin yang menerapkan teknologi injeksi ini juga

akan lebih diminati karena lebih powerfull dan mudah perawatan dengan selisih harga 250 ribu dari type non PGM FI,” katanya lagi. Karena punya kekuatan penuh, maka teknologi PGM-FI diyakininya tidak akan kehilangan sentuhan dan kecepatan di arena balap motor. Menurut Min Hian, Technical Service Manager CV Indako Trading Co, perubahan ini akan melibatkan jaringan Honda secara luas. Sebelum Maret 2012, ungkapnya, seluruh jaringan purna jual resmi Honda akan dibekali kembali edukasi teknologi PGM-FI. “Jaringan purna jual kita telah siap sejak awal, karena Honda sendiri telah mempelopori PGM FI pada Honda Supra X 125 Injeksi sejak tahun 2005, sekaligus merupakan pelopor injeksi motor massal di Indonesia,” ucap Min Hian. Dalam deklarasi “Cinta Honda PGM FI, Cinta Indonesia” 23 November lalu, PT Astra Honda Motor (AHM) selaku Agen Tunggal Pemegang Merk Honda memastikan seluruh type motor Honda yang dipasarkan di Indonesia akan menerapkan teknologi PGM-FI hingga akhir tahun 2013. Selain dapat mengurangi emisi gas buang hingga 33 persen, sistem PGM-FI memberikan efisiensi bahan bakar hingga 17 persen dengan tanpa kehilangan daya pacunya. Ini tindakan berani, tapi sangat bermanfaat mengingat semakin terbatasnya bahan bakar minyak. (adv)

Kistim Kirim Atlet Terbanyak Porkab Asahan 2011 KISARAN (Waspada): Kecamatan Kota Kisaran Timur, Kabupaten Asahan, mengirim 275 atlet dan akan menjadi kontingen dengan jumlah atlet terbanyak pada Pekan Olahraga Kabupaten (Porkab) Asahan 2011 di Kisaran, 9-16 Desember. Camat Kota Kisaran Timur Rahmad Hidayat Siregar SSos MSi kepada Waspada, Rabu (7/12), mengatakan kontingen Kisaran Timur akan turun pada semua cabang olahraga yang dipertandingkan, yakni sepak-

bola, bola voli, bulutangkis, tenis meja, pencak silat, karate, atletik, dan catur. “Meski kami disibukkan dengan persiapan sebagai finalis (enam besar) dalam pemilihan kecamatan terbaik se Sumut baru-baru ini, tetapi kami tetap memprioritaskan persiapkan atlet tampil di Porkab,” ucap Hidayat. “ Kami berharap bisa tampi sebagai juara umum di Porkab yang baru pertama kalinya digelar,” pungkasnya. (a31)


STRIKER Marseille Loic Remy (tengah) membobol gawang Dortmund yang dikawal kiper Roman Weidenfeller di Signal Iduna Park, Rabu (7/12) dinihari WIB.

Marseille Menakjubkan Dampingi Arsenal Dari Grup F BERLIN ( Waspada): Olympique Marseille melaju ke fase gugur L iga Champions, Selasa (Rabu WIB), setelah mereka mampu membalikkan ketinggalan 0-2 menjadi kemenangan 3-2 di kandang Borussia Dortmund. Pahlawan kemenangan Marseille, Mathieu Valbeuna mengaku, aksi kebangkitan timnya ‘benar-benar menakjubkan’ pada matchday 6 Grup E di Signal Iduna Park tersebut. “Saat tertinggal 0-2, tugas kami menjadi rumit. Gol Loic (Remy) benar-benar sangat membantu kami ketika jeda. Gol Loic itu membuat kami kembali ke trek,” ucap Valbuena dalam laman UEFA, Rabu (7/12).

Gol gelandang Polandia Jakub Blaszczykowski menit 23 dan penalti bek Jerman Mats Hummels menit 32, membuat Dortmund sepertinya bakal menang besar. Namun penyerang Prancis Loic Remy mencetak satu gol balasan bagi tim asuhan Didier Deschamps di akhir babak pertama. Andre Ayew menyamakan kedudukan menit 85, Velbuena kemudian melengkapi kisah manis klub Prancis dua menit kemudian. “Dengan kedudukan 2-1, (laga) itu masih tetap terbuka. Di babak kedua kami tahu masih punya kesempatan untuk mencetak gol. Setiap pemain mesti diberi aplaus malam ini,” ujar Valbuena. “Bisa comeback di sini benar-benar menakjubkan. Kami gagal mengambil kesempatan

ketika menghadapi Olympiakos. Kami gembira bisa kembali pada 2012,” katanya menambahkan. Berkat kemenangan tersebut, Marseille berhak mendampingi Arsenal ke babak 16 besar. Pasukan Deschamps tak terpengaruh hasil duel lainnya di Grup F, saat Olympiakos Piraeus menaklukkan The Gunners 3-1 di Yunani. “Sepakbola adalah olahraga yang luar biasa. Ini pertandingan sangat penting dalam sejarah Marseille. Suatu kebanggaan bagi kami masuk ke putaran berikutnya setelah dua tahun gagal,” tutur Deschamps. “Kami sudah sangat dekat dengan kenyataan tak mendapatkan apa-apa. Jadi, ini kinerja kolektif yang bagus. Kami memiliki keyakinan sampai akhir laga, n begitu juga suporter kami

Klasemen Grup E *Chelsea *Leverkusen Valencia RC Genk

6 6 6 6

3 3 2 0

2 1 2 3

1 2 2 3

13-4 11 8- 8 10 12-7 8 2-16 3

Klasemen Grup F *Arsenal *Marseille Olympiakos Dortmund

6 6 6 6

3 3 3 1

2 1 0 1

1 2 3 4

7- 6 11 7- 4 10 8- 6 9 6-12 4

Klasemen Grup G *APOEL *Zenit SP FC Porto Shakhtar

6 6 6 6

2 2 2 1

3 3 2 2

1 1 2 3

6-6 7-5 7-7 6-8

9 9 8 5

Klasemen Grup H *Barcelona *AC Milan Viktoria BATE

6 6 6 6

5 2 1 0

1 3 2 2

0 1 3 4

20-4 16 11-8 9 4-11 5 2-14 2

di stadion,” tambah mantan kapten Juventus dan Timnas Prancis tersebut. (m15/uefa/afp)

Hasil Matchday 6 Liga Champions, Selasa (Rabu WIB) Grup E: Genk (Belgia) vs Bayer Leverkusen (Jerman) Chelsea (Inggris) vs Valencia (Spanyol)

1-1 3-0

Grup F: B Dortmund (Jerman) vs Marseille (Prancis) Olympiakos (Yunani) vs Arsenal (Inggris)

2-3 3-1

Grup G APOEL Nicosia (Siprus) vs Shakhtar (Ukraina) Porto (Portugal) vs Zenit St Petersburg (Rusia)

0-2 0-0

Grup H Barcelona (Spanyo) vs BATE Borisov (Belarus) Viktoria Plzen (Ceko) vs AC Milan (Italia)

4-0 2-2


PEMAIN Porto James Rodriguez kecewa gagal menaklukkan Zenit St Petersburg di Dragao Stadium.

APOEL Tak Percaya Puncaki Grup G Waspada/Ist

MEKANIK Honda membahas cara kerja sistem injeksi berlabel PGM-FI.

LISBON (Waspada): Zenit St Petersburg berhasil melaju ke babak 16 besar Liga Champions, Selasa (RabuWIB), setelah menahan 0-0 FC Porto di Estadio do Dragao pada matchday 6 Grup G. Zenit hanya membutuhkan hasil imbang untuk meloloskan diri ke fase gugur untuk perta-

ma kalinya sepanjang sejarah. Meskipun klub Rusia itu jarang merepotkan kiper tuan rumah Helton, Zenit mampu bertahan dengan bagus dan layak lolos ke babak berikutnya. Namun, satu poin tidak cukup bagi mereka untuk menjadi juara grup, kendati APOEL Nicosia kalah 0-2 ketika menjamu

klub Ukraina, Shakhtar Donetsk. Klub Siprus itu memuncaki klasemen Grup G, karena rekor punya head-to-head lebih baik dari Zenit. Sukses besar ini hampir tak dipercayai APOEL. “Bisa menjadi salah satu di antara 16 tim terbaik di Eropa rasanya seperti tak bisa dipercaya. Saat ini semua tatapan du-

nia mengarah kepada kami,” ungkap pelatih APOEL Ivan Jovanovic dalam laman UEFA, Rabu (7/12). “Tahun ini kami menginginkan sesuatu dan kami ternyata mampu melampaui harapan. Saya kira ini hal yang normal bagi kami,” ujarnya lagi. (m15/rtr/uefa)


WASPADA Kamis 8 Desember 2011


Boling Sumut Masuk Tiga Besar Kejurnas Pra PON

MEDAN (Waspada): Grafik meningkat ditunjukkan kontingen atlet boling Sumut pada Kejurnas Pra PON 2011 yang berlangsung di Lintasan Jaya Ancol, Jakarta, 26 November hingga 2 Desember lalu. Di kelompok putra, Sumut berhasil menduduki posisi ketiga di bawah DKI Jakarta dan Jawa Barat. Imam Wiguna cs tampil di urutan ketiga dengan victory point 178. Jumlah itu adalah nilai total dari nomor single, double, trio, dan all event yang di-

ikuti. Pada bagian putri, Sumut turut menunjukkan grafik meningkat dengan tampil di posisi kelima setelah membukukan 87 poin. Dengan hasil itu, kontingen Sumut baik di kategori putra maupun putri dipastikan

tampil di PON 2012 Riau. “Naiknya peringkat Sumut tidak terlepas keberhasilan atlet menyumbangkan dua medali perunggu. Ini capaian yang jauh meningkat dibanding Kejurnas Pra PON sebelumnya, di mana Sumut gagal menyabet medali,” ujar Ketua Pengda PBI Sumut, Singgih Goenawan, Rabu (7/12). Dikatakan, keberhasilan atlet di luar dugaan mengingat awalnya Sumut tidak memasang target medali, melainkan

Pebulutangkis Kelas Dunia Ramaikan Kejuaraan Shamrock Candra Wijaya MEDAN (Waspada): Pebulutangkis kelas dunia dan klub tangguh di tanah air plus negara tetangga ikut meramaikan Kejuaraan Shamrock Candra Wijaya Yonex Open II memperebutkan piala bergilir Pangdam I/BB dengan total dana pembinaan Rp100 juta lebih. Menurut Ketua PB Shamrock Candra Wijaya, Suyantono, pebulutangkis kelas dunia juga mantan pemain nasional yang akan tampil di antaranya Waspada/Setia Budi Siregar Herianto (mantan partner Liem KETUA PB Shamrock Candra Wijaya didampingi Wakil Ketua Swie King), Ronald Susilo (Singa- Pengkot PBSI Medan Ahmad Haswin ST dan Sugeng Nasikin pura), Haryanto Arbie, Edy Har- foto bersama di PB Shamrock, Rabu (7/12) memegang trofi tono, Hermawan Susanto, Can- Kejuaraan Shamrock Candra Wijaya Yonex Open II. dra Wijaya, Trikus, dan lainnya. terdiri atas Jaya Raya Jakarta, SGS Bandung, Selain itu, Suyantono mengatakan turut hadir Surya Naga Surabaya, Ganesha Banten, Penang, mantan pebulutangkis nasional putri seperti Tangkas Jakarta ditambah Malaysia dan Verawaty Fajrin, Sar-wendah, Rosiana Tandean, Singapura. Liang Chui Shia, Yanti Kusmiati, Ratih Kumala Walaupun masih berumur dua tahun, SuyanDewi, dan lainnya. tono menyebutkan PB Shamrock berupaya “Mereka bukan bermain eksibisi, namun membuat terbaik seperti menggelar kejuaraan mengikuti kejuaraan. Ditargetkan 700 peserta untuk kedua kalinya dengan tujuan mengangkat mengikuti kejuaraan,” tambah Suyantono harkat dan martabat bulutangkis Sumut. didampingi Wakil Ketua Pengkot Percasi Medan Wakil Ketua PBSI Medan, Ahmad Haswin Ahmad Haswin ST dan Sugeng Nasikin, Rabu ST, menyebutkan pihaknya sangat mendukung (7/12). kejuaraan. Dengan banyaknya kegiatan, tentu Pemain nasional yang akan tampil di Gedung akan menambah jam terbang pemain. Di Medan Bulutangkis PBSI Medan pada 10-14 Januari saat ini, kata Ahmad, ada 35 klub yang terdaftar, 2012 itu adalah Rendra Wijaya, Rian Sukmawan, namun hanya 10-15 klub yang aktif. (m18) dan Erwin Wihardi. Klub yang memastikan ikut

KONI Medan Berharap Kalender Tetap Catur Beregu Piala Wali Kota Medan MEDAN (Waspada): Dalam rangka pengembangan dan peningkatan prestasi olahraga catur di Sumatera Utara umumnya dan Medan khususnya, Pengkot Percasi Medan dan KONI Medan bekerjasama dengan Pengprov Percasi Sumut menyelenggarakan kejuaraan catur beregu memperebutkan Piala Wali Kota Medan. Demikian disampaikan Ketua Panitia Ir H Syaharuddin Noor MN, Rabu (7/12). Menurutnya, pagelaran yang dihelat di Aula Universitas Amir Hamzah JlWillem Iskandar PasarV Barat Kampus Medan Estate pada 13-16 Desember nanti akan diikuti klub/perkumpulan catur dari instansi, perusahaan, sekolah dan perguruan tinggi, dan lainnya. Di samping trofi Wali Kota Medan, panpel juga menyediakan hadiah dana pembinaan untuk kategori beregu dan perorangan berjumlah total Rp13,5 juta. Nantinya, kejuaraan beregu ini mempertandingkan tiga partai dari setiap regu peserta di mana masing-masing tim hanya boleh diikuti satu pecatur bergelar Master.

Setiap regu peserta terdiri atas tiga pemain inti tanpa cadangan dengan satu manajer (ofisial). Pendaftaran peserta sudah dibuka mulai 8 Desember lalu dan ditutup 12 Desember nanti di Sekretariat Panitia, Jl Sena No 26 Medan (depan kantor POMDAM I/BB) atau menghubungi Ir H Syaharuddin Noor MN (081361626569), Suhadi WN (081375729850). Syarat pendaftaran menyerahkan daftar nama pecatur dan membayar biaya pendaftaran Rp100 ribu per regu. Secara terpisah, Drs H Zulhifzi Lubis (Opunk Ladon) yang juga Ketua Umum KONI Medan didampingi Sekum Drs Khairil Basri berharap turnamen tersebut menjadi kalender tetap Percasi Kota Medan dalam meningkatkan pembinaan catur daerah tersebut. “Untuk itu, kami berharap pecatur yang berhimpun dalam wadah regu khususnya pecaturpecatur Kota Medan dapat berpartisipasi sebagai peserta dalam kejuaraan beregu kali ini,” pinta Opunk. (m18)

Sepatu Roda Sumut Target Maksimal Kejurnas Kualifikasi PON MEDAN (Waspada): Kontingen atlet sepatu roda Sumut memasang target maksimal pada Kejurnas Kualifikasi PON yang akan berlangsung di Lintasan In Line GOR Saparua Bandung, Jawa Barat, 9-11 Desember nanti. “Kali ini kami tidak sekadar ingin merebut tiket PON, tapi juga meraih medali minimal satu emas,” ujar pelatih sekaligus atlet Persatuan Olahraga Sepatu Roda Seluruh Indonesia (Perserosi) Sumut, Doli M Ja’far Dalimunthe, di Bandara Polonia Medan, Rabu (7/12). Didampingi Manajer Tim Zulfan Ramli, Doli mengaku sebelumnya Perserosi Sumut yang mayoritas diperkuat atlet junior hanya memasang target minimal meraih lima tiket PON 2012 di Riau. “Namun melihat motivasi atlet yang cukup tinggi ditambah kemampuan yang terus

meningkat, kami akhirnya berani memasang target satu medali emas,” ucap Doli yang akan tampil di nomor 300 meter ITT. Diketahui, tim sepatu roda Sumut yang diperkuat 11 atlet akan bertanding di nomor Individual Time Trial (ITT) 300 meter, ITT 500 meter, Sprint 1.500 meter, Elimination & Poin to Point (PTP) 10.000 meter, dan Relay 5000 meter. “Peluang medali ada di nomor sprint 300 meter ITT, 1500 m putra dan Relay putra. Insya Allah, saya akan ikut tampil dan mempersembahkan medali,” pungkas Doli. Ke-11 atlet sepatu roda Sumut di Kejurnas tersebut adalah M Rizki Ramadhan, Nafian Pradipta, Arif Hidayat, Sendi Mazini, Adrian, Doli M Ja’far Dalimunthe (putra), Ananda Putri, Lydia Pupita, Siti Kadarsih, Nasyatul Aufa, dan Arini Adni (putri). (m42)

Problem Catur


Hitam melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2 8







1 A








tiket PON. Namun berkat perjuangan maksimal atlet, Sumut membawa pulang medali. “Sekarang saatnya seluruh atlet mulai fokus mempersiapkan diri tampil di PON. Sesuai kuota, setiap daerah akan mengirim enam atlet. Untuk itu, dalam waktu dekat PBI Sumut segera menentukan keenam atlet itu,” ucap Singgih. Sumut merebut dua medali perunggu dari Imam Wiguna pada single putra dan pasangan Kartika Wahyu Putri/Aldila Indryati di double putri. “Kami sangat bersyukur bisa mempersembahkan medali, setidaknya ini awal baik bagi penampilan pertama kami di ajang sekelas Pra PON. Apa yang telah kami capai juga menjadi motivasi merebut medali emas di PON nanti,” ucap Aldila Indryati optimis. (m42)

Bupati Madina Lepas Peserta Safari Wisata Buru 2011 PANYABUNGAN (Waspada): Bupati Mandailing Natal (Madina), HM Hidayat Batubara SE, resmi melepas peserta Kejuaraan Daerah (Kejurda) Safari Wisata Buru 2011 di halaman Mapolres Madina, Rabu (7/12). Sebelumnya, Dir Pamovit Poldasu Kombes Pol Barmen Tampubolon lebih dulu membuka event ini ditandai penyerahan senjata berburu secara simbolis kepada Bupati Madina. HM Hidayat menyebutkan, selain menyalurkan hobi dan bakat berburu, event ini juga memiliki manfaat sosial membantu petani membasmi hama babi yang merusak lahan warga. “Kerjasama pemerintah daerah dengan Pengprov maupun Pengcab Perbakin harus lebih ditingkatkan. Selain meraih prestasi, event berburu juga bertujuan membantu petani untuk membasmi hama babi,” ucap Bupati. Ketua Harian Pengprov Perbakin Sumut, Musa Idhishah akrab disapa Doddy, mengharapkan peserta dapat bertanding dengan menjunjung tinggi sportivitas. Dia juga mengingatkan agar peserta mengikuti aturan dan tata tertib berlaku, di antaranya tidak membiarkan atau meninggalkan hewan buruannya begitu saja. AKBP Barmen Tampubolon, menyampaikan amanat Kapoldasu Irjenpol Wisjnu Amat Sastro, berharap event berburu ini dapat dilakukan secara rutin. “Para peserta dapat mengambil peran dengan membantu membasmi hama babi. Selain itu juga meningkatkan kerjasama menjaga Kamtibmas di daerah berburu dengan melaporkan kegiatan-kegiatan yang dicurigai melanggar hukum,” terangnya. Kapolres Madina, AKBP Ahmad Fauzi Dalimunte, memberikan apresiasi besar atas perhelatan yang sudah menjadi program kerja tetap Perbakin Sumut ini. Safari Wisata Buru 2011 diikuti 36 peserta dan berlangsung 7-11 Desember 2011. (m47)


TIM Boling Sumut foto bersama usai mengikuti Kejurnas Pra PON 2011 di Lintasan Jaya Ancol, Jakarta. Sumut berhasil merebut dua medali perunggu pada event yang berakhir 2 Desember lalu.

Kejutan Grace Di Laga Perdana Garuda Indonesia Tennis Master 2011 JAKARTA (Waspada): Petenis putri andalan Sumut, Grace Sari Ysidora Tobing, membuat kejutan pada penampilan pertamanya di turnamen Garuda Indonesia Tennis Masters 2011, Rabu (7/12). Boru Tobing sukses mengalahkan Sandy Gumulya (Kaltim) 4-6, 6-1, 8-6 di Lapangan Tenis Hotel Sultan, Jakarta. Mengandalkan pukulan keras ke arah baseline ditunjang fisik prima, Grace memberi perlawanan sengit dan beberapa kali membuat penonton bertepuk tangan, hingga sukses memastikan tiket ke babak kedua. Laga lain di Grup B, Lavinia Tananta mengalahkan mantan

petenis nasional era 1990-an, Romana Tedjakusuma (Jatim), 6-4, 6-4. Selain itu, Jessy Rompies (Kaltim) menang 7-6 (1), 6-1 atas Laili Rahmawati Ulfa (DKI). Pada bagian putra, petenis terbaik putra Indonesia asal DKI, Christopher Rungkat, mencatat kemenangan mudah 6-2, 6-3 atas Seno Hartono Suwandi (Jabar). Di tunggal putra lainnya, Sunu Wahyu Trijati (Jateng) ditaklukkan Aditya Hari Sasongko (DIY) 7-6 (3), 6-1. Di Grup B, Elbert Sie (Jabar) menang 6-2, 6-2 atas pemain alternatif Ega Uneputty (DKI) dan David Agung Susanto (Riau) mengalahkan Ryan Tanujoyo

(Jabar) 6-0, 6-2. Di tunggal putri, unggulan pertama Ayu Fani Damayanti (DKI) juga tidak menemui kesulitan berarti. Ayu, berada di Grup A, menang 6-3, 6-1 atas Cynthia Melita (Jateng). Pada Kamis (8/12) ini, Christo akan menghadapi Aditya Hari Sasongko, Sunu melawan Seno Hartono. Pada Grup B, Elbert berhadapan dengan Ryan Tanujoyo dan David Agung bertemu Ega Uneputi. Turnamen master ini diikuti hanya delapan tunggal putraputri terbaik Indonesia. Di sektor ganda, peserta hanya ditandai empat pasangan baik putra maupun putri. (yuslan)

6 Balon Ketum IMI Bersaing JAKARTA (Waspada): Dari 13 formulir yang diambil bakal calon Ketua Umum PP Ikatan Motor Indonesia (IMI) periode 2011-2015, hanya enam berkas yang dikembalikan ke Tim Pendaftaran Bakal Calon Pimpinan IMI. Keenam berkas yang dikembalikan untuk maju di arena Musyawarah Nasional (Munas) IMI di Solo, 15-16 Desember nanti, adalah milik Adiguna Sutowo, Hotma Mangaradja Panjaitan, Nanan Soekarna, Benny Laos, Sadikin Aksa, dan Johny Pramono. “Sejak dibukanya pendaftaran dua bulan lalu, ada 13 formulir yang diambil. Namun saat penutupan Jumat (2/12). hanya enam formulir yang dikembalikan,” ujar Ketua Pendaftaran Bakal Calon Pimpinan IMI 2011-2015, Donni B Prihandana, Rabu (7/12). Berkas-berkas yang diserahkan oleh enam Balon, lanjutnya, telah diperiksa kelengkapannya. Dikatakan, berkas akan diserahkan kepada pleno Munas IMI pada 16 Desember untuk selanjutnya ditetapkan Munas IMI menjadi calon Ketua Umum IMI. Nantinya, balon akan diundang memaparkan visi misinya di hadapan peserta pleno Munas IMI VII. Sementara itu, pendaftaran balon anggota Dewan Pertimbangan IMI diperpanjang hingga 15 Desember pukul 20.00 WIB. (yuslan)

32 Klub Ikuti Divisi Utama JAKARTA (Waspada): Sebanyak 32 klub berkomitmen mengikuti kompetisi Divisi Utama yang diselenggarakan PT Liga Indonesia (LI) sekaligus menolak untuk mengikuti liga yang digelar PT Liga Prima Indonesia Sportindo (PT LPIS). “Kami ingin mempertegas pada masyarakat bola, bahwa Divisi Utama itu cuma satu. Nantinya, 32 tim berikrar akan bermain di PT Liga berdasarkan komitmen kami pada Kongres Bali yang dilanggar pengurus baru PSSI,” kata CEO Persigo Gorontalo, Afen Genolo, pada pertemuan manajer di Hotel Sahid, Jakarta, Rabu (7/12). Kompetisi Divisi Utama akan dimulai 15 Desember nanti dan Yogyakarta mendapat kehormatan menjadi tuan rumah pembukaan. Pertandingan perdana akan mempertemukan tuan rumah PSIM Yogyakarta dengan Persita Tangerang. “Liga akan diikuti 32 klub. Rencana awal akan dibagi dalam 3 grup. Selanjutnya, nanti akan didiskusikan para peserta,” kata CEO PSIM, Yoyok Setiawan. CEO PT LI, Joko Driyono, menerangkan bahwa lebih dari 50 pertandingan di kompetisi Divisi Utama juga akan ditayangkan langsung oleh ANTV. Namun, Divisi Utama baru live dengan catatan di hari tersebut tidak ada jadwal laga kompetisi Indonesian Super League (ISL). (m33/vvn)



1. Tempat duduk untuk penunggang kuda, tapi dalam olahraga senam jadi alat untuk pegangan yang terpasang pada kuda-kuda. 4. Alat berbunyi yang ditiup wasit dalam memimpin pertandingan. 6. Persatuan Sepakbola Makassar. 8. Sabuk; Ikat pinggang (Inggris). Sabuk hitam karate disebut black ___. 9. Arti kata court dalam olahraga tenis atau diamond dalam bisbol. 11. Persatuan Squash Indonesia. 15. Arti kata stick dalam olahraga hoki dan polo. 16. Sarung tangan tinju (Inggris, jamak). 17. Kata yang diucapkan pemain catur untuk memperingatkan raja lawan sedang terancam. 19. Gerak dalam karate, yudo dan aikido. 20. Liga Pendidikan Indonesia. 22. Salah satu perlombaan dalam karate (di SEAGames 2011 dijagoi Jintar Simanjuntak dan Donny Dharmawan dari Sumut). 23. Mencetak skor dalam bisbol setelah pemain memukul bola keluar lapangan (dua kata Inggris populer, tulis tanpa spasi). 25. Hati-hati; Nama koran di Medan yang menggelar pertandingan olahraga setiap memperingati ulang tahunnya pada 11 Januari.


Anneke/Nitya Lolos Tanpa Keringat JEONNAM, Korea (Waspada): Ganda putri Anneke Feinya Agustin/Nitya Krishinda Maheswari (foto) melenggang ke babak ketiga Korea Terbuka GP Gold setelah unggulan utama Ha Jung Eun/Kim Min Jung mengundurkan diri, Rabu (7/12). Sebelumnya, Feinya/Nitya lolos ke babak kedua dengan menyingkirkan ganda Korea lainnya, Chae Yoo Jung/Lee Im Jung. Di hadapan publiknya sendiri yang memadati Hwasun Indoor Stadium, Chae/Lee dikalahkan 21-14, 21-9. Dua ganda putri lainnya juga maju ke babak kedua. Della Destiara/Andini Suci Rizky menyingkirkan Jung Ji Song/Yoo 21-12, 21-10 dan Komala Dewi/ Jenna Gozali menyingkirkan Han SoYeon/Kim Hyo Min juga

26. Olahraga bela diri asal Korea.


1. Tendangan hukuman di titik 12 pas dalam sepakbola. 2. Gelanggang. 3. Medan; Tempat (untuk bertanding dsb). 4. Kayu tipis (tempat meletakkan buah catur). 5. Javelin dalam atletik adalah lempar ____. 7. Cabang olahraga yang memerlukan kekuatan, ketangkasan dan kecepatan, terdiri atas nomor-nomor lari, lompat dan lempar. 10. Salah satu kategori yang dinilai dalam olahraga senam dan lomba renang indah. 12. Cabang olahraga yang kompetisinya saat ini ada ISL dan IPL. 13. Cabang olahraga yang menerapkan aturan 35 detik untuk melakukan tembakan bola ke gawang selain bola basket (dua kata tanpa spasi). 14. Alat ringan yang dilempar dalam cabang atletik (Inggris). 18. Perjanjian tertulis antara dua pihak, dalam sewa menyewa pemain asing. 21. Medali nomor satu. 24. Pukulan dalam tinju. 25. Walk Out.

dari Korea 21-17, 21-12. Selain ganda putri, Indonesia juga berhasil meloloskan wakilnya di kategori tunggal dan ganda campuran. Untuk tunggal putri, Maria Febe Kusumastuti belum terhadang menyusul kemenangan atas Kim Min Young 21-17, 21-15. Selanjutnya, Febe akan menantang unggulan kelima asal China, Li Xuerui. Di ganda campuran, Fadhilah Irfan/Anggraini Weni mengalahkan Jang Seung Hoon/ Yoon Yeo Sook 22-20, 21-15. Fran Kurniawan/Shendy Puspa Irawati meraih tiket babak selanjutnya dengan menyingkirkan Lee Sang Joon/Ko A Ra 21-17, 21-19. Wakil Indonesia lain yang lolos adalah tunggal putra. Tommy Sugiarto, diunggulkan di tempat kelima, menunduk-

kan Pei Wee Chung (Malaysia) 21-7, 21-4, sedangkan Sony Dwi Kuncoro melewati rintangan pertama kala mengalahkan pemain tuan rumah, Kim Dong Nyung, 21-11, 21-16. Dionysius Hayom Rumbaka mendampingi kedua rekannya usai menang susah payah atas Park Young Nam. Untuk lolos, Hayom harus bertarung tiga set sebelum menang 20-22, 21-8, 21-8. Kekalahan dialami tunggal putri Aprilia Yuswandari yang takluk dari Tee Jing Yi 9-21, 21-23, 18-21. Selain Aprilia, ganda putri Imawan Gebby Ristyani/Nuraidah Tiara Rosalia dan Gideon Markus Fernaldi/Agripinna Prima Rahmanto Putra pun gagal mengikuti laju rekanrekannya. (m33/ant)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu 15 menit. Jawabannya lihat di halaman A2 kolom 1.

4 3 7 9 5 2 3 5 6 1 3 8 4 1 9 9 6 3 8 5 2 7

8 6 7 2 7 6 5 5 3 7 ****209



WASPADA Kamis 8 Desember 2011

Saha Ingin Bayar Utang Persisam Bakal Pulang Tangan Hampa MEDAN (Waspada): Striker PSMS Medan, Ikpefua Osas M Saha, merasa berutang kepada penonton, karena gagal mencetak gol pada penampilan pertamanya di pentas Indonesia Super League (ISL) musim ini. Karena itu, Saha berjanji melunasi utang itu saat Ayam Kinantan menjamu Persisam Samarinda di Stadion Teladan, Kamis (8/12) ini pukul 15.30 WIB.

KEGAGALAN mencetak gol di laga perdana ingin ditebus striker PSMS Medan asal Nigeria, Osas Saha (hijau), kala menghadapi Persisam Samarinda di Stadion Teladan, Kamis (8/12) ini.

Sama halnya dengan Saha, penjaga gawang Markus Haris Maulana berjanji siap mempertahankan gawangnya agar tidak kobobolan. Markus yang juga kapten PSMS mengatakan siap mengawal gawangnya dari kemasukan apapun resikonya. Janji Saha dan Markus pun direspon hangat oleh Drs Benny Tomasoa. Manajer Tim PSMS ini mengaku keyakinannya atas janji kedua bintang itu dapat terwujud saat Ayam Kinantan menghadapi Persisam.

(8/12) ini. Manajer Keuangan PSMS, H Iswanda Nanda Ramli, mengatakan tiket yang akan dibagikan itu berupa VIP 300 lembar dan tribun tertutup sebanyak 400 lembar. Ketua AMPI Medan itu juga menambahkan Rahudman turut mengajak masyarakat sepakbola Medan

lainnya membeli tiket saat menyaksikan aksi PSMS menjamu Persisam Samarinda. Kepada wartawan di Stadion Kebun Bunga Medan, Rabu (7/12), Nanda Ramli menambahkan Rahudman yang juga Ketua Umum PSMS itu akan menyerahkan hasil penjualan tiket untuk meringankan

beban Ayam Kinantan selama mengikuti kompetisi yang dipastikan menelan biaya hingga puluhan miliar. Sementara itu, pihak panpel menyatakan tetap menghargai tiket VIP Rp100 ribu, tribun tertutup Rp60 ribu, Rp30 ribu untuk tribun terbuka. (m17)

Panpel PSMS Kecolongan MEDAN (Waspada): Panitia Pelaksana (Panpel) Kompetisi Indonesian Super League (ISL) di Medan kecolongan dengan banyaknya penonton yang masuk tanpa tiket, saat PSMS Medan menghadapi Mitra Kukar di Stadion Teladan Medan, Minggu (4/12) lalu. Panpel mengklaim penjualan tiket sebanyak 8.727 lembar malam itu. Namun banyak pihak meragukan penjualan tersebut mengacu banyaknya penonton

yang menyaksikan pertandingan. “Ya, kita akui penonton banyak, tapi itulah hasil dari penjualan tiket. Tidak ada yang kita sembunyikan dan ini transparan untuk publik,” ungkap Ketua Panpel PSMS, Syafril SH, di Medan, Rabu (7/12). Kendati begitu, Syafril tidak membantah masih banyak penonton yang masuk stadion tanpa membeli tiket. Parahnya, penonton bisa memasuki stadion

karena dibawa petugas panpel dan juga pihak keamanan yang menjaga pintu masuk, khususnya tribun terbuka. “Karena itu, kami mengimbau petugas panpel dan aparat keamanan tidak lagi memasukkan penonton tanpa tiket. Apabila terulang dan oknumnya ketahuan, kami akan tindak te-

gas,” sebut Syafril. Manajer Keuangan PSMS, H Iswanda Nanda Ramli, pun mengaku panpel masih banyak kecolongan. Demi perbaikan ke depan dan mencegah halhal yang tidak diinginkan, pihaknya akan melakukan pembenahan dan evaluasi secara perlahan. (m17)

Emas Olimpiade Incaran Djokovic LONDON (Waspada): Novak Djokovic memang berhasil memenangkan sejumlah gelar grand slam musim ini. Sementara itu, ajang Olimpiade 2012 mendatang sudah dibidik petenis Serbia itu dengan harapan mendulang medali emas. Penampilan mengagumkan diperlihatkan Djokovic sepanjang tahun 2011. Terbukti, petenis nomor wahid dunia itu merebut tiga gelar grand slam di Australia, Wimbledon, dan Amerika Serikat. Kini, Djokovic membeberkan kunci keberhasilan meraih banyak gelar. AP “Memang benar permainan saya membaik, tapi itu hanya presentasi kecil. Ini adalah permainan yang sama seperti yang dimainkan dalam beberapa tahun terakhir. Hanya, mental bertanding di lapangan yang sedikit berubah,” jelas Djokovic, Rabu (7/12). “Itulah yang membedakan. Saya mampu memperbaikinya. Saya lebih dewasa dan mengatakan bisa melakukannya. Saya rasa keberuntungan tidak hanya berkaitan dengan keberuntungan, tapi juga keyakinan,” lanjutnya. Setelah istirahat panjang, Djokovic kembali bulan depan. Tugas pertamanya tentu mempertahankan gelar juara Australia Terbuka. Setelah itu, The Djoker membidik Wimbledon dan Olimpiade di London. “Saya baru berusia 24 tahun dan ingin meraih banyak kesuksesan dan gelar juara sebanyak mungkin. Ajang Olimpiade juga akan bergulir di mana saya juga mengincar medali emas,” tandas petenis Serbia yang menggeser Rafael Nadal sebagai petenis nomor satu dunia. (m33/ap)

Gonzales,” ujar pelatih asal Malaysia itu. “Kami cukup antusias menghadapi laga ini, karena kami pun menganggap Persisam sebagai timnas mini,” ungkap mantan pelatih Persipura Jayapura dan Persiram Raja Ampat itu. Manajer Tim Persisam, Agus Setiawan, tidak terlalu bersedia mengungkapkan persiapan timnya dalam laga tandang keduanya ini. Yang jelas, Agus mengatakan seluruh punggawa Elang Borneo dalam kondisi terbaiknya. “Misi Persisam tetap seperti melawan PSAP, yakni mencuri poin. Namun, kami tak menganggap enteng PSMS yang memiliki nama besar. Intinya, kami juga tak ingin lengah meskipun tiga pemain asing belum dapat turun,” sebutnya. (m17)

Olimpiade Sarat Makna Bagi Becks

Rahudman Bagi-bagi Tiket MEDAN (Waspada): Merasa bersyukur atas suksesnya penyelenggaraan kompetisi Indonesian Super League (ISL) di Stadion Teladan Medan, Minggu (4/12) lalu, Wali Kota Medan Drs H Rahudman Harahap MM kembali akan membagi-bagikan tiket cuma-cuma (gratis) kepada masyarakat Kamis

“Walau diperkuat sejumlah pemain nasional seperti Christian El Loco Gonzales, Yongki Aribowo, dan Eka Ramdhani, saya yakin Persisam tetap akan mengalami kesulitan menghadapi PSMS,” katanya kepada wartawan di Stadion Kebun Bunga Medan, Rabu (7/12). Kegagalan memetik angka penuh dari Mitra Kukar pun mencambuk Zulkarnaen cs untuk melampiaskannya ke lawan kedua PSMS nanti. Benny menambahkan sulitnya PSMS

tumbang di Teladan dari lawanlawannya kembali akan tercermin nanti. “Intinya, Persisam harus siap-siap menerima kenyataan pahit dan pulang tangan hampa,” sebut Benny. Pelatih Raja Isa mengaku timnya akan menghadapi laga kandang nan berat karena Persisam memiliki pemain-pemain merata dan penuh pengalaman, seperti El Loco yang terkenal haus gol dan ‘mematikan’ di kotak penalti. Kualitas sebagai tim tangguh juga sudah dibuktikan Persisam saat mengalahkan PSAP Sigli di kandangnya, Minggu lalu. “Pemain telah diwanti-wanti agar waspada dengan serangan Persiram dan tidak memberi kesempatan bagi Gonzales melakukan tendangan ke arah gawang Markus. Pastinya, pemain harus mempersempit gerakan

Waspada/Austin Antariksa

MELBOURNE, Australia (Waspada): David Beckham (foto) mengatakan akan merasa takjub bila ada prospek baginya bermain di Olimpiade 2012 di London. Bintang LA Galaxy ini juga mengaku enggan kembali ke Liga Premier. Demikian dikatakan mantan bintang Manchester United dan Real Madrid usai Galaxy yang juga jawara Liga Sepakbola AS (MLS) 2011 mengalahkan Melbourne Victory 4-3 lewat adu penalti di Melbourne, Selasa (6/12) malam. Mantan kapten timnas Inggris itu tengah memperhitungkan kembali ke Eropa dengan adanya tawaran besar dari klub Prancis, Paris Saint-Germain. Namun, Beckham juga bisa memilih tetap berada di Galaxy atau memilih klub Eropa lainnya. Gelandang berusia 36 tahun itu dilaporkan memiliki juga tawaran dari klub Inggris, tetapi masih memperhitungkan adanya hubungan panjang dengan Manchester United. Beckham, menikmati masa cemerlangnya bersama klub juara Liga Inggris yang ditinggalkannya pada 2003, mengatakan tampil di Olimpiade 2012 merupakan kesempatan paling hebat dalam kariernya. “Saya pendukung Man United dari waktu ke waktu, jadi rasanya sukar untuk tampil dalam tim lain, selain Red Devils,” kata Beckham. “Saya putra asli Leytonstone karena di kota sebelah timur London itu saya dibesarkan. Karena itu pula saya ingin menjadi bagian dari tim Olimpiade di negara saya. Membela tim negara di London di tempat saya tumbuh tentu merupakan bagian yang teramat spesial,” lanjut Becks. Dengan kemenangan atas Melbourne, Galaxy mengakhiri tur Asia mereka tanpa kekalahan. Sebelumnya, skuad besutan Bruce Arena ini menaklukkan Indonesia Selection 1-0 dan tim nasional Filipina 6-1. Dari Paris, Harian Le Parisien menyebutkan Paris Saint Germain mengambil langkah progresif dalam upaya mendatangkan Beckham dengan mendapatkan sekolah bagi anak-anak suami Victoria Adams di ibukota Prancis itu. Harian tersebut mengklaim PSG telah mengidentifikasi British School of Paris di Croissy-sur-Seine atau 17 km ke arah Barat dari pusat kota sebagai tempat ideal bagi proses belajar Brooklyn (12 tahun), Romeo (9), dan Cruz (6). Sementara itu, anak terkecil Beckham, Harper Seven, baru berusia enam bulan. Le Parisien juga menyebutkan PSG telah memperoleh dua properti mewah untuk keluarga Beckham berupa rumah mewah di pusat kota dan villa di daerah Yvelines, sebelah barat Paris. (m33/ant/afp)

Medan Metropolitan

WASPADA Kamis 8 Desember 2011


Muhammadiyah Minta Hakim Kabulkan Permohonan BKM Al-Ikhlas MEDAN (Waspada): Kasus penggusuran dan pembongkaran Mesjid Al-Ikhlas di Jln. Timor Medan mulai mendekati titik akhir. Kamis (8/12), hakim Pengadilan Tata Usaha Negara (PTUN) Medan akan memutuskan perkara penghancuran mesjid itu yang dinilai melanggar hukum wakaf dan undang-undang, serta penyelewengan penerbitan sertifikat tanah areal masjid. “Kami berharap majelis hakim, memperhatikan fakta-fakta persidangan dan jangan mau diintervensi dalam pengambilan keputusan. Muhammadiyah meminta hakim mengabulkan permohonan BKM Al-Ikhlas,“ tegasWakil Ketua Pimpinan Daerah

Muhammadiyah (PDM) Kota Medan Rafdinal MAP, Rabu (7/12). Di dampingi Ketua Majelis Hikmah dan Kebijakan Publik PDM Medan Drs. Anwar Bakti, Rafdinal mengatakan, kasus yang melukai perasaan umat Islam ini, telah cukup lama terombang-ambing. Fakta-fakta persidangan menyatakan masjid itu berstatus wakaf sehingga tidak boleh diperjualbelikan. Kedua, warkat atau risalah sertifikat hak pakai nomor 847 tahun 2006 yang dikeluarkan Badan Pertanahan Nasional (BPN) atas tanah yang di atasnya berdiri Masjid Al-Ikhlas sebelum dirobohkan, telah menyalahi aturan prosedur penerbitan sertifikat.

Ketiga, ketika dilakukan pengukuran langsung di lapangan, ditemukan ketidaksamaan antara ukuran tanah yang ditulis di sertifikat dengan fakta di lapangan. Keempat, bangunan mesjid tidak disebutkan sebagai objek dalam sertifikat tersebut. Lebih jauh, kata pakar administrasi publik ini, undang-undang telah menyebutkan objek barang, baik tanah dan bangunan berstatus wakaf tidak boleh dijual. “Namun, substansi sebenarnya adalah kasus pembongkaran mesjid bertentangan secara langsung dengan konstitusi UUD 1945 soal kebebasan dalam menjalan kehidupan beragama. Bayangkan saja, pada malam hari saat

penggusuran itu, umat Islam yang sedang iktikaf diusir dari masjid,” tegas Rafdinal . Sementara itu, Anwar Bakti menekankan, kasus ini hanya bisa terjadi karena tidak adanya perlindungan terhadap rumah ibadah terutama masjid. “Harusnya, Kota Medan dari dulu sudah punya Perda soal perlindungan rumah ibadah, terutama masjid,” ujarnya. Terakhir, Rafdinal dan Anwar menyerukan agar seluruh ormas dan aktivis Islam merapatkan barisan guna mengawal persidangan ini. “Melalui semangat tahun baru Islam 1433 H, mari luruskan shaf dan rapatkan barisan,” tegas Rafdinal. (m49)

Dua Penumpang Pesawat Sembunyikan SS Dalam Perut MEDAN (Waspada): Petugas P2 Bea dan Cukai (BC) Bandara Polonia Medan, kembali menggagalkan masuknya narkotika jenis sabu-sabu (SS) dari Malaysia, yang dibawa dua penumpang pesawat Air Asia, Selasa (6/12) malam. Kedua tersangka Syarwan Bin Yusuf, 29, warga Cot Glumpang Baroh, Kab. Biereun dan Rasyidi, 27, warga Desa Lhok Keutapang, Kec. Tangse, Kab. Pidie, diamankan dari terminal kedatangan internasional Ban-

dara Polonia. Mereka ditangkap setelah terdeteksi petugas P2 BC menyembunyikan sabu-sabu di dalam perut. Direktur Dit Narkoba Polda Sumut Kombes Pol. Andjar Dewanto kepada wartawan, Rabu (7/12) mengatakan, kedua warga Aceh itu ditangkap oleh dua petugas Bea dan Cukai, Berry dan Fendi sekira pukul 21:45. Ketika itu, kedua tersangka baru saja mendarat di Bandara Polonia dengan pesawat Air Asia AK 1356 dari Kuala Lumpur, Malaysia. Saat melintas di depan petugas Bea dan Cukai, tampak gerak-gerik keduanya mencurigakan. Karena itu, petugas melakukan pemeriksaan

Waspada/Amir Syarifuddin

DIREKTUR Utama PDAM Tirtanadi Ir Azzam Rizal menerima kunjungan PW Aisyiyah Sumut, di ruang kerjanya, Selasa (6/12).

PW Aisyiyah Sumut Kunjungi PDAM Tirtanadi MEDAN (Waspada): PDAM Tirtanadi menerima kunjungan PimpinanWilayah(PW) Aisyiyah Sumut, Selasa (6/12). Rombongan dipimpin Hj Elynita diterima Direktur Utama PDAM Tirtanadi Ir Azzam Rizal, MEng didampingi Kadiv Public Relations Ir Amrun dan Kabid Publikasi dan Komunikasi. Kepala Divisi Public Relations PDAM Tirtanadi Ir Amrun dalam siaran persnya, Rabu (7/12) mengatakan, Hj Elynita mewakili rombongan menyampaikan maksud kunjungan untuk mendapatkan informasi tentang kondisi dan program kerja PDAM Tirtanadi dalam memberikan pelayanan kepada masyarakat, sekaligus menyampaikan rencana kegiatan Konsolidasi dan Rapat Kerja Majelis dan Lembaga Aisyiyah Sumut yang akan dilaksanakan 23 – 25 Desember 2011. Ir Azzam Rizal, MEng dalam kesempatan itu menyampaikan secara ringkas kondisi PDAM Tirtanadi yang saat ini mengalami keterbatasan kapasitas produksi, sehingga tidak dapat melakukan pengembangan pelayanan. Namun PDAM Tirtanadi tetap berkomitmen untuk tetap memberikan pelayanan terbaik bagi pelanggan. “Kita berharap semua bersatu untuk mencari solusi ketersediaan air bersih bagi masyarakat, karena kebutuhan akan air bersih merupakan kebutuhan utama masyarakat yang tidak dapat tergantikan” katanya. Elynita mengatakan, cukup puas dengan pemaparan Dirut PDAM Tirtanadi tersebut dan akan mensosialisasikan hal ini kepada pengurus dan anggota Aisyiyah Sumut, untuk melakukan penghematan air sekaligus mendukung upaya yang dilakukan PDAM Tirtanadi dalam melaksanakan program peningkatan pelayanan akses air bersih kepada masyarakat.(m28)

Kaca Mobil Dosen Pecah Dilempar Batu MEDAN (Waspada): Mobil dosen Politeknik Medan, Eqmond Daniel Sitompul,56, warga Jln. Pintu Air IV, Kel. Kwala Bekala, Kec. Medan Johor, yang parkir di grasi rumahnya rusak dilempar pakai batu, Rabu (7/12). Informasi diterima wartawan di Mapolsek Delitua menyebutkan, korban mengetahui kaca belakang mobilnya Daihatsu Terios warna hitam BK 1125 IS pecah berantakan, saat hendak menghidupkan mesin mobilnya pukul 06:30. Dia mendapati dari dalam mobil tiga batu yang diduga digunakan pelaku untuk melempar mobilnya. Kepada petugas Polsek Delitua, korban mengaku tidak ada barang-barangnya di dalam mobil ataupun di rumah yang hilang. Kapolsek Delitua Kompol SP Sinulingga melalui Kanit Reskrim AKP S Sembiring yang dikonfirmasi membenarkan laporan dosen tersebut dan akan segera memproses kasus itu.(m40)

barang bawaan termasuk badan keduanya. Hasil pemeriksaan petugas, diketahui keduanya menyimpan sabu-sabu di dalam perut yang dimasukkan melalui anus. Barang bukti narkoba itu dikemas dalam beberapa capsul. Berdasarkan tiket pesawat yang juga diamankan sebagai barang bukti, tersangka Syarwan Bin Yusuf selama penerbangan berada di seat (bangku)

nomor 29A dengan nomor paspor T 036945, sedangkan Rasyidi di seat 29B dengan nomor paspor W 751812. Kombes Andjar Dewanto mengatakan, keseluruhan barang bukti sabu-sabu yang diamankan dari keduanya sebanyak 285 gram, antara lain berasal dari perut Syarwan sebanyak 169 gram dan dari perut Rasyidi 116 gram. “Hasil pemeriksaan, kedua tersangka me-

ngaku sebagai kurir, sedangkan orang yang akan menerima barang itu di Medan, masih dalam penyelidikan,” sebutnya. Penangkapan para kurir sabu-sabu dari Kuala Lumpur di Bandara Polonia sudah terjadi beberapa kali. Sebelumnya juga petugas Bea dan Cukai pernah menangkapkurirsabu-sabuyang menyimpan barang bukti dalam anusnya, tidak lama setelah mendarat di bandara.(m27)

Wali Kota Tepung Tawar Jamaah Haji Asal Medan MEDAN (Waspada): Wali Kota Medan Drs. H. Rahudman Harahap, MM menepungtawari jamaah haji asal Kota Medan yang baru tiba di tanah air. Tepung tawar yang digelar di Asrama Haji Medan, Rabu (7/12), merupakan bentuk rasa syukur kepada Allah SWT karena para jamaah haji kembali ke tanah air dengan selamat, sekaligus memperingati tahun baru Islam 1433 H. Wali Kota Medan Drs. H. Rahudman Harahap, MM menyatakan bersyukur karena bisa bersilaturahmi dengan para pengurus Majelis Ulama Indonesia (MUI) Kota Medan. Dia berharap, silaturahmi ini dapat memperkuat persaudaraan, kebersamaan, kemitraan, kerjasama dan sinergi diantara ulama dan umaro. Menurut Rahudman, sifat bergandengan tangan antara ulama dan umaro merupakan faktor yang sangat dominan,

guna mewujudkan tatanan kehidupan yang lebih baik duniawi dan ukhrowi atau material dan spiritual, terutama dalam upaya memacu akselerasi pembangunan Kota Medan. Atas nama pribadi dan pemerintah, Rahudman mengucapkan selamat datang kembali ke Kota Medan. Semoga menjadi haji dan hajjah yang mabrur. “Saya juga mengucap-kan selamat tahun baru Islam 1433 H. Semoga pergantian tahun ini dapat menumbuhkan semangat baru bagi kita semua, baik aparatur pemerintah, ulama dan seluruh masyarakat untuk membangun dan memajukan Kota Medan ke arah yang lebih baik lagi,” tambahnya. Mewakili Kemenag Kota Medan H Muhammad Kasbi MA mengatakan, sebelum pemberangkatan beberapa waktu lalu, pihaknya telah melakukan penepungtawaran haji

yang dilakukan MUI bekerjasama dengan Pemko Medan. Jumlah jamaah yang melunasi sebanyak 2.652 orang, sedangkan yang gagal berangkat sebanyak 18 orang terdiri dari empat meninggal dan selebihnya masuk rumah sakit. Jumlah jamaah haji yang meninggal di tanah suci Mekkah sebanyak lima orang, empat laki-laki dan satu perempuan. Acara tepung tawar haji ini diisi paparan mengenai isi buku Peta Dakwah Kota Medan oleh tim penilai Prof DR Ir Basyaruddin MS dan juga tausiyah oleh Dra HJ Aminah Ismail dari Jakarta. Acara ini dihadiri Ketua Umum MUI Kota Medan Prof DR HM Hatta MA, para ulama, Kapolresta Medan Kombes Pol Tagam Sinaga SH, Ketua DPRD Medanb Drs H Amiruddin, mewakil Pangdam I/BB, Pangkosek Hanudnas III, Dan Lanud Medan, Dan Lantamal serta KBIH Kota Medan. (csf)

Orangtua Siswa SMAN 7 Keberatan Biaya Penambahan Daya Listrik MEDAN (Waspada): Siswa SMAN 7 Medan Jl. Timor Medan dibebankan biaya untuk penambahan daya listrik di sekolah sebesar Rp165 ribu. Biaya tersebut sesuai dari hasil rapat komite sekolah beberapa bulan lalu. Hal itu terungkap saat salah satu orangtua murid Ismed Lubis datang ke redaksi Waspada, Selasa (7/12). “Bulan September lalu, ada rapat komite sekolah. Dalam rapat tersebut ditetapkan biaya penambahan daya listrik dibebankan ke siswa sebesar Rp165 ribu. Pada waktu itu, ada yang setuju ada yang tidak. Namun tetap dikeluarkan kebijakan kalau tidak membayar maka tidak bisa ikut ujian semester,” kata Ismed. Menurutnya, kebijakan itu adalah kebijakan salah kaprah karena tidak ada relevansinya antara biaya penambahan daya listrik dengan ujian semester. “Kecuali dia tidak membayar uang sekolah, itu mungkin. Mengenai biaya tambah daya listrik inikan bisa diajukan ke Pemko Medan. Misalkan tidak ada alokasi dana dari Pemko Medan, seharusnya dikutip seikhlas hati, jangan dipatokkan biayanya,” sebutnya. Ismed mengharapkan, pihak sekolah dan komite sekolah membatalkan kebijakan tersebut karena diduga merugikan siswa dan orangtua murid.

“Harus diselesaikan, tidak boleh ada pengutipan selain uang sekolah,” ujarnya. Keterangan itu juga diakui salah satu siswi kelas XII yang enggan menyebutkan namanya. Dia mengaku membayarkan Rp165 ribu untuk iuran listrik. “Baru bulan ini disuruh bayar, saya sudah bayar. Saya nggak tahu kalau tidak bayar, nggak bisa ikut ujian,” tuturnya saat dimintai keterangan. Sementara itu, pihak kepala sekolah ketika dikonfirmasi tengah berada di Bogor karena ada urusan. Sedangkan wakil kepala sekolah melalui Pem-


PERWAKILAN MDGC, UNILEVER BAHAS KEMITRAAN: PT Unilever Indonesia menggelar workshop bersama kemitraan strategis dalam penyusunan rencana kerja 2012. Dalam kesempatan itu Dewi Budiati Teruna Jasa Said, relawan MDGC dari Medan dan praktisi lingkungandaerah lain ikut dalam acara tersebut.Hadir juga di situ Sinta Kaniawati, Sancoyo Antarikso. Selain Dewi Budiati yang mewakili Medan Green And Clean (MDGC) ada juga perwakilan dari beberapa kota di Indonesia seperti Saharudin dari Makassar, Rohadji Trie dari Bandung dan beberapa aktivis lain. Acara itu berlangsung di Aston Marina Hotel Jakarta, 7-8 Desember 2011.

Protes Nanyang Berlanjut

Warga Halau Truk Material Bangunan MEDAN (Waspada): Aksi unjukrasa warga yang memprotes pembangunan gedung Nanyang Zhi Hiu Modern Indonesian School di Jln. Sriwijaya simpang Jln. Abdullah Lubis Medan, terus berlanjut. Rabu (7/12), warga setempat menghalau truk pengangkut material bangunan yang hendak memasuki halaman sekolah tersebut. Peristiwa itu bermula ketika masyarakat setempat melakukan unjukrasa damai memprotes pembangunan gedung Nanyang Zhi Hiu Modern Indonesian School. Pada saat bersamaan, truk yang mengangkut material bangunan berusaha memasuki halaman sekolah Nanyang. Melihat hal itu, warga langsung menghalau truk tersebut hingga keluar dari lokasi. “Bangunan Nanyang ini masih bermasalah dengan warga setempat,” ujar para pengunjukrasa ketika melakukan orasi di depan bangunan Nanyang tersebut. Warga juga mempertanyakan keberadaan personel Brimob Poldasu di lokasi tersebut. Sebenarnya, menurut mereka, pengamanan aksi unjukrasa damai di Nanyang cukup dilakukan personel Polsek Medan Baru. “Bahkan, Polresta Medan tidak menurunkan personelnya untuk melakukan pengamanan terhadap unjukrasa damai ini,” ujar mereka. Warga meminta kasus pembangunan Nanyang dituntaskan agar tidak menjadi polemik yang berkepanjangan. Buktinya saja masalah ini sudah dilaporkan ke berbagai

instansi, tetapi tidak ada tindak lanjutnya. Sementara pembangunan Nanyang terus berjalan. “Pemko Medan terkesan berpihak kepada Nanyang. Buktinya, hingga kini Pemko Medan tidak melakukan penertiban terhadap bangunan tersebut. Keresahan warga juga tidak ditanggapi. Karena itu, kami akan meneruskan masalah ini kepada Presiden RI,” ujar pengunjukrasa. Sementara itu, Kapolsek Medan Baru AKP Dony Alexander, SH, SIK yang ditemui Waspada di lokasi mengatakan, pihaknya telah mengimbau masyarakat agar tidak melakukan tindakan anarkis. “Jangan coba-coba melakukan tindakan anarkis kalau tidak mau berurusan dengan pihak berwajib,” tegasnya. Upaya pendekatan yang dilakukan Kapolsek Medan Baru AKP Dony Alexander, SH, SIK mendapat sambutan positif dari para pengunjukrasa. Bahkan salah seorang wanita yang ikut berunjukrasa sambil menangis memohon kepada Kapolsek Medan Baru untuk menuntaskan masalah tersebut. “Kami cukup resah dengan pembangunan gedung Nanyang. Tidak ada instansi pemerintah yang berani memberikan tindakan tegas terhadap bangunan tersebut,” ujar Pelita, 46, warga Jln. Darat Medan. Setelah menerima keluhan dari para pengunjukrasa, Kapolsek Medan Baru berjanji akan menjembatani masalah bangunan Nanyang tersebut. Dijadwalkan, akan dilakukan pertemuan antara pihak Nanyang, Danramil, Camat Medan Baru, Lurah dan masyarakat setempat di Mapolsek Medan Baru hari Ini (Kamis, 8/12). (m36)

bantu Kepala Sekolah (PKS) Karo-Karo, ketika dimintai keterangan mengaku tidak berani memberikan keterangan tanpa izin kepala sekolah. “Tidak ada maksud menghindar, kami tetap menjalankan hubungan baik dengan pers. Tapi saya takut salah memberikan keterangan tanpa sepengetahuan kepala sekolah. Memang waktu rapat komite saya tidak ikut rapat, dan itu dihadiri orangtua murid, kepala sekolah dan BP3 (biaya penunjang penyelenggaraan pendidikan) dari dinas pendidikan,” katanya. (h02/cag)

Perhimpunan SPMB Nusantara - UISU Seleksi Calon Mahasiswa Baru 2012/2013 MEDAN (Waspada): Perhimpunan Seleksi Penerimaan Mahasiswa Baru (SPMB) Nusantara menjalin kerjasama dengan Universitas Islam Sumatera Utara (UISU) kampus AlManar Jln. Karya Bakti Medan. “Kita menjalin kerjasama untuk seleksi calon mahasiswa baru UISU tahun Akademi (TA) 2012/2013. Perjanjian kerjasama dibuat pada 25 November 2011,” kata Rektor UISU Dr. Ir. Mhd Asaad, Msi kepada Waspada, Rabu (7/12).. Isi perjanjian No.02/PK/PSPMBN/2011 itu, jelas rektor, mengenai hak dan kewajiban

Waspada/Ismanto Ismail

PELITA, 46, tak kuasa menahan tangis ketika memberi penjelasan kepada Kapolsek Medan Baru AKP Dony Alexander, SH,SIK (kanan) terkait keresahan warga terhadap pembangunan gedung Nanyang di Jln. Sriwijaya simpang Jln. Abdullah Lubis Medan, Rabu (7/12) siang.

masing-masing pihak. Tujuannya untuk menjamin kelancaran pelaksanaan kegiatan tersebut. Sesuai perjanjian itu, pihak pertama membantu pihak kedua membentuk Panitia Penyelenggara Lokal Ujian Masuk Bersama (UMB) Perhimpunan SPMB Nusantara di masingmasing universitas/institut dengan surat keputusan pihak pertama. Rektor menyatakan biaya yang timbul sebagai akibat pelaksanaan perjanjian ini dibebankan pada kontribusi peserta UMB-PTS Perhimpunan SPMB Nusantara. Kemudian, pihak kedua mengelola seluruh dana yang diperoleh dari hasil kerjasama dan dialokasikan untuk Institutional Fee pihak I . Bagi mahasiswa yang berminat dapat mengikuti UMBPTS TA 2012-2013 di enam kota besar yakni Medan, Lampung, Jakarta, Bandung, Yogyakarta dan Surabaya. “Bagi yang berminat mengikuti UMB PTS dapat melakukan pembayaran di bank atau online pada 14 November-9 Desember 2011. Sedangkan pelaksanaan cyber test pada 11 Desember 2011,” katanya. Menurut rektor, manfaat UMB-PTS melalui online, mahasiswa dapat memilih tiga program studi secara lintas pada PTS lainnya di luar Medan serta menghemat biaya dan waktu.(m49)

Waspada/ Rustam Effendi

SEJUMLAH warga antri menunggu giliran untuk mendaftarkan diri pembuatan e-KTP di Kantor Kecamatan Medan Belawan, Selasa (6/12).

Rencana Pendaftaran e-KTP Selesai Akhir Desember Tidak Tercapai BELAWAN (Waspada): Pendaftaran e-KTP yang direncanakan selesai akhir Desember 2011, diperkirakan tidak tercapai di empat kecamatan Medan Utara yakni, Kecamatan Medan Deli, Medan Labuhan, Medan Marelan, dan Medan Belawan. Penusuran Waspada, Selasa (6/12), dari 86. 812 orang wajib mendapat e-KTP di Kec. Medan Belawan yang mendaftar baru 8.435 orang, Kec. Medan Deli sekitar 20 ribu orang dari 127 ribu, Kec. Medan Labuhan sekira 11 ribu dari 96 ribu orang, dan di Kec. Medan Marelan sekira 11 ribu dari 120 ribu orang. Keterlambatan itu akibat masih kurangnya komputer dan peralatan yang tersedia di masing- masing kecamatan. Saat ini setiap kecamatan yang berada di Medan Utara, baru memiliki dua set peralatan komputer yang telah beroperasi, ditambah dua set yang belum tahu kapan dioperasikan dari delapan unit yang direncanakan. Camat Medan Belawan Andi Harahap mengatakan, pihaknya telah berkerja keras agar pendaftaran e-KTP tersebut dapat selesai secepatnya. Bahkan guna mencapai target tersebut, operator komputer dipekerjakan secara ekstra mulai pukul 08:00 pagi hingga pukul 20:00 setiap hari kecuali hari MInggu. “Kita ingin pendaftaran e KPT ini segera selesai dan setiap hari undangan kita sebesar sebanyak 400 undangan,” katanya melalui Sekcam Putra Situmeang. Sementara Camat Medan Labuhan Zain Nopal menyebutkan, pencapaian target selesai e-KTP pada akhir Desember tahun ini sulit tercapai, karena minimnya peralatan dan lambatnya program itu dimulai di daerahnya. Walaupun demikian pihaknya tetap melaksanakan pendaftaran e-KTP tersebut

setiap hari mulai pukul 08:00 hingga pukul 22:00 dengan target sebanyak 400 orang. “Kita mulai e-KTP disini pada 11 November dan untuk mempercepat pendaftaran hari Minggu juga kita buka,” ujarnya. Camat Medan Marelan Pulungan Harahap mengjelaskan, pihaknya telah menerima dua unit penambahan peralatan komputer untuk pembuatan e-KTP. Namun alat tersebut belum bisa digunakan karena peralatan pendukungnya masih ada yang belum masuk. “Alat ini milik daerah lain yang belum bisa on line dan sifatnya disini dipinjamkan menunggu daerah pemilik menggunakannya sekitar bulan Maret tahun depan,” sebutnya. Sebagai daerah pertama atau pencanangan e- KTP, Camat Medan DeliYusdarlina mengatakan, dalam satu hari pihaknya menargetkan warga yang terdaftar sekitar 400 jiwa dengan memanfaatkan dua unit komputer dan peralatannya. “Kemampuan petugas memang sekitar 150 orang perhari. Namun kita upayakan 200 satu komputer,” ucapnya. Sebelumnnya saat mengadakan laucing eKTP di Kec. Medan Deli, Wali Kota Medan Rahudman Harahap mengatakan, dari 2.835.000 jiwa penduduk Kota Medan sebanyak 2.170. 400 jiwa di antaranya wajib memiliki e-KTP dan nomor induk kependudukan (NIK) yang berlaku di seluruh Indonesia. Keberhasilan pelaksanaan e- KTP itu tergantung dari keseriusan dan keiklasan kepling, lurah, dan camat yang mencerminkan kalau pemerintah adalah pelayan, bukan yang dilayani. Dana pembuatan e- KTP, berasal dari APBN dan APBD Kota Medan. Tehnis pelaksanaan pembuatannya dilakukan bertahap yakni berdasarkan undangan dari kecamatan kepada warga yang diharapkan mau menghadirinya tepat waktu. Sedangkan warga yang belum diundang tidak perlu khawatir karena akan diundang untuk pembuatan e-KTP. (h03)

Medan Metropolitan


WASPADA Kamis 8 Desember 2011

Dakwah Harus Berikan Solusi Bagi Masyarakat


KETUA KNPI Medan Zulham Effendi Siregar (dua kiri) bersama narasumber lainnya pada acara sosialisasi UU Lalulintas yang diprakarsai PK KNPI Medan Perjuangan, Selasa (6/12).

KNPI Sosialisasi UU 22/2009 MEDAN (Waspada): Ketua Komite Nasional Pemuda Indonesia (KNPI) Kota Medan Zulham Effendi Siregar, ST mengatakan, undang-undang serta peraturan yang dibuat dan disahkan DPR, termasuk UU No. 22 Tahun 2009 tentang Lalulintas dan Angkutan Jalan Raya harus dipatuhi. Demikian ditegaskan Zulham pada sosialisasi UU Lalulintas dan AngkutanJalanRayayangdiselenggarakanPKKNPIMedanPerjuangan di Hotel Royal Perintis Jln. Perintis Kemerdekaan, Selasa (6/12). Menurut Zulham, UU itu dibuat untuk menciptakan kedisiplinan, ketertiban dan kenyamanan bagi masyarakat umum. “Undang-undang ini menjamin kepentingan umum, bukan kepentingan pribadi atau golongan,” katanya seraya mengajak pemuda sebagai pelopor gerakan disiplin berlalulintas.a Namun masih banyak masyarakat terutama pengendara di jalan raya yang tidak mematuhi peraturan berlalulintas, sehingga angka kecelakaan terus meningkat khususnya di kalangan pemuda. Selain itu, minimnya rambu lalulintas menjadi penyebab kecelakaan. Sosialisasi yang baru pertama dilaksanakan ini dihadiri puluhan pemuda dan masyakarat dengan narasumber Kapolsek Medan Timur Kompol Patar Silalahi, mewakili Sat Lantas Polresta Medan AKP Rosmawati, mewakili Dispora Medan Suriadi, SE, dengan moderator Yose Rizal, MAP. Kapolsek Medan Timur Kompol Patar Silalahi menyampaikan dukungan dan apresiasi kepada KNPI yang turut serta mensosialisasikan UU Lalulintas dan Angkutan Jalan Raya kepada masyarakat, khususnya kalangan pemuda. “Disiplin berlalulintas bukan hanya tanggungjawab Polri, tetapi menjadi tanggungjawab bersama, termasuk pemuda,” ujar Patar. Sedangkan Ketua PK KNPI Medan Perjuangan M Azwar, S.Sos di dampingi Sekretaris Soni Edison Ginting mengucapkan terima kasih kepada panitia dan pengurus sehingga acara itu terlaksana dengan baik. “Mudah-mudahan dari kegiatan ini akan terwujud Medan Zero To Accident,” katanya.(m27)

Guru Swasta Diminta Tingkatkan Profesionalisme MEDAN (Waspada): Kepala Dinas Pendidikan dan Kebudayaan Kota Medan Drs Hasan Basri meminta guru-guru swasta yang ada diKotaMedanmagarmeningkatkanprofesionalismesehinggamampu menciptakan mutu pendidikan dan anak didik yang berkualitas. “Tantangan guru-guru swasta sangat kompleks, oleh sebab itu kinerja guru swasta harus lebih ditingkatkan dan benar-benar profesionalisme, terlebih-lebih bagi mereka yang telah lulus sertifikasi,” sebut Hasan Basri pada acara pelantikan Badan Pengurus Daerah (BPD) Persatuan Guru Swasta Indonesia (PGSI) Kota Medan, di Medan, Senin (5/12). Menurut Hasan, guru-guru swasta yang tidak berkompetensi dalam meningkatkan kinerja secara perlahan akan memiliki permasalahan sendiri karena tidak mampu berkompetisi secara sehat dan gagal lulus sertifikasi. Persoalan pendidikan akan berkolerasi dengan kondisi guru-guru, tidak hanya guru negeri tetapi juga guru swasta. Sementara itu, Ketua PGSI Kota Medan periode 2011-2016 yang baru dilantik Partomuan Silitonga menyayangkan masih ada kepala sekolah swasta atau yayasan yang merasa takut dengan kehadiran PGSI, bahkan mengidentikkan PGSI sama seperti lembaga swadaya masyarakat (LSM). “PGSI itu bukan LSM dan bukan untuk menakut-nakuti kepala sekolah atau yayasan,” ujarnya. Silitonga mengajak agar seluruh guru swasta di Kota Medan, yang berjumlah 20 ribu orang agar tetap kompak dan bersatu, demi kemajuan organisasi dan nasib anggotanya. “Kalau kita tidak kompak, maka guru-guru negeri yang merasa memiliki negara ini,” katanya seraya menambahkan guru-guru swasta juga perlu mendapat perlindungan, apalagi sekarang ini perlindungan hukum terhadap guru-guru swasta belum jelas dari pemerintah. (h04)

Univa Gelar Seminar Hijrah Kunci Kesuksesan MEDAN (Waspada): Dalam rangka menyambut HUT ke 81 Al Jam’iyatul Washliyah, Universitas Al Washliyah (Univa) Medan, menggelar seminar tentang “Hijrah Kunci Kesuksesan” yang menghadirkan pembicara Ketua Pengurus Besar Al Jam’iyatul Washliyah Bidang Dakwah Al Ustadz Drs H Masyuril Khamis SH, di Aula Univa Medan, baru-baru ini. Dihadapan peserta seminar, Masyuril Khamis mengatakan, salah satu kunci kesuksesan seorang muslim adalah melakukan hijrah secara kaffah, baik pikiran, perkataan maupun perbuatan. Pada kesempatan itu, Rektor Univa Medan Ir H Aliman Saragih M.Si mengatakan, dipilihnya tanggal 28 untuk penyelenggaraan seminar tersebut, mengingatkan kita kepada makna lambang 28 garis cahaya yang bermakna pancaran ilmu dan Univa lahir 28 tahun setelah Al Washliyah berdiri. Turut hadir dalam acara tersebut Pembantu Rektor (PR) II Univa Medan Drs H Hairul Arifin Ritonga, PR III Drs Alimuddin Siregar SH, S.Pd.I, M.Hum, PR IV H Sultoni Trikusuma MA, serta seluruh dosen dan guru di lingkungan Univa Medan. Sambut jamaah haji Selain itu, pada Jumat (2/12), Rektor Univa Medan beserta para Pembantu Rektor dan beberapa dosen menyambut kedatangan jamaah haji dari Univa yakni, Dr Ir HM Idris MP (Pembantu Rektor I) dan Drs H Achmad Adib Nasution MM (Dekan Fakultas Ekonomi ). Menurut kedua jamaah haji yang baru pulang dari tanah suci itu, bahwa yang terpenting bukan menjadi haji, tetapi menjaga marwah kehajian di tengah masyarakat. (cwan)


REKTOR Univa Medan Ir H Aliman Saragih M.Si menyerahkan cendra mata kepada nara sumber H Masyuril Khomis, di Aula Univa Medan.

MEDAN (Waspada): Jurusan Pengembangan Masyarakat Islam (PMI) Fakultas Dakwah IAIN Sumut melaksanakan pelatihan bagi dai dan daiyah (juru dakwah laki-laki dan perempuan), di Aula Fakultas Dakwah Jalan Willem Iskandar Medan Estate, Selasa (6/12). Dekan Fakultas Dakwah Dr H Abdullah M.Si mengatakan, dakwah memiliki makna sangat luas yakni menyebarkan dan tekun mengkaji nilai normatif dalam Islam, sehingga menjadi konsep yang secara teknis mudah dijalankan oleh masyarakat. Oleh karenan itu, lanjutnya, dakwah yang disampaikan kepada masyarakat merupakan jalan terbaik untuk menyelesaikan persoalan yang terjadi di tengah kehidupan umat yang saat ini semakin kompleks. Dalam kaitan itu, menurut Abdullah, dibutuhkan pembenahan signifikan terhadap kemajuan serta peningkatan

keilmuan pada dai dan daiyah. “Dengan begitu akan terbentuk dai yang profesional, bermartabat dan progesif,” sebutnya didampingi PD II Drs Sahdin Hasibuan M.Ag dan Kajur Prodi PMI Muhammad Husni Ritonga MA. Dijelaskannya, pada kuliah kerja nyata tahun berikutnya FD IAIN SU memprioritaskan program desa binaan dengan konsep dakwah Parsipatory Action Research (PAR), di mana mahasiswa diterjunkan akan menjadi agen social of change atau agen perubahan dengan melihat serta mengelola potensi sumber daya alam dan sumber daya manusia yang ada. Ketua panitia kegiatan Muhammad Husni Ritonga MA yang juga Ketua Prodi PMI menambahkan, kegiatan diikuti 40 mahasiswa jurusan PMI dengan target agar kemampuan yang dimiliki alumni jurusan ini lebih menonjol dalam berdakwah. Sebagai nara sumber dalam kegiatan tersebut adalah Dekan

FD IAIN SU Dr H Abdullah M.Si dan H Fajar Hasan Mursyid Lc. MA Direktur Ma’had Abu Ubaidah. Disampaikannya, serbuan budaya global dan westernisasi mengakibatkan tumbuh suburnya budaya permisif atau serba boleh maupun prilaku naif yang bertentangan dengan nilai luhur maupun norma agama yang selama ini ditaati. Selain itu, kata Ritonga, munculnya kekuatan telekomunikasi, transportasi, dan trafel (3T) disamping menimbulkan perubahan cepat, tapi juga menyebabkan tumbuhnya budaya materialisme, skulerisme, serta apatisme terhadap agama. Menurut dia, Fakultas Dakwah IAIN SU juga melaksanakan Dialog Revitalisasi Hijrah bagi Kehidupan Umat Islam di aula kampus itu, Rabu (7/12). Sebagai pembicara Dekan Dr H Abdullah M.Si, HM Iqbal A Muin Lc, MA, dan Dr HM Yakub MA. (m49)

Penertiban Ternak Babi Mendapat Perlawanan MEDAN (Waspada): Penertiban ternak babi di Kecamatan Medan Barat dan Medan Petisah, Rabu (7/ 12), mendapat perlawanan dari pihak warga. Namun, tim gabungan dari Dinas Pertanian dan Kelautan (Distanla) Kota Medan bersama Satpol PP, Kodam dan Polresta Kota Medan berhasil mengangkut paksa tujuh ekor babi.

Pantauan Waspada di lapangan, penertiban diawali dari Kecamatan Medan Barat milik marga Nadapdap. Di lokasi tersebut sempat terjadi perlawanan karena warga menolak ternaknya diangkut petugas. Namun, pihak Distanlatetapmengangkutternak babi yang masih ditemukan di dalam kandang. Kemudian, petugas melakukan negosiasi dengan pemilik ternak. Akhirnya satu ekor ternak babi bisa dibawa dari tempat tersebut. Sedangkan lainnya gagal diangkut dengan alasan pemilik akan mengosongkannya sendiri.

“Penertiban ini untuk menegakkan peraturan wali kota (Perwal) tentang larangan ternak kaki empat di Kota Medan. Karenanya penertiban ini dilakukan. Tidak ada pilih kasih dalam penertiban ternak kaki empat ini,” kata Kadistanla Kota Medan Ir Wahid didampingi Kabid Produksi Peternakan di Distanla Kota Medan Emilia Lubis kepada Waspada di lokasi penertiban. MenurutWahid, penertiban ternak babi di Kota Medan terus berlanjut hingga benar-benar habis. Dari penertiban di dua kecamatan tersebut, tujuh ekor

babi diangkut paksa dari dalam kandang. Sedangkan lainnya masih diberikan dispensasi kepada pemiliknya untuk mengangkut sendiri. “Kita berikan waktu tiga hari paling lama kepada pemilik supaya mengosongkan kandangnya. Bila tidak kosong dalam waktu tersebut, kita angkut paksa semuanya,” tegas Wahid. Dispensasi tersebut karena warga memohon diberikan

waktu untuk mengangkut sendiri. Jadi, waktu yang diberikan tersebut harus ditindaklanjuti pemilik ternak. “Mereka sudah menerima biaya transportasi dari kita, jadi apalagi alasannya tidak mengosongkan kandangnya. Selain itu, kita juga berikan bibit lele untuk mereka untuk beralih usaha,” ucapnya. Sementara itu, Lurah Sei Agul Kecamatan Medan BaratYuda P Setiawan mengatakan, jumlah

populasi ternak babi di wilayahnya hanya tinggal lima kepala keluarga. Semua peter-nak diberi waktu dalam tiga hari untuk mengosongkan kandang ternaknya. “Saya akan pantau dalam tiga hari ini, bila tidak kosong maka akan kita tertibkan secara paksa. Penertiban ini merupakan penegakan Perwal. Kita sudah berulangkali melakukan sosialisasi secara persuasif,” demikian Yuda. (m50)

Nelayan Kebanjiran Solar Bersubsidi BELAWAN (Waspada): Mulai awal Januari tahun 2012, nelayan Belawan akan kebanjiran minyak solar bersubsidi. Pasalnya, adanya penambahan tiga unit Solar Pocket Dealer Nelayan (SPDN) baru yang memiliki kuota sekitar 10 ton perhari. Dua unit SPDN itu, saat ini sedang dibangun di kawasan Sundari dan Gabion Kec. Medan Belawan. Sedangkan satu unit lagi akan dibangun di Kelurahan Nelayan Indah, Kec. Medan Labuhan, saat ini dalam masa pengurusan izin dari pemerintah dan PT Surya Parna Niaga (SPN) selaku penyalur. Dengan adanya penambahan tiga unit SPDN tersebut, maka di Kec. Medan Belawan, Medan Labuhan, dan Medan Marelan, berdiri 10 SPDN yang terdiri dari tiga SPDN PT SPN, tiga SPDN PT AKR, dan empat SPDN PT Pertamina. Tiga unit SPDN yang minyaknya disalurkan PT AKR itu berada di Kampung Kurnia, Kel. Belawan Bahari, Jalan Hiu, Kel. Belawan Satu, Kec Medan Belawan, dan JalanYoung Panah Hujau, Kel. Labuhan Deli, Kec. Medan Marelan. Sedangkan empat unit SPDN yang minyaknya disalurkan dari PT Pertamina (Persero) tiga berada kawasan Pelabuhan Perikanan Samudera Belawan (PPSB) yakni di gudang Janda atas nama Koperasi PNS PPSB, gudang Pekong Gabion dua unit dan di TPI Gabion dua unit serta satu unit lagi berada di TPI Bagan Deli, dengan kuota sekitar ratusan ton minyak solar bersubsidi setiap bulan. Selain SPDN, nelayan juga

mendapat minyak bersubsidi dari sekitar empat Agen Premium dan Minyak Solar (APMS) yang beroperasi di PPSB dan mendapat alokasi minyak solar bersubsisi dari PT Pertamina (Pesero) yakni APMS PT Edina 1.330 ton, Sugianto 1.030 ton, Suriani 554 ton dan PT Sekar Mulia sekitar 300 ton tiap bulannya. Humas PT Pertamina Sony melalui telepon seluler, Rabu (7/12) menyebutkan, ada dua SPDN dengan alokasi minyak solar bersubsidi perbualan sebesar 561 kl dan 6 APMS mendapat alokasi sebesar 4.037 kl per bulan. Dari banyaknya jumlah SPDN dan APMS yang telah dibangun di tiga kecamatan Medan bagian Utara itu, sudah sewajarnya kebutuhan nelayan Kota Medan akan minyak solar bersubsidi telah cukup. Namun, beberapa bulan belakangan ini kebutuhan utama nelayan itu tetap berkurang. Lalu kemanakah perginya ribuan liter minyak bersubsidi itu. Penyelewengan Penelusuran Waspada, umumnya minyak solar besubsidi yang ada pada SPDN tersebut dijual kepada sejumlah warga dengan menggunakan jeregen dan drum yang diangkut menggunakan sepedamotor, becak, dan mobil pick up. Padahal, cara penjualan seperti itu tidak diperbolehkan karena harus dijual langsung kepada nelayan yang memarkirkan boatnya di dekat SPDN. “Jadi penjualan minyak di SPDN itu seharusnya sama dengan pen-

jualan minyak di SPBU yakni mobil mendatangi SPBU bukan dijual melalui jeregen. Kalau itu yang terjadi besar kemungkinan ada penyelewengan,” kata D Pasaribu, tokoh masyarakat Medan Labuhan. Beberapa dari pembeli minyak solar di SPDN tersebut mengaku membeli minyak solar itu atas pesanan pengumpul yang berada di kawasan Pajak Baru, Belawan dan Pekan Labuhan, Kec Medan Labuhan. Selain itu, sejumlah pembeli tersebut juga mengaku mendapat modal dari toke pengumpul untuk membeli minyak solar dari sejumlah SPDN dan SPBU. “Aku jual minyak ini kepada mereka dengan harga dua ratus rupiah lebih mahal dari yang kami beli,” katanya. Ditanya mau diapakan minyak tersebut oleh pengumpul, pembeli itu tidak bersedia memberi penjelasan. Namun, menurut informasi kalau minyak itu akan dijual pengumpul ke sejumlah industri yang ada di Medan Utara, dengan harga non subsidi. Menanggapi hal itu, Kadis Pertanian dan Kelautan Kota Medan Ir Wahid selaku instansi yang mengeluarkan rekomendasi pendirian SPDN, mengaku telah melayangkan surat kepada SPDN agar tidak melayani pembelian minyak melalui jeregen selain menjual langsung ke kapal nelayan. “Penjualan melalui jeregen atau cara lain tidak boleh dan kalau masih ada akan kita tindak,” katanya melalui telepon. (h03)

Pasal 36 UU No 32 Hambat Penuntasan Kasus Korupsi MEDAN (Waspada): Sejumlah organisasi mahasiswa di Sumut yang tergabung dalam Kelompok Cipayung Plus mendesak Mahkamah Konstitusi membatalkan Pasal 36 ayat 1, 2, 3, 4, 5, di UU No.32 Tahun 2004 tentang Pemerintahan Daerah (Pemda), karena berpotensi menghambat pemberantasan korupsi. “Pasal 36 itu harus dihilangkan dari dalam UU tersebut karena dinilai diskriminatif dan menghambat pemberantasan korupsi di daerah, “ kata Ketua PW Ikatan Pelajar Nadhatul Ulama (IPNU) Sumut Gunawan Abdi Hasibuan, Rabu (7/12), saat berbicara dalam dialog yang digelar Pengurus Koordinator Cabang (PKC) Pergerakan Mahasiswa Islam Indonesia (PMII) Sumut di Aula IAIN-SU. Hasibuan mengatakan, bentuk diskriminatif pasal adalah memberi keistimewaan hukum bagi kepala daerah diduga terlibat kasus korupsi. Sebab, mereka tidak bisa diperiksa penyidik kejaksaan atau kepolisian sebelum keluar surat izin dari Presiden. Menurut Hasibuan, rumusan Pasal 36 UU Pemda sangat diskriminatif. Penyidik tidak bisa memaksakan kehendak memeriksa kepala daerah dan wakil

kepala daerah yang diduga terlibat kasus korupsi. Artinya, mereka tidak bisa diperiksa penyidik begitu saja sebelum ada izin Presiden. “Kasarnya, kepala daerah dituduh mencuri uang rakyat, tapi tidak bisa dipenjara kalau belum ada izin presiden. Sementara pelaku pidana seperti pencuriayamlangsungditangkap dan masuk penjara,” ujarnya. Ketua Umum DPD IMM Sumut Zefrizal menambahkan, penerapan UU No 32 mengharuskan izin presiden sangat menghambat pemberantasan korupsi di daerah. “Izin presiden yang tak kunjung keluar, bisa saja dijadikan praktik kong-kalikong untuk menghentikan kasus dugaan korupsi yang melibatkan kepala daerah,” katanya. Sementra Ketua Umum Badko HMI Sumut Andika Syahputra mengungkapkan, untuk membongkar kasus korupsi di Sumut, tidak jarang rintangan muncul dari penyidik . “Mahasiswa dan aktivis LSM penggiat antikorupsi, kerap dipanggil pihak kepolisian, dengan menyebut informasi yang digaungkannya sebagai fitnah. Ketua Himmah Sumut Alimnur Nasution menimpali kasus korupsi masih dijadikan alat tawar menawar bagi oknum penegak hukum. Bahkan, ko-

ruptor menjadi “ATM” bagi oknum aparat penegak hukum. Sedangkan di kalangan penggiat antikorupsi, sering dihadapkan dengan conflic of interest. Satu sisi ingin membongkar kasus korupsi, tapi di sisi lain selalu tergoda oleh oknum-oknum yang menawarkan ‘kerjasama’. “Ini tantangan. Kita imbau mahasiswa dan penggiat antikorupsi agar istiqamah,” ajaknya. Sementara Kapoldasu diwakili Kabid Pembinaan Hukum Poldasu Kombes Pol John Hendri mengatakan, Poldasu mempersilakan elemen masyarakat dan mahasiswa untuk melaporkan dugaan kasus-kasus korupsi di Sumut. “Yang penting, ada bukti permulaan yang cukup, bukan fitnah,” ucapnya. Sekjen PB PMII A Jabidi Ritonga mengatakan hasil dialog Kelompok Cipayung Plus dan elemen mahasiswa terkait penegakan supremasi hukum ini, akan dijadikan rekomendasi sebagai upaya penciptaan pemerintahan yang bersih. “Kegiatan ini juga berkaitan dengan peringatan Hari Anti Korupsi seDunia pada 9 Desember ini. Segenap elemen mahasiswa akan turun ke jalan untuk menyuarakan ini bersama-sama, “ katanya. (m49)


KADIS Kesehatan Kota Medan dr.Edwin Effendi,MSc (kanan) ketika membesuk mantan Gubsu Marah Halim Harahap yang menjalani perawatan intensif di RSU Permata Bunda, Selasa (6/12).

Kadis Kesehatan Besuk Mantan Gubsu MEDAN (Waspada): Kadis Kesehatan Kota Medan dr. Edwin Effendi, Msc membesuk mantan Gubernur Sumatera Utara (Gubsu) H. Marah Halim Harahap yang menjalani perawatan intensif di RSU Permata Bunda, Selasa (6/12). Saat itu, Edwin memeriksa kartu status pasien dan keadaan umum Marah Halim. “Kedatangan saya ini merupakan tindak lanjut dari kunjungan Wali Kota Rahudman Harahap dan Wakil Wali Kota Dzulmi Eldin beberapa waktu lalu. Jadi, saya ditugaskan untuk memantau perkembangan kesehatan mantan

Gubsu ini,” ujarnya. Secara umum, lanjut Edwin, kondisi Marah Halim dinyatakan stabil, namun masih membutuhkan perawatan intensif. “Dari riwayat kesehatannya diketahui pak Marah Halim mengalami hipertensi dan stroke berulang sehingga membutuhkan perawatan khusus,” ujarnya. Sementara itu, pihak RSU Permata Bunda telah menunjuk dr. Yuneldi Anwar, SpS dan Prof. Abdul Majid untuk merawat Marah Halim. “Kita harapkan semoga kondisi kesehatan pak Marah Halim semakin membaik,” ujarnya.(m50)

Tahjuddin Nur Pimpin DPW Lasykar Ampera Arif Rahman Hakim Sumut MEDAN (Waspada) : H.M. Tahjuddin Nur dipercayakan memimpin Lasykar Ampera Arif Rahman Hakim Angkatan 66 Sumut periode 2011-2016. Hal itu tertuang dalam SK DPP Nomor 11/DPP-LA.ARH ‘66’/XI/11 tanggal 30 November 2011 ditandatangani Ketua Umum DPP Lasykar Ampera Arief Rahman Hakim Capt. Hendrik J Pasaribu dan Sekretaris Jenderal H. Aan Rustiawan. Menurut Tahjuddin dalam pertemuan di Amaliun Food Court Jln. Amaliun Medan, Rabu (7/12), selain dirinya juga dipercayakan Bachtiar Effendi sebagai Sekretaris. Sementara, H. Chairuman Harahap sebagai Pembina dan Azwir A Husein sebagai Ketua Dewan Penasehat. Tahjuddin menceritakan sejarah berdirinya

organisasi Laskar Ampera Arif Rahman Hakim di Sumut yang berkaitan dengan Amril YS. Pada pertemuan itu, Tahjuddin mengingatkan para pengurus tidak memanfaatkan Lasykar Ampera Arif Rahman Hakim ini menjadi ajang politik sesaat untuk kepentingan Pilkada, Pemilu dan lainnya. Karena, organisasi ataupun wadah ini bersifat independen. Dia mengharapkan, hendaknya Lasykar Ampera ini bisa membantu rakyat dalam menyelesaikan persoalan seperti masalah tanah atau lahan eks HGU PTPN 2, serta lainnya. Dengan diamanahkannya kepengurusan Lasykar Ampera Sumut tersebut diharapkan tidak muncul polemik sehingga wadah atau organisasi ini kelak diperhitungkan kebera-daannya. (m34)

Pembina YPSA Presenter Terbaik TIIMI Di London MEDAN (Waspada): Pembina YP Shafiyyatul Amaliyyah dan kolumnis ekonomi Harian Waspada Arisyi Fariza Raz, BBA (foto), mendapat penghargaan sebagai presenter terbaik tentang besarnya potensi pengembangan energi panas bumi di Indonesia pada acara Temu Ilmiah Internasional Mahasiswa Indonesia (TIIMI) ke-5 di London, 2-4 Desember 2011. Arisyi Fariza Raz, yang akan memperoleh gelar Master of Science dari University of Manchester ini mengatakan, acara TIIMI merupakan kegiatan tahunan yang diselenggarakan Persatuan Pelajar Indonesia di Inggris. “Kegiatan ini merupakan pertemuan mahasiswa Indonesia yang kuliah di Inggris, Perancis, Belanda, Rusia, Italia, Jepang dan Australia, untuk saling berbagi tentang hasil penelitian mereka. Pada tahun ini tema acara adalah Sustaining Renewable Energy in Indonesia: Challenges and Oppurtunities in Multidisciplinary Perpectives,” katanya.

Dalam mempresentasikan karya ilmiahnya berjudul Geothermal Energy as a Sustainable Energy Option in Promoting Growth in Indonesia, Arisyi Fariza Raz (University of Manchester) bersama rekannya Randy Remigius (Lund University), Renan Raimundus (University of Tokyo) danTamarind Indra (University of Melbourne) ini mendapat sambutan hangat dari peserta. Arisyi menjelaskan, potensi pengembangan energi panas bumi di Indonesia sangat besar, namun banyak kendala yang menghambat perkembangannya, antara lain peraturan dan undang-undang yang belummemadai,terbatasnyainfrastruktur,korupsi dan kurangnya kapasitas sumber daya manusia. Dalam kesimpulannya, Arisyi memaparkan, dengan dikembangkannya energi panas bumi di Indonesia sebagai sumber energi alternatif, Indonesia tidak hanya mendapat manfaat dari berkurangnya polusi bahan bakar minyak, tetapi juga berpotensi mendapatkan keuntungan ekonomi, terang putra kedua dari pasangan Drs. H. Sofyan Raz, Ak, MM dan Hj. Rahmawaty ini. (m43)

WASPADA Kamis 8 Desember 2011

Medan Metropolitan


Kapolresta: Razia Dilakukan Tekan Kriminalitas Jln. HM Yamin Dan Madong Lubis Prioritas MEDAN (Waspada): Kapolresta Medan Kombes Tagam Sinaga kepada wartawan, Rabu (7/12) mengatakan, polisi terus melakukan Ops Zebra Toba 2011 di setiap ruas jalan yang ada di kota Medan untuk menekan angka kriminalitas menjelang Natal dan Tahun Baru. Menurut Tagam, selain Ops Zebra di jalan, pihaknya juga akan menyebarkan anggota Intel dan Reserse ke beberapa lokasi yang dianggap rawan kejahatan. “Anggota kita sebarkan di tempat keramaian, seperti pusat perbelanjaan, Mall dan objek vital lainnya,” kata Tagam. Untuk menjaga kekondusifan kota Medan, Kapolresta meminta dukungan masyarakat kota Medan, agar melaporkan kepada pihak berwajib kalau ada hal-hal yang mencurigakan di sekitarnya. Jadi Atensi Sementara itu, Kabag Ops Polresta Medan Kompol Yushfi Nasution mengatakan, aksi pencurian dengan kekerasan (curas) dan pencurian pemberatan (curat) yang semakin marak terjadi dalam bulan Desember 2012 ini, menjadi atensi petugas kepolisian dalam pengamanan Natal dan Tahun Baru. Dijelaskannya, untuk mengantisipasi segala kemungkinan potensi tindak kejahatan terjadi di akhir tahun ini, Polresta Medan melakukan Operasi Cipta Kondisi yakni 14 hari menggelar Operasi Zebra, dan H-7 menggelar Operasi Lilin Toba. “Operasi Lilin Toba kita gelar setelah melakukan Operasi Zebra yang mengerahkan seluruh kekuatan personel jajaran Polsek, Polresta Medan sebanyak 150 an personel,” katanya. Dia mengimbau kepada masyarakat agar tidak memakai perhiasan yang mencolok pada saat berpergian. “Ini dilakuikan agar tidak menjadi perhatian pelaku kejahatan,” sebutnyanya. Prioritas Petugas Unit Lalulintas Polsek Medan Timur yang menggelar razia di kawasan

prioritas razia Jalan Prof HM Yamin dan Jalan Madong Lubis, Rabu (7/12), menahan 15 unit sepedamotor. Selain itu juga dikeluarkan 60 lembar surat tilang kepada pengendara tidak memiliki SIM dan STNK. Pantauan Waspada, razia terhadap pengendara kendaraan bermotor tersebut merupakan bagian dari Operasi Zebra Toba 2011 yang mulai digelar sejak pekan lalu. Razia tersebut dipimpin oleh Kanit Lantas Polsek Medan Timur AKP Sawangin dan diawasi oleh Kanit Provost Aiptu Rizal. Meski razia telah dilaksanakan beberapa hari yang lalu, namun masih banyak juga pengendara sepedamotor yang tidak membawa SIM, STNK, dan tidak menghidupkan lampu utama pada siang hari. Selain itu, banyak juga pengendara yang tidak melengkapi kaca spion sepedamotornya. Setelah beberapa jam menggelar razia di Jalan Prof HM Yamin, razia berpindah lokasi ke Jalan Madong Lubis. Dua lokasi tersebut merupakan lokasi yang rawan aksi kekerasan jalanan seperti jambret dan pencurian sehingga menjadi prioritas. Dari dua lokasi tersebut, petugas Lantas Polsek Medan Timur menilang 60 pengendara sepedamotor yang tidak memiliki SIM, STNK, dan tidak menghidupkan lampu utama pada siang hari. Kapolsek Medan Timur Kompol Patar Silalahi menyebutkan, razia tersebut selain untuk menciptakan disiplin berlalulintas, juga untuk mencegah terjadinya aksi pencurian dan penjambretan di kawasan Jalan Prof HM Yamin dan Madong Lubis. Selain itu, tambah Patar Silalahi, kawasan lainnya di Kecamatan Medan Timur dan Kecamatan Medan Perjuangan, juga tak luput dari sasaran razia, seperti Jalan Krakatau simpang Jalan Bilal dan Jalan Perintis Kemerdekaan. Namun, hingga kini belum ditemukan sepedamotor yang diduga hasil kejahatan dan tindak kriminal lainnya selama pelaksanaan razia. (m39/h04)

Waspada/Rudi Arman

SEORANG petugas Sat Lantas Polresta Medan mendorong sepedamotor ke pinggir jalan karena pemiliknya tidak bisa menunjukkan SIM dan STNK saat razia di Jalan HM Yamin Medan, Rabu (7/12) siang.

Lokasi Persembunyian Pemalsu BPKB Digerebek MEDAN (Waspada): Tim dari unit Reserse Umum (Resum) menggerebek lokasi persembunyian tersangka pemalsu Buku Pemilik Kendaraan Bermotor (BPKB) dump truk di gedung Platinum di Jln. Iskandar Muda Medan, Selasa (6/12) malam. Saat penggerebekan itu, tersangka Rudi Popay alias Sin Hua, warga Jln. Prof. HM Yamin Medan melarikan diri. Namun dari lokasi gedung Platinum, bridal,

Waspada/Rudi Arman

DI GEDUNG Platinum Jln. Iskandar Muda inilah polisi menggerebek tempat persembunyian tersangka Rudi Pope pemalsu BPKB, Selasa (6/12) malam. Namun yang bersangkutan sudah kabur. Polisi hanya mengamankan barang bukti duplikat BPKB truk BK 9481 CK dan surat lainnya yang dipalsukan.

Mayat Luka Bakar Di Thamrin Plaza Belum Teridentifikasi MEDAN (Waspada): Mayat berjenis kelamin wanita yang ditemukan tewas dalam kondisi luka bakar di sekujur tubuhnya di Lantai IV-A Thamrin Plaza Medan, pada Selasa (6/12) sekira pukul 22:00, hingga Rabu (7/12) belum diketahui identitasnya, sehingga polisi mengalami kesulitan untuk mengungkap kasus tersebut. Selain itu, pihak pengelola Thamrin Plaza tidak memasang kamera pengintai (CCTV) di Lantai IV-A yang dijadikan sebagai lokasi parkir kendaraan bermotor roda empat itu. “Setelah petugas kepolisian mengamati TKP penemuan mayat korban, ternyata pihak pengelola plaza tidak memasang kamera pengintai, sehingga polisi kesulitan untuk menyelidiki kasus tersebut, apalagi barang bukti yang disita sangat minim,” ujar Kanit Reskrim Polsekta Medan Area AKP Jonser Banjarnahor kepada Waspada. Saat ditanya berapa saksi yang sudah diperiksa, Banjarnahor mengatakan, pihaknya sudah melakukan pemeriksaan dua saksi dari pihak keamanan Thamrin Plaza yakni B Peranginangin dan Jarianus. “Sudah dua saksi yang diperiksa dalam kasus ini. Kemungkin bertambah saksi yang akan diperiksa,” sebutnya. Menurut dia, dari lokasi TKP, pihaknya hanya menyita ember plastik yang lengket dipunggung wanita tersebut. “Yang kita amankan hanya ember plastik saja di lokasi kejadian,” katanya. Selain itu, lanjut Banjarnahor, dari identifikasi yang dilakukan pihaknya kemarin malam di lokasi, tidak ada ditemukan kartu indentitas maupun identitas fisik seperti cincin dan anting pada tubuh mayat tersebut. Hal itu membuat pihak Polsekta Medan Area mengalami kesulitan untuk mengungkap motif terbakarnya wanita

tersebut. Banjarnahor menjelaskan, dari hasil pemeriksaan sisa bagian tubuh tidak terbakar, ciriciri wanita terbakar tersebut rambu panjang, berusia diperkirakan 30 tahun, tinggi badan sekitar 160 Cm, tubuh kecil, dan warna kulit putih. Namun saat disinggung mayat itu keturunan Tionghoa, Banjarnahor enggan mengomentarinya.“Ciri-ciri jasad sudah diketahui, kalau keturunan Tionghoa belum tahu,” sebutnya. Dia mengimbau kepada warga yang kehilangan anggota keluarganya untuk segera melaporkan ke Polsek Medan Area, atau mendatangi kamar mayat RSU dr Pirngadi Medan. “Sampai saat ini belum ada yang melapor kehilangan keluarga, saya mengimbau untuk warga yang kehilangan anggota keluarganya agar mendatangi kamar mayat RS dr Pirngadi,” katanya. Namun, sekira pukul 13:30, seorang pria bernama Budi, warga Jl Ambon, menjumpai petugas kamar mayat karena ingin melihat mayat korban luka bakar tersebut apakah istrinya atau tidak. Setelah diperiksa berdasarkan ciri-ciri yang diberitahukan Budi, ternyata mayat wanita itu bukan istrinya yang sudah seminggu pergi dari rumah. “Istri saya sudah seminggu pergi dari rumah, makanya begitu mengetahui ada mayat luka bakar masuk kesini saya datang untuk melihat. Ternyata, setelah diperiksa bukan istri saya,” ujar Budi. Hingga Rabu (7/12) sekira pk 18:00, mayat wanita Mrs.X masih berada di kamar mayat RSU dr Pirngadi Medan untuk dilakukan otopsi. Mayat tersebut mengalami luka bakar 100 persen. (h04/ h02)

TNI Siapkan Armed Roket MLRS MEDAN (Waspada): Artileri Medan (Armed) TNI Angkatan Darat segera merealisasikan modernisasi alat utama sistem senjata (Alutsista) berupa rematerialisasi meriam 72 MM/Gun menjadi meriam 105 MM/Gun dan penyiapan Batalyon Armed Roket Multiple Launcher Rocket System (MLRS). “Untuk itu kita mengharap doa dan restu dari para sesepuh dan perwira senior karena selaras dengan rencana strategis TNI AD dalam kurun waktu sampai dengan 2014 dalam perkembangan dan pembangunan satuan Armed akan segera merealisasikan modernisasi Alutsista,” kata Danpusen Armed Brigjen TNI Ariyadi Padmanegara dalam amanatnya yang dibacakan Danyon Armed 2/105 Letkol Arm Leobis Muhammad Hasbi, S.IP. saat syukuran HUT ke 66 Armed 2011, di Aula Djarot Supadmo Mako Yon Armed 2/105, Senin (5/12). Dia menyampaikan, hendaknya HUT ini dapat dijadikan sumber motivasi dalam melanjutkan pengabdian warga Armed, kepada bangsa dan negara, serta dapat dijadikan wahana untuk mewujudkan komitmen ber-sama dalam rangka membangun kebanggaan dan kejayaan korps. Adapun tema HUT Armed 2011 ini yakni, ‘Dengan dilandasi oleh semangat patriotisme dan militansi yang tinggi prajurit Armed siap meningkatkan profesionalisme dan soliditas

korps guna mewujudkan kesiapan operasional satuan’. “Tema ini tidak menjadi sesuatu yang hanya bersifat retorika belaka, maka saya mengimbau kepada seluruh prajurit Armed untuk semakin meningkatkan kuailitas pribadi, utamanya dalam bidang disiplin, integritas, moralitas dan profesionalisme guna memberikan pengabdian terbaik kepada bangsa dan negara Indonesia tercinta,” sebutnya. Acarasyukurandilaksanakansecaraseder-hana dan pemotongan tumpeng oleh Danyon Armed 2/105 Letkol Arm Leobis Muhhmad Hasbi, S.IP, didampingi ketua persit cabang 14 Yon Armed 2/ 105. Nasi tumpeng diberikan kepada Serda Fardy Ary Armaya sebagai prajurit berpres-tasi, Juara I KejurdaWadokai tahun 2008, Juara I Kejurda Forki tahun 2010, Juara I Kejurda Porwil Surabaya tahun 2010 dan Juara I Kejurda Lemkari tahun 2010. Acara Syukuran diwarnai dengan acara hiburan diisi oleh Ibu-ibu Persit dari cabang 14 Yon Armed 2/105 serta para Prajurit Yon Armed 2/105 dengan Koordinator Pasi Intel Yon Armed 2/105 Kapten Arm Perdy. Acara dihadiri oleh Kasrem 022/PT Letkol Arm Anton Irianto Popang, sesepuh Armed Kepala Pos BIN Wil Sumut Brigjen TNI Bambang Subagyo, Dandim 0204/DS Letkol Arh Wawiek, para Danyon BS, Kapolsek Delitua Kompol Sinulingga, tokoh agama, tokoh masyarakat, dan Ibu Persit Cabang Yon Armed 2/105. (h02)

photography dan salon ini ditemukan barang bukti duplikat BPKB truk BK 9481 CK dan surat lainnya yang dipalsukan beserta tandatangan palsu. Waka Sat Reskrim AKP Ronny Nicolas Sidabutar yang dikonfirmasi melalui Kanit Resum AKP Amri, Rabu (7/12), membenarkan penggerebekan tersebut. “Namun saat digerebek yang bersangkutan melarikan diri. Hanya barang bukti yang ditemukan yakni duplikat BPKB,” jelasnya. Informasi di Polresta Medan, peristiwa itu berawal pada Desember 2009. Saat itu, tersangka membuat iklan layanan

masyarakat di tiga suratkabar perihal kehilangan BPKB selama tiga hari berturut-turut dengan harapan mengetahui siapa yang memegang BPKB itu. Hingga lebih satu bulan, tidak ada yang komplain atau merasa memiliki BPKB itu. Kemudian tersangka mengurus duplikat BPKB ke Samsat. Saat itu hanya diurus tiga duplikat BPKB, salah satunya BK 9481 LK atas nama Parman. BPKB tersebut belum melalui proses bea balik nama (BBN), semua masih atas nama Parman selaku pemilik pertama. Persoalan ini muncul pada 17 Mei 2011, ketika seseorang

Diduga Dibajak, Mobil Tangki CPO Ditemukan Kosong BELAWAN (Waspada): Satu unit mobil tangki pengangkut 22 ton Crude Palm Oil (CPO), nopol BM 8566 AD yang dikemudikan Syahrizal, 45, warga Lengking Langsa, Aceh Timur, ditemukan dalam keadaan kosong di depan SPBU Jalan Kapten Sumarsono, Desa Hevetia, Kec. Labuhan Deli, Rabu (7/12). Diduga mobil tangki yang mengangkut minyak CPO milik PTPN I itu dibajak oleh orang tak dikenal dan hingga berita ini diturunkan, sopir dan kernetnya belum ditemukan dan belum diketahui keberadaannya. Teman sopir mobil pengangkut CPO, Hendra Mulia kepada Waspada, di Mapolsek Medan Labuhan mengatakan, dia bersama Syahrizal berangkat bersama dari pabrik kelapa sawit (PKS) Mentok, Aceh, menuju pabrik PT Musim Mas yang berada di Pelabuhan Belawan, Senin (5/12). “Kemarin, kami berangkat pada hari yang sama dari Aceh, mobil dia di depan dan aku dibelakangnya,” katanya. Ditengah perjalanan, mobil Hendra mengalami bocor ban. Setelah selesai melakukan perbaikan, Hendra kembali melanjutkan perjalanan dan tiba di

Belawan, Selasa (6/12). “Saat berada di Belawan aku sudah berusaha mencari korban namun tidak ketemu,” sebutnya. Usai membongkar muatannya, Hendra berniat kembali ke Aceh. Namun dalam perjalanan pulang tersebut, dia melihat mobil korban di depan SPBU Jalan Kapten Sumarsono, Desa Hevetia, Kec. Labuhan Deli, dalam keadaan kosong dan sepedometernya sudah tidak ada. “Waktu kulihat aku langsung berhenti dan setelah kuketok ternyata tangkinya sudah kosong,” sebutnya. Mengetahui hal itu, Hendra menghubungi bosnya di Aceh dan tiba Rabu (7/12). Selanjutnya, pemilik angkutan melapor ke Polsek Medan Labuhan. Setelah dilakukan pemeriksaan lokasi penemuan, mobil tangki berwarna putih kream bergaris tengah warna coklat tersebut diboyong ke Mapolsek Medan Labuhan sebagai barang bukti. Kanit Reskrim Polsekta Medan Labuhan AKP Oktavianus mengatakan, pihaknya masih melakukan pencarian terhadap pelaku. “Buat sementara dugaan kita ini kasus penggelapan dan kita sedang memburu sopir yang sudah lari,” katanya.

Dalam kurun enam bulan terakhir ini, kasus pembajakan terhadap mobil CPO sudah dua kali terjadi di wilayah hukum Polres Pelabuhan Belawan. Satu dari kasus terbsebut belum terungkap yakni pembajakan terhadap mobil tangki CPO milik PT Tangki Mas yang terjadi sekitar bulan Mei 2011. Kedua pembajakan terjadi terhadap mobil dikemudikan T Manurung pada 19 Nopember lalu di pintu tol Belmera H Anif. Tiga dari lima orang yang diduga pelaku pembajakan telah ditangkap dan dua di antaranya oknum TNI AL yang saat ini diproses di Pomal Belawan. Namun, hingga saat ini polisi belum berhasil mengungkap siapa otak pelaku dan penadah barang kejahatan tersebut. Akibat kejadian itu perusahaan jasa angkutan CPO mulai resah dan berharap polisi mengungkup semua aksi pembajakan itu dengan terang tanpa ada yang disembunyikan. Bahkan seorang kuasa korban Banggas HO Siregar, SH meminta polisi memberikan jaminan rasa nyaman kepada kleinnya untuk berusaha di wilayah hukum Polres Pelabuhan Belawan.(h03)

Warga Jln Jati Adukan Ketua PN Ke Poldasu MEDAN (Waspada): Menilai pelaksanaan eksekusi terhadap lahan warga belum berkekuatan hukum tetap, warga Jalan Jati Lingkungan X, Kel. Pulo Brayan,Kec.MedanTimur, melaporkan Ketua Pengadilan Negeri (PN) Medan berinisial EMM dan Wakil Panitera berinisial BS ke Polda Sumut, Rabu (7/12) Siang. Kedua pejabat di Pengadilan Negeri Medan tersebut dilaporkan oleh Demak Tobing, 58, dan Sikasno, 50, warga Jalan Jati Gang Prima, karena menyalahi kekuasaan sehingga kedua warga tersebut masing-masing mengalami kerugian dari Rp5 miliar hingga Rp6 miliar. Saat membuat laporan pengaduan ke Poldasu, kedua warga itu didampingi oleh kuasa hukumnya Djonggi Simorangkir SH, MH. Sikasno mengatakan, dia sudah melaporkan Ketua PN Medan dan Wakil Panitera PN Medan atas eksekusi rumahnya yang dilakukan Juru Sita PN Medan, sesuai dengan surat laporan polisi; STTLP/985/XII/2011/ SPKT-I. Sedangkan Demak Tobing melaporkan ketua PN dan wakil panitera dengan no STTLP/986/XII/2011/SPKT-I tertanggal 7 Desember 2011 yang diterima oleh Briptu Ajis Simangunsong. Menurut Sikasno, tanah dibangunanrumahnya itu dibelinya pada tahun 1981, kemudian pada tahun 2002 dia mengurus sertifikat hak milik tanah ke BPN kota Medan.Tahun 2003 dirinya mengurus IMB di TRTB kota Medan untuk membangun rumahnya.

“Saat membuat IMB di TRTB kota Medan tidak ada masalah, kemudian saya cek lagi keabsahan sertifikat tanah BPN kembali tidak ada masalah silang sengketa tanah. Saya sangat aneh melihat kasus ini. Kerugian yang saya derita mencapai Rp5,7 miliar, belum lagi kerugian immateril” ujarnya sembari mengatakan akibat eksekusi rumahnya yang dihuni oleh istri, anak dan mertuanya Arbian Hasibuan, kini harus menumpang ke rumah famili, sedangkan mertuanya kini sakit dan tidak mau makan akibat eksekusi itu. Dia yang selama ini bekerja di perusahaan Migas di Qatar, Timur Tengah, sengaja datang ke Medan, untuk melihat kasus yang dialami keluarga dan mertuanya yang mana rumahnya ikut di eksekusi oleh pihak Juru Sita PN Medan. Sebagai warga yang menjadi korban mafia hukum, mafia tanah, dan mafia peradilan ini, Sikasno berharap agar Kapoldasu bersikap profesional untuk menindaklanjuti kasus itu dan mengungkappelaku-pelakuyang merugikan warga selama ini. Sementara itu, Djonggi M Simorangkir, selaku kuasa hukum mengatakan, dengan dilaporkan Ketua PN Medan dan Wakil Panitera PN Medan agar mata penegak hukum terbuka atas kebenaran dan keabsahan dari sertifikat tanah milik warga.”Harus kita laporkan kasus ini ke Poldasu karena warga memiliki sertifikat tanah yang sah

dikeluarkan oleh BPN Kota Medan, dan tidak pernah bersengketa dengan Abdul Kiram yang mengakui menduduki dan menempati lokasi tersebut,” sebutnya. Djonggi menjelaskan, perlawanan dan gugatan terhadap perkara No.113/Pdt.G/2006/PN Medan, tanggal 1 Maret 2007 antara Abdul Kiram dkk, dengan Ruslim Lugianto adalah milik orang lain dan BPN Medan tidak pernah membatalkan sertifikat milik warga yakni 52 sertifikat hak milik. “Sudah terlihat hasil sertifikat milik warga yang dikeluarkan pihak BPN, keputusan No.113 tidak terdapat satu pun nama warga dalam putusan tersebut, jadi saya mau tanya seandainya gugatan kami menang, terbukti tanah itu milik warga, siapa mau ganti keseluruhan bangunan warga yang hancur ini,” kata Djonggi. Djonggi menilai ada keanehan dalam kasus tersebut, yakni PN Medan tidak pernah melakukan sidang lapang di lokasi sengketa dan pelaksanaan eksekusi belum berkekuatan hukum tetap, apalagi warga telah mengajukan gugatan perlawanan terhadap putusan eksekusi nomor 113 tersebut. Dia mengatakan, pihaknya sudah menyurati Mahkamah Agung (MA), Komisi Yudisial (KY), Komisi Pemberantasan Korupsi (KPK) dan pihak terkait lainnya.”Akan kita laporkan kasus ini dengan cara menyurati MA, KY, KPK dan pihak terkait lainnya,” tuturnya. (h04)

membuat laporan ke Polresta Medan terkait pembelian 23 unit dump truk dari Edi Kartono dengan menunjukkan BPKB asli. Dalam laporannya ke Polresta Medan, selain membeli 23 dump truk, dia juga membeli dua alat berat eskavator dan satu sepedamotor seharga Rp3,8 miliar. Bukti pembelian ditunjukkan dalam selembar kertas folio berikut jumlah barang yang dibeli. Setelah adanya laporan itu, Polresta Medan melakukan pemeriksaan terhadap saksi-saksi yang terkait dalam permasalahan ini termasuk Rudi Pope. Semula polisi memanggil yang

bersangkutan dalam kapasitas sebagai saksi dan sempat memenuhi panggilan. Namun dari hasil pemeriksaan, status yang bersangkutan dinaikkan menjadi tersangka karena dari hasil Labfor diketahui tandatangan korban dipalsukan tersangka. Sejak penetapan sebagai tersangka, Rudi Pope tidak memenuhi panggilan hingga dua kali. “Berdasarkan itu, polisi melakukan upaya membawa paksa. Namun saat dilakukan penggerebekan di gedung Platinum tersangka melarikan diri,” jelas Amri. (m39)

Pabrik Tahu Terbakar BELAWAN (Waspada): Pabrik tahu milik Sukarmin, 36, di Jalan Rumah Potong Hewan (RPH), Kelurahan Mabar, Kecamatan Medan Deli, terbakar, Selasa (6/12) dini hari sekitar pukul 03.00. Tidak ada korban jiwa dalam peristiwa kebakaran yang diduga apinya berasal dari tungku masak tahu tersebut. Namun kerugian diperkirakan puluhan juta rupiah. Keterangan dari lapangan menyebutkan, dinihari itu, seorang karyawan bagian masak menghidupkan api tunggku masak tahu. Selanjutnya karyawan tersebut duduk di tempat peristirahatan menunggu tahu yang dimasak agar matang. Namun, tiba-tiba api dari bakaran kayu marak hingga menjilat ke dinding dapur pabrik. Akibatnya, api dengan cepat menyambar keseluruh bagian pabrik hingga membuat sejumlah masyarakat sekitar panik dan berusaha memadamkan api. Enam unit mobil pemadam kebakaran yang datang ke lokasi berusaha melakukan pemadaman. Namun karena bangunan pabrik itu terbuat dari bahan yang mudah terbakar, dalam waktu singkat pabrik tahu tersebut rata dengan tanah. Kanit Reskrim Polsek Medan Labuhan AKP Oktavianus mengatakan, pihaknya masih melakukan penyelidikan penyebab kebakaran tersebut. “Garis polisi telah kita pasang sambil menunggu hasil pemeriksaan,” sebutnya. (h03)

Waria Curi HP, Uang Teman Kencan MEDAN (Waspada): Polsek Medan Baru menangkap dua pria wanita (waria) yang sudah berulangkali melakukan pencurian barang milik teman kencannya, di Jln. Labu II Medan, Rabu (7/ 12) dinihari. Dari kedua waria AMS alias Cika dan Ha alias Mei, polisi menyita barang bukti uang Rp70.000 dan handphone Black Berry (BB) hasil kejahatan. Informasi Waspada peroleh di lapangan, tersangka H alias Mei yang selalu mangkal di kawasan Jln. Gajah Mada dan Jln. Samanhudi, mendapat tamu kencan korban MHS. Kemudian Mei membawa teman kencannya itu ke kamar kosnya di kawasan Jln. Labu II, Medan Baru. Ketika berada dalam kamar, korban MHS menanggalkan celana panjangnya yang di sakunya ada handphone BB dan uang lalu digantung dibelakang pintu kamar. Sewaktu keduanya asyik berkencan, tersangka AMS alias Cika secara diam-diam masuk ke dalam kamar mengambil handphone dan uang milik korban. Usai berkencan, korban MHS memakai celana panjangnya sembari memberikan uang Rp100 ribu kepada Mei. Namun saat ke luar kamar, korban menyadari handphone dan uang di dalam saku celananya sudah raib. Selanjutnya korban membuat pengaduan ke Polsek Medan Baru. Timsus Reskrim Polsek Medan Baru mendapat laporan langsung meringkus kedua waria tersebut bersama barang buktinya. Kapolsek Medan Baru AKP Dony Alexander, SH,SIK mengatakan, kedua waria itu diduga sudah berulangkali melakukan aksi kejahatan yang sama. Keduanya saat ini masih menjalani pemeriksaan. (m36)

Waspada/Andi Aria Tirtayasa

DJONGGI M Simorangkir selaku kuasa hukum Demak Tobing dan Sikasno memperlihatkan surat pengaduan warga terhadap Ketua PN Medan dan wakil panitera ke Poldasu, Rabu (7/12).



Jangan Lagi Ada Kekerasan Di Aceh


ekerasan bersenjata kembali terjadi di Aceh, Minggu malam, 4 Desember 2011, sejumlah pekerja perkebunan di Krueng Jawa, pedalaman Kecamatan Geureudong Pase, Aceh Utara, yang sedang asyik menonton televisi diberondong tembakan. 3 Tewas dan 5 orang kritis. Tentunya hal ini menjadi luka sendiri bagi warga Aceh yang sudah merasakan kedamaian pasca MoU Helsinki, Finlandia 15 Agustus 2005. Aksi brutal pemberondongan buruh PT Satiya Agung di Desa Uram Jalan, Kec. Geureudong Pase (GP), Aceh Utara pada Minggu (4/12) malam, masih tinggi kaitannya dengan Pilkada Aceh, bahkan ini digolongkan dalam aksi terorisme yang tersruktur. Hal itu dikemukakan pakar politik/teroris nasional Al Chaidar kepada Waspada, Selasa (6/12). Al Chaidar menambahkan, aksi brutal masih cendrung terjadi di daerah yang penduduknya heterogen, artinya masyarakat di wilayah itu komunitas penduduknya beragam. “Masyarakat sebenarnya jangan salah menafsirkan arti teroris, segala bentuk tindakan yang membuat masyarakat takut dan gundah dengan misi suatu kelompok tertentu, sudah dikatakan terorisme. Bahkan, teroris ini bukan hanya dari kalangan kelompok Jamaah Islamiyah, yang sering dikaitkan dengan Islam,” kata Al Chaidar, yang juga alumnus UI itu. Pemberondongan sudah masuk aksi terorisme dalam konteks Pilkada Aceh. Mereka melampiaskan aksi di daerah itu, kemungkinan mereka melihat suara masyarakat yang diklaimnya dalam menentukan pilihan politik ke depan masih tidak menguntungkan pihak-pihak tertentu. Al Chaidar juga tidak menepikan kasus penggranatan yang terjadi di kantor Seuramoe Irwandi-Muhyan dan Mes Kemenpolhukam Perwakilan Aceh di Lampriet. Kedua kejadian itu masih punya kaitannya erat dengan yang terjadi di Geureudong Pase, Aceh Utara. “Serangkaian itu, pelakukanya adalah pihakpihak yang tidak terima Pilkada Aceh berjalan damai,” katanya. Pertanyaan ke depan tentunya apakah kemudian proses damai. Menanggapi aksi teror granat dan penembakan, Kapolda Aceh Iskandar Hasan menyebutkan tidak mudah melacak pelaku. Apalagi selama ini banyak warga yang enggan menjadi saksi. “Kami bicara hukum tak mungkin kami bisa main tangkap orang sembarangIntisari an. Kami harus mempertimbangkan itu termasuk memeriksa saksi dan mendeketerangan saksi ahli,” katanya Perdamaian di Aceh se- ngarkan Kapolda Aceh, Iskandar Hasan mengaharusnya dapat dijaga takan personilnya terus memburu pelaku yang terjadi di Aceh. Sejauh ini, kata untuk kemaslahatan teror dia, Polda Aceh masih bisa mengendalikan rakyat. situasi keamanan setempat.“Sejauh ini masih bisa kita tangani, untuk daerah yang dianggap rawan akan kita perkuat personil Brimob ke daerah itu. Sampai saat belum dibutuhkan penambahan pasukan,” katanya. Disebutkan, Polda Aceh juga berencana akan bekerja sama dengan TNI untuk melacak dan mengungkap dalang di balik aksi teror ini dengan meningkatkan razia dan membentuk operasi gabungan. Iskandar mengatakan, senjata-senjata yang digunakan oleh kelompok peneror ini kemungkinan besar berasal dari sisasisa konflik di Aceh. Iskandar sendiri mengakui senjata sisa konflik di Aceh masih banyak beredar di masyarakat. Kata dia, selama dirinya menjabat Kapolda sejak dua tahun terakhir saja, sudah ada 43 pucuk senjata organik yang berhasil disita polisi. “Peluru yang berhasil kita kumpulkan ada 7.000 butir, granat puluhan buah. Mungkin saja para pelaku kriminal ini membeli senjata zaman konflik untuk melakukan aksinya,” ujarnya. Iskandar juga menyebutkan dalam beberapa kasus kekerasan bersenjata yang berhasil diungkap, para pelaku menyewa senjata dari temannya yang masih menyimpan senjata sisa konfik. Jadi kata dia, kemungkinan masih banyaknya senjata sisa konflik yang beredar di Aceh cukup tinggi. “Kita mengimbau agar yang masih menyimpan senjata segera menyerahkannya ke polisi,” ujarnya. Jadi sesungguhnya yang diharapkan kini menurut hemat kita adalah bagaimana kedamaian di Aceh benar-benar Tujuan perdamaian ini sendiri adalah untuk mengakhiri perang, sekaligus membangun kembali Aceh yang hancur akibat terjangan tsunami dan konflik, serta untuk menjalankan politik yang demokratis di Aceh. Perdamaian di Aceh yang telah terpelihara hingga sekarang telah menjadi contoh bagi dunia Internasional. Banyak hal yang masih harus diperhatikan dalam mengisi perdamaian Aceh. Antara lain, mengenai nasib janda dan anak yatim, serta orang yang cedera akibat konflik yang masih perlu mendapat perhatian. Jadi kini, mari semua kita sama-sama menjaga perdamaian di Aceh.****


Faks 061 4510025


+6283197565871 HENING CIPTA ALSYURO Mengenang segala Peristiwa yang terjadi atas Diri Para Nabi Pilihan yang banyak terjadi di tanggal 10 Al-Syuro atau 10 Mukharrom . Maka di sunnatkan terhadap setiap Muslim BERPUASA yang di awali Nawaytu Sunnatu Showma dikala hendak menyantap Hidangan SAHUR dimalam Isnin atau Dinihari Isnin 05 Des.. Ashbab Awal Tahun Baru Hijriyah di tandai Hilal di Petang Jum ’at 25 Nov.. Dan pada mal amnya merupakan ; Malam TAHUN BARU HIJRIYAH yang berarti ; Malam Satu SYURO atau AWAL BULAN MUKHARROM 1433 . Dan dimalam Sepuluh Syuro mari kita santap Hidangan Sahur pada detik- detik dinihari # Massage ’s Writer ; Dato^ MNSejok~ Tepi Barat Medan City +628153195774 Firman Allah dalam Al Qur’an tentang perintah Allah utk perempuan berjilbab. ‘’ Hai Nabi kataknlah kepada istri2mu, anak2 perempuanmu dan isteri2 orang mu’min: * Hendaklah mereka mengulurkan jilbabnya ke seluruh tubuh mereka*. Yg demikian itu supaya mereka lebih mudah dikenal, karena itu mereka tdk diganggu. Dan Allah adalah Maha Pengampun lagi Maha Penyanyang.( QS AL AHZAB 33-ayat 59. +6285372345131 Selamat memasuki thn baru hijriyah 1432 h , tegakkan al qur’an - as sunnah , patahkan bid’ah dhalalah dlm ibadah ibadah maqdha , perbaharui aqidah , kembali kepada ajaran Islam yg murni utuh baik dan benar , jauhi musuh Allah swt (la’natullah) : tahyul , bid’ah , churafat krn ketiga yg dilaknat ini sangat dekat dgn kemusyrikan dan syiriq. Menyusupnya syirik , tahyul , bid’ah dan churafat ditengah penyakit masyarakat Islam saat ini ibarat semut hitam berjalan dimalam hari diatas batu hitam ditengah gelap gulita. Contoh kecil ibu hamil mengenakan gunting kecil yg diyakini mampu menangkal segala bentuk gangguan , anak bayi diberi ponpon. Na’uzu billahi min zaliq. +6283199572197 TIDAK MENYURUT KAN LANGKAH * Tidak menyurutkan AirTelaga walaupun terjadi kemarau sepanjang zaman . Itulah Telaga Zamzam abadi di Tan ah Suci Makkah Saudi ’Aro biya . Tidak menyurut kan niyat melangkah walaupun terjadi tragedi menyedihkan di Perguruan Tinggi Moslem di Negeri Yaman . Itulah yang terpatri di Qolbu si Anak dan yang Beranak di Negeri Nusantara. Perguruan Sekte Syi ’ah dan Perguruan Sekte Sunni . Terjadi konflik di Negeri Jauhari. Negeri Yaman tempat studi . Anak Kemanakan kita yang pandai mengaji. Tetapi apalah daya diri. Janji ajal telah menanti . Anak Kemanakan kita dijeput IZRO-’IL menuju ’Alamabadi dengan ashbab yang tersebut tadi # Pengirim Sya ’ir ; Dato^MNSejok ÅB* +6281265333535 ZIKIR & DOA adalah inti ibadah, didalam Alqur’an ada 20 an ayat seuan berzikir & berdoa, bagaimana pengamalannya diatur dalam alqur’an itu sendiri, yaitu surat al a’raf ayat 205 “BERZIKIRLAH kamu kepada tuhanmu DIDALAM HATIMU dengan merendahkan diri dan rasa takut dan TIDAK DENGAN SUARAYG KERAS pada pagi & petang dan janganlah kamu termasuk org2 yg lalai”. lalu al a’raf ayat 55 “BERDOALAH kamu kepada tuhanmu dgn rendah hati dan dgn SUARA YG TERSEMBUNYI/TERSAMAR sesungguhnya Dia tdk menyukai org2 yg melampaui batas”. Saudara2ku, lakukanlah zikir & doa sesuai dgn TATA CARA yg telah ditetapkan oleh alqur’an itu. Janganlah dikerjakan sesuka hati & ngikut selera masing2, buktinya perhatikan saja bgmana praktek zikir & doa sesudah shalat 5 waktu di masjid2, apalagi yg diamalkan org2 dalam wirit, tahlilan, dll, sudahkah sesuai dgn tuntunannya tsb ? sepertinya masih jauh. Semoga saja amal ibadah kita tdk tertolak. Amin Terimakasih.

WASPADA Kamis 8 Desember 2011

Masyarakat Butuh Sejarah (Catatan Dari Seminar Peristiwa Berdarah 13 Desember 1945 Di Tebing Tinggi, 6 Desember 2011) Oleh Shohibul Anshor Siregar Sekali lagi, sejarah bukanlah sekadar penanggalan suatu kejadian,bukan pula cuma kenangan pahit atau ceria tentang masa silam. Sejarah adalah petunjuk masa depan.


baratpohon,sejarahitusemestinya mampu mendeskripsikan diri kita secara lengkap (akar, batang, cabang, ranting, anak ranting, dedaun,danbahkanserpihan-serpihanyang gugur ke bumi). Bisa saja memang, karena sebuah kesalahan besar sejarah dibuat tidak jujur. Sejarah bahkan kerap menjadi cerita tentang perilaku dan “omong kosong” orang-orang besar di zamannya. Kalau begitu sejarah bukan sekadar butuh metode, tetapi juga kemasuk-akalan dan kejujuran. Itu karena sejarah adalah cermin yang bukan sekadar mata pelajaran penting tentang penanggalan, peristiwa, tempat dan sejumlah nama belaka, plus seremoni yang disakralkan. Sudah pasti sebuah bangsa akan terbelakang jika tak mampu bermatematika. Tetapi jika ia jatuh dan menjadi budak bagi negara lain, termasuk mengapa tak tahu matematika, jawabannya justru ada pada sejarah. Saksikanlah apa kata orang belakangan tentang detik-detik menegangkan ketika Soekarno dan Hatta diculik oleh sejumlah anak muda untuk dipaksa“memerdekakan” Indonesia. Rengasdengklok disebut menjadi sebuah tempat yang entah mengapa menjadi pilihan bagi Adam Malik dan kawan-kawan. empatyangdinilaicukupuntuk“menjauhkan” pengaruh Jepang dari Indonesia baru yang akan dimerdekakan? Tetapi kemudian tibalah saatnya orang bertanya mengapalah Maeda, si penguasa Jepang itu, justru menjadi figur penentu melebihi peran sebagai pelengkap di tengah percaturan politik global yang membuat negaranya terpaksa menerima kekalahan dari sekutu? Mungkin ia tak sekadar fasilitator.“Sutradara”inisemakinjelasposisinya jika dihubungkan dengan historical background BPUPKI dan PPKI yang sebelumnya dibentuk. Ketakmasukakalan alasan penjauhan Soekarno-HattadariJepangdenganperistiwapenculikanRengasdengklokpunperlahanterbuka.Bukansaja,kataIchwanAzhari, karena Adam Malik itu, di zaman itu, seolah “memakai sepasang sepatu yang jauh lebih besar dari kedua kakinya”.Tetapi

dua orang yang kemudian mengatasnamakan rakyat Indonesia pun ditakdirkan lupa bahwa meskipun telah melakukan pencoretan beberapa kata, naskah proklamasi tetap saja menyisakan aroma kental skenario Jepang yang negaranya secara tak sportif diluluh-lantakkan oleh sekutu dengan bom atom, justru rakyat negara matahari terbit itu sedang tidur pulas. Sejarah memang harus jujur dan tidak membodohi. Bukankah bisa dan biasa terjadi, bahwa karena kenaifan suatu bangsa, sejarah ditulis oleh orang lain yang menghendaki keperiadaantertentubagisebuahbangsa yang kerap harus dijuluki gagap dan dicoba senantiasadigagapkan?Periksalah dengan cermat pertengkaran sengit Mohammad Said, pendiri HarianWaspada, dengan banyak orang tentang Sisingamangaraja XII seputar klaim kemangkatannyadan perburuangagalpasukan Belanda. Tentang bendera yang menyimbolkan kediriannya. Tentang stempel yang multi-interpretasi dan tentangbanyakhalmengenaipengikutnya Parmalim.Distorsiselalumewajibkanrevisi tajam. Itu jika sebuah generasi pewaris ingin menjelaskan dirinya secara jujur. Petunjuk masa depan Sekali lagi, sejarah bukanlah sekadar penanggalan untuksuatukejadiandisuatu tempat yang melibatkan orang-orang. Sejarah bukan pula cuma kenangan pahit atau ceria tentang masa silam. Sejarah adalah petunjuk masa depan. Sejarah mestinya pula mampu menjelaskan bahwasetelahIndiadanChina,Indonesiaadalah negara dengan penduduk terbesar penderitatuberculosissaatinidisusulAfrika Selatan, Nigeria, Bangladesh, Ethiopia,

Pakistan, Philipina, Kongo, dan Rusia. Saat ini ada 22 negara dengan beban berat penyakit menular yang berbahaya ini, yang pada umumnya adalah negara-negara dengantingkatketerbelakanganyangmenyedihkan, termasukViet Nam, Kenya,Tanzania,Uganda,Brazil,Mozambique,Thailand, Myanmar,Zimbabwe,KambojadanAfghanistan. Jika sejarah tak mampu menjelaskan fakta ini, maka negara-negara ini pun tak akan punya masa depan. Sejarah yang benar wajib menjelaskan kepada kita mengapa Ujian Nasional (UN) yang berbiaya begitu besar dipandang menjadi prioritas pendidikan padahal semua orang tahu bahwa jangankan ujian, ijazah saja pun lazim diperjual-belikan di indonesia. Lagi pula trend umum sudah sukar dihindari bahwa ujian itu sendiri dikerjasamakan di sekolah dan dilihat dari besaran permasalahan pendidikan Indonesia kurang lebih UN itu cuma seperti orang yang tak punya celana dan tak punya bajutetapimemaksadiri untuk memakai dasi. Jikatidak,Indonesiatidak akan memiliki masa depan kecuali sebagai pecundang belaka di tengah percaturan global. Interaksi berbagai aspek dalam demokrasi Indonesia hingga kini menunjukkan bahwa aspek kebebasan sipil sepintas telah jauh melampaui yang lain. Tetapi itu tidak serta merta menjadi jaminan terpenuhinyaaspek-aspeklainsepertihak-hakpolitik warga dan tumbuhnya lembaga-lembaga demokrasi secara sehat. Pertanyaan ”mengapa” harus muncul dari sejarah hingga sebuah jalan baru terbuka bagi Indonesia untuk menempuh sebuah masa depan yang lebih baik. Kecuali para elitnya memang menginginkan Indonesia tak diperukankecualisebagaipersembahankhusus bagi hasrat hedonitas dan ambisi kekuasaan mereka. Jika sejarah tak dapat menjelaskan luluh-lantaknya kedaulatan Indonesia oleh kekuatan asing dalam pengelolaan sumberdaya alam yang menebar malapetaka kemanusiaan, kejahatan lingkungan dan kejahatan keuangan negara, maka Indonesia, dengan perantaraan mandat yang diberikan kepada para

pemimpinnya, telah menerima legowo nasibnya kembali ke periode kolonial yang tak punya harga diri. Indonesiapunharuscepatsiumandan membuat sejarahnya secara kritis mampu menjelaskan mengapa lembaga tak penting yang dipenting-pentingkan seperti KPK dan Satgas Pemberantasan Mafia Hukum tak mampu berbuat apa-apa kecualisekadarsepertiberteriaktakmenentu untuk mengaburkan bahwa sebuah rezim hanya bertindak untuk kepentingaan terbatas yang menjauhi kepentingan pemenuhan kemaslahatan rakyat. Jika rezim ini sadar, sejarah sebaiknya tidak perlu ditungguuntukmenceritakanbetapaburuknyareziminisecarasubjektifmerumuskan sendiripengabdiannyauntuksesuatuyang sama sekali tak difahami oleh rakyatnya. Penutup Marilah meluangkan sedikit waktu untukmengikuticermatperkelahianbesar yang pernah terjadi di bumi ini dan menggunakannya sebagai patron analisis untuk kejadian-kejadian di belakang hari. Kenalilah dengan amat baik ketauladanan para nabiyangmerubahdunia.Jangansungkan menyebut Engels, Marx, Lenin, Gevara, Jilas dan lain-lain. Sekali melupakan Ibn Batutah dan Ibn Khaldun yang kaya pemikiran, dengan membabi buta kita bisa memihaki ilmuan Barat yang tanpa penghargaan terhadap hak intelektual saat mereka akan membangun berbagai disiplin ilmu di kampungnya. Keperiadaan kiri maupun kanan dalam konstelasi perbenturanidiologimestinyatidakmembuat kita malas memburu sejarah orang-orang palingkananmaupunpalingkirisepanjang sejarah. Para perintis peradaban baru yang berpengaruh dalam sejarah Barat adalah ibarat tonggak baru yang mematahkan tonggak lama di Timur dengan hukumhukum kausalitas yang pinasti. Kita wajib menjadi cendekiawan organik yang tak perlu merasa harus dihitung. Kita menjadi mahasiswa abadi saja dan profesor emiritus di sebuah universitas paling terbuka sepanjang sejarah. Kita gerakkan naluri keluruhan untuk tetap menjadipewartakebenaranbiarpunakanmenjadi wartawan tanpa surat kabar. Kita wajib menjadi negarawan paling agung di sebuah negeri paling berjaya sepanjang sejarah, yakni negara konstruksi kontinum, dan itu tak perlu dengan jabatan formal dan pernak-pernik simbol kebesaran apa pun. Penulis adalah Dosen Sosiologi Politik FISIP UMSU, Koordinator Umum ’nBASIS.

Pilgubsu 2013, Langsung Atau DPRD ? Oleh Drs H.Eddy Syofian, MAP Sesuai keterangan Dirjen Otda Djoehermansyah Djohan, Pemerintah mengagendakan Pilkada Provinsi melalui pemilihan oleh DPRD sudah dapat dimulai 2013.


i Indonesia peranan kepala daerah sangat besar, baik dalam aspek pemerintahan maupun aspek pembangunan dan kemasyarakatan.Tidak berlebihan bila keberhasilan manajemenpemerintahandaerah,sangat tergantung pada tanggung jawab kepala daerah sebagai “manajemen daerah”. Implikasinya ialah bahwa tugas-tugas kepala daerah dengan sendirinya menjadi sangat berat. Dengan merujuk pada konsep negara kesatuan sebagaimana dianut saat ini, maka kepala daerah memiliki peran ganda sebagai“alat daerah” dan“alat pemerintah pusat”. Dalam perjalanan pemerintah daerah, peranan kepala daerah silih berganti,terutamatugasdankewenangannya. Kita ketahui kepala daerah di Indonesia ada di provinsi dan kabupaten/kota. Saat ini sesuai dengan UU Otda, peran kepala daerah di kabupaten/kota sesuai dengan kewenangan otda yang luas pada kabupaten/kota, posisi kepala daerah kabupaten/kota sangat kuat bila dibanding posisi gubernur di provinsi. Dalam proses rekruitmen kepala daerah, pemilihan kepala daerah baik di provinsi maupun di kabupaten/kota, selama ini berubah-ubah yakni penunjukkan langsung oleh pemerintah pusat, dipilih oleh DPRD, hingga dipilih langsung oleh rakyat.Kiniprosespemilihankepaladaerah (gubernur), khususnya di provinsi, telah dipersiapkan pemerintah (Kemendagri) melaluirevisiRUUOtda,pemilihanmelalui mekanisme pemilihan DPRD, tanpa mengajukan wakil kepala daerah. Saat penulis menghadiri diskusi nasional diselenggarakan Majelis Pakar KAHMI Sumut, 26 Oktober 2011 dengan tema: Pilkada Gubernur (dipilih langsung/ DPRD)?, dengan menghadirkan Ketua DPD RI: H. Irman Gusman dan Ketua Fraksi PPP Sumut: H. Fadli Nurzal. Keduanya tidak sependapat pemilihan oleh DPRD, tetapi lebih menekankan pada pemilihan langsung (berbeda dari rencana usulan pemerintah). Sedangkan peserta dialog tidak semua setuju pemilihan langsung dan tidak semua setuju pula melalui pemilihan DPRD. Bahkan secara ekstrim salah seorang peserta menyatakan bukan persoalan dipilih DPRD atau rakyat, melainkandirumuskanduluapakewenangan gubernur yang saat ini posisinya tidak sekuat sebagaimana diatur UU Nomor: 5 Tahun 1974. Gubernur saat ini hanya seperti “Kakanwil Kementerian Dalam Negeri”, karena besarnya kewenangan bupati/walikota. Kalau kewenangan gubernur masih seperti saat ini, lebih baik dipilih DPRD dari Parpol Pemenangan Pemilu yang di-

usulkan 3 nama untuk dipilih DPRD, atau ditunjuk presiden dari usulan Partai PemenanganPemiludandisetarakandengan Menteri(diMalaysiaMenteriBesar),karena kewenangannya cukup sebagaiWakil Pemerintah Pusat. Hanya saja penunjukan langsung bertentangan dengan UUD karena diamanatkan pemilihan kepala daerah dilaksanakan secara demokratis (dipilih langsung atau dipilih DPRD). Pilkada langsung DiIndonesia(khususdiSumateraUtara) pemilihan langsung kepala daerah (gubernur) sudah berjalan satu kali sejak diberlakukannya UU Nomor 32 Tahun 2004, yang dilaksanakan pada April 2008 lalu, diikuti 5 pasangan calon, dan tingkat partisipasipolitikmasyarakatSumut± 70%. Gubernur terpilih saat itu (H. Syamsul Arifin, SE/H. Gatot Pujo Nugroho, ST) dipilih rakyat Sumut sekitar 28%. Biaya yang dikeluarkan Pemerintah Provinsi saat itu ± Rp370 miliar (Rp224 miliar untuk KPU), belum termasuk biaya yang dikeluarkan kabupaten/kota, karena saat itu kabupaten/kota juga ada mempersiapkan anggaran tersebut. Biayayangbesaritulebihbanyakdigunakan penyelenggara (KPU), antara lain: cetak surat suara, pembuatan kotak suara, honor petugas mulai dari petugas KPPS, PPS, PPK, KPU kab/kota hingga honor di tingkat provinsi. Belum termasuk biaya untukpanitiapengawas,biayapengamanan, biaya sosialisasi dan biaya pemuktahiran data pemilih. Tidak hanya itu, Pilkada ini juga bisa berlanjut pada putaran ke dua. Ini juga tidak selesai, karena peluang Pilkadaulangkeseluruhanataupemungutan suara ulang pada tempat/wilayah tertentu. Itu semua membutuhkan resiko biaya besar yang pendanaannya tidak ada bantuan dari APBN (Pusat), melainkan dari APBD Provinsi. Biaya yang dikeluarkan Pemerintah Daerah tersebut, belum termasuk biaya yang dikeluarkan kandidat. Pilkada Sumut 2008 misalnya, KPU provinsi menetapkan 5 pasangan calon, sebelumnya juga sudah banyak beberapa tokoh yang memperkenalkan diri, baik melalui pertemuan masyarakat maupun Public Campagne melalui media massa. Semua itu, amat sedikit hanya menggunakan “biaya dengan modal senyum dan nafas”, melainkan membutuhkan “fulus”, “gizi”, atau biaya yang cukup besar, apalagi untuk memenangkannya. Besarnya biaya yang dikeluarkan pemerintahdaerah(uangrakyat)maupun olehkandidatcalon,belumjugamenjamin hasilPilkadaberdampakpadaperwujudan kondisi masyarakat kondusif. Modal sosial

yangharmonibisaterpecahkarenaPilkada, yangmenimbulkankonflik,bahkankonflik bisa berkembang menjadi amuk massa dan gesekan sosial. Namun, tidak semua Pilkada langsung berdampak negatif. Pilkada mekanisme DPRD Pilkada melalui mekanisme DPRD pernah dilakukan Pemerintah Orde Baru hingga lahirnya Reformas. Setelah lahirnya UU Nomor 32Tahun 2004 tentang Pemda sebagai pengganti UU No.22 Tahun 1999 joUUNo.5Tahun1974.Pilkada(Gubernur/ Bupati/Walikota) dipilih langsung rakyat. Pemerintah dalam waktu dekat menyampaikan revisi UU No.32Tahun 2004 tentang Pemerintahan Daerah yang antara lain mengubah pemilihan Gubernur melalui DPRD, sedangkan pemilihan bupati/walikota tetap dipilih langsung rakyat. Sesuai keterangan Dirjen Otda Djoehermansyah Djohan, Pemerintah mengagendakan Pilkada Provinsi melalui pemilihan oleh DPRD sudah dapat dimulai 2013. Di tahun 2013 ada beberapa provinsi akanmenggelarPilkadaantaralain:Provinsi Jawa Barat, Provinsi JawaTengah dan Provinsi Sumatera Utara. Provinsi Jawa Barat dan Provinsi JawaTengah akan ditetapkan sebagai pilot project program efisiensi pemilukada tersebut. Terlepas apakah Provinsi Sumatera Utara akan menggelar Pilkada langsung atau melalui pemilihan DPRD tentunya Pemerintah Provinsi, DPRD terutama KPU harusmempersiapkansecaramatang,agar Pilkada ini dapat berjalan dengan lancar dan sukses. KPU Provinsi Sumut telah menyampaikan rancangan biaya Pemilihan Gubernur Sumatera Utara secara langsung kepada Pemerintah Provinsi Sumatera UtarasebesarRp496Mlebih,belumtermasuk biaya pengamanan (TNI/Polri), Panwaslu, biaya sosialisasi dan Desk Pilkada yangdiselenggarakanPemerintahProvinsi. Biaya lainnya yang cukup besar penyampaian visi dan misi calon serta peresmian pelantikan gubernur dan wakil gubernur terpilih. Penutup Pertama, sistem apapun yang digelar muaranya adalah bagaimana proses demokrasi di Indonesia berjalan dengan baik dan pengelolaan tata pemerintahan di daerah dapat memberi pelayanan yang optimal, terhindar dari praktek KKN dan dapat menjagakeutuhanNKRI.Kedua,perubahan pemilihan Gubernur dari langsung oleh rakyat kepada pemilihan oleh DPRD, dimaksudkanpenyederhanaandanpenghematan anggaran serta mengeliminir potensi kerawanan konflik di tengah masyarakat. Pilkada Gubernur bukan hanya sekedardilihatdarisisipemilihanlangsungatau oleh DPRD, melainkan tentukan dahulu apakahkewenangannyamasihsepertisaat ini? Kalau seperti ini lebih baik dipilih oleh DPRD. Pilkada gubernur langsung tidak menjamin Kepala Daerah (KDH) tersebut dikenal masyarakat dan pengenalan itu

tidak begitu penting. Tetapi untuk bupati dan walikota sangat perlu dikenal dekat oleh masyarakatnya, karena kabupaten/ kota memang harus langsung memberi pelayananpadawarganya.Olehkarenanya pilkada bupati dan walikota harus tetap dipilih langsung. Ketiga, dari sisi anggaran pemerintah, kebutuhannya jauh berkurang kalau Pilkada oleh DPRD, tetapi tidak menjamin politik uang akan hilang. Kandidat calon gubernur tetap juga harus mengeluarkan uang yang cukup lumayan besar (cost politik). Keempat, ke depan persoalannya bukan hanya sekedar Pilkada Gubernur dipilih langsung atau dipilih DPRD, melainkan menata sistem Pemilu. Akhirnya, Pilkada Gubernur dipilih DPRD tergantung proses pembahasan di DPR.Yang penting proses demokrasi tidak hilang hanya karena efisiensi. Atau Pilkada Langsungwalaumengeluarkanbiayayang besar namun out come-nya menghasilkan pemerintahan yang kuat,akuntabel, transparan, aspiratif terhadap tuntutan masyarakat daerah, dan support terhadap kecenderungan global. Kita menanti urung rembuk Pemerintah dan DPR diakhir tahun ini. Penulis adalah Mantan Kadis Kominfo Provsu/Staf BPP Provsu

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Pemko Medan dituding lindungi bangunan bermasalah - Alamak jadi backing pulak! * Rekening gendut PNS akan diteliti - Masih akan, belum diteliti! * Briptu Norman Kamaru resmi diberhentikan - Chaiya...chaiya, he...he...he


D Wak


WASPADA Kamis 8 Desember 2011

Kepada Bapak Walikota Medan

Yth Walikota Medan Kami doakan semoga BapakWalikota Medan Drs H Rahudman Harahap, MM sehat selalu dan tidak terkendala melakukan tugas yang kami lihat sangat berat. Bagaimana tidak. Bapak harus ‘berjibaku’ memperbaiki sejumlah ketidakberesan di kota ini, tapi setelah dilantik sekira satu tahun lalu,Alhamdulillah Bapak dan jajaran Pemko Medan toh mampu mengukir sejumlah prestasi membanggakan secara nasional di sejumlah sektor. Kami melihat, salah satu kunci keberhasilan Bapak, adalah ketegasan. Bapak cenderung tanpa kompromi dalam menegakkan aturan. Tanpa pandang bulu. Bapak kami lihat terus melakukan monitoring di lapangan, turun langsung di tengah masyarakat, dan segera bertindak begitu melihat ada yang tidak beres.Bapak tak pernah mau mendengar laporan asal bapak senang. Ketegasan BapakWalikota inilah yang kami harapkan dapat menyelesaikan persoalan kami yang sudah sekian lama dirundung keresahan. Kami adalah warga yang sudah lama bermukim di Jl Sidorukun/Sidomulyo Lingkungan XI dan sekitarnya,Kelurahan Pulo Brayan Darat II,Medan Timur. Di lingkungan kami, Pak Wali, tepatnya yang dulu dikenal dengan Jl Sidomulyo persisnya di Nomor 35, 37, dan diduga sedang diperluas ke Nomor 23, yang sebenarnya areal pemukiman, belakangan ini berdiri bangunan gedung yang difungsikan sebagai gudang dan bengkel las yang ditembok tinggi mencapai empat meter atau malah lebih. Bangunan Gudang ini telah meresahkan dan mengganggu kehidupan warga. Polusi suara atau bising,lingkungan yang tidak nyaman (tembok tinggi),udara panas,dan kondisi yang rawan banjir adalah sebagian dampak yang warga rasakan atas keberadaan bangunan ini. Terus terang, kami para warga telah membuat surat pernyataan keberatan yang sudah disampaikan kepada beberapa instansi/aparat terkait, yakni Lurah, Camat, dan tembusannya ke Polsek serta Koramil Medan Timur. Kami warga masyarakat sangat berharap kepada Pak Rahudman untuk melihat langsung laporkan keberatan kami,seperti yang sering Bapak lakukan dengan turun langsung ke lapangan dan tidak hanya menerima laporan asal bapak senang. Kami berharap,Bapak dapat melihat langsung dan membayangkan penderitaan kami dengan adanya bangunan yang kami tidak tau ada atau tidak izinnya. Tapi, dalam kondisi seperti itu, bagaimana mungkin Kota Medan dapat kita ciptakan menjadi selain bersih, juga tertib, aman dan nyaman. Demikian kami sampaikan. Atas perhatian Pak Wali, kami ucapkan terimakasih. Kami sekalilagimendoakan,agarketegasanyangmenjadikarakterWalikotaMedanakanterusmenjadikan Kota Medan lebih baik dari kemarin, dan esok lebih cerah dari hari ini. Hormat Kami, Warga Sidorukun/Sidomulyo Lingkungan XI sekitarnya

Untuk Perhatian Dinas PU Dan PT.KAI Assalamu’alaikum.Wr.Wb. Bapak Gubsu mohon instruksikan pada Dinas PU Provsu dan PJKA untuk secepatnya memperbaiki Infrastruktur Jalinsum & Memperbaiki sambungan jembatan dgn jalinsum serta Memperbaiki sambungan rel kereta api dgn jalan raya. Sambungan jalan dgn rel kereta api yang baik & mulus hanya satu ada diantara kota Lb.Pakam-Perbaungan & sambungan rel dgn jalan ditengah kota Medan banyak dibiarkan rusak, berlubang tidak ada yang baik & sangat membahayakan pengendara kendaraan, mohon kepada, 1. Pihak PJKA segera memperbaiki 6 titik sambungan rel Kereta Api dgn Jalinsum dari Perbaungan Bengkel-Rantau Prapat, karena sangat banyak sambungan rel dgn jalan yang sdh lama dibiarkan belubang, 2.Sambungan rel kereta api dgn jalan dikota Medan yang berlubang & jauh dari kenyamanan, 3.Dinas Perawatan Perbaikan Jalan & Jembatan Pemprovsu agar membenahi sambungan antara jembatan dgn jalinsum dijembatan Sei Ular yg bergelombang & pd beberapa titik antara Pulau Raja-Aek Kanopan berlubang besar, 4.Bapak Gubsu mohon pikirkan kerusakan tersebut, jangan abaikan penderitaan pengendara, karena warga tetap bayar pajak kendaraan yang tiap tahun naik, tetapi kenyamanan dijalan raya sangat jauh dari harapan. Wassalam Ir.Zulkifli AM +628566238659


Dedi Sahputra

Ketidakteraturan—Keadilan Suatu ketika di sebuah hotel di Arizona, Amerika, saya melihat iklan televisi tentang sale laptop murah. Discount harganya cukup menggiurkan, hampir separuh harga. Saya tergiur: Ini bakal jadi oleh-oleh “menawan” dari negeri Paman Sam, bathin saya. Saya jadi lebih berhasrat ketika tahu kalau mall tempat mengobral laptop itu berada persis di depan hotel tempat kami menginap. Maka pagi-pagi sekali, sebelum sempat matahari terbit, saya keluar melihat-lihat situasi di sana. Tetapi pemandangan yang saya lihat kemudian serta merta membatalkan niat saya itu. Di halaman pakir mall yang luasnya mencapai hitungan hektar itu telah berbaris panjang puluhan bahkan ratusan orang, mengekor panjang dari pintu masuk mall, mirip iringiringan semut. Jika saya ikut mengantri, saya mungkin jadi pengantri ke seratus. Sejak dini hari jauh sebelum mall itu dibuka, orang telah pasang jalur antrian di sana.Tujuannya satu: Berburu laptop murah. Meski melibatkan banyak orang dan melibatkan kompetisi memperebutkan barang yang terbatas jumlahnya, tapi antrian terlihat tertib. Maka saya tidak saja urung, tapi sekaligus surprised untuk dua hal. Pertama karena antrian sebegitu banyak orang bisa tetap tertib, kedua.karena ternyata bakat orang Amerika “berebut” barang murah gak beda-beda amat dengan kita. *** Kemarin seorang sahabat menelefon saya. Dia menceritakan betapa menyedihkannya orang-orang yang tewas karena berebut membeli Blackberry itu. Iklan barang mewah yang murah itu telah memancing hasrat ratusan orang secara berlebihan. Sahabat saya ini kemudian mengisahkan tentang orang di kampungnya yang juga punya hasrat yang besar atas kepemilikkan barang mewah serupa handphone. Walau untuk makan sehari-hari susah, tetapi untuk sebuah hanphone harus dibela-belai meski harus mengorbankan gizi makanan harian. “Untuk beli kentang saja mereka harus menggantinya dengan kangkung, karena lebih murah. Kalau hujan, mereka yang buruh tani itu tak bisa kerja, hanya memandangi hanphone barunya karena pulsanya terbatas,‘‘ katanya. Saya jadi teringat ketika pertama kali punya radio transistor yang dibeli ibu dari pasar. Saya senang bukan kepalang. Langit di atas saya serasa lebih lebar dari biasa. Saya buka radio itu dari bungkusnya sambil lantas jungkir balik. Siang malam saya kupingi radio itu, suaranya pun saya stel sampai kandas, sekandas suara saya mengiringi lagu-lagu

dari kotak berantena itu. Saya jadi hapal banyak lagu favorit sehingga saya jadi merasa lebih “gagah“ dibuatnya. Lebih dari itu semua, saya bisa mengimbangi—meski tak benar-benar imbang— suara tape recorder tetangga yang dilengkapi loadspeaker itu. Pinomat, saya punya “senjata“ meski kecil-kecilan. Jadi yakinlah, saya bisa tahu persis bagaimana perasaan si pemilik hanphone baru itu. *** Suatu kekeliruan yang dilakukan berulang-ulang, dia akan dianggap hal lumrah dan pada waktunya akan menjadi sesuatu yang bukan kekeliruan, bahkan suatu keharusan. Begitulah cara kerjanya suatu kesalahan kolektif yang permisif itu terbentuk. Dia menjadi semacam keyakinan dalam benak publik. Berbahayakah ini? Jawabnya sangat berbahaya. Itu sebabnya agama melarang Anda melakukan dosa kecil berulang-ulang. Karena dalam benak Anda akan terbentuk sebuah keyakinan baru. Anda belum jadi pengendara kalau belum melanggar aturan lalu lintas, Anda belum jadi pejabat kalau tidak korupsi, dan Anda tak jadi PNS kalau tak menyuap, Anda belum jadi penguasa kalau belum terima setoran, dan Anda belum jadi bos kalau tak “memijak” orang lain. Begitu juga dalam antrian. Belum sah kalau belum ada yang memotong jalur orang lain. Jadi kalau ada antrian yang tidak ricuh, itu bukan antrian namanya, tapi baris-berbaris. Kalau ada pembagian zakat, pembagian beras miskin, pembagian daging kurban, pembagian BLT, sampai antrian Blackberry semua punya ciri yang sama, berdesakan dan saling berebut. Apakah orang-orang yang berdesakan dan saling berebut itu atau orang memotong jalur kendaraan orang di jalan raya tidak tahu kalau perbuatannya keliru? Jawabnya tahu. Mereka tahu itu salah. Tapi kenapa mereka selalu saja meneruskan kesalahannya itu? Itu karena ada sesuatu yang lebih besar dari pengetahuan tentang kesalahan itu mendesak dalam diri mereka. Itulah dia akumulasi kekesalan, ketidakpuasan atas segala ketidak-seharusandanketidakadilanyangdialami.Kenapa antrian di Arizona itu tertib, itu karena ada keyakinan ada keadilan, tidak ada orang yang leluasa nyerobot. Itulah keyakinan atas keadilan. Tanpa keyakinan itu, maka buruh tani miskin itu bisa nekat beli hanphone baru meski mempertaruhkan seluruh hartanya, tanpa keyakinan itu orang bisa tewas karena antrian Blackberry. Bahkan segala ketidakteraturan bermula dari alpanya keyakinan itu.(Vol.273, 14/12/2011)

Kolom foliopini dapat juga diakses melalui


Pendidikan Karakter Di Keragaman Budaya (Catatan Dari Temu Tahunan Forum Rektor Indonesia) Oleh Nur A. Fadhil Lubis Mengenai ranking PT Indonesia yang sulit masuk kelompok 100 atau 200 besar,agar jangan mengendorkan semangat para penggerak dan penggiat pendidikan negeri ini.


ara rektor perguruan tinggi Indonesia, baik negeri maupun swasta, baru saja selesai melakukan pertemuan tahun 2-4 Desember 2011. Pertemuan kali ini berlangsung di kota Kendari Sulawesi Tenggara, dan Universitas Haluoleo bertindak sebagai tuan rumah. Forum Rektor Indonesia (FRI) merupakan wadah berhimpunnya para pimpinan lembaga pendidikan tinggi di seluruh tanah air yang lahir bersamaan dengan proses reformasi dan diikrarkan berdiri oleh pimpinan perguruan tinggi Indonesia di kampus ITB Bandung pada 7 Nopember 1998. FRI merupakan kekuatan moral dan intelektual serta center of excellence (pusat keunggulan) yang bermaksud ikut berperan aktif, bahkan proaktif, dalam proses pembangunan bangsa dan negara Indonesia dalam rangka mewujudkan cita-cita proklamasi yaitu mewujudkan rakyat Indonesia yang adil, makmur dan cerdas turut serta dalam membangun kemanusiaan yang adil dan beradab. Bersamaan dengan pertemuan FRI yang ke-14 ini, digelar juga perhelatan Konvensi Kampus ke-8. Pihak penyelenggara local masih memeriahkan acara ini dengan mengadakan Expo Kampus dan berbagai acara lainnya. Adalah menarik bahwa FRI tahun menyandang tema yang aktual dan strategis: ‘Restorasi peradaban dimulai dari pendidikan karakter di tengah keragaman budaya dalam memperkuat daya saing bangsa, Daya saing bangsa Hampir semua pembicara dan peserta tampaknya sepakat bahwa negara-bangsa Indonesia sedang menghadapi masalah multi-aspek. Yang terpenting di antaranya adalah krisis moral dan kepercayaan. Berbagai hasil penelitian dibahas dan bermacam ulasan diperbincangkan yang berpuncak pada kekhawatiran atas rusaknya akhlak dan dekadensi moral bangsa. Ini bukan hanya terjadi di kalangan generasi muda, tetapi telah merebak hingga kalangan petinggi negara dan wakil rakyat. Ironisnya seorang peserta menyindir betapa dekadensiitu juga sudah menyebar luas di kalangan pendidikan dan lembaga pendidikan, termasuk pendidikan tinggi. Kekhawatiran ini kian memuncak ketika fenomena ini diletakkan regional dan global pada saat bangsa ini tidak bisa mengelak dari gelombang globalisasi, terutama dengan terbukanya Indonesia bagi kalangan luar yang

kelihatannya lebih siap untuk bersaing keras. Diawalinya masyarakat ASEAN beberapa tahun ke depan juga menghadapkan perguruan tinggi Indonesia untuk bersaing lebih keras, dalam wilayah regional yang sebetulnya Indonesia memiliki banyak potensi kelebihan. Dari sisi ini, posisi ranking PT Indonesia juga sangat memprihatinkan. PT papan kelas atas Indonesia, yang telah berumur cukup tua dan menyerap dana negara dan masyarakat cukup banyak, ternyata bukan saja tidak bisa naik kelas, bahkan hampir semua malah rontok tidak masuk dalam kelompok 100 besar dunia. Di tengah kegalauan tersebut, seorang pembicara tamu asal Australia, Kevin Jones, malah tampil dengan kesimpulan berbeda. Setelah menampilkan hasil survei berbagai sumber ia menampilkan bahwa penampilan Indonesia sejak 2003 hingga saat ini, menunjukkan beberapa aspek yang membaik. Akan terlihat berbeda kalau melihatnya terlalu melebar mencakup negara-negara kelas atas. Di banding negara-negara sejenis, Indonesia memiliki prestasi, memang tidak istimewa, namun membaik. Ini merupakan modal untuk meningkatkan usaha dan menjaga momentum. Mengenai ranking PT Indonesia yang sulit masuk kelompok 100 atau 200 besar, agar jangan mengendorkan semangat para penggerak dan penggiat pendidikan negeri ini. Yang penting terus bekerja untuk meningkatkan kualitas dan kuantitas pendidikan tinggi. Lagi pula, patut dicermati bahwa kriteria penilaian yang digunakan pihak penyelenggara perankingan tersebut memang masih banyak yang menguntungkan negara-negara maju dan Barat-sentris. Sedangkan apa-apa yang dianggap penting dan unggul di kalangan negara berkembang sering tidak masuk penilaian, bahkan dianggap faktor ketertinggalan. Pendidikan karakter Berbagai permasalahan negarabangsa Indonesia berpangkal pada merosotnya akhlak dan rusaknya budi pekerti. Hingga upaya untuk perbaikan dan pembenahan juga harus dimulai dari karakter dan budi pekerti tersebut. Ini harus dilakukan secara serempak, simultan, berkesinambung dan menyeluruh. Namun, kewajiban dunia pendidikan, tidak dapat dielakkan, memang lebih besar. Pendidikan tinggi, sebagai lembaga pendidikan tertinggi dan terakhir, tentu mengemban tugas paling besar. Ini ha-

rus disadari bersama dan mesti menghindari saling menyalahkan. Jangan sampai kalangan PT menyalahkan SLTA, dan SLTA menyudutkan SLTP, pada gilirannya mereka mengkambing-hitamkan pendidikan dasar. Pendidikan dasar kemudian melempar tanggungjawab ke orang tua dan masyarakat, yang akhirnya menyudutkan pemerintah yang tidak becus. Pendidikan budi pekerti harus merupakan proses yang integral bukan saja dalam pendidikan formal, tetapi juga pendidikan informal, bahkan non-formal. Pendidikan karakter bukan saja tanggungjawab sekolah dan guru, tetapi juga kewajiban bersama negara, keluarga dan masyarakat secara menyeluruh. Pendidikan karakter, apapun sebutannya, harus dilaksanakan sejak pendidikan pra-sekolah, pendidikan sekolah, hingga pendidikan luar sekolah. Ia tidak harus dalam bentuk mata pelajaran terpisah, tetapi menjadi bagian integral dari semua komponen kurikulum, tetapi juga dalam kegiatan ko-kurikuler, bahkan ekstra-kurikuler. Bukan hanya guru mata pelajaran PKN atau agama saja yang dibebankan, tetapi semua guru, staf bahkan pengusaha kantin dan petugas keamanan. Keragaman budaya dan restorasi peradaban Apakah peradaban Indonesia sudah rusak? Memang banyak yang berkesimpulan demikian. Yang lebih parah, ada yang beranggapan bahwa sebenarnya ‘peradaban Indonesia’ itu belum pernah ada. Yang ada dalam lembar sejarah adalah bagian atau ci-

kal bakal yang di atasnya berdiri negara-bangsa Indonesia yang memiliki kekayaan budaya yang sangat beragam. Bahwa rakyat Indonesia memiliki budaya yang kaya dan beragam semua orang juga sudah mengetahui dan meyakininya. Namun, apakah keragaman itu suatu faktor yang memecah bangsa atau merupakan aset yang mempererat warga yang perpaduan harmonisnya menjadi modal untuk mewujudkan peradaban yang luhur? Inilah yang belum disepakati sepenuhnya dan belum dilaksanakan seutuhnya. Budaya adalah hasil karya, cita, rasa dan karsa manusia, terutama ketika mereka berkelompok, untuk memenuhi kebutuhan hidupnya. Puncakpuncak dari budaya inilah yang mencuat menjadi peradaban (civilizationhadhari). Hanya bangsa yang besar saja bisa menghasilkan peradaban yang besar pula. Peradaban besar tidak hanya menjadi milik penggagasnya, tetapi ia menjadi khazanah kelompok yang lebih besar, bahkan kemanusiaan. Peradaban Indonesia hanya lahir dan berkembang dengan menghargai semua budaya rakyat Indonesia yang ada secara harmonis, berimbang dan visioner ke depan. Jika pertemuan FRI tahun ini diawali dengan munculnya berbagai kekecewaan, kekhawatiran dan kecemasan bahkan sebagian dalam nada pesimis, maka temu tahunan ini diakhiri tampaknya dengan suasana yang lebih optimis, komitmen yang lebih kuat dan harapan yang lebih cerah. Semoga! Penulis adalah Rektor IAIN Sumatera Utara.

Indonesia Mengajar (Upaya Mencerdaskan Bangsa Di Desa Terpencil) Oleh Haidar P. Daulay Dari sudut pendidikan persoalan mendasar yang dihadapi desa-desa terpencil adalah kekurangan guru.


egiatan dan cita-cita dari Indonesia Mengajar (IM) amat positif. Menurut hemat saya, perlu dibentuk semacam IM di Sumatera Utara. Terkait dengan itu, pada malam Sabtu tanggal 2 Desember Kick Andy menayangkan tiga sosok pengajar muda IM yang telah berkiprah di daerah pedesaan terpencil, yaitu Patria, Rahmat dan Ayu. Mereka membeberkan sebagian kecil pengalaman mereka satu tahun di pedesaan, di Kalimantan (Patria), di Riau kepulauan (Rahmat) dan Maluku Utara (Ayu). Tayangan malam itu menimbulkan ingatan saya lagi untuk membentuk semacam IM di Sumatera Utara. Kegiatan ini adalah menghimpun tenaga-tenaga muda Indonesia terdidik, minimal S1 dengan IPK minimal 3 serta berbagai persaratan lainnya untuk dikirim mengajar selama setahun ke desa-desa terpencil. Tujuan utamanya adalah membantu tenaga-tenaga guru di pedesaan terpencil untuk mengajar. Seterusnya juga mereka diharapkan akan menjadi motivator bagi penduduk desa dan inspirator bagi murid-murid di pedesaan, dengan moto IM “Setahun mengajar seumur hidup menginsipirasi “ Indonesia yang luas dengan penduduk mendekati 250 juta jiwa. Sebagian masih hidup di daerah terpencil, dengan listrik dan sinyal terbatas, fasilitas pembelajaran yang sangat minim. Begitu juga guru yang jauh dari mencukupi, di samping persepsi masyarakat tentang pendidikan yang tidak mendukung. Bagi mereka mungkin lebih berguna memanfatkan tenaga anak-anak mereka membantu

men-cari nafkah ketimbang sekolah berta-hun-tahun. Tantangan seperti inilah agakanya dihadapi anak-anak muda terdidik yang akan mengajar di pede-saan terpencil tersebut. Pekerjaan mulia ini pantas didukung masyarakat dan pemerintah. Karena upaya ini adalah upaya mencerdaskan bangsa sebagai salah satu tujuan terbentuknya negara Republik Indonesia. Mereka yang hidup jauh dari fasilitas memadai, adalah masyarakat lemah dan tak berdaya. Alangkah mulianya bila ada tangan-tangan penolong yang akan membantu mereka menanggulangi masalah pendidikan anak-anak mereka. Desa-desa terpencil dan pendidikan Ribuan pulau yang membentang dari Sabang sampai ke Merauke dengan penduduk keempat terbesar dunia, Indonesia tentu mengalami berbagai permasalahan pendidikan. Di antaranya adalah: pertama, masih banyak desa-desa terpencil sulit dijangkau yang terletak di kepulauan, di huluhulu sungai, di kaki-kaki pegunungan, di pinggir-pinggir pantai. Kondisi demikian menyebabkan masih banyak penduduk yang hidup dengan fasilitas seadanya seperti kurangnya listrik, telefon, air bersih, pendidikan, kesehatan, dan lain-lain. Keterbatasan keterbatasan tersebut sekaligus berpengaruh pula terhadap dunia pendidikan di pedesaan. Dari sudut pendidikan persoalan mendasar yang dihadapi desa-desa terpencil adalah kekurangan guru. Guru pada umumnya menumpuk di kota-kota atau di daerah-daerah yang

mudah dijangkau transportasi. Padahal unsur pokok pendidikan yang paling utama adalah guru. Kalau guru tidak ada atau guru kurang, bagaimana proses belajar mengajar berjalan dengan baik. Kekurangan fasiltas dan media pembelajaran masih bisa di atasi dengan ketersediaan guru, tetapi kalau guru tidak ada atau guru kurang, tidak bisa digantikan oleh apa dan siapapun. Karena itulah program IM untuk mengirim guru-guru ke desa-desa terpencil terbut sangat tepat. Menumbuh solidaritas sosial kebangsaan Melihat kondisi yang sedemikian itu, maka perlu ditumbuhkan semangat kepedulian sosial dari sebagian masyarakat Indonesia yang telah menikmati fasilitas pendidikan yang sekarang hidup di kota- kota. Kepedulian itu dapat diujudkan dalam bentuk: pertama, adanya lembaga yang mengurusi tentang upaya memberikan bantuan kepada masyarakat Indonesia yang belum beruntung dalam dunia pendidikan. Kedua, adanya penyandang dana, tumbuhnya semangat membantu dari orang-orang yang telah diberikan Allah kelebihan rezeki . Ketiga, adanya generasi muda terdidik yang rela hidup di pedesaan dengan fasilitas terbatas guna bertugas sebagai pengajar selama waktu yang telah ditetapkan untuk itu. Dalam hal ini IM telah memiliki ketiga hal tersebut dan telah mereka lakukan kegiatan dimaksud sejak beberapa tahun lalu. Sekarang timbul pertanyaan : Indonesia yang luas dengan jumlah desa terpencil yang tidak sedikit, apakah IM akan mampu menangani itu sendirian? Tentu saja menurut hemat penulis tidak bisa, oleh karena itu semacam IM ini perlu dibentuk di provinsi-provinsi yang memiliki desa-desa terpencil dan tertinggal yang dipelopori oleh

tokoh-tokoh pendidik di daerah tersebut dengan mendapat dukungan pemerintah dan masyarakat . Diasumsikan bahwa desa-desa terpencil itu masih banyak di Sumatera, Kalimantan, Sulawesi, Indonesia bagian Timur sampai ke Irian. Sumatera Utara yang berpenduduk lebih dari 12 juta orang yang tersebar di sejumlah Pemerintahan Kabupaten/Kota, yang sebagiannya masih ada yang tinggal di desa-desa terpencil yang kondisi pendidikannya masih memprihatinkan. Sehubungan dengan itu maka menurut hemat penulis perlu dibentuk lembaga seperti IM di Sumatera Utara ini agar anak-anak bangsa yang berdiam jauh dari jangkauan fasilitas pendidikan yang layak, seperti: kekurangan guru dan sarana serta prasarana pendidikan dapat menikmati pendidikan . Dengan semangat keotonomian daerah perlu digalakkan kepedulian terhadap pendidikan di desa-desa terpencil yang serba kekurangan tersebut. Penutup Apa yang telah dirintis oleh IM , perlu dicontoh. Indonesia yang begitu luas dengan penduduk keempat terbesar dunia, memiliki beban pendidikan yang tidak ringan, karena itu perlu dibangun solidaritas sosial untuk menumbuhkan semangat peduli pendidikan, dengan salah satu upayanya adalah memberi perhatian terhadap anak-anak bangsa yang tinggal di daerah-daerah terpencil. Sehingga mereka dapat menikmati pendidikan. Indonesia yang luas ini juga, tentu tidak bisa dijangkau gerakan Indonesia Mengajar seluruhnya. Karenanya perlu di daerah-daerah untuk membentuk semacam gerkan IM, termasuk di Sumtera Utara. Penulis adalah Ketua Komisi B Dewan Pendidikan Sumatera Utara.

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


: : : : :

Bursa Automotive

Air Condition Ban Radial Central Lock Nippon Denso Double Blower


: : : : :

Power Stearing Power Window Radio Tape Velg Racing Electric Window

MBL CANTIK, LENGKAP. HANYA 87,5JT CHEVROLET BLAZER MONTERA Thn. 2005 Warna hitam metalik, 2200cc. Lengkap: AC, PW, CL, TV/DVD, 5 Ban baru Harga: 87,5Jt (Nego) Hub: MARMAN HP: 0812 6562 845

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000

HYUNDAI GETZ 2003 BK Baru Diperpanjang Wrn. Hitam, 83 Juta, Velg 16, Hub. 0813 9688 7670

SUZUKI Carry, Thn. 86 Alexander, W. Biru, sehat BK Medan VR, Cat mulus, pajak baru. Harga 13,5Jt. Nego. Hub. 0812 6496 881

HONDA Jazz Th. 2004. W. Gold Metalic. AC, Tape, VR, BR, PS, PW, CL, body kaleng mulus seperti baru. Hrg. Nego. Hub. 0813 6233 0595

SUZUKI Carry Adiputro Th. 88/89 dijual cepat. W. Biru metalik, VR, BR, Tape, BK 1 thn lagi. Kondisi sgt mulus. Hub. 0821 6604 1073

ISUZU Panther Th. 2001 Wrn biru, LV, VR, AC. Hrg. 97Jt. Nego. Pem. Hub. HP. 0821 6404 4539

SUZUKI Carry Futura Realvan DRV Dijual Cepat. Th. 95/96 W. Merah metalic. VR, BR, Tape. Kondisi mulus. Hub. 0853 6172 0189

ISUZU Panther Green Royal Plus Thn. 96 W. Merah metalic, AC, DB, Tape, VR, BR, PS, PW, CL, BK Medan asli. Jok kulit. H. Nego. Hub. 061-7633 4272

SUZUKI Carry 88 Biru, Alexander, Velg Racing, Tape, kondisi sehat. Hub. 0813 6135 7361


ISUZU Panther Hi Grade Thn. 94, biru metalik, kondisi mulus, pajak panjang. Harga Rp. 58Jt/Nego. Hub. 0812 6344 5757 TP.

SUZUKI Katana 91 Hijau metalik, AC, Tape, lengkap dengan sound, BK Medan asli, body kaleng mulus dan mesin halus. Pemakai serius Hub. 0852 7630 2013

DAIHATSU Taft Badak 81. 4x4 aktif, siap pakai. Ban Bagus. Twincam 90. Hitam, original. 0853 6077 9299

New Panther Grand Touring Type J, LS, LV, Pick Up, Ready Stock!!, Irit, Kuat, Awet. Terima Tukar Tambah. Semua Merk Info: Astra Isuzu. 061-6844 8554, 0813 7591 5420


DAIHATSU Xenia Th. 2005 Velg Racing, AC, spion miror, power steering, wrn silver. Hrg. 98Jt Nego. Mobil original. HP. 0813 6212 2339


Ready Stock !, DP mulai 18 Jt-an Hub. 0812.653.1129 DAIHATSU Feroza Dijual. Th. 94. Warna hitam, ban cangkol, plat BL, pajak hidup. Siap pakai. Harga 37Jt/ Nego. Hub. 0812 8621 4177


Terios Pick Up New Xenia Minibus Luxio Sirion Dapatkan juga Undian total 5 Milyar Pesan sekarang di nomor: 0813 6237 8733 (Virton Astra)

DAIHATSU PAKET RINGAN - All New Xenia DP 20Jt-an...........Angs. 3 Jt-an - Pick Up Gran Max DP 10 Jt-an....Angs. 2 Jt-an -Terios DP 25 Jt-an.........................Angs. 4 Jt-an Mobil 100% Baru, Proses Cepat & Data Dijemput Di rmh Hub. TEDDY CAPELLA 0812 6356 56/77884663





Sportage, Pregio, Picanto Cosmo Ready Stock DP Ringan, Bunga Rendah, Garansi 5 thn. Bisa Tukar Tambah Hub. 0852 7691 0079




MITSUBISHI L300 Minibus Th. 97 W. Putih metalic, AC, Tape, BR, BK Medan Full 1 thn. body lempang. Jamin mulus Hub. 0852 6129 5788


Discount Kandas, Proses Cepat LINA.S

0812 6947 2909

PROMO MITSUBISHI DP RENDAH Angsuran Murah Diskon Kandas. Pajero Sport, Strada Triton T120, L300, Colt Diesel dan Fuso. Hub: Ayub Supriadi Meliala - 0813 9773 2729 - 0853 5923 2999 - 0857 6088 4398


# PROMO AKHIR TAHUN DAIHATSU # Ready Stock New Pick Up - Terios - All New Xenia -Luxio - Proses Cepat & DP Ringan, Bunga Rendah - Pesan segera ke Ahmad Arif Nasution 0812 6005 2465 NB: Simpan No. Ini sewaktu2 berguna

Unit Ready Stock: Grand Livina, March, X-Trail, Serena, Teana, Elgrand, Indent Juke. Proses Cepat. DP & Bunga Ringan. Bisa Nego. Hub. Wandi 0813 6140 0058 - 061.77709408

Promo Daihatsu, All New Xenia. Luxio, Terios, Ready Stock. Hub. Daud Astra 0812 6362 4634

OPEL Blazer Lt. Injection Biru gelap Thn. 97 Sgt orisinil, Asli Medan, jarang ada kondisi mobil sebagus ini. Hrg. 53Jt. Nego. Abiss. Hub. 0812 6477 7088


OPEL Blazer, Thn. 97 W. Silver lengkap. Sehat, siap pakai. Harga 47 Jt Nego. Hub. 0812 6496 881


Terios Angs. 3,6Jt-an Minibus Luxio, Sirion Pick Up Angs 2,3Jtan Adek Astra: 081 263 400 55, PIN: 274CA61C

SUZUKI Real Van Thn. 95. Hijau metalik, kondisi mulus, harga Rp. 42Jt/Nego. Hub. 0853 6230 0613 TP. SUZUKI Baleno Hijau met Th. 97, mesin sehat, complit, mulus luar dalam, siap pakai. Hrg. 65Jt Nego. Hub. 0821 6246 7871

TOYOTA Kijang Dijual. Jantan, Thn. 91 BK Medan, AC, Tape, Velg Racing. Wrn Hijau. Hrg. 43Juta. Hub. 0813 6101 8855

9 CM Rp. 126.000 10 CM Rp. 140.000


TOYOTA Kijang Capsul LSX Th. 2001 W. Gold metalic. AC DB, Tape, VR, BR, PS, CL, BK Medan. Body kaleng. Mulus seperti baru. H. Nego. Hub. 0813 7582 3555

TOYOTA Corona Twin Cam 91 AC, VR, CL, W. Blue metalic. Hub. 0813 7012 7279, 0878 9216 6427

TOYOTA LGX Capsul Thn. 2000 Dijual. Diesel, biru metalik. Pemakai langsung, tidak pake perantara. Hub. 0811 6006 888 / 0813 7597 7197

PW, VR, CL, Plat BK A/n. sendiri, Asuransi Allrisk, Bisa over kredit Hub. (061) 9131.5123

TOYOTA Avanza 2006 Type G Silver mulus, siap pakai Rp. 125Jt/damai. Hub. 0856 6224 223 / 0813 7695 5180

TOYOTA Kijang Capsul Solar Th. 97 Model Sudah LGX New Solar 2004 luar dalam, VR, BR, PS, PW, CL, RMT, E. Miror, AC DB, Full Sound Sistem, pake TV, Wrn Hitam met, Hrg. 110Jt. Nego. Hub. 061.6967 9753

TOYOTA Kijang Capsul LSX Thn. 2000. Warna hijau metalik, Harga Rp. 90Jt. Hubungi Pak Mey HP. 0813 7672 1582 Jl. HM Said No. 112 Kp. Durian Medan.

TOYOTA Avanza Type G 2009, warna hitam original, A/n. Saya sendiri. Hub. 0811 648358 TOYOTA Fortuner G Solar Th. ‘08, Manual, wrn grey/abu2 metalik. Balik DP Rp. 117Jt. sdh byr 21 kali, per bln Rp. 8.868.000. Pelunasan Rp. 205Jt. Mbl ctk sekali. 1 tangan dari baru Jl. SM. Raja No. 200 Kembar Ponsel (Depan UISU). 0811 613 107 / 7851402

TOYOTA Kijang LSX Bensin Th. ‘97 W. Biru met. Hrg. 92Jt Nego. Suzuki Baleno Th. 2001 metik W. Silver. Hrg. 73Jt. Nego. HP. 0852 7650 6242

TOYOTA Avanza G Th. 2005 BK Mdn W. Biru, siap pakai Hrg. 118Jt Nego. HP. 0811 652506 TOYOTA Fortuner Bensin Th. ‘06, matic, wrn hitam metalik, mbl mulus, 1 tangan dari baru, Rp. 250Jt. Kembar Ponsel Jl. SM. Raja No. 200 (depan UISU). 0821 6767 7000

TOYOTA Innova G Bensin 2005 Dijual. Warna Green Light BK Medan, pajak panjang. Nama sendiri. HP. 0811 65 4880

TOYOTA Kijang Super Commando Thn. 94 W. Biru metalic. AC, Tape, VR, BR, BK Full 1 tahun. Body lempang. Jamin mulus, H. Nego. Hub. 061-7760 9041




Hub. BENGKEL “SUTRISNO” Specialist PINTU MOBIL Jl. Sutrisno No. 240 B Dari Jl. Thamrin belok kiri +/- 200m

BURSA BUTUH DANA BUTUH D AN A DAN ANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 H P P.. 0853.6199.1500-0816 314 1807


Jaminan: SHM, SK Camat, HGB dan BPKB (Bantu Pelunasan BPKB). 3 Jam Cair 1 Juta - 500Juta. Hub. FAMILY FINANCE. 0813 7044 6668 - 0813 7044 6633



Pelanggan Yang Terhormat

TOYOTA Kijang Grand Extra Thn. 92 Akhir. W. Hijau met, BK Mdn pnjg. AC DB, Tape, VR, BR, PS, PW, CL. Remot, Mulus, original dijual cepat. BU. Hub. HP. 0852 7600 8094 Mdn.

TOYOTA BARU 100% Ready Stock: Innova G. Hitam/Silver, Avanza, Yaris, Rush, Fortuner, Dapatkan DP 10% dan Discount menarik. Bisa Tukar Tambah. Hub. 0813 6120 1719/6878 3325

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila anda ingin produk anda, dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih

TOYOTA Kijang G Thn. 1994 Abu2, AC, Velg, Sound, Power mulus. Jual Cepat. Khusus pemakai hub. 0852 96 36 3212

TOYOTA AVANZA 2005 Silver mulus, Telp. 414 2161

11 CM Rp. 165.000 12 CM Rp. 180.000

Kamis, 8 Desember 2011

ALAT MUSIK DIJUAL 2nd OBRAL EQ Hasley USA 150z (1.5) Furman 60ch (2.0) 30ch (1.5) Dod 60ch USA (2.0) 30ch (1.5) USA. 430 USA (1.250) 1 set BMB DA J7 (c) SPK 10” BMB asli (4.0) Power: Jepan Fostex 600w (2.0) Das 800 W. USA (3,5) Yamaha Revert (1.5) terima Visa 0% Jl. Wahidin Gg. Sp. Kijang - 76850902 Jl. Indragiri 25-061-7345487


(Menjual Laptop Seken Bergaransi) 0821 6868 5346



TV LCD 32” 22 LG= 1,8jt. 32”LCD/LG=3,2JT, 42” LCD Samsung=3,5Jt, 34 Sony = 2 Jt, 29” Flat Baru LG =2 Jt, 29” Bekas 900rb - 1,7 Jt. 14 - 21=300rb - 650rb, 17” LCD Monitor 1Jt, 22”=1,5jt. PS1=400rb, PS 2=800rb, DVD 200rb, Vortable = 700rb. Ampli Gitar=700rb, Sansui Technics-SU 7600 Spk. BMB= 1,45 Jt - EQ - TV Mobil=500rb



Handicam Sony Hi-8=1Jt, Mini DV=2Jt, DVD/HDD=3Jt, Camera 5 Mp - 12 Mp 500rb - 1,2Jt. Fax= 600rb, LCD Projector, Printer HP=450rb, Epson =3Jt.

BPKB Spd. Motor Yamaha BK 6593 SI a/n. SAMIN. Alamat: Jl. Industri No. 68 DS. T. Morawa D/S.


BPKB Mobil Xenia BK 1079 TL. a/n. Robensius Sembiring. Alamat Jl. Sutomo No. 7. Sambu Dolok Simalingkar.


UD. SENANG HATI Hub. 4517509 - 0821 6322 4343 (Jual - Beli) Jl. Sekip 67 A





Mulai TOSHIBA, ACER, HP, DELL, LENOVO, Merk terkenal Rp. Kwalitas oke, Desain mantap, Tahan Lama, terjamin & Digaransi, Dapatkan barangnya skrg juga, banjir bonus & Hadiah utk Pembelian hari ini tanpa syarat. Hubungi & Miliki Segera di Jutaan

* Millenium Plaza: 0813 7071 1319 * Siantar Plaza : 081396507030 * Aksara Plaza : 0819 720 2153 * Binjai Supermall : 081397963020


Harga Mulai Merk terkenal sudah tidak diragukan lagi Rp.

kwalitasnya Sudah lama teruji, Terjamin & Digaransi Kunjungi dan Miliki Segera di Pameran kami di:

* Medan Mall Lt. Dasar : 0812 6455 7274 * Deli Mas L. Pajam : 0821 6087 3210 * Pajus USU : 0853 6049 2888 * Millenium Suzuki : 0812 8882 1068






ELEKTRONIK REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 082163120894 Siap Ketempat

Cuci + B. Pasang Kulkas, Dispenser Hub. MAJU TEKNIK 0813 6244 4913

Nama : SUHARDI SUKRI Umur : +/- 63 Tahun Alamat: Jl. Indrapura No. 27 Bagi yang mengetahui keberadaannya mohon diinformasikan kepada

Kurniawan 0831 9957 5488

TEL. (061) 4155678 TEL. (061) 7350 777 TEL. (061) 4555 928





845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F




DIJUAL MURAH 10 Unit Mesin pembuat tusuk Sate / Sumpit/Tusuk roti, dll. Hub. 0812 6500 293 - 0853 7301 7869 DIJUAL GENSET BEKAS MERK

CATERPILLAR dg berbagai kapasitas dari 100-1800 kVA. Hubungi: Donny 0812 917 9564 Kondisi 90% bagus. (





Setiap Sabtu & Minggu: 3, 4, 10, 11, 17 dan 18 Des. 2011 Dapatkan: Oli Saringan Oli Busi Discount Spare Part








Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

(NB: Syarat & Ketentuan Berlaku)


Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866

Ekonomi & Bisnis

WASPADA Kamis 8 Desember 2011


Dua Minggu Lagi Stok Premium Habis JAKARTA (Waspada): Kementerian Energi dan Sumber Daya Mineral (ESDM) menegaskan kuota Bahan Bakar Minyak (BBM) bersubsidi sebesar 40,49 kiloliter (kl) dipastikan habis dua minggu lagi. “Kelihatannya dengan kuota sekarang akan habis minggu ke3 Desember,” ung-kap Dirjen Migas ESDM Evita Legowo kala ditemui dalam acara pengumuman pemenang lelang di Plaza Centris, Jakarta, Rabu (7/12). Menurutnya, masalah ini akan dibawanya pada Dewan Perwakilan Rakyat (DPR) dan Badan Pemeriksa Keuangan (BPK) selaku auditor, terkait bobolnya kuota BBM bersubsidi. “Kita akan konsultasi juga dengan DPR dan auditor, kelihatannya enggak akan cukup ini. Tapi sekarang kita masih punya sampai minggu ketiga Desember. Sebelum minggu ketiga kita akan konsultasi,” tegasnya. Meski begitu, Evita menga-

kuikonsultasitersebuttidakharus dalam rapat kerja yang sesuai dengan UU APBN 2011. Untuk itu, lanjut Evita, pihaknya akan menambah kuota antara 500 ribu hingga satu juta kl, guna menambal bobolnya kuota tersebut. “Kami akan konsultasi karena pada dasarnya dimungkinkan untuk tambahan kuota. Tambahannya antara 500 ribu kl atau satu juta sesuai kekurangannya. Kira-kira antara itu tapi sekarang masih ada s a m p a i m i n g g u k e t i g a ,” ungkapnya. Badan Pengatur Hilir Minyak dan Gas Bumi (BPH Migas) dan Pertamina akan melakukan pengetatandistribusibahanbakar minyak (BBM) subsidi seiring dengan terus menipis-nya kuota

dan dikhawatirkan akan habis sebelum 2011 usai. Kepala BPH Migas Tubagus Haryono menjelaskan saat ini kebutuhanmasyarakatterha-dap BBM subsidi cukup tinggi sehingga BPH Migas dan Pertamina berupaya keras mengatur agar over kuota tidak terlampau tinggi. “Perkiraan over kuota 1,4 juta kiloliter menjadi 41,68 juta KL, saya berharap angka itu tak tercapai,” kata Tubagus saat ditemui di Kementerian ESDM, Jakarta, belum lama ini. Menurut dia, BPH Migas dan Pertamina akan berusaha keras menekan konsumsi da-lam satu bulanpenghujungta-hunini.Sisa kuota BBM ber-subsidi tinggal sedikit karena ter-jadi over kuota di November yang disebabkan permintaan masyarakat cukup tinggi. Per-mintaan premium naik 8 persen dan solar 6 persen karena terjadi pertumbuhan kendaraan bermotor 19,12 persen. BPH Migas akan menyeleksi dan tidak langsung menyetujui persetujuan permintaan BBM

Durian Banjiri Blangkejeren BLANGKEJEREN ( Waspada) : Kota Blangkejeren sejak sebulan terakhir dibanjiri buah durian yang menjamur di seluruh sudut kota strategis. Kendati begitu, harga jual tidak turun karena animo beli masyarakat masih tinggi. Amatan Waspada, Selasa (6/12) sore, lokasi yang sering mangkal pedagang durian musiman itu terlihat dibeberapa titik lokasi Kota Blangkejeren, antara lain, simpang tugu, depan pendopo Bupati, simpang Rikit Gaib, simpang Kutapanjang, ujung jembatan Penampaan dan Pasar Centong. Terdapat hingga enam lokasi dan diperkirakan stok durian rata - rata mencapai ribuan buah per titik. Bahkan menurut pengakuan beberapa pedagang musi-



Jaga anak atau mau jadi PRT tinggal pilih !!! Gaji Rp. 700 Rb/ bln bersih Hub. 0821.6552.4355 di Medan


man ini mereka membuka lapaknya hingga larut malam. Saidi, salah satu dari pedagang dadakan menguraikan, durian yang diperdagangkan berasal dari Kabupaten Aceh Tenggara dan Kecamatan Putri Betung. Harga buah paling besar berkisar Rp35 ribu – Rp40 ribu per buah, harga standar Rp10 ribu – Rp15 ribu per buah, dan ada yang dijual satu tum-pukan Rp60 ribu dengan jumlah tujuh buah. Membanjirnya buah durian di Blangkejeren, Gayo Lues itu membuat suasana menjadi semarak. Puluhan bahkan ratusan warga setiap harinya membeli buah berduri itu. Kondisi ini membuat puluhan pedagang durian meraup keuntungan lumayan, karena banyaknya konsumen yang membeli. RUMAH dijual Jl. Setia Budi Pondok Surya (Jl. Karya Sei Agul), Uk. 7,5x16mtr, SHM 3 K T , 2 K M , R p . 3 5 0 J t / n e g o H P. 0856.6224.223 - 0812.6056.6356 RUMAH Baru siap minimalis di Jl. Bromo Lr. Setuju Carpot Gypsum Genteng Metal, 2 KT, 2 KM, Rp. 175 Jt Hub. 0812.652.9561 - 0852.6263.5885


Dibutuhkan beberapa Pegawai ditempatkan di Bengkel Baut, syarat: - Pria max. 35 tahun - Rajin, jujur, ulet, disiplin

Kost ekslusife karyawan/ti Jl.Laksana No. 102, Lokasi strategis (±500m dari Yuki S.Raya/ Amaliun Foodcort) Hub. 0811.631.234 - 0813.6221.3622 - 736.4014


Wanita muslim, Rp. 250.000/ bln, Jl. B. Katamso dpn Suzuya Hub. 0813.6244.4913

Hubungi: Setiawan 0819.2021.0096 (061) 7628.1161 Alamat Jl. Asia

PERUSAHAAN AMERIKA Membutuhkan orang-orang dinamis dan bermotivasi tinggi sebagai: KONSULTAN INDEPENDENT (P/F/ 5 - 10 Juta) Serius hubungi: Tengku Rahmah S.Ag 0812.6056.2302 Yanuarlin Lubis, SE 0812.6477.875



Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik RUMAH Jl. Aluminium I Krakatau dkt Maju bersama Keramik, 2 KT, 2 KM, Hrg Rp. 165 Jt Hub. 0856.6224.223 0821.6603.3261


Jl. Flamboyan I/1 No. 25 Komplek Pemda Tk. II Medan, Luas Tanah 412m², Kamar 5, Kamar Mandi 3, Garasi mobil, Telp Hub. 0852.1330.1438 Harga 750 Juta


1 unit Rumah Perum. Taman Budi Luhur di Jl. Budi Luhur Kav. 7, LT. 8x13m, Rmh Tipe 70, KT 3, KM 2, Dpr, RT, R. Kg, PLN, PAM, SHM, Rumah baru, Siap huni Peminat langsung hub. 0813.7016.0474




Sedang dibangun 11 pintu ruko di Jalan Mandor No. 23 Simp. Krakatau, LB.4x16m, Row 6 meter, SHM, PLN, PAM, Pintu plat, Full keramik, Cocok untuk usaha Praktek Dokter/ Toko HP & Warnet, H. 550 Jt, KPR/ bulan 6 Juta, Bisa bantu KPR, 2 Tkt, Siap huni/ Full keramik, Komplek 450 Jt, Sisa 8 Unit

Hub. 7772.2123 - 7759.8123 HP. 081.165.1123

Permintaan buah durian di Blangkejeren kini tergolong tinggi. Pengakuan Saidi dalam sehari bisa melepas hingga 150200 buah. Selain itu, harga buah dilepas-pun bervariasi, kecuali durian asal Kecamatan Pining, Gayo Lues, biasanya buah ini tergolong mahal, disebabkan rasanya lebih enak ketimbang durian asal Kutacane. Mengapa durian asal Pining kurangnya minat pembeli, selain harganya mahal dan rasanya enak, kondisi durian ini rata-rata kecil sedikit isi. “ Biasa-nya durian Pining ukuran 1 kg dijual Rp20.000, sedangkan durian asal Kutacane ukuran dua kg dijual Rp10.000, perbedaannya mencapai setengah harga, konsumen tidak terlalu membandingkan rasa, yang penting harga murah, bisa menikmati,” tutur Saidi. (cjs)


Investasi menguntungkan Uk. 6x16m², Cash Rp. 18 Jt/nego, Bisa kredit (18 bln), Jln 4 mtr, SHM, Lokasi berbatas langsung dgn Komp. Johar Mencirim Indah Jl. Pala Sei Mencirim Sunggal Hub. 0853.7176.5677 - 0813.6112.2791 0821.7397.9098




pihak BTN untuk pembiayaan perumahan atau properti. “Bank BTN akan mengagunkan tagihan KPRkepadakreditursampaijatuh tempo pinjaman. Selama pinjamanberlangsung,BTNtetap mengelola admins-trasi KPR seperti proses pena-gihan dan pembayaran ang-suran,” jelas Iqbal. Jahja mengatakan pihaknya melakukan sinergi dengan BTN dikarenakan kebutuhan masyarakat akan perumahan yang layak setiap tahun terus meningkat. “Makanya kita sangat mendukung kerjasama dengan BTN. Ini juga salah satu komit-


Izin Usaha: 503/1099.SK.HO/SL/NT/08


Penerbangan Via Singapore * Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis * Seluruh Jamaah Tertanggung ASURANSI

DAFTAR SEGERA Kantor Pusat: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4 / 18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488





Berpengalaman professional

1. Umroh Reguler 9Hr, dan 2 Minggu/ 13hari 2. Umroh dan Arbain di Madinah 3. Umroh Plus Mesir 4. Umroh Plus Turkey 5. Umroh Plus Jordan Aqsha 6. Umroh Plus India Kashmir 7. Umroh Plus Dubai PEMBUKAAN MANASIK HAJI DILAKSANAKAN PADA FEBRUARI 2012 DAFTARKAN SEGERA KE:

KANTOR PUSAT MULTAZAM MEDAN JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING TELP. (061) 457.6116 - 7731.3385 HP. 0812.6495.8456 - 0813.6137.2321 - 0812.6481.828










Daerah Seunebok Pidie - Aceh Timur Hak Milik, 10 Kolam 8,6 Ha Hub. 0852.6207.1193 KAVLING

JAKARTA (Waspada): Bank Tabungan Negara (BTN) Tbk, mengagunkan aset Kredit Pemilikan Rumah (KPR)-nya kepada Bank Central Asia (BCA) Tbk senilai Rp2 triliun yang akan digunakan untuk perluasan pembiayaan perumahan. “Pinjaman Rp2 triliun dari BCA, bisa kita salurkan untuk 70 ribu debitur BTN yang ingin memilikirumah,”kataDirutBank BTNN Iqbal Latanro se-usai penandatanganan kerja-sama pinjaman dengan Presdir Bank BCA Jahja Setiaatmadja di Jakarta, Rabu (7/12). Menurutnya, dana dari hasil kerjasama ini akan digunakan







Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

Jalan Denai samping Gg. Setia, ±50m dari Simpang Mandala, Uk. 5x16m, 3 Tkt, Hal muka, Rolen 8m, Hal

Refleksi Kaki & Terapi Thai Shatsu Plaza Medan Fair Lt. III No. 22 (Samping Electronic City)


Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke


Ingin Promosikan Produk Anda Harian

Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I

Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Te l p. ( 0 7 6 1 ) 4 5 3 6 8 H P. 0 8 1 2 . 6 5 6 . 8 7 0 0 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai

Telp. 414.0252

Media yang Tepat untuk Iklan Anda

Hub HP. 0812.6529.4000, TP


- Tenaga terapist yang berpengalaman diatas 8 tahun - Tersedia minuman bandrek secara gratis - 10 kali terapi gratis 1 kali


belakang 4M, Full keramik

Kopi Sumut,Aceh Baru 10 Persen Tersertifikasi MEDAN (Waspada): Farmers Training Center (FTC) atau pusat pelatihan petani kopi resmi dibuka di Desa Simpang Bage, Nagori Sinar Naga Mariah, Kecamatan Pamatang Silimahuta, Kabupaten Simalungun pada Selasa (6/12) pagi. Peres-

BTN Agunkan Aset Ke BCA Rp2 T





LAPTOP MENGEDEPANKAN FESYEN: Director Consumer Business Lenovo Indonesia Gunawan Halim (kiri) dan Brand Ambassador Lenovo For ThoseWho Do Leny Agustin, mengoperasikan laptop IdeaPad U300s Ultrabook yang diluncurkan, di Jakarta, Rabu (7/12). Laptop yang didesain untuk konsumen yang berorientasi fesyen.


TANAH Lokasi Gd. Johor Psr. V, Uk. 30x20m, Gg. Permata (samping Da’rul Ilmi/ Pesantren) Harga 95 Jt Hub. 0852.6134.0601

yang diajukan pemerintah daerah. Ia menilai selama ini pemda mengajukan permintaan kuota BBM melebihi kebutuhan sebenarnya di daerah. “Misalnya kebutuhan di daerah 15, tapi mintanya 20 maka kami distribusikan 15,” katanya. Dia meminta agar masyarakat tidak perlu panik dengan semakin menipisnya kuota BBM subsidi sehingga tidak akan ada panic buying yang menimbulkan kelangkaan BBM subsidi. Wakil Presiden Komunikasi Korporat Pertamina, Mochamad Harun menjelaskan jika Pertamina tidak melakukan pengkitiranmakaoverkuotaakan lebih besar.Tingginya kon-sumsi BBM subsidi ini diakibat-kan banyaknya penyalahguna-an BBM subsidi di daerah pertambangan seperti Kalimantan dan Sumatera. “Waktu awal kami minta volume 42 juta KL tapi disuruh 38,5 juta KL karena ada program pengendalian. Hingga ditam-bah menjadi 40,49 juta KL. Na-mun pengendalian tidak berja-lan, masalahnya kebutuhan masyarakat terus naik,” katanya. (vvn/okz)

SPECIALIST MATA TANPA OPERASI Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll Khusus yg mau masuk angkatan minus jarak pandang ± 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web:




men kita dalam memberikan pelayanan terbaik kepada masyarakat,” ujarnya. Iqbal menambahkan pinjaman tersebut merupakan pimbiayaan jangka menengah bagi KPR dan menciptakan satu mekanisme dalam mengatasi masalah maturity mistmach pembiayaan KPR. “Kerjasama ini membawa dampak positif dalam mendukung program pembiayaan perumahan nasional,” tegasnya.(j03)

mian pusat pelatihan petani kopi ini merupakan hasil kerja-sama International Finance Corporation (IFC) grup Bank Dunia dengan PT Indo Cafco, anak perusahaan kopi internasional Ecom Agroindustrial Corporation. Berdirinya pusat pelatihan ini menurut Manager PT Indo Cafco Nick Watson bertujuan untuk mentransfer pengetahuan kepada petani sehingga petani dapat meningkatkan taraf hidup. Selain itu, untuk menjawabtuntutankonsumerakancita rasa kopi yang berkualitas. “Sikap yang diambil Ecom terhadap kebijakan pemerintah, tetap mematuhi apapun kebijakan pemerintah. Fokusnya bagaimana hubungan dengan petani tetap terjaga,” tutur Nick. Mendapatkan sertifikasi internasional juga merupakan tujuan dilangsungkannya pelatihan kepada petani di Sumatera Utara dan Aceh. Sertifikasi internasional tersebut seperti UTZ, Rainfor-

est Alliance dan C.A.F.E, sertifikasi dari Starbucks juga menjadi ukuran kopi petani lokal layak dipasarkan di Amerika, Jepang dan Swiss. Sementara itu, dari 70.000 hektar lahan kopi di Sumut dan Aceh hanya 7000 hektar baru tersertifikasi. “Di Indonesia baru 12 perusahaan yang disertifikasi. Sementara itu di Sumut dan Aceh dari total lahan pertanian sebesar 70.000 hektar baru 7.000 hektar yang disertifikasi atau 10 persen. Kopi yang belum diser-tifikasi dipasarkan ke Singapura, Jepang dan pasar lokal,” tutur Zaenudin, Consultant Agribisnis International, IFC. Operation Officer IFC, Rahmad Syakib, pelatihan yang diberikankepadapetanidilakukan dengan tiga cara. Pertama, meningkatkan produktivitas petani dan mutu kopi. Kedua, menghubungkan petani dengan pasar yang bersertifikat dan rantai distribusi yang pendek dengan membuatmesinprosesorsendiri. (cag)

Elpiji 3 Kg Di Bireuen Dijual Di Atas HET BIREUEN ( Waspada): Harga elpiji ukuran 3 kg di kabupaten Bireuen sekarang masih di atas Harga Eceran Tetap (HET ) yang pernah ditetapkan Gubernur Aceh belum lama ini. Sehingga warga mempertanyakan hal tersebut karena harganya Rp20 ribu per tabung. Sedangkan HET ditetapkan Gubernur Aceh untuk wilayah yang jarak dari Stasiun Pengisian Bahan Bakar Elpiji (SPBBE) maksimum 60 km harus dijual Rp15 ribu per tabung. Namun, di atas 60 km jaraknya dengan SPBE boleh dijual diatas HET. Informasi diperoleh Waspada Selasa (6/12), sejumlah ibu rumah tangga mengaku berat membeli gas elpiji ukuran 3 kg, karena setahu mereka harganya Rp15 ribu per tabung. Namun mereka harus membelinya de-ngan harga Rp20 ribu. Padahal kios yang mereka beli itu belum sampai

60 Km dari SPBBE. “Saya merasa berat kalau harus membeli gas elpiji ukuran 3 kg dengan harga Rp20 ribu per tabung,” kata Maryati seorang ibu rumah tangga di Bireuen. Penuturan sama juga dikatakan Zubaidah,45, pemilik warung di Kota Bireuen. “Saya selaku pedagang terasa berat membeli elpiji 3 kg dengan harga Rp20 ribu. Kami berharap kepada pemerintah menertibkan agen atau pedagang yang menjual Elpiji diatas harga HET yang ditetapkan Bapak Gubernur belum lama ini,” tegasnya Sementara itu, Mukhlis seorang pedagang pengecer elpiji di Bireuen ditemui secara terpisah mengatakan, terpaksa menjual elpiji 3 kg dengan harga Rp20.000, karena menebus dari distributor satu tabung kecil itu mencapai Rp17.000-Rp18.000 per tabung. “Kami pedagang ini menjual lebih Rp2.000 per tabung dari harga tebusnya.,

Contohnya kalau kami tebus Rp16.000 per tabung, maka kami jual Rp18.000, begitu seterusnya,” jelas dia. Mulyadi, seorang pekerja di salah satu pangkalan elpiji di Kecamatan Peusangan, mengaku menjual Rp16.000 per tabung. “Saya jual satu tabung Rp16 ribu,” katanya singkat. Kadis Perindagkop dan UKM Bireuen, Asnawi melalui Kabid Pelayanan dan Perlindungan Konsumen, Die Palar kepada wartawan mengatakan, terhadap persoalan tersebut pihaknya belum bisa mengambil tindakan. Pasalnya, hingga kemarin belum menerima surat tentang penetapan HET elpiji 3 kg dari provinsi.“Sampaihariini(kemarinred) kami belum menerima surat penetapan HET dari Provinsi, jadi kami belum bisa mengambil tindakan kepada pedagang yang menjual di atas HET,” katanya singkat. (cb02)

Alang Sari Tembus Penjualan 100 Juta Saset JAKARTA (Waspada): Hingga saat ini produk jenis minuman AlangSarisecaranasionalberhasil menembus angka 100 juta saset per tahun, sementara pangsa pasar jenis minuman ini masih memiliki peluang pasar , mengingat sejauh ini hanya ada dua pema-in besar yang memproduksijenisminumanini. Demikian disampaikan Produk Manager Alang Sari Plus dari PT Sidomuncul Linawati Suteja disela-sela peluncuran produk Alang Sari Plus, di Jakarta baru-baru ini. “Meski pe-main baru, produk minuman untuk panas dalam ini kami harapkan mampu menguasai 30 persen pangsapasarminum-aninisecara nasional,” katanya.

Produk terbaru dari Sidomuncul yang selama ini lebih terkenal dengan prodiu herbal Tolak Angin dan minuman energi Kuku Bima Energi , Alang Sari Plus dilengkapi dengan sari cincau hijau dan sari akar alang-alang merupakan perpaduan yang tepat untuk meredakan panas dalam. Selain itu, menurut Lina, dalam Alang Sari Plus dengan bintang iklannya Soimah , terdapat akar alang-alang yang mengandung cylindol A sebagai aktivitas anti radang dan penghilang rasa sakit yang memiliki khasiat menghambat agregasi trombosit serta memperlancar peredaran darah. Sedangkan cincau hijau mengandung klo-

rofil yang berfungsi sebagai anti oksidan dan anti peradangan. Pada kesempatan yang sama Direktur Utama PT Sido-muncul Irwan Hidayar mengu-tarakan dengan diluncurkannya produk baru ini, diharapkan akan mampu menaikkan omzet penjualan secara keseluruhan , dengan bertambahnya omzer akan dapat membantu sesama yang memerlukan. Perusahaan yang satu ini tercatat baru saja menyelesaikan operasi mata katarak yang ke 6000 bagi penderita secara gratis. Tahun depan pelaksanaan operasi mata katarak secara gratis akan ditingkatkan PT Sidomuncul jadi 12.000 mata penderita katarak, katanya. (rel)




PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188


Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188




DIRUT Sidomuncul Irwan Hidaya ikut dalam proses peluncuran Alang Sari di Jakarta.

Ekonomi & Bisnis


Ikuti Mekanisme Pasar BANK Indonesia (BI) saat ini memang sudah menurunPerbankan, selain kan suku bunga Bank Indomengajukan rencana nesia (SBI) atau BI rate dari bisnis bank, mereka 6,5 persen menjadi 6 persen melaporkan suku bunga sejak November 2011 lalu. dasar kredit. Suku bunga Penurunan tersebut dilakudasar kredit itu dipantau kan BI mekanisme pasar yang oleh pengawas bank, terjadi saat ini dan perkiraan bagaimana laporan inflasi tahun depan yang mereka perbulan, apakah stabil. suku bunga itu wajar, atau menunjukkan trend “BI memutuskan untuk penurunan menurunkan BI rate sebesar 50 basis poin menjadi 6 perMikael Budisatrio Kabid Ekonomi dan Moneter BI sen. Penurunan BI rate itu mengikuti perkembangan mekanisme pasar dan sejalan dengan bunga itu wajar, atau menunjukkan trend tekanan inflasi ke depan yang semakin penurunan,” jelasnya. rendah,” kata Kepala Bidang Ekonomi dan Mikael menyebutkan, tidak ada keharusMoneter Bank Indonesia (BI) Regional an untuk menurunkan bunga, yang namaSumut-Aceh Mikael Budisatrio, kepada nya suku bunga, mekanismenya adalah paWaspada Rabu (7/12). sar. Karena BI tidak punya otoritas me-nenDia mengatakan, penurunan BI rate ini tukan suku bunga atau mengharuskan bank berdampak positif ke bursa saham dan menurunkan bunga. Tetap BI akan lebih ekonomi Indonesia karena penurunan suku memonitor, apakah bank sudah menubunga berdampak stimulatif membuat runkan suku bunganya. “Memang harapanongkos pinjaman lebih murah. Suku bunga nya, bank bertahap bisa mengikuti suku yang rendah akan mendorong konsumsi bunga turun dengan acuan BI, serta melihat nasional. “Dengan menurunkan suku bunga kondisi makro 2012,” katanya. artinya bagi usaha akan dapat mudah Sebelumnya, Mikael Budisatrio mengamengembalikan pinjamannya kepada bank, takan, berdasarkan data BI, secara agregat sehingga pergerakan di dunia bisnis bisa suku bunga kredit menunjukkan penurunan. mengalir dengan biaya suku bunga rendah. Pada Agustus 2011 rata-rata sebesar 11,65 Sehingga semua pengusaha bisa mengempersen, sedangkan September 2011 bangkan usahanya. Oleh karena itu, suku menurun jadi 11,56 persen. Ini menunjukkan bunga yang rendah sangat dibutuhkan dunia kinerja fungsi intermediasi perbankan terus usaha,” katanya. mengalami peningkatan. Namun saat ini, katanya, bank-bank beHal tersebut tercermin dari kredit yang lum menurunkan suku bunga pinjamannya, disalurkan mencapai Rp99,19 triliun, naik meskipun ada bank yang sudah menu0,65 persen dibandingkan pada Agustus 2011 runkan bunganya hanya bank-bank besar. sebesar Rp98,56 triliun. Sedangkan perMenurutnya, perbankan belum menyesuaisentase penyalurannya dibanding dana yang kan suku bunganya, karena bank harus terhimpun atau loan to deposit ratio (LDR) membuat rencana bisnis yang tepat tahun pada September sebesar 82,24 persen. De2012, terutama terkait seberapa bunga kredit ngan pertumbuhan sebesar itu, tambahnya, yang ditetapkan untuk menopang kinerja kualitas kredit masih terjaga dengan baik bank tersebut, sehingga bank tidak buruyang terlihat dari rasio gross non performing buru harus menyesuaikan langkah penurunloans (NPLs) September 2011 sebesar 2,78 an BI rate. “Jika pada 2012 nanti bank sudah persen. menurunkan suku bunga, berarti bank “Saya harapkan sampai akhir tahun 2011 tersebut sudah membuat rencana bisnis penyaluran kredit perbankan di Sumut dapat yang efektif,” ujarnya. tumbuh di atas 20 persen, seperti tahun 2010 Terhadap penyesuaian bunga kredit yang mampu tumbuh sebesar 20,75 persen,” perbankan, BI akan lebih ketat melakukan katanya seraya menyebutkan, optimisme monitor bunga perbankan, salah satunya tersebut dipicu keyakinan bahwa hingga melalui presentase bank kepada BI tentang akhir tahun perekonomian masih dalam rencana bisnis bank (RBB). “Jadi bank akan kondisi yang stabil dengan tingkat pertummengajukan RBB 2012 dan BI akan mengabuhan relatif tinggi. nalisa lebih dalam yang pada intinya adalah Begitu juga dengan aktivitas kinerja perbankan yang menunjukkan peningkatan akan menilai komponen dari struktur bunga cukup menggembirakan. Pada September apakah suku bunga sudah efisien,” katanya. 2011, aset Rp153,44 triliun, meningkat 3,02 Sebagai contoh, katanya, apakah suku persen dibanding bulan lalu dan meningkat bunga bank sudah wajar, apakah biaya-biaya 21,19 persen dibanding tahun lalu. Hal ini overhead sudah cukup wajar, misalnya sejalan dengan perkembangan perekonobagaimana rencana pengembangan kantor, mian Sumut sampai triwulan III tahun 2011 apakah memang sudah mengembangkan menunjukkan kinerja yang sangat baik. dengan overhead yang tinggi sehingga Sementara itu, dana pihak ketiga (DPK) kreditpun menjadi tinggi atau belum yang dihimpun perbankan di Sumut juga melakukan pengembangan jaringan kantor meningkat sebesar 17,17 persen (yoy) harus menurunkan overheadnya, itu akan menjadi Rp120,61 triliun. “Peningkatan ini ditinjau dari segi bisnis, segi makro, apakah tidak terlepas dari peningkatan semua overheadnya realistis. komponen DPK baik giro, tabungan maupun “Perbankan, selain mengajukan rencana deposito,” katanya. Pada September 2011, bisnis bank, mereka melaporkan suku bunga nilai giro Rp21,99 triliun, deposito Rp48,96 dasar kredit. Suku bunga dasar kredit itu triliun dan tabungan Rp49,66 triliun. dipantau oleh pengawas bank, bagaimana ** Sugiarto laporan mereka perbulan, apakah suku

Vincent Wijaya, praktisi bisnis

Paling Penting Penyerapannya BICARA tentang penurunan suku bunga pasti menarik. Tidak hanya untuk perbankan, pengamat, praktisi bisnis atau pengusaha. Tapi juga masyarakat kebanyakan. Banyak yang berkepentingan dengan penurunan suku bunga. Pengusaha, misalnya, pasti menunggu suku bunga turun. Begitu juga masyarakat umum. Mereka yang terikat kredit untuk membeli rumah, mobil, sepedamotor atau pun kartu kredit

Jadi saya sangat yakin kalau ini bukan masalah berapa besar penurunan kredit. Tapi pada bagaimana perbankan bisa menugucurkan kredit dan seperti apa kemampuan pengusaha untuk menyerap.

pasti punya harapan yang sama dengan pengusaha. Bagi perbankan penurunan suku bunga kredit pasti butuh waktu panjang. Sebab ada banyak hal yang harus disesuaikan. Vincent Wijaya, praktisi bisnis di Medan, ketika dihubungi Rabu (7/12), pun mengaku tertarik membahasnya. “Tadi sekitar pk.14.00 saya bertemu dengan orang bank. Saya tanya mereka bagaimana tentang kredit mobil dan rumah saat ini. Mereka mengaku memang ada pengetatan,” jelas Vincent. Dia mengatakan jawaban para bankir itu setidaknya mewakili keresahan para pengelola leasing (kredit kendaraan bermotor). Sebab yang saya dengar leasing mengeluh karena perbankan mengetatkan penyaluran pembiayaan, kata Vincent. “Bukan itu saja. Jawaban orang bank tentang KPR pun mencengangkan. Mereka bilang KPR pun menjadi lebih selektif. Artinya apa? Dari dua indikator itu saya menyimpulkan saat ini sedang terjadi likuiditas ketat di perbankan,” ungkapnya. Ketatnya likuiditas ini merupakan pengaruh akan bergulirnya arus dana kembali ke AS untuk membeli berbagai portofolio di negara tersebut. “Semua ini punya hubungan dengan penurunan bunga kredit,” jelasnya. Kalau likuiditas sedang ketat, yang perlu diperhatikan adalah bukan pada masalah penurunan suku bunga satu persen atau setengah persen. Tapi bagaimana perbankan bisa menyalurkan kredit, jelasnya. “Ini bukan masalah turun satu persen atau berapa persen. Tapi bagaimana perbankan bisa mengucurkan kredit, dan bagaimana respon pengusaha bisa menyerapnya,” kata dia. Vincent merunut cerita ketika 1998 saat krisis ekonomi sedang memuncak suku bunga deposito mencapai 70 persen kemudian turun ke level 40 persen hingga 50 persen. Tapi pengusaha waktu itu hidup

Vincent Wijaya Praktisi bisnis

juga dengan suku bunga tersebut. “Atau sebelum 1998 pun sebenarnya suku bunga kita berada di level 30 persen. Kalau dirata-ratakan sekira 2,5 persen per bulan. Pengusaha bisa mengembalikan kok,” tuturnya. Jadi, menurut dia, desakan agar perbankan mau menurunkan suku bunga bukan pada besarnya persentase. “Tapi bagaimana roda bisnis berjalan. Andai pun suku bunga kredit turun banyak, kalau likuiditas ketat pasti tak akan tersalur. Atau suku bunga rendah, namun bisnis sedang mandeg pasti pengusaha tak berani ambil risiko. Mau bayar pakai apa,” ujarnya. Dia mengatakan kalau ekonomi lagi bagus, ekspor berjalan bukan tidak mungkin pengusaha bisa mendapatkan keuntungan lebih dari 2,5 persen per bulan. “Jadi saya sangat yakin kalau ini bukan masalah berapa besar penurunan kredit. Tapi pada bagaimana perbankan bisa menugucurkan kredit dan seperti apa kemampuan pengusaha untuk menyerap,” jelasnya. Kalaupun suku bunga 30 persen, namun jika bisnis sedang bagus pasti pengusaha mau mengambil kredit, tegasnya. Vincent sudah merasakan beberapa kali kebijakan moneter yang ketat. “Saya sudah ikut di beberapa periode tight money policy. Tidak penting mau seperti apa ketatnya atau setinggi apa suku bunga. Kalau usaha sedang bagus pengusaha tak akan keberatan,” tuturnya. Jadi kesimpulan Vincent adalah bukan pada suku bunga tapi pada penyerapan. Selain itu dia juga melihat memang saat ini terjadi kenaikan LDR (loan to deposit ratio) yang meningkat sementara penghimpunan dana tetap. “Dengan begitu otomatis uang yang ada di sistem perbankan menjadi berkurang. Wajar kalau kemudian pembiayaan menjadi lebih ketat,” ungkapnya. Kalau kebijakan sudah ketat, berarti perbankan akan lebih selektif menyalurkan kredit, tuturnya. � Armin Nasution

WASPADA Kamis 8 Desember 2011

Bank Mulai Terdesak Turunkan Bunga PENURUNAN BI rate yang sekarang di level enam persen telah membuat perbankan terdesak. Ketika BI rate turun, perbankan pun seolah diajak ikut menurunkan suku bunga kreditnya yang saat ini berada di level 12 persen sampai 16 persen. BI secara terang-terangan meminta perbankan mengikuti langkah otoritas moneter yang menurunkan bunga acuan. Begitupula dengan LPS (Lembaga Penjamin Simpanan) yang hanya memberi penjaminan maksimal 6,75 persen untuk simpanan rupiah. Artinya kalau ada bank yang menawarkan suku bunga di atas itu pasti tidak dijamin. BI dan Menteri Perdagangan Gita Wirjawan sudah ikut mendesak perbankan menurunkan suku bunga kreditnya. Bahkan Menteri Perdagangan membandingkan suku bunga berlaku di Indonesia dengan Malaysia. Walau kemudian itu bukan gambaran ideal tapi kemudian keinginan itu sudah disambut Bank Mandiri dan BCA. Dua perbankan terbesar di Indonesia ini sudah mulai menurunkan suku bunga kreditnya. Jika Mandiri menurunku suku bunga untuk seluruh sektor sebesar 50 poin, maka BCA hanya menurunkan suku bunga kredit ritel dengan nilai yang sama. Selain itu, penurunan suku bunga juga akan disusul BNI. Bank milik pemerintah ini pun sudah mengumumkan siap menurunkan suku bunga. Begitu juga dengan BTN. Sementara bank lain belum terindikasi menurunkan suku bunga. Ba n k In d o n e s i a a k t i f melakukan pendekatan kepada bank-bank untuk penurunan suku bunga dasar kredit (SBDK). Tak hanya suku bunga, namun juga spread antara suku bunga kredit dengan suku bunga

Waspada/Armin Nasution

PERBANKAN didesak menurunkan suku bunga kredit. Para nasabah bank terlihat sedang melakukan transaksi di salah satu bank pemerintah. Jika suku bunga kredit turun, otomatis suku bunga dana nasabah pun akan turun. deposito yang masih tinggi. BI menginginkan bagaimana meningkatkan efektivitas penurunan suku bunga BI rate sebesar 0,75 persen agar bunga deposito bisa turun, sehingga bunga kredit juga mengikuti. Bahkan, sejumlah bank sudah menurunkan suku bunga kreditnya. Dia berharap bank yang lain mengikuti langkah penurunan suku bunga itu. Dengan BI rate sebesar 6 persen dan imbal hasil (yield) surat utang sebesar 6,5 persen, menurut dia, masih menarik bagi investor. Angka itu lebih tinggi dibanding negara lain seperti Malaysia dan Singapura. Desakan menurunkan suku bunga ini kian kencang. Muliaman D Hadad, deputi Gubernur BI, mengungkap harusnya suku bunga kredit saat ini 10 persen. BI menunjukkan tingkat suku bunga kredit perbankan masih tetap tinggi walau ada kecenderungan penurunan suku bunga. “Rata-rata suku bunga kre-

dit di atas 12 persen,” katanya. Walau memang ada sebagian bank yang sudah menurunkan ke 10 persen. Tingginya bunga k re d i t , k a t a d i a , d i i k u t i rendahnya bunga deposito. Suku bunga deposito sedikit di atas enam persen sehingga spread kredit sekitar enam persen ternyata merupakan yang tertinggi di Asia. Padahal dengan suku bunga lebih rendah pun perbankan tetap menuai untung besar. Lalu kenapa penurunan suku bunga terkesan lambat? Para bankir sepakat ada time gap antara penurunan suku bunga kredit dengan penurunan suku bunga deposito. Untuk menurunkan bunga kredit, perbankan harus menurunkan cost of fund (suku bunga pendanaan), seperti deposito, giro dan tabungan. Itu ditambah lagi faktor seperti overhead cost fund, cost of fund, margin, dan premi risiko yang harus diturunkan.

Paling tidak butuh waktu tiga bulan. Buat para pengguna kredit tinggal menunggu waktu

penurunan. Sebab perbankan pun sudah terdesak. � Armin Nasution

Berikut daftar 10 bank yang paling rajin mengucurkan kredit: 1.

PT Bank Rakyat Indonesia Tbk (BRI) Rp276,299 triliun (13,29 persen dari total kredit nasional). PT Bank Mandiri Tbk Rp257,77 triliun (12,4 persen dari total kredit nasional). 3. PT Bank Central Asia Tbk (BCA) Rp175,571 triliun (8,44 persen dari total kredit nasional). 4. PT Bank Negara Indonesia Tbk (BNI) Rp154,674 triliun (7,44 persen dari total kredit nasional). 5. PT Bank CIMB Niaga Tbk Rp118,684 triliun (5,71 persen dari total kredit nasional). 6. PT Bank Danamon Indonesia Tbk Rp85,643 triliun (4,12 persen dari total kredit nasional). 7. PT Pan Indonesia Bank Tbk (Bank Panin) Rp64,724 triliun (3,11 persen dari total kredit nasional). 8. PT Bank Permata Tbk Rp62,942 triliun (3,03 persen dari total kredit nasional). 9. PT Bank Tabungan Negara Tbk (BTN) Rp59,295 triliun (2,85 persen dari total kredit nasional). 10. PT Bank Internasional Indonesia Tbk (BII) Rp57,378 triliun ( 2,76 persen dari total kredit nasional). 2.

Pengusaha Berharap Cepat-cepat Turun LANGKAH Bank Indonesia (BI) menurunkan suku bunga acuannya (BI Rate) dari 6,5 persen menjadi enam persen, disambut baik kalangan pengusaha dan nasabah. Mereka berharap, penurunan ini diikuti turunnya bunga kredit pada perbankan, sehingga dapat menggairahkan perekonomian dan meningkatkan daya beli masyarakat. “Kalau BI rate sudah turun, seharusnya juga diikuti bunga pada perbankan harus turun. Harapan kita, harus efektif penurunan BI rate dengan realisasi penurunan bunga di perbankannya,” kata Ketua Himpunan Pengusaha Muda Indonesia (HIMPI) Sumut, Firsal Mutyara kepada Waspada, Rabu (7/12). Firsal Mutyara yang biasa disapa Dida ini mengatakan dengan turunnya bunga pinjaman ini tentunya akan menggairahkan bisnis para pengusaha, karena dengan bunga kredit yang rendah maka akan terjadi cost yang rendah. “Kalau dana yang dikeluarkan untuk biaya bunga pinjaman bisa berkurang, maka dana yang ada bisa diputar dan digunakan untuk pengembangan usaha,” katanya. Banyak manfaat yang bisa diambil dari para pengusaha bila perbankan ikut menurunkan bunga kredit, karena efeknya simultan dengan perkembangan ekonomi, bahkan akan semakin banyak yang meminjam. Namun saat ini, lanjutnya, meskipun BI rate sudah turun dari 6,5 persen menjadi 6 persen, riil bunga pinjaman perbankan belum turun, sementara bunga simpanan sudah ikut turun. “Ini kan artinya tidak sejalan. Seharusnya bunga bank kan ikut turun menyesuaikan dengan suku bunga acuan BI yang sebesar 6 persen,” ujar Dida. Hal yang senada juga disampaikan, Ketua DPD Real Estate Indonesia (REI) Sumut Tomi Wistan. Pihaknya berharap dengan penurunan BI rate ini bisa diikuti suku bunga perbankan.

Waspada/Armin Nasution

BUKAN hanya pengusaha yang menginginkan suku bunga kredit turun. Tetapi efeknya simpanan masyarakat bisa turun di perbankan. Papan pengumuman suku bunga terpampang di salah satu bank di Medan tepat di atas nasabah yang sedang berkomunikasi dengan customer service.

Ya seharusnya bank bisa menyesuaikan dengan suku bunga BI rate. Kita berharap, dengan penurunan 0,5 persen saja tentu akan dapat meningkatkan daya beli masyarakat, seperti daya beli terhadap properti (perumahan). Tomi Wistan Ketua DPD REI Sumut

“Ya seharusnya bank bisa menyesuaikan dengan suku bunga BI rate. Kita berharap, dengan penurunan 0,5 persen saja tentu akan dapat meningkatkan daya beli masyarakat, seperti daya beli terhadap

properti (perumahan),” ujar Tomi. Dia mengatakan, dirinya sangat yakin kalau suku bunga perbankan turun, masyarakat akan bergairah membeli rumah dengan Kredit Perumahan

Rakyat (KPR) dengan bunga yang lebih rendah. “Dengan bunga KPR yang rendah, tentunya daya beli masyarakat terhadap perumahan akan lebih besar lagi. Dia menyebutkan, beberapa bank sudah menurunkan suku bunganya terhadap pinjaman KPR. Meskipun hanya fix dua tahun tapi itu sudah bisa menggembirakan dan diharap-kan bisa lebih dari itu mengikuti bunga acuan BI. “Kita harap dengan penurunan ini, semua bank bisa menyesuaikan, walaupun biasanya kita ketahui, bank turunnya agak pelan menyesuaikannya. Kita berharap bulan depan

(Januari 2012) perbankan sudah bisa menyesuaikan, sehingga dengan sendirinya akan meningkatkan daya beli masyarakat dan mempergairah bisnis secara umum termasuk bisnis properti,” ujar Tomi. Untuk pinjaman yang sudah berjalan, Tomi Wistan menyebutkan, biasanya bunga pinjaman KPR nasabah juga akan disesuaikan penurunannya. Kecuali kalau nasabah ada ikatan dengan perbankan yang sudah menetapkan suku bunganya. “Biasanya disesuaikan dengan bunga acuan BI, kalau suku bunga naik maka bunga pinjaman juga akan naik, begitu juga seharusnya, kalau suku bunga turun, bunga pinjaman juga harus turun,” ujarnya. Dengan penurunan suku bunga acuan BI turun, REI Sumut sangat menyambut baik, apalagi kata Tomi, selama dasawarsa ini, suku bunga acuan BI yang paling rendah adalah saat ini dan diharapkan bisa turun lagi. Kalau di luar negeri, katanya, yang namanya pinjaman sudah hanya 3 persen sampai 5 persen. “Penurunan bunga pinjaman akan memperluas sekup volume pembeli, itu meningkatkan daya beli masyarakat. Misalnya kalau selama ini cicilannya Rp1 juta, dengan bunga pinjaman turun maka cicilannya bisa Rp900.000.Jadi otomatis yang Rp900.000 itu akan semakin banyak volumenya. Itu yang kita harapkan,” ujarnya. Tidak saja hanya kalangan pengusaha yang menyambut positif penurunan bunga pinjaman, tetapi masyarakat konsumen maupun nasabah pinjaman kredit perbankan juga berharap agar bunga pinjaman mereka ikut turun. Seperti dikatakan Taufik, salah seorang warga Medan Johor yang mengaku sebagai nasabah kredit pinjaman untuk perumahan. Dia mengatakan, meskipun penurunan suku bunga pin-jaman turun, tidak memberikan pengaruh yang signifikan baginya. ** Sugiarto

Sumatera Utara

WASPADA Kamis 8 Desember 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:18 12:31 12:18 12:26 12:25 12:22 12:18 12:14 12:21 12:20

‘Ashar 15:41 15:53 15:42 15:48 15:48 15:47 15:42 15:38 15:45 15:44

Magrib 18:16 18:26 18:17 18:21 18:22 18:24 18:18 18:13 18:19 18:17



Shubuh Syuruq


19:30 19:40 19:30 19:35 19:35 19:38 19:31 19:27 19:33 19:31

04:48 05:04 04:48 04:58 04:57 04:48 04:47 04:43 04:50 04:52

04:58 05:14 04:58 05:08 05:07 04:58 04:57 04:53 05:00 05:02

L.Seumawe 12:24 L. Pakam 12:17 Sei Rampah12:16 Meulaboh 12:28 P.Sidimpuan12:15 P. Siantar 12:16 Balige 12:16 R. Prapat 12:13 Sabang 12:31 Pandan 12:17

06:18 06:34 06:19 06:28 06:27 06:18 06:18 06:13 06:21 06:22

Zhuhur ‘Ashar 15:47 15:41 15:40 15:51 15:40 15:40 15:40 15:37 15:53 15:42




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:19 18:15 18:14 18:25 18:17 18:16 18:16 18:14 18:25 18:19

19:33 19:29 19:28 19:39 19:31 19:29 19:30 19:27 20:39 19:32

04:56 04:47 04:46 04:59 04:41 04:45 04:44 04:40 05:04 04:44

05:06 04:57 04:56 05:09 04:51 04:55 04:54 04:50 05:14 04:54

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:17 12:19 12:28 12:21 12:18 12:25 12:13 12:24 12:17 12:16

18:19 18:18 18:24 18:22 18:16 18:22 18:13 18:22 18:18 18:15

19:32 19:32 19:38 19:35 19:30 19:35 19:26 19:36 19:31 19:28

04:44 04:47 05:01 04:48 04:48 04:56 04:42 04:53 04:44 04:45

04:54 04:57 05:11 04:59 04:58 05:06 04:52 05:03 04:54 04:55

Panyabungan 12:14 Teluk Dalam12:21 Salak 12:19 Limapuluh 12:15 Parapat 12:17 GunungTua 12:14 Sibuhuan 12:13 Lhoksukon 12:23 D.Sanggul 12:17 Kotapinang 12:12 AekKanopan 12:14

06:27 06:17 06:16 06:29 06:12 06:15 06:14 06:11 06:35 06:14

15:42 15:43 15:51 15:46 15:42 15:48 15:37 15:47 15:41 15:40

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Pendataan e-KTP Di Binjai 40,92 Persen BINJAI (Waspada): Pendataan pelaksanaan e-KTP di kota Binjai sampai 4 Desember 2011 baru 49,92 persen. Kepala Dinas Kependudukan dan Catatan Sipil Kota Binjai, Iswan menjelaskan, Rabu (7/12) target dari jumlah wajib KTP di Binjai 210.609 orang sulit tercapai. “Banyak faktor menjadi kendala” ujarnya tanpa menyebutkan secara rinci. Pelaksanaan e-KTP di Binjai dimulai 20 September 2011 di Binjai Kota, sampai saat ini realisasinya 50,13 persen. Kec. Binjai Barat dimulai 24 September terrekam 55,90 persen. Binjai Timur 35,08 persen, Binjai Selatan 40,92 persen. Sedangkan Binjai Utara dimulai 19 Oktober mencapai 24 persen. Iswan menjelaskan, warga Binjai yang terdata sudah merekam data e-KTP 86.181 orang dari wajib KTP 210.609 orang. Berarti masihada124.428wajibKTPdiBinjaibelummelakukanpendataan. Iswan menyebutkan, pendataan akan dilakukan sampai akhir Desember2011danpetugaspelayanandisetiapkantorkecamatan siaga sampai pukul 21:00, bahkan hari libur tetap bekerja. (a04)

PT Tanimas Soap Industries Berupaya Penuhi Hak Buruh PATUMBAK (Waspada): PTTanimas Soap Industries di Jalan Pertahanan, Dusun III, Desa Sigara-gara, Patumbak, Deliserdang berupaya memenuhi hak normatif yang dituntut buruh. Kesepakatan antara perusahaan dengan buruh/karyawan itu disaksikan Muspika Patumbak, perwakilan Disnaker dan Serikat Buruh Merdeka Indonesia (SBMI) Deliserdang. Perwakilan PT Tanimas Soap Industries, SM Simanjuntak, SH mengatakan, Rabu (7/12), selama ini hasil kapasitas produksi perusahaan tidak pernah tercapai, sementara jumlah tenaga kerja melebihi. Meski demikian perusahaan berupaya membayar upah karyawan sesuai upah minimum sektoral Deliserdang, dan hakhak normatif lainnya. “Bagi karyawan harian lepas yang telah bekerja enam bulan secara terus menerus, akan dinilai kinerjanya. Jika menurut penilaian manajemen perusahaan karyawan tersebut layak dan memenuhi syarat, akan diangkat menjadi pegawai harian tetap,” kata Simanjuntak. “Perusahaan juga tetap membayarkan upah karyawan yang mogok kerja, tidak akan melakukan PHK maupun intimidasi karyawan yang berunjukrasa. Diharapkan, dengan dipenuhinya hak normatif akan meningkatkan kinerja karyawan, sesuai yang disepakati,” harap Simanjuntak.(c02)

Tugu 100 Tahun Perminyakan Di P.Brandan Diselimuti Semak P.BRANDAN (Waspada): Menjelang datangnya Hari Ulang Tahun PT Pertamina (Persero) segala kegiatan menjelang HUT ini banyak dilaksanakan seperti bakti sosial, operasi bibir sumbing, operasi katarak dan sunatan massal berkerjasama media RCTI, MNC dan RS Pertamina P. Brandan juga akan dilaksanakan kegiatan olahraga. Menurut keterangan warga setempat persisnya simpang bukit satu Desa Securai Utara, Kecamatan Babalan Langkat sudah lama tidak ada perawatan yakni pembersihan di sekitar tugu itu sehingga terjadi semak dan tak indah dipandang mata. Dalam waktu dekat ini Pertamina memperingati HUTnya di seluruh Indonesia dan di Kota Palembang baru saja selesai pesta olah raga akbar Sea Games, hanya beberapa meter persegi saja rumputnya tak bisa diberesi ucap warga kepada Waspada Senin (5/12) saat melintas di tempat itu. Karena tugu adalah simbolnya daerah dan perlu diketahui para generasi muda (Gema) apa makna tugu karena disinilah minyak yang pertama ditemui oleh bangsa Belanda yakni di Desa Telaga Said. Dari modal ini terbangunlah unit unit Pertamina lainnya seperrti unit II, III, IV, danV ucap sumber.(c01)

PPP Percut Sei Tuan Semarakkan Tahun Baru Islam PERCUT SEI TUAN (Waspada): Pimpinan Anak Cabang Partai Persatuan Pembangunan (PAC PPP) Percut SeiTuan bekerjasama dengan STM Al-Hijrah menyemarakkan Tahun Baru Islam 1433 H di Jalan Beringin Pasar 7 Tembung. Kegiatan dirangkai penyambutan Hari Lahir (Harlah PPP) ke 39 baru-baru ini, di antaranya kegiatan jalan santai, santunan kepada anak yatim dan kaum duafa kemudian pada malam hari ceramah agama oleh Ustadz Drs H. Bahron Nasution, diawali pembacaan ayat suci Alquran oleh Muhammad Fadlan. Ketua PAC PPP Percut Sei Tuan Misnan Al Jawi, Minggu (4/12) mengatakan,Tahun Baru Islam 1433 H menjadi semangat baru bagi seluruh kader maupun masyarakat untuk menatap masa depan yang lebih baik lagi.“Bagi PPP Percut SeiTuan menjadi tanda kebangkitan besar karena komitmen untuk membangun bersama masyarakat demi perubahan yang lebih baik terutama untuk menghadapi Pemilu 2014 mendatang,” ucap Misnan. Ketua STM Al Hijrah Wagino menyampaikan apresiasinya kepada PPP Percut Sei Tuan karena memberikan andil sangat besar bagi pembinaan keagamaan di daerah ini. Sementara Ustadz Bahron Nasution dalam tausyiahnya menyampaikan, hakekatTahun Baru Hijriyah yang paling utama adalah perubahan untuk menjadi lebih baik lagi dari sebelumnya. Hijrah atau pindah itu seperti dari akhlak yang tidak baik menjadi lebih baik, begitu juga kewajiban shalat menjadi lebih ditingkatkan. Dengan perbaikan itu, kata Nasution, maka kualitas umat Islam akan mengalami perubahan ke arah positif yaitu lebih baik dari masa sebelumnya. “Nabi juga mengingatkan bahwa umat yang merugi adalah yang hidupnya tidak mengalami kemajuan dari waktu ke waktu,” ujarnya.(m41)

06:14 06:17 06:32 06:19 06:19 06:27 06:12 06:23 06:14 06:16

Zhuhur ‘Ashar 15:39 15:46 15:43 15:39 15:41 15:38 15:38 15:46 15:42 15:36 15:38




Shubuh Syuruq

18:17 18:24 18:19 18:14 18:16 18:16 18:16 18:19 18:18 18:13 18:14

19:31 19:38 19:33 19:27 19:30 19:29 19:30 19:33 19:32 19:27 19:27

04:39 04:46 04:47 04:44 04:45 04:40 04:39 04:55 04:45 04:39 04:42

04:49 04:56 04:57 04:54 04:55 04:50 04:49 05:05 04:55 04:49 04:52

06:10 06:16 06:17 06:14 06:15 06:10 06:09 06:26 06:15 06:09 06:12

Mendadak Tinjau Proses e-KTP Di Batangserangan

Hutan Mangrove Beralih Fungsi, Warga Unjukrasa STABAT (Waspada): Puluhan warga Desa Kwala Serapuh Kec. Tanjungpura Kab. Langkat berunjukrasa di kawasan hutan mangrove yang telah berubah menjadi perkebunan kelapa sawit disana, memprotes alih fungsi tersebut, Rabu (7/12). Warga meminta ratusan hektare kawasan hutan mangrove yang telah ditanami kelapa sawit oleh oknum pengusaha berinisial A, dikembalikan kepada masyarakat. Dalam tuntutan itu massa menilai kerusakan hutan mangrove di Kab.Langkat khususnya di Tanjungpura sudah cukup parah akibat alih fungsi. Namun, tindakan ilegal itu belum ditindaklanjuti petugas berwenang untuk diproses sehingga terkesan penegak hukum ‘tutup mata’. Dampak alih fungsi kawasan hutan yang dirasakan warga, kata pengunjukrasa saat berorasi, hasil tangkapan nelayan saat melaut berkurang, karena hutan bakau yang merupakan tempat berkembang ikan dan biota laut lainnya berubah menjadi perkebunan kelapa sawit. Unjukrasa tersebut dikawal aparat Polres Langkat hingga tidak terjadi pengerusakan tanaman di lahan yang diperebutkan. Sebelumnya, menurut Sekda Langkat Surya Djahisa, Pemkab Langkat sedang membentuk tim berkordinasi dengan sejumlah pihak terkait dengan tujuan untuk mengembalikan kawasan hutan mangrove yang telah beralih fungsi. (a03)


Waspada/Abdul Khalik

DIORAMA Peristiwa Berdarah 13 Desember 1945 di tugu lapangan Merdeka, terlihat dibersihkan, menjelang hari peringatan bersejarah warga 13 Desember.

Peristiwa Berdarah 13 Desember 1945:

DHC ‘45 Minta Jepang Buka Arsip TEBINGTINGGI (Waspada): Dewan Harian Cabang Angkatan ’45 Kota Tebingtinggi meminta pemerintah Jepang untuk membuka arsip tentara Jepang terkait Peristiwa Berdarah 13 Desember 1945. Hal itu dilakukan demi pelurusan sejarah, sekaligus membersihkan ingatan massa, soal berbagai dugaan seputar peristiwa itu. Hal itu disampaikan Ketua DHC ’45 kota Tebingtinggi Ibrahim, SH, didampingi Sekretaris Drs. Suhadi Pranata, Rabu (7/ 12), di Sekretariat DHC ’45. Pernyataan itu disampaikan, terkait pernyataan sejarahwan Unimed Dr. (Phil) Ikhwan Azhari, bahwa peristiwa itu merupakan kejahatan perang dan pelanggaran HAM berat. Menurut DHC ’45, apa yang dipaparkan direktur PUSSIS Unimed itu, pada “Seminar PeristiwaBerdarah13Desember1945” bisadibenarkan.Karenaperistiwa yang berlangsung beberapa hari itu (diperkirakan 13-17 Desember 1945), tentara Jepang bertindak membabi buta, membunuhi setiap laki-laki yang ditemukan. “Itu sebabnya angka korban bisa mencapai ribuan orang,” ujar Ibrahim, SH. Salahsatukorbanyangmasih

diingat,adalahAbdulRahimLubis yang namanya diabadikan pada salahsatujalandiKel.Tebingtinggi, Kec. Padang Hilir. Korban, sebenarnya bukan laskar dan sama sekali tak tahu menahu asal muasal kejadian. Namun, hari itu, saat Abdul Rahim Lubis naik sepeda di Kampung Kebun Kelapa, tentara Jepang menangkapnya dan langsung menusuk korban dengan bayonet hingga tewas. “SayadapatceritaitudariH.Ibnoe Kassim Lubis, adik mendiang, sebelum dia meninggal,” tutur Ibrahim, SH. Pembantaian demikian, tambah Ketua DHC’45, banyak terjadi dalam peristiwa itu. Misalnya, banyak kaum laki-laki yang ditangkap, kemudian dikumpulkan, selanjut dibunuh dengan tusukan bayonet. “Dulu banyak ditemukan, pemakaman massal akibat peristiwa itu,” ungkap dia.

Misalnya, di Jalan Sisingamangaraja, Kel. Bandar Sono, tepian sei Bahilang(sekarangkomplekGKPS). Demikian pula di bawah monumen 13 Desember 1945 di lapangan Merdeka. Selain itu, ada kuburan massal di pekuburan umum titi gantung tepi sei Padang di Kel. Bulian, Kec. Bajenis. “Peristiwa itu masih kuat dalam ingatanmasyarakatTebingtinggi,” tambah dia. Namun,selama66tahunpasca peristiwa itu, imbuh Ibrahim, SH, pemerintah Jepang terkesan diam dan tidak peduli. Memori turun termurun masyarakat saat ini, seluruhnya berasal dari arsip dan informasi oral korban. Sedangkan tentara Jepang sebagai pelaku, menutup erat data-data mereka seputar peristiwa pilu itu. “Kita himbau Konsul Jenderal JepangdiMedan,menyampaikan pada pemerintah Jepang diTokyo ada beban sejarah yang harus dibersihkan di Tebingtinggi,” harap Ketua DHC ’45 itu. Bahkan,DHC’45KotaTebingtinggi mempersilahkan Konsul Jenderal Jepang di Medan untuk datangkeTebingtinggi,gunamendapatkan informasi soal itu. “Kita ikhlas, jika posisi peristiwa itu bisa diluruskan,”tandasmantanwartawan berusia 71 tahun itu. (a09)

Bisnis Tipu Menipu Mobil Gadaian Makin Marak SEI RAMPAH (Waspada): Modus kasus menyerahkan uang dengan imbalan mobil dalam jangka waktu tertentu untuk mengelabuikonsumen,makinmarak. Dalam prakteknya, korban ditawari mobil yang menggiurkan. Seperti dijelaskan Joko, 29, PNS yang bertugas di Dinas Pendapatan Pengelolaan Keuangan danAset(PPKA)PemkabSerdang Bedagai, Selasa (6/12). Pasalnya, mobil DaihatsuTerios merah BK 970 KO yang disewakannya (rental-red) kepada Heri, 18, warga Lubuk Pakam limabulansilam,belumjugakembali hingga sekarang, sehingga Herisibukkesanakemarimencari tahu di mana mobil tersebut.

Pucuk dicinta ulam pun tiba. Salahsatudarilimamobilmiliknya tersebut terlihat melintas di jalan lintas Sumatera (Jalinsum), di Sungai Ular menuju arahTebingtinggi. Pria bertubuh kecil itu mengejar dan menghubungi petugas Sat Lantas Polres Sergai, saat mobil tersebut parkir di SPBU Firdaus, Sei Rampah. Ternyata, mobilnya dikemudikan Muhammad Nuhin, S.Ag, 37,wargaDusunBourtrem,Bangko Pusako, Rokan Hilir. Kemudian bersamapetugas,pengemudidan mobilnyadigiringkePolresSergai. MenurutNuhin,iamenyewamobil itu dari Gino, 38, warga Lubuk Pakam seharga Rp35 juta selama empatbulan.“SayasewadariGino

Rp35juta,itupunataspersetujuan pemiliknya bernama Kanjeng Mami,40,dansuaminyaAndiLala, 43, mereka masih warga yang sama,” kata Nuhin. Nuhin juga bersikukuh tidak mengenal pemilik mobil. “Saya tidak kenal, yang saya tahu mobil saya sewa dari Gino,” katanya serius. Joko yang merasa dirugikan karena mobilnya belum dibayar sekian lama oleh Heri, akan mengadu ke polisi. Karena lokasi kejadian awal di Lubuk Pakam, petugas Polres SergaimenyarankankorbanmelaporkePolressetempat.Selanjutnya, Jokodanpengemudimobilmiliknya berangkat ke Polres Deliderdang, mengadukankasustersebut.(a08)

STABAT (Waspada): Bupati Langkat H. Ngogesa Sitepu mendadak berkunjung ke kantor Camat Batangserangan, berdialog dengan warga yang menunggu panggilan untuk perekaman e-KTP. Bupati juga mengemukakan bangga dan salut atas perhatian dan antusias warga untuk datang ke kantor camat, guna mengikuti proses pembuatan KTP elektronik. “Program ini harus kita dukung dan sukseskan demi keakuratan data kependudukan serta memudahkan dalam proses administrasi bagi kebutuhan lainnya,” ujar bupati. Sementara Kadis Kependudukan dan Catpil, Ruswin, SH kepada Waspada, Rabu (7/12) mengemukakan, sejak peluncuran program eKTP awal Oktober, hingga kini dari 1.194.463 jiwa penduduk Langkat tercatat 832.747 jiwa wajib memiliki KTP. Hingga awal Desember 2011, perekaman data warga baru sekira 31,4 persen atau 261.356 warga wajib berKTP. Masalah pelayanan kerap mengalami kendala akibat gangguan peralatan dan hal ini sudah kita laporkan, lanjut Ruswin

seraya menambahkan, pelayanan perekaman e-KTP didukung 46 unit peralatan standar dari Kemendagri melibatkan 142 petugas operator dibantu 284 g petugas pendukung pelayanan pada 23 Kecamatan se Kab. Langkat. Rakorpem Secara terpisah dalam Rakorpem (Rapat Koordinasi Pemerintahan) yang berlangsung di ruang pola kantor bupati di Stabat, Selasa (6/12), Bupati H. Ngogesa menyoroti lemahnya administrasi di sejumlah SKPD dan belum konsistennya perencanaan dengan pelaksanaan. Melalui forum ini, masalah koordinasi dan penguasaan terhadap tugas benar-benar menjadi perhatian, kata bupati dalam sambutan tertulis dibacakan Sekda Surya Djahisa. Selain itu sisi pencapaian realisasi target PAD Rp39,643,817,920 juga menjadi hal serius, hingga Oktober 2011 baru terealisasi Rp26,466,659,705 atau 68,50%. SKPD pengelola PAD diimbau untuk lebih meningkatkan kinerja secara maksimal sehingga pada akhir tahun anggaran yang tinggal beberapa minggu lagi, target dapat tercapai, katanya.(a01)

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu meninjau proses perekaman e-KTP di kantor Camat Batangserangan.

Pemkab DS Gelar Seminar ‘Peran Guru Membangun Karakter Bangsa’ LUBUK PAKAM ( Waspada): Dalam rangkaian HUT PGRI ke 66 dan Hari Guru Nasional 2011, Pemkab Deliserdang melalui Dinas Pendidikan - Pemuda dan Olahraga (Disdikpopra) menyelenggarakan seminar sehari berkaitan peran guru untuk membangun karakter bangsa, di aula PGRI Deliserdang di Lubuk Pakam, Selasa (6/12). Seminar diikuti 250 peserta anggota PGRI terdiri dari guru TK, SD, SMP, SMA dan para KacabdisdikporaKecamatan,dengannarasumber Prof Dr Belfrick Manullang (Direktur Pasca Sarjana Universitas Negeri Medan), dibuka Kepala Dinas Pendidikan, Pemuda dan Olahraga Deliserdang, Hj. Sa’adah Lubis, SPd, MAP. Kadisdikpora Deliserdang selaku pembina PGRI menjelaskan, seminar sehari tentang peran guru untuk membangun karakter bangsa

dilaksanakan dalam rangkaian peringatan HUT PGRI ke 66 dan Hari Guru Nasional 2011 di tingkat Kab. Deliserdang, dimana puncak acara 15 Desember 2011. Menurutnya, seminar yang digelar sejalan dengan tema yang ditetapkan pemerintah, yaitu “Meningkatkan peran strategis guru untuk membangun karakter bangsa”, dengan sub tema, “Peningkatan kinerja guru untuk pendidikan bermutu”, merupakan tema peringatan yang menempatkanposisigurupadatempatyangsangat strategis dalam menentukan peradaban bangsa dimasa mendatang. Sementara Prof. Dr. Belfrick Manullang menguraikan profesi guru yang memiliki peran sangatstrategisdalammenentukan.Gurumemiliki peluang memberi warna pada kehidupan generasi yang akan datang.(a06)

Guru Bertugas Siapkan Masa Depan Generasi Penerus RANTAUPRAPAT (Waspada): Guru dapat merasakan dan menyentuh pinggiran masa depan melalui persinggungan dengan peserta didiknya, yakni dengan kewajiban menyiapkan generasi penerus demi masa depan yang lebih baik, berbudaya dan membangun peradaban. Demikian dikatakan Bupati pada peringatan Hari Guru Nasional ke-17 dan HUT PGRI ke-66 di Lapangan Ika Bina Rantauprapat Senin (5/12). Disebutkan, kemampuan guru menyentuh masa depan walaupun hanya pinggirannya mendapatkan rasa tanggung jawab yang besar namun mulia, sebab kemampuan dan kesempatan tersebut tidak dimiliki yang lainnya. Pada diri guru tertumpu beban tanggungjawab menyiapkan masa depan yang baik, yaitu dengan berfungsi sebagai jembatanbagipesertadidikuntuk melintas menuju masa depan mereka. Ketua Panitia Pelaksana Drs. SanuddinDeskydalamlaporanya

menyampaikan, kegiatan Hari Guru Nasional ke-17 dan HUT PGRI ke 66 Tahun ini diselenggarakan mulai 25 November sampai 5 Desember 2011, yang

diawali dengan upacara HGN dan HUT PGRI ke-66 di sekolahsekolah baik pada Tingkat SD/ MI, SMP/MTS, SMA/MA, dan SMK. (a18/c07)

Waspada/Armansyah Abdi

BUPATI L.Batu dr H Tigor Panusunan Siregar SpPD memberikan sambutan pada peringan Hari Guru Nasional ke-17 dan HUT PGRI ke-66 di Lapangan Ika BIna Rantauprapat, Senin (5/12).


USAI serah terima jabatan, Dan Brigif-3 Marinir, Kolonel Bambang Suswanto bersama Danyonif8 Marinir Letkol Mar Daniel Kreuta, Letkol Mar Arinto Benny Sarana dan para prajurit baret ungu di lapangan Yonif-8 Tangkahan Lagan.

Profesionalitas Marinir Harus Terus Ditingkatkan P. BRANDAN (Waspada): Yonif-8 Marinir sebagai pelaksana Brigif-3 Marinir mempunyai tugas pokok untuk membina kemampuan unsur tempur, dalam melaksanakan tugas operasi amfibi dan tugas tempur lainnya, serta melaksanakan tugas operasi militer selain perang. Hal itu disampaikan Komandan Brigif-3 Marnir, Kolonel Mar Bambang Suswantono, dalam serahterima jabatan Danyonif-8 Marinir Tangkahan Lagan dari Letkol Mar Arinto Benny Sarana kepada Letkol Mar Daniel Kreuta, Rabu (7/12), di Yonif-8 Marinir Tangkahan Lagan. “Perlu disadari, kemampuan negara untuk memenuhi kebutuhan alat utama sistem persenjataan, pemeliharaan material, mau pun kebutuhan perbaikan kesejahteraan prajurit sangat terbatas. Namun hal itu tidak boleh mengurangi profesionalisme untuk menegakkan kedaulatan NKRI,” ujarnya.

Dia mengakui,Yonif-8 Marinir telah memberi warnabagiBrigif-3denganprestasimembanggakan. Dalammenghadapiperkembangansituasikedepan, ia berharap batalyon ini terus meningkatkan dan memantapkan identitas serta jati diri prajurit korps mariniryangbermoral,profesionaldandicintairakyat. Pada kesempatan itu, Komandan Brigif menyampaikan penghargaan yang tinggi kepada Letkol Mar Arinto Benny Sarana, yang menempati tugas baru sebagai Komandan Detasemen 2 GrupA Paspamres di Jakarta. Ia berterima kasih atas pengabdian yang tulus dalam memimpin serta memajukan Yonif-8 Marinir. Khusus kepada Danyonif-8 Marnir yang baru, dia berharap dapat mengemban kepercayaan dankehormataninidenganpenuhtanggungjawab. “Sayayakin,denganpengetahuandanpengalaman yangdimiliki,LetkolMarDanielmampumenjawab tantangan tugas ke depan,” tegasnya.(a02)

Sumatera Utara


Bidan Desa Dirampok Dan Ditikam


KISARAN (Waspada): Seorang bidan desa terpaksa dirawat di RS Jamaluddin Kisaran, setelah dirampok dan ditikam tiga kali. Sedangkan kerugian diperkirakan mencapai Rp17 juta. Informasi dihimpun Waspada, korban, Risna Triwani Sinurat, 27, warga Dusun III, Desa Bangun Sari Kec. Setia Janji, Kab. Asahan, bersama rekannya Miswani, 28, pulang dari undangan melintas di areal Perkebunan Karet, PTPN III Kebun Sei Silau Afdeling VI, menggunakan sepeda motor, Senin (5/12) sekitar pukul 21.00. Tanpamerekasadari,tigapriadenganduasepedamotormemepet korban dan memaksa berhenti. Ke dua wanita itu langsung digiring sejauh 30 meter dari jalan, dan diikat di pohon karet. Sedangkan Risna Triwani Sinurat ditikam tiga kali dengan luka serius di bagian dada, pinggang dan tangan kiri. Sementara Miswani, mengalami luka ringan di dagu. Sepeda motor korban serta kalung emas 1 mayam (3,3 gram) dilarikan perampok, yang meninggalkan korban berlumuran darah. Tidak lama kemudian, salah seorang warga mendengar rintihan mereka, sehingga korban dibawa ke RS Jamaluddin untuk perawatan. “Saya tidak kenal tiga pria itu, mereka mengancam pakai pisau, dan menikam Risna. Setelah mengambil kalung dan sepeda motor mereka lari,” ujarTriwani, ditemuiWaspada di RS Jamaluddin Kisaran, Rabu (7/12). Sedangkan rekannya masih dalam perawatan intensif karena luka serius. Kapolres Asahan AKBP Marzuki, MM dikonfirmasi melalui Kasubag Humas AKP R. Berutu membenarkan kejadian itu. Kasusnya tahap penyidikan, untuk mengejar para tersangka.(a15)

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Waspada/Rahmad F Siregar

KENDARI baru tiga tahun diresmikan, namun jembatan sungai Asahan menghubungkan Kota Tanjungbalai dengan Kec. Seikepayang Barat, Kab. Asahan, terancam ambruk.

Bupati Panggil Kadis PU Terkait Kerusakan Jembatan Sungai Asahan SEIKEPAYANG (Waspada): Kadis PU Kab. Asahan, Taswir mendapat panggilan mendadak dari Bupati Asahan Taufan Gama Simatupang terkait jembatan sungai Asahan yang terancam ambruk karena plat injak dan oprit yang turun hingga 4 inci. “Kadis PU dipanggil Bupati tadi untuk membicarakan kerusakan jembatan sungai Asahan,” kata sumber Waspada, Rabu (7/ 12). Menurut sumber, Bupati meminta Kadis PU mengeksplor kondisi jembatan terpanjang di Sumut itu, guna mengetahui penyebab kerusakannya. “Untuk informasi lebih jelas, hubungi saja Kabag Humas Asahan,” saran sumber kepada Waspada. Kabag Humas Asahan Rahman Halim membenarkan pemanggilan Kadis PU itu. Selain meminta ekspos kondisi jembatan, menurut Halim, Bupati juga menginstruksikan Kadis PU

segera turun ke lokasi untuk melihat sejauhmana kerusakan jembatan, serta mencari tahu penyebabnya.“Apa karena faktor alam atau faktor lainnya,” jelas Halim. Halim menerangkan, Pemkab melalui Dinas PU akan segera menurunkan tim ahli untuk memeriksa dan meneliti secara teknis kondisi jembatan yang menghubungkan Kota Tanjungbalai dengan Kec. Seikepayang Barat,Kab.Asahanitu.Tujuannya, lanjut Halim, supaya diketahui pasti penyebab plat injak dan oprit turun hingga 4 inci. “Akan kita pastikan dulu

penyebab rusaknya jembatan itu, apa karena faktor usia, alam, atau pengerjaannya yang tidak sesuai bestek. Bila kerusakan itu membahayakan bagi pengguna jembatanataumasyarakatsekitar, maka akan diperbaiki secepatnya,” ujar Halim. Seandainya pekerjaan tidak sesuai bestek, maka masalah ini akan dikaji kembali sehingga bisa ditentukansiapayangseharusnya bertanggung jawab. “Paling penting, kita ketahui dulu penyebab kerusakan, sehingga bisa diantisipasi secepat mungkin,” ujar Halim sambil menambahkan, perbaikan diupayakan pada TA 2012 supaya kerusakannya tidak bertambah parah. Di tempat terpisah, aktifis LSM Asahan, M. Roby MA menduga, kerusakan jembatan sungai Asahan itu, lebih dominan akibat pekerjaannya tidak sesuai bestek. Alasannya, ketika jembatan itu belum diresmikan,

pertemuan abudmen dengan tembok penahan kiri kanan oprit jembatan di wilayah Seikepayang Barat, sudah retak. Dan, kata Roby, bangunan yang retak itu ditempel seadanya saja ketika hendak diresmikan. “Tidak logika jika kerusakan jembatan ini akibat faktor alam ataupunfaktorusia.Soalnyajembatan ini selesai dibangun 2006 dan diresmikan Mei 2008,” ujar Roby. Sebelumnya, jembatan sungai Asahan menghubungkan Kota Tanjungbalai dengan Kec. Seikepayang Barat, Kab. Asahan, terancam ambruk karena plat injakdanopritturunhingga4inci. Akibatnya, pertemuan abudmen dengan tembok penahan kiri kanan oprit jembatan di wilayah SeikepayangBarat,menimbulkan rongga besar. Seharusnya oprit jembatan diisi tanah uruk, tapi ternyata hanya diisi pasir yang dikemas dalam karung atau goni plastik. (a14/a15)

Dua Bocah Kakak Beradik Diperkosa Pria Cacat KOTAPINANG (Waspada): Selasa(6/12)soremerupakanhari nahas bagi dua kakak beradik sebut saja Bunga, 12, siswi kelas 1 SMP dan adiknya Mawar, 9, siswi kelas 4 SD. Kedua bocah warga Kec. Torgamba, Kab. Labuhanbatu Selatan (Labusel) itu jadi korban perkosaan seorang priacacatyangtidakmerekakenal sebelumnya. Kedua korban yang hingga kini masih trauma itu diperkosa oleh N, 25, warga Dusun Sulum, Desa Pengarungan, Kec. Torgamba di areal salah satu perkebunan kelapa sawit tak jauh dari

kediaman kedua korban. Akibat prilaku pria yang menderita cacat padabagiantangandankaki,serta sudah beristri dan memiliki seorang anak itu, kedua korban kini harus dirawat intensif di Ruang Anak, RSU Nur Aini, Kotapinang. Saat ditemui Waspada, Rabu (7/12) siang, kedua korban masih terbaring lemah di ruang perawatan rumah sakit yang terletak di Jalinsum, Blok IX, Kotapinang. Di lengan mereka masih menancap jarum infus. Kedua orangtua mereka juga terlihat termenung sambil sesekali menatap ke arah kedua anaknya.

Peristiwa perkosaan ini sontakmenghebohkanseluruhwarga kampung dan melaporkannya ke pihak PolsekTorgamba. Hanya dalam hitungan jam, Polisi berhasil meringkus pelaku di kediamannya. Sementara Bunga yang mengalami pendarahan langsung dibawa ke rumah sakit untuk mendapatkan pertolongan.“Waktuituanaksayamengalami pendarahan. Setelah dibawakeklinikkebunkemudiandilarikankeRSUNurAiniuntukmendapatkan pertolongan,” katanya. Dia berharap pelaku mendapat hukuman setimpal atas

perbuatannya.Akibatulahpelaku, kini kedua putrinya itu terancam kehilanganmasadepan.“Maunya mati saja bajingan itu. Anak ku udah dinodainya,” katanya. Pelaku kini mendekam di ruang tahanan Mapolres Labuhanbatu untuk mempertanggungjawabkan perbuatannya. Kasat Reskrim Polres Labuhanbatu, AKP Tito Travolta yang dikonfirmasimengatakan,pelaku masihdimintaiketeranganterkait kasus itu. “Masih dilakukan pemeriksaan. Untuk keterangan lebih lanjut ke Kapolres saja ya,” katanya. (c18)

Pendapatan Batubara 2012 Rp633,7 M LIMAPULUH (Waspada): Total Pendapatan Daerah Kab. Batubara Tahun 2012 sebesar Rp633.788.926.964. ‘’Rata-rata persentase kenaikan ini Rp93,1 miliar atau 17,22 % dibanding tahun sebelumnya 2011,’’ tukas Bupati H OK Arya Zulkarnain, SH,MM pada penyampaian nota pengantar keuangan APBD Tahun 2012 dalam sidang paripurna DPRD Kab. Batubara, Rabu (7/12). Sumber pendapatan meliputi PAD Rp17,089 miliar, dana perimbangan Rp528,1 miliar

dan lain-lain pendapatan daerah yang sah Rp 88,5 miliar. Sedangkan PAD dari pajak daerah Rp6,2 miliar atau naik sebesar Rp14,14 % dari tahun sebelumnya sama seperti retribusi daerah mencapai Rp3,8 miliar. ‘’Ini salah satu keuntungan penerimaan retribusi KTP dan akta kelahiran pada Dukcapil dan program E-KTP,’’ ujarnya. Lain-lain PAD yang sah Rp7 miliar sama Tahun 2011. Penerimaan dana perimbangan dari Bagi Hasil Pajak dan Bukan Pajak (BHP dan BHBP) Rp31,7 miliar, DAU Rp452,2 miliar, DAK Rp44,1

masing-masing mengalami peningkatan. Penerimaan lainlain dari bagi hasil pajak provinsi Rp13,8 miliar dan bantuan keuangan Rp18,2 miliar. Bupati berharap, terjadi kenaikan dana perimbangan dari target ditetapkan, sebab potensi Bagi Hasil Pajak (PBB, PPH) masih sangat memungkinkan untuk mendongkrak. Karena realisasinya sampai semester 1 Tahun 2011 baru mencapai Rp6,6 miliar dari target Rp17,3 miliar (38,36%) dan Bagi Hasil Bukan Pajak Rp145,4 juta dari target Rp557,3 juta

(26,09%). ‘’Bagi Hasil Pajak untuk Batubara perlu dilakukan penghitungan ulang, sehingga keberadaannya diharapkan dapat mewujudkan stabilitas fiskal daerah khususnya dalam memberikan ketersediaan sumber pembiayaan dalam menjaga kelancaran penyelenggaraan pemerintahan dan peningkatan kualitas pelayanan publik,” ujarnya pada sidang dipimpin Ketua DPRD Batubara Selamat Arifin SE. MSi dan anggota dewan beserta jajaran SKPD, undangan yang hadir. (a13)

KORPRI Asahan Membangun Kekuatan KONSOLIDASI dan regenerasi dalam tubuh Korpri Asahan cenderung membangun kekuatan untuk kepemimpinan Bupati/Wakil Bupati Asahan namun jika kekuatanituberbalikarahtidak loyalis akan sangat mempengaruhi kinerja Pemkab Asahan. Sesuai Perda Kab. Asahan nomor 6 tahun 2011 Sekretaris DPK KORPRI Kabupaten Asahan adalah Kepala SKPD Sekretariat KORPRI Asahan, sehingga suatu hal mustahil bila kekuatan KORPRI berbalik arahterhadapkepemimpinan di Pemkab Asahan. Namun dalam euphoria kekuasaan atau demokrasi saat ini, tidak ada hal yang mustahil. KORPRI Asahan dengan8.236anggota memiliki iuran Rp103.000.000, ditambah DPD dan DPC PurnabhaktiPNSAsahan.Lantasada wacana pengorganisiran putra-putri PNS/Pensiunan PNS, KORPRI Asahan akan berwujudsebagaisebuahlembaga sosial yang punya posisi

tawar politik. Agaknya wajar saja KORPRI Asahan punya “hasrat politik” menempatkan kader terbaiknya dalam pentas suksesi kepemimpinan Kab. Asahan. Karena, jika berhasilakanmemperkuatpemerintahan daerah ini dalam melayani publik. Perlu disikapi pembentukan DPD dan DPC Purnabhakti PNS dan wacana pembentukan generasi mudanya akan mempengaruhi peta politik Kabupaten Asahan, apalagi melihat figur Mhd. Sofyan Yoga yang juga Ketua Depicab SOKSI Asahan, Ketua KAHMI Asahan, Wakil Ketua SOKSI Sumut. Mantan Ketua DPD KNPI Asahan 1991-1994 ini yang menjabatStaffAhliBupatiAsahanBidang Pembangunanpunyapengalaman matang di birokrasi mulai dari pejabatKepalaBagiandiSekretariat sampai jabatan eselon II. Jika dicermati penghunjukan Sofyan Yoga sebagai Ketua Tim Pengembangan Kebudayaan, agaknya mencerminkan Taufan menjadikan Sofyan laksana “Panglima Politik” atau “Bemper

WASPADA Kamis 8 Desember 2011

Politik” bagi kekuasaan Taufan/ Surya. Tim ini sedang menyusun perhelatan pesta seni budaya rakyat Asahan tahun 2013. Loyalitas Sofyan sudah terbukti dalam perjalanan karir PNS dan keorganisasian. “Resiko sebagaikader.Loyalitasdandedikasi harus tetap terjaga kualitasnya. Jangan menafsirkan macammacam, kami ingin membangun KORPRI sebagai sebuah organisasi yang bermanfaat,” ujarYoga dikonfirmasi Selasa (6/12). Masih relakah Sofyan Yoga jadi“tumbalpolitik”sebagaimana pernah dijalaninya di masa kepemimpinan Bupati (alm) Drs. H. Risuddin? Mampukah Taufan mengendalikan dan memanfaatkan “hasrat politik” Sofyan Yoga untuk menopang kepemimpinannya di Asahan? Keunggulan KORPRI Asahan di Sumut, antara lain pemberdayaanIuranuntukkesejahteraan anggota, organ sampai tingkat kecamatan, tradisi usung jenazah anggota KORPRI, menyusul terbentuknya DPD Purnabhakti PNS Asahan sampai tingkat kecamatan. Keunikan lain,

KORPRI Asahan tidak dipimpin Sekdakab sebagaimana lazimnya KORPRI di kabupaten lain. Melihat konfigurasi yang dibangun KORPRI Asahan dalam konsolidasi serta regenerasi, sangat ideal dan strategis, khususnya membangunan kekuatan

keluarga besar PNS Kabupaten Asahan, apalagi jika terwujud wadah putra putrid PNS/Pensiunan PNS. Taufan jeli memberi kesempatan luas bagi KORPRI Asa-han di bawah kepemimpinan Sofyan Yoga untuk mengem-bangkan

organ. Akan menjadi katup efisien bagi Taufan, baik internal maupun eksternal. Hal ini patut menjadi model percontohan KORPRI kabupaten/kota lainya di Sumut bahkan nasioal. * Nurkarim Nehe

Waspada/Nurkarim Nehe

BUPATI Asahan Drs.H.Taufan Gama Simatupang MAP menyerahkan pengembalian iuran anggota KORPRI secara simbolis dalam puncak HUT KORPRI Asahan ke 40 tanggal 29 November.

Warga Kuatir Oprit Jembatan Bagandalam Rubuh BAGANDALAM-Batubara (Waspada): Warga Dusun I dan VI Desa Bagandalam Tanjung tiram Batubara merasa kuatir oprit (penyangga pangkal jembatan) di desa itu sewaktu-waktu bisa rubuh karena bangunan turapnya retak-retak “Apalagi kalau oprit diisi tanah timbun, bisa saja turapnya merekah ambruk menimpa rumah warga disampingnya” kata Naharuddin Ancil, Kadus I Bagandalam, Selasa (6/12). Menurut warga, pembangunan jembatan di sana sempat terbengkalai menelan dana dua tahun anggaran, APBD Batubara tahun 2009 Rp812 juta dan 2011 Rp400 juta lebih. Saat ini bangunan jembatan belum siap, dan lanjutan pekerjaan pembuatan lantai menyeberang Dusun I ke Dusun VI meski oprit di ujung jembatan belum diisi tanah timbun. Diragukan daya tahan turapsudahretak,bahkanditopangtiangcorbisaambrukmengancam jiwa/rumah warga. Warga minta Kadis PU Batubara turun ke lokasi mencek kondisi jembatan yang menelan dana Rp1,2 miliar itu agar bermanfaat bagi masyarakat nelayan setempat. (a12)

Buruh Lepas Minta Bupati Bongkar Portal Di Airjoman AIRJOMAN (Waspada): Para pekerja harian lepas UD. Asam Mulana meminta Bupati Asahan Taufan Gama Simatupang agar memerintahkan pembongkaran portal di Jalan Lintas Asahan-Kota Tanjungbalai, di Desa Airjoman Baru, Kec. Airjoman. Permintaan itu disampaikan mereka melalui surat tertulis yang ditandatangani 70 pekerja dan Ketua Solidaritas Pekerja Harian Lepas UD. Asam Mulana (SPHL) Airjoman Baru, Mukodas. “Selain ditujukan ke Bupati Asahan, surat ini kita tembuskan ke Ketua DPRD Asahan, Kadis PU Asahan, Kadis Perhubungan Asahan, Camat Airjoman dan Kades Airjoman Baru,” ujar Mukodas kepadaWaspada, Rabu (7/12). Mukodas menuturkan, mereka meminta agar portal itu dibongkar dengantujuanmelancarkankeluarmasuknyahasilpertaniantermasuk bahan baku oleh UD. Asam Mulana. “Jika portal dibongkar, berarti arus lalu lintas hasil pertanian lancar dan berpengaruh untuk mengurangi pengangguran di Airjoman Baru dan sekitarnya,” jelas Mukodas. Menurut Mukodas, saat ini, truk pengangkut hasil pertanian sulitmasukkedaerahtersebut,sehinggamerekakesulitanmemperoleh bahan baku untuk diolah dan selanjutnya dipasarkan ke luar daerah. Bupati Asahan Taufan Gama Simatupang dikonfirmasi melalui Kabag Humas Rahman Halim membenarkan tidak adanya peraturan tentang portal jalan. Mengenai portal di Desa Airjoman Baru, Kec. Airjoman, menurut Halim, Pemkab akan meneliti keberadaannya. “Siapa yang membangun, apakah Pemerintah Desa,” ujar Halim. Selain itu, lanjut Halim, Pemkab akan mengundang Camat dan Kepala Desa serta masyarakat untuk membicarakan keberadaan portal tersebut. (a14)

Waspada/Rahmad F Siregar

PORTAL di Jalan Lintas Asahan-Kota Tanjungbalai di Desa Airjoman Baru, Kec. Airjoman.

Komplotan Pembobol Kantor Camat Diringkus TANJUNGBALAI (Waspada): Dua dari tiga diduga komplotan pembobol Kantor Camat Seitualang Raso yang mencuri alat pembuatan KTP elektronik diringkus, Rabu (7/12) siang. Dari tangan kedua tersangka berhasil diamankan dua unit kamera merk Canon dan tiga alat penyimpan energi listrik yang digunakan untuk komputer (UPS). Namun sayang, otak dari pencurian itu berhasil melarikan diri. Informasi dihimpun Waspada, kedua tersangka RD alias Dani, 19, warga Gg. Peringgan, dan seorang bocah Sya alias Ipul, 15, warga Gg. Andak, Kel. Pasarbaru, Kec. Seitualang Raso. Sedangkan seorang lainnya diidentifikasi bernama Ip, juga warga Seitualang Raso. Mereka ditangkap didekat rel kereta api (KA) tepat berada di belakang kantor camat saat akan mengambil karung plastik berisi hasil curian. Namun belum sempat barang-barang itu dibawa, petugas Polsek Seitualang Raso tiba-tiba datang dan menyergap. “Gembongnya melarikan diri, namun telah kita identitasnya dan masih dalam perburuan,” ungkap Kapolres Tanjungbalai AKBP EP Sirait, melalui Kasubbag Humas AKP Y Sinulingga didampingi Kapolsek Seitualang Raso AKP Ruslan Lubis. Dikatakan, aksi pembobolan terjadi beberapa hari lalu dan di luar dugaan hasil curian ternyata masih disembunyikan di sekitar lokasi. “Saat mengambil barang curian itulah kita tangkap mereka,” papar Kapolsek yang juga didampingi Juru Periksa H Nadeak. (a32)

Musda KNPI L. Batu 16-17 Desember RANTAUPRAPAT (Waspada): Musyawarah Daerah (Musda) XII Dewan Pimpinan Daerah Komite Nasional Pemuda Indonesia (DPD KNPI) Kab. Labuhanbatu dipastikan berlangsung 16-17 Desember 2011. Ketua DPD KNPI L. Batu H. Kamal Ilham SKM MM didampingi Sekretaris M Risfan SH, Ketua OC Sahrial dan Ketua SC Andi Pati Dana, menyampaikan itu kepada Waspada, Selasa (6/12) di Aula Sekretariat DPD KNPI L. Batu Jl SM Raja Rantauprapat. Dikatakan, persiapan untuk pelaksanaan Musda sudah hampir rampung, yakni mencapai 75 persen. Progress itu tercapai karena kerja keras panitia OC dan SC Musda KNPI XII. Sekretaris DPD KNPI L. Batu M Risfan SH yang juga salah satu kandidat Ketua DPD KNPI menyampaikan, dengan kerja keras semua panitia OC dan SC, persiapan Musda XII KNPI L. Batu akhirnya mendekati final dan tentu saja hal ini tidak terlepas dari dukungan dan bantuan dari Bupati L. Batu dr H Tigor Panusunan Siregar, SpPD. Sementara Ketua Organizing Committee (OC) Sahrial SE menepis rumor yang menyatakan panitia tidak akan mampu menggelar Musda KNPI L. Batu XII karena dianggap tidak memiliki kemampuan finansial. Ditegaskannya, panitia siap bersimbah keringat untuk mensukseskan Musda KNPI L. Batu XII dan tidak ada persoalan yang membuat panitia Musda tidak berdaya melaksanakan even tersebut. (a18)

Sumatera Utara

WASPADA Kamis 8 Desember 2011


Dinas Pertamanan P.Sidimpuan Dilapor Ke Poldasu P.SIDIMPUAN (Waspada): Dinas Kebersihan Pertamanan dan Pencegahan Kebakaran Kota Padangsidimpuan dilaporkan ke Polda Sumatera Utara (Poldasu), terkait dugaan proyek fiktif dan mark up anggaran kegiatan proyek tahun 2010. Laporan tersebut dibuat LSM Pemantau Birokrasi Pemerintahan (PBP) Kota Padangsidimpuan diketuai Ammar Goozali Lubis dan Sekretaris MuhammadSukurNasutionSPd,melalui surat No: 350/L/PBP/XI/2011 tertanggal 16 November 2011 dengan tujuan langsung ke Kapoldasu. “Kita tetap mengedepankan asas praduga tidak bersalah. Dalam laporan ini kita lampirkan sejumlah data pembuktian terjadinya dugaan tindak pidana korupsi di dinas tersebut,” kata

Ammar dan Sukur di Padangsidimpuan, Rabu (7/12). Pada APBD Kota Padangsidimpuan TA 2010 terdapat kode rekening1. dengan item Belanja Pemeliharaan LPJU Rp360.000.000. Kemudian kode rekening Modal Pengadaan Lampu Hias Jalan Rp315.000.000. Hasil investigasi dan analisa LSM PBP Kota Padangsidimpuan, kegiatan yang ditampung dalam kode rekening berbiaya

Rp360.000.000, sama sekali tidak dikerjakan alias fiktif. “Kode rekening berbiaya Rp360.000.000 kami duga fiktif. Hal ini berdasarkan pada kondisi LPJU di wilayah Padangsidimpuanyangmasihrusakdantanpa pemeliharaan sampai sekarang. Dalam laporan itu juga kami lampirkan dokumen Foto sebagai bukti,” sebut Ammar Disebutkan, pelaksanaan kegiatankoderekening1.08.02.01. berbiaya Rp315.000.000 dengan nama kegiatan Pemeliharaan Ruang Terbuka Hijau (RTH), diduga telah terjadi penggelembungan atau mark up harga barang hingga totalnya mencapai Rp166.761.500. “Untuk pembuktiannya, kita

juga melampirkan data perbandingan harga satuan barang yang dibuatpanitialelangdenganharga satuanbarangsejenisditokoyang ada di Kota Padangsidimpuan,” tambah Sukur sembari menyebut jumlah penggelembungan itu cukup fantastis. Dalam proyek tersebut LSM PBP juga menemukan pelanggaran berupa pemiktifan kerja di lapangan. Karena sesuai SPP kontrak No.602/07/SPP/2010, total lampu jalan yang dikerjakan 165 titik dan 15 tiang. Di lapangan hanya 106 titik dan 10 tiang. Bantah Kadis Kebersihan Pertamanan dan Pemadam Kebakaran, Dra Syahraini Lubis, yang dikonfirmasi melalui Kasi Penataan Lingkungan,MSaidzal,membantah tudingan yang ada pada laporan tersebut.

“Sebelum ini kami juga telah diperiksa di Kejatisu terkait laporan yang sama dan oleh lembaga yang sama pula. Kita telah dimintai keterangan dan dinyatakan tidak ada ditemukan pelanggaran,” katanya. M Saidzal yang terlibat langsung dalam pelaksaanaan kegiatansebagaimanayangtercantum pada APBD TA 2010 dengan kode rekening dan, menyatakan tidak ada yangdifiktifkanataupunanggaran yang digelembungkan. “Saya rasa mereka saja yang kurang teliti dan kurang menguasainya. Karena apa yang dilaporkan tersebut sama sekali tidak pernah ditanyakan pada kami,” ujarnya sembari menyatakan pihaknyasiapuntukmenghadapi laporan tersebut. (a27)

80 Persen Sekolah Di Madina Belum Dimasuki Listrik PANYABUNGAN(Waspada): Sekitar 80 persen sekolah di KabupatenMandailingNatalbelum dimasuki aliran listrik, padahal arus tersebut sangat vital dalam menunjang proses belajar siswa dan tenaga pendidik. Hal itu disampaikan Ketua Persatuan Guru Republik Indonesia (PGRI) Madina Drs. H. Musaddad Daulay, MM saat hearing dengan Badan Legislasi (Baleg) DPRD dipimpin H. Binsar Nasution terkait Rencana PembangunanJangkaMenengah Daerah (RPJMD) tahun 2011-

2016 yang salah satu program prioritasnya yakni kegiatan pendidikan gratis. Menurutnya, salah satu faktor pendukung pendidikan adalahkelengkapanfasilitas(media pendidikan).Fasilitaspendi-dikan merupakan sesuatu yang bisa membantu kelancaran pendidikan, baik proses belajarmengajar, administrasi, pengelolaan pendidikan dan mediamedia pendidikan yang bersifat elektrik (menggunakan listrik). Dikatakan,dizamansekarang pengelolaan pendidikan yang

Kompor Gas Meledak SIDIKALANG (Waspada): Hamonangan Sihotang, 37, Sekretaris Desa Sileuleu Kec. Sumbul, Kab. Dairi mengalami luka bakar di sekujur tubuh akibat tabung gas 3 kg yang digunakan untuk memasak, Senin (5/12) sore meledak. Korban kemudian dilarikan ke RSUD Sidikalang. Menurut keterangan, Selasa (6/12), peristiwa itu terjadi saat Nolesta br Silalahi, istri Sihotang, memasak di dapur. Penyebab ledakan diduga akibat ada kebocoran di selang kompor. Ledakan sempat membuat warga terkejut dan panik. “Tadinya sempatkukiraadabom,”ujarSihombing,wargaSileuleu.Hamonangan yang mengalami luka bakar di kaki, tangan dan wajah kemudian dilarikan dan dirawat di RSUD Sidikalang.(a20)

Pelayanan e-KTP Tapsel 65,56 Persen P.SIDIMPUAN (Waspada): Pemkab Tapanuli Selatan sudah melayani penerbitan 118.378 Kartu Tanda Penduduk Elektronik (e-KTP) atau 65,56 persen dari 180.575 target wajib KTP yang harus dicapai hingga 31 Desember nanti. Hal itu terungkap dalam rapat evaluasi pelayanan e-KTP dipimpin Bupati H. Syahrul M Pasaribu, didampingi Wakil Bupati H. Aldinz Rapolo Siregar, bersama Plt Kadis Kependudukan dan Pencatatan Sipil, H. Hotma Dalid Harahap S.Sos.MAP, dan 14 Camat se-Tapsel, Selasa (6/12) sore. Evaluasi pelayanan e-KTP ini sangat penting, karena selain merumuskan cara pencapaian target juga sebagai sarana tukar informasi sesama camat dalam mengejar target layanan 180.575 wajib KTP hingga akhir 2011. “Target harus tercapai, karena ini menyangkut ’marwah’ daerah kita. Saya ingatkan kepada Camat dan Dinas Dukcapil, sebelum ayam berkokok masuk tahun 2012, pelayanan e-KTP sudah terekam semua dan jangan amburadul dalam mengerjakannya,” pesan Bupati Tapsel. Syahrul M Pasaribu menekankan, target kinerja harus dapat terselesaikan sebagaimana amanat undang-undang kependudukan dan komitmen Pemkab Tapsel dalam pelayanan e-KTP ini. Disebutkannya, pencapaian target pelayanan yang diperoleh Tapsel saat ini termasuk kategori terbaik dibanding 14 dari 33 kab/ kota di Sumatera Utara yang tahun ini melaksanakan program pelayanan e-KTP. “Rentang waktu pencapaian target 100 persen tinggal 3 pekan lagi. Saya berlakukan reward and punishment kepada aparatur pelaksana pelayanan yang mampu mencapai target di tingkat kabupaten, kecamatan, desa, kelurahan,” ujarnya. Dalam rapat itu Wakil Bupati, Aldinz Rapolo Siregar, bersama Plt. Kadis Dukcapil, Hotma Dalid Harahap, dan Camat se-Tapsel menyimpulkan beberapa langkah strategis yang akan ditempuh antara lain memaksimalkan target layanan setiap harinya dengan cara menambah undangan dan waktu pelayanan. (a27)

bersifat administrasi pembukuan (penulisan) hampir rata-rata menggunakan komputer, sebab itumudahdilakukan,lebihpraktis dan hasilnya pun bangus, sehinggajikaadalistrik,pihaksekolah bisa mengerjakan administrasi denganmenggunakankomputer dan database siswa dan alat elektronik lainnya. “Memang pendidikan bisa dijalankan dalam situasi apapun. Tetapi kita bisa membayangkan bagaimana pendidikan tersebut bisa berkembang dan berjalan dengan baik tanpa ada listrik,” ungkapnya. Menyangkut aplikasi pendidikan gratis di Madina, katanya, amat sangat visioner dengan program wajib belajar 12 tahun yang dirintis oleh pemerintah pusat melalui Kementerian Pendidikan Nasional. “Di saat pemerintah pusat masih menggagas wajib belajar 12 tahun, Pemkab

Madina sudah membuat program pendidikan gratis guna peningkatan akses pendidikan berkualitasdidaerahini,”jelasnya. Ia berharap, untuk meletakkan pendidikan gratis sebagai bidang prioritas, ada baiknya Dinas Pendidikan dan Kementerian Agama Madina duduk satu meja, agar tidak ada perbedaan sekolah negeri dan swasta. Artinya, perlu ada tatanan dan kalaborasi dari stakeholder agar semua menikmati program pendidikan gratis itu. “Untuk mewujudkan program pendidikan gratis sebagai salah satu program kerja utama Bupati Hidayat Batubara dan Wabup Dahlan Hasan Nasution limatahunkedepan,pemerintah, komite sekolah dan orangtua diharapkan dapat berkalaborasi, apalagi kulitas guru mendukung sepenuhnya program ini dengan adanya sertifikasi,” tambahnya.

UPTD Permanen Selain masalah sarana listrik, duniapendidikandiMadinasebut Musaddad Daulay, juga masih dihadapkan kepada persoalan peran UPTD Pendidikan di kecamatan-kecamatan, karena hingga saat ini tidak ada yang permanen. “Sentra pendidikan itu ada di sana, karena peran UPTD sangat penting dalam menyusun program kerja, pembinaan, pengawasan serta pengendalian penyelenggaraan pelayanankegiatanpendidikanditingkat kecamatan,” terangnya. UPTD kecamatan lanjutnya juga berfungsi melaksanakan pembinaan, pengawasan, monitoring, evaluasi pelaksanaan pendidikan yang meliputi kurikulum, sarana dan prasarana pendidikan danpengurusanpendidikankhususnyaPraSekolahyangmerupakan penentu keberhasilan pendidikan ke depan. (a28)

Kantor Pemerintah Ulupungkut Numpang Di Rumah Warga PANYABUNGAN(Waspada): Meski sudah hampir lima tahun dimekarkan dari kecamatan induk Kotanopan, sarana fasilitas perkantoran di Kecamatan Ulupungkut Kabupaten Mandailing Natal masih minim. Hampir semua kantor pemerintah di kecamatan itu menumpang, menyewa serta menempati rumah penduduk. Tokoh masyarakat Ulupungkut, Syafruddin Lubis, Rabu (7/ 12)mengatakan,akibatminimnya fasilitas perkantoran itu, otomatis mengganggu kelancaran pelayanan kepada masyarakat utamanya di bidang administrasi. “Kantor Camat Ulupungkut hinggasaatinimasihmenumpang dibangunan sekolah dasar (SD) yang ada di ibukota kecamatan

itu. Ironis rasanya, suatu kecamatan tidak ada kantor camatnya yang permanen,” ungkapnya. Selainitu,katanya,jikamelihat kantor UPTD-UPTD dan kelurahan yang saat ini masih menumpang. Begitu juga dengan kantor KUAyangmasihmemamfaatkan rumah penduduk. “Sarana dan prasarana yang memadai sangat perluuntukmenunjangterwujudnya pemerintahan yang baik dan bisamemberikanpelayananyang maksimal kepada masyarakat luas,” jelasnya. Hal sama juga disampaikan Andi Hakim. Disebutkan, setelah mekar dan berpisah dari kecamatanindukKotanopan,pemerintah Ulupungut terus berbenah diri, namun di lapangan ditemukan kendala akibat kurangnya sarana

dan prasarana perkantoran. “Pembenahan untuk peningkatan pembangunan terus dilakukan kendati untuk mencapainya memiliki tantangan dan hambatan. Kami memang kekurangansaranadanprasarana dan ini perlu menjadi perhatian pemerintah daerah, agar proses pemerintahan di Ulupungkut tetap berjalan, aman dan terkendali,” tuturnya. Untuk itu, keduanya berharap agar Pemkab Madina di bawah komando Bupati Hidayat Batubara dan Wabup Dahlan Hasan Nasution dapat sesegera mungkin membangun sarana kantor pemerintahan di Kecamatan Ulupungkut guna peningkatan pelayanan kepada masyarakat setempat.(a28)

Waspada/Sarmin Harahap

PULUHAN massa GEMPUR saat unjukrasa, Selasa (6/12) di Kantor Kajari, Pertamben, dan DPRD.

Warga Khawatir Longsor Susulan ANGKOLA SELATAN (Waspada): Sejumlah orangtua dan siswa SMA Negeri 1 Angkola Selatan khawatir terjadi longsor susulan dari bukit ke kawasan gedung sekolah ketika anak mereka di kelas mengikuti pelajaran. Hal itu diutarakan orang tua siswa Jamangasi Harahap, 45, di Desa Simarpinggan kepada Waspada di rumahnya. Dia kecewa, perhatian dari pemerintah tak kunjung tiba untuk memperbaiki ruang kelas yang jebol dihantam longsor kemarin dan harapannya pemerintah segera membangun penahan tanah di atas perbukitan lokasi gedung sekolah. ‘’Anak saya dan sejumlah kawan-kawannya mengeluh akibatnya mereka tidak dapat berkonsentrasi belajar di ruangan laboratorium komputer seperti biasanya di ruangan kelas sebelumnya, mereka takut longsor susulan terjadi dan merenggut nyawa mereka. Bea nomahita on pak (Bagaimana lagi kita ini pak) apalagi anak saya itu nantinya mau Ujian Nasional (UN),’’ keluh Jamangasi, Selasa (6/12). Menurut Jamangasi, bukit yang ada di atas perbukitangedungsekolahitusudahmengancam keselamatan para guru yang mengajar serta siswa di ruangan kelas. Jangan sampai ada korban jiwa seperti yang terjadi di Pulau Nias baru-baru ini yang telah menelan korban jiwa puluhan orang

Waspada/Syarif Ali Usman

BUPATI Padang Lawas H. Basyrah Lubis bersama Muspida saat memberikan bantuan secara simbolis kepada ribuan fakir miskin dan anak yatim, khatib dan bilal dalam perayaan Hari Raya Asyura di lapangan Merdeka Sibuhuan.

Bubur Asyura Ala Padang Lawas SIBUHUAN (Waspada): Perayaan hari Asyura atau hari ke10 dalam bulan Muharram terus menjadi tradisi di Kab. Padang Lawas. Perayaan ditandai dengan pembuatan ribuan porsi bubur asyura yang dirangkai dengan penyerahan bantuan dan pawai diiringi drum band dari sejumlah sekolah. PantauanWaspada,Selasa(7/ 11)pukul10:00,LapanganMerdeka Sibuhuan yang terletak persis di depan Pendopo Pemkab Palas telah ramai dihadiri kaum ibu untuk bergotong royong menyiapkan ribuan porsi bubur tersebut. Pembuatan bubur asyuro yang diiringi dengan penampilan irama gambus dari group gambus Pemkab, menarik perhatian warga dan sempat memacetkan Jalinsum Sibuhuan –Riau

Pada pukul 14:00, perayaan kembali digelar dengan acara pawai diiringi drum band dari sejumlahsekolahtingkatSD,SMP dan SMA. Pawai dilaksanakan di sekitar jalan protokol Sibuhuan kemudian berahir di Lapangan Merdeka. Puncakacaraditandaidengan pelaksanaan pengajian dihadiri ribuan anggota pengajian Amaliah Akbar se-Kab Padang Lawas, kemudian penyerahan bantuan kepada 2.085 KK fakir miskin dan anak yatim, 390imammasjid,358 khatib, 312 bilal mayit laki-laki dan 312 bilal mayit perempuan dan 415 orang penyandang cacat. Bupati Padang Lawas H. BasyrahLubisdalamkesempatan itu mengatakan Hijrah sebagai proses perubahan merupakan keharusan yang harus dilakukan

terus-menerus. Berpindah dari yang tidak baik menuju ke yang lebihbaikatauberpindahdariyang diharamkan Allah menuju yang dihalalkan harus dilaksanakan. Melalui peringatan tersebut dia berharap kepada warga agar tetap menjalin silaturrahmi antar muslim dan meningkatkan kerjasama dalam segala bidang untuk mencapaipembangunanPadang Lawas dengan kebersamaan. Puncakacaradiakhiridengan pencerahan disampaikan AlUstadz Muhammad Hasbi AlMawardi Lubis S.Ag. Hadir dalam acara tersebut Kapolres Tapsel AKBP Subandriya, SH, MH, Ketua Pengadilan Agama Tapsel H. Aspan Pulungan,Wakil Bupati H. Ali Sutan Harahap (TSO). Ketua DPRD Palas H.M Ridho Harahap serta ribuan warga. (a34)

siswa salah satu murid SMA akibat longsoran tanah. AmatanWaspada, jarak bukit sekira 20 meter dari dinding gedung SMA tersebut ke lokasi tanah yang sudah gembur dan rawan longsor di Kelurahan Napa, Kecamatan Angkola Selatan Kab. Tapanuli Selatan (Tapsel), kemarin satu ruangan kelas jebol oleh longsoran dari atas bukit di antara tiga ruangan kelas yang ada di bawah perbukitan itu. Kepala Sekolah Darazad Daulay SPd menjelaskan, ruangan kelas yang telah jebol akibat longsoran tanah sudah dibuat permohonan kepada pemerintah agar segera diperbaiki. ‘’Kita sudahmembuatpermohonankepadapemerintah agar ruangan kelas segera diperbaiki. Kemudian perbukitan di bawah lokasi gedung sekolah sudah kita buat juga permohonannya agar tanah yang sudah gembur itu tidak mengalami longsor jika sudah dibangun penahan terbuat dari beton,’’ ungkap Daulay. Anggota DPRD Tapsel yang juga Ketua Fraksi Partai Demokrat membidangi pendidikan, H Darwis Sitompul SE mengatakan akan memantau penanganan perbaikan sekolah tersebut. ‘’Kita sebagaiwakilrakyattetapproterhadappenderitaan rakyat,SMANegeri1AngkolaSelatankitaharapkan sebagai ‘PR’ bersama,’’ tegas Darwis. (c13)

Pelayanan Puskesmas 24 Jam Di Simalungun Disambut Positif SIMALUNGUN (Waspada): Kalangan DPRD Simalungun mengapresiasi operasional Puskesmas 24 jam di Kab. Simalungun, sebagai salah satu langkah nyata yang dilakukan pemerintah daerahdalammeningkatkanpelayanankesehatan kepada masyarakat. Anggota DPRD Simalungun, Bernhard Damanik, mengatakan sejauh pengamatan legislatif operasional Puskesmas 24 jam mendapat sambutan positif masyarakat. “Kami melihat masyarakat sangat terbantu sekali dengan beroperasinya Puskesmas di kecamatan selama 24 jam,” ujar Damanik, Rabu (7/12), di gedung DPRD Simalungun. Politisi PIB itu berharap, Pemkab Simalungun terus meningkatkan pelayanan prima di bidang kesehatan, khususnya dalam hal pelayanan

Puskesmas, sehingga pelayanan optimal yang diberikan tidak hanya sebentar dinikmati masyarakat. Pemkab juga diharapkan memberi perhatian terhadap peningkatan kesejahteraan petugas medis atau PNS yang bertugas dalam pelayanan Puskesmas 24 jam. Bupati Simalungun, JR Saragih memberlakukan operasional Puskesmas 24 jam sejak beberapa bulan lalu, karena banyak menerima keluhan masyarakat. “Puskesmas 24 jam untuk menjawab keluhan masyarakat, yang sulit mendapat pelayanan kesehatan setelah Puskesmas tutup pada jam kerja,” ujar JR. Ke depan, tambah JR, Pemkab Simalungun juga berupaya memberi pelayanan kesehatan 24 jam di Pos-Pos Kesehatan pedesaan.(a29)

Yonif 126/KC Adakan LUST Tingkat Kompi TA 2011 PEMATANGSIANTAR (Waspada): Batalyon Infanteri (Yonif) 126/Kala Cakti (KC) dituntut memiliki kesiapan tempur optimal hingga setiap saat siap melaksanakan tugas yang dipercaya. “Guna menegakkan kedaulatan dan menjaga keutuhan wilayah serta melindungi masyarakat darisegalabentukancaman,gangguan,hambatan dantantanganyangdapatmempengaruhistabilitas keamanan di wilayah NKRI,” tegas Danrem 022/ PT Kolonel Inf Karsiyanto melalui Kasrem 022/ PT Letkol Arm Anton Irianto Popang, SH saat memimpin pembukaan Latihan Uji Siap Tempur (LUST) bagi para prajurit Yonif 126/KC, dalam menjaga dan meningkatkan mutu tempur serta melaksanakan program latihan tahunan di lapangan Tanjung Dolok, Kab. Simalungun dan AekNatolu,Kab.TobaSamosir,sepertidikutipKapenrem 022/PT Mayor Caj Drs. Prinaldi, Rabu (7/12). Karena itu, Kasrem mengharapkan program LUST itu dapat dilaksanakan sungguh-sungguh

Bupati Madina Didesak Copot Kadis Pertambangan PANYABUNGAN (Waspada): Terkait dugaan adanya tambang siluman dan jual beli izin pertambangan di Madina yang merupakan temuan reses anggota DPRD Madina dari Partai Demokrat, Ir. Ali Mutiara saat reses, puluhan massa menamakan dirinya Gerakan Mahasiswa Pemuda Dan Rakyat (GEMPUR), Selasa (6/12) sekira pukul 10:30 mengadakan aksi unjuk rasa ke Kantor Kajari, Dinas Pertambangan dan Energi, dan ke DPRD. Kedatangan pengunjukrasa mendapat pengawalan ketat dari pihak Kepolisian dan Satpol PP Madina. Gempur dalam aksinya meminta aparat terkait mengusut dana pelelangan wilayah panas bumi tahun 2009 dan 2010 senilai Rp400 juta rupiah. Karena dinilai terlalu besar dan kesannya menghamburkan uang negara. Mereka juga menduga ada oknum pejabat di Dinas Pertambangan dan Energi (Pertamben) yang “mempermainkan” anggaran tersebut untuk kepentingan peribadi. Atas dugaan KKN di dinas tersebut, Gempur meminta Bupati Madina, Hidayat Batubara supaya mencopot Plt Kadis Pertamben, Parmonangan Hutasuhut, karena dikhawatirkan bisa membahayakan kepemimpinan bupati ke depan. Gempur dengan koordinator aksi, Wahab, Zainal Lubis, dan koordinator lapangan, Akhiruddin Lubis dkk, usai mengadakan orasi bubar dengan tertib. Kadis Pertamben, Parmonangan Hutasuhut yang dikonfirmasi via seluler mengaku anggaran tersebut digunakan secara rill baik itu untuk kebutuhan rapat di provinsi dan Jakarta, biaya rapat, pengumuman, dan biaya lainnya. (c14)

Waspada/Ahmad Cerem Meha

SISWA SMA Negeri 1 Angkola Selatan di Kelurahan Napa, Kecamatan Angsel Kab. Tapsel masih khawatir longsor susulan ke ruangan kelas mereka dari tanah di perbukitan areal sekolah, Direkam Senin (1/12).

untuk menempa kualitas kemampuan prajurit, baik perorangan, kelompok dan hubungan organisasi tugas, termasuk bagi para pejabatnya hingga diperoleh kesiapan operasional satuan yang tinggi guna menunjang keberhasilan tugas pokok. Sementara, Kasiops Korem 022/PT Letkol Inf EH. Limbong, S.Sos menyebutkan kegiatan itu diikuti 438 prajuritYonif 126/KC, terdiri Kompi SenapanA,KompiSenapanBdanKompiSenapan C ditambah 75 orang Tim Penilai dan Bulsi. Materi yang diujikan pada LUST tingkat Kompi Satuan Yonif126/KCyakniWandangkenderaan,Wandang jalan kaki, patroli penghadangan, patroli penyergapan, serangan mukim dan Han instalasi. Hadir dalam pembukaan LUST tingkat kompi Yonif 126/KC itu antara lain Danyon 126/KC, Dandim 0207/Sml, Kasatdisjan, Kasiops Korem 022/PT, Pasi Intelrem 022/PT dan Pasipersrem 022/PT.(a30)

Percepatan Pemekaran Simalungun Diperjuangkan Di Rakernas PAN MEDAN ( Waspada): Ketua DPD PAN Simalungun Salbin Damanik, SH mengatakan, pihaknya mengedepankan permasalahan krusial untuk dijadikan agenda pembahasan pada pelaksanaan Rapat Kerja Nasional (Rakernas) PAN, 9 hingga 11 Desember di Jakarta. “Di antaranya berkaitan pemekaran Simalungun Hataran yang sudah lama didambakan masyarakat, akan kita perjuangkan agar menjadi agenda pembahasan dibantu percepatan realisasinya melalui Rakernas,” kata Salbin Damanik, Rabu (7/12). D P D PA N Si m a l u n g u n j u g a a k a n menyampaikan sikap dukungan terhadap kehadiran Kawasan Ekonomi Khusus (KEK) Sei Mangke, Kab. Simalungun. Permasalahan krusial lainnya terkait kebijakan PTPN IV melakukan konversitehmenujukebunsawityangmematikan pabrik teh hitam terkenal dan bersejarah di Sidamanik, sekaligus memunculkan dampak terjadinyapengangguranratusankaryawanpabrik. Konversi teh ke sawit tahap II di lahan sekira 1.300 ha itu, memicu penolakan keras masyarakat. Sebab konversi menyebabkan sawah penduduk

terancam kekeringan. “Kita akan minta Rakernas PAN membahas sekaligus memberi pressure politik, agar konversi teh ke sawit di Sidamanik dihentikan,” ujarnya. PAN Simalungun juga minta Pemprovsu mengagendakan kembali subsidi pupuk untuk petani di Simalungun dan menganggarkannya di APBD Sumut. “Hal ini untuk menjamin swasembadapangandankeberadaanSimalungun sebagaisalahsatudaerahpenghasilberasdidaerah ini,” katanya. Sementara itu, di tempat sama jelang keberangkatan mengikuti Rakernas PAN, Ketua DPD PAN Pematang Siantar Zainal Purba menyatakan, PAN Siantar akan memperjuangkan agar kelanjutan pembangunan jalan auto ringroad demi perluasan Kota Siantar dapat dijadikan agenda pembahasan Rakernas. “Kita juga mengharapkan bantuan modal (perekonomian) untuk ibu-ibu rumah tangga di Kota Siantar, demi memberdayakan dan meningkatkan kesejahteraan masyarakat di sana,” kata Zainal, yang juga Wakil Ketua DPRD Pematangsiantar.(m14)



WASPADA Kamis 8 Desember 2011

MOU Pengurangan Emisi Gas Rumah Kaca di Los Angeles, USA tampak Gubernur Aceh, Irwandi Yusuf dan Gubernur California, Amerika Serikat Arnold Schwarzenegger.

Energi Terbarukan Dan Aceh Hijau (Aceh Green) SELURUH sumber potensi energi terbarukan berupa potensi geothermal dan hydropower yang ada di Aceh terdapat pada kawasan hutan. Oleh karenanya, sangatlah sesuai bahwa pengembangan energi terbarukan tersebut memerlukan siklus ketersediaan air dari kawasan hutan yang ada di sekitarnya.

Aceh Hijau (Aceh Green) yang dicetuskan oleh Gubernur Aceh Irwandi Yusuf, merupakan sebuah visi progresif, tentang arah baru pembangunan Aceh pasca konflik dan bencana tsunami, terutama dengan sumberdaya alam terbarukan sebagai pijakan utama. Visi Aceh Green yaitu menjaga, memelihara dan mempertahankan sumberdaya alam Aceh demi mewujudkan pembangunan ekonomi berkelanjutan melalui strategi investasi hijau untuk Aceh. Sedangkan misi yang diemban Aceh Green adalah: 1. Terwujudnya pengelolaan sumberdaya alam terbarukan, dengan cara menghabiskan tidak lebih cepat dari kemampuan alam itu tumbuh kembali. 2. Terwujudnya pengelolaan sumberdaya alam tak terbarukan, yakni dengan cara menghabiskan tidak lebih cepat dari kecepatan sumber daya terbarukan dapat menggantikannya. 3. Terwujudnya pengelolaan limbah, dengan cara tidak boleh lebih cepat dari kemampuan alam untuk memurnikan kembali limbah tersebut. Sebagai perwujudan dari visi dan misi itu maka, Aceh Green mempunyai program sebagai berikut : A. Memperkuat keamanan energi melalui pembangunan energi dari sumber daya terbarukan. 1. Geothermal. 2. Hydro power dan sumber energi

terbarukan lainnya. B. Pelestarian lingkungan melalui pengelolaan tata guna lahan, perubahan tata guna lahan dan pengelolaan hutan. 1. Pengelolaan dan perlindungan hutan primer. 2. Reforestasi dan restorasi hutan. 3. Pengembangan hutan kemasyarakatan dan perkebunan hutan. C. Pembangunan ekonomi berkelanjutan untuk membangun keamanan pangan dan peningkatan pendapatan masyarakat. 1. Pengembangan pertanian dan perkebunan skala kecil melalui kemitraan dengan pihak swasta dan perusahaan perkebunan 2. Pengembangan dan pengelolaan perikanan tangkap dan aquaculture. 3. Pembangunan infrastruktur publik. Dari uraian di atas jelaslah, pengembangan energi terbarukan di Aceh sangatlah erat kaitannya dengan pelestarian hutan. Kelestarian hutan adalah harga mati bagi pengembangan energi terbarukan dan harus mendapat dukungan dari semua pihak. Masyarakat Aceh memerlukan energi untuk penerangan listrik dan disamping itu masyarakat Aceh juga membutuhkan ketersedian dan persedian air dari kelestarian hutan. Rencana Pengembangan Energi Terbarukan Aceh Kebutuhan akan energi terutama untuk listrik sangatlah mendesak bagi kebutuhan masyarakat Aceh. Pembangunan sumbersumber energi untuk pembangkit listrik di Aceh perlu diwujudkan segera untuk dapat memenuhi kemandirian energi listrik di Aceh. Untuk itu, Pemerintah Aceh melalui Dinas Pertambangan dan Energi telah menyusun Rencana Pengembangan Energi Terbarukan Aceh dengan melihat perkiraan kebutuhan listrik dan rencana penyediaan pembangkit energi terbarukan. (lihat tabel di bawah)

GUBERNUR Aceh Irwandi Yusuf, Direktur Jenderal Pengelolaan Hutang Kementerian Keuangan, Direktur Pinjaman Bank Pembangunan Jerman (KWF) Bjorn Theis, Sekretaris Kedutaan Jerman Andreas Kleine, saat penandatanganan perjanjian hibah dari pemerintah Jerman untuk proyek PLT Panas Bumi Seulawah Agam.

Aceh Men uju Ener gi Hijau Menuju Energi MAKA energi terbarukan berupa hydropower dan geothermal memerlukan siklus ketersediaan air dari kawasan hutan yang ada di Aceh.

ENERGI terbarukan adalah energi yang berasal dari alam, seperti cahaya matahari, angin, tenaga air, tenaga gelombang dan geothermal, yang dapat diperbarui secara alamiah. Alam menyediakan berbagai sumber energi ini dalam jumlah yang sangat besar karena hampir selalu ada dan siap diolah menjadi sumber energi. Potensi energi terbarukan Aceh yang sangat besar terutama potensi panas bumi (geothermal) dan potensi tenaga air (hydro power). Seluruh potensi energi terbarukan berada pada kawasan hutan. Oleh karena itu kebijakan pengembangan energi di Aceh ke depan difokuskan kepada pembangunan sumber-sumber potensi energi terbarukan yang ramah lingkungan. Potensi energi terbarukan di Aceh sangat layak dikembangkan menjadi sumber-sumber pembangkit listrik berkapasitas besar untuk mendukung penyediaan kebutuhan energi listrik di Aceh. Selain untuk memenuhi kebutuhan energi listrik di Aceh, potensi sumber energi tersebut dapat pula membantu pemenuhan kebutuhan listrik di pulau Sumatera yang saat telah ini terhubung dengan jaringan tegangan tinggi 150 KV yang kemudian akan dikembangkan juga jaringan tegangan tinggi 275 KV. Pengembangan potensi energi terbarukan di Aceh sangatlah mendesak dilakukan mengingat kebutuhan energi di

tengah masyarakat yang semakin hari semakin meningkat. disamping itu, sebagian besar kebutuhan energi listrik di Aceh masih dipasok dari luar Aceh dan ditambah dengan pembangkit-pembangkit listrik kecil yang masih menggunakan bahan bakar fosil (BBM) yang tidak ramah terhadap lingkungan yang secara bertahap sedang dihapuskan Pengembangan energi terbarukan di Aceh pada akhirakhir ini terasa lebih menggeliat sejak Gubernur Aceh Irwandi Yusuf pada tahun 2007 melakukan kunjungan ke Jerman dalam rangka mempromosikan sumber-sumber potensi energi terbarukan yang ada di Aceh. Dari hasil dari kunjungan itu, Aceh mendapat hibah sebesar 7 juta Euro dari Pemerintah Jerman untuk melakukan pengembangan Panas Bumi Seulawah Agam di Kabupaten Aceh Besar. Hal itu ditindaklanjuti Pemerintah Aceh dengan melakukan pelelangan internasional pengembangan wilayah kerja pertambangan (WKP) panas bumi Seulawah Agam yang saat ini telah memasuki tahapan evaluasi pra kualifikasi. Diharapkan pembangunan Pembangkit Listrik Tenaga Panas Bumi (PLTP) Seulawah Agam pada tahap pertama dapat menyumpangkan 55 MW kepada system Jaringan Tengangan Tinggi 150 KV Medan Aceh, dari 200 MW yang diperkirakan dapat dikembangkan. Demikian pula dengan potensi WKP Panas Bumi Jaboi di Saban, yang saat ini sedang dalam tahap negosiasi harga jual listrik dengan PLN yang selanjutnya akan dilanjutkan dengan kegiatan eksplorasi. Menjawab Surat Gubernur Aceh, Dirjen EBTKE Kementerian ESDM memenuhi usulan Gubernur Aceh untuk melakukan survey pendahuluan di lo-

Potensi Panas Bumi Seulawah Agam kasi Gunung Feureudong Aceh Tengah dan Gunung Kembar Gayo Lues mulai tahun 20122014. Sedangkan pengembangan energi terbarukan di Aceh lainnya, yaitu Pembangunan Pembangkit Listrik Tenaga Air (PLTA) Peusangan 1 dan 2, yang terletak di Kabupaten Aceh Tengah, PLTA Peusangan ini akan dibangun dengan kapasitas 2 x 43 MW dan akan disambungkan dengan sistem Jaringan Tengangan Tinggi 150 KV yang telah ada untuk memenuhi kebutuhan pemakaian listrik di Aceh. Di samping kondisi kelistrikan dan pengembangan sektor kelistrikan di Aceh saat ini sebagaimana dijelaskan di atas, Pemerintah Aceh terus berupaya melakukan percepatan pengembangan pembangunan kelistrikan dengan mempromosikan dan memperkenalkan potensi yang sangat besar terse-

but kepada seluruh calon pengembang baik dalam maupun luar negeri. Sesuai dengan kebijakan Pemerintah Aceh, pengembangan energi Aceh diarahkan untuk terwujudnya pengelolaan energi dengan memprioritaskan pengembangan energi terbarukan yang ramah lingkungan untuk memenuhi kebutuhan energi dan kesejahteraan rakyat Aceh melalui Diversifikasi Energi, Intensifikasi Energi dan Konservasi Energi. Sedangkan sasaran yang akan diambil untuk mewujudkan hal itu di atas adalah. 1. Terpenuhinya kebutuhan energi listrik di Aceh yang berasal dari sumber pembangkit setempat pada tahun 2015. 2. Terpenuhinya kebutuhan energi listrik di Aceh yang berasal dari sumber pembangkit energi terbarukan setempat pada tahun 2023.

KUNJUNGAN Gubernur Aceh, Bupati Bener Meriah dan Kepala Dinas Pertambangan dan Energi Aceh ke lokasi Pembangunan PLTMH di Kemukiman Samar Kilang, Kabupaten Bener Meriah. Tabel


Perkiraan TotalP embangkit Tambahan Daya Kebutuhan Listrik(MW) Energi Terbarukan (MW) Listrik(MW)

2011 2012 2013 2014 2015

314 339 367 398 432

7 105

7 98

2016 2017 2018

466 503 543

148 203

43 55

2019 2020 2021

587 634 684





2022 2023

739 798

758 813

300 55

2024 2025

862 931

913 963

100 50



PLTP Jaboi 1 x 7 MW PLTP Seulawah Agam (1 x 55 MW) Plant 1 &PLTA Peusangan Unit I (1 x 43 MW) PLTA Peusangan Unit II (1 x 43 MW) PLTP Seulawah Agam (1 x 55 MW) Plant 2 PLTA Jambo Aye 2 x 100 MW

PLTP Seulawah Agam (1 x 55 MW) Plant 3 PLTA Tampur 2 x 150 MW PLTP Seulawah Agam (1 x 55 MW) Plant 4 PLTP G. Geuredong PLTP G. Kembar

Rumah Pembangkit Pembangkit Listrik tenagan Mini Hidro (PLTMH) Wilayah Samar Kilang, Kabupaten Bener Meriah

3.Relokasi/penghapusan secara bertahap Pembangkit Listrik berbahan bakar fosil. 4. Kemitraan Strategis dengan pihak swasta baik lokal, nasional dan internasional untuk pengembangan Energi Terbarukan. 5. Pengurangan emisi dari sektor Energi. Banyak usaha dilakukan, walaupun tantangan dari sisi regulasi kadangkala menjadi hambatan dalam melakukan upaya percepatan pembangunan di sektor kelistrikan. Namun demikian usaha terus dilakukan Gubernur Aceh untuk melakukan terobosan-terobosan pembangunan di sektor ini diantaranya: a. Merintis pembiayaan proyek Geothermal Seulawah Agam untuk Pembangunan Pembangkit Listrik Tenaga Panas Bumi (PLTP) Seulawah Agam 1 x 55 MW dan mendapat dukungan komitmen dari pemerintah Jerman pada tahun 2007 sebesar 7 juta euro. b. Rehabilitasi dan Rekontruksi Turbin Gas PT. Arun untuk Pembangkit Listrik Tenaga Gas (PLTG) 2 x 22 MW. c. Pembangunan 17 titik Pembangkit Listrik Tenaga Mikro Hidro (PLTMH) untuk daerah yang belum terlayani oleh listrik PT. PLN (persero). Mendorong keterlibatan swasta dalam pengembangan Energi Terbarukan, Biodisel dan Biomassa. Dukungan PT PLN (Persero) Wilayah Aceh Sebagai upaya nyata untuk mendukung kebijakan Gubernur Irwandi Yusuf, PT PLN (Persero)Wilayah Aceh juga telah menyatakan kesediaannya untuk membeli energi listrik dari pengembangan dan telah menandatangani MoU dengan beberapa calon pengembang yang beda di bawah wadah KADIN Aceh. PT PLN (Persero) Wilayah Aceh memberi kesempatan kepada para pengembang untuk membangun PLTMH berkapasitas sampai dengan 10 MW dengan jumlah kapasitas 50 60 MW untuk tahap pertama yang selanjutnya akan diikuti oleh tahab kedua jika dilihat program tahap pertama ini berjalan sukses.

ya. an


WASPADA Kamis 8 Desember 2011

Sekda Aceh Lantik Pejabat Eselon III-IV

BBM Langka, Warga Banda Aceh Dan Aceh Besar Beli Eceran

BANDA ACEH (Waspada) : Sekda Aceh Setia Budi, Selasa (6/12) melantik 23 pejabat struktural di lingkungan Pemerintah Aceh untuk peningkatan kinerja menjadi lebih baik. Sekda Aceh Setia Budi menegaskan mutasi jabatan ini telah dipertimbangkan dengan matang serta melalui proses Baperjakat sesuai aturan yang berlaku dengan mempertimbangkan situasi, kondisi serta tantangan yang terus berubah-ubah. Sekda meminta para pejabat yang telah dilantik agar menegakkan kedisiplinan pegawai, karena salah satu hal yang harus diurus terhadap stafnya adalah kedisiplinan. “Bila pimpinannya sendiri tidak mampu disiplin, bagaimana mengatur stafnya,” kata Sekda. Akhir-akhir ini, kata Sekda, tingkat kedisiplinan dan kepatuhan dalam menunaikan kewajiban yang ditunjukkan PNS di lingkungan pemerintah provinsi tidak berbanding dengan fasilitas dan hak yang telah diberikan pemerintah kepada PNS. “Jangan pernah menyesal nantinya bila suatu waktu TPK dan fasilitas lain yang selama ini diterima kami evaluasi karena tidak menunjukkan perubahan,”jelas Setia Budi. (cb01)

Harganya Rp10.000 Per Liter

Waspada/Arman Konadi

Seminar Penelitian Manusia Pra Sejarah Di Loyang Takengen

SEJUMLAH pengendara terpaksa membeli premium dari pedagang eceran di Jln.T Hamzah Bendahara seharga Rp8.000 per liter. Meski SPBU telah mendapat pasokan, namun sejumlah warga Banda Aceh masih kesulitan memperoleh BBM. Foto direkam Rabu (7/12) pagi.

TAKENGEN (Waspada) : Hasil penelitian dan eskavasi Loyang Medale dan Ujung Karang yang sebelumnya dilakukan Balar Arkeolgogi Medan, Sumut, serta uji tes deoxyribonucleic acid (DNA) terhadap ratusan warga di Gayo Aceh Tengah, menjadi materi penting yang disampaikan dalam sebuah sarasehan di Gedung Olah Seni (GOS) Takengon, Selasa (6/12). Acara yang dibuka Bupati Aceh Tengah diwakili Asisten dua Setdakab setempat Muhammad Syukri, kemudian dirangkai dengan peluncuran buku berjudul “Gayo Merangkai Identitas.” Demikian rilis yang disampaikan Kadis Kebudayaan dan Pariwisata Aceh Tengah Muklis Gayo, Rabu (7/12) di Takengen. “Atas temuan tim Balar Medan yang diketuai Ketut Wiradnyana dan membantu menemukan identitas masyarakat Gayo, kami mewakili warga Aceh Tengah mengucapkan terima kasih. Karena hal ini telah membuka tabir baru sejarah panjang tentang keberadaan urang Gayo di masa lalu,” kata Muchlis Gayo. Selain itu terkait peluncuran buku itu, lanjutnya, untuk memperkenalkan sejarah penemuan kerangka manusia yang berusia ribuan tahun diperkirakan dari zaman purba. Dia mengatakan, temuan tim Balar Medan, bukan saja mampu mendorong menegakkan sejarah baru identitas urang Gayo, tetapi juga sejarah migrasi umat manusia di Indonesia. (cb09)

Kondisi Aceh Aman Tapi Tak Nyaman

Badko HMI Minta Polda Aceh Tangkap Pelaku Penembakan BANDA ACEH (Waspada) : Badan Koordinasi Himpunan Mahasiswa Islam (Badko HMI) Aceh menilai kasus penembakan terhadap pekerja PT Satiya Agung yang terjadi, Minggu (4/12) merupakan kelalaian pihak kepolisian dalam mengamankan senjata ilegal yang kini masih beredar di masyarakat. “Kejadian tersebut selain menodai perdamaian Aceh, juga sangat meresahkan masyarakat Aceh,” ungkap Ketua Badko HMI Aceh Herri Mauliza HR dalam pernyataan tertulis yang disampaikan ke Waspada, Selasa (6/12). Untuk itu, Badko HMI Aceh mengharapkan keseriusan Polda Aceh untuk segera menangkap pelaku penembakan tersebut. “Kalau memang tidak mampu, HMI Aceh mampu menjadi relawan membantu Polda mencari pelaku demi menjaga per-damaian. Ini sangat penting agar kepercayaan masyarakat terhadap aparat kepolisian pada umumnya terus terjaga,” tutur Herri. (b04)

Ribuan Masyarakat Bener Meriah Hadiri Zikir Akbar REDELONG (Waspada) : Sedikitnya seribu anggota masyarakat di Kabupaten Bener Meriah menghadiri zikir akbar di Masjid Babussalam, Kecamatan Bukit, Kabupaten Bener Meriah yang digelar Majelis Permusyawaratan Ulama (MPU) untuk merayakan Hari Besar Islam. Ketua MPU Bener Meriah Tgk Syarqawi Abdussamad, Selasa (6/12) mengatakan, zikir akbar digelar dalam rangka memperingati 10 Muharram 1433 H. “Sedangkan tujuannya agar kaum muslimin-muslimat dari semua golongan, tua maupun muda, mengetahui bahwa mereka memiliki tahun barunya sendiri,” jelas ketua MPU ini. Menurut Tgk Syarqawi, selama ini sebagian besar umat Islam terbuai dengan perayaan tahun baru Masehi atau bagi kalangan muda-mudi merayakan hari Valentine. “Mereka tampak kehilangan pijakan, padahal merayakan tahun baru itu sama sekali bukan milik Islam. Dengan momen dan kegiatan ini, kami berharap agar masyarakat mulai menyadarinya,” harap Tgk Syarqawi. Sedangkan pejabat Pemkab Bener Meriah yang menghadiri acara tersebut adalah Sekretaris Daerah T Islah Berdan. Sekda ini meminta maaf kepada para peserta karena tidak hadirnya Bupati Tagore AB. (b33/cb10)

PEMA Unsyiah: Polda Aceh Lamban BANDA ACEH (Waspada): Kondisi Aceh selama dua pekan terakhir cukup memberi preseden buruk secara keseluruhan. Tak hanya membuat masyarakat merasa khawatir, tapi juga telah menodai perdamaian Aceh yang selama ini menjadi sorotan banyak pihak, baik di tingkat nasional maupun internasional. “Peledakan granat di Banda Aceh dan penembakan warga Langkat di Aceh Utara ini menambah daftar panjang kasuskasus teror yang terjadi di Aceh. Ini artinya polisi belum mampu mencegah teror semacam itu,” kata Direktur Koalisi NGO HAM Aceh, Evi Narti Zain di Banda Aceh, Rabu (7/12). Karena itu, kata Evi, polisi harus bekerja maksimal, bukan hanya untuk menangkap pelaku teror, tapi juga harus mampu mencegah terjadinya kembali teror yang semakin meresahkan masyarakat. Begitu pun, dia juga mengingatkan agar pengusutan dan pencegahan teror itu tetap harus dilakukan dengan pendekatan-pendekatan persuasif. “Artinya, jangan sampai

kerja-kerja kepolisian justru semakin membuat resah masyarakat. Harus dipahami, sebagian masyarakat Aceh masih merasakan trauma konflik,” kata Evi. Dari hasil analisisa, Evi menyimpulkan bahwa kondisi Aceh saat ini masih aman, tapi tidak nyaman. Maksudnya, masih aman bila dilihat dari aktivitas masyarakat yang masih berjalan seperti biasa. Tapi, di sisi lain masyarakat juga sudah merasa tidak nyaman, karena khawatir dengan beberapa kejadian seperti pelemparan granat di Banda Aceh dan penembakan di Aceh Utara yang memakan korban. Khusus kasus penembakan di areal perkebunan PT Satya Agung, Krueng Jawa, Geureudong Pase, Aceh Utara, Minggu (4/12), Koalisi NGO HAM menilai kejadian itu cukup memberi bukti orang-orang yang menebar teror dengan senjata api masih berkeliaran bebas di Aceh. Terhadap pernyataan Kapolda Aceh dan Pangdam IM, Evi mengatakan, sebagai langkah untuk mengusut tuntas kasus penembakan tersebut, langkah yang diambil Polda Aceh dan Kodam Iskandar Muda tentu didukung. Namun ia mengingatkan agar apapun langkah yang diambil jangan sampai menimbulkan korban pelanggaran HAM.

Sebagaimana diberitakan, Kapolda Aceh Irjen Pol Iskandar Hasan mengatakan, pihaknya mengirimkan tim pemburu untuk membantu pengejaran tersangka penembakan. Sedangkan Pangdam IM Mayjen TNI Adi Mulyono mengatakan, TNI siap menyerang titik inti pengacau. “Penanganan ini jangan sampai menimbulkan masalah pelanggaran HAM baru, seperti jatuhnya korban dari masyarakat yang tidak bersalah. Apapun alasannya itu tidak boleh terjadi,” tegas Evi. Polda Lamban Secara terpisah, Presiden Mahasiswa (Presma) Unsyiah, Furqan Ihsan Aksa menilai Polda Aceh lamban menanggapi teror di Aceh. Seharusnya, saat teror granat di Lampriet, Polda Aceh sudah meningkatkan keamanan, bukannya memberikan statement lunak ke media yang mengatakan seolah- olah kondisi keamanan Aceh baikbaik saja. “Statemen Polda Aceh membuat ulah pelaku teror semakin menjadi-jadi. Saat teror meningkat, Polda Aceh baru berencana meningkatkan keamanan di Aceh. Seharusnya Polda Aceh sudah meningkatkan keamanan saat teror pertama terjadi, bukannya menunggu teror berikutnya, baru bergerak,” ungkapnya. (b04)

fil) yang bertugas di Lebanon, Selasa (6/12). Disebutkan, hingga akhir 2011 pihak TNI telah menyita 218 pucuk senjata di sejumlah kabupaten/kota di Aceh. Pangdam juga menyatakan, untuk mengatasi gerak para pengacau tersebut, pihaknya menyiapkan langkah yang diperlukan. Menurut Pangdam, tindakan para pengacau tidak bisa dibiarkan begitu saja. “Tindakan mereka sudah keterlaluan, apalagi sampai ada korban jiwa seperti penembakan yang terjadi di Aceh Utara,” kata Mayjen TNI

Adi Mulyono. Karenanya, Pangdam berharap adanya kerjasama dari masyarakat dalam memberikan informasi jika di sekitar tempat tinggalnya ada orang yang mencurigakan. Menjawab Waspada tentang perlu-tidaknya penambahan pasukan TNI untuk membantu pengamanan Pilkada Aceh yang dijadwalkan 16 Februari tahun depan, Pangdam Iskandar Muda Mayjen TNI Adi Mulyono mengatakan, untuk saat ini cukup dengan kekuatan yang ada. (b05)

Ada Kelompok Lama Ingin Kacaukan Aceh BANDA ACEH (Waspada): Pangdam Iskandar Muda Mayjen TNI Adi Mulyono mencurigai ada kelompok lama yang bermain di Aceh dengan tujuan mengacaukan perdamaian yang sedang dirajut di Aceh. “Rakyat Aceh saat ini sedang menikmati perdamaian, jadi untuk apa kita ribut-ribut. Kalau Pilkada, yang terpilih nanti putra Aceh yang terbaik,” kata Pangdam Adi Mulyono usai menyambut kepulangan prajurit Kodam IM yang tergabung dalam Satgas Bataliyon Mekanik Kontingen Garuda XXIII-E (Uni-

Bayu Aiyub, Merintis Bibit Kayu Jabon TAK pernah terbayang sebelumnya. Dengan niat ikhlas merantau ke Pulau Jawa, ternyata ilmu yang didapatkan dari sana bisa dimanfaatkan masyarakat Aceh. Ilmu dimanksud yakni pengembangan pembibitan kayu jenis Jabon. Secara umum, solusi Bayu Aiyub itu bisa membuka lapangan kerja bagi masyarakat terutama bagi pemuda di desanya di kawasan pedalaman Aceh Timur itu. Bayu Aiyub yang kini sudah berusia 31 tahun itu berdomisili di Desa Buket Teupeun, Kecamatan Darul Falah, Kab. AcehTimur, dimana lokasi pembibitan Jabon dilakukan. Dengan berbekal ilmu tentang pembibitan pohon kayu yang diperoleh selama merantau dan melalang buana di Jawa, Bayu kini memberanikan diri membuka pembibitan kayu di pedalaman Aceh Timur. Meski modal yang minim Bayu yakin dengan dana yang minim dan lahan yang sempit, namun pembibitan kayu bermacam jenis yang dikelolanya telah berkembang hingga dapat mela-

Bayu Aiyub diberi nama Galeri Istana Bibit. Letaknya di kawasan pelosok yang terpaut 10 kilometer ke arah selatan Jalinsum Banda Aceh – Medan. Bayu mengaku sejak pulang merantau dari Pulau Jawa tahun 2007, dia berusaha mengembangkan dan memperkenalkan bibit Jabon sebagai sarana peningkatan pendapatan kelompok tani di Aceh, khususnya di Aceh Timur. Bayu mengatakan, dirinya memperoleh ilmu pembibitan kayu Jabon saat berada di daerah Cipanas, Cianjur ( Jawa Barat). Di sanalah Bayu kenal cara menghadilkan pembibitan kayu Jabon. “Saya tertarik dengan salah satu jenis yaitu kayu Jabon, karena kayu itu dari hasil analisa saya cocok dikembangkan di Aceh sebagai komoditi andalan yang dapat dipasarkan,” kata Bayu seraya menambahkan, masa pertumbuhan Jabon sangat cepat dibanding jenis bibit kayu lain. Dijelaskan, kayu Jabon masa panennya membutuhkan 4 sampai 6 tahun dan sudah menghasilkan dengan meraih untung yang luar biasa. “Bayangkan dalam 5 tahun kayu tersebut dapat dipotong dengan harga jual dalam satu batangnya menghasilkan 2 m3 (kayu log)


masyarakat dengan memanfaatkan lahan terlantar. Meski banyak kendala dalam melakukan pembibitan, namun alumni STIP Lancang Kuning (Pekan Baru-Riau) itu tak pernah ada kata menyerah dan dia tampak begitu tertarik dengan bibit Jabon. Soal kesulitan, ujar Bayu, tingkat keberhasilan dalam pembibitan sangat rendah dibanding kayu lain. Jabon merupakan jenis kayu yang paling sulit dilakukan pembibitan, karena risiko serangan hama sangat tinggi. “Bahkan untuk pembibitan Jabon sangat sulit dilakukan oleh orang-orang biasa, kecuali mempunyai kepiawaian yang matang,” katanya. Meski kala 2007 belum banyak, kini usaha yang digeluti Bayu Aiyub menghasilkan ribuan bibit Jabon yang dipasarkan ke seluruh Aceh. Bahkan kerab juga disuplai untuk kepentingan kelompok tani binaan Dinas Kehutanan Aceh Timur atau ke daerah lain seperti ke Aceh Utara dan Bireun. “Harga bibit Jabon yang dijual juga tidak terlalu tinggi yakni berkisar Rp3.500-Rp4.000per batang,” sebutnya. Tak hanya itu saja, dia juga membuka lahan miliknya sendiri di beberapa kawasan di

Waspada/Muhammad H Ishak

BAYU AIYUB saat berada di areal pembibitan kayu Jabon di Desa Buket Teumpheun,Kecamatan Darul Falah, Kabupaten Aceh Timur. itu telah menghasilkan ribuan bibit kayu Jabon yang disuplai ke seluruh pelosok Aceh, termasuk Aceh Tamiang, Bireun dan Pidie Jaya. Pekerjaan yang digeluti Bayu Aiyub tak hanya hal yang remeh. Ini merupakan lahan baru bagi masyarakat Aceh untuk meningkatkan ekonomi keluarga melalui sektor perkebunan dan kehutanan. Selain itu pekerjaan yang digeluti pria

tanam satu miliar pohon di negeri ini. Bagi Bayu Aiyub, sebagai aksinya dalam menjaga hutan dia rencananya terus berkiprah guna memajukan sektor perkebunan di Aceh. Sehingga masyarakat Aceh tidak terlalu fokus dengan penebangan kayu-kayu keras di hutan. “Kayu sudah banyak yang ditebang. Jika program saya ini sukses, maka seba-

BANDA ACEH (Waspada) : Meski telah menerima pasokan minyak, kesulitan memperoleh premium masih dialami warga Banda Aceh dan Aceh Besar hingga Rabu (7/12) siang. Akibatnya, sejumlah pengendara terpaksa membeli bensin di pedagang eceran dengan harga bervariasi antara Rp 10.000 hingga Rp6.000 perliter. Pantauan Waspada, di sejumlah SPBU di kawasan Lamtemen, Mibo Lambuk dan Kuta Alam pukul 11:30, Rabu pagi, persediaan premium kembali habis. Mahdi, pengawas SPBU Kuta Alam di Jalan T Hamzah Bendahara yang ditemui Waspada mengatakan, stok premium di SPBU tersebut habis sejak Selasa sore setelah diserbu warga yang ingin memperoleh premium. “Kalau normal biasanya premium kapasitas truk tanki 20 ton bisa bertahan dua hari. Sejak langka Sabtu kemarin, kami sudah dua kali menerima pasokan, tapi habis dalam sekejap karena terus diserbu. Masyarakat panik, jadi sekali ngisi sampai full tank,” kata Mahdi. Selain pengendara roda dua dan empat, pembelian juga dilakukan oleh warga dengan menggunakan jerigen. Umumnya, kata Mahdi, warga membeli dalam jumlah besar karena takut kelangkaan premium berlangsung lama. “Kita tidak mungkin membatasi pembelian warga, kecuali untuk pembelian jerigen yang hanya kita batasi 5 liter per orang. Bagaimana mau kita larang, mereka sudah antre berjamjam,” kata Mahdi.

Mahdi mengatakan, sejak terjadi kelangkaan premium, pihaknya meminta penambahan jatah sebanyak 16 ton premium dari jumlah biasa yang hanya 20 ton. Namun Mahdi belum mengetahui apakah jumlah tersebut dikabulkan pihak Pertamina. “Biasanya 20 ton jatah kami per hari, tapi tadi kita minta tambah 16 ton, tapi belum tahu apa dikabulkan,” katanya. Selain SPBU Kuta Alam, kehabisan stok premium sejak Selasa sore juga dialami sejumlah SPBU lain akibat diserbu warga. Namun sejumlah pemilik SPBU menjamin ketersediaan premium pada Rabu sore. “Mungkin nanti siang premium sudah masuk lagi. Karena truk tangki sedang mengisi premium di depot Pertamina Krueng Raya,” kata Mahdi. Sementara itu Mizan, 40, salah seorang pengendara roda empat berharap Pertamina menjamin ketersediaan premium. Dikatakan, kelangkaan premium sangat menyulitkan sejumlah pengendara. “Ya saya pribadi berharap agar jangan sampai langka. Susah sekali kalau begini. Bayangin kalau harus ngisi di eceran yang harganya Rp10.000 per liter,”kata warga Setui itu. Mizan mengatakan, meski harga sangat memberatkan, namun sebagian warga mengaku terpaksa membeli di eceran. Beberapa di antaranya memilih memarkirkan kendaraannya jika tidak terlalu terdesak menggunakan kendaraannya. (cb06)

Satu Jam, Bensin Habis Diserbu Pembeli LANGSA (Waspada) : Antrian panjang kendaraan bermotor yang akan mengisi Bahan Bakar Minyak (BBM) jenis premium terjadi di Kota Langsa. Hampir di seluruh Stasiun Pengisian Bahan Bakar Umum (SPBU) terlihat antrian panjang kendaraan yang mengular, Rabu (7/ 12). Bahkan di SPBU Gampong Siderejo, Kecamatan Langsa Lama, antrian para pembeli premium baik dengan menggunakan kendaraan maupun datang membawa jerigen hanya berlangsung satu jam saja, persediaan premium di SPBU langsung habis. Sementara di SPBU Harapan yang terletak di tengah Kota Langsa, antrian kendaraan terlihat sejak pukul 06:30 saat SPBU itu baru buka, menjelang siang antrian bertambah panjang

sampai mengular ke badan jalan A.Yani. Akibat kelangkaan premium itu mendongkrak harga jual di tingkat pengecer. Saat ini harga premium per liter di tingkat pengecer mencapai Rp6.000 per liter. Bahkan di kioskios penjual premium literan di gamponggampong, harga premium bahkan menyentuh harga Rp6.500 per liter. Sejumlah konsumen premium di Kota Langsa mengharapkan pihak Pertamina dapat menjamin suplai premium ke Kota Langsa, sehingga tidak menimbulkan kepanikan pelanggan. “Karena ada isu premium langka, masyarakat ramai-ramai memborong premium, padahal mereka tidak butuh minyak sebanyak itu dalam aktivitas sehari-hari,” ujar Marhaban, warga Kota Langsa. (b22)

Waspada/Muhammad H. Ishak

JAMAAH pengajian rutin ulama-umara tampak serius menyimak Kitab Kuning saat berlangsungnya pengajian yang dipimpin Tgk H Nur Zuhri (Waled Nu) dari Samalanga, Bireuen, di Balai Pengajian Ulama-Umara di Desa Alue Bu, Kecamatan Peureulak Barat, Aceh Timur, Sabtu (3/12).

Pengajian Rutin Ulama-Umara Aceh Timur

Jangan Memfatwa Hukum Di Warung Kopi PEUREULAK (Waspada): Para ustadz (teungku—Aceh) untuk tidak sekedar menjawab ataupun berbicara terkait persoalan-persoalan yang timbul dalam masyarakat di Warung Kopi (Warkop). Sebab, jika salah menjawab dan memberikan keterangan hukum Islam maka amalan umat akan sesat dan menyesatkan. “Jangan memfatwakan hukum di Warkop. Jika tidak mengetahui persis lengkap dengan dalilnya jangan menjawab ataupun memaparkan sesuatu hukum. Sebab perkataan teungku akan dijadikan pegangan dalam beribadah, bermu’amalah dan munakahat,” papar Ketua Panpel Pengajian Rutin Ulama-Umara se-Aceh Timur Tgk. H. Armis Musa, Rabu (3/12) di Peureulak. Hal itu perlu disampaikan mengingat nasehat dan petuah yang disampaikan Tgk H Nur Zuhri yang akrap disapa Waled Nu saat bertindak sebagai pemateri di Balai Pengajian UlamaUmara se Aceh Timur, Sabtu (3/12) lalu. Menurut Haji Armis, umat Islam di Aceh Timur jangan sekedar mengamalkan hukum syariat Islam jika tidak mengetahui asal muasalnya. “Artinya, jika ada persoalan yang muncul di tengah-tengah masyarakat, maka silakan

bertanya ke para alim ulama dan pimpinan dayah dan balai pengajian yang ada di sekitar. Jika benar-benar tidak selesai dan tidak mencapai titik temu, maka silakan bertanya ke para ulama yang diundang setiap Sabtu di Balai Pengajian Ulama-Umara,” jelas H Armis Musa. Diharapkan, untuk masa mendatang tidak lagi timbul persoalan diWarkop-Warkop, sebab persoalan di sana tidak akan terselesaikan tanpa ada putusan hukum dari alim ulama dengan berpedoman kepada Alquran, hadis, dan kitabkitab kuning yang merupakan karangan ulama terdahulu yang kuat dan terpelihara. Di Balai Pengajian Ulama-Umara, sambung H Armis Musa, setiap Sabtu berkumpul ribuan pimpinan dayah/balai pengajian se Aceh Timur dengan tujuan mengikuti pengajian yang pematerinya diundang dari luar seperti Prof DR Abuya Muhibuddin Wali (Abuya) dan Tgk H Usman (Abu Kuta Krueng), Tgk HM Amin (Tumin), Tgk H Karimuddin, Tgk. H Ibrahim (Abu Panton) serta sejumlah ulama-ulama besar Aceh lainnya di seluruh Aceh. “Mari samasama kita ikuti pengajian ini dengan seksama, dan kita saling menukar ilmu di sini,” tandas H Armis Musa. (b24)

Unimus Dan Unsyiah Penyelenggara PPG Di Aceh PEUSANGAN (Waspada) : Berdasarkan SK Mendiknas No.052 tahun 2010, Universitas Almuslim (Unimus) Peusangan, Bireuen, bersama Universitas Syiah Kula (Unsyiah) Banda Aceh terpilih sebagai penyelenggara Program Profesi Guru (PPG) di Aceh. Program PPG ini merupakan program pemerintah untuk memberikan peluang bagi guru berstatus PNS yang belum sertifikasi dan program ini hanya diwajibkan bagi guru PNS jenjang S1 yang belum sertifikasi dengan masa kerja minimal 5 tahun dan khusunya Prodi PGSD. Sedangkan uang kuliahnya ditanggung pemerintah melalui Dirjen Dikti Kemendiknas. Demikian Rektor Unimus Amiruddin Idris

ditandatangani Rektor Unimus dengan Dirjen Dikti beberapa hari lalu di Jakarta,” kata Zulkifli. Menurut Zulkifli, di Unimus untuk gelombang pertama diikuti 60 orang dan kuliah perdana dibuka secara serentak di seluruh Indonesia. Adapun sistem perkuliahan dengan lama belajar selama enam bulan. Sedangkan sistem belajarnya yaitu menggunakan sistem modul 3 bulan dan 3 bulan praktik pada sekolah mitra yang telah ditetapkan. “Untuk Unimus program ini akan diikuti oleh guru yang berasal dari 11 kabupaten/kota yang ada di Aceh yaitu Bireuen, Aceh Tamiang, Lhokseumawe, Aceh Tengah, Pidie Jaya, Aceh



WASPADA Kamis 8 Desember 2011

Catatan Kelam Di Tanah Rencong Dan Bumi Muda Sedia HUMAN Immunodeficiency Virus (HIV) dapat menyebabkan AIDS dengan menyerang sel darah putih yang bernama sel CD4 sehingga dapat merusak sistem kekebalan tubuh manusia yang pada akhirnya tidak dapat bertahan dari gangguan penyakit walaupun yang sangat ringan sekalipun.

Waspada/Irwandi MN

TAMPAK remaja sedang berduaan di bawah tribun dan di beberapa titik sepi di arena pacuan kuda itu, Senin (5/12) sore.

Ketika Budaya Barat Jadi Benalu Di Negeri Timur KONON peradaban manusia di dataran tinggi Gayo, Aceh Tengah, begitu kuat, hingga sulit rasanya tradisi luar dapat berkembang ‘biak’ dengan pesat. Agama dan adat istiadat menjadi landasan kokoh dalam kehidupan masyarakat. Sehingga pada masa-masa itu khususnya urang Gayo (etnis pribumi) alergi dari kata sumang (tabu-Gayo). Namun ironinya kini sebuah kultur milik nenek moyang yang telah dititipkannya lewat petuah kepada anak cucu turunnya, mulai jarang terlihat. Di negeri ‘lumbung kopi’ ini terjadi perubahan‘kiblat’ dalam menilai tradisi. Budaya barat telah mengakar seperti benalu yang menghisap budaya timur hingga ‘krontang’. Hal itu dapat dibuktikan dari sesi perubahan akhlak dan moral bagi sebagian regenerasi (remaja) bangsa yang tumbuh di sana. Kawula mudanya bagai tidak mengetahui arti budaya sumang milik endatunya. Malah seperti suatu kelaziman mereka kerap ‘memamerkan’ tradisi ala barat di tengah lingkungan warga Aceh Tengah, yang pada dasarnya beragama, beradab dan berbudaya. “Kalau tidak ikut trendy, belum gaul,” kata remaja yang kerap terdengar masa kini. Ada apa dengan remaja di Gayo ini? Saban harinya bila hari menjelang sore mayoritas lokasi yang kira-kira sepi seperti; Belang Bebangka, Bur Gayo, seputar Laut Tawar dan berbagai lokasi wisata lainnya dikunjungi pasangan remaja non muhrim berlainan jenis. Mereka kerap bergandengan mesra atau duduk berdua-duaan. Entah apa yang dibicarakannya. Anehnya hal tersebut seolah menjadi lumrah dan bagai bagian dari sebuah tradisi selama ini. Selebihnya aksi remaja itu juga kerap tidak memperdulikan manusia berlalu lalang di sekitarnya. Ada kesan bahwa orang lain hanya ‘nyamuk’ bersileweran, datang dan pergi begitu saja. Padahal bagi manusia yang melintas kadang tersipu mata. Menurut seorang tokoh adat (mukim Pegasing) Ali Husin AZ, 75, konon dunia remaja di daerah sentral kopi ini begitu berbudaya. Bila bukan muhrim, jangankan jalan bersama. Untuk sekadar bertegur sapa saja kerap berujung masalah dan menjadi‘pertikaian’ apabila tidak didampingi pihak kerabat. Mengenang kisah remaja dulu, lanjutnya,

kalaupun ada sepasang remaja menjalin kasih biasanya mereka hanya berkirim ‘pesan’ dengan melalui perantara teman. Bahkan dapat dipastikan tidak pernah saling berduaan, kecuali setelah sah dinikahkan. “Pada proses perkenalan juga, mereka biasanya sangat tertib. Malu bila diketahui orang. Hal ini menunjukan masih tingginya nilai keluhuran dan budi pekerti remaja pada masa itu ,” paparnya. Namun kini, katanya, seiring kemajuan zaman, norma-norma adat budaya mulai tergerus waktu. Telah terjadi perbandingan terbalik bila menilai prilaku remaja tempo dulu dan saat ini. “Perubahan moral sebagian remaja sekarang dengan masa dulu, bak seperti langit dan bumi. Ada tindakan yang tidak lagi sesuai ajaran agama dan adat,” katanya. “Saya kira muda -mudi sekarang belum memiliki filter dalam menyerap perkembangan budaya luar. Mereka terkontaminasi kemajuan dunia teknologi, salah satunya seperti menonton siaran televisi yang kurang penting bagi pertumbuhannya,” lanjutnya. Untuk mengurangi kegiatan sumang yang kerap dilakukan sebagian remaja hendaknya pihak terkait, tokoh-tokoh adat dan para ulama turun tangan memberi sosialisasi ke masyarakat. Terutama di kampung-kampung yang merupakan komunitas terkecil dan akar paling bawah dalam struktur pemerintahan. Anggota DPRK Sorot M Ridwan, Ketua Komisi D DPRK Aceh Tengah, bidang sosial masyarakat mengatakan, adanya ’kenakalan’ remaja selama ini, diperkirakan menggerus citra daerah dan telah mendapat perhatian serius dari lembaganya. Ia menilai, selama ini peran dinas terkait dari Pemda Aceh Tengah, seperti Satpol PP dan Wilayatul Hisbah (WH) belum memberi kontribusi yang berarti untuk menghalau menukiknya perubahan moral sebagian remaja. “Kendati telah ada upaya dilakukan dinas terkait untuk menghalau. Namun sejauh mana tindakan mereka mampu memberi efek jera kepada para remaja yang melanggar. Malah saya nilai semakin menjadi-jadi,” jelas Ridwan. Padahal, sebutnya, bila pihak terkait serius, dengan mengerahkan personil secara rutin ke lokasi-lokasi dicurigai dan disinyalir merupakan sarang mesum kawula muda, maka hal ini setidaknya mengurangi aktivitas remaja untuk bertindak negatif. Kadis Satpol PP dan WH Aceh Tengah, Syukurudin, ketika hendak dikonfirmasi di kantornya tidak berada di tempat. Irwandi MN

Waspada/Irwandi MN

Beberapa tempat wisata dan fasilitas pemerintah seperti Lapangan Pacu-kuda, Belang Bebangka, Pegasing Aceh Tengah, kerap menjadi lokasi aksi ‘mesum’ sebagian remaja non muhrim berlainan jenis. Mereka tidak mempedulikan warga yang berlalu lalang di sekitarnya. Hal ini telah meresahkan masyarakat.

Virus HIV menyerang sel CD4 dan merubahnya menjadi tempat berkembang biak Virus HIV baru kemudian merusaknya sehingga tidak dapat digunakan lagi. Sel darah putih sangat diperlukan untuk sistem kekebalan tubuh. Tanpa kekebalan tubuh maka ketika diserang penyakit maka tubuh kita tidak memiliki pelindung. Dampaknya adalah kita dapat meninggal dunia. Acquired Immune Deficiency Syndrome (AIDS) yang merupakan dampak atau efek dari perkembang biakan virus HIV dalam tubuh makhluk hidup.Virus HIV membutuhkan waktu untuk menyebabkan sindrom AIDS yang mematikan dan sangat berbahaya. Penyakit AIDS disebabkan oleh melemah atau menghilangnya sistem kekebalan tubuh yang tadinya dimiliki karena sel CD4 pada sel darah putih yang banyak dirusak oleh virus HIV. Ada hal yang sangat mengejutkan pada tanggal 1 Desember 2011 yang merupakan tanggal peringatan Hari AIDS se dunia. Khusus untuk di Provinsi Aceh pada kegiatan memperingati penyakit yang belum ada obatnya itu ternyata jumlah penderita HIV/AIDS seperti yang diwartakan Waspada, edisi Jumat (2 Desember 2011) pada halaman 1 disebutkan Provinsi Aceh kini memiliki 102 kasus dan diperkirakan ada 235 pengidap AIDS yang belum mau berobat. Jika diestimasi 1:13 maka saat ini diduga ada 1.300 warga Aceh yang terinfeksi virus mematikan itu. Berdasarkan analisis terhadap munculnya angka tersebut di atas sekaligus sebagai potret buram yang dibungkus dengan aroma bernuansa seberkas catatan kelam di atas Bumi Muda Sedia dan Tanah Rencong yang selama ini dikenal memberlakukan penerapan Syariat Islam sesuai dengan Qanun (Perda) Provinsi Nanggroe Aceh Darussalam Nomor:11 Tahun 2002 Tentang Pelaksanaan Syariat Islam Bidang Akidah, Ibadah dan syiar Islam. Zulfendi kepada Waspada merincikan, sejumlah penderita HIV/AIDS di Aceh yakni jumlah kasus tertinggi ada Aceh Tamiang, Pidie, Kutacane dan Aceh Besar masing-masing 9 kasus, Aceh Utara 8 kasus, Lhokseumawe 5 kasus,Biruen 4 kasus,Aceh Barat, Bener Meriah dan Pidie Jaya masing-masing 5 kasus, Sabang dan Aceh Jaya 2 kasus, Kota Langsa, Aceh Tenggara dan Aceh Selatan 8 kasus. “ Sebelum terjadi ledakan kasus HIV/AIDS di Aceh, sebaiknya semua orang peduli untuk menyelamatkan generasi kita,” kata Zulfendi. Menurut Pengelola Program Komisi Penanggulangan HIV/AIDS Aceh, Zulfendi seperti yang telah dilansir koran ini, di Aceh hingga saat ini belum ada lokalisasi seks komersial, tetapi hasil survey Komisi Penanggulangan AIDS/HIV ( KPA) menunjukkan di Aceh ada banyak penjaja seks. Contohnya , KPA pernah mengambil sample darah 200 penjaja seks di Banda Aceh, Lhokseumawe 50 orang, Tamiang 50 orang. “ Lokalisasi tidak ada di Aceh, tetapi penjaja dan pembeli seks ada di Aceh, buktinya sample yang kita ambil,” kata Zulfendi. Fenomena Gunung Es Angka-angka penderita HIV/AIDS di Aceh seperti yang telah dirincikan Zulfendi di atas tentu saja masih perlu untuk ditelusuri oleh Waspada di Kabupaten Aceh Tamiang. Ternyata , hasil penelusuran Waspada di Kabupaten Aceh Tamiang atau dijuluki sebagai Bumi Muda Sedia ,Senin (5/12) , angka untuk Kabupaten Aceh Tamiang bukan 9 kasus, melainkan 11 kasus. Tentu saja angka 11 kasus yang terjadi di Bumi Muda Sedia itu sekaligus menempatkan posisi Kabupaten Aceh Tamiang “meraih peringkat” pertama atau tertinggi angka penderita HIV/AIDS di Provinsi Aceh. Tentu saja hal itu bukan merupakan “prestasi” yang membanggakan bagi Kabupaten Aceh Tamiang,tetapi merupakan

Waspada/Muhammad Hanafiah

TRIBUN Utama Pelaksanaan MTQ XXX Aceh Tahun 2011 di Karang Baru,Kabupaten Aceh Tamiang.Kini setelah pelaksanaan event tersebut lokasi tersebut dalam keadaan gelap gulita karena tidak ada penerangan dan lokasi ini juga telah berubah funsi menjadi arena perbuatan maksiat ,terutama pada malam hari. catatan hitam bagi Bumi Muda Sedia. “ Ada 11 kasus penderita HIV/AIDS di Aceh Tamiang,” terang Pengelola Program HIV/ AIDS di Dinas Kesehatan Kabupaten Aceh Tamiang, Mahlil ketika dikonfirmasi Waspada, Senin (5/12). Menurut Mahlil, angka 11 kasus HIV/AIDS yang dicatat pihaknya itu adalah angka akumulasi penderita HIV/AIDS yang terjadi sejak tahun 2006 hingga 2011. Mahlil merincikan pada tahun 2006 di Kabupaten Aceh Tamiang ada 1 kasus, lalu tahun 2007 tercatat 2 kasus, tahun 2008 ada 1 kasus, tahun 2009 tercatat ada 2 kasus,tahun 2010 ada 1 kasus dan pada tahun 2011 mengalami kenaikan yang signifikan tercatat ada 4 kasus, sehingga total keseluruhannya ada 11 kasus. Dari 11 kasus yang terjadi, terang Mahlil, tercatat ada 4 orang yang telah merenggang nyawa atau meninggal dunia yakni 2 orang perempuan dan 2 orang laki-laki yang telah meninggal dunia di Bumi Muda Sedia. Menurut Mahlil, pada tahun 2007 ada seorang perempuan yang meninggal dunia, lalu pada tahun 2008 tercatat seorang laki-laki yang meninggal dunia, seterusnya pada tahun 2011 masing-masing tercatat seorang perempuan dan seorang lakilaki meninggal dunia karena menderita HIV/AIDS. Menurutnya, dari 11 kasus yang terjadi di Aceh Tamiang hanya 1 kasus pada tahun 2008 yang merupakan hasil temuan langsung pihaknya di Lapangan ketika melakukan kegiatan Serologi (survey darah). Sedangkan 10 kasus lagi ditemukan ketika penderita HIV/AIDS berobat di Rumah Sakit Umum Daerah ( RSUD) Tamiang. Menurut catatan yang ada, kata Mahlil, rata-rata yang kena HIV/AIDS di Aceh Tamiang berusia produksi yaitu usia antara 15 tahun hingga 45 tahun . Di Aceh Tamiang, ungkap Mahlil, berdasarkan catatan yang ada ternyata ada perempuan berusia muda yang belum punya suami tetapi terkena HIV/AIDS dan ada juga perempuan yang sudah punya suami serta ada juga suami yang sudah punya istri terkena penyakit itu.” Mohon maaf demi menjaga beban psikologis penderita HIV/AIDS di daerah ini saya tidak bisa mempublikasikan nama dan alamatnya,” ujarnya. Menyinggung upaya-upaya apa saja yang telah dilakukan pihaknya , Mahlil menyatakan, bagi penderita HIV/AIDS yang masih hidup ditangani pemeriksaan status HIV,periksa CD4 ( daya tahan tubuh/sistem anti body di dalam tubuh) dan pemberian obat kepada penderita yang sudah AIDS. “ Sampai saat ini kami sudah melakukan rawat jalan bagi 3 orang penderita AIDS di Aceh Tamiang ini yakni seorang lakilaki dan 2 orang perempuan untuk mengambil obat 1 kali dalam sebulan secara rutin seumur hidup dan tidak dikenakan biaya kepada penderita AIDS yang mengambil obat. Alhamdullillah setelah diberikan obat,ada perubahan yang signifikan terhadap penderita AIDS di Aceh Tamiang ini,” kata Mahlil. Mahlil mengatakan ada fenomena “Gunung Es” yang artinya satu penderita HIV/ AIDS bisa menular kepada 100 orang.” Makanya semua pihak di Aceh Tamiang harus waspada

terhadap fenomena itu,” imbau Mahlil. Diskriminatif Me n y a n g k u t d e n g a n kendala yang dihadapi di Aceh Tamiang, ungkap Mahlil, masih ada diskriminatif terhadap penderita masih relatif tinggi , artinya masih ada rasa takut dari masyarakat untuk bergaul dengan penderita HIV/AIDS yang ada di lingkungannya. Bahkan ada warga yang meminta agar penderita HIV/AIDS dipindahkan dari tempat mereka berdomisili. “ Seharusnya hal itu tidak perlu terjadi dan tidak perlu ditakuti karena virus HIV/AIDS tidak akan menular jika kita berteman dengan penderita HIV/AIDS yang ada di lingkungan kita berdomisili.Adanya sikap yang enggan berteman dengan penderita HIV/AIDS membuat penderita HIV/AIDS mengalami depresi mental, sehingga proses untuk penyembuhannya juga mengalami gangguan karena mereka dikucilkan oleh lingkungan sosialnya,” papar Mahlil. Mahlil menerangkan hanya ada 3 hal sebagai berikut yang bisa menyebabkan virus HIV/ AIDS menular yaitu kontak darah , artinya melalui transfusi darah yang sudah ada virus HIV/AIDS, pemakaian jarum suntik yang bergantian, kontak cairan sperma atau berhubungan badan dengan penderita HIV/AIDS dan pemberian Air Susu Ibu ( ASI) oleh ibunya yang menderita HIV/AIDS kepada bayinya. Terkait dengan semakin tingginya angka penderita HIV/ AIDS di Aceh Tamiang,Mahlil menyatakan di Bumi Muda Sedia tidak ada lokasi tempat prostitusi bursa seks, tetapi Penjaja Seks Komersial ( PSK) banyak juga di Aceh Tamiang. Mereka biasanya melakukan negosiasi tentang tarif ngeseks di Aceh Tamiang. Setelah cocok, selanjutnya mereka biasanya pergi ke luar Aceh Tamiang. Mahlil mengimbau kepada orang tua di Aceh Tamiang untuk mengawasi anaknya agar tidak terjerumus dalam kehidupan seks bebas di luar nikah. Begitu juga bagi laki-laki jangan sampai terpengaruh “jajan” mencari Wanita Idaman Lain di luar karena bisa berakibat fatal terkena virus HIV/AIDS. Begitu juga perempuan jangan mencari Pria Idaman Lain ( PIL) yang sangat membahayakan bagi dirinya bisa saja terkena penyakit yang mematikan itu. “ Mantan PSK di Aceh Tamiang juga ada yang sudah terkena HIV/AIDS,” ungkapnya. Alih Profesi Kabupaten Aceh Tamiang merupakan pintu gerbang berbatasan langsung dengan Kabupaten Langkat, Provinsi Sumatera Utara. Kabupaten Aceh Tamiang adalah pintu gerbang perbatasan Provinsi Aceh dengan Provinsi Sumatera Utara. Sebelumnya beberapa waktu yang laluWaspada sudah pernah melansir tulisan tentang adanya dugaan praktik prostitusi di Kabupaten Langkat, persis di kawasan Bukit Harapan, Bukit Selamat yang sangat terkenal dengan sebutan Bukit Arjuna dan di seputaran Halban, Kecamatan Besitang, Kabupaten Langkat, Provinsi Sumatera Utara itu sudah berlangsung lama lokasi bisnis esekesek, bahkan sudah pernah berulangkali dirazia oleh Pemkab Kabupaten langkat dan aparat di daerah itu.

Bukan itu saja, masih menurut catatan Waspada, kalau dahulu modus operandi praktik prostitusi berlangsung di warung remang-remang, kini ada dugaan indikasi bisnis esek-esek mulai pindah haluan menjadikan rumah sebagai tempat praktik para PSK di Langkat. Ironisnya lagi, berdasarkan hasil pantauan Waspada di kawasan “bursa “ penjaja birahi dan cinta kilat di daera itu beberapa waktu yang lalu , tidak sedikit perempuan yang berasal dari Provinsi Aceh bersama perempuan yang berasal dari daerah lainnya di Sumut ikut menjaja seks di Bukit Harapan, Bukit Selamat, Seputaran Halban dan kawasan lainnya di Kabupaten Langkat. Berdasarkan penelusuran Waspada, usia perempuan asal Aceh yang menjajakan diri sebagai wanita pemuas birahi di daerah itu antara 17 hingga 30 Tahun. Perempuan asal Aceh itu berdatangan dari sejumlah kabupaten/Kota yang ada di Provinsi Aceh, terutama dari kawasan belahan pantai Timur Aceh, mulai dari Kabupaten Bireuen hingga Aceh Tamiang. “ Kalau di Aceh karena diberlakukan Syariat Islam, maka tak ada lokasi warung remangremang seperti di sini.Makanya banyak wanita asal Aceh yang beroperasi di Langkat ini,” ungkap Selvia ( bukan nama sebenarnya) perempuan yang mengaku berasal dari Kota Lhokseumawe yang menjajakan diri di Langkat ketika ditanya Waspada beberapa waktu yang lalu. Menurut Selvia yang mengaku berusia 22 Tahun itu, Dirinya bukan satu-satunya wanita yang berasal dari Aceh ikut menjajakan diri di Kabupaten Langkat, tetapi masih banyak wanita lainnya dari Aceh menjadi PSK di Langkat. Hal senada juga diungkapkan Intan ( juga bukan nama sebenarnya) yang mengaku berasal dari Kabupaten Aceh Timur. PSK berusia 25 Tahun yang berkulit putih dan rambut yang direbonding serta memakai pemerah bibir warna merah jambu itu juga mengakui dirinya melayani laki-laki yang membutuhkan layanan seks darinya di rumah yang dijadikan sebagai tempat prostusi tersembunyi dan ada juga dijual minuman keras di rumah tempat dirinya mangkal menanti pengunjung . Menurut pengakuan dari PSK yang beroperasi di Langkat, mereka ada yang belum pernah menikah tapi karena sudah pernah di “rusak” oleh laki-laki yang tidak bertanggungjawab, maka akhirnya memilih jadi PSK. Selain itu ada juga yang gara-gara ditinggal begitu saja oleh suami yang tidak bertanggung jawab karena kawin lain dan ada pula yang berstatus janda dan lain-lain yang memang kesulitan ekonomi dan tidak punya modal untuk buka usaha serta tak punya keterampilan lainnya yang menghasilkan uang. “ Apa boleh buat, karena kami butuh uang untuk menghidupkan keluarga, maka terpaksa menjadi PSK di sini,” kilah Juwita ( bukan nama sebenarnya) yang mengaku dari Kota Langsa Menurut pengakuan kupukupu malam yang ada di daerah itu, Tarif yang dikenakan untuk berkencan short time sangat bervariasi antara Rp 125 ribu – Rp 150 ribu dan tarif tersebut belum termasuk sewa kamar yang juga tarifnya sangat ber-

variasi yaitu antara Rp25 ribu –Rp 50 ribu. Sedangkan untuk tarif “long time” atau booking , terang wanita malam itu lagi, juga bervariasi antara Rp 300 ribu-Rp 500 ribu. “ Penghasilan yang saya peroleh lumayan jadi PSK di sini,” imbuh Juwita yang berparas cantik itu sambil menyulut rokok yang menempel di bibirnya yang tipis berwarna merah itu. Para PSK yang ada di daerah lembah hitam itu juga menandaskan, mereka tidak tahu sampai kapan berhenti bekerja sebagai PSK.” Mungkin kalau kami sudah tua dan sudah tidak cantik lagi, sehingga tak ada lagi laki-laki yang butuh layanan, tentu saja kami akan berhenti sendiri sebagai PSK di daerah ini,” ujarnya sambil menuangkan minuman berakohol ke dalam gelas laki-laki“hidung belang” yang lagi asyik berkaroke ria di lokasi bisnis haram esekesek itu. Sementara itu sebelumnya beberapa waktu yang lalu, Ketua LSM Peusigak Droe Aceh,S.Adi Putra AHM ketika dikonfirmasi Waspada terkait wanita asal Aceh yang menggeluti bisnis sebagai PSK di Kabupaten Langkat itu menyatakan banyak wanita asal Aceh yang terjerumus dan terjun sebagai PSK di Bukit Harapan, Bukit Selamat dan seputaran Halban , Kabupaten Langkat. “ Saya dan dibantu oleh rekan-rekan dari KPA sedang melakukan penelitian atau investigasi tentang hal itu,” ungkap Adi. Berdasarkan data sementara hasil investigasi, papar Adi, data kasarnya telah ada sebanyak 440 orang warga Aceh yang berprofesi sebagai PSK di Langkat. Adi merincikan,Warga Aceh itu berasal dari Kabupaten Bireuen sampai Kabupaten Aceh Tamiang. Untuk Kabupaten Aceh Tamiang yang terindifikasi yaitu 200 orang, Kota Langsa 60 orang, Idi 20 orang, Peureulak 20 orang, selebihnya ada yang berasal dari Bireuen, Lhokseumawe, Panton Labu ( Aceh Utara) dan Kota Binjei ( Aceh Timur). Adi mengungkapkan, jika ditelusuri mereka menjadi PSK karena alasan ekonomi dan tidak punya keahlian, ada pula karena frustrasi kecewa pada suami dan menjadikan lokasi prostitusi di Langkat sebagai tempat pelarian. Menurut Adi, Sebenarnya bukan faktor kemiskinan saja yang membuat warga Aceh terjerumus jadi PSK, tetap ada juga anak orang kaya yang terjun sebagai PSK karena akibat pergaulan bebas. Bahkan, ada juga yang korban konflik yang awalnya berpacaran dan kemudian dijanjikan dinikahi, namun malah dicampakkan, sehingga wanita ini melampiaskan dirinya menjadi PSK di Langkat. Lantas kini muncul pertanyaan, apakah akibat banyaknya perempuan berasal dari Provinsi Aceh yang disebut-sebut sebagai penjaja seks di Langkat itu atau kemungkinan ada penyebab faktor lainnya sehingga ikut mendongkrak angka penderita HIV/AIDS di Provinsi Aceh yang dijuluki sebagai Tanah Rencong dan Serambi Makkah itu, khususnya bagi Kabupaten Aceh Tamiang yang angkanya terus merangkak naik melambung tinggi itu? Tentu saja untuk menjawab pertanyaan diperlukan hasil penelitian lebih lanjut secara lebih mendalam. Muhammad Hanafiah


WASPADA Kamis 8 Desember 2011

C7 Jangan Pakai Dana APBK Untuk Gaji Dosen UGL

Gorong Tak Diaspal, Kawasan Pasar Neusu Rawan Kecelakaan BANDA ACEH (Waspada) : Akibat pembangunan goronggorong yang dinilai asal jadi di Jalan Hasan Saleh yang merupakan jalan lintas utama Pasar Neusu di Kecamatan Baiturrahman, Kota Banda Aceh persis di depan Bank Aceh Capem Neusu dan Pante Pirak, kondisinya kini rawan kecelakaan. Sejumlah pengendara dan warga setempat menyampaikan hal itu, Rabu (7/12). “Jika tidak segera dituntaskan pengerjaannya dengan melakukan pengaspalan kembali, warga mengancam akan melakukan pemblokiran lintas tersebut. Kontraktor diminta bertanggungjawab,” sebut seorang warga setempat. Kemarahan warga itu memuncak menyusul pihak rekanan tidak menggubris keluhan pengguna jalan dan warga setempat yang hampir saban hari terjadi kecelakaan akibat gorong-gorong yang tengah dikerjakan ditinggalkan begitu saja. “Warga melakukan aksi protes ini agar pembangunan goronggorong ini cepat diselesaikan pihak rekanan,” ujar M Ikhsan, warga setempat, Rabu (7/12). Kata dia, tiap hari titik itu tak sepi dari kecelakaan yang terperosok dan tersenggol. Pasalnya, gorong-gorong itu dikerjakan asal jadi. “Kondisi sekarang berdebu sehingga warga sekitar menghirup debu dan tak tertutup kemungkinan akan terjadi penyakit,” katanya Sejumlah pedagang di Jalan Hasan Saleh dan Jalan Residen Danu Broto, kawasan Des Neusu, Kecamatan Baiturrahman dan Desa Lamlagang, Kecamatan Banda Raya mengeluhkan kondisi gorong-gorong dan badan jalan yang berdebu. Pembangunan gorong-gorong dan drainase yang masih dalam tahap pengerjaan, namun sudah ditinggalkan itu tidak pernah disiram, baik pada pagi maupun siang hari. (b09)

DPRK Pidie Nilai Kinerja SKPK Buruk SIGLI (Waspada) : Terlambatnya pembahasan dan pengesahan Anggaran Pendapatan dan Belanja Kabupaten Perubahan (APBKP) Pidie tahun ini, DPRK setempat menilai kinerja SKPK Pidie sangat buruk dan lambat. Hal itu disampaikan sejumlah anggota dewan setempat kepada Waspada, Selasa (6/12) secara terpisah menyangkut terlambatnya pembahasan dan pengesahan APBK-P 2011 yang tinggal beberapa hari lalgi. “Dewan menyesalkan keterlambatan itu pada tahun anggaran 2011 ini menjelang tutup tahun. Keterlambatan itu disebabkan sistem kinerja Satuan Kerja Perangkat Kabupaten (SKPK). Padahal, limit waktu yang diberikan Oktober 2011 lalu harus diserahkan ke dewan, namun yang terjadi baru diserahkan beberapa pekan lalu,” katanya. “Kami sangat kecewa kinerja SKPK yang lambat. Bupati harus berani menegur kinerja SKPK,” kata Mahfuddin. Ia menjelaskan, terlambatnya diserahkan Rancangan APBKP, eksesnya bisa menyebabkan molornya pelaksanaan proyek pembangunan sekaligus lambatnya pembahasan Anggaran Belanja Tambahan (ABT) atau perubahan anggaran tahun ini. Bahkan, dewan akan terlambat melakukan pansus. Efek lainnya, bisa mempengaruhi pembangunan infrastruktur masyarakat. “Kita khawatir, nantinya akan hadir proyek luncuran. Apalagi saat ini Pemkab miskin dana karena terserap untuk biaya rutin PNS. (b09)

Perempuan Pidie Tuntut Dana Kelompok Segera Dicairkan SIGLI (Waspada) : Sejumlah perempuan di Kabupaten Pidie yang tergabung dalam Kelompok usaha rakyat menuntut Pemkab setempat segera mencairkan dana pemberdayaan ekonomi perempuan di daerah itu yang didugakan telah diendapkan. Sebab dana itu hingga kini belum dicairkan kepada masyarakat yang berhak. Padahal sebelumnya berdasarkan informasi yang diperoleh dana tersebut telah ada hanya menunggu penyalurannya saja, sebut beberapa pengurus kelompok perempuan itu kepada Waspada, Selasa (6/12). Disebutkan, total dana bantuan untuk kelompok perberdayaan ekonomi perempuan di Pidie mencapai Rp7,3 miliar yang diperuntukkan untuk 730 kelompok, masing-masing kelompok memperoleh Rp10 juta. Kepala Badan Keluarga Sejahtera dan Pemberdayaan Perempuan (BKSP) Kabupaten Pidie, Ir Afniati kepada wartawan menjelaskan, paling lambat dana bantuan itu sudah dikirim dari provinsi ke Kabupate Pidie, pada Rabu atau Kamis (7–8/12). Dana yang harus disalurkan kepada 730 kelompok di desa masing-masing mencapai Rp.7,3 miliar. Dana itu ditransfer ke rekening kita dan setelah itu langsung disalurkan ke kelompok, ujar Afni. (b09)

Rancangan Perubahan APBK Agara 2011 Diterima Semua Fraksi KUTACANE (Waspada) : Tiga fraksi yakni Fraksi Kerakyatan, Fraksi Keadilan dan Fraksi Golkar, dalam sidang anggaran perubahaan APBK Aceh Tenggara 2011 dinyatakan disetujui menjadi qanun perubahan 2011, Rabu (7/12). Rasjidin, dari Fraksi Kerakyatan dalam pidato pandangan akhir fraksinya terkait perubahan APBK yang semula Rp480 miliar lebih bertambah menjadi Rp170 miliar dan setelah perubahan menjadi Rp658 miliar lebih tersebut meminta eksekutif agar mematuhi peraturan di dalam penggunaan anggaran, juga diminta benarbenar mengefektifkan pos-pos yang menjadi sumber PAD. Disebutkan juga selama ini masih banyak program yang dijalankan bupati yang belum pro rakyat. Irwandi Deski, dari Fraksi Keadilan dalam penyampaian dalam sidang yang dipimpin Ketua DPRK Salim Fakhri dan Bupati Agara Hasanuddin B menyoroti defisit anggaran Rp5 miliar tahun 2011 dan bertambah menjadi Rp7 miliar menjadi Rp12 miliar di tahun 2012. Dia menekankan agar eksekutif benar – benar memprioritaskan kegiatan yang bersifat sosial, pro rakyat karena masih tampak ada kegiatan yang tidak pro rakyat. Dari Fraksi Golkar melalui Roy Darwan Tarigan menyampaikan salut atas semua yang telah dilakukan Bupati Agara. Apa yang dilakukan selama ini cukup komprehensif serta cukup positif. Di akhir sidang perubahan yang dihadiri 17 anggota dan 4 anggota izin tidak hadir di gedung dewan tersebut, Rasidun Pagan menyampaikan keputusan akhir fraksi – fraksi, selanjutnya Sekwan Salidin Husein membacakan keputusan Qanun perubahan APBK Agara tahun 2011. (b25)

Waspada / Rusli Ismail

KONDISI gorong-gorong yang ditinggalkan kontraktor tidak dilakukan pengaspalan kembali, sehingga mengganggu pengendara motor saat melewati. Tampak pengendara becak melewati goronggorong yang belum diaspal itu, Senin (5/12).

Buluhseuma MasihTerisolir TAPAKTUAN (Waspada):Ancaman Masyarakat Kemukiman Bulohseuma, Kecamatan Trumon, akan bergabung dalam wilayah Kota Subulussalam, karena kecewa terhadap perhatian Pemkab Aceh Selatan, mendapat perhatian serius Bupati Husin Yusuf. Bupati Husin Yusuf berjanji akan menurunkan tim ke Bulohseuma guna mengetahui keinginan sebenarnya masyarakat di sana, sekaligus menjajaki solusi yang tepat terhadap ancaman masyarakat itu. Dalam jawabannya terhadap pemandangan umum anggota dewan yang membahas

tentang RAPBK tahun anggaran 2012, di gedung dewan setempat di Tapaktuan, Rabu (7/12) bupati mengakui masyarakat daerah terpencil itu, memang memerlukan perhatian dari semua pihak, terutama me-nyangkut kasus pembangunan jalan tembus Keude TrumonBulohseuma. Sehari sebelumnya anggota DPRK Aceh Selatan, Azmir dalam pemandangan umumnya mengatakan sebanyak 197 kepala keluarga (KK) atau 800 jiwa warga Kemukiman Bulohseuma, Kecamatan Trumon mengancam akan memisahkan diri dari Kabuapaten Aceh Selatan dan bergabung dengan Kota Subulussalam, jika Pemkab Aceh Selatan tidak memfokuskan pembangunan di wilayah mereka. Pasalnya, menurut Azmir selama ini mereka merasa

kurang diperhatikan, terutama menyangkut jalan tembus Keude Trumon-Bulohseuma yang hingga saat ini belum kunjung tuntas. Karena masyarakat di sana sepakat berinisiatif akan memisahkan diri dari kabupaten induk Aceh Selatan. Informasi ini, kata Azmir merupakan aspirasi masyarakat memlui beberapa tokohnya mendatangi Ketua Komisi B itu. Mengantisipasi inisiatif masyarakat tersebut, Azmir meminta Bupati Husin Yusuf, lebih fokus memperhatikan pembangunan di wilayah itu. “Kita minta Bupati Husin Yusuf, benar-benar memperhatikan pembangunan di sana,”sebut Azmir seraya mengatakan pihaknya sangat prihatin dengan nasib masyarakat setempat karena masih dibelenggu kemiskinan dan ketertinggalan. (b30)

Saksi Akui Tinju Pembogem Bupati Aceh Selatan TAPAKTUAN(Waspada): Sidang lanjutan kasus bogem Bupati Aceh Selatan HusinYusuf dengan terdakwa Ketua LSM Pormak yang juga kontraktor, Ali Zamzami,35, yang digelar Pengadilan Negeri Tapaktuan, Rabu (7/12), berlangsung singkat dengan agenda mendengar keterangan saksi korban. Dalam sidang yang dipimpin Hakim Ketua Mukhlis, SH didampingi hakim anggota T.Alamadyan, SH dan Hasnul Tambunan, SH dan Jaksa Penunut Umum (JPU), Untung Syahputra, SH, saksi korban Husin Yusuf hadir di pengadilan, setelah tiga kali sidang sebelumnya berhalangan hadir,karena berdinas di luar daerah. Menjawab pertanyaan maj-

lis hakim, saksi korban Husin Yusuf mengakui dalam kasus penganiayaan tersebut, tinju terdakwa mengenai pelipis kirinyas. Ia menyebutkan kasus penganiayaan terjadi di pendopo bupati, 10 September lalu karena terdakwa kesal tidak mendapat paket proyek. Bupati Husin Yusuf tiba di pengadilan sekira pukul 09:20 mengenakan baju seragam coklat, menggunakan mobil dinas BL 170 TB dan dikawal dua aparat kepolisian. Sementara terdakwa didampingi penasehat hukumnya, Wahyu M.Waly ,SH. Sidang lanjutan kasus penganiayaan bupati itu, mendapat perhatian dari kalangan pers. Ketua Majelis Hakim Mukh-

lis,SH menskor sidang dan akan dilanjutkan Rabu pekan depan, dengan agenda pemerikasaan saksi lainnya. JPU Untung Syahputra,SH mendakwa Ali Zamzami, warga Gampong Ruak,Kecamatan Kluet Utara, yang kini berstatus tahanan luar itu, telah melakukan penyaniayaan terhadap Bupati Aceh Selatan HusinYusuf di pendopo bupati, 10 September lalu dan mengenai telinga sebelah kirinya. Akibat penganiaayaan itu menurut JPU terdakwa dibidik melanggar pasal 353 ayat 1 KUHP, jo pasal 351 ayat 1 KUHP, jo pasal 335 ayat 1 KUHP dengan ancaman hukuman, minimal empat tahun penjara. Kaus penganiayaan itu, diduga terkait persoalan proyek. (b30)

Proyek Normalisasi Saluran Pembuangan Di Kuta Jeumpa Asal-asalan BLANGPIDIE (Waspada) : Warga Gampong Kuta Jeumpa, Kecamatan Jeumpa, Kabupaten Aceh Barat Daya kecewa dengan proses pengerjaan proyek normalisasi saluran pembuang di desa mereka. Akibat proses pengerjaan yang serampangan menyebabkan jalan penghubung antara Desa Kuta Jeumpa dengan Desa Iku Lhung tak bisa diberfungsi lagi karena tanah yang diangkat dari saluran pem-

buang ditumpukkan di badan jalan. “Coba anda lihat, sekarang jalan penghubung dari Desa Kuta Jeumpa tembus Ikue Lhueng ini tak bisa dilewati lagi kendaraan bermotor akibat tanah yang diangkat dari saluran pembuangan itu ditumpukkan di badan jalan. Padahal sebelumnya jalan ini merupakan jalur alternatif menuju Desa Iku Lhung,” kata Tgk Syafii, 50,

warga setempat, Senin (5/12). Ketua Fraksi Partai Aceh DPRK Abdya, Zaman Akli bersama Ketua Komisi C DPRK Abdya Muhammad Nasir yang meninjau kondisi badan jalan mengaku kecewa melihat proses pelaksanaan proyek normalisasi saluran pembuang di desa tersebut. Sebab tujuannya untuk memperbaiki kendala yang satu malah kendala yang baru muncul. (cb05)

40 Ha Sawah Terancam Banjir Di Gayo Lues, Dua Irigasi Rusak BLANGKEJEREN (Waspada) : Tingginya intensitas curah hujan dalam beberapa bulan ini di Kabupaten Gayo Lues membuat sekitar empat puluhan hektare areal persawahan di daerah itu terancam banjir dan tergerus akibat keganasan beberapa arus sungai. Sementara dua irigasi di Desa Penggalangan yakni irigasi buah dan renggali rusak. Selain tingginya curah hujan di musim penghujan ini, pendangkalan arus sungai menjadi penyebab ancaman kerusakan. Akibatnya tidak sedikit areal persawahan ditutupi pasir dan batu serta sampah kayu.

Areal persawahan yang terluas terancam rusak akibat pendangkalan arus sungai terjadi di Desa Penggalangan, Kecamatan Blangkejeren seluas dua puluh hektare dan Desa Badak di Kecamatan Dabun Gelang, 21 hektare. Beberapa warga mengatakan, untuk mengantisipasi kerusakan yang lebih parah khususnya areal persawahan dan perkebunan, Pemkab setempat perlu melakukan normalisasi arus sungai seperti di Sungai Badak dan Sungai Atu Runtuk serta Sungai Tripe. “Kerusakan ancaman abrasi biasa terjadi di bulan Septem-

ber-Oktober. Namun usai dua bulan itu ancaman yang serupa akan datang pada JanuariFebruari. Soalnya dalam bulan itu intensitas curah hujan sampai pada puncaknya,” Kata Matsah, warga Penggalangan, Selasa (6/12). Dikatakan, dalam September lalu dua irigasi di daerah itu rusak dan areal persawahan warga setempat yang selesai ditanami tertimbun pasir dan batu serta kayu yang ikut di bawa air sungai. “Kami terpaksa melakukan penanaman ulang dan air di sawah kami tidak ada lagi akibat rusaknya irigasi buah dan renggali,” katanya warga itu.

Sementara petani di Desa Badak menyebutkan, areal persawahan mereka setiap tahun menjadi langganan banjir akibat dangkalnya arus sungai. “Kalau pemerintah tak segera melakukan normalisasi arus sungai, tak tertutup kemungkinan areal persawahan di desa kami menjadi bagian dari sungai. Sementara daerah persawahan menjadi salah satu penghasil gabah terbesar di Gayo Lues,” paparnya. Kepala Kantor Badan Penanggulangan Bencana Daerah (BPBD) Gayo Lues Djamaluddin Ilyas menjelaskan, pihaknya telah menyiapkan perencanaan

untuk penanggulangan bencana. Namun akibat minimnya dana tidak bisa semua daerah yang terancam banjir bisa diatasi. “Dana yang disediakan di APBD 2012 hanya Rp10 miliar. Sementara dana penanggulangan bencana dan normalisasi arus sungai memerlukan Rp700 miliar. Jadi dana dari APBD tidak cukup,” katanya. Kadis Pertanian dan Holtikultura Gayo Lues melalui Kabid Pertanian Edward Canto mengatakan, luas lahan persawahan saat ini mencapai 8.000 hektar. Sedangkan 5 persen (50 hektare) dari jumlah itu rusak akibat banjir. (cb04)

KUTACANE (Waspada) : Untuk menghemat dana daerah dan menambah alokasi dana bagi kegiatan lain yang masih belum tertampung, DPR Aceh mengusulkan Pemkab jangan gunakan APBK untuk gaji dosen. Usul dan saran pendapat itu disampaikan H Muslim Ayub, anggota DPR Aceh dari Fraksi PAN ,salah seorang anggota tim Pansus Tujuh ketika melakukan pertemuan dengan Bupati, Muspida Plus dan SKPK ,di Oproom Setdakab Agara, Selasa (6/12). Penggunaan dan pengalokasian dana dari APBK Agara untuk gaji dosen di Universitas Gunung Leuser (UGL) Kutacane, karena akan membebani keuangan daerah. Padahal, dari uang kuliah ribuan mahasiswa yang menimba ilmu di Fakultas Keguruan Ilmu Pendidikan, Tekhnik, Ekonomi dan Pertanian sendiri, mampu untuk membiayai gaji dosen yang ada di UGL Kutacane. Sebab itu, pengalokasian dana APBK Agara untuk membayar gaji dosen di Universitas Gunung Leuser, sudah selayaknya dihentikan karena kurang efektif dan sangat membebani keuangan daerah. “Andai saja dana untuk gaji dosen yang bersumber dari APBK digunakan untuk pos lain yang langsung menyentuh kepentingan

rakyat, tentu lebih bermanfaat lagi,” ujar Muslim Wakil Ketua DPW PAN Aceh itu. Ditambahkan calon Wakil Ketua DPR Aceh tersebut, pola atau kebijakan yang masih mempertahankan dana APBK untuk membiayai gaji dosen UGL Kutacane, perlu segera dihentikan, mengingat terbebaninya keuangan daerah dan masih banyaknya sumber dana lain yang masuk ke UGL Kutacane. Menyikapi usulan Bupati terkait penambahan ruangan baru di Universitas Gunung Leuser (UGL) Kutacane, Muslim dan anggota dewan lainnya, seprinsip untuk melobi dan membantu agar dana yang ada di Provinsi Aceh bisa dimasukkan untuk program pembangunan atau penambahan gedung baru UGL, seperti tahun 2010 lalu. DPRA sangat komit dan perhatian terhadap perkembangan UGL Kutacane, apalagi setelah mendengar rencana Pemkab dan pihak berkompeten lainnya untuk menambah Fakultas dan jurusan baru seperti Hukum dan Kehutanan yang memang sangat dibutuhkan di Aceh Tenggara dan sekitarnya. Turut hadir pada acara temu ramah antara DPRA dengan Bupati, Muspida dan SKPK, H Umuruddn Desky, HT Syarifuddin Selian, Adnan Beuransyah dan Jemarin.(b26)

Status PTGL Agara Jadi Universitas Berdampak Molor Wisuda KUTACANE (Waspada) : Pj Rektor Universitas Gunung Leuser (UGL) Aceh Tenggara Prof Hasnudi mengeluarkan surat yang menghilangkan jabatan ketua sekolah tinggi akibat perubahan status akan berdampak molornya jadwal wisuda mahasiswa di Agara ini. Prof Husnadi kepada Waspada, Selasa (6/ 12) mengaku digantinya status perguruan tinggi itu menjadi universitas di Agara itu, memiliki konsekwensi terjadinya perubahan status jabatan dosen, maka dilakukan perubahan. Hal ini disampaikannya terkait dihilangkannya jabatan para ketua perguruan tinggi di antaranya Sragafa, Ketua Sekolah Tinggi Pertanian menjadi Purek I dan Usman Safri, sebelumnya Ketua FKIP ditempatkan pada bagian Badan Penelitian dan Pengembangan UGL. Husnadi mengaku dikeluarkannya surat penugasan pergantian status bukan merupakan inisiatifnya sendiri, melainkan mempedomani suara Bupati Agara Hasanuddin selaku Pembina UGL dan Ketua Yayasan Syahbudin.

Hal ini disampaikan, terkait adanya suara sumbang yang mengatakan tugas seorang Pj Rektor semestinya mempersiapkan rektor defenitif serta ornamen lainnya ketimbang memangkas jabatan di status perguruan tinggi, karena status universitas sendiri masih dalam proses. Hal ini jelas berdampak pada ratusan mahasiswa yang telah menjalani sidang akan mengalami penundaan jadwal wisuda mereka. Sumber Waspada mengatakan, seharusnya Prof Husnadi terlebih dahulu membentuk dewan senat dosen UGL yang bekerja melahirkan rektor defenitif. Sementara Syahbuddin, Ketua Badan Pelaksana Harian UGL di DPRK Agara, Rabu (7/12) mengatakan, dia telah membicarakan persoalan UGL dan nasib para mahasiswa pasca perubahan status serta jabatan di kampus itu. Diakui, akibat kebijakan saat ini memang akan berdampak molornya jadwal wisuda yang semestinya dilakukan Desember 2011 ini, diprediksi akan molor minggu ketiga Januari 2012. (b25)

Bupati Minta DPRA Perjuangkan Dana Pembangunan Gedung DPRK Agara KUTACANE (Waspada) : Bupati H Hasanuddin B meminta anggota DPR Aceh yang berasal dari Daerah Pemilihan Tujuh Aceh, agar memperjuangkan pembangunan Kantor DPRK Agara . Permintaan itu disampaikan Bupati, ketika bertemu dan bertatap muka dengan enam dari tujuh anggota DPR Aceh, di Oproom Pemkab Agara, muspida Plus dan SKPK, Selasa (6/12), terkait turunnya tim Pansus Tujuh Aceh ke Bumi Sepakat Segenep. “Kantor DPRK ini , usianya terbilang renta dan dibangun tahun 1972 lalu, karena itu wajar saja bila disana sini telah banyak mengalami kerusakan , bahkan ruangan kerja dewan pun terbilang masih kekurangan,” kata Bupati. Untuk pembangunan gedung baru itu, Bupati berharap agar wakil rakyat di DPR Aceh yang berasal dari DP tujuh, bersama-sama membantu memperjuangkan dana pembangunan gedung baru, karena dengan perjua-

ngan dewan, diyakini pengalokasian dana pembangunan gedung baru itu bisa segera terlaksana. Berdasarkan perkiraaan awal, pembangunan gedung itu sendiri akan menelan dana sebesar Rp14 miliar, dana itu sendiri diharapkan dari dana aspirasi DPRA atau dana lain yang memungkinkan bisa dimasukkan ke Agara. “Jika masing-masing anggota DPRA memplotkan dana aspirasinya senilai Rp2 M saja, maka dari tujuh anggota DPRA dari DP tujuh, akan terkumpul dana sebesar Rp14 M, ini juga merupakan solusi yang bisa ditempuh,” ujar bupati. Usai melakukan temu ramah dan menyerap aspirasi masyarakat, Bupati bersama anggota DPRA, H Umuruddin Desky, Adnan Beuransah, Muslim Ayub, T Syarifuddin Selian dan Jemarin ,turun ke lapangan meninjau pembangunan fisik proyek yang bersumber dari APBA di UGL Kutacane dan Masjid At Taqwa Kutacane. (b26)

Sejumlah LSM Keberatan Disebut Ilegal BLANGKEJEREN (Waspada) : Terkait pernyataan Selamat, Kepala Kesbang Polinmas Kabupaten Gayo Lues, tentang status ilegal 46 organisasi kemasyarakatan di Gayo Luesyang dimuat koran ini edisi kemarin langsung dibantah beberapa LSM yang beroperasi di Gayo Lues. Di antaranya LSM Perlahan melalui ketuanya Syukran mengaku keberatan dikatakan organisasi yang dipimpinnya termasuk dalam kategori ilegal. Padahal ia telah mendaftarkan ulang ke Kesbanglinmas sejak 2008 dan akan berakhir pada 2013. Menurutnya, yang dikatakan ilegal sama sekali tidak mempunyai badan hukum dari notaris dan tidak dileges ke pengadilan negeri setempat. Karena, kewajiban sebuah organisasi pada Peraturan Pemerintah RI No. 08 tahun 1985 tentang organisasi kemasyarakatan tidak pernah menyebutkan setiap organisasi wajib terdaftar pada Kesbang Linmas. Yang hanya mengatakan pada pasal 7 poin mempunyai anggaran dasar dan rumah tangga dan poin b. menghayati, mengamalkan dan meng-

amankan Pancasila dan UUD 1945. Sedangkan, bila dikatakan bolehnya suatu organisasi beroperasi atau tidak, baik itu pembekuan dan pembubaran pemerintah, disebabkan melakukan kegiatan yang mengganggu keamanan dan ketertiban umum, menerima bantuan dari pihak asing tanpa persetujuan pemerintah dan memberi bantuan kepada pihak asing yang merugikan kepentingan bangsa dan negara. Hal ini jelas diatur pada PP No.8 tahun 1985 Bbab VII pasal 13. Selamat, Kepala Kesbang Polinmas Gayo Lues, Selasa (6/12) di ruang kerjanya mengimbau kepada seluruh organisasi kemasyarakatan bagi yang izinnya sudah habis masa berlakunya agar diperpanjang kembali. Mengenai pemberitaan dirinya tidak pernah mengatakan setiap LSM harus didaftar ulang setahun sekali, dia mengatakan setiap organisasi kemasyarakatan yang telah terdaftar di Kesbang Polinmas Gayo Lues agar mendaftar ulang sesuai dengan masa waktu yang tercantum di dalam akte notaris. (cjs)

Buhari Selian Kembali Pimpin PAN Agara KUTACANE (Waspada) : Buhari Selian kembali dipercayakan memimpin PAN Aceh Tenggara, setelah peserta Musda III yang berlangsung, Selasa (6/12) di Gedung Seni Kutacane, secara aklamasi hanya mengajukan satu nama. Keputusan 16 Dewan Pimpinan Cabang (DPC) PAN se-Agara tersebut, secara otomatis menghentikan rumor yang berkembang bakal terjadi persaingan ketat merebut posisi orang nomor satu di tubuh PAN Agara. Bahkan, isu munculnya nama dr Bukhari Pinem yang mendapat dukungan dari kader untuk bersaing dengan Buhari Selian, pupus sudah setelah kader muda mengatakan tidak mencalonkan diri, demikian juga dengan kandidat lain Paisal Pinem dan Erdianto Sekedang. Praktis dengan tidak majunya tiga bakal calon ketua tersebut, membuat langkah Buhari Selian, Ketua DPD sebelumnya menjadi mulus dan kembali memimpin partai berlambang Matahari terbit tersebut untuk periode 2011-

2015. Aswat Saleh, Ketua DPC PAN Bukit Tusam, Selasa (6/12) mengatakan, munculnya keputusan aklamasi dari enam belas Ketua dan Sekretaris DPC terhadap Buhari Selian karena kader masih percaya terhadap kepemimpinan partai matahari di bawah Ketua Baleg DPRK Agara. Selain itu, terjadinya kesepakatan politik antara sejumlah bakal calon dengan ketua terpilih, menjadi langkah maju dan membuat proses Musda III berjalan lancar dan sukses seperti harapan kader. Adapun enam belas DPC yang mengusulkan secara aklamasi agar PAN Agara kembali dipimpin Buhari Selian yakni, DPC Ketambe, Badar, Darul Hasanah, Babussalam, Lawe Bulan, Deleng Pokisen, Lawe Alas, Tanoh Alas, Babul Rahmah. Selanjutnya, Dewan Pimpinan Cabang PAN Lawe Sumur, Bambel, Bukit Tusam, Semadam, Lawe Sigalagala, Babul Makmur dan Dewan Pimpinan Cabang PAN Kecamatan Leuser.(b26)



WASPADA Kamis 8 Desember 2011

Unimal Bahas Zakat Produktif Dengan Instansi Terkait LHOKSEUMAWE (Waspada) : Universitas Malikussaleh (Unimal) Lhokseumawe membahas pengelolaan zakat produktif dengan intasi terkait, baik Baitul Mal Aceh Utara maupun Baitul Mal Lhokseuamwe. Melaui seminar sehari di Gedung ACC Unimal, Cunda, Lhokseumawe, Rabu (7/12). Seminar sehari itu dikaji tiga pemateri, yaitu Prof Dr Hasbi Amiruddin, MA dan Dr Nazaruddin A Wahid, MA dari IAIN Ar Raniry dan Dr Armiadi Musa, MA dari BI Banda Aceh. “Acara dibuka Rektor Unimal Apridar, SE.MSi, sementara peserta dari ulama, intansi perbankan, lembaga pendidikan, ICMI, AKLI dan masyarakat,” tutur Hijri Juliansyah selaku Ketua Pantia. Hijri mengungkap, Unimal selama ini sudah empat tahun menjalankan program pemberian zakat produktif kepada masyarakat miskin di Aceh Utara dan Lhokseumawe. “Kami berikan itu bagi masyarakat yang mau membuka usaha, khusunya usahausaha UKM, dan saya lihat perkembangannya meningkat 60 persen,” sebutnya. Panitia berharap kepada Baitul Mal kabupaten/kota bisa mengaplikasi konsep pemberian zakat produktif kepada si muzakki (penerima zakat) untuk menunjang perekonomian masyarakat miskin di daerah. Karena selama ini arah Baitul Mal masih lebih banyak menyalurkan zakat dalam bentuk konsumtif (zakat bukan untuk usaha). Dalam pembahasan itu direkomendasi enam poin, yaitu objek zakat setiap pertambahan nilai ekonomis, kemudian pembayaran zakat harus pada lembaga formal yang telah ditetapkan oleh pemerintah, mengaplikasi sebagai pengurang pajak pendapat mengenai nisab harus mengaju kepada DNS Baitul Mal Provinsi. Selanjutnya kadar nisap Qanun nomor 10 tahun 2007 sama seperti keputusan MUI, dan yang terakhir Baitul Mal perlunya mapping (pemetaan) kemiskinan sehingga mempunyai database mustahik (pengeluar zakat) dan muzakki (penerima zakat). (cmk)

Tenggelam, Nelayan Kutablang Belum Ditemukan KRUENGMANE (Waspada) : M Jamil yang tenggelam di ujung Kuala Peusangan, Bireuen belum ditemukan Tim SAR sejak Rabu (7/12) pukul 06:00. Tenggelamnya M Jamil saat menarik pukat dan menyelam ke dasar laut yang berada 3-4 mil dari daratan TPI Krueng Mane di Muara Batu, Aceh Utara. M Jamil seorang nelayan asal Buket Dalam, Kec. Kutablang, Bireuen, sejak setahun sudah melaut di seputaran TPI Krueng Mane. Hari naasnya, M Jamil menyelam tidak memakai peralatan lengkap berenang untuk menarik jaring yang tersangkut. Panglima Laot Dahlan mengatakan, menurut pengakuan temannya, setelah M Jamil tenggelam mereka berusaha mencari, sampai meminta bantu teman-teman dari boat lain. Kendati demikian, usaha itu tidak membuahkan hasil. Usaha itu diperluas dengan menghubungi Kapolsek, Tim SAR dan PMI. Pencarian itu juga belum membuahkan hasil. Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kapolsek Muara Batu Iptu Ilyas Hamid mengatakan, pencarian itu terus dilakukan, karena pencarian kini turut di bantu oleh petugas LANAL dan TNI. (cmk)

20 Tahanan Kabur Masih Diburu BIREUEN (Waspada) : Selama sepuluh hari sejak kaburnya 30 napi dan tahanan Rutan Bireuen, Minggu (27/11) pukul 16:55, hingga Rabu (7/12), Rutan Bireuen masih ditutup dan tidak bisa menerima kunjungan tamu untuk masuk ke dalam Rutan. Masih ditutupnya kunjungan tamu bagi para keluarga untuk menjenguk tahanan sebagai suatu kebijakan Rutan karena saat ini masih melakukan pembenahan internal dan menyelidiki insiden kaburnya para tahanan. Bagi para keluarga tahanan yang mau mengantar makanan diserahkan melalui petugas Rutan untuk disampaikan kepada tahanan yang dituju. Kepala Cabang Rutan Bireuen Indra Gunawan, menjelaskan hal itu menjawab Waspada di kantornya, Rabu (7/12). Kebijakan ini, kata Indra Gunawan, bersifat sementara dan meminta keluarga tahanan agar bersabar karena belum dapat izin kunjungan ke dalam Rutan. Hingga, Rabu (7/12) dari 30 napi yang kabur, 10 napi sudah ditangkap. Kapolres Bireuen AKBP Yuri Karsono mengatakan, pihaknya masih fokus memburu 20 napi dan tahanan yang masih kabur. Indentitas 20 napi dan tahanan yang sudah masuk DPO sudah disebar ke seluruh Polres di Aceh maupun luar Aceh. (b12)

Waspada/Arafat Nur

TERLIHAT beberapa ekor sapi dan kambing yang berkeliaran di pekarangan kampus Universitas Malikulssaleh (Unimal) Reuleut, Muara Batu, Aceh Utara.

Sapi Berkeliaran Di Kampus Unimal MUARA BATU (Waspada) : Tidak hanya di luar perkarangan di dalam kampus Universitas Malikulssaleh (Unimal) Reuleut, Muara Batu, Aceh Utara juga berkeliaran sapi dan kambing dengan meninggalkan kotorannya. Menurut mahasiswa setempat, Rabu (7/12), kawanan sapi sering berkeliaran di kampus itu. Ada kalanya sapi milik penduduk setempat berkeliaran di jalan, juga mengotori badan jalan. Bahkan kotoran lembu ini juga menciptakan sebuah kejadian langka, ada kenderaan mahasiswa yang terjatuh gara-gara terpeleset kotoran ini. Sejumlah mahasiswa mengaku tidak sanggup lagi mengusir kawanan sapi itu yang ternyata bukan hanya di satu titik. Kendatipun kampus memiliki pagar, tetapi terkesan terbiarkan sapi-sapi itu masuk. Sejumlah dosen di kampus itu menolak untuk berkomentar. (b14)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


Kekacauan Hambat Pembangunan, Personil TNI Harus Waspada LHOKSEUMAWE (Waspada) : Danrem 011/ Lilawangsa meminta seluruh personil yang bertugas di setiap Koramil bersikap waspada. Anggota TNI di kecamatan di wilayah teritorial Korem harus membantu menciptakan perdamaian dalam masyarakat. Danrem 011/LW Kolonel Inf A Rachim Siregar menegaskan, seluruh personil TNI di jajaran Koramil harus waspada. Meskipun potensi kekerasan bersenjata terjadi di kawasan tertentu, seperti Geureudong Pase, namun semua Koramil tetap waspada. “Tidak hanya di Geureudong Pase, semua Koramil kita minta waspada,” ungkapnya usai apel Danramil 2011 di Gedung KNPI Lhokseumawe, Rabu (7/12). Sekitar 150 personil TNI dari tujuh Kodim ikut kegiatan itu. Danrem mengatakan, pembangunan di bumi Serambi Mekkah ini tidak akan jalan, bila masih ada kelompok yang berusaha memecah belah, mengadu domba serta menciptakan suasana yang tak kondusif. Pada kesempatan tersebut, Danrem menambahkan, di provinsi paling barat Indonesia Waspada/Zainal Abidin

DANREM 011/LW,Kolonel Inf A Rachim Siregar sedang memasang tanda peserta apel Danramil di Gedung KNPI Lhokseumawe, Rabu (7/12).

PDAM Tirta Mon Pase Belum Layak Hapus Subsidi LHOKSEUMAWE (Waspada): PDAM Tirta Mon Pase belum layak menaikkan tarif air karena pelayanannya belum maksimal. Dengan Kualitas air masih rendah dan perlatan kadaluarsa, seharusnya Pemkab Aceh Utara mempetahankan subsidi air kepada masyarakat.

Ketua Lembaga Konsumen Muslim (LKM), Syarial, NS kepada Waspada, Rabu (7/12) mengatakan, selama ini kualitas air PDAM Tirta Mon Pase masih rendah. “Bahkan dengan kondisi kekeruhannya, tarif yang diperlakukan sekarang terlalu mahal,” kata Syahrial. Selain itu, sejumlah meteran sambungan rumah juga kadaluarsa. Sehingga tidak standar,

perhitungannya lebih tinggi dibandingkan dengan jumlah air yang keluar. “Kondisi ini tentunya juga dapat merugikan masyarakat. Olehsebab itu masyarakat jangan terlalu dibebani dengan menikan tarif,” tambahnya. Kalau memang Pemkab Aceh Utara terpaksa menghapus subsidi air PDAM, perusahaan milik pemerintah daerah itu harus memberikan pelayanan maksimal. Seperti mengantikan meteran yang tidak standar lagi, serta mensuplai air bekualitas. Syarial NS menambahkan, Pemko Lhokseumawe jangan tinggal diam dengan ancaman kenaikan tarif air kepada warga kota. PDAM milik Pemko yang sudah dibentuk harus segera mencari solusi agar masyarakat tidak dibebankan dengan tariff air tanpa subsidi dari Pemkab Aceh Utara. Direktur PDAM Tirta Mon Pase, Zulfikar Rasyid mengakui, kondisi sejumlah meteran sambungan rumah kurang

bagus. “Kalau tarif sudah kita naikan, kita akan ganti. Bahkan beberapa meteran milik pelanggan di Kota Lhokseumawe sedang kita ganti,” jelasnnya. Terkait dengan rencana kenaikan tarif pada tahun 2012, menurutnya akibat tidak ada lagi dana subsidi dari pemerintah daerah. Biaya pengolahan air bersih, kata dia semakin tinggi. Diantaranya, untuk pembayan pajak air permukaan, pembelian tawas, biaya listik dan berbagai pengeluaran lainnya. Namun untuk meringankan pemakai air bersih di Wilayah Kota Lhokseumawe, menurut Zulfikar Rasyid, masih ada solusi. Yaitu, Pemko Lhokseumawe bisa membantu mengantikan biaya tarif agar warga tidak perlu membayar penuh tarif yang ditentukan PDAM. “Untuk teknisnya kita masih bisa membantu, bila pemerintah kota mau membantu masyarakat,” tambah Zulfikar Rasyid.(b15)

Galian C Penyebab Kerawanan Laka Lantas LHOKSEUMAWE (Waspada) : Rawannya kecelakaan lalu lintas di jalan raya provinsi di Desa Balang Panyang dan Meuria Paloh, Lhokseumawe, lebih disebabkan akibat rusaknya lingkungan akibatproyek liar galian C di wilayah dua desa setempat. Pihak Badan Lingkungan Hidup dan Kebersihan (BLHK) menyatakan bahwa proyek galian C di Blang Panyang menyebabkan rusaknya lingkungan setempat, dan mengotori badan jalan raya.“Kasus ini sudah kami laporkan, tetapi tetap tidak ada

respon,” ungkap Kasub Analisis Dampak Lingkungan, Iskandar, Rabu (7/12). Iskandar mengakui bahwa akibat dari angkutan tanah itu telah mencemari badan jalan raya, jalan menjadi licin dengan lumpur liat manakala hujan turun. Bila pun tidak ada hujan, jalanan menjadi onggokanonggokan kecil yang membuat kendaraan bergoyang-goyang dan tergelincir. Belum lagi akibat dari banyaknya lubang yang bertebaran di banyak titik sepanjang 2 Km itu. Pihak BLHK menyesali ke-

adaan itu, tetapi tidak mampu berbuat banyak. Sebelumnya Walikota sendiri sudah menegur pihak pengusaha galian, dan diperintahkan untuk membuat penyangga. Sementara itu, Murtala yang membidangi pengawasan di BLHK menegaskan, usaha galian C itu liar, sebab tidak ada rekomendasi dari BLHK serta tidak ada suarat izin Pelayanan Perizinan Terpadu (P2T) Kota Lhokseumawe. “Kami juga sering datang ke lokasi galian, tetapi pemiliknya tidak pernah ada,” katanya. (b14)

Laka Lantas Di Peusangan, Pasutri Tewas, Bayi Selamat PEUSANGAN (Waspada) : Kecelakaan lalu lintas yang melibatkan mobil pick-up Carry BK 9202 CJ dengan sepedamotor Yamaha RX King BL 5449 ZY terjadi di Jalinsum kawasan Matang Sagoe, Kecamatan Peusangan, Selasa (6/12) pukul 17:15, menewaskan pasangan suami istri. Pasangan yang tewas saat dalam pertolongan medis di Puskesmas Peusangan, Mulyadi, 30, dan Rahmi, 21, warga Desa Seuneubok Rawa, Kecamatan Peusangan Bireuen. Sedangkan bayi perempuan yang ikut bersama pasutri itu Dina Sutari yang berusia 6 bulan, selamat dalam laka lantas itu. Keterangan yang diperoleh dari saksi mata di TKP menyebutkan, Mulyadi yang berboncengan dengan Rahmi dan bayinya Dina Sutari meluncur dari arah Bireuen menuju Peusangan. Namun setiba di kawasan Matang Sagoe, bertubrukan dengan pick-up Carry yang dikemudikanWawan Setiawan, 37, warga Desa Alue Peunoe Peusangan, melaju dengan kecepatan tinggi dari arah Lhokseumawe menuju Bireuen. Saat itu sopir mobil pick-up mengerem mendadak hingga menyebabkan mobilnya tidak terkendali dan oleng ke kanan hingga menabrak sepeda motor

pasangan suami istri itu. Mobil pick up dan korban terpelanting ke areal persawahan. Sopir pick-up yang terjepit di dalam mobil dan pasutri bersama bayinya yang jatuh terlempar ke sawah dibantu warga setempat dan dilarikan ke Puskesmas Peusangan unuk mendapat pertolongan medis. Kepala Puskesmas Peusangan dr Agusnaini mengatakan, pihak medis sudah berupaya menyelamatkan jiwa suami istri itu. Namun lantaran mengalami benturan dan pendarahan berat di bagian kepala, nyawa keduanya tidak tertolong dan menghembuskan nafas yang terakhir di Puskesmas itu. Sedang bayi perempuan yang selamat kini bersama kedua jenazah orang tuanya sudah dijemput pihak keluarga. Kecelakaan Angkutan Umum Sementara di saat bersamaan di tempat terpisah, satu unit angkutan umum L-300 trayek Meulaboh-Langsa bertubrukan dengan bus angkutan umum CV Cenderawasih di jalinsum Bireuen-Medan, kawasan Pulo Awe, Desa Paya Rangkulueh, Kecamatan Kuta Blang, Bireuen Selasa (6/12) pukul 06:45. Akibat tabrakan itu, 11 pe-

numpang terluka dan dirawat di Puskesmas Krueng Panjoe, Pukesmas Kuta Blang, dan beberapa korban lain yang kritis dirawat ke RS Arun Batuphat di Kecamatan Muara Satu Lhokseumawe. Menurut Muhammad, kernet bus Cenderawasih mengatakan, bus Cenderawasih BL 7620 ZA sedang berhenti menaikkan penumpang, namun tiba-tiba dihantam mini bus L300 BL 1535 KB dari arah belakang menyebabkan bagian depan L-300 dan bagian belakang bus Cenderawasih ringsek. Jailani, 30, sopir bus Cenderawasih, warga Desa Paya Rangkulueh bersama Dahlan, 45, warga Lhokseumawe, sopir L-300 mengalami luka berat setelah mendapat pertolongan di Puskesmas Krueng Panjoe dirujuk ke RS PT Arun. Kasat Lantas Polres Bireuen AKP H Suharmadi bersama anggotanya sempat meluncur ke TKP untuk memberikan pertolongan kepada korban. Para korban laka lantas di Pulo Awe itu yakni Alisa, 7, warga Alur Pinenung Langsa, M Syawaluddin, 8, warga Meulaboh, Yusri, 32, warga Nagan Raya, Nur Hafni, 13, warga Meulaboh, M Hadiz, 3,5, anak Nurmala dan Nurdin, 42, warga Meulaboh. (b12)

ini khusunya di wilayah Korem 011/LW merupakan daerah yang pernah mengalami berbagai gejolak sosial dan konflik vertikal. Sampai hari ini masih ada bias-bias dan sisa konflik dengan masih terjadinya beberapa tindakan kriminal. Oleh sebab itu, dia mengharapkan para Danramil dan Babinsa agar terus meningkatkan kualitas dan profesionalisme kerjanya dalam menjalankan tugas yang diemban. “Karena bukan tidak mungkin situasi perdamaian yang kita rasakan saat ini, sewaktu – waktu dapat berubah menjadi situasi yang lebih mencekam. Disinilah peran para Danramil dalam melakukan komunikasi sosial dengan komponen masyarakat,” ungkapnya. Danrem juga menjelaskan, Sapta Marga, Sumpah Prajurit dan 8 wajib TNI sebagai landasan moral dan etika di dalam melaksanakan tugas harus mampu diimplementasikan dengan optimal. Sehingga selaku prajurit teritorial dapat menarik simpati masyarakat serta selalu disayangi oleh seluruh komponen masyarakat. (b15)

Jangan Tebarkan Prasangka Dan Kedengkian Antar Sesama Warga KRUENG GEUKUEH (Waspada): Prasangka dan kedengkian sesama warga memang cukup meresahkan dewasa ini. adanya timbul fitnah dan tuduhan diguna-guna dapat merusak kerukunan di dalam masyarakat. “Banyak sekali warga yang pikirannya masih terkebelakang. Ketika sakit langsung timbul prasangka sudah diguna-guna, padahal itu semua adalah penyakit badan akibat gangguan kesehatan. Banyak yang saya periksa demikian,” ungkap Tgk. M Nur Amin, pimpinan balai pengajian Syamsul Ma’rifak kepada Waspada, Rabu (7/12). Waled—demikian juga dia dipanggil— adalah juga tabib yang mengobati sejumlah penyakit, baik penyakit dunia maupun penyakit kasar biasa. Dia merasa resah terhadap warga yang dengan mudah berprasangka buruk terhadap tetangganya, ataupun terhadap orang lainnya secara tidak beralasan. Pikiran yang dihantui prasangka, katanya, dapat membuat seseorang makin terkebelakang dan hidupnya semakin terpuruk. “Berprasangka buruk itu akan merusak jiwa, membuat perasaan rusuh, dan pikiran akan teracuni dengan khayalan-khayalan yang tidak ada guna,” tegasnya.

Namun, bukan tidak ada orang yang masih mengamalkan ilmu sihir dan masih suka mengguna-guna orang lain akibat daripada kedengkian dan rasa tidak senang. Beberapa pasien yang diperiksa Waled memang nyata terkena guna-guna, tetapi seseorang tidak bisa menuduh orang lain secara sembarangan, pintanya. Jika ada orang yang dijampi-jampi, sebaiknya diobati tanpa menylahkan orang lain. Perbuatan sihir ini adalah halus, hal yang tidak bisa dibuktikan secara kasar, dan sebaiknya ditangani dengan bijak, sehingga tidak menimbulkan persoalan lain yang lebih besar. “Inilah risiko masalah ini, dan bagi mereka yang mendengki memang tidak ada obatnya. Amalannya pun sudah ludes seperti api kayu kering dimakan api,” katanya. Intinya, lanjut Waled, perbuatan sihir dan tengki akan membawa manusia mundur dan tak akan bisa maju. Di dunia saja kehidupannya akan susah, dan di akhirat kelak hidupnya tambah susah lagi. “Sihir dan perbuatan aneh-aneh itu bukan zamannya lagi sekarang, karena semua itu peninggalan Fir’aun. Siapa yang mengikutinya, berarti mengikuti jejak Fir’aun Laknatullah!” tandasnya.(b14)


DANDIM 0116 Nagan Raya Letkol Inf Yunardi ketika melakukan acara penyambutan dan laporan korp perwira baru di lingkungan Kodim 0116 Nagan Raya, Rabu (7/12). Dandim 0116 Nagan Raya Letkol InfYunardi mengingatkan masyarakat agar senantiasa mewaspadai upaya perusakan perdamaian di Aceh oleh kelompok tertentu.

Warga Nagan Raya Diminta Aktifkan Kembali Pam-Swakarsa Dan Poskamling NAGANRAYA (Waspada) : Pasca aksi bersenjata di Kabupaten Aceh Utara yang menyebabkan jatuhnya korban, kondisi keamanan di Aceh saat ini dinilai semakin memanas. Sejumlah daerah juga dikabarkan mulai melakukan aktivitas pengamanan serta penjaringan senjata ilegal dalam rangka menekan kepemilikan senjata ilegal yang saat ini ditengarai masih disimpan oleh kelompok tertentu di Aceh. “Tak dapat dipungkiri, pasca penembakan warga sipil di Aceh Utara ikut mempengaruhi kondisi keamanan di sejumlah daerah, kita mendapatkan instruksi dari Panglima agar seluruh personel di daerah waspada untuk menghadapi kondisi tersebut dan kami tegaskan jangan cobacoba buat kacau Aceh,” ungkap Komandan Kodim 0116 Nagan Raya Letkol Inf Yunardi dalam

sambutannya pada laporan korps penyambutan perwira baru yang berlangsung di aula Makodim 0116 Nagan Raya, Rabu (7/12). Menurut Letkol Inf Yunardi, dengan kondisi Aceh saat ini, maka kepada seluruh elemen masyarakat diminta kembali mengaktifkan Pos Keamanan Lingkungan (Poskamling) dan pengamanan swakarsa (Pam-Swakarsa) dalam upaya menangkal setiap tindakan yang dinilai dapat mengancam muncul gangguan keamanan serta ketertiban masyarakat. “Kepada masyarakat kita imbau senantiasa waspada terhadap setiap kemungkinan yang akan terjadi, mohon pam-swakarsa dan poskamling di desa-desa kembali diaktifkan,” tegas Dandim 0116 Nagan Raya. (cb05)

DPRK Harus Ketahui Pengeluaran Pinjaman Aceh Utara Rp20 M LHOKSEUMAWE (Waspada): LSM Masyarakat Transparansi Aceh (MaTA) menegaskan rencana pinjaman Pemkab Aceh Utara Rp20 miliyar di Bank Aceh perlu pembahasan serius di DPRK. Dewan harus mengetahui pengeluaran tersebut sehingga tidak merugikan daerah. Koordinator MaTA Alfian kepada Waspada, Selasa (6/12) menyebutkan, pinjaman akhir tahun sangat rawan masalah. Oleh sebab itu DPRK Aceh Utara harus mengetahui setiap pengeluaran yang akan dilakukan pada dana pinjaman. Pinjaman pada Bank Aceh harus betulbetul digunakan untuk kepentingan mendesak. Pj Bupati Aceh Utara, menurut dia, pada dasarnya bertugas selain menyukseskan Pemilukada juga menertiban administrasi daerah yang berada diambang kebangkrutan. Oleh sebab itu DPRK Aceh Utara harus memastikan, pinjaman bank jangan malah mempercapat kas daerah bangkrut. Karena menurut Alfian, pengalaman yang sama pernah terjadi pada penjabat bupati sebelumnya yang membeban daerah melalui pinjaman bank. Sementara itu Pj Bupati Aceh Utara M.Ali Basyah, MM menjelaskan, pinjaman Rp20 miliar di Bank Aceh akan digunakan untuk pengeluaran wajib saja. Pinjaman untuk pengeluaran wajib, tambah dia, sudah dianggarkan dalam APBK 2011. Namun akibat transfer dana Migas dari pemerintah pusat terlambat, sehinga Pemkab terpaksa meminjam pada akhir tahun. Pinjaman menurut dia tidak akan membebankan daerah. Bunga bank 16 persen kemungkinan akan lebih rendah melalui bila dinegosiasi dengan pihak perbankan. “Apa lagi,

pembayaran tidak akan lama, bungannya juga sedikit,” jelas Ali Basyah kembali. Setelah transper dana Migas triwulan ke-IV diterima, utang tersebut langsung dibayar kembali. Pj Bupati Aceh Utara juga mengatakan, bila pinjaman gagal diperoleh makan sejumlah pengeluaran wajib terganggu. Pengeluaran wajib di antaranya, biaya pekerjaan yang sudah dikontrakan.(b15)

Warga Kumbang Peuntet Perluas Meunasah LHOKSEUMAWE (Waspada): Pertambahan penduduk di Gampong Kumbang Peunteut Kecamatan Blang Mangat, Pemko Lhokseumawe mengakibatkan meunasah (surau) semakin sempit.Warga setempat mengharapkan bantuan untuk perluasan sarana ibadah. Kepala Desa Kumbang Puntet, Tgk. Muhammad Umar, Selasa (6/12) mengatakan, warga Kumbang Peunteut semakin padat. Menurut data, jumlahnya mencapai 1.500 jiwa atau 168 kepala keluarga. Untuk itu warga setempat akan memperluas meunasah. “Namun karena dana terbatas, kami sangat mengharapkan bantuan dari pihak lain,” tambah Muhammad Umar pada acara peletakan batu pertama perluasan menasah yang dilakukan Wakil walikota Lhokseumawe, Suady Yahya dan Husaini, anggota DPRK Lhokseumawe. (b15)

Waspada, Kamis 8 Desember 2011  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you